data_3N9Z
# 
_entry.id   3N9Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N9Z         
RCSB  RCSB059566   
WWPDB D_1000059566 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3N9Y . unspecified 
PDB 3NA0 . unspecified 
PDB 3NA1 . unspecified 
# 
_pdbx_database_status.entry_id                        3N9Z 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Strushkevich, N.V.'                   1  
'MacKenzie, F.'                        2  
'Tempel, W.'                           3  
'Botchkarev, A.'                       4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Bountra, C.'                          7  
'Weigelt, J.U.'                        8  
'Park, H.'                             9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                10139 
_citation.page_last                 10143 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21636783 
_citation.pdbx_database_id_DOI      10.1073/pnas.1019441108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Strushkevich, N.' 1 
primary 'Mackenzie, F.'    2 
primary 'Cherkesova, T.'   3 
primary 'Grabovec, I.'     4 
primary 'Usanov, S.'       5 
primary 'Park, H.W.'       6 
# 
_cell.entry_id           3N9Z 
_cell.length_a           83.383 
_cell.length_b           115.095 
_cell.length_c           86.213 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.82 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N9Z 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cholesterol side-chain cleavage enzyme'      56885.066 2   1.14.15.6 ? 'UNP residues 44-514' ? 
2 polymer     man Adrenodoxin                                   13488.032 2   ?         ? 'UNP residues 62-184' ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'             616.487   2   ?         ? ?                     ? 
4 non-polymer syn '(3alpha,8alpha,22R)-cholest-5-ene-3,22-diol' 402.653   2   ?         ? ?                     ? 
5 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                  175.820   2   ?         ? ?                     ? 
6 water       nat water                                         18.015    488 ?         ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cytochrome P450 11A1, CYPXIA1, Cytochrome P450(scc), Cholesterol desmolase' 
2 'Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin'                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
QHHHHHH
;
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
QHHHHHH
;
A,B ? 
2 'polypeptide(L)' no no 
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   THR n 
1 3   ARG n 
1 4   SER n 
1 5   PRO n 
1 6   ARG n 
1 7   PRO n 
1 8   PHE n 
1 9   ASN n 
1 10  GLU n 
1 11  ILE n 
1 12  PRO n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  ASP n 
1 17  ASN n 
1 18  GLY n 
1 19  TRP n 
1 20  LEU n 
1 21  ASN n 
1 22  LEU n 
1 23  TYR n 
1 24  HIS n 
1 25  PHE n 
1 26  TRP n 
1 27  ARG n 
1 28  GLU n 
1 29  THR n 
1 30  GLY n 
1 31  THR n 
1 32  HIS n 
1 33  LYS n 
1 34  VAL n 
1 35  HIS n 
1 36  LEU n 
1 37  HIS n 
1 38  HIS n 
1 39  VAL n 
1 40  GLN n 
1 41  ASN n 
1 42  PHE n 
1 43  GLN n 
1 44  LYS n 
1 45  TYR n 
1 46  GLY n 
1 47  PRO n 
1 48  ILE n 
1 49  TYR n 
1 50  ARG n 
1 51  GLU n 
1 52  LYS n 
1 53  LEU n 
1 54  GLY n 
1 55  ASN n 
1 56  VAL n 
1 57  GLU n 
1 58  SER n 
1 59  VAL n 
1 60  TYR n 
1 61  VAL n 
1 62  ILE n 
1 63  ASP n 
1 64  PRO n 
1 65  GLU n 
1 66  ASP n 
1 67  VAL n 
1 68  ALA n 
1 69  LEU n 
1 70  LEU n 
1 71  PHE n 
1 72  LYS n 
1 73  SER n 
1 74  GLU n 
1 75  GLY n 
1 76  PRO n 
1 77  ASN n 
1 78  PRO n 
1 79  GLU n 
1 80  ARG n 
1 81  PHE n 
1 82  LEU n 
1 83  ILE n 
1 84  PRO n 
1 85  PRO n 
1 86  TRP n 
1 87  VAL n 
1 88  ALA n 
1 89  TYR n 
1 90  HIS n 
1 91  GLN n 
1 92  TYR n 
1 93  TYR n 
1 94  GLN n 
1 95  ARG n 
1 96  PRO n 
1 97  ILE n 
1 98  GLY n 
1 99  VAL n 
1 100 LEU n 
1 101 LEU n 
1 102 LYS n 
1 103 LYS n 
1 104 SER n 
1 105 ALA n 
1 106 ALA n 
1 107 TRP n 
1 108 LYS n 
1 109 LYS n 
1 110 ASP n 
1 111 ARG n 
1 112 VAL n 
1 113 ALA n 
1 114 LEU n 
1 115 ASN n 
1 116 GLN n 
1 117 GLU n 
1 118 VAL n 
1 119 MET n 
1 120 ALA n 
1 121 PRO n 
1 122 GLU n 
1 123 ALA n 
1 124 THR n 
1 125 LYS n 
1 126 ASN n 
1 127 PHE n 
1 128 LEU n 
1 129 PRO n 
1 130 LEU n 
1 131 LEU n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 SER n 
1 136 ARG n 
1 137 ASP n 
1 138 PHE n 
1 139 VAL n 
1 140 SER n 
1 141 VAL n 
1 142 LEU n 
1 143 HIS n 
1 144 ARG n 
1 145 ARG n 
1 146 ILE n 
1 147 LYS n 
1 148 LYS n 
1 149 ALA n 
1 150 GLY n 
1 151 SER n 
1 152 GLY n 
1 153 ASN n 
1 154 TYR n 
1 155 SER n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 SER n 
1 160 ASP n 
1 161 ASP n 
1 162 LEU n 
1 163 PHE n 
1 164 ARG n 
1 165 PHE n 
1 166 ALA n 
1 167 PHE n 
1 168 GLU n 
1 169 SER n 
1 170 ILE n 
1 171 THR n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 PHE n 
1 176 GLY n 
1 177 GLU n 
1 178 ARG n 
1 179 GLN n 
1 180 GLY n 
1 181 MET n 
1 182 LEU n 
1 183 GLU n 
1 184 GLU n 
1 185 VAL n 
1 186 VAL n 
1 187 ASN n 
1 188 PRO n 
1 189 GLU n 
1 190 ALA n 
1 191 GLN n 
1 192 ARG n 
1 193 PHE n 
1 194 ILE n 
1 195 ASP n 
1 196 ALA n 
1 197 ILE n 
1 198 TYR n 
1 199 GLN n 
1 200 MET n 
1 201 PHE n 
1 202 HIS n 
1 203 THR n 
1 204 SER n 
1 205 VAL n 
1 206 PRO n 
1 207 MET n 
1 208 LEU n 
1 209 ASN n 
1 210 LEU n 
1 211 PRO n 
1 212 PRO n 
1 213 ASP n 
1 214 LEU n 
1 215 PHE n 
1 216 ARG n 
1 217 LEU n 
1 218 PHE n 
1 219 ARG n 
1 220 THR n 
1 221 LYS n 
1 222 THR n 
1 223 TRP n 
1 224 LYS n 
1 225 ASP n 
1 226 HIS n 
1 227 VAL n 
1 228 ALA n 
1 229 ALA n 
1 230 TRP n 
1 231 ASP n 
1 232 VAL n 
1 233 ILE n 
1 234 PHE n 
1 235 SER n 
1 236 LYS n 
1 237 ALA n 
1 238 ASP n 
1 239 ILE n 
1 240 TYR n 
1 241 THR n 
1 242 GLN n 
1 243 ASN n 
1 244 PHE n 
1 245 TYR n 
1 246 TRP n 
1 247 GLU n 
1 248 LEU n 
1 249 ARG n 
1 250 GLN n 
1 251 LYS n 
1 252 GLY n 
1 253 SER n 
1 254 VAL n 
1 255 HIS n 
1 256 HIS n 
1 257 ASP n 
1 258 TYR n 
1 259 ARG n 
1 260 GLY n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 ARG n 
1 265 LEU n 
1 266 LEU n 
1 267 GLY n 
1 268 ASP n 
1 269 SER n 
1 270 LYS n 
1 271 MET n 
1 272 SER n 
1 273 PHE n 
1 274 GLU n 
1 275 ASP n 
1 276 ILE n 
1 277 LYS n 
1 278 ALA n 
1 279 ASN n 
1 280 VAL n 
1 281 THR n 
1 282 GLU n 
1 283 MET n 
1 284 LEU n 
1 285 ALA n 
1 286 GLY n 
1 287 GLY n 
1 288 VAL n 
1 289 ASP n 
1 290 THR n 
1 291 THR n 
1 292 SER n 
1 293 MET n 
1 294 THR n 
1 295 LEU n 
1 296 GLN n 
1 297 TRP n 
1 298 HIS n 
1 299 LEU n 
1 300 TYR n 
1 301 GLU n 
1 302 MET n 
1 303 ALA n 
1 304 ARG n 
1 305 ASN n 
1 306 LEU n 
1 307 LYS n 
1 308 VAL n 
1 309 GLN n 
1 310 ASP n 
1 311 MET n 
1 312 LEU n 
1 313 ARG n 
1 314 ALA n 
1 315 GLU n 
1 316 VAL n 
1 317 LEU n 
1 318 ALA n 
1 319 ALA n 
1 320 ARG n 
1 321 HIS n 
1 322 GLN n 
1 323 ALA n 
1 324 GLN n 
1 325 GLY n 
1 326 ASP n 
1 327 MET n 
1 328 ALA n 
1 329 THR n 
1 330 MET n 
1 331 LEU n 
1 332 GLN n 
1 333 LEU n 
1 334 VAL n 
1 335 PRO n 
1 336 LEU n 
1 337 LEU n 
1 338 LYS n 
1 339 ALA n 
1 340 SER n 
1 341 ILE n 
1 342 LYS n 
1 343 GLU n 
1 344 THR n 
1 345 LEU n 
1 346 ARG n 
1 347 LEU n 
1 348 HIS n 
1 349 PRO n 
1 350 ILE n 
1 351 SER n 
1 352 VAL n 
1 353 THR n 
1 354 LEU n 
1 355 GLN n 
1 356 ARG n 
1 357 TYR n 
1 358 LEU n 
1 359 VAL n 
1 360 ASN n 
1 361 ASP n 
1 362 LEU n 
1 363 VAL n 
1 364 LEU n 
1 365 ARG n 
1 366 ASP n 
1 367 TYR n 
1 368 MET n 
1 369 ILE n 
1 370 PRO n 
1 371 ALA n 
1 372 LYS n 
1 373 THR n 
1 374 LEU n 
1 375 VAL n 
1 376 GLN n 
1 377 VAL n 
1 378 ALA n 
1 379 ILE n 
1 380 TYR n 
1 381 ALA n 
1 382 LEU n 
1 383 GLY n 
1 384 ARG n 
1 385 GLU n 
1 386 PRO n 
1 387 THR n 
1 388 PHE n 
1 389 PHE n 
1 390 PHE n 
1 391 ASP n 
1 392 PRO n 
1 393 GLU n 
1 394 ASN n 
1 395 PHE n 
1 396 ASP n 
1 397 PRO n 
1 398 THR n 
1 399 ARG n 
1 400 TRP n 
1 401 LEU n 
1 402 SER n 
1 403 LYS n 
1 404 ASP n 
1 405 LYS n 
1 406 ASN n 
1 407 ILE n 
1 408 THR n 
1 409 TYR n 
1 410 PHE n 
1 411 ARG n 
1 412 ASN n 
1 413 LEU n 
1 414 GLY n 
1 415 PHE n 
1 416 GLY n 
1 417 TRP n 
1 418 GLY n 
1 419 VAL n 
1 420 ARG n 
1 421 GLN n 
1 422 CYS n 
1 423 LEU n 
1 424 GLY n 
1 425 ARG n 
1 426 ARG n 
1 427 ILE n 
1 428 ALA n 
1 429 GLU n 
1 430 LEU n 
1 431 GLU n 
1 432 MET n 
1 433 THR n 
1 434 ILE n 
1 435 PHE n 
1 436 LEU n 
1 437 ILE n 
1 438 ASN n 
1 439 MET n 
1 440 LEU n 
1 441 GLU n 
1 442 ASN n 
1 443 PHE n 
1 444 ARG n 
1 445 VAL n 
1 446 GLU n 
1 447 ILE n 
1 448 GLN n 
1 449 HIS n 
1 450 LEU n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 GLY n 
1 455 THR n 
1 456 THR n 
1 457 PHE n 
1 458 ASN n 
1 459 LEU n 
1 460 ILE n 
1 461 LEU n 
1 462 MET n 
1 463 PRO n 
1 464 GLU n 
1 465 LYS n 
1 466 PRO n 
1 467 ILE n 
1 468 SER n 
1 469 PHE n 
1 470 THR n 
1 471 PHE n 
1 472 TRP n 
1 473 PRO n 
1 474 PHE n 
1 475 ASN n 
1 476 GLN n 
1 477 GLU n 
1 478 ALA n 
1 479 THR n 
1 480 GLN n 
1 481 GLN n 
1 482 HIS n 
1 483 HIS n 
1 484 HIS n 
1 485 HIS n 
1 486 HIS n 
1 487 HIS n 
2 1   SER n 
2 2   SER n 
2 3   GLU n 
2 4   ASP n 
2 5   LYS n 
2 6   ILE n 
2 7   THR n 
2 8   VAL n 
2 9   HIS n 
2 10  PHE n 
2 11  ILE n 
2 12  ASN n 
2 13  ARG n 
2 14  ASP n 
2 15  GLY n 
2 16  GLU n 
2 17  THR n 
2 18  LEU n 
2 19  THR n 
2 20  THR n 
2 21  LYS n 
2 22  GLY n 
2 23  LYS n 
2 24  VAL n 
2 25  GLY n 
2 26  ASP n 
2 27  SER n 
2 28  LEU n 
2 29  LEU n 
2 30  ASP n 
2 31  VAL n 
2 32  VAL n 
2 33  VAL n 
2 34  GLU n 
2 35  ASN n 
2 36  ASN n 
2 37  LEU n 
2 38  ASP n 
2 39  ILE n 
2 40  ASP n 
2 41  GLY n 
2 42  PHE n 
2 43  GLY n 
2 44  ALA n 
2 45  CYS n 
2 46  GLU n 
2 47  GLY n 
2 48  THR n 
2 49  LEU n 
2 50  ALA n 
2 51  CYS n 
2 52  SER n 
2 53  THR n 
2 54  CYS n 
2 55  HIS n 
2 56  LEU n 
2 57  ILE n 
2 58  PHE n 
2 59  GLU n 
2 60  ASP n 
2 61  HIS n 
2 62  ILE n 
2 63  TYR n 
2 64  GLU n 
2 65  LYS n 
2 66  LEU n 
2 67  ASP n 
2 68  ALA n 
2 69  ILE n 
2 70  THR n 
2 71  ASP n 
2 72  GLU n 
2 73  GLU n 
2 74  ASN n 
2 75  ASP n 
2 76  MET n 
2 77  LEU n 
2 78  ASP n 
2 79  LEU n 
2 80  ALA n 
2 81  TYR n 
2 82  GLY n 
2 83  LEU n 
2 84  THR n 
2 85  ASP n 
2 86  ARG n 
2 87  SER n 
2 88  ARG n 
2 89  LEU n 
2 90  GLY n 
2 91  CYS n 
2 92  GLN n 
2 93  ILE n 
2 94  CYS n 
2 95  LEU n 
2 96  THR n 
2 97  LYS n 
2 98  SER n 
2 99  MET n 
2 100 ASP n 
2 101 ASN n 
2 102 MET n 
2 103 THR n 
2 104 VAL n 
2 105 ARG n 
2 106 VAL n 
2 107 PRO n 
2 108 GLU n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ASP n 
2 113 ALA n 
2 114 ARG n 
2 115 GLN n 
2 116 SER n 
2 117 ILE n 
2 118 ASP n 
2 119 VAL n 
2 120 GLY n 
2 121 LYS n 
2 122 THR n 
2 123 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CYP11A, CYP11A1'        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
2 1 sample ? ? ? human ? 'adrenodoxin, ADX, FDX1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CP11A_HUMAN P05108 1 
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
Q
;
41 ? 
2 UNP ADX_HUMAN   P10109 2 
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
62 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3N9Z A 1 ? 481 ? P05108 41 ? 521 ? 2 482 
2 1 3N9Z B 1 ? 481 ? P05108 41 ? 521 ? 2 482 
3 2 3N9Z C 1 ? 123 ? P10109 62 ? 184 ? 2 124 
4 2 3N9Z D 1 ? 123 ? P10109 62 ? 184 ? 2 124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3N9Z HIS A 482 ? UNP P05108 ? ? 'EXPRESSION TAG' 483 1  
1 3N9Z HIS A 483 ? UNP P05108 ? ? 'EXPRESSION TAG' 484 2  
1 3N9Z HIS A 484 ? UNP P05108 ? ? 'EXPRESSION TAG' 485 3  
1 3N9Z HIS A 485 ? UNP P05108 ? ? 'EXPRESSION TAG' 486 4  
1 3N9Z HIS A 486 ? UNP P05108 ? ? 'EXPRESSION TAG' 487 5  
1 3N9Z HIS A 487 ? UNP P05108 ? ? 'EXPRESSION TAG' 488 6  
2 3N9Z HIS B 482 ? UNP P05108 ? ? 'EXPRESSION TAG' 483 7  
2 3N9Z HIS B 483 ? UNP P05108 ? ? 'EXPRESSION TAG' 484 8  
2 3N9Z HIS B 484 ? UNP P05108 ? ? 'EXPRESSION TAG' 485 9  
2 3N9Z HIS B 485 ? UNP P05108 ? ? 'EXPRESSION TAG' 486 10 
2 3N9Z HIS B 486 ? UNP P05108 ? ? 'EXPRESSION TAG' 487 11 
2 3N9Z HIS B 487 ? UNP P05108 ? ? 'EXPRESSION TAG' 488 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                      ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ?    'C3 H7 N O2 S'     121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                  ?    'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                                     ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                       ?    'C2 H5 N O2'       75.067  
HC9 non-polymer         . '(3alpha,8alpha,22R)-cholest-5-ene-3,22-diol' ?    'C27 H46 O2'       402.653 
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'             HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                                     ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                         ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                        ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                    ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                       ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                        ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                     ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                        ?    'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3N9Z 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.91 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Ca acetate, pH 7.5, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2009-07-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     3N9Z 
_reflns.d_resolution_high            2.150 
_reflns.d_resolution_low             20.000 
_reflns.number_obs                   82082 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_netI_over_sigmaI        8.700 
_reflns.pdbx_chi_squared             1.675 
_reflns.pdbx_redundancy              3.800 
_reflns.percent_possible_obs         98.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.15 2.20  ? ? ? 0.515 ? ? 1.268 2.70 ? 5159 93.50  1  1 
2.20 2.25  ? ? ? 0.544 ? ? 4.762 2.80 ? 5239 94.60  2  1 
2.25 2.32  ? ? ? 0.400 ? ? 1.215 3.20 ? 5368 96.90  3  1 
2.32 2.38  ? ? ? 0.348 ? ? 1.287 3.40 ? 5424 98.00  4  1 
2.38 2.46  ? ? ? 0.292 ? ? 1.026 3.60 ? 5474 98.80  5  1 
2.46 2.55  ? ? ? 0.267 ? ? 1.106 3.90 ? 5503 99.30  6  1 
2.55 2.65  ? ? ? 0.246 ? ? 1.073 4.00 ? 5539 99.70  7  1 
2.65 2.77  ? ? ? 0.202 ? ? 1.136 4.20 ? 5535 100.00 8  1 
2.77 2.92  ? ? ? 0.160 ? ? 1.180 4.20 ? 5543 99.90  9  1 
2.92 3.10  ? ? ? 0.129 ? ? 1.259 4.30 ? 5539 100.00 10 1 
3.10 3.34  ? ? ? 0.101 ? ? 1.506 4.20 ? 5561 99.90  11 1 
3.34 3.67  ? ? ? 0.084 ? ? 2.008 4.10 ? 5538 99.70  12 1 
3.67 4.20  ? ? ? 0.066 ? ? 2.331 4.10 ? 5558 99.40  13 1 
4.20 5.27  ? ? ? 0.053 ? ? 2.325 4.10 ? 5546 99.20  14 1 
5.27 20.00 ? ? ? 0.050 ? ? 2.507 3.90 ? 5556 98.00  15 1 
# 
_refine.entry_id                                 3N9Z 
_refine.ls_d_res_high                            2.170 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.400 
_refine.ls_number_reflns_obs                     81861 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.211 
_refine.ls_R_factor_R_work                       0.210 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.243 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4093 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               26.913 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.760 
_refine.aniso_B[2][2]                            -1.420 
_refine.aniso_B[3][3]                            0.210 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.090 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.907 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.182 
_refine.overall_SU_ML                            0.125 
_refine.overall_SU_B                             4.816 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                75.14 
_refine.B_iso_min                                7.17 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8132 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         152 
_refine_hist.number_atoms_solvent             488 
_refine_hist.number_atoms_total               8772 
_refine_hist.d_res_high                       2.170 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       8521  0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    11588 1.140  1.989  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 986   5.157  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 414   35.734 23.382 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 1422  14.410 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 62    16.271 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         1240  0.081  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   6482  0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            4961  0.536  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           8030  1.045  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            3560  1.526  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           3554  2.588  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.170 
_refine_ls_shell.d_res_low                        2.226 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               81.590 
_refine_ls_shell.number_reflns_R_work             4803 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             227 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                5030 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3N9Z 
_struct.title                     'Crystal structure of human CYP11A1 in complex with 22-hydroxycholesterol' 
_struct.pdbx_descriptor           
'Cholesterol side-chain cleavage enzyme, mitochondrial (E.C.1.14.15.6), Adrenodoxin, mitochondrial' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N9Z 
_struct_keywords.text            
;cytochrome P450, 22-hydroxycholesterol, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
;
_struct_keywords.pdbx_keywords   'Oxidoreductase, Electron transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 7   ? ILE A 11  ? PRO A 8   ILE A 12  5 ? 5  
HELX_P HELX_P2  2  ASN A 17  ? THR A 29  ? ASN A 18  THR A 30  1 ? 13 
HELX_P HELX_P3  3  GLY A 30  ? HIS A 32  ? GLY A 31  HIS A 33  5 ? 3  
HELX_P HELX_P4  4  LYS A 33  ? GLY A 46  ? LYS A 34  GLY A 47  1 ? 14 
HELX_P HELX_P5  5  ASP A 63  ? SER A 73  ? ASP A 64  SER A 74  1 ? 11 
HELX_P HELX_P6  6  ILE A 83  ? TYR A 93  ? ILE A 84  TYR A 94  1 ? 11 
HELX_P HELX_P7  7  GLY A 98  ? LYS A 102 ? GLY A 99  LYS A 103 5 ? 5  
HELX_P HELX_P8  8  LYS A 103 ? MET A 119 ? LYS A 104 MET A 120 1 ? 17 
HELX_P HELX_P9  9  ALA A 120 ? LYS A 125 ? ALA A 121 LYS A 126 1 ? 6  
HELX_P HELX_P10 10 PHE A 127 ? GLY A 150 ? PHE A 128 GLY A 151 1 ? 24 
HELX_P HELX_P11 11 ILE A 158 ? GLY A 176 ? ILE A 159 GLY A 177 1 ? 19 
HELX_P HELX_P12 12 ASN A 187 ? VAL A 205 ? ASN A 188 VAL A 206 1 ? 19 
HELX_P HELX_P13 13 PRO A 206 ? LEU A 208 ? PRO A 207 LEU A 209 5 ? 3  
HELX_P HELX_P14 14 PRO A 211 ? ARG A 219 ? PRO A 212 ARG A 220 1 ? 9  
HELX_P HELX_P15 15 ARG A 219 ? GLY A 252 ? ARG A 220 GLY A 253 1 ? 34 
HELX_P HELX_P16 16 GLY A 260 ? ASP A 268 ? GLY A 261 ASP A 269 1 ? 9  
HELX_P HELX_P17 17 SER A 272 ? GLY A 287 ? SER A 273 GLY A 288 1 ? 16 
HELX_P HELX_P18 18 VAL A 288 ? ASN A 305 ? VAL A 289 ASN A 306 1 ? 18 
HELX_P HELX_P19 19 ASN A 305 ? ALA A 323 ? ASN A 306 ALA A 324 1 ? 19 
HELX_P HELX_P20 20 ASP A 326 ? LEU A 331 ? ASP A 327 LEU A 332 1 ? 6  
HELX_P HELX_P21 21 VAL A 334 ? HIS A 348 ? VAL A 335 HIS A 349 1 ? 15 
HELX_P HELX_P22 22 ILE A 379 ? GLU A 385 ? ILE A 380 GLU A 386 1 ? 7  
HELX_P HELX_P23 23 ASP A 396 ? SER A 402 ? ASP A 397 SER A 403 5 ? 7  
HELX_P HELX_P24 24 TRP A 417 ? GLN A 421 ? TRP A 418 GLN A 422 5 ? 5  
HELX_P HELX_P25 25 GLY A 424 ? ASN A 442 ? GLY A 425 ASN A 443 1 ? 19 
HELX_P HELX_P26 26 PRO B 7   ? ILE B 11  ? PRO B 8   ILE B 12  5 ? 5  
HELX_P HELX_P27 27 ASN B 17  ? THR B 29  ? ASN B 18  THR B 30  1 ? 13 
HELX_P HELX_P28 28 GLY B 30  ? HIS B 32  ? GLY B 31  HIS B 33  5 ? 3  
HELX_P HELX_P29 29 LYS B 33  ? GLY B 46  ? LYS B 34  GLY B 47  1 ? 14 
HELX_P HELX_P30 30 ASP B 63  ? SER B 73  ? ASP B 64  SER B 74  1 ? 11 
HELX_P HELX_P31 31 ILE B 83  ? TYR B 93  ? ILE B 84  TYR B 94  1 ? 11 
HELX_P HELX_P32 32 GLY B 98  ? LYS B 102 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P33 33 LYS B 103 ? MET B 119 ? LYS B 104 MET B 120 1 ? 17 
HELX_P HELX_P34 34 ALA B 120 ? LYS B 125 ? ALA B 121 LYS B 126 1 ? 6  
HELX_P HELX_P35 35 ASN B 126 ? GLY B 150 ? ASN B 127 GLY B 151 1 ? 25 
HELX_P HELX_P36 36 ILE B 158 ? GLY B 176 ? ILE B 159 GLY B 177 1 ? 19 
HELX_P HELX_P37 37 ASN B 187 ? VAL B 205 ? ASN B 188 VAL B 206 1 ? 19 
HELX_P HELX_P38 38 PRO B 206 ? LEU B 208 ? PRO B 207 LEU B 209 5 ? 3  
HELX_P HELX_P39 39 PRO B 211 ? ARG B 219 ? PRO B 212 ARG B 220 1 ? 9  
HELX_P HELX_P40 40 ARG B 219 ? LYS B 251 ? ARG B 220 LYS B 252 1 ? 33 
HELX_P HELX_P41 41 GLY B 260 ? ASP B 268 ? GLY B 261 ASP B 269 1 ? 9  
HELX_P HELX_P42 42 SER B 272 ? GLY B 287 ? SER B 273 GLY B 288 1 ? 16 
HELX_P HELX_P43 43 VAL B 288 ? ASN B 305 ? VAL B 289 ASN B 306 1 ? 18 
HELX_P HELX_P44 44 ASN B 305 ? ALA B 323 ? ASN B 306 ALA B 324 1 ? 19 
HELX_P HELX_P45 45 ASP B 326 ? LEU B 331 ? ASP B 327 LEU B 332 1 ? 6  
HELX_P HELX_P46 46 VAL B 334 ? HIS B 348 ? VAL B 335 HIS B 349 1 ? 15 
HELX_P HELX_P47 47 ALA B 378 ? ARG B 384 ? ALA B 379 ARG B 385 1 ? 7  
HELX_P HELX_P48 48 ASP B 396 ? SER B 402 ? ASP B 397 SER B 403 5 ? 7  
HELX_P HELX_P49 49 TRP B 417 ? GLN B 421 ? TRP B 418 GLN B 422 5 ? 5  
HELX_P HELX_P50 50 GLY B 424 ? ASN B 442 ? GLY B 425 ASN B 443 1 ? 19 
HELX_P HELX_P51 51 ASP C 71  ? ASP C 78  ? ASP C 72  ASP C 79  1 ? 8  
HELX_P HELX_P52 52 ASP D 71  ? ASP D 78  ? ASP D 72  ASP D 79  1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CYS 45  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 46  D FES 151 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc2  metalc ? ? D CYS 54  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 55  D FES 151 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc3  metalc ? ? C CYS 45  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 46  C FES 150 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc4  metalc ? ? D CYS 91  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 92  D FES 151 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc5  metalc ? ? C CYS 91  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 92  C FES 150 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc6  metalc ? ? C CYS 54  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 55  C FES 150 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc7  metalc ? ? A CYS 422 SG ? ? ? 1_555 E HEM . FE  ? ? A CYS 423 A HEM 601 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc8  metalc ? ? B CYS 422 SG ? ? ? 1_555 G HEM . FE  ? ? B CYS 423 B HEM 601 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc9  metalc ? ? C CYS 51  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 52  C FES 150 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc10 metalc ? ? D CYS 51  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 52  D FES 151 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc11 metalc ? ? G HEM .   FE ? ? ? 1_555 H HC9 . O2  ? ? B HEM 601 B HC9 602 1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc12 metalc ? ? E HEM .   FE ? ? ? 1_555 F HC9 . O2  ? ? A HEM 601 A HC9 602 1_555 ? ? ? ? ? ? ? 2.570 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 48  ? LEU A 53  ? ILE A 49  LEU A 54  
A 2 VAL A 56  ? VAL A 61  ? VAL A 57  VAL A 62  
A 3 LEU A 374 ? ALA A 378 ? LEU A 375 ALA A 379 
A 4 THR A 353 ? TYR A 357 ? THR A 354 TYR A 358 
B 1 TYR A 154 ? GLY A 156 ? TYR A 155 GLY A 157 
B 2 PHE A 469 ? PRO A 473 ? PHE A 470 PRO A 474 
B 3 PHE A 443 ? GLU A 446 ? PHE A 444 GLU A 447 
C 1 LEU A 362 ? LEU A 364 ? LEU A 363 LEU A 365 
C 2 TYR A 367 ? ILE A 369 ? TYR A 368 ILE A 370 
D 1 THR A 455 ? PHE A 457 ? THR A 456 PHE A 458 
D 2 LEU A 461 ? PRO A 463 ? LEU A 462 PRO A 464 
E 1 ILE B 48  ? LEU B 53  ? ILE B 49  LEU B 54  
E 2 VAL B 56  ? VAL B 61  ? VAL B 57  VAL B 62  
E 3 LEU B 374 ? VAL B 377 ? LEU B 375 VAL B 378 
E 4 LEU B 354 ? TYR B 357 ? LEU B 355 TYR B 358 
F 1 TYR B 154 ? GLY B 156 ? TYR B 155 GLY B 157 
F 2 PHE B 469 ? PRO B 473 ? PHE B 470 PRO B 474 
F 3 PHE B 443 ? ILE B 447 ? PHE B 444 ILE B 448 
G 1 LEU B 362 ? LEU B 364 ? LEU B 363 LEU B 365 
G 2 TYR B 367 ? ILE B 369 ? TYR B 368 ILE B 370 
H 1 THR B 455 ? PHE B 457 ? THR B 456 PHE B 458 
H 2 LEU B 461 ? PRO B 463 ? LEU B 462 PRO B 464 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 49  ? N TYR A 50  O TYR A 60  ? O TYR A 61  
A 2 3 N VAL A 59  ? N VAL A 60  O GLN A 376 ? O GLN A 377 
A 3 4 O VAL A 375 ? O VAL A 376 N ARG A 356 ? N ARG A 357 
B 1 2 N TYR A 154 ? N TYR A 155 O PHE A 471 ? O PHE A 472 
B 2 3 O THR A 470 ? O THR A 471 N GLU A 446 ? N GLU A 447 
C 1 2 N LEU A 362 ? N LEU A 363 O ILE A 369 ? O ILE A 370 
D 1 2 N THR A 456 ? N THR A 457 O MET A 462 ? O MET A 463 
E 1 2 N TYR B 49  ? N TYR B 50  O TYR B 60  ? O TYR B 61  
E 2 3 N VAL B 59  ? N VAL B 60  O GLN B 376 ? O GLN B 377 
E 3 4 O VAL B 377 ? O VAL B 378 N LEU B 354 ? N LEU B 355 
F 1 2 N TYR B 154 ? N TYR B 155 O PHE B 471 ? O PHE B 472 
F 2 3 O TRP B 472 ? O TRP B 473 N ARG B 444 ? N ARG B 445 
G 1 2 N LEU B 362 ? N LEU B 363 O ILE B 369 ? O ILE B 370 
H 1 2 N THR B 456 ? N THR B 457 O MET B 462 ? O MET B 463 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM A 601' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE HC9 A 602' 
AC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM B 601' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HC9 B 602' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FES C 150' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FES D 151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 ARG A 80  ? ARG A 81  . ? 1_555 ? 
2  AC1 22 VAL A 99  ? VAL A 100 . ? 1_555 ? 
3  AC1 22 TRP A 107 ? TRP A 108 . ? 1_555 ? 
4  AC1 22 ARG A 111 ? ARG A 112 . ? 1_555 ? 
5  AC1 22 MET A 283 ? MET A 284 . ? 1_555 ? 
6  AC1 22 GLY A 286 ? GLY A 287 . ? 1_555 ? 
7  AC1 22 THR A 290 ? THR A 291 . ? 1_555 ? 
8  AC1 22 THR A 291 ? THR A 292 . ? 1_555 ? 
9  AC1 22 THR A 294 ? THR A 295 . ? 1_555 ? 
10 AC1 22 ILE A 350 ? ILE A 351 . ? 1_555 ? 
11 AC1 22 SER A 351 ? SER A 352 . ? 1_555 ? 
12 AC1 22 ARG A 356 ? ARG A 357 . ? 1_555 ? 
13 AC1 22 GLY A 414 ? GLY A 415 . ? 1_555 ? 
14 AC1 22 PHE A 415 ? PHE A 416 . ? 1_555 ? 
15 AC1 22 GLY A 416 ? GLY A 417 . ? 1_555 ? 
16 AC1 22 TRP A 417 ? TRP A 418 . ? 1_555 ? 
17 AC1 22 ARG A 420 ? ARG A 421 . ? 1_555 ? 
18 AC1 22 GLN A 421 ? GLN A 422 . ? 1_555 ? 
19 AC1 22 CYS A 422 ? CYS A 423 . ? 1_555 ? 
20 AC1 22 GLY A 424 ? GLY A 425 . ? 1_555 ? 
21 AC1 22 HOH K .   ? HOH A 491 . ? 1_555 ? 
22 AC1 22 HC9 F .   ? HC9 A 602 . ? 1_555 ? 
23 AC2 11 PHE A 81  ? PHE A 82  . ? 1_555 ? 
24 AC2 11 PHE A 201 ? PHE A 202 . ? 1_555 ? 
25 AC2 11 GLU A 282 ? GLU A 283 . ? 1_555 ? 
26 AC2 11 SER A 351 ? SER A 352 . ? 1_555 ? 
27 AC2 11 THR A 353 ? THR A 354 . ? 1_555 ? 
28 AC2 11 GLN A 355 ? GLN A 356 . ? 1_555 ? 
29 AC2 11 LEU A 459 ? LEU A 460 . ? 1_555 ? 
30 AC2 11 HOH K .   ? HOH A 520 . ? 1_555 ? 
31 AC2 11 HOH K .   ? HOH A 531 . ? 1_555 ? 
32 AC2 11 HOH K .   ? HOH A 595 . ? 1_555 ? 
33 AC2 11 HEM E .   ? HEM A 601 . ? 1_555 ? 
34 AC3 22 ARG B 80  ? ARG B 81  . ? 1_555 ? 
35 AC3 22 VAL B 99  ? VAL B 100 . ? 1_555 ? 
36 AC3 22 LEU B 100 ? LEU B 101 . ? 1_555 ? 
37 AC3 22 TRP B 107 ? TRP B 108 . ? 1_555 ? 
38 AC3 22 ARG B 111 ? ARG B 112 . ? 1_555 ? 
39 AC3 22 MET B 283 ? MET B 284 . ? 1_555 ? 
40 AC3 22 GLY B 286 ? GLY B 287 . ? 1_555 ? 
41 AC3 22 GLY B 287 ? GLY B 288 . ? 1_555 ? 
42 AC3 22 THR B 290 ? THR B 291 . ? 1_555 ? 
43 AC3 22 ILE B 350 ? ILE B 351 . ? 1_555 ? 
44 AC3 22 SER B 351 ? SER B 352 . ? 1_555 ? 
45 AC3 22 ARG B 356 ? ARG B 357 . ? 1_555 ? 
46 AC3 22 GLY B 414 ? GLY B 415 . ? 1_555 ? 
47 AC3 22 PHE B 415 ? PHE B 416 . ? 1_555 ? 
48 AC3 22 GLY B 416 ? GLY B 417 . ? 1_555 ? 
49 AC3 22 TRP B 417 ? TRP B 418 . ? 1_555 ? 
50 AC3 22 ARG B 420 ? ARG B 421 . ? 1_555 ? 
51 AC3 22 CYS B 422 ? CYS B 423 . ? 1_555 ? 
52 AC3 22 GLY B 424 ? GLY B 425 . ? 1_555 ? 
53 AC3 22 MET B 432 ? MET B 433 . ? 1_555 ? 
54 AC3 22 HOH L .   ? HOH B 502 . ? 1_555 ? 
55 AC3 22 HC9 H .   ? HC9 B 602 . ? 1_555 ? 
56 AC4 10 PHE B 81  ? PHE B 82  . ? 1_555 ? 
57 AC4 10 ILE B 83  ? ILE B 84  . ? 1_555 ? 
58 AC4 10 GLU B 282 ? GLU B 283 . ? 1_555 ? 
59 AC4 10 SER B 351 ? SER B 352 . ? 1_555 ? 
60 AC4 10 THR B 353 ? THR B 354 . ? 1_555 ? 
61 AC4 10 GLN B 355 ? GLN B 356 . ? 1_555 ? 
62 AC4 10 HOH L .   ? HOH B 518 . ? 1_555 ? 
63 AC4 10 HOH L .   ? HOH B 576 . ? 1_555 ? 
64 AC4 10 HEM G .   ? HEM B 601 . ? 1_555 ? 
65 AC4 10 HOH L .   ? HOH B 608 . ? 1_555 ? 
66 AC5 5  CYS C 45  ? CYS C 46  . ? 1_555 ? 
67 AC5 5  GLY C 47  ? GLY C 48  . ? 1_555 ? 
68 AC5 5  CYS C 51  ? CYS C 52  . ? 1_555 ? 
69 AC5 5  CYS C 54  ? CYS C 55  . ? 1_555 ? 
70 AC5 5  CYS C 91  ? CYS C 92  . ? 1_555 ? 
71 AC6 6  GLY D 43  ? GLY D 44  . ? 1_555 ? 
72 AC6 6  CYS D 45  ? CYS D 46  . ? 1_555 ? 
73 AC6 6  GLY D 47  ? GLY D 48  . ? 1_555 ? 
74 AC6 6  CYS D 51  ? CYS D 52  . ? 1_555 ? 
75 AC6 6  CYS D 54  ? CYS D 55  . ? 1_555 ? 
76 AC6 6  CYS D 91  ? CYS D 92  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3N9Z 
_atom_sites.fract_transf_matrix[1][1]   0.011993 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002510 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008688 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011850 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 5   ? -18.716 -15.726 16.934  1.00 39.16 ? 6   PRO A N   1 
ATOM   2    C  CA  . PRO A 1 5   ? -17.263 -15.493 16.987  1.00 38.92 ? 6   PRO A CA  1 
ATOM   3    C  C   . PRO A 1 5   ? -16.469 -16.798 17.107  1.00 38.38 ? 6   PRO A C   1 
ATOM   4    O  O   . PRO A 1 5   ? -16.526 -17.473 18.138  1.00 38.55 ? 6   PRO A O   1 
ATOM   5    C  CB  . PRO A 1 5   ? -17.080 -14.620 18.240  1.00 39.09 ? 6   PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 5   ? -18.419 -14.661 18.971  1.00 39.46 ? 6   PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 5   ? -19.447 -14.895 17.905  1.00 39.40 ? 6   PRO A CD  1 
ATOM   8    N  N   . ARG A 1 6   ? -15.740 -17.141 16.048  1.00 37.52 ? 7   ARG A N   1 
ATOM   9    C  CA  . ARG A 1 6   ? -14.991 -18.395 15.982  1.00 36.94 ? 7   ARG A CA  1 
ATOM   10   C  C   . ARG A 1 6   ? -13.871 -18.446 17.030  1.00 36.35 ? 7   ARG A C   1 
ATOM   11   O  O   . ARG A 1 6   ? -13.220 -17.428 17.292  1.00 36.10 ? 7   ARG A O   1 
ATOM   12   C  CB  . ARG A 1 6   ? -14.438 -18.609 14.570  1.00 36.97 ? 7   ARG A CB  1 
ATOM   13   C  CG  . ARG A 1 6   ? -15.516 -18.646 13.492  1.00 37.66 ? 7   ARG A CG  1 
ATOM   14   C  CD  . ARG A 1 6   ? -15.218 -17.629 12.399  1.00 39.18 ? 7   ARG A CD  1 
ATOM   15   N  NE  . ARG A 1 6   ? -14.685 -18.215 11.169  1.00 39.94 ? 7   ARG A NE  1 
ATOM   16   C  CZ  . ARG A 1 6   ? -14.029 -17.530 10.230  1.00 39.64 ? 7   ARG A CZ  1 
ATOM   17   N  NH1 . ARG A 1 6   ? -13.779 -16.234 10.383  1.00 39.32 ? 7   ARG A NH1 1 
ATOM   18   N  NH2 . ARG A 1 6   ? -13.599 -18.150 9.142   1.00 39.64 ? 7   ARG A NH2 1 
ATOM   19   N  N   . PRO A 1 7   ? -13.663 -19.628 17.650  1.00 35.80 ? 8   PRO A N   1 
ATOM   20   C  CA  . PRO A 1 7   ? -12.610 -19.804 18.654  1.00 35.36 ? 8   PRO A CA  1 
ATOM   21   C  C   . PRO A 1 7   ? -11.209 -19.758 18.038  1.00 34.91 ? 8   PRO A C   1 
ATOM   22   O  O   . PRO A 1 7   ? -11.065 -19.881 16.815  1.00 34.82 ? 8   PRO A O   1 
ATOM   23   C  CB  . PRO A 1 7   ? -12.888 -21.207 19.212  1.00 35.43 ? 8   PRO A CB  1 
ATOM   24   C  CG  . PRO A 1 7   ? -13.605 -21.921 18.114  1.00 35.67 ? 8   PRO A CG  1 
ATOM   25   C  CD  . PRO A 1 7   ? -14.443 -20.866 17.449  1.00 35.85 ? 8   PRO A CD  1 
ATOM   26   N  N   . PHE A 1 8   ? -10.200 -19.599 18.895  1.00 34.09 ? 9   PHE A N   1 
ATOM   27   C  CA  . PHE A 1 8   ? -8.795  -19.513 18.492  1.00 33.41 ? 9   PHE A CA  1 
ATOM   28   C  C   . PHE A 1 8   ? -8.305  -20.689 17.643  1.00 32.80 ? 9   PHE A C   1 
ATOM   29   O  O   . PHE A 1 8   ? -7.580  -20.487 16.668  1.00 32.46 ? 9   PHE A O   1 
ATOM   30   C  CB  . PHE A 1 8   ? -7.903  -19.357 19.731  1.00 33.53 ? 9   PHE A CB  1 
ATOM   31   C  CG  . PHE A 1 8   ? -6.435  -19.206 19.417  1.00 34.05 ? 9   PHE A CG  1 
ATOM   32   C  CD1 . PHE A 1 8   ? -5.913  -17.970 19.052  1.00 34.18 ? 9   PHE A CD1 1 
ATOM   33   C  CD2 . PHE A 1 8   ? -5.576  -20.298 19.505  1.00 34.56 ? 9   PHE A CD2 1 
ATOM   34   C  CE1 . PHE A 1 8   ? -4.559  -17.823 18.770  1.00 34.89 ? 9   PHE A CE1 1 
ATOM   35   C  CE2 . PHE A 1 8   ? -4.218  -20.160 19.223  1.00 36.33 ? 9   PHE A CE2 1 
ATOM   36   C  CZ  . PHE A 1 8   ? -3.707  -18.915 18.853  1.00 34.59 ? 9   PHE A CZ  1 
ATOM   37   N  N   . ASN A 1 9   ? -8.697  -21.907 18.010  1.00 32.26 ? 10  ASN A N   1 
ATOM   38   C  CA  . ASN A 1 9   ? -8.203  -23.105 17.325  1.00 31.66 ? 10  ASN A CA  1 
ATOM   39   C  C   . ASN A 1 9   ? -8.613  -23.226 15.851  1.00 30.93 ? 10  ASN A C   1 
ATOM   40   O  O   . ASN A 1 9   ? -8.041  -24.028 15.111  1.00 30.89 ? 10  ASN A O   1 
ATOM   41   C  CB  . ASN A 1 9   ? -8.522  -24.393 18.117  1.00 32.17 ? 10  ASN A CB  1 
ATOM   42   C  CG  . ASN A 1 9   ? -10.015 -24.606 18.357  1.00 33.05 ? 10  ASN A CG  1 
ATOM   43   O  OD1 . ASN A 1 9   ? -10.854 -23.788 17.983  1.00 34.54 ? 10  ASN A OD1 1 
ATOM   44   N  ND2 . ASN A 1 9   ? -10.346 -25.725 18.992  1.00 35.13 ? 10  ASN A ND2 1 
ATOM   45   N  N   . GLU A 1 10  ? -9.578  -22.411 15.426  1.00 29.91 ? 11  GLU A N   1 
ATOM   46   C  CA  . GLU A 1 10  ? -10.061 -22.455 14.043  1.00 29.25 ? 11  GLU A CA  1 
ATOM   47   C  C   . GLU A 1 10  ? -9.281  -21.559 13.078  1.00 28.14 ? 11  GLU A C   1 
ATOM   48   O  O   . GLU A 1 10  ? -9.398  -21.705 11.861  1.00 27.43 ? 11  GLU A O   1 
ATOM   49   C  CB  . GLU A 1 10  ? -11.570 -22.195 13.969  1.00 29.61 ? 11  GLU A CB  1 
ATOM   50   C  CG  . GLU A 1 10  ? -12.397 -23.427 14.365  1.00 31.40 ? 11  GLU A CG  1 
ATOM   51   C  CD  . GLU A 1 10  ? -13.901 -23.188 14.357  1.00 33.72 ? 11  GLU A CD  1 
ATOM   52   O  OE1 . GLU A 1 10  ? -14.372 -22.257 13.666  1.00 34.48 ? 11  GLU A OE1 1 
ATOM   53   O  OE2 . GLU A 1 10  ? -14.618 -23.946 15.050  1.00 35.21 ? 11  GLU A OE2 1 
ATOM   54   N  N   . ILE A 1 11  ? -8.480  -20.646 13.631  1.00 26.95 ? 12  ILE A N   1 
ATOM   55   C  CA  . ILE A 1 11  ? -7.550  -19.849 12.836  1.00 25.82 ? 12  ILE A CA  1 
ATOM   56   C  C   . ILE A 1 11  ? -6.658  -20.805 12.043  1.00 25.33 ? 12  ILE A C   1 
ATOM   57   O  O   . ILE A 1 11  ? -6.038  -21.684 12.634  1.00 25.07 ? 12  ILE A O   1 
ATOM   58   C  CB  . ILE A 1 11  ? -6.691  -18.908 13.735  1.00 25.87 ? 12  ILE A CB  1 
ATOM   59   C  CG1 . ILE A 1 11  ? -7.591  -17.906 14.459  1.00 24.95 ? 12  ILE A CG1 1 
ATOM   60   C  CG2 . ILE A 1 11  ? -5.588  -18.201 12.913  1.00 24.90 ? 12  ILE A CG2 1 
ATOM   61   C  CD1 . ILE A 1 11  ? -6.905  -17.036 15.485  1.00 25.15 ? 12  ILE A CD1 1 
ATOM   62   N  N   . PRO A 1 12  ? -6.609  -20.650 10.703  1.00 25.09 ? 13  PRO A N   1 
ATOM   63   C  CA  . PRO A 1 12  ? -5.771  -21.503 9.859   1.00 24.96 ? 13  PRO A CA  1 
ATOM   64   C  C   . PRO A 1 12  ? -4.340  -21.628 10.389  1.00 24.98 ? 13  PRO A C   1 
ATOM   65   O  O   . PRO A 1 12  ? -3.793  -20.669 10.945  1.00 24.45 ? 13  PRO A O   1 
ATOM   66   C  CB  . PRO A 1 12  ? -5.784  -20.776 8.513   1.00 24.82 ? 13  PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 12  ? -7.099  -20.105 8.485   1.00 24.97 ? 13  PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 12  ? -7.341  -19.651 9.897   1.00 25.25 ? 13  PRO A CD  1 
ATOM   69   N  N   . SER A 1 13  ? -3.751  -22.806 10.204  1.00 25.30 ? 14  SER A N   1 
ATOM   70   C  CA  . SER A 1 13  ? -2.472  -23.148 10.817  1.00 26.04 ? 14  SER A CA  1 
ATOM   71   C  C   . SER A 1 13  ? -1.842  -24.359 10.130  1.00 26.34 ? 14  SER A C   1 
ATOM   72   O  O   . SER A 1 13  ? -2.565  -25.238 9.670   1.00 26.55 ? 14  SER A O   1 
ATOM   73   C  CB  . SER A 1 13  ? -2.690  -23.457 12.304  1.00 25.58 ? 14  SER A CB  1 
ATOM   74   O  OG  . SER A 1 13  ? -1.459  -23.669 12.967  1.00 26.84 ? 14  SER A OG  1 
ATOM   75   N  N   . PRO A 1 14  ? -0.493  -24.413 10.054  1.00 26.94 ? 15  PRO A N   1 
ATOM   76   C  CA  . PRO A 1 14  ? 0.194   -25.640 9.613   1.00 27.05 ? 15  PRO A CA  1 
ATOM   77   C  C   . PRO A 1 14  ? 0.012   -26.824 10.564  1.00 27.29 ? 15  PRO A C   1 
ATOM   78   O  O   . PRO A 1 14  ? 0.187   -27.967 10.147  1.00 28.19 ? 15  PRO A O   1 
ATOM   79   C  CB  . PRO A 1 14  ? 1.674   -25.231 9.584   1.00 27.01 ? 15  PRO A CB  1 
ATOM   80   C  CG  . PRO A 1 14  ? 1.763   -24.040 10.465  1.00 26.99 ? 15  PRO A CG  1 
ATOM   81   C  CD  . PRO A 1 14  ? 0.463   -23.315 10.275  1.00 26.68 ? 15  PRO A CD  1 
ATOM   82   N  N   . GLY A 1 15  ? -0.335  -26.556 11.823  1.00 27.10 ? 16  GLY A N   1 
ATOM   83   C  CA  . GLY A 1 15  ? -0.467  -27.605 12.843  1.00 26.81 ? 16  GLY A CA  1 
ATOM   84   C  C   . GLY A 1 15  ? 0.054   -27.143 14.194  1.00 26.60 ? 16  GLY A C   1 
ATOM   85   O  O   . GLY A 1 15  ? 0.644   -26.065 14.301  1.00 26.20 ? 16  GLY A O   1 
ATOM   86   N  N   . ASP A 1 16  ? -0.142  -27.961 15.225  1.00 26.51 ? 17  ASP A N   1 
ATOM   87   C  CA  . ASP A 1 16  ? 0.209   -27.557 16.593  1.00 26.73 ? 17  ASP A CA  1 
ATOM   88   C  C   . ASP A 1 16  ? 1.590   -27.987 17.085  1.00 25.98 ? 17  ASP A C   1 
ATOM   89   O  O   . ASP A 1 16  ? 2.021   -27.574 18.161  1.00 26.38 ? 17  ASP A O   1 
ATOM   90   C  CB  . ASP A 1 16  ? -0.878  -27.978 17.580  1.00 27.45 ? 17  ASP A CB  1 
ATOM   91   C  CG  . ASP A 1 16  ? -2.151  -27.162 17.414  1.00 29.58 ? 17  ASP A CG  1 
ATOM   92   O  OD1 . ASP A 1 16  ? -2.131  -25.932 17.673  1.00 31.48 ? 17  ASP A OD1 1 
ATOM   93   O  OD2 . ASP A 1 16  ? -3.169  -27.752 17.009  1.00 32.20 ? 17  ASP A OD2 1 
ATOM   94   N  N   . ASN A 1 17  ? 2.285   -28.798 16.298  1.00 24.87 ? 18  ASN A N   1 
ATOM   95   C  CA  . ASN A 1 17  ? 3.630   -29.229 16.662  1.00 24.20 ? 18  ASN A CA  1 
ATOM   96   C  C   . ASN A 1 17  ? 4.685   -28.204 16.219  1.00 23.48 ? 18  ASN A C   1 
ATOM   97   O  O   . ASN A 1 17  ? 5.081   -28.158 15.048  1.00 22.95 ? 18  ASN A O   1 
ATOM   98   C  CB  . ASN A 1 17  ? 3.914   -30.634 16.109  1.00 24.12 ? 18  ASN A CB  1 
ATOM   99   C  CG  . ASN A 1 17  ? 5.227   -31.217 16.615  1.00 24.83 ? 18  ASN A CG  1 
ATOM   100  O  OD1 . ASN A 1 17  ? 6.160   -30.492 16.972  1.00 26.50 ? 18  ASN A OD1 1 
ATOM   101  N  ND2 . ASN A 1 17  ? 5.304   -32.536 16.640  1.00 24.46 ? 18  ASN A ND2 1 
ATOM   102  N  N   . GLY A 1 18  ? 5.122   -27.384 17.175  1.00 22.97 ? 19  GLY A N   1 
ATOM   103  C  CA  . GLY A 1 18  ? 6.083   -26.304 16.928  1.00 22.40 ? 19  GLY A CA  1 
ATOM   104  C  C   . GLY A 1 18  ? 7.434   -26.736 16.391  1.00 22.26 ? 19  GLY A C   1 
ATOM   105  O  O   . GLY A 1 18  ? 8.060   -26.014 15.605  1.00 22.12 ? 19  GLY A O   1 
ATOM   106  N  N   . TRP A 1 19  ? 7.884   -27.919 16.808  1.00 21.65 ? 20  TRP A N   1 
ATOM   107  C  CA  . TRP A 1 19  ? 9.179   -28.440 16.384  1.00 21.44 ? 20  TRP A CA  1 
ATOM   108  C  C   . TRP A 1 19  ? 9.114   -28.964 14.960  1.00 20.97 ? 20  TRP A C   1 
ATOM   109  O  O   . TRP A 1 19  ? 10.063  -28.807 14.195  1.00 20.55 ? 20  TRP A O   1 
ATOM   110  C  CB  . TRP A 1 19  ? 9.680   -29.515 17.361  1.00 21.59 ? 20  TRP A CB  1 
ATOM   111  C  CG  . TRP A 1 19  ? 9.686   -29.000 18.762  1.00 22.34 ? 20  TRP A CG  1 
ATOM   112  C  CD1 . TRP A 1 19  ? 8.858   -29.375 19.779  1.00 22.37 ? 20  TRP A CD1 1 
ATOM   113  C  CD2 . TRP A 1 19  ? 10.537  -27.973 19.290  1.00 23.02 ? 20  TRP A CD2 1 
ATOM   114  N  NE1 . TRP A 1 19  ? 9.153   -28.659 20.914  1.00 24.15 ? 20  TRP A NE1 1 
ATOM   115  C  CE2 . TRP A 1 19  ? 10.176  -27.788 20.639  1.00 23.67 ? 20  TRP A CE2 1 
ATOM   116  C  CE3 . TRP A 1 19  ? 11.570  -27.193 18.752  1.00 23.87 ? 20  TRP A CE3 1 
ATOM   117  C  CZ2 . TRP A 1 19  ? 10.811  -26.852 21.463  1.00 24.28 ? 20  TRP A CZ2 1 
ATOM   118  C  CZ3 . TRP A 1 19  ? 12.204  -26.262 19.573  1.00 23.25 ? 20  TRP A CZ3 1 
ATOM   119  C  CH2 . TRP A 1 19  ? 11.818  -26.100 20.909  1.00 23.82 ? 20  TRP A CH2 1 
ATOM   120  N  N   . LEU A 1 20  ? 7.981   -29.571 14.612  1.00 20.73 ? 21  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 20  ? 7.723   -30.007 13.238  1.00 20.63 ? 21  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 20  ? 7.565   -28.806 12.301  1.00 19.83 ? 21  LEU A C   1 
ATOM   123  O  O   . LEU A 1 20  ? 8.109   -28.809 11.191  1.00 19.69 ? 21  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 20  ? 6.495   -30.938 13.172  1.00 20.53 ? 21  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 20  ? 6.158   -31.648 11.848  1.00 22.57 ? 21  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 20  ? 7.258   -32.636 11.374  1.00 22.72 ? 21  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 20  ? 4.814   -32.371 11.955  1.00 23.21 ? 21  LEU A CD2 1 
ATOM   128  N  N   . ASN A 1 21  ? 6.834   -27.781 12.742  1.00 19.49 ? 22  ASN A N   1 
ATOM   129  C  CA  . ASN A 1 21  ? 6.719   -26.531 11.957  1.00 19.18 ? 22  ASN A CA  1 
ATOM   130  C  C   . ASN A 1 21  ? 8.086   -25.884 11.702  1.00 19.06 ? 22  ASN A C   1 
ATOM   131  O  O   . ASN A 1 21  ? 8.363   -25.384 10.600  1.00 18.89 ? 22  ASN A O   1 
ATOM   132  C  CB  . ASN A 1 21  ? 5.765   -25.528 12.630  1.00 19.26 ? 22  ASN A CB  1 
ATOM   133  C  CG  . ASN A 1 21  ? 4.346   -26.065 12.771  1.00 19.08 ? 22  ASN A CG  1 
ATOM   134  O  OD1 . ASN A 1 21  ? 3.959   -27.010 12.093  1.00 20.93 ? 22  ASN A OD1 1 
ATOM   135  N  ND2 . ASN A 1 21  ? 3.573   -25.473 13.669  1.00 18.89 ? 22  ASN A ND2 1 
ATOM   136  N  N   . LEU A 1 22  ? 8.945   -25.918 12.719  1.00 19.13 ? 23  LEU A N   1 
ATOM   137  C  CA  . LEU A 1 22  ? 10.296  -25.366 12.620  1.00 19.17 ? 23  LEU A CA  1 
ATOM   138  C  C   . LEU A 1 22  ? 11.109  -26.183 11.628  1.00 19.45 ? 23  LEU A C   1 
ATOM   139  O  O   . LEU A 1 22  ? 11.832  -25.633 10.788  1.00 19.35 ? 23  LEU A O   1 
ATOM   140  C  CB  . LEU A 1 22  ? 10.976  -25.323 13.998  1.00 18.73 ? 23  LEU A CB  1 
ATOM   141  C  CG  . LEU A 1 22  ? 12.244  -24.466 14.152  1.00 19.57 ? 23  LEU A CG  1 
ATOM   142  C  CD1 . LEU A 1 22  ? 12.030  -23.018 13.659  1.00 17.91 ? 23  LEU A CD1 1 
ATOM   143  C  CD2 . LEU A 1 22  ? 12.769  -24.466 15.590  1.00 17.35 ? 23  LEU A CD2 1 
ATOM   144  N  N   . TYR A 1 23  ? 10.962  -27.503 11.715  1.00 20.02 ? 24  TYR A N   1 
ATOM   145  C  CA  . TYR A 1 23  ? 11.605  -28.408 10.783  1.00 20.49 ? 24  TYR A CA  1 
ATOM   146  C  C   . TYR A 1 23  ? 11.241  -28.079 9.331   1.00 20.24 ? 24  TYR A C   1 
ATOM   147  O  O   . TYR A 1 23  ? 12.119  -27.970 8.484   1.00 20.19 ? 24  TYR A O   1 
ATOM   148  C  CB  . TYR A 1 23  ? 11.273  -29.863 11.135  1.00 21.06 ? 24  TYR A CB  1 
ATOM   149  C  CG  . TYR A 1 23  ? 11.724  -30.856 10.091  1.00 23.04 ? 24  TYR A CG  1 
ATOM   150  C  CD1 . TYR A 1 23  ? 13.077  -31.116 9.889   1.00 25.75 ? 24  TYR A CD1 1 
ATOM   151  C  CD2 . TYR A 1 23  ? 10.797  -31.533 9.308   1.00 25.51 ? 24  TYR A CD2 1 
ATOM   152  C  CE1 . TYR A 1 23  ? 13.499  -32.021 8.925   1.00 28.18 ? 24  TYR A CE1 1 
ATOM   153  C  CE2 . TYR A 1 23  ? 11.205  -32.444 8.340   1.00 28.10 ? 24  TYR A CE2 1 
ATOM   154  C  CZ  . TYR A 1 23  ? 12.555  -32.684 8.161   1.00 28.99 ? 24  TYR A CZ  1 
ATOM   155  O  OH  . TYR A 1 23  ? 12.961  -33.578 7.205   1.00 32.11 ? 24  TYR A OH  1 
ATOM   156  N  N   . HIS A 1 24  ? 9.954   -27.907 9.050   1.00 20.31 ? 25  HIS A N   1 
ATOM   157  C  CA  . HIS A 1 24  ? 9.518   -27.600 7.685   1.00 20.92 ? 25  HIS A CA  1 
ATOM   158  C  C   . HIS A 1 24  ? 9.953   -26.211 7.213   1.00 20.40 ? 25  HIS A C   1 
ATOM   159  O  O   . HIS A 1 24  ? 10.297  -26.038 6.053   1.00 20.25 ? 25  HIS A O   1 
ATOM   160  C  CB  . HIS A 1 24  ? 8.007   -27.774 7.533   1.00 21.08 ? 25  HIS A CB  1 
ATOM   161  C  CG  . HIS A 1 24  ? 7.564   -29.203 7.539   1.00 22.97 ? 25  HIS A CG  1 
ATOM   162  N  ND1 . HIS A 1 24  ? 8.163   -30.172 6.760   1.00 24.98 ? 25  HIS A ND1 1 
ATOM   163  C  CD2 . HIS A 1 24  ? 6.563   -29.824 8.207   1.00 23.51 ? 25  HIS A CD2 1 
ATOM   164  C  CE1 . HIS A 1 24  ? 7.563   -31.332 6.964   1.00 24.56 ? 25  HIS A CE1 1 
ATOM   165  N  NE2 . HIS A 1 24  ? 6.588   -31.147 7.836   1.00 24.44 ? 25  HIS A NE2 1 
ATOM   166  N  N   . PHE A 1 25  ? 9.937   -25.234 8.115   1.00 20.50 ? 26  PHE A N   1 
ATOM   167  C  CA  . PHE A 1 25  ? 10.407  -23.884 7.807   1.00 20.64 ? 26  PHE A CA  1 
ATOM   168  C  C   . PHE A 1 25  ? 11.884  -23.925 7.394   1.00 21.17 ? 26  PHE A C   1 
ATOM   169  O  O   . PHE A 1 25  ? 12.226  -23.426 6.324   1.00 20.51 ? 26  PHE A O   1 
ATOM   170  C  CB  . PHE A 1 25  ? 10.142  -22.935 8.988   1.00 20.46 ? 26  PHE A CB  1 
ATOM   171  C  CG  . PHE A 1 25  ? 10.894  -21.625 8.932   1.00 20.94 ? 26  PHE A CG  1 
ATOM   172  C  CD1 . PHE A 1 25  ? 10.940  -20.862 7.766   1.00 21.42 ? 26  PHE A CD1 1 
ATOM   173  C  CD2 . PHE A 1 25  ? 11.532  -21.136 10.073  1.00 21.87 ? 26  PHE A CD2 1 
ATOM   174  C  CE1 . PHE A 1 25  ? 11.632  -19.649 7.727   1.00 21.35 ? 26  PHE A CE1 1 
ATOM   175  C  CE2 . PHE A 1 25  ? 12.227  -19.915 10.050  1.00 21.89 ? 26  PHE A CE2 1 
ATOM   176  C  CZ  . PHE A 1 25  ? 12.273  -19.172 8.879   1.00 22.16 ? 26  PHE A CZ  1 
ATOM   177  N  N   . TRP A 1 26  ? 12.738  -24.556 8.210   1.00 21.97 ? 27  TRP A N   1 
ATOM   178  C  CA  . TRP A 1 26  ? 14.170  -24.657 7.890   1.00 23.28 ? 27  TRP A CA  1 
ATOM   179  C  C   . TRP A 1 26  ? 14.459  -25.385 6.591   1.00 24.02 ? 27  TRP A C   1 
ATOM   180  O  O   . TRP A 1 26  ? 15.315  -24.961 5.828   1.00 24.09 ? 27  TRP A O   1 
ATOM   181  C  CB  . TRP A 1 26  ? 14.975  -25.302 9.020   1.00 23.08 ? 27  TRP A CB  1 
ATOM   182  C  CG  . TRP A 1 26  ? 15.053  -24.481 10.258  1.00 23.42 ? 27  TRP A CG  1 
ATOM   183  C  CD1 . TRP A 1 26  ? 14.592  -23.208 10.435  1.00 22.17 ? 27  TRP A CD1 1 
ATOM   184  C  CD2 . TRP A 1 26  ? 15.644  -24.871 11.496  1.00 23.78 ? 27  TRP A CD2 1 
ATOM   185  N  NE1 . TRP A 1 26  ? 14.848  -22.786 11.710  1.00 24.02 ? 27  TRP A NE1 1 
ATOM   186  C  CE2 . TRP A 1 26  ? 15.497  -23.785 12.387  1.00 24.09 ? 27  TRP A CE2 1 
ATOM   187  C  CE3 . TRP A 1 26  ? 16.289  -26.035 11.941  1.00 24.12 ? 27  TRP A CE3 1 
ATOM   188  C  CZ2 . TRP A 1 26  ? 15.964  -23.825 13.705  1.00 24.76 ? 27  TRP A CZ2 1 
ATOM   189  C  CZ3 . TRP A 1 26  ? 16.757  -26.078 13.249  1.00 25.67 ? 27  TRP A CZ3 1 
ATOM   190  C  CH2 . TRP A 1 26  ? 16.590  -24.976 14.118  1.00 25.93 ? 27  TRP A CH2 1 
ATOM   191  N  N   . ARG A 1 27  ? 13.739  -26.476 6.347   1.00 25.46 ? 28  ARG A N   1 
ATOM   192  C  CA  . ARG A 1 27  ? 13.962  -27.308 5.164   1.00 26.55 ? 28  ARG A CA  1 
ATOM   193  C  C   . ARG A 1 27  ? 13.511  -26.631 3.853   1.00 26.45 ? 28  ARG A C   1 
ATOM   194  O  O   . ARG A 1 27  ? 14.229  -26.669 2.860   1.00 26.06 ? 28  ARG A O   1 
ATOM   195  C  CB  . ARG A 1 27  ? 13.281  -28.682 5.346   1.00 27.04 ? 28  ARG A CB  1 
ATOM   196  C  CG  . ARG A 1 27  ? 13.672  -29.749 4.309   1.00 29.74 ? 28  ARG A CG  1 
ATOM   197  C  CD  . ARG A 1 27  ? 12.738  -30.974 4.349   1.00 34.91 ? 28  ARG A CD  1 
ATOM   198  N  NE  . ARG A 1 27  ? 11.329  -30.590 4.189   1.00 39.08 ? 28  ARG A NE  1 
ATOM   199  C  CZ  . ARG A 1 27  ? 10.306  -31.433 4.050   1.00 40.96 ? 28  ARG A CZ  1 
ATOM   200  N  NH1 . ARG A 1 27  ? 10.494  -32.750 4.044   1.00 42.07 ? 28  ARG A NH1 1 
ATOM   201  N  NH2 . ARG A 1 27  ? 9.079   -30.949 3.910   1.00 42.13 ? 28  ARG A NH2 1 
ATOM   202  N  N   . GLU A 1 28  ? 12.331  -26.013 3.864   1.00 26.86 ? 29  GLU A N   1 
ATOM   203  C  CA  . GLU A 1 28  ? 11.701  -25.485 2.640   1.00 27.27 ? 29  GLU A CA  1 
ATOM   204  C  C   . GLU A 1 28  ? 12.091  -24.047 2.300   1.00 26.82 ? 29  GLU A C   1 
ATOM   205  O  O   . GLU A 1 28  ? 12.184  -23.688 1.131   1.00 27.07 ? 29  GLU A O   1 
ATOM   206  C  CB  . GLU A 1 28  ? 10.176  -25.545 2.753   1.00 27.55 ? 29  GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 28  ? 9.576   -26.949 2.748   1.00 30.68 ? 29  GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 28  ? 8.105   -26.946 3.127   1.00 34.11 ? 29  GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 28  ? 7.321   -26.211 2.483   1.00 35.30 ? 29  GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 28  ? 7.734   -27.677 4.074   1.00 36.35 ? 29  GLU A OE2 1 
ATOM   211  N  N   . THR A 1 29  ? 12.290  -23.224 3.322   1.00 26.36 ? 30  THR A N   1 
ATOM   212  C  CA  . THR A 1 29  ? 12.476  -21.789 3.132   1.00 26.09 ? 30  THR A CA  1 
ATOM   213  C  C   . THR A 1 29  ? 13.820  -21.336 3.685   1.00 25.84 ? 30  THR A C   1 
ATOM   214  O  O   . THR A 1 29  ? 14.562  -20.628 3.013   1.00 25.97 ? 30  THR A O   1 
ATOM   215  C  CB  . THR A 1 29  ? 11.308  -20.992 3.760   1.00 25.95 ? 30  THR A CB  1 
ATOM   216  O  OG1 . THR A 1 29  ? 10.071  -21.488 3.228   1.00 26.31 ? 30  THR A OG1 1 
ATOM   217  C  CG2 . THR A 1 29  ? 11.413  -19.507 3.433   1.00 25.55 ? 30  THR A CG2 1 
ATOM   218  N  N   . GLY A 1 30  ? 14.137  -21.765 4.902   1.00 25.67 ? 31  GLY A N   1 
ATOM   219  C  CA  . GLY A 1 30  ? 15.417  -21.442 5.506   1.00 25.11 ? 31  GLY A CA  1 
ATOM   220  C  C   . GLY A 1 30  ? 15.333  -20.249 6.432   1.00 24.93 ? 31  GLY A C   1 
ATOM   221  O  O   . GLY A 1 30  ? 14.505  -19.341 6.238   1.00 24.26 ? 31  GLY A O   1 
ATOM   222  N  N   . THR A 1 31  ? 16.218  -20.256 7.426   1.00 24.78 ? 32  THR A N   1 
ATOM   223  C  CA  . THR A 1 31  ? 16.266  -19.253 8.495   1.00 25.17 ? 32  THR A CA  1 
ATOM   224  C  C   . THR A 1 31  ? 16.422  -17.817 7.982   1.00 24.27 ? 32  THR A C   1 
ATOM   225  O  O   . THR A 1 31  ? 15.839  -16.880 8.535   1.00 24.31 ? 32  THR A O   1 
ATOM   226  C  CB  . THR A 1 31  ? 17.423  -19.561 9.481   1.00 25.46 ? 32  THR A CB  1 
ATOM   227  O  OG1 . THR A 1 31  ? 17.874  -20.910 9.288   1.00 28.20 ? 32  THR A OG1 1 
ATOM   228  C  CG2 . THR A 1 31  ? 16.941  -19.434 10.898  1.00 26.65 ? 32  THR A CG2 1 
ATOM   229  N  N   . HIS A 1 32  ? 17.195  -17.659 6.914   1.00 23.04 ? 33  HIS A N   1 
ATOM   230  C  CA  . HIS A 1 32  ? 17.535  -16.346 6.392   1.00 22.72 ? 33  HIS A CA  1 
ATOM   231  C  C   . HIS A 1 32  ? 16.500  -15.816 5.399   1.00 21.85 ? 33  HIS A C   1 
ATOM   232  O  O   . HIS A 1 32  ? 16.718  -14.793 4.760   1.00 21.82 ? 33  HIS A O   1 
ATOM   233  C  CB  . HIS A 1 32  ? 18.947  -16.376 5.788   1.00 23.06 ? 33  HIS A CB  1 
ATOM   234  C  CG  . HIS A 1 32  ? 20.004  -16.721 6.790   1.00 24.75 ? 33  HIS A CG  1 
ATOM   235  N  ND1 . HIS A 1 32  ? 20.454  -15.823 7.735   1.00 26.16 ? 33  HIS A ND1 1 
ATOM   236  C  CD2 . HIS A 1 32  ? 20.661  -17.880 7.031   1.00 26.20 ? 33  HIS A CD2 1 
ATOM   237  C  CE1 . HIS A 1 32  ? 21.358  -16.407 8.500   1.00 27.09 ? 33  HIS A CE1 1 
ATOM   238  N  NE2 . HIS A 1 32  ? 21.497  -17.658 8.098   1.00 27.43 ? 33  HIS A NE2 1 
ATOM   239  N  N   . LYS A 1 33  ? 15.365  -16.509 5.306   1.00 20.87 ? 34  LYS A N   1 
ATOM   240  C  CA  . LYS A 1 33  ? 14.298  -16.170 4.376   1.00 19.99 ? 34  LYS A CA  1 
ATOM   241  C  C   . LYS A 1 33  ? 12.940  -16.133 5.071   1.00 19.04 ? 34  LYS A C   1 
ATOM   242  O  O   . LYS A 1 33  ? 11.916  -16.402 4.455   1.00 18.26 ? 34  LYS A O   1 
ATOM   243  C  CB  . LYS A 1 33  ? 14.263  -17.173 3.211   1.00 20.04 ? 34  LYS A CB  1 
ATOM   244  C  CG  . LYS A 1 33  ? 15.510  -17.186 2.317   1.00 21.50 ? 34  LYS A CG  1 
ATOM   245  C  CD  . LYS A 1 33  ? 15.744  -15.833 1.647   1.00 24.39 ? 34  LYS A CD  1 
ATOM   246  C  CE  . LYS A 1 33  ? 16.885  -15.893 0.648   1.00 25.77 ? 34  LYS A CE  1 
ATOM   247  N  NZ  . LYS A 1 33  ? 17.239  -14.545 0.135   1.00 26.45 ? 34  LYS A NZ  1 
ATOM   248  N  N   . VAL A 1 34  ? 12.928  -15.787 6.352   1.00 18.66 ? 35  VAL A N   1 
ATOM   249  C  CA  . VAL A 1 34  ? 11.680  -15.754 7.122   1.00 18.68 ? 35  VAL A CA  1 
ATOM   250  C  C   . VAL A 1 34  ? 10.623  -14.813 6.491   1.00 18.64 ? 35  VAL A C   1 
ATOM   251  O  O   . VAL A 1 34  ? 9.420   -15.073 6.584   1.00 18.63 ? 35  VAL A O   1 
ATOM   252  C  CB  . VAL A 1 34  ? 11.928  -15.407 8.616   1.00 18.81 ? 35  VAL A CB  1 
ATOM   253  C  CG1 . VAL A 1 34  ? 12.351  -13.956 8.788   1.00 18.03 ? 35  VAL A CG1 1 
ATOM   254  C  CG2 . VAL A 1 34  ? 10.675  -15.698 9.451   1.00 19.73 ? 35  VAL A CG2 1 
ATOM   255  N  N   . HIS A 1 35  ? 11.084  -13.746 5.835   1.00 18.06 ? 36  HIS A N   1 
ATOM   256  C  CA  . HIS A 1 35  ? 10.194  -12.811 5.136   1.00 18.21 ? 36  HIS A CA  1 
ATOM   257  C  C   . HIS A 1 35  ? 9.417   -13.477 3.987   1.00 18.33 ? 36  HIS A C   1 
ATOM   258  O  O   . HIS A 1 35  ? 8.222   -13.205 3.801   1.00 18.06 ? 36  HIS A O   1 
ATOM   259  C  CB  . HIS A 1 35  ? 10.956  -11.564 4.657   1.00 17.87 ? 36  HIS A CB  1 
ATOM   260  C  CG  . HIS A 1 35  ? 12.149  -11.861 3.795   1.00 17.52 ? 36  HIS A CG  1 
ATOM   261  N  ND1 . HIS A 1 35  ? 13.250  -12.549 4.257   1.00 16.26 ? 36  HIS A ND1 1 
ATOM   262  C  CD2 . HIS A 1 35  ? 12.424  -11.532 2.511   1.00 16.59 ? 36  HIS A CD2 1 
ATOM   263  C  CE1 . HIS A 1 35  ? 14.150  -12.637 3.294   1.00 17.27 ? 36  HIS A CE1 1 
ATOM   264  N  NE2 . HIS A 1 35  ? 13.672  -12.032 2.222   1.00 17.18 ? 36  HIS A NE2 1 
ATOM   265  N  N   . LEU A 1 36  ? 10.089  -14.360 3.245   1.00 18.29 ? 37  LEU A N   1 
ATOM   266  C  CA  . LEU A 1 36  ? 9.438   -15.133 2.183   1.00 18.82 ? 37  LEU A CA  1 
ATOM   267  C  C   . LEU A 1 36  ? 8.459   -16.132 2.767   1.00 18.57 ? 37  LEU A C   1 
ATOM   268  O  O   . LEU A 1 36  ? 7.406   -16.386 2.200   1.00 18.69 ? 37  LEU A O   1 
ATOM   269  C  CB  . LEU A 1 36  ? 10.461  -15.852 1.294   1.00 18.79 ? 37  LEU A CB  1 
ATOM   270  C  CG  . LEU A 1 36  ? 11.454  -14.981 0.503   1.00 19.63 ? 37  LEU A CG  1 
ATOM   271  C  CD1 . LEU A 1 36  ? 12.323  -15.835 -0.415  1.00 19.56 ? 37  LEU A CD1 1 
ATOM   272  C  CD2 . LEU A 1 36  ? 10.756  -13.883 -0.307  1.00 21.22 ? 37  LEU A CD2 1 
ATOM   273  N  N   . HIS A 1 37  ? 8.812   -16.673 3.924   1.00 18.61 ? 38  HIS A N   1 
ATOM   274  C  CA  . HIS A 1 37  ? 7.987   -17.636 4.635   1.00 18.64 ? 38  HIS A CA  1 
ATOM   275  C  C   . HIS A 1 37  ? 6.646   -17.003 5.024   1.00 18.29 ? 38  HIS A C   1 
ATOM   276  O  O   . HIS A 1 37  ? 5.597   -17.654 4.918   1.00 18.06 ? 38  HIS A O   1 
ATOM   277  C  CB  . HIS A 1 37  ? 8.767   -18.158 5.847   1.00 18.83 ? 38  HIS A CB  1 
ATOM   278  C  CG  . HIS A 1 37  ? 7.983   -19.044 6.758   1.00 19.77 ? 38  HIS A CG  1 
ATOM   279  N  ND1 . HIS A 1 37  ? 7.667   -20.346 6.439   1.00 20.89 ? 38  HIS A ND1 1 
ATOM   280  C  CD2 . HIS A 1 37  ? 7.491   -18.831 8.002   1.00 21.79 ? 38  HIS A CD2 1 
ATOM   281  C  CE1 . HIS A 1 37  ? 6.990   -20.890 7.436   1.00 21.87 ? 38  HIS A CE1 1 
ATOM   282  N  NE2 . HIS A 1 37  ? 6.877   -19.995 8.402   1.00 21.83 ? 38  HIS A NE2 1 
ATOM   283  N  N   . HIS A 1 38  ? 6.681   -15.738 5.444   1.00 17.81 ? 39  HIS A N   1 
ATOM   284  C  CA  . HIS A 1 38  ? 5.455   -14.974 5.707   1.00 17.86 ? 39  HIS A CA  1 
ATOM   285  C  C   . HIS A 1 38  ? 4.624   -14.754 4.452   1.00 17.68 ? 39  HIS A C   1 
ATOM   286  O  O   . HIS A 1 38  ? 3.416   -14.961 4.481   1.00 17.83 ? 39  HIS A O   1 
ATOM   287  C  CB  . HIS A 1 38  ? 5.750   -13.614 6.340   1.00 17.63 ? 39  HIS A CB  1 
ATOM   288  C  CG  . HIS A 1 38  ? 6.396   -13.699 7.685   1.00 17.50 ? 39  HIS A CG  1 
ATOM   289  N  ND1 . HIS A 1 38  ? 7.098   -12.650 8.234   1.00 15.43 ? 39  HIS A ND1 1 
ATOM   290  C  CD2 . HIS A 1 38  ? 6.458   -14.709 8.585   1.00 16.44 ? 39  HIS A CD2 1 
ATOM   291  C  CE1 . HIS A 1 38  ? 7.557   -13.008 9.420   1.00 16.67 ? 39  HIS A CE1 1 
ATOM   292  N  NE2 . HIS A 1 38  ? 7.185   -14.253 9.654   1.00 16.27 ? 39  HIS A NE2 1 
ATOM   293  N  N   . VAL A 1 39  ? 5.266   -14.322 3.365   1.00 17.70 ? 40  VAL A N   1 
ATOM   294  C  CA  . VAL A 1 39  ? 4.575   -14.124 2.083   1.00 17.53 ? 40  VAL A CA  1 
ATOM   295  C  C   . VAL A 1 39  ? 3.830   -15.406 1.684   1.00 17.89 ? 40  VAL A C   1 
ATOM   296  O  O   . VAL A 1 39  ? 2.616   -15.393 1.502   1.00 17.80 ? 40  VAL A O   1 
ATOM   297  C  CB  . VAL A 1 39  ? 5.536   -13.663 0.955   1.00 17.31 ? 40  VAL A CB  1 
ATOM   298  C  CG1 . VAL A 1 39  ? 4.820   -13.632 -0.404  1.00 17.11 ? 40  VAL A CG1 1 
ATOM   299  C  CG2 . VAL A 1 39  ? 6.103   -12.296 1.269   1.00 17.07 ? 40  VAL A CG2 1 
ATOM   300  N  N   . GLN A 1 40  ? 4.564   -16.511 1.617   1.00 18.08 ? 41  GLN A N   1 
ATOM   301  C  CA  . GLN A 1 40  ? 4.013   -17.812 1.246   1.00 19.01 ? 41  GLN A CA  1 
ATOM   302  C  C   . GLN A 1 40  ? 2.862   -18.272 2.147   1.00 18.73 ? 41  GLN A C   1 
ATOM   303  O  O   . GLN A 1 40  ? 1.913   -18.876 1.661   1.00 18.98 ? 41  GLN A O   1 
ATOM   304  C  CB  . GLN A 1 40  ? 5.124   -18.870 1.222   1.00 18.91 ? 41  GLN A CB  1 
ATOM   305  C  CG  . GLN A 1 40  ? 6.194   -18.610 0.158   1.00 22.44 ? 41  GLN A CG  1 
ATOM   306  C  CD  . GLN A 1 40  ? 7.385   -19.569 0.236   1.00 26.11 ? 41  GLN A CD  1 
ATOM   307  O  OE1 . GLN A 1 40  ? 7.804   -19.994 1.319   1.00 27.73 ? 41  GLN A OE1 1 
ATOM   308  N  NE2 . GLN A 1 40  ? 7.933   -19.908 -0.920  1.00 27.29 ? 41  GLN A NE2 1 
ATOM   309  N  N   . ASN A 1 41  ? 2.955   -17.986 3.446   1.00 18.49 ? 42  ASN A N   1 
ATOM   310  C  CA  . ASN A 1 41  ? 1.930   -18.373 4.405   1.00 18.28 ? 42  ASN A CA  1 
ATOM   311  C  C   . ASN A 1 41  ? 0.589   -17.646 4.195   1.00 18.58 ? 42  ASN A C   1 
ATOM   312  O  O   . ASN A 1 41  ? -0.474  -18.280 4.227   1.00 18.09 ? 42  ASN A O   1 
ATOM   313  C  CB  . ASN A 1 41  ? 2.431   -18.187 5.848   1.00 18.34 ? 42  ASN A CB  1 
ATOM   314  C  CG  . ASN A 1 41  ? 3.305   -19.358 6.345   1.00 19.03 ? 42  ASN A CG  1 
ATOM   315  O  OD1 . ASN A 1 41  ? 3.299   -20.449 5.777   1.00 20.18 ? 42  ASN A OD1 1 
ATOM   316  N  ND2 . ASN A 1 41  ? 4.050   -19.120 7.416   1.00 17.79 ? 42  ASN A ND2 1 
ATOM   317  N  N   . PHE A 1 42  ? 0.626   -16.329 3.979   1.00 18.38 ? 43  PHE A N   1 
ATOM   318  C  CA  . PHE A 1 42  ? -0.607  -15.598 3.629   1.00 18.73 ? 43  PHE A CA  1 
ATOM   319  C  C   . PHE A 1 42  ? -1.251  -16.090 2.331   1.00 19.53 ? 43  PHE A C   1 
ATOM   320  O  O   . PHE A 1 42  ? -2.472  -16.157 2.241   1.00 19.49 ? 43  PHE A O   1 
ATOM   321  C  CB  . PHE A 1 42  ? -0.394  -14.081 3.600   1.00 18.16 ? 43  PHE A CB  1 
ATOM   322  C  CG  . PHE A 1 42  ? -0.030  -13.514 4.931   1.00 16.62 ? 43  PHE A CG  1 
ATOM   323  C  CD1 . PHE A 1 42  ? 1.245   -13.008 5.159   1.00 14.19 ? 43  PHE A CD1 1 
ATOM   324  C  CD2 . PHE A 1 42  ? -0.953  -13.516 5.972   1.00 14.46 ? 43  PHE A CD2 1 
ATOM   325  C  CE1 . PHE A 1 42  ? 1.594   -12.500 6.405   1.00 13.83 ? 43  PHE A CE1 1 
ATOM   326  C  CE2 . PHE A 1 42  ? -0.621  -13.023 7.217   1.00 13.99 ? 43  PHE A CE2 1 
ATOM   327  C  CZ  . PHE A 1 42  ? 0.657   -12.508 7.439   1.00 14.81 ? 43  PHE A CZ  1 
ATOM   328  N  N   . GLN A 1 43  ? -0.434  -16.453 1.342   1.00 20.73 ? 44  GLN A N   1 
ATOM   329  C  CA  . GLN A 1 43  ? -0.954  -17.017 0.098   1.00 22.38 ? 44  GLN A CA  1 
ATOM   330  C  C   . GLN A 1 43  ? -1.603  -18.384 0.318   1.00 22.72 ? 44  GLN A C   1 
ATOM   331  O  O   . GLN A 1 43  ? -2.559  -18.746 -0.373  1.00 22.76 ? 44  GLN A O   1 
ATOM   332  C  CB  . GLN A 1 43  ? 0.146   -17.097 -0.964  1.00 22.79 ? 44  GLN A CB  1 
ATOM   333  C  CG  . GLN A 1 43  ? 0.391   -15.746 -1.647  1.00 26.25 ? 44  GLN A CG  1 
ATOM   334  C  CD  . GLN A 1 43  ? 1.751   -15.643 -2.283  1.00 30.06 ? 44  GLN A CD  1 
ATOM   335  O  OE1 . GLN A 1 43  ? 2.506   -16.617 -2.327  1.00 33.77 ? 44  GLN A OE1 1 
ATOM   336  N  NE2 . GLN A 1 43  ? 2.083   -14.454 -2.782  1.00 31.57 ? 44  GLN A NE2 1 
ATOM   337  N  N   . LYS A 1 44  ? -1.095  -19.119 1.304   1.00 22.59 ? 45  LYS A N   1 
ATOM   338  C  CA  . LYS A 1 44  ? -1.594  -20.451 1.626   1.00 22.86 ? 45  LYS A CA  1 
ATOM   339  C  C   . LYS A 1 44  ? -2.830  -20.420 2.549   1.00 22.09 ? 45  LYS A C   1 
ATOM   340  O  O   . LYS A 1 44  ? -3.763  -21.190 2.353   1.00 21.80 ? 45  LYS A O   1 
ATOM   341  C  CB  . LYS A 1 44  ? -0.464  -21.279 2.262   1.00 23.28 ? 45  LYS A CB  1 
ATOM   342  C  CG  . LYS A 1 44  ? -0.527  -22.778 1.994   1.00 25.61 ? 45  LYS A CG  1 
ATOM   343  C  CD  . LYS A 1 44  ? 0.515   -23.559 2.820   1.00 28.82 ? 45  LYS A CD  1 
ATOM   344  C  CE  . LYS A 1 44  ? 1.943   -23.318 2.328   1.00 30.37 ? 45  LYS A CE  1 
ATOM   345  N  NZ  . LYS A 1 44  ? 2.951   -24.070 3.132   1.00 31.85 ? 45  LYS A NZ  1 
ATOM   346  N  N   . TYR A 1 45  ? -2.835  -19.524 3.536   1.00 21.57 ? 46  TYR A N   1 
ATOM   347  C  CA  . TYR A 1 45  ? -3.861  -19.531 4.590   1.00 21.32 ? 46  TYR A CA  1 
ATOM   348  C  C   . TYR A 1 45  ? -4.896  -18.411 4.526   1.00 21.04 ? 46  TYR A C   1 
ATOM   349  O  O   . TYR A 1 45  ? -5.971  -18.519 5.125   1.00 20.84 ? 46  TYR A O   1 
ATOM   350  C  CB  . TYR A 1 45  ? -3.208  -19.545 5.977   1.00 21.28 ? 46  TYR A CB  1 
ATOM   351  C  CG  . TYR A 1 45  ? -2.328  -20.755 6.209   1.00 22.36 ? 46  TYR A CG  1 
ATOM   352  C  CD1 . TYR A 1 45  ? -0.977  -20.599 6.488   1.00 23.11 ? 46  TYR A CD1 1 
ATOM   353  C  CD2 . TYR A 1 45  ? -2.849  -22.058 6.133   1.00 23.33 ? 46  TYR A CD2 1 
ATOM   354  C  CE1 . TYR A 1 45  ? -0.156  -21.698 6.692   1.00 26.25 ? 46  TYR A CE1 1 
ATOM   355  C  CE2 . TYR A 1 45  ? -2.035  -23.173 6.341   1.00 25.31 ? 46  TYR A CE2 1 
ATOM   356  C  CZ  . TYR A 1 45  ? -0.684  -22.979 6.617   1.00 26.88 ? 46  TYR A CZ  1 
ATOM   357  O  OH  . TYR A 1 45  ? 0.156   -24.050 6.819   1.00 30.02 ? 46  TYR A OH  1 
ATOM   358  N  N   . GLY A 1 46  ? -4.568  -17.344 3.804   1.00 20.58 ? 47  GLY A N   1 
ATOM   359  C  CA  . GLY A 1 46  ? -5.390  -16.147 3.806   1.00 20.12 ? 47  GLY A CA  1 
ATOM   360  C  C   . GLY A 1 46  ? -4.766  -15.058 4.658   1.00 20.09 ? 47  GLY A C   1 
ATOM   361  O  O   . GLY A 1 46  ? -3.606  -15.175 5.081   1.00 20.15 ? 47  GLY A O   1 
ATOM   362  N  N   . PRO A 1 47  ? -5.543  -14.000 4.944   1.00 19.99 ? 48  PRO A N   1 
ATOM   363  C  CA  . PRO A 1 47  ? -5.062  -12.767 5.594   1.00 19.71 ? 48  PRO A CA  1 
ATOM   364  C  C   . PRO A 1 47  ? -4.775  -12.872 7.098   1.00 19.55 ? 48  PRO A C   1 
ATOM   365  O  O   . PRO A 1 47  ? -4.263  -11.914 7.693   1.00 19.75 ? 48  PRO A O   1 
ATOM   366  C  CB  . PRO A 1 47  ? -6.199  -11.775 5.335   1.00 19.99 ? 48  PRO A CB  1 
ATOM   367  C  CG  . PRO A 1 47  ? -7.437  -12.643 5.207   1.00 19.99 ? 48  PRO A CG  1 
ATOM   368  C  CD  . PRO A 1 47  ? -6.994  -13.963 4.661   1.00 19.63 ? 48  PRO A CD  1 
ATOM   369  N  N   . ILE A 1 48  ? -5.098  -14.012 7.704   1.00 19.12 ? 49  ILE A N   1 
ATOM   370  C  CA  . ILE A 1 48  ? -4.752  -14.284 9.103   1.00 18.65 ? 49  ILE A CA  1 
ATOM   371  C  C   . ILE A 1 48  ? -4.411  -15.755 9.320   1.00 18.66 ? 49  ILE A C   1 
ATOM   372  O  O   . ILE A 1 48  ? -5.077  -16.648 8.794   1.00 18.20 ? 49  ILE A O   1 
ATOM   373  C  CB  . ILE A 1 48  ? -5.864  -13.831 10.106  1.00 19.16 ? 49  ILE A CB  1 
ATOM   374  C  CG1 . ILE A 1 48  ? -5.444  -14.116 11.561  1.00 18.91 ? 49  ILE A CG1 1 
ATOM   375  C  CG2 . ILE A 1 48  ? -7.228  -14.463 9.757   1.00 18.46 ? 49  ILE A CG2 1 
ATOM   376  C  CD1 . ILE A 1 48  ? -6.351  -13.473 12.629  1.00 20.38 ? 49  ILE A CD1 1 
ATOM   377  N  N   . TYR A 1 49  ? -3.356  -16.005 10.088  1.00 18.63 ? 50  TYR A N   1 
ATOM   378  C  CA  . TYR A 1 49  ? -3.020  -17.372 10.475  1.00 18.74 ? 50  TYR A CA  1 
ATOM   379  C  C   . TYR A 1 49  ? -2.290  -17.416 11.816  1.00 18.94 ? 50  TYR A C   1 
ATOM   380  O  O   . TYR A 1 49  ? -1.882  -16.386 12.355  1.00 18.23 ? 50  TYR A O   1 
ATOM   381  C  CB  . TYR A 1 49  ? -2.231  -18.102 9.363   1.00 18.88 ? 50  TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 49  ? -0.808  -17.620 9.181   1.00 19.13 ? 50  TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 49  ? 0.242   -18.202 9.902   1.00 18.57 ? 50  TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 49  ? -0.508  -16.574 8.301   1.00 19.25 ? 50  TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 49  ? 1.554   -17.763 9.746   1.00 18.55 ? 50  TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 49  ? 0.808   -16.121 8.141   1.00 19.17 ? 50  TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 49  ? 1.832   -16.722 8.870   1.00 19.95 ? 50  TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 49  ? 3.136   -16.294 8.723   1.00 20.68 ? 50  TYR A OH  1 
ATOM   389  N  N   . ARG A 1 50  ? -2.168  -18.618 12.366  1.00 19.75 ? 51  ARG A N   1 
ATOM   390  C  CA  . ARG A 1 50  ? -1.355  -18.834 13.548  1.00 21.06 ? 51  ARG A CA  1 
ATOM   391  C  C   . ARG A 1 50  ? -0.280  -19.854 13.220  1.00 21.32 ? 51  ARG A C   1 
ATOM   392  O  O   . ARG A 1 50  ? -0.503  -20.764 12.422  1.00 21.15 ? 51  ARG A O   1 
ATOM   393  C  CB  . ARG A 1 50  ? -2.198  -19.276 14.755  1.00 21.16 ? 51  ARG A CB  1 
ATOM   394  C  CG  . ARG A 1 50  ? -2.981  -20.545 14.543  1.00 22.97 ? 51  ARG A CG  1 
ATOM   395  C  CD  . ARG A 1 50  ? -3.901  -20.833 15.716  1.00 26.29 ? 51  ARG A CD  1 
ATOM   396  N  NE  . ARG A 1 50  ? -4.698  -22.032 15.460  1.00 28.86 ? 51  ARG A NE  1 
ATOM   397  C  CZ  . ARG A 1 50  ? -4.306  -23.273 15.740  1.00 29.98 ? 51  ARG A CZ  1 
ATOM   398  N  NH1 . ARG A 1 50  ? -3.120  -23.491 16.303  1.00 29.86 ? 51  ARG A NH1 1 
ATOM   399  N  NH2 . ARG A 1 50  ? -5.104  -24.301 15.457  1.00 30.54 ? 51  ARG A NH2 1 
ATOM   400  N  N   . GLU A 1 51  ? 0.893   -19.674 13.817  1.00 21.77 ? 52  GLU A N   1 
ATOM   401  C  CA  . GLU A 1 51  ? 1.979   -20.637 13.685  1.00 22.43 ? 52  GLU A CA  1 
ATOM   402  C  C   . GLU A 1 51  ? 2.815   -20.669 14.953  1.00 22.35 ? 52  GLU A C   1 
ATOM   403  O  O   . GLU A 1 51  ? 3.336   -19.641 15.399  1.00 22.10 ? 52  GLU A O   1 
ATOM   404  C  CB  . GLU A 1 51  ? 2.866   -20.346 12.463  1.00 22.78 ? 52  GLU A CB  1 
ATOM   405  C  CG  . GLU A 1 51  ? 3.961   -21.409 12.223  1.00 25.01 ? 52  GLU A CG  1 
ATOM   406  C  CD  . GLU A 1 51  ? 4.660   -21.290 10.864  1.00 28.35 ? 52  GLU A CD  1 
ATOM   407  O  OE1 . GLU A 1 51  ? 5.028   -20.168 10.458  1.00 28.51 ? 52  GLU A OE1 1 
ATOM   408  O  OE2 . GLU A 1 51  ? 4.860   -22.339 10.202  1.00 30.90 ? 52  GLU A OE2 1 
ATOM   409  N  N   . LYS A 1 52  ? 2.917   -21.862 15.530  1.00 22.48 ? 53  LYS A N   1 
ATOM   410  C  CA  . LYS A 1 52  ? 3.871   -22.134 16.588  1.00 22.91 ? 53  LYS A CA  1 
ATOM   411  C  C   . LYS A 1 52  ? 5.212   -22.527 15.956  1.00 22.86 ? 53  LYS A C   1 
ATOM   412  O  O   . LYS A 1 52  ? 5.306   -23.535 15.252  1.00 22.45 ? 53  LYS A O   1 
ATOM   413  C  CB  . LYS A 1 52  ? 3.357   -23.259 17.482  1.00 22.91 ? 53  LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 52  ? 3.977   -23.300 18.871  1.00 24.22 ? 53  LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 52  ? 3.463   -24.529 19.624  1.00 27.34 ? 53  LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 52  ? 3.206   -24.230 21.090  1.00 29.42 ? 53  LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 52  ? 2.647   -25.430 21.801  1.00 31.29 ? 53  LYS A NZ  1 
ATOM   418  N  N   . LEU A 1 53  ? 6.229   -21.703 16.184  1.00 23.09 ? 54  LEU A N   1 
ATOM   419  C  CA  . LEU A 1 53  ? 7.594   -22.032 15.785  1.00 23.84 ? 54  LEU A CA  1 
ATOM   420  C  C   . LEU A 1 53  ? 8.413   -22.317 17.023  1.00 24.28 ? 54  LEU A C   1 
ATOM   421  O  O   . LEU A 1 53  ? 8.618   -21.434 17.869  1.00 24.11 ? 54  LEU A O   1 
ATOM   422  C  CB  . LEU A 1 53  ? 8.235   -20.916 14.954  1.00 23.71 ? 54  LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 53  ? 7.750   -20.781 13.509  1.00 23.29 ? 54  LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 53  ? 8.404   -19.583 12.860  1.00 23.21 ? 54  LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 53  ? 8.015   -22.038 12.685  1.00 23.13 ? 54  LEU A CD2 1 
ATOM   426  N  N   . GLY A 1 54  ? 8.853   -23.570 17.132  1.00 24.85 ? 55  GLY A N   1 
ATOM   427  C  CA  . GLY A 1 54  ? 9.512   -24.059 18.337  1.00 25.60 ? 55  GLY A CA  1 
ATOM   428  C  C   . GLY A 1 54  ? 8.625   -23.900 19.553  1.00 26.23 ? 55  GLY A C   1 
ATOM   429  O  O   . GLY A 1 54  ? 7.600   -24.569 19.681  1.00 26.05 ? 55  GLY A O   1 
ATOM   430  N  N   . ASN A 1 55  ? 9.027   -22.997 20.441  1.00 27.20 ? 56  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 55  ? 8.292   -22.721 21.675  1.00 28.15 ? 56  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 55  ? 7.274   -21.580 21.548  1.00 28.23 ? 56  ASN A C   1 
ATOM   433  O  O   . ASN A 1 55  ? 6.278   -21.544 22.284  1.00 28.76 ? 56  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 55  ? 9.268   -22.457 22.835  1.00 28.64 ? 56  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 55  ? 10.451  -21.548 22.441  1.00 30.58 ? 56  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 55  ? 10.997  -21.629 21.323  1.00 31.58 ? 56  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 55  ? 10.864  -20.690 23.380  1.00 31.51 ? 56  ASN A ND2 1 
ATOM   438  N  N   . VAL A 1 56  ? 7.512   -20.673 20.598  1.00 27.83 ? 57  VAL A N   1 
ATOM   439  C  CA  . VAL A 1 56  ? 6.695   -19.459 20.434  1.00 27.09 ? 57  VAL A CA  1 
ATOM   440  C  C   . VAL A 1 56  ? 5.563   -19.581 19.402  1.00 26.10 ? 57  VAL A C   1 
ATOM   441  O  O   . VAL A 1 56  ? 5.789   -19.846 18.212  1.00 25.63 ? 57  VAL A O   1 
ATOM   442  C  CB  . VAL A 1 56  ? 7.589   -18.214 20.139  1.00 27.35 ? 57  VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 56  ? 6.778   -17.053 19.552  1.00 28.18 ? 57  VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 56  ? 8.309   -17.764 21.415  1.00 28.20 ? 57  VAL A CG2 1 
ATOM   445  N  N   . GLU A 1 57  ? 4.344   -19.373 19.889  1.00 25.06 ? 58  GLU A N   1 
ATOM   446  C  CA  . GLU A 1 57  ? 3.156   -19.269 19.056  1.00 24.54 ? 58  GLU A CA  1 
ATOM   447  C  C   . GLU A 1 57  ? 2.783   -17.802 18.800  1.00 23.45 ? 58  GLU A C   1 
ATOM   448  O  O   . GLU A 1 57  ? 2.857   -16.954 19.701  1.00 23.11 ? 58  GLU A O   1 
ATOM   449  C  CB  . GLU A 1 57  ? 1.983   -19.977 19.731  1.00 24.88 ? 58  GLU A CB  1 
ATOM   450  C  CG  . GLU A 1 57  ? 0.724   -20.043 18.882  1.00 27.15 ? 58  GLU A CG  1 
ATOM   451  C  CD  . GLU A 1 57  ? -0.321  -20.944 19.495  1.00 31.15 ? 58  GLU A CD  1 
ATOM   452  O  OE1 . GLU A 1 57  ? -0.687  -20.708 20.674  1.00 32.93 ? 58  GLU A OE1 1 
ATOM   453  O  OE2 . GLU A 1 57  ? -0.763  -21.890 18.802  1.00 32.02 ? 58  GLU A OE2 1 
ATOM   454  N  N   . SER A 1 58  ? 2.379   -17.517 17.569  1.00 22.16 ? 59  SER A N   1 
ATOM   455  C  CA  . SER A 1 58  ? 1.921   -16.186 17.205  1.00 21.15 ? 59  SER A CA  1 
ATOM   456  C  C   . SER A 1 58  ? 0.736   -16.260 16.265  1.00 19.98 ? 59  SER A C   1 
ATOM   457  O  O   . SER A 1 58  ? 0.568   -17.231 15.543  1.00 19.40 ? 59  SER A O   1 
ATOM   458  C  CB  . SER A 1 58  ? 3.038   -15.388 16.515  1.00 21.28 ? 59  SER A CB  1 
ATOM   459  O  OG  . SER A 1 58  ? 4.178   -15.253 17.336  1.00 22.40 ? 59  SER A OG  1 
ATOM   460  N  N   . VAL A 1 59  ? -0.075  -15.209 16.289  1.00 19.43 ? 60  VAL A N   1 
ATOM   461  C  CA  . VAL A 1 59  ? -1.075  -14.961 15.263  1.00 18.83 ? 60  VAL A CA  1 
ATOM   462  C  C   . VAL A 1 59  ? -0.474  -13.920 14.326  1.00 18.34 ? 60  VAL A C   1 
ATOM   463  O  O   . VAL A 1 59  ? 0.081   -12.924 14.777  1.00 18.27 ? 60  VAL A O   1 
ATOM   464  C  CB  . VAL A 1 59  ? -2.403  -14.433 15.871  1.00 18.92 ? 60  VAL A CB  1 
ATOM   465  C  CG1 . VAL A 1 59  ? -3.360  -13.973 14.784  1.00 17.99 ? 60  VAL A CG1 1 
ATOM   466  C  CG2 . VAL A 1 59  ? -3.057  -15.508 16.736  1.00 19.17 ? 60  VAL A CG2 1 
ATOM   467  N  N   . TYR A 1 60  ? -0.570  -14.170 13.024  1.00 18.18 ? 61  TYR A N   1 
ATOM   468  C  CA  . TYR A 1 60  ? -0.018  -13.263 12.024  1.00 18.03 ? 61  TYR A CA  1 
ATOM   469  C  C   . TYR A 1 60  ? -1.117  -12.569 11.234  1.00 17.82 ? 61  TYR A C   1 
ATOM   470  O  O   . TYR A 1 60  ? -2.063  -13.216 10.768  1.00 16.85 ? 61  TYR A O   1 
ATOM   471  C  CB  . TYR A 1 60  ? 0.895   -14.013 11.054  1.00 17.92 ? 61  TYR A CB  1 
ATOM   472  C  CG  . TYR A 1 60  ? 2.163   -14.549 11.675  1.00 18.29 ? 61  TYR A CG  1 
ATOM   473  C  CD1 . TYR A 1 60  ? 2.169   -15.791 12.314  1.00 17.96 ? 61  TYR A CD1 1 
ATOM   474  C  CD2 . TYR A 1 60  ? 3.359   -13.826 11.609  1.00 17.33 ? 61  TYR A CD2 1 
ATOM   475  C  CE1 . TYR A 1 60  ? 3.325   -16.303 12.873  1.00 20.23 ? 61  TYR A CE1 1 
ATOM   476  C  CE2 . TYR A 1 60  ? 4.532   -14.328 12.168  1.00 18.30 ? 61  TYR A CE2 1 
ATOM   477  C  CZ  . TYR A 1 60  ? 4.502   -15.566 12.804  1.00 19.72 ? 61  TYR A CZ  1 
ATOM   478  O  OH  . TYR A 1 60  ? 5.634   -16.091 13.367  1.00 20.82 ? 61  TYR A OH  1 
ATOM   479  N  N   . VAL A 1 61  ? -0.970  -11.255 11.084  1.00 17.93 ? 62  VAL A N   1 
ATOM   480  C  CA  . VAL A 1 61  ? -1.907  -10.448 10.293  1.00 18.62 ? 62  VAL A CA  1 
ATOM   481  C  C   . VAL A 1 61  ? -1.174  -9.636  9.231   1.00 19.38 ? 62  VAL A C   1 
ATOM   482  O  O   . VAL A 1 61  ? 0.035   -9.385  9.340   1.00 19.35 ? 62  VAL A O   1 
ATOM   483  C  CB  . VAL A 1 61  ? -2.804  -9.528  11.177  1.00 18.14 ? 62  VAL A CB  1 
ATOM   484  C  CG1 . VAL A 1 61  ? -3.703  -10.362 12.089  1.00 18.10 ? 62  VAL A CG1 1 
ATOM   485  C  CG2 . VAL A 1 61  ? -1.970  -8.563  11.990  1.00 18.03 ? 62  VAL A CG2 1 
ATOM   486  N  N   . ILE A 1 62  ? -1.922  -9.239  8.203   1.00 20.62 ? 63  ILE A N   1 
ATOM   487  C  CA  . ILE A 1 62  ? -1.388  -8.494  7.060   1.00 21.14 ? 63  ILE A CA  1 
ATOM   488  C  C   . ILE A 1 62  ? -2.258  -7.275  6.696   1.00 21.96 ? 63  ILE A C   1 
ATOM   489  O  O   . ILE A 1 62  ? -1.745  -6.273  6.191   1.00 21.95 ? 63  ILE A O   1 
ATOM   490  C  CB  . ILE A 1 62  ? -1.173  -9.423  5.829   1.00 21.13 ? 63  ILE A CB  1 
ATOM   491  C  CG1 . ILE A 1 62  ? -0.243  -8.762  4.794   1.00 20.20 ? 63  ILE A CG1 1 
ATOM   492  C  CG2 . ILE A 1 62  ? -2.523  -9.884  5.216   1.00 20.41 ? 63  ILE A CG2 1 
ATOM   493  C  CD1 . ILE A 1 62  ? 0.100   -9.663  3.610   1.00 18.70 ? 63  ILE A CD1 1 
ATOM   494  N  N   . ASP A 1 63  ? -3.563  -7.365  6.971   1.00 22.86 ? 64  ASP A N   1 
ATOM   495  C  CA  . ASP A 1 63  ? -4.523  -6.298  6.626   1.00 23.54 ? 64  ASP A CA  1 
ATOM   496  C  C   . ASP A 1 63  ? -4.360  -5.075  7.517   1.00 23.78 ? 64  ASP A C   1 
ATOM   497  O  O   . ASP A 1 63  ? -4.442  -5.185  8.736   1.00 23.89 ? 64  ASP A O   1 
ATOM   498  C  CB  . ASP A 1 63  ? -5.969  -6.818  6.711   1.00 23.82 ? 64  ASP A CB  1 
ATOM   499  C  CG  . ASP A 1 63  ? -6.998  -5.878  6.042   1.00 25.39 ? 64  ASP A CG  1 
ATOM   500  O  OD1 . ASP A 1 63  ? -6.869  -4.632  6.088   1.00 25.36 ? 64  ASP A OD1 1 
ATOM   501  O  OD2 . ASP A 1 63  ? -7.974  -6.406  5.479   1.00 27.90 ? 64  ASP A OD2 1 
ATOM   502  N  N   . PRO A 1 64  ? -4.139  -3.893  6.909   1.00 24.58 ? 65  PRO A N   1 
ATOM   503  C  CA  . PRO A 1 64  ? -4.059  -2.638  7.665   1.00 25.18 ? 65  PRO A CA  1 
ATOM   504  C  C   . PRO A 1 64  ? -5.280  -2.393  8.561   1.00 25.96 ? 65  PRO A C   1 
ATOM   505  O  O   . PRO A 1 64  ? -5.173  -1.714  9.585   1.00 26.23 ? 65  PRO A O   1 
ATOM   506  C  CB  . PRO A 1 64  ? -3.990  -1.580  6.564   1.00 24.96 ? 65  PRO A CB  1 
ATOM   507  C  CG  . PRO A 1 64  ? -3.311  -2.269  5.444   1.00 24.77 ? 65  PRO A CG  1 
ATOM   508  C  CD  . PRO A 1 64  ? -3.837  -3.684  5.480   1.00 24.39 ? 65  PRO A CD  1 
ATOM   509  N  N   . GLU A 1 65  ? -6.420  -2.961  8.184   1.00 26.88 ? 66  GLU A N   1 
ATOM   510  C  CA  . GLU A 1 65  ? -7.662  -2.804  8.937   1.00 28.20 ? 66  GLU A CA  1 
ATOM   511  C  C   . GLU A 1 65  ? -7.604  -3.603  10.246  1.00 27.92 ? 66  GLU A C   1 
ATOM   512  O  O   . GLU A 1 65  ? -8.126  -3.169  11.275  1.00 28.11 ? 66  GLU A O   1 
ATOM   513  C  CB  . GLU A 1 65  ? -8.851  -3.241  8.069   1.00 28.80 ? 66  GLU A CB  1 
ATOM   514  C  CG  . GLU A 1 65  ? -10.120 -2.414  8.247   1.00 32.42 ? 66  GLU A CG  1 
ATOM   515  C  CD  . GLU A 1 65  ? -9.965  -0.963  7.791   1.00 36.35 ? 66  GLU A CD  1 
ATOM   516  O  OE1 . GLU A 1 65  ? -9.814  -0.723  6.569   1.00 39.05 ? 66  GLU A OE1 1 
ATOM   517  O  OE2 . GLU A 1 65  ? -10.007 -0.061  8.657   1.00 37.38 ? 66  GLU A OE2 1 
ATOM   518  N  N   . ASP A 1 66  ? -6.950  -4.762  10.199  1.00 27.77 ? 67  ASP A N   1 
ATOM   519  C  CA  . ASP A 1 66  ? -6.683  -5.568  11.399  1.00 27.28 ? 67  ASP A CA  1 
ATOM   520  C  C   . ASP A 1 66  ? -5.574  -4.965  12.254  1.00 26.51 ? 67  ASP A C   1 
ATOM   521  O  O   . ASP A 1 66  ? -5.634  -5.015  13.483  1.00 26.23 ? 67  ASP A O   1 
ATOM   522  C  CB  . ASP A 1 66  ? -6.359  -7.017  11.018  1.00 27.40 ? 67  ASP A CB  1 
ATOM   523  C  CG  . ASP A 1 66  ? -7.526  -7.712  10.328  1.00 28.97 ? 67  ASP A CG  1 
ATOM   524  O  OD1 . ASP A 1 66  ? -8.692  -7.379  10.646  1.00 30.30 ? 67  ASP A OD1 1 
ATOM   525  O  OD2 . ASP A 1 66  ? -7.290  -8.591  9.466   1.00 30.56 ? 67  ASP A OD2 1 
ATOM   526  N  N   . VAL A 1 67  ? -4.574  -4.382  11.595  1.00 26.28 ? 68  VAL A N   1 
ATOM   527  C  CA  . VAL A 1 67  ? -3.482  -3.672  12.271  1.00 25.98 ? 68  VAL A CA  1 
ATOM   528  C  C   . VAL A 1 67  ? -4.041  -2.533  13.122  1.00 26.26 ? 68  VAL A C   1 
ATOM   529  O  O   . VAL A 1 67  ? -3.649  -2.369  14.277  1.00 26.45 ? 68  VAL A O   1 
ATOM   530  C  CB  . VAL A 1 67  ? -2.433  -3.130  11.254  1.00 25.93 ? 68  VAL A CB  1 
ATOM   531  C  CG1 . VAL A 1 67  ? -1.384  -2.271  11.936  1.00 25.19 ? 68  VAL A CG1 1 
ATOM   532  C  CG2 . VAL A 1 67  ? -1.770  -4.272  10.520  1.00 25.20 ? 68  VAL A CG2 1 
ATOM   533  N  N   . ALA A 1 68  ? -4.982  -1.780  12.555  1.00 26.62 ? 69  ALA A N   1 
ATOM   534  C  CA  . ALA A 1 68  ? -5.638  -0.668  13.248  1.00 27.05 ? 69  ALA A CA  1 
ATOM   535  C  C   . ALA A 1 68  ? -6.333  -1.104  14.536  1.00 27.43 ? 69  ALA A C   1 
ATOM   536  O  O   . ALA A 1 68  ? -6.242  -0.420  15.565  1.00 27.22 ? 69  ALA A O   1 
ATOM   537  C  CB  . ALA A 1 68  ? -6.632  0.024   12.318  1.00 27.07 ? 69  ALA A CB  1 
ATOM   538  N  N   . LEU A 1 69  ? -7.017  -2.243  14.468  1.00 27.97 ? 70  LEU A N   1 
ATOM   539  C  CA  . LEU A 1 69  ? -7.700  -2.812  15.624  1.00 28.95 ? 70  LEU A CA  1 
ATOM   540  C  C   . LEU A 1 69  ? -6.712  -3.267  16.691  1.00 29.03 ? 70  LEU A C   1 
ATOM   541  O  O   . LEU A 1 69  ? -6.941  -3.062  17.888  1.00 29.17 ? 70  LEU A O   1 
ATOM   542  C  CB  . LEU A 1 69  ? -8.613  -3.970  15.207  1.00 29.14 ? 70  LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 69  ? -9.872  -3.617  14.400  1.00 30.56 ? 70  LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 69  ? -10.507 -4.880  13.837  1.00 31.05 ? 70  LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 69  ? -10.893 -2.835  15.244  1.00 31.01 ? 70  LEU A CD2 1 
ATOM   546  N  N   . LEU A 1 70  ? -5.605  -3.866  16.256  1.00 29.31 ? 71  LEU A N   1 
ATOM   547  C  CA  . LEU A 1 70  ? -4.570  -4.307  17.189  1.00 29.64 ? 71  LEU A CA  1 
ATOM   548  C  C   . LEU A 1 70  ? -4.021  -3.130  17.995  1.00 30.47 ? 71  LEU A C   1 
ATOM   549  O  O   . LEU A 1 70  ? -3.904  -3.205  19.218  1.00 30.46 ? 71  LEU A O   1 
ATOM   550  C  CB  . LEU A 1 70  ? -3.435  -5.040  16.457  1.00 29.17 ? 71  LEU A CB  1 
ATOM   551  C  CG  . LEU A 1 70  ? -2.154  -5.322  17.252  1.00 28.23 ? 71  LEU A CG  1 
ATOM   552  C  CD1 . LEU A 1 70  ? -2.417  -6.304  18.387  1.00 27.41 ? 71  LEU A CD1 1 
ATOM   553  C  CD2 . LEU A 1 70  ? -1.050  -5.835  16.356  1.00 26.84 ? 71  LEU A CD2 1 
ATOM   554  N  N   . PHE A 1 71  ? -3.703  -2.041  17.307  1.00 31.62 ? 72  PHE A N   1 
ATOM   555  C  CA  . PHE A 1 71  ? -3.068  -0.908  17.965  1.00 33.09 ? 72  PHE A CA  1 
ATOM   556  C  C   . PHE A 1 71  ? -4.033  -0.021  18.764  1.00 33.81 ? 72  PHE A C   1 
ATOM   557  O  O   . PHE A 1 71  ? -3.609  0.653   19.695  1.00 34.14 ? 72  PHE A O   1 
ATOM   558  C  CB  . PHE A 1 71  ? -2.213  -0.108  16.975  1.00 33.01 ? 72  PHE A CB  1 
ATOM   559  C  CG  . PHE A 1 71  ? -0.890  -0.769  16.645  1.00 34.20 ? 72  PHE A CG  1 
ATOM   560  C  CD1 . PHE A 1 71  ? -0.615  -1.207  15.354  1.00 35.28 ? 72  PHE A CD1 1 
ATOM   561  C  CD2 . PHE A 1 71  ? 0.077   -0.964  17.632  1.00 34.40 ? 72  PHE A CD2 1 
ATOM   562  C  CE1 . PHE A 1 71  ? 0.614   -1.818  15.045  1.00 35.45 ? 72  PHE A CE1 1 
ATOM   563  C  CE2 . PHE A 1 71  ? 1.296   -1.571  17.337  1.00 34.42 ? 72  PHE A CE2 1 
ATOM   564  C  CZ  . PHE A 1 71  ? 1.563   -2.003  16.042  1.00 34.68 ? 72  PHE A CZ  1 
ATOM   565  N  N   . LYS A 1 72  ? -5.317  -0.038  18.411  1.00 34.88 ? 73  LYS A N   1 
ATOM   566  C  CA  . LYS A 1 72  ? -6.359  0.653   19.186  1.00 35.90 ? 73  LYS A CA  1 
ATOM   567  C  C   . LYS A 1 72  ? -6.594  0.009   20.559  1.00 36.03 ? 73  LYS A C   1 
ATOM   568  O  O   . LYS A 1 72  ? -6.908  0.701   21.527  1.00 36.50 ? 73  LYS A O   1 
ATOM   569  C  CB  . LYS A 1 72  ? -7.681  0.694   18.404  1.00 36.41 ? 73  LYS A CB  1 
ATOM   570  C  CG  . LYS A 1 72  ? -8.831  1.396   19.132  1.00 38.09 ? 73  LYS A CG  1 
ATOM   571  C  CD  . LYS A 1 72  ? -10.184 1.010   18.552  1.00 41.46 ? 73  LYS A CD  1 
ATOM   572  C  CE  . LYS A 1 72  ? -11.322 1.645   19.345  1.00 43.12 ? 73  LYS A CE  1 
ATOM   573  N  NZ  . LYS A 1 72  ? -12.646 1.351   18.721  1.00 44.58 ? 73  LYS A NZ  1 
ATOM   574  N  N   . SER A 1 73  ? -6.442  -1.309  20.636  1.00 36.25 ? 74  SER A N   1 
ATOM   575  C  CA  . SER A 1 73  ? -6.670  -2.047  21.881  1.00 36.48 ? 74  SER A CA  1 
ATOM   576  C  C   . SER A 1 73  ? -5.440  -2.072  22.779  1.00 36.28 ? 74  SER A C   1 
ATOM   577  O  O   . SER A 1 73  ? -5.442  -2.719  23.831  1.00 36.49 ? 74  SER A O   1 
ATOM   578  C  CB  . SER A 1 73  ? -7.101  -3.484  21.578  1.00 36.52 ? 74  SER A CB  1 
ATOM   579  O  OG  . SER A 1 73  ? -6.013  -4.229  21.062  1.00 37.59 ? 74  SER A OG  1 
ATOM   580  N  N   . GLU A 1 74  ? -4.397  -1.364  22.358  1.00 35.91 ? 75  GLU A N   1 
ATOM   581  C  CA  . GLU A 1 74  ? -3.122  -1.344  23.057  1.00 35.35 ? 75  GLU A CA  1 
ATOM   582  C  C   . GLU A 1 74  ? -3.240  -0.717  24.440  1.00 34.94 ? 75  GLU A C   1 
ATOM   583  O  O   . GLU A 1 74  ? -3.912  0.305   24.614  1.00 34.84 ? 75  GLU A O   1 
ATOM   584  C  CB  . GLU A 1 74  ? -2.098  -0.571  22.232  1.00 35.58 ? 75  GLU A CB  1 
ATOM   585  C  CG  . GLU A 1 74  ? -0.662  -0.795  22.652  1.00 36.29 ? 75  GLU A CG  1 
ATOM   586  C  CD  . GLU A 1 74  ? 0.312   -0.298  21.616  1.00 36.35 ? 75  GLU A CD  1 
ATOM   587  O  OE1 . GLU A 1 74  ? 0.622   0.915   21.617  1.00 36.32 ? 75  GLU A OE1 1 
ATOM   588  O  OE2 . GLU A 1 74  ? 0.758   -1.126  20.800  1.00 36.57 ? 75  GLU A OE2 1 
ATOM   589  N  N   . GLY A 1 75  ? -2.577  -1.340  25.411  1.00 34.07 ? 76  GLY A N   1 
ATOM   590  C  CA  . GLY A 1 75  ? -2.510  -0.826  26.770  1.00 33.50 ? 76  GLY A CA  1 
ATOM   591  C  C   . GLY A 1 75  ? -1.463  0.264   26.938  1.00 32.86 ? 76  GLY A C   1 
ATOM   592  O  O   . GLY A 1 75  ? -0.758  0.603   25.979  1.00 33.15 ? 76  GLY A O   1 
ATOM   593  N  N   . PRO A 1 76  ? -1.351  0.822   28.159  1.00 32.16 ? 77  PRO A N   1 
ATOM   594  C  CA  . PRO A 1 76  ? -0.411  1.916   28.428  1.00 31.47 ? 77  PRO A CA  1 
ATOM   595  C  C   . PRO A 1 76  ? 1.070   1.513   28.348  1.00 30.75 ? 77  PRO A C   1 
ATOM   596  O  O   . PRO A 1 76  ? 1.910   2.347   27.990  1.00 30.91 ? 77  PRO A O   1 
ATOM   597  C  CB  . PRO A 1 76  ? -0.773  2.355   29.856  1.00 31.72 ? 77  PRO A CB  1 
ATOM   598  C  CG  . PRO A 1 76  ? -1.474  1.183   30.462  1.00 31.81 ? 77  PRO A CG  1 
ATOM   599  C  CD  . PRO A 1 76  ? -2.191  0.510   29.334  1.00 32.03 ? 77  PRO A CD  1 
ATOM   600  N  N   . ASN A 1 77  ? 1.380   0.261   28.681  1.00 29.51 ? 78  ASN A N   1 
ATOM   601  C  CA  . ASN A 1 77  ? 2.759   -0.249  28.648  1.00 28.31 ? 78  ASN A CA  1 
ATOM   602  C  C   . ASN A 1 77  ? 2.913   -1.452  27.704  1.00 27.06 ? 78  ASN A C   1 
ATOM   603  O  O   . ASN A 1 77  ? 3.024   -2.588  28.162  1.00 26.79 ? 78  ASN A O   1 
ATOM   604  C  CB  . ASN A 1 77  ? 3.221   -0.631  30.058  1.00 28.59 ? 78  ASN A CB  1 
ATOM   605  C  CG  . ASN A 1 77  ? 3.179   0.541   31.040  1.00 29.39 ? 78  ASN A CG  1 
ATOM   606  O  OD1 . ASN A 1 77  ? 3.853   1.559   30.857  1.00 30.90 ? 78  ASN A OD1 1 
ATOM   607  N  ND2 . ASN A 1 77  ? 2.391   0.390   32.091  1.00 29.82 ? 78  ASN A ND2 1 
ATOM   608  N  N   . PRO A 1 78  ? 2.941   -1.203  26.379  1.00 25.92 ? 79  PRO A N   1 
ATOM   609  C  CA  . PRO A 1 78  ? 2.956   -2.299  25.408  1.00 25.00 ? 79  PRO A CA  1 
ATOM   610  C  C   . PRO A 1 78  ? 4.236   -3.126  25.471  1.00 24.21 ? 79  PRO A C   1 
ATOM   611  O  O   . PRO A 1 78  ? 5.295   -2.623  25.847  1.00 24.03 ? 79  PRO A O   1 
ATOM   612  C  CB  . PRO A 1 78  ? 2.863   -1.588  24.049  1.00 25.01 ? 79  PRO A CB  1 
ATOM   613  C  CG  . PRO A 1 78  ? 2.682   -0.143  24.337  1.00 25.40 ? 79  PRO A CG  1 
ATOM   614  C  CD  . PRO A 1 78  ? 3.133   0.104   25.733  1.00 25.74 ? 79  PRO A CD  1 
ATOM   615  N  N   . GLU A 1 79  ? 4.115   -4.398  25.114  1.00 23.28 ? 80  GLU A N   1 
ATOM   616  C  CA  . GLU A 1 79  ? 5.248   -5.303  25.059  1.00 22.42 ? 80  GLU A CA  1 
ATOM   617  C  C   . GLU A 1 79  ? 5.296   -5.939  23.677  1.00 21.02 ? 80  GLU A C   1 
ATOM   618  O  O   . GLU A 1 79  ? 4.270   -6.372  23.150  1.00 20.36 ? 80  GLU A O   1 
ATOM   619  C  CB  . GLU A 1 79  ? 5.128   -6.381  26.140  1.00 22.99 ? 80  GLU A CB  1 
ATOM   620  C  CG  . GLU A 1 79  ? 5.040   -5.826  27.569  1.00 25.42 ? 80  GLU A CG  1 
ATOM   621  C  CD  . GLU A 1 79  ? 4.629   -6.881  28.580  1.00 30.56 ? 80  GLU A CD  1 
ATOM   622  O  OE1 . GLU A 1 79  ? 5.450   -7.785  28.875  1.00 32.40 ? 80  GLU A OE1 1 
ATOM   623  O  OE2 . GLU A 1 79  ? 3.478   -6.806  29.082  1.00 32.99 ? 80  GLU A OE2 1 
ATOM   624  N  N   . ARG A 1 80  ? 6.484   -5.954  23.084  1.00 19.52 ? 81  ARG A N   1 
ATOM   625  C  CA  . ARG A 1 80  ? 6.702   -6.647  21.824  1.00 18.66 ? 81  ARG A CA  1 
ATOM   626  C  C   . ARG A 1 80  ? 7.416   -7.963  22.140  1.00 18.49 ? 81  ARG A C   1 
ATOM   627  O  O   . ARG A 1 80  ? 7.664   -8.265  23.307  1.00 18.53 ? 81  ARG A O   1 
ATOM   628  C  CB  . ARG A 1 80  ? 7.543   -5.790  20.876  1.00 18.01 ? 81  ARG A CB  1 
ATOM   629  C  CG  . ARG A 1 80  ? 8.994   -5.616  21.312  1.00 17.18 ? 81  ARG A CG  1 
ATOM   630  C  CD  . ARG A 1 80  ? 9.835   -4.922  20.251  1.00 15.00 ? 81  ARG A CD  1 
ATOM   631  N  NE  . ARG A 1 80  ? 9.502   -3.506  20.138  1.00 14.00 ? 81  ARG A NE  1 
ATOM   632  C  CZ  . ARG A 1 80  ? 10.019  -2.538  20.891  1.00 12.79 ? 81  ARG A CZ  1 
ATOM   633  N  NH1 . ARG A 1 80  ? 10.892  -2.813  21.850  1.00 10.10 ? 81  ARG A NH1 1 
ATOM   634  N  NH2 . ARG A 1 80  ? 9.649   -1.280  20.681  1.00 12.41 ? 81  ARG A NH2 1 
ATOM   635  N  N   . PHE A 1 81  ? 7.751   -8.724  21.104  1.00 18.38 ? 82  PHE A N   1 
ATOM   636  C  CA  . PHE A 1 81  ? 8.542   -9.937  21.246  1.00 18.15 ? 82  PHE A CA  1 
ATOM   637  C  C   . PHE A 1 81  ? 9.990   -9.616  21.604  1.00 18.49 ? 82  PHE A C   1 
ATOM   638  O  O   . PHE A 1 81  ? 10.657  -8.806  20.928  1.00 18.33 ? 82  PHE A O   1 
ATOM   639  C  CB  . PHE A 1 81  ? 8.488   -10.766 19.957  1.00 18.44 ? 82  PHE A CB  1 
ATOM   640  C  CG  . PHE A 1 81  ? 9.242   -12.066 20.040  1.00 17.83 ? 82  PHE A CG  1 
ATOM   641  C  CD1 . PHE A 1 81  ? 8.756   -13.121 20.822  1.00 17.20 ? 82  PHE A CD1 1 
ATOM   642  C  CD2 . PHE A 1 81  ? 10.440  -12.237 19.343  1.00 17.72 ? 82  PHE A CD2 1 
ATOM   643  C  CE1 . PHE A 1 81  ? 9.457   -14.326 20.913  1.00 17.38 ? 82  PHE A CE1 1 
ATOM   644  C  CE2 . PHE A 1 81  ? 11.154  -13.447 19.427  1.00 18.23 ? 82  PHE A CE2 1 
ATOM   645  C  CZ  . PHE A 1 81  ? 10.660  -14.489 20.217  1.00 16.59 ? 82  PHE A CZ  1 
ATOM   646  N  N   . LEU A 1 82  ? 10.468  -10.262 22.671  1.00 18.04 ? 83  LEU A N   1 
ATOM   647  C  CA  . LEU A 1 82  ? 11.848  -10.112 23.126  1.00 17.58 ? 83  LEU A CA  1 
ATOM   648  C  C   . LEU A 1 82  ? 12.721  -11.195 22.504  1.00 17.27 ? 83  LEU A C   1 
ATOM   649  O  O   . LEU A 1 82  ? 12.364  -12.375 22.531  1.00 16.85 ? 83  LEU A O   1 
ATOM   650  C  CB  . LEU A 1 82  ? 11.933  -10.175 24.656  1.00 17.46 ? 83  LEU A CB  1 
ATOM   651  C  CG  . LEU A 1 82  ? 11.194  -9.104  25.477  1.00 18.61 ? 83  LEU A CG  1 
ATOM   652  C  CD1 . LEU A 1 82  ? 11.099  -9.526  26.959  1.00 17.76 ? 83  LEU A CD1 1 
ATOM   653  C  CD2 . LEU A 1 82  ? 11.890  -7.750  25.343  1.00 18.23 ? 83  LEU A CD2 1 
ATOM   654  N  N   . ILE A 1 83  ? 13.859  -10.782 21.944  1.00 16.86 ? 84  ILE A N   1 
ATOM   655  C  CA  . ILE A 1 83  ? 14.814  -11.701 21.325  1.00 16.53 ? 84  ILE A CA  1 
ATOM   656  C  C   . ILE A 1 83  ? 15.525  -12.537 22.411  1.00 16.40 ? 84  ILE A C   1 
ATOM   657  O  O   . ILE A 1 83  ? 16.304  -12.005 23.196  1.00 16.34 ? 84  ILE A O   1 
ATOM   658  C  CB  . ILE A 1 83  ? 15.860  -10.944 20.457  1.00 16.62 ? 84  ILE A CB  1 
ATOM   659  C  CG1 . ILE A 1 83  ? 15.181  -9.958  19.472  1.00 16.28 ? 84  ILE A CG1 1 
ATOM   660  C  CG2 . ILE A 1 83  ? 16.784  -11.932 19.737  1.00 16.00 ? 84  ILE A CG2 1 
ATOM   661  C  CD1 . ILE A 1 83  ? 14.428  -10.612 18.301  1.00 16.66 ? 84  ILE A CD1 1 
ATOM   662  N  N   . PRO A 1 84  ? 15.264  -13.854 22.447  1.00 16.34 ? 85  PRO A N   1 
ATOM   663  C  CA  . PRO A 1 84  ? 15.765  -14.670 23.569  1.00 16.40 ? 85  PRO A CA  1 
ATOM   664  C  C   . PRO A 1 84  ? 17.292  -14.694 23.759  1.00 15.95 ? 85  PRO A C   1 
ATOM   665  O  O   . PRO A 1 84  ? 17.737  -14.612 24.899  1.00 16.39 ? 85  PRO A O   1 
ATOM   666  C  CB  . PRO A 1 84  ? 15.206  -16.076 23.268  1.00 16.71 ? 85  PRO A CB  1 
ATOM   667  C  CG  . PRO A 1 84  ? 14.011  -15.814 22.393  1.00 16.55 ? 85  PRO A CG  1 
ATOM   668  C  CD  . PRO A 1 84  ? 14.421  -14.645 21.532  1.00 15.98 ? 85  PRO A CD  1 
ATOM   669  N  N   . PRO A 1 85  ? 18.095  -14.795 22.674  1.00 16.05 ? 86  PRO A N   1 
ATOM   670  C  CA  . PRO A 1 85  ? 19.536  -14.692 22.953  1.00 15.95 ? 86  PRO A CA  1 
ATOM   671  C  C   . PRO A 1 85  ? 19.948  -13.355 23.567  1.00 15.74 ? 86  PRO A C   1 
ATOM   672  O  O   . PRO A 1 85  ? 20.885  -13.328 24.353  1.00 15.94 ? 86  PRO A O   1 
ATOM   673  C  CB  . PRO A 1 85  ? 20.200  -14.863 21.570  1.00 15.63 ? 86  PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 85  ? 19.123  -14.620 20.583  1.00 16.26 ? 86  PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 85  ? 17.845  -15.073 21.245  1.00 15.79 ? 86  PRO A CD  1 
ATOM   676  N  N   . TRP A 1 86  ? 19.270  -12.267 23.208  1.00 15.56 ? 87  TRP A N   1 
ATOM   677  C  CA  . TRP A 1 86  ? 19.569  -10.943 23.799  1.00 15.96 ? 87  TRP A CA  1 
ATOM   678  C  C   . TRP A 1 86  ? 19.238  -10.941 25.279  1.00 16.11 ? 87  TRP A C   1 
ATOM   679  O  O   . TRP A 1 86  ? 20.031  -10.463 26.084  1.00 16.27 ? 87  TRP A O   1 
ATOM   680  C  CB  . TRP A 1 86  ? 18.802  -9.808  23.088  1.00 15.04 ? 87  TRP A CB  1 
ATOM   681  C  CG  . TRP A 1 86  ? 19.168  -9.627  21.628  1.00 15.11 ? 87  TRP A CG  1 
ATOM   682  C  CD1 . TRP A 1 86  ? 19.992  -10.418 20.883  1.00 15.58 ? 87  TRP A CD1 1 
ATOM   683  C  CD2 . TRP A 1 86  ? 18.676  -8.614  20.739  1.00 15.12 ? 87  TRP A CD2 1 
ATOM   684  N  NE1 . TRP A 1 86  ? 20.067  -9.946  19.592  1.00 16.51 ? 87  TRP A NE1 1 
ATOM   685  C  CE2 . TRP A 1 86  ? 19.261  -8.845  19.475  1.00 15.95 ? 87  TRP A CE2 1 
ATOM   686  C  CE3 . TRP A 1 86  ? 17.798  -7.534  20.889  1.00 15.94 ? 87  TRP A CE3 1 
ATOM   687  C  CZ2 . TRP A 1 86  ? 18.999  -8.036  18.367  1.00 14.91 ? 87  TRP A CZ2 1 
ATOM   688  C  CZ3 . TRP A 1 86  ? 17.535  -6.726  19.779  1.00 17.37 ? 87  TRP A CZ3 1 
ATOM   689  C  CH2 . TRP A 1 86  ? 18.139  -6.985  18.536  1.00 16.24 ? 87  TRP A CH2 1 
ATOM   690  N  N   . VAL A 1 87  ? 18.061  -11.471 25.623  1.00 16.97 ? 88  VAL A N   1 
ATOM   691  C  CA  . VAL A 1 87  ? 17.607  -11.553 27.019  1.00 17.88 ? 88  VAL A CA  1 
ATOM   692  C  C   . VAL A 1 87  ? 18.550  -12.437 27.834  1.00 18.17 ? 88  VAL A C   1 
ATOM   693  O  O   . VAL A 1 87  ? 19.044  -12.025 28.886  1.00 19.11 ? 88  VAL A O   1 
ATOM   694  C  CB  . VAL A 1 87  ? 16.147  -12.078 27.119  1.00 18.03 ? 88  VAL A CB  1 
ATOM   695  C  CG1 . VAL A 1 87  ? 15.771  -12.405 28.577  1.00 17.60 ? 88  VAL A CG1 1 
ATOM   696  C  CG2 . VAL A 1 87  ? 15.182  -11.068 26.529  1.00 18.39 ? 88  VAL A CG2 1 
ATOM   697  N  N   . ALA A 1 88  ? 18.826  -13.635 27.333  1.00 18.71 ? 89  ALA A N   1 
ATOM   698  C  CA  . ALA A 1 88  ? 19.700  -14.575 28.042  1.00 19.09 ? 89  ALA A CA  1 
ATOM   699  C  C   . ALA A 1 88  ? 21.075  -13.989 28.316  1.00 19.62 ? 89  ALA A C   1 
ATOM   700  O  O   . ALA A 1 88  ? 21.606  -14.150 29.418  1.00 19.97 ? 89  ALA A O   1 
ATOM   701  C  CB  . ALA A 1 88  ? 19.819  -15.881 27.285  1.00 19.02 ? 89  ALA A CB  1 
ATOM   702  N  N   . TYR A 1 89  ? 21.650  -13.302 27.324  1.00 19.72 ? 90  TYR A N   1 
ATOM   703  C  CA  . TYR A 1 89  ? 22.951  -12.676 27.510  1.00 20.05 ? 90  TYR A CA  1 
ATOM   704  C  C   . TYR A 1 89  ? 22.943  -11.645 28.652  1.00 20.65 ? 90  TYR A C   1 
ATOM   705  O  O   . TYR A 1 89  ? 23.837  -11.647 29.494  1.00 20.59 ? 90  TYR A O   1 
ATOM   706  C  CB  . TYR A 1 89  ? 23.470  -12.039 26.215  1.00 19.62 ? 90  TYR A CB  1 
ATOM   707  C  CG  . TYR A 1 89  ? 24.671  -11.156 26.463  1.00 18.86 ? 90  TYR A CG  1 
ATOM   708  C  CD1 . TYR A 1 89  ? 25.961  -11.690 26.505  1.00 17.46 ? 90  TYR A CD1 1 
ATOM   709  C  CD2 . TYR A 1 89  ? 24.513  -9.786  26.695  1.00 17.43 ? 90  TYR A CD2 1 
ATOM   710  C  CE1 . TYR A 1 89  ? 27.064  -10.874 26.762  1.00 18.04 ? 90  TYR A CE1 1 
ATOM   711  C  CE2 . TYR A 1 89  ? 25.601  -8.971  26.948  1.00 18.46 ? 90  TYR A CE2 1 
ATOM   712  C  CZ  . TYR A 1 89  ? 26.870  -9.515  26.981  1.00 17.72 ? 90  TYR A CZ  1 
ATOM   713  O  OH  . TYR A 1 89  ? 27.934  -8.693  27.224  1.00 18.96 ? 90  TYR A OH  1 
ATOM   714  N  N   . HIS A 1 90  ? 21.945  -10.767 28.668  1.00 21.57 ? 91  HIS A N   1 
ATOM   715  C  CA  . HIS A 1 90  ? 21.864  -9.718  29.685  1.00 22.97 ? 91  HIS A CA  1 
ATOM   716  C  C   . HIS A 1 90  ? 21.634  -10.308 31.073  1.00 24.03 ? 91  HIS A C   1 
ATOM   717  O  O   . HIS A 1 90  ? 22.226  -9.845  32.041  1.00 23.75 ? 91  HIS A O   1 
ATOM   718  C  CB  . HIS A 1 90  ? 20.759  -8.700  29.365  1.00 22.83 ? 91  HIS A CB  1 
ATOM   719  C  CG  . HIS A 1 90  ? 21.104  -7.757  28.255  1.00 22.72 ? 91  HIS A CG  1 
ATOM   720  N  ND1 . HIS A 1 90  ? 21.023  -8.112  26.927  1.00 23.74 ? 91  HIS A ND1 1 
ATOM   721  C  CD2 . HIS A 1 90  ? 21.517  -6.468  28.275  1.00 22.77 ? 91  HIS A CD2 1 
ATOM   722  C  CE1 . HIS A 1 90  ? 21.375  -7.084  26.176  1.00 23.24 ? 91  HIS A CE1 1 
ATOM   723  N  NE2 . HIS A 1 90  ? 21.683  -6.076  26.970  1.00 23.10 ? 91  HIS A NE2 1 
ATOM   724  N  N   . GLN A 1 91  ? 20.776  -11.326 31.157  1.00 25.50 ? 92  GLN A N   1 
ATOM   725  C  CA  . GLN A 1 91  ? 20.478  -11.984 32.432  1.00 26.91 ? 92  GLN A CA  1 
ATOM   726  C  C   . GLN A 1 91  ? 21.683  -12.772 32.937  1.00 27.68 ? 92  GLN A C   1 
ATOM   727  O  O   . GLN A 1 91  ? 22.132  -12.567 34.074  1.00 28.03 ? 92  GLN A O   1 
ATOM   728  C  CB  . GLN A 1 91  ? 19.226  -12.873 32.335  1.00 26.77 ? 92  GLN A CB  1 
ATOM   729  C  CG  . GLN A 1 91  ? 17.913  -12.069 32.343  1.00 29.08 ? 92  GLN A CG  1 
ATOM   730  C  CD  . GLN A 1 91  ? 16.641  -12.913 32.159  1.00 31.62 ? 92  GLN A CD  1 
ATOM   731  O  OE1 . GLN A 1 91  ? 16.697  -14.123 31.901  1.00 33.54 ? 92  GLN A OE1 1 
ATOM   732  N  NE2 . GLN A 1 91  ? 15.482  -12.260 32.280  1.00 31.08 ? 92  GLN A NE2 1 
ATOM   733  N  N   . TYR A 1 92  ? 22.224  -13.647 32.094  1.00 28.38 ? 93  TYR A N   1 
ATOM   734  C  CA  . TYR A 1 92  ? 23.338  -14.495 32.515  1.00 29.22 ? 93  TYR A CA  1 
ATOM   735  C  C   . TYR A 1 92  ? 24.578  -13.682 32.894  1.00 29.25 ? 93  TYR A C   1 
ATOM   736  O  O   . TYR A 1 92  ? 25.147  -13.890 33.967  1.00 29.05 ? 93  TYR A O   1 
ATOM   737  C  CB  . TYR A 1 92  ? 23.677  -15.565 31.467  1.00 29.50 ? 93  TYR A CB  1 
ATOM   738  C  CG  . TYR A 1 92  ? 24.687  -16.577 31.965  1.00 32.00 ? 93  TYR A CG  1 
ATOM   739  C  CD1 . TYR A 1 92  ? 24.286  -17.670 32.745  1.00 33.71 ? 93  TYR A CD1 1 
ATOM   740  C  CD2 . TYR A 1 92  ? 26.050  -16.437 31.679  1.00 33.89 ? 93  TYR A CD2 1 
ATOM   741  C  CE1 . TYR A 1 92  ? 25.216  -18.603 33.216  1.00 34.41 ? 93  TYR A CE1 1 
ATOM   742  C  CE2 . TYR A 1 92  ? 26.990  -17.369 32.149  1.00 34.87 ? 93  TYR A CE2 1 
ATOM   743  C  CZ  . TYR A 1 92  ? 26.560  -18.444 32.915  1.00 35.70 ? 93  TYR A CZ  1 
ATOM   744  O  OH  . TYR A 1 92  ? 27.476  -19.365 33.376  1.00 37.75 ? 93  TYR A OH  1 
ATOM   745  N  N   . TYR A 1 93  ? 24.976  -12.747 32.028  1.00 29.12 ? 94  TYR A N   1 
ATOM   746  C  CA  . TYR A 1 93  ? 26.153  -11.922 32.291  1.00 29.46 ? 94  TYR A CA  1 
ATOM   747  C  C   . TYR A 1 93  ? 25.848  -10.650 33.092  1.00 29.58 ? 94  TYR A C   1 
ATOM   748  O  O   . TYR A 1 93  ? 26.703  -9.769  33.226  1.00 29.83 ? 94  TYR A O   1 
ATOM   749  C  CB  . TYR A 1 93  ? 26.917  -11.630 30.995  1.00 29.39 ? 94  TYR A CB  1 
ATOM   750  C  CG  . TYR A 1 93  ? 27.536  -12.874 30.402  1.00 30.33 ? 94  TYR A CG  1 
ATOM   751  C  CD1 . TYR A 1 93  ? 26.861  -13.620 29.434  1.00 30.16 ? 94  TYR A CD1 1 
ATOM   752  C  CD2 . TYR A 1 93  ? 28.784  -13.335 30.838  1.00 31.42 ? 94  TYR A CD2 1 
ATOM   753  C  CE1 . TYR A 1 93  ? 27.418  -14.777 28.899  1.00 30.75 ? 94  TYR A CE1 1 
ATOM   754  C  CE2 . TYR A 1 93  ? 29.352  -14.494 30.301  1.00 31.25 ? 94  TYR A CE2 1 
ATOM   755  C  CZ  . TYR A 1 93  ? 28.661  -15.206 29.332  1.00 30.88 ? 94  TYR A CZ  1 
ATOM   756  O  OH  . TYR A 1 93  ? 29.209  -16.348 28.796  1.00 31.43 ? 94  TYR A OH  1 
ATOM   757  N  N   . GLN A 1 94  ? 24.637  -10.580 33.643  1.00 29.80 ? 95  GLN A N   1 
ATOM   758  C  CA  . GLN A 1 94  ? 24.209  -9.474  34.517  1.00 30.34 ? 95  GLN A CA  1 
ATOM   759  C  C   . GLN A 1 94  ? 24.535  -8.066  33.982  1.00 29.75 ? 95  GLN A C   1 
ATOM   760  O  O   . GLN A 1 94  ? 25.137  -7.246  34.686  1.00 30.13 ? 95  GLN A O   1 
ATOM   761  C  CB  . GLN A 1 94  ? 24.783  -9.646  35.932  1.00 30.75 ? 95  GLN A CB  1 
ATOM   762  C  CG  . GLN A 1 94  ? 24.225  -10.827 36.724  1.00 33.18 ? 95  GLN A CG  1 
ATOM   763  C  CD  . GLN A 1 94  ? 24.743  -10.847 38.158  1.00 36.62 ? 95  GLN A CD  1 
ATOM   764  O  OE1 . GLN A 1 94  ? 25.958  -10.928 38.394  1.00 37.75 ? 95  GLN A OE1 1 
ATOM   765  N  NE2 . GLN A 1 94  ? 23.825  -10.763 39.124  1.00 36.50 ? 95  GLN A NE2 1 
ATOM   766  N  N   . ARG A 1 95  ? 24.135  -7.787  32.745  1.00 28.99 ? 96  ARG A N   1 
ATOM   767  C  CA  . ARG A 1 95  ? 24.347  -6.471  32.157  1.00 28.37 ? 96  ARG A CA  1 
ATOM   768  C  C   . ARG A 1 95  ? 23.118  -5.608  32.398  1.00 27.73 ? 96  ARG A C   1 
ATOM   769  O  O   . ARG A 1 95  ? 21.997  -6.091  32.277  1.00 27.85 ? 96  ARG A O   1 
ATOM   770  C  CB  . ARG A 1 95  ? 24.612  -6.583  30.657  1.00 28.63 ? 96  ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 95  ? 25.711  -7.556  30.284  1.00 29.74 ? 96  ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 95  ? 27.085  -6.902  30.166  1.00 31.49 ? 96  ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 95  ? 28.114  -7.926  30.311  1.00 34.44 ? 96  ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 95  ? 29.427  -7.720  30.254  1.00 36.25 ? 96  ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 95  ? 29.912  -6.497  30.043  1.00 36.18 ? 96  ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 95  ? 30.258  -8.752  30.411  1.00 35.49 ? 96  ARG A NH2 1 
ATOM   777  N  N   . PRO A 1 96  ? 23.317  -4.325  32.747  1.00 27.18 ? 97  PRO A N   1 
ATOM   778  C  CA  . PRO A 1 96  ? 22.135  -3.491  32.949  1.00 26.56 ? 97  PRO A CA  1 
ATOM   779  C  C   . PRO A 1 96  ? 21.368  -3.328  31.641  1.00 25.90 ? 97  PRO A C   1 
ATOM   780  O  O   . PRO A 1 96  ? 21.975  -3.170  30.576  1.00 25.47 ? 97  PRO A O   1 
ATOM   781  C  CB  . PRO A 1 96  ? 22.705  -2.153  33.429  1.00 26.71 ? 97  PRO A CB  1 
ATOM   782  C  CG  . PRO A 1 96  ? 24.148  -2.176  33.042  1.00 27.31 ? 97  PRO A CG  1 
ATOM   783  C  CD  . PRO A 1 96  ? 24.579  -3.596  32.978  1.00 27.09 ? 97  PRO A CD  1 
ATOM   784  N  N   . ILE A 1 97  ? 20.045  -3.400  31.737  1.00 25.14 ? 98  ILE A N   1 
ATOM   785  C  CA  . ILE A 1 97  ? 19.181  -3.336  30.575  1.00 24.48 ? 98  ILE A CA  1 
ATOM   786  C  C   . ILE A 1 97  ? 18.652  -1.924  30.382  1.00 24.15 ? 98  ILE A C   1 
ATOM   787  O  O   . ILE A 1 97  ? 18.488  -1.162  31.341  1.00 24.18 ? 98  ILE A O   1 
ATOM   788  C  CB  . ILE A 1 97  ? 18.000  -4.355  30.656  1.00 24.40 ? 98  ILE A CB  1 
ATOM   789  C  CG1 . ILE A 1 97  ? 17.099  -4.074  31.868  1.00 22.94 ? 98  ILE A CG1 1 
ATOM   790  C  CG2 . ILE A 1 97  ? 18.535  -5.799  30.646  1.00 24.31 ? 98  ILE A CG2 1 
ATOM   791  C  CD1 . ILE A 1 97  ? 15.985  -5.089  32.073  1.00 21.28 ? 98  ILE A CD1 1 
ATOM   792  N  N   . GLY A 1 98  ? 18.401  -1.582  29.126  1.00 23.52 ? 99  GLY A N   1 
ATOM   793  C  CA  . GLY A 1 98  ? 17.803  -0.312  28.796  1.00 22.36 ? 99  GLY A CA  1 
ATOM   794  C  C   . GLY A 1 98  ? 16.349  -0.493  28.418  1.00 22.08 ? 99  GLY A C   1 
ATOM   795  O  O   . GLY A 1 98  ? 15.726  -1.527  28.691  1.00 21.82 ? 99  GLY A O   1 
ATOM   796  N  N   . VAL A 1 99  ? 15.822  0.528   27.764  1.00 21.26 ? 100 VAL A N   1 
ATOM   797  C  CA  . VAL A 1 99  ? 14.413  0.621   27.455  1.00 20.71 ? 100 VAL A CA  1 
ATOM   798  C  C   . VAL A 1 99  ? 13.932  -0.567  26.594  1.00 20.58 ? 100 VAL A C   1 
ATOM   799  O  O   . VAL A 1 99  ? 12.809  -1.060  26.772  1.00 20.68 ? 100 VAL A O   1 
ATOM   800  C  CB  . VAL A 1 99  ? 14.132  2.019   26.843  1.00 20.84 ? 100 VAL A CB  1 
ATOM   801  C  CG1 . VAL A 1 99  ? 14.647  2.124   25.385  1.00 20.39 ? 100 VAL A CG1 1 
ATOM   802  C  CG2 . VAL A 1 99  ? 12.682  2.406   26.988  1.00 21.21 ? 100 VAL A CG2 1 
ATOM   803  N  N   . LEU A 1 100 ? 14.797  -1.054  25.705  1.00 20.00 ? 101 LEU A N   1 
ATOM   804  C  CA  . LEU A 1 100 ? 14.463  -2.180  24.827  1.00 19.88 ? 101 LEU A CA  1 
ATOM   805  C  C   . LEU A 1 100 ? 14.050  -3.459  25.564  1.00 20.01 ? 101 LEU A C   1 
ATOM   806  O  O   . LEU A 1 100 ? 13.215  -4.217  25.080  1.00 19.36 ? 101 LEU A O   1 
ATOM   807  C  CB  . LEU A 1 100 ? 15.636  -2.493  23.883  1.00 19.68 ? 101 LEU A CB  1 
ATOM   808  C  CG  . LEU A 1 100 ? 15.539  -3.761  23.016  1.00 19.39 ? 101 LEU A CG  1 
ATOM   809  C  CD1 . LEU A 1 100 ? 14.463  -3.604  21.949  1.00 19.16 ? 101 LEU A CD1 1 
ATOM   810  C  CD2 . LEU A 1 100 ? 16.885  -4.118  22.394  1.00 17.97 ? 101 LEU A CD2 1 
ATOM   811  N  N   . LEU A 1 101 ? 14.657  -3.708  26.715  1.00 20.27 ? 102 LEU A N   1 
ATOM   812  C  CA  . LEU A 1 101 ? 14.436  -4.968  27.409  1.00 21.46 ? 102 LEU A CA  1 
ATOM   813  C  C   . LEU A 1 101 ? 13.585  -4.839  28.672  1.00 21.84 ? 102 LEU A C   1 
ATOM   814  O  O   . LEU A 1 101 ? 13.303  -5.836  29.325  1.00 22.66 ? 102 LEU A O   1 
ATOM   815  C  CB  . LEU A 1 101 ? 15.770  -5.648  27.719  1.00 21.31 ? 102 LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 101 ? 16.601  -6.088  26.508  1.00 22.23 ? 102 LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 101 ? 17.898  -6.696  26.980  1.00 23.20 ? 102 LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 101 ? 15.845  -7.074  25.610  1.00 22.94 ? 102 LEU A CD2 1 
ATOM   819  N  N   . LYS A 1 102 ? 13.183  -3.613  28.996  1.00 22.29 ? 103 LYS A N   1 
ATOM   820  C  CA  . LYS A 1 102 ? 12.323  -3.335  30.143  1.00 22.68 ? 103 LYS A CA  1 
ATOM   821  C  C   . LYS A 1 102 ? 10.843  -3.463  29.793  1.00 23.12 ? 103 LYS A C   1 
ATOM   822  O  O   . LYS A 1 102 ? 10.475  -3.541  28.616  1.00 23.33 ? 103 LYS A O   1 
ATOM   823  C  CB  . LYS A 1 102 ? 12.623  -1.939  30.703  1.00 22.64 ? 103 LYS A CB  1 
ATOM   824  C  CG  . LYS A 1 102 ? 13.955  -1.852  31.429  1.00 22.03 ? 103 LYS A CG  1 
ATOM   825  C  CD  . LYS A 1 102 ? 14.163  -0.497  32.084  1.00 22.99 ? 103 LYS A CD  1 
ATOM   826  C  CE  . LYS A 1 102 ? 15.497  -0.471  32.807  1.00 22.65 ? 103 LYS A CE  1 
ATOM   827  N  NZ  . LYS A 1 102 ? 15.884  0.895   33.218  1.00 23.20 ? 103 LYS A NZ  1 
ATOM   828  N  N   . LYS A 1 103 ? 10.003  -3.508  30.824  1.00 23.80 ? 104 LYS A N   1 
ATOM   829  C  CA  . LYS A 1 103 ? 8.546   -3.556  30.666  1.00 24.82 ? 104 LYS A CA  1 
ATOM   830  C  C   . LYS A 1 103 ? 7.842   -2.716  31.741  1.00 24.74 ? 104 LYS A C   1 
ATOM   831  O  O   . LYS A 1 103 ? 8.487   -2.222  32.666  1.00 24.30 ? 104 LYS A O   1 
ATOM   832  C  CB  . LYS A 1 103 ? 8.028   -5.003  30.687  1.00 24.92 ? 104 LYS A CB  1 
ATOM   833  C  CG  . LYS A 1 103 ? 8.346   -5.772  31.959  1.00 27.63 ? 104 LYS A CG  1 
ATOM   834  C  CD  . LYS A 1 103 ? 7.711   -7.155  31.957  1.00 31.19 ? 104 LYS A CD  1 
ATOM   835  C  CE  . LYS A 1 103 ? 8.327   -8.030  33.037  1.00 34.18 ? 104 LYS A CE  1 
ATOM   836  N  NZ  . LYS A 1 103 ? 7.992   -9.479  32.829  1.00 36.79 ? 104 LYS A NZ  1 
ATOM   837  N  N   . SER A 1 104 ? 6.526   -2.562  31.582  1.00 25.21 ? 105 SER A N   1 
ATOM   838  C  CA  . SER A 1 104 ? 5.643   -1.815  32.490  1.00 25.81 ? 105 SER A CA  1 
ATOM   839  C  C   . SER A 1 104 ? 6.225   -0.489  32.997  1.00 25.85 ? 105 SER A C   1 
ATOM   840  O  O   . SER A 1 104 ? 6.790   0.289   32.209  1.00 25.85 ? 105 SER A O   1 
ATOM   841  C  CB  . SER A 1 104 ? 5.147   -2.707  33.648  1.00 26.10 ? 105 SER A CB  1 
ATOM   842  O  OG  . SER A 1 104 ? 6.197   -3.012  34.549  1.00 27.68 ? 105 SER A OG  1 
ATOM   843  N  N   . ALA A 1 105 ? 6.101   -0.251  34.304  1.00 25.56 ? 106 ALA A N   1 
ATOM   844  C  CA  . ALA A 1 105 ? 6.419   1.048   34.905  1.00 25.49 ? 106 ALA A CA  1 
ATOM   845  C  C   . ALA A 1 105 ? 7.891   1.419   34.770  1.00 25.17 ? 106 ALA A C   1 
ATOM   846  O  O   . ALA A 1 105 ? 8.220   2.595   34.612  1.00 25.14 ? 106 ALA A O   1 
ATOM   847  C  CB  . ALA A 1 105 ? 5.986   1.085   36.384  1.00 25.46 ? 106 ALA A CB  1 
ATOM   848  N  N   . ALA A 1 106 ? 8.767   0.415   34.837  1.00 24.53 ? 107 ALA A N   1 
ATOM   849  C  CA  . ALA A 1 106 ? 10.197  0.638   34.689  1.00 24.24 ? 107 ALA A CA  1 
ATOM   850  C  C   . ALA A 1 106 ? 10.553  1.066   33.258  1.00 23.96 ? 107 ALA A C   1 
ATOM   851  O  O   . ALA A 1 106 ? 11.450  1.888   33.065  1.00 23.77 ? 107 ALA A O   1 
ATOM   852  C  CB  . ALA A 1 106 ? 10.984  -0.590  35.106  1.00 24.13 ? 107 ALA A CB  1 
ATOM   853  N  N   . TRP A 1 107 ? 9.849   0.511   32.269  1.00 23.73 ? 108 TRP A N   1 
ATOM   854  C  CA  . TRP A 1 107 ? 10.032  0.912   30.875  1.00 23.56 ? 108 TRP A CA  1 
ATOM   855  C  C   . TRP A 1 107 ? 9.564   2.351   30.675  1.00 24.28 ? 108 TRP A C   1 
ATOM   856  O  O   . TRP A 1 107 ? 10.238  3.136   30.016  1.00 24.03 ? 108 TRP A O   1 
ATOM   857  C  CB  . TRP A 1 107 ? 9.287   -0.016  29.898  1.00 22.90 ? 108 TRP A CB  1 
ATOM   858  C  CG  . TRP A 1 107 ? 9.158   0.608   28.526  1.00 21.19 ? 108 TRP A CG  1 
ATOM   859  C  CD1 . TRP A 1 107 ? 10.106  0.616   27.533  1.00 19.30 ? 108 TRP A CD1 1 
ATOM   860  C  CD2 . TRP A 1 107 ? 8.046   1.363   28.023  1.00 19.67 ? 108 TRP A CD2 1 
ATOM   861  N  NE1 . TRP A 1 107 ? 9.645   1.312   26.445  1.00 18.81 ? 108 TRP A NE1 1 
ATOM   862  C  CE2 . TRP A 1 107 ? 8.386   1.784   26.716  1.00 19.12 ? 108 TRP A CE2 1 
ATOM   863  C  CE3 . TRP A 1 107 ? 6.794   1.723   28.546  1.00 19.46 ? 108 TRP A CE3 1 
ATOM   864  C  CZ2 . TRP A 1 107 ? 7.519   2.544   25.926  1.00 17.22 ? 108 TRP A CZ2 1 
ATOM   865  C  CZ3 . TRP A 1 107 ? 5.929   2.474   27.755  1.00 17.84 ? 108 TRP A CZ3 1 
ATOM   866  C  CH2 . TRP A 1 107 ? 6.302   2.878   26.458  1.00 18.06 ? 108 TRP A CH2 1 
ATOM   867  N  N   . LYS A 1 108 ? 8.405   2.673   31.245  1.00 25.10 ? 109 LYS A N   1 
ATOM   868  C  CA  . LYS A 1 108 ? 7.785   3.989   31.111  1.00 26.43 ? 109 LYS A CA  1 
ATOM   869  C  C   . LYS A 1 108 ? 8.677   5.118   31.629  1.00 26.72 ? 109 LYS A C   1 
ATOM   870  O  O   . LYS A 1 108 ? 8.825   6.144   30.964  1.00 26.68 ? 109 LYS A O   1 
ATOM   871  C  CB  . LYS A 1 108 ? 6.429   4.013   31.827  1.00 26.74 ? 109 LYS A CB  1 
ATOM   872  C  CG  . LYS A 1 108 ? 5.666   5.328   31.696  1.00 28.90 ? 109 LYS A CG  1 
ATOM   873  C  CD  . LYS A 1 108 ? 5.175   5.559   30.274  1.00 31.47 ? 109 LYS A CD  1 
ATOM   874  C  CE  . LYS A 1 108 ? 4.252   6.766   30.205  1.00 33.77 ? 109 LYS A CE  1 
ATOM   875  N  NZ  . LYS A 1 108 ? 3.469   6.759   28.940  1.00 35.21 ? 109 LYS A NZ  1 
ATOM   876  N  N   . LYS A 1 109 ? 9.267   4.910   32.807  1.00 26.96 ? 110 LYS A N   1 
ATOM   877  C  CA  . LYS A 1 109 ? 10.169  5.882   33.425  1.00 27.45 ? 110 LYS A CA  1 
ATOM   878  C  C   . LYS A 1 109 ? 11.384  6.197   32.535  1.00 27.29 ? 110 LYS A C   1 
ATOM   879  O  O   . LYS A 1 109 ? 11.741  7.367   32.357  1.00 27.55 ? 110 LYS A O   1 
ATOM   880  C  CB  . LYS A 1 109 ? 10.616  5.373   34.796  1.00 27.83 ? 110 LYS A CB  1 
ATOM   881  C  CG  . LYS A 1 109 ? 11.418  6.366   35.615  1.00 29.22 ? 110 LYS A CG  1 
ATOM   882  C  CD  . LYS A 1 109 ? 11.898  5.719   36.907  1.00 31.80 ? 110 LYS A CD  1 
ATOM   883  C  CE  . LYS A 1 109 ? 12.840  6.636   37.655  1.00 33.30 ? 110 LYS A CE  1 
ATOM   884  N  NZ  . LYS A 1 109 ? 13.285  6.005   38.926  1.00 35.77 ? 110 LYS A NZ  1 
ATOM   885  N  N   . ASP A 1 110 ? 12.010  5.157   31.980  1.00 26.82 ? 111 ASP A N   1 
ATOM   886  C  CA  . ASP A 1 110 ? 13.097  5.329   31.012  1.00 26.18 ? 111 ASP A CA  1 
ATOM   887  C  C   . ASP A 1 110 ? 12.632  6.038   29.740  1.00 25.47 ? 111 ASP A C   1 
ATOM   888  O  O   . ASP A 1 110 ? 13.255  7.001   29.300  1.00 25.63 ? 111 ASP A O   1 
ATOM   889  C  CB  . ASP A 1 110 ? 13.729  3.985   30.650  1.00 26.46 ? 111 ASP A CB  1 
ATOM   890  C  CG  . ASP A 1 110 ? 14.858  3.585   31.593  1.00 28.13 ? 111 ASP A CG  1 
ATOM   891  O  OD1 . ASP A 1 110 ? 14.864  4.029   32.767  1.00 30.32 ? 111 ASP A OD1 1 
ATOM   892  O  OD2 . ASP A 1 110 ? 15.745  2.812   31.156  1.00 29.15 ? 111 ASP A OD2 1 
ATOM   893  N  N   . ARG A 1 111 ? 11.528  5.566   29.168  1.00 24.64 ? 112 ARG A N   1 
ATOM   894  C  CA  . ARG A 1 111 ? 11.031  6.075   27.896  1.00 23.96 ? 112 ARG A CA  1 
ATOM   895  C  C   . ARG A 1 111 ? 10.701  7.568   27.950  1.00 24.13 ? 112 ARG A C   1 
ATOM   896  O  O   . ARG A 1 111 ? 11.138  8.338   27.086  1.00 24.48 ? 112 ARG A O   1 
ATOM   897  C  CB  . ARG A 1 111 ? 9.828   5.256   27.406  1.00 23.15 ? 112 ARG A CB  1 
ATOM   898  C  CG  . ARG A 1 111 ? 9.375   5.585   25.983  1.00 21.46 ? 112 ARG A CG  1 
ATOM   899  C  CD  . ARG A 1 111 ? 10.479  5.343   24.938  1.00 19.95 ? 112 ARG A CD  1 
ATOM   900  N  NE  . ARG A 1 111 ? 10.114  5.914   23.640  1.00 17.61 ? 112 ARG A NE  1 
ATOM   901  C  CZ  . ARG A 1 111 ? 9.868   5.220   22.530  1.00 17.23 ? 112 ARG A CZ  1 
ATOM   902  N  NH1 . ARG A 1 111 ? 9.967   3.887   22.509  1.00 14.91 ? 112 ARG A NH1 1 
ATOM   903  N  NH2 . ARG A 1 111 ? 9.541   5.872   21.422  1.00 14.86 ? 112 ARG A NH2 1 
ATOM   904  N  N   . VAL A 1 112 ? 9.940   7.963   28.969  1.00 24.06 ? 113 VAL A N   1 
ATOM   905  C  CA  . VAL A 1 112 ? 9.580   9.363   29.205  1.00 24.01 ? 113 VAL A CA  1 
ATOM   906  C  C   . VAL A 1 112 ? 10.809  10.274  29.387  1.00 23.74 ? 113 VAL A C   1 
ATOM   907  O  O   . VAL A 1 112 ? 10.849  11.383  28.845  1.00 24.15 ? 113 VAL A O   1 
ATOM   908  C  CB  . VAL A 1 112 ? 8.596   9.488   30.403  1.00 23.95 ? 113 VAL A CB  1 
ATOM   909  C  CG1 . VAL A 1 112 ? 8.561   10.913  30.955  1.00 25.11 ? 113 VAL A CG1 1 
ATOM   910  C  CG2 . VAL A 1 112 ? 7.205   9.050   29.980  1.00 23.92 ? 113 VAL A CG2 1 
ATOM   911  N  N   . ALA A 1 113 ? 11.804  9.813   30.138  1.00 23.10 ? 114 ALA A N   1 
ATOM   912  C  CA  . ALA A 1 113 ? 13.055  10.564  30.279  1.00 22.96 ? 114 ALA A CA  1 
ATOM   913  C  C   . ALA A 1 113 ? 13.818  10.682  28.949  1.00 22.92 ? 114 ALA A C   1 
ATOM   914  O  O   . ALA A 1 113 ? 14.382  11.740  28.636  1.00 22.86 ? 114 ALA A O   1 
ATOM   915  C  CB  . ALA A 1 113 ? 13.939  9.942   31.349  1.00 22.57 ? 114 ALA A CB  1 
ATOM   916  N  N   . LEU A 1 114 ? 13.825  9.602   28.168  1.00 22.78 ? 115 LEU A N   1 
ATOM   917  C  CA  . LEU A 1 114 ? 14.557  9.586   26.901  1.00 22.68 ? 115 LEU A CA  1 
ATOM   918  C  C   . LEU A 1 114 ? 13.873  10.423  25.817  1.00 22.76 ? 115 LEU A C   1 
ATOM   919  O  O   . LEU A 1 114 ? 14.542  11.180  25.117  1.00 22.81 ? 115 LEU A O   1 
ATOM   920  C  CB  . LEU A 1 114 ? 14.820  8.151   26.423  1.00 22.40 ? 115 LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 114 ? 15.822  7.313   27.227  1.00 21.74 ? 115 LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 114 ? 15.847  5.864   26.737  1.00 20.68 ? 115 LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 114 ? 17.231  7.914   27.210  1.00 20.16 ? 115 LEU A CD2 1 
ATOM   924  N  N   . ASN A 1 115 ? 12.551  10.290  25.698  1.00 23.03 ? 116 ASN A N   1 
ATOM   925  C  CA  . ASN A 1 115 ? 11.752  11.075  24.752  1.00 23.45 ? 116 ASN A CA  1 
ATOM   926  C  C   . ASN A 1 115 ? 11.988  12.585  24.823  1.00 24.04 ? 116 ASN A C   1 
ATOM   927  O  O   . ASN A 1 115 ? 11.958  13.264  23.798  1.00 24.21 ? 116 ASN A O   1 
ATOM   928  C  CB  . ASN A 1 115 ? 10.255  10.790  24.923  1.00 23.38 ? 116 ASN A CB  1 
ATOM   929  C  CG  . ASN A 1 115 ? 9.829   9.461   24.313  1.00 23.81 ? 116 ASN A CG  1 
ATOM   930  O  OD1 . ASN A 1 115 ? 10.614  8.771   23.660  1.00 22.74 ? 116 ASN A OD1 1 
ATOM   931  N  ND2 . ASN A 1 115 ? 8.572   9.101   24.524  1.00 24.34 ? 116 ASN A ND2 1 
ATOM   932  N  N   . GLN A 1 116 ? 12.226  13.103  26.025  1.00 24.62 ? 117 GLN A N   1 
ATOM   933  C  CA  . GLN A 1 116 ? 12.505  14.527  26.215  1.00 25.82 ? 117 GLN A CA  1 
ATOM   934  C  C   . GLN A 1 116 ? 13.770  14.984  25.483  1.00 25.49 ? 117 GLN A C   1 
ATOM   935  O  O   . GLN A 1 116 ? 13.879  16.148  25.093  1.00 25.49 ? 117 GLN A O   1 
ATOM   936  C  CB  . GLN A 1 116 ? 12.627  14.869  27.706  1.00 26.21 ? 117 GLN A CB  1 
ATOM   937  C  CG  . GLN A 1 116 ? 11.429  14.490  28.560  1.00 29.41 ? 117 GLN A CG  1 
ATOM   938  C  CD  . GLN A 1 116 ? 10.277  15.481  28.476  1.00 34.07 ? 117 GLN A CD  1 
ATOM   939  O  OE1 . GLN A 1 116 ? 9.782   15.803  27.389  1.00 36.60 ? 117 GLN A OE1 1 
ATOM   940  N  NE2 . GLN A 1 116 ? 9.829   15.957  29.636  1.00 35.82 ? 117 GLN A NE2 1 
ATOM   941  N  N   . GLU A 1 117 ? 14.714  14.066  25.299  1.00 25.31 ? 118 GLU A N   1 
ATOM   942  C  CA  . GLU A 1 117 ? 16.003  14.407  24.702  1.00 25.33 ? 118 GLU A CA  1 
ATOM   943  C  C   . GLU A 1 117 ? 16.215  13.894  23.273  1.00 25.00 ? 118 GLU A C   1 
ATOM   944  O  O   . GLU A 1 117 ? 17.031  14.444  22.533  1.00 24.29 ? 118 GLU A O   1 
ATOM   945  C  CB  . GLU A 1 117 ? 17.155  13.979  25.622  1.00 25.65 ? 118 GLU A CB  1 
ATOM   946  C  CG  . GLU A 1 117 ? 17.157  14.684  26.998  1.00 27.13 ? 118 GLU A CG  1 
ATOM   947  C  CD  . GLU A 1 117 ? 17.122  16.219  26.906  1.00 29.00 ? 118 GLU A CD  1 
ATOM   948  O  OE1 . GLU A 1 117 ? 17.517  16.787  25.858  1.00 29.26 ? 118 GLU A OE1 1 
ATOM   949  O  OE2 . GLU A 1 117 ? 16.697  16.862  27.892  1.00 29.83 ? 118 GLU A OE2 1 
ATOM   950  N  N   . VAL A 1 118 ? 15.472  12.864  22.877  1.00 25.16 ? 119 VAL A N   1 
ATOM   951  C  CA  . VAL A 1 118 ? 15.700  12.240  21.565  1.00 25.44 ? 119 VAL A CA  1 
ATOM   952  C  C   . VAL A 1 118 ? 14.494  12.284  20.618  1.00 25.65 ? 119 VAL A C   1 
ATOM   953  O  O   . VAL A 1 118 ? 14.650  12.085  19.409  1.00 25.27 ? 119 VAL A O   1 
ATOM   954  C  CB  . VAL A 1 118 ? 16.289  10.790  21.698  1.00 25.56 ? 119 VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 118 ? 17.356  10.751  22.786  1.00 25.77 ? 119 VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 118 ? 15.204  9.781   22.000  1.00 24.77 ? 119 VAL A CG2 1 
ATOM   957  N  N   . MET A 1 119 ? 13.302  12.547  21.160  1.00 26.32 ? 120 MET A N   1 
ATOM   958  C  CA  . MET A 1 119 ? 12.077  12.566  20.347  1.00 27.09 ? 120 MET A CA  1 
ATOM   959  C  C   . MET A 1 119 ? 11.444  13.958  20.199  1.00 27.11 ? 120 MET A C   1 
ATOM   960  O  O   . MET A 1 119 ? 10.964  14.303  19.119  1.00 27.10 ? 120 MET A O   1 
ATOM   961  C  CB  . MET A 1 119 ? 11.034  11.558  20.874  1.00 27.44 ? 120 MET A CB  1 
ATOM   962  C  CG  . MET A 1 119 ? 11.351  10.081  20.606  1.00 30.10 ? 120 MET A CG  1 
ATOM   963  S  SD  . MET A 1 119 ? 11.092  9.546   18.885  1.00 36.42 ? 120 MET A SD  1 
ATOM   964  C  CE  . MET A 1 119 ? 9.432   8.877   18.950  1.00 33.96 ? 120 MET A CE  1 
ATOM   965  N  N   . ALA A 1 120 ? 11.445  14.744  21.273  1.00 27.17 ? 121 ALA A N   1 
ATOM   966  C  CA  . ALA A 1 120 ? 10.750  16.041  21.302  1.00 27.90 ? 121 ALA A CA  1 
ATOM   967  C  C   . ALA A 1 120 ? 11.326  17.067  20.318  1.00 28.27 ? 121 ALA A C   1 
ATOM   968  O  O   . ALA A 1 120 ? 12.552  17.209  20.224  1.00 28.16 ? 121 ALA A O   1 
ATOM   969  C  CB  . ALA A 1 120 ? 10.743  16.611  22.722  1.00 27.59 ? 121 ALA A CB  1 
ATOM   970  N  N   . PRO A 1 121 ? 10.442  17.785  19.586  1.00 28.84 ? 122 PRO A N   1 
ATOM   971  C  CA  . PRO A 1 121 ? 10.857  18.830  18.630  1.00 29.27 ? 122 PRO A CA  1 
ATOM   972  C  C   . PRO A 1 121 ? 11.868  19.819  19.206  1.00 29.58 ? 122 PRO A C   1 
ATOM   973  O  O   . PRO A 1 121 ? 12.797  20.215  18.506  1.00 29.84 ? 122 PRO A O   1 
ATOM   974  C  CB  . PRO A 1 121 ? 9.545   19.551  18.298  1.00 29.15 ? 122 PRO A CB  1 
ATOM   975  C  CG  . PRO A 1 121 ? 8.487   18.511  18.499  1.00 29.40 ? 122 PRO A CG  1 
ATOM   976  C  CD  . PRO A 1 121 ? 8.973   17.607  19.606  1.00 28.81 ? 122 PRO A CD  1 
ATOM   977  N  N   . GLU A 1 122 ? 11.697  20.196  20.472  1.00 30.09 ? 123 GLU A N   1 
ATOM   978  C  CA  . GLU A 1 122 ? 12.590  21.155  21.129  1.00 30.55 ? 123 GLU A CA  1 
ATOM   979  C  C   . GLU A 1 122 ? 14.008  20.621  21.291  1.00 29.88 ? 123 GLU A C   1 
ATOM   980  O  O   . GLU A 1 122 ? 14.970  21.386  21.213  1.00 29.79 ? 123 GLU A O   1 
ATOM   981  C  CB  . GLU A 1 122 ? 12.042  21.572  22.497  1.00 31.49 ? 123 GLU A CB  1 
ATOM   982  C  CG  . GLU A 1 122 ? 10.793  22.464  22.435  1.00 35.02 ? 123 GLU A CG  1 
ATOM   983  C  CD  . GLU A 1 122 ? 9.495   21.673  22.319  1.00 39.38 ? 123 GLU A CD  1 
ATOM   984  O  OE1 . GLU A 1 122 ? 9.516   20.426  22.504  1.00 41.11 ? 123 GLU A OE1 1 
ATOM   985  O  OE2 . GLU A 1 122 ? 8.448   22.305  22.045  1.00 41.28 ? 123 GLU A OE2 1 
ATOM   986  N  N   . ALA A 1 123 ? 14.128  19.314  21.537  1.00 28.81 ? 124 ALA A N   1 
ATOM   987  C  CA  . ALA A 1 123 ? 15.431  18.649  21.576  1.00 27.75 ? 124 ALA A CA  1 
ATOM   988  C  C   . ALA A 1 123 ? 15.992  18.393  20.173  1.00 27.05 ? 124 ALA A C   1 
ATOM   989  O  O   . ALA A 1 123 ? 17.165  18.659  19.926  1.00 27.06 ? 124 ALA A O   1 
ATOM   990  C  CB  . ALA A 1 123 ? 15.349  17.340  22.362  1.00 27.46 ? 124 ALA A CB  1 
ATOM   991  N  N   . THR A 1 124 ? 15.157  17.894  19.261  1.00 26.15 ? 125 THR A N   1 
ATOM   992  C  CA  . THR A 1 124 ? 15.639  17.415  17.957  1.00 25.78 ? 125 THR A CA  1 
ATOM   993  C  C   . THR A 1 124 ? 16.175  18.510  17.030  1.00 25.70 ? 125 THR A C   1 
ATOM   994  O  O   . THR A 1 124 ? 17.042  18.237  16.193  1.00 24.97 ? 125 THR A O   1 
ATOM   995  C  CB  . THR A 1 124 ? 14.577  16.578  17.190  1.00 25.55 ? 125 THR A CB  1 
ATOM   996  O  OG1 . THR A 1 124 ? 13.399  17.363  16.986  1.00 25.77 ? 125 THR A OG1 1 
ATOM   997  C  CG2 . THR A 1 124 ? 14.235  15.291  17.944  1.00 25.17 ? 125 THR A CG2 1 
ATOM   998  N  N   . LYS A 1 125 ? 15.653  19.733  17.176  1.00 25.62 ? 126 LYS A N   1 
ATOM   999  C  CA  . LYS A 1 125 ? 16.147  20.894  16.418  1.00 25.71 ? 126 LYS A CA  1 
ATOM   1000 C  C   . LYS A 1 125 ? 17.662  21.068  16.577  1.00 24.91 ? 126 LYS A C   1 
ATOM   1001 O  O   . LYS A 1 125 ? 18.332  21.508  15.658  1.00 24.80 ? 126 LYS A O   1 
ATOM   1002 C  CB  . LYS A 1 125 ? 15.398  22.184  16.797  1.00 25.85 ? 126 LYS A CB  1 
ATOM   1003 C  CG  . LYS A 1 125 ? 15.723  22.728  18.186  1.00 28.10 ? 126 LYS A CG  1 
ATOM   1004 C  CD  . LYS A 1 125 ? 14.930  23.997  18.526  1.00 31.62 ? 126 LYS A CD  1 
ATOM   1005 C  CE  . LYS A 1 125 ? 15.184  24.424  19.978  1.00 34.08 ? 126 LYS A CE  1 
ATOM   1006 N  NZ  . LYS A 1 125 ? 14.384  25.628  20.392  1.00 35.36 ? 126 LYS A NZ  1 
ATOM   1007 N  N   . ASN A 1 126 ? 18.191  20.693  17.738  1.00 24.68 ? 127 ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 126 ? 19.632  20.751  17.997  1.00 24.46 ? 127 ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 126 ? 20.458  19.694  17.248  1.00 23.92 ? 127 ASN A C   1 
ATOM   1010 O  O   . ASN A 1 126 ? 21.673  19.815  17.149  1.00 23.55 ? 127 ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 126 ? 19.906  20.649  19.495  1.00 24.80 ? 127 ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 126 ? 19.350  21.825  20.274  1.00 25.54 ? 127 ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 126 ? 19.791  22.959  20.113  1.00 27.89 ? 127 ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 126 ? 18.383  21.554  21.131  1.00 27.06 ? 127 ASN A ND2 1 
ATOM   1015 N  N   . PHE A 1 127 ? 19.799  18.665  16.723  1.00 23.38 ? 128 PHE A N   1 
ATOM   1016 C  CA  . PHE A 1 127 ? 20.504  17.601  16.011  1.00 23.27 ? 128 PHE A CA  1 
ATOM   1017 C  C   . PHE A 1 127 ? 20.959  18.046  14.624  1.00 23.01 ? 128 PHE A C   1 
ATOM   1018 O  O   . PHE A 1 127 ? 21.944  17.530  14.101  1.00 22.91 ? 128 PHE A O   1 
ATOM   1019 C  CB  . PHE A 1 127 ? 19.639  16.338  15.877  1.00 23.17 ? 128 PHE A CB  1 
ATOM   1020 C  CG  . PHE A 1 127 ? 19.255  15.694  17.196  1.00 23.50 ? 128 PHE A CG  1 
ATOM   1021 C  CD1 . PHE A 1 127 ? 19.968  15.949  18.366  1.00 23.38 ? 128 PHE A CD1 1 
ATOM   1022 C  CD2 . PHE A 1 127 ? 18.184  14.796  17.247  1.00 23.42 ? 128 PHE A CD2 1 
ATOM   1023 C  CE1 . PHE A 1 127 ? 19.607  15.335  19.574  1.00 23.70 ? 128 PHE A CE1 1 
ATOM   1024 C  CE2 . PHE A 1 127 ? 17.820  14.176  18.445  1.00 23.65 ? 128 PHE A CE2 1 
ATOM   1025 C  CZ  . PHE A 1 127 ? 18.535  14.445  19.612  1.00 22.75 ? 128 PHE A CZ  1 
ATOM   1026 N  N   . LEU A 1 128 ? 20.239  19.006  14.044  1.00 22.88 ? 129 LEU A N   1 
ATOM   1027 C  CA  . LEU A 1 128 ? 20.428  19.401  12.642  1.00 22.65 ? 129 LEU A CA  1 
ATOM   1028 C  C   . LEU A 1 128 ? 21.882  19.696  12.242  1.00 22.50 ? 129 LEU A C   1 
ATOM   1029 O  O   . LEU A 1 128 ? 22.402  19.053  11.324  1.00 22.72 ? 129 LEU A O   1 
ATOM   1030 C  CB  . LEU A 1 128 ? 19.465  20.533  12.230  1.00 22.58 ? 129 LEU A CB  1 
ATOM   1031 C  CG  . LEU A 1 128 ? 17.968  20.344  12.534  1.00 23.40 ? 129 LEU A CG  1 
ATOM   1032 C  CD1 . LEU A 1 128 ? 17.131  21.307  11.709  1.00 23.97 ? 129 LEU A CD1 1 
ATOM   1033 C  CD2 . LEU A 1 128 ? 17.476  18.910  12.326  1.00 22.36 ? 129 LEU A CD2 1 
ATOM   1034 N  N   . PRO A 1 129 ? 22.548  20.656  12.923  1.00 22.15 ? 130 PRO A N   1 
ATOM   1035 C  CA  . PRO A 1 129 ? 23.930  20.959  12.512  1.00 21.86 ? 130 PRO A CA  1 
ATOM   1036 C  C   . PRO A 1 129 ? 24.931  19.837  12.829  1.00 21.53 ? 130 PRO A C   1 
ATOM   1037 O  O   . PRO A 1 129 ? 25.984  19.747  12.183  1.00 21.97 ? 130 PRO A O   1 
ATOM   1038 C  CB  . PRO A 1 129 ? 24.272  22.217  13.318  1.00 21.80 ? 130 PRO A CB  1 
ATOM   1039 C  CG  . PRO A 1 129 ? 23.352  22.174  14.503  1.00 22.24 ? 130 PRO A CG  1 
ATOM   1040 C  CD  . PRO A 1 129 ? 22.089  21.536  14.018  1.00 21.99 ? 130 PRO A CD  1 
ATOM   1041 N  N   . LEU A 1 130 ? 24.614  19.004  13.818  1.00 20.56 ? 131 LEU A N   1 
ATOM   1042 C  CA  . LEU A 1 130 ? 25.485  17.888  14.182  1.00 19.98 ? 131 LEU A CA  1 
ATOM   1043 C  C   . LEU A 1 130 ? 25.417  16.797  13.111  1.00 19.46 ? 131 LEU A C   1 
ATOM   1044 O  O   . LEU A 1 130 ? 26.436  16.196  12.768  1.00 19.64 ? 131 LEU A O   1 
ATOM   1045 C  CB  . LEU A 1 130 ? 25.138  17.330  15.576  1.00 19.65 ? 131 LEU A CB  1 
ATOM   1046 C  CG  . LEU A 1 130 ? 25.357  18.249  16.796  1.00 20.00 ? 131 LEU A CG  1 
ATOM   1047 C  CD1 . LEU A 1 130 ? 24.863  17.590  18.083  1.00 18.36 ? 131 LEU A CD1 1 
ATOM   1048 C  CD2 . LEU A 1 130 ? 26.823  18.661  16.955  1.00 19.18 ? 131 LEU A CD2 1 
ATOM   1049 N  N   . LEU A 1 131 ? 24.220  16.567  12.576  1.00 18.41 ? 132 LEU A N   1 
ATOM   1050 C  CA  . LEU A 1 131 ? 24.031  15.556  11.538  1.00 18.10 ? 132 LEU A CA  1 
ATOM   1051 C  C   . LEU A 1 131 ? 24.453  16.097  10.181  1.00 18.00 ? 132 LEU A C   1 
ATOM   1052 O  O   . LEU A 1 131 ? 24.953  15.345  9.348   1.00 17.89 ? 132 LEU A O   1 
ATOM   1053 C  CB  . LEU A 1 131 ? 22.579  15.050  11.482  1.00 17.34 ? 132 LEU A CB  1 
ATOM   1054 C  CG  . LEU A 1 131 ? 22.036  14.298  12.707  1.00 16.79 ? 132 LEU A CG  1 
ATOM   1055 C  CD1 . LEU A 1 131 ? 20.511  14.311  12.717  1.00 13.63 ? 132 LEU A CD1 1 
ATOM   1056 C  CD2 . LEU A 1 131 ? 22.574  12.868  12.794  1.00 14.47 ? 132 LEU A CD2 1 
ATOM   1057 N  N   . ASP A 1 132 ? 24.246  17.397  9.964   1.00 17.78 ? 133 ASP A N   1 
ATOM   1058 C  CA  . ASP A 1 132 ? 24.661  18.043  8.717   1.00 17.88 ? 133 ASP A CA  1 
ATOM   1059 C  C   . ASP A 1 132 ? 26.187  18.044  8.540   1.00 17.61 ? 133 ASP A C   1 
ATOM   1060 O  O   . ASP A 1 132 ? 26.679  17.837  7.428   1.00 17.40 ? 133 ASP A O   1 
ATOM   1061 C  CB  . ASP A 1 132 ? 24.108  19.469  8.622   1.00 18.28 ? 133 ASP A CB  1 
ATOM   1062 C  CG  . ASP A 1 132 ? 24.096  19.998  7.200   1.00 20.15 ? 133 ASP A CG  1 
ATOM   1063 O  OD1 . ASP A 1 132 ? 24.167  21.238  7.028   1.00 22.76 ? 133 ASP A OD1 1 
ATOM   1064 O  OD2 . ASP A 1 132 ? 24.008  19.180  6.250   1.00 21.64 ? 133 ASP A OD2 1 
ATOM   1065 N  N   . ALA A 1 133 ? 26.919  18.277  9.630   1.00 17.31 ? 134 ALA A N   1 
ATOM   1066 C  CA  . ALA A 1 133 ? 28.389  18.225  9.613   1.00 17.56 ? 134 ALA A CA  1 
ATOM   1067 C  C   . ALA A 1 133 ? 28.913  16.872  9.134   1.00 17.51 ? 134 ALA A C   1 
ATOM   1068 O  O   . ALA A 1 133 ? 29.844  16.816  8.324   1.00 17.94 ? 134 ALA A O   1 
ATOM   1069 C  CB  . ALA A 1 133 ? 28.969  18.565  10.993  1.00 17.29 ? 134 ALA A CB  1 
ATOM   1070 N  N   . VAL A 1 134 ? 28.312  15.788  9.623   1.00 17.45 ? 135 VAL A N   1 
ATOM   1071 C  CA  . VAL A 1 134 ? 28.733  14.439  9.231   1.00 17.13 ? 135 VAL A CA  1 
ATOM   1072 C  C   . VAL A 1 134 ? 28.407  14.166  7.752   1.00 17.34 ? 135 VAL A C   1 
ATOM   1073 O  O   . VAL A 1 134 ? 29.266  13.682  7.015   1.00 16.66 ? 135 VAL A O   1 
ATOM   1074 C  CB  . VAL A 1 134 ? 28.153  13.347  10.170  1.00 17.25 ? 135 VAL A CB  1 
ATOM   1075 C  CG1 . VAL A 1 134 ? 28.617  11.959  9.744   1.00 16.64 ? 135 VAL A CG1 1 
ATOM   1076 C  CG2 . VAL A 1 134 ? 28.564  13.618  11.640  1.00 17.16 ? 135 VAL A CG2 1 
ATOM   1077 N  N   . SER A 1 135 ? 27.193  14.519  7.319   1.00 17.65 ? 136 SER A N   1 
ATOM   1078 C  CA  . SER A 1 135 ? 26.785  14.336  5.917   1.00 18.79 ? 136 SER A CA  1 
ATOM   1079 C  C   . SER A 1 135 ? 27.642  15.116  4.910   1.00 19.02 ? 136 SER A C   1 
ATOM   1080 O  O   . SER A 1 135 ? 27.977  14.585  3.849   1.00 19.03 ? 136 SER A O   1 
ATOM   1081 C  CB  . SER A 1 135 ? 25.312  14.681  5.720   1.00 18.39 ? 136 SER A CB  1 
ATOM   1082 O  OG  . SER A 1 135 ? 24.513  13.645  6.230   1.00 20.25 ? 136 SER A OG  1 
ATOM   1083 N  N   . ARG A 1 136 ? 27.986  16.360  5.252   1.00 19.20 ? 137 ARG A N   1 
ATOM   1084 C  CA  . ARG A 1 136 ? 28.917  17.165  4.452   1.00 20.11 ? 137 ARG A CA  1 
ATOM   1085 C  C   . ARG A 1 136 ? 30.298  16.516  4.316   1.00 19.85 ? 137 ARG A C   1 
ATOM   1086 O  O   . ARG A 1 136 ? 30.905  16.570  3.247   1.00 19.79 ? 137 ARG A O   1 
ATOM   1087 C  CB  . ARG A 1 136 ? 29.031  18.598  4.996   1.00 20.39 ? 137 ARG A CB  1 
ATOM   1088 C  CG  . ARG A 1 136 ? 27.726  19.388  4.879   1.00 22.68 ? 137 ARG A CG  1 
ATOM   1089 C  CD  . ARG A 1 136 ? 27.890  20.857  5.283   1.00 26.98 ? 137 ARG A CD  1 
ATOM   1090 N  NE  . ARG A 1 136 ? 28.310  21.673  4.140   1.00 31.99 ? 137 ARG A NE  1 
ATOM   1091 C  CZ  . ARG A 1 136 ? 28.263  23.005  4.092   1.00 34.34 ? 137 ARG A CZ  1 
ATOM   1092 N  NH1 . ARG A 1 136 ? 27.808  23.711  5.124   1.00 36.31 ? 137 ARG A NH1 1 
ATOM   1093 N  NH2 . ARG A 1 136 ? 28.677  23.640  3.005   1.00 35.64 ? 137 ARG A NH2 1 
ATOM   1094 N  N   . ASP A 1 137 ? 30.786  15.903  5.393   1.00 20.08 ? 138 ASP A N   1 
ATOM   1095 C  CA  . ASP A 1 137 ? 32.038  15.142  5.341   1.00 20.15 ? 138 ASP A CA  1 
ATOM   1096 C  C   . ASP A 1 137 ? 31.925  13.871  4.492   1.00 19.90 ? 138 ASP A C   1 
ATOM   1097 O  O   . ASP A 1 137 ? 32.878  13.502  3.808   1.00 20.40 ? 138 ASP A O   1 
ATOM   1098 C  CB  . ASP A 1 137 ? 32.580  14.839  6.751   1.00 20.76 ? 138 ASP A CB  1 
ATOM   1099 C  CG  . ASP A 1 137 ? 33.115  16.087  7.451   1.00 22.58 ? 138 ASP A CG  1 
ATOM   1100 O  OD1 . ASP A 1 137 ? 33.262  17.135  6.783   1.00 23.38 ? 138 ASP A OD1 1 
ATOM   1101 O  OD2 . ASP A 1 137 ? 33.374  16.034  8.674   1.00 25.26 ? 138 ASP A OD2 1 
ATOM   1102 N  N   . PHE A 1 138 ? 30.761  13.219  4.503   1.00 19.46 ? 139 PHE A N   1 
ATOM   1103 C  CA  . PHE A 1 138 ? 30.544  12.072  3.618   1.00 19.19 ? 139 PHE A CA  1 
ATOM   1104 C  C   . PHE A 1 138 ? 30.648  12.477  2.145   1.00 19.23 ? 139 PHE A C   1 
ATOM   1105 O  O   . PHE A 1 138 ? 31.278  11.778  1.355   1.00 19.54 ? 139 PHE A O   1 
ATOM   1106 C  CB  . PHE A 1 138 ? 29.204  11.371  3.881   1.00 18.76 ? 139 PHE A CB  1 
ATOM   1107 C  CG  . PHE A 1 138 ? 29.096  10.029  3.209   1.00 17.51 ? 139 PHE A CG  1 
ATOM   1108 C  CD1 . PHE A 1 138 ? 29.513  8.880   3.866   1.00 16.36 ? 139 PHE A CD1 1 
ATOM   1109 C  CD2 . PHE A 1 138 ? 28.607  9.919   1.909   1.00 17.31 ? 139 PHE A CD2 1 
ATOM   1110 C  CE1 . PHE A 1 138 ? 29.427  7.636   3.250   1.00 16.50 ? 139 PHE A CE1 1 
ATOM   1111 C  CE2 . PHE A 1 138 ? 28.526  8.677   1.272   1.00 16.47 ? 139 PHE A CE2 1 
ATOM   1112 C  CZ  . PHE A 1 138 ? 28.937  7.532   1.950   1.00 16.73 ? 139 PHE A CZ  1 
ATOM   1113 N  N   . VAL A 1 139 ? 30.023  13.597  1.791   1.00 19.36 ? 140 VAL A N   1 
ATOM   1114 C  CA  . VAL A 1 139 ? 30.123  14.176  0.451   1.00 19.57 ? 140 VAL A CA  1 
ATOM   1115 C  C   . VAL A 1 139 ? 31.596  14.406  0.055   1.00 20.25 ? 140 VAL A C   1 
ATOM   1116 O  O   . VAL A 1 139 ? 32.012  14.055  -1.061  1.00 20.13 ? 140 VAL A O   1 
ATOM   1117 C  CB  . VAL A 1 139 ? 29.266  15.484  0.353   1.00 19.69 ? 140 VAL A CB  1 
ATOM   1118 C  CG1 . VAL A 1 139 ? 29.713  16.389  -0.791  1.00 19.45 ? 140 VAL A CG1 1 
ATOM   1119 C  CG2 . VAL A 1 139 ? 27.781  15.142  0.216   1.00 19.19 ? 140 VAL A CG2 1 
ATOM   1120 N  N   . SER A 1 140 ? 32.379  14.962  0.980   1.00 20.68 ? 141 SER A N   1 
ATOM   1121 C  CA  . SER A 1 140 ? 33.807  15.231  0.742   1.00 21.71 ? 141 SER A CA  1 
ATOM   1122 C  C   . SER A 1 140 ? 34.632  13.967  0.521   1.00 21.66 ? 141 SER A C   1 
ATOM   1123 O  O   . SER A 1 140 ? 35.535  13.962  -0.310  1.00 22.10 ? 141 SER A O   1 
ATOM   1124 C  CB  . SER A 1 140 ? 34.401  16.067  1.877   1.00 21.63 ? 141 SER A CB  1 
ATOM   1125 O  OG  . SER A 1 140 ? 33.692  17.293  1.985   1.00 23.51 ? 141 SER A OG  1 
ATOM   1126 N  N   . VAL A 1 141 ? 34.314  12.901  1.254   1.00 22.02 ? 142 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 141 ? 34.924  11.591  1.021   1.00 21.83 ? 142 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 141 ? 34.743  11.194  -0.452  1.00 22.12 ? 142 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 141 ? 35.713  10.838  -1.144  1.00 21.88 ? 142 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 141 ? 34.298  10.499  1.923   1.00 21.77 ? 142 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 141 ? 34.768  9.112   1.512   1.00 21.16 ? 142 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 141 ? 34.614  10.751  3.400   1.00 22.59 ? 142 VAL A CG2 1 
ATOM   1133 N  N   . LEU A 1 142 ? 33.496  11.265  -0.916  1.00 21.91 ? 143 LEU A N   1 
ATOM   1134 C  CA  . LEU A 1 142 ? 33.151  10.872  -2.278  1.00 22.32 ? 143 LEU A CA  1 
ATOM   1135 C  C   . LEU A 1 142 ? 33.843  11.726  -3.346  1.00 22.39 ? 143 LEU A C   1 
ATOM   1136 O  O   . LEU A 1 142 ? 34.399  11.170  -4.288  1.00 22.26 ? 143 LEU A O   1 
ATOM   1137 C  CB  . LEU A 1 142 ? 31.632  10.827  -2.487  1.00 21.79 ? 143 LEU A CB  1 
ATOM   1138 C  CG  . LEU A 1 142 ? 30.861  9.679   -1.824  1.00 22.72 ? 143 LEU A CG  1 
ATOM   1139 C  CD1 . LEU A 1 142 ? 29.402  9.689   -2.275  1.00 22.98 ? 143 LEU A CD1 1 
ATOM   1140 C  CD2 . LEU A 1 142 ? 31.486  8.322   -2.113  1.00 22.70 ? 143 LEU A CD2 1 
ATOM   1141 N  N   . HIS A 1 143 ? 33.826  13.052  -3.184  1.00 22.98 ? 144 HIS A N   1 
ATOM   1142 C  CA  . HIS A 1 143 ? 34.530  13.974  -4.104  1.00 24.29 ? 144 HIS A CA  1 
ATOM   1143 C  C   . HIS A 1 143 ? 36.013  13.637  -4.201  1.00 24.62 ? 144 HIS A C   1 
ATOM   1144 O  O   . HIS A 1 143 ? 36.588  13.670  -5.280  1.00 25.01 ? 144 HIS A O   1 
ATOM   1145 C  CB  . HIS A 1 143 ? 34.384  15.448  -3.679  1.00 24.37 ? 144 HIS A CB  1 
ATOM   1146 C  CG  . HIS A 1 143 ? 33.092  16.084  -4.091  1.00 25.13 ? 144 HIS A CG  1 
ATOM   1147 N  ND1 . HIS A 1 143 ? 32.614  16.040  -5.384  1.00 26.76 ? 144 HIS A ND1 1 
ATOM   1148 C  CD2 . HIS A 1 143 ? 32.190  16.806  -3.382  1.00 25.50 ? 144 HIS A CD2 1 
ATOM   1149 C  CE1 . HIS A 1 143 ? 31.467  16.695  -5.451  1.00 26.93 ? 144 HIS A CE1 1 
ATOM   1150 N  NE2 . HIS A 1 143 ? 31.188  17.169  -4.249  1.00 27.13 ? 144 HIS A NE2 1 
ATOM   1151 N  N   . ARG A 1 144 ? 36.611  13.308  -3.059  1.00 25.40 ? 145 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 144 ? 38.014  12.912  -2.958  1.00 26.23 ? 145 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 144 ? 38.274  11.601  -3.709  1.00 26.07 ? 145 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 144 ? 39.255  11.479  -4.444  1.00 26.27 ? 145 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 144 ? 38.381  12.769  -1.475  1.00 26.50 ? 145 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 144 ? 39.857  12.648  -1.136  1.00 29.17 ? 145 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 144 ? 40.031  12.172  0.326   1.00 33.79 ? 145 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 144 ? 39.274  13.008  1.270   1.00 36.01 ? 145 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 144 ? 38.689  12.568  2.384   1.00 37.18 ? 145 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 144 ? 38.750  11.281  2.724   1.00 37.75 ? 145 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 144 ? 38.025  13.420  3.159   1.00 37.05 ? 145 ARG A NH2 1 
ATOM   1162 N  N   . ARG A 1 145 ? 37.387  10.626  -3.530  1.00 25.75 ? 146 ARG A N   1 
ATOM   1163 C  CA  . ARG A 1 145 ? 37.505  9.360   -4.244  1.00 25.66 ? 146 ARG A CA  1 
ATOM   1164 C  C   . ARG A 1 145 ? 37.314  9.526   -5.751  1.00 25.50 ? 146 ARG A C   1 
ATOM   1165 O  O   . ARG A 1 145 ? 37.907  8.791   -6.526  1.00 25.07 ? 146 ARG A O   1 
ATOM   1166 C  CB  . ARG A 1 145 ? 36.542  8.314   -3.684  1.00 25.26 ? 146 ARG A CB  1 
ATOM   1167 C  CG  . ARG A 1 145 ? 36.978  7.789   -2.344  1.00 25.81 ? 146 ARG A CG  1 
ATOM   1168 C  CD  . ARG A 1 145 ? 36.184  6.577   -1.944  1.00 25.72 ? 146 ARG A CD  1 
ATOM   1169 N  NE  . ARG A 1 145 ? 36.378  6.269   -0.536  1.00 26.66 ? 146 ARG A NE  1 
ATOM   1170 C  CZ  . ARG A 1 145 ? 35.669  5.373   0.144   1.00 27.33 ? 146 ARG A CZ  1 
ATOM   1171 N  NH1 . ARG A 1 145 ? 34.703  4.681   -0.454  1.00 26.94 ? 146 ARG A NH1 1 
ATOM   1172 N  NH2 . ARG A 1 145 ? 35.927  5.171   1.427   1.00 26.81 ? 146 ARG A NH2 1 
ATOM   1173 N  N   . ILE A 1 146 ? 36.481  10.489  -6.148  1.00 26.08 ? 147 ILE A N   1 
ATOM   1174 C  CA  . ILE A 1 146 ? 36.250  10.798  -7.560  1.00 26.43 ? 147 ILE A CA  1 
ATOM   1175 C  C   . ILE A 1 146 ? 37.514  11.396  -8.185  1.00 26.98 ? 147 ILE A C   1 
ATOM   1176 O  O   . ILE A 1 146 ? 37.928  10.989  -9.271  1.00 26.88 ? 147 ILE A O   1 
ATOM   1177 C  CB  . ILE A 1 146 ? 35.035  11.745  -7.741  1.00 26.74 ? 147 ILE A CB  1 
ATOM   1178 C  CG1 . ILE A 1 146 ? 33.722  10.994  -7.445  1.00 26.43 ? 147 ILE A CG1 1 
ATOM   1179 C  CG2 . ILE A 1 146 ? 35.018  12.364  -9.149  1.00 26.00 ? 147 ILE A CG2 1 
ATOM   1180 C  CD1 . ILE A 1 146 ? 32.474  11.863  -7.456  1.00 26.76 ? 147 ILE A CD1 1 
ATOM   1181 N  N   . LYS A 1 147 ? 38.131  12.342  -7.478  1.00 27.64 ? 148 LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 147 ? 39.370  12.978  -7.922  1.00 28.53 ? 148 LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 147 ? 40.473  11.938  -8.119  1.00 28.63 ? 148 LYS A C   1 
ATOM   1184 O  O   . LYS A 1 147 ? 41.122  11.914  -9.164  1.00 28.63 ? 148 LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 147 ? 39.810  14.047  -6.912  1.00 29.02 ? 148 LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 147 ? 40.896  15.002  -7.411  1.00 30.67 ? 148 LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 147 ? 41.222  16.061  -6.353  1.00 33.49 ? 148 LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 147 ? 42.248  17.075  -6.863  1.00 34.79 ? 148 LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 147 ? 41.673  17.943  -7.942  1.00 36.22 ? 148 LYS A NZ  1 
ATOM   1190 N  N   . LYS A 1 148 ? 40.650  11.073  -7.118  1.00 28.87 ? 149 LYS A N   1 
ATOM   1191 C  CA  . LYS A 1 148 ? 41.661  10.009  -7.130  1.00 28.96 ? 149 LYS A CA  1 
ATOM   1192 C  C   . LYS A 1 148 ? 41.493  8.993   -8.271  1.00 28.60 ? 149 LYS A C   1 
ATOM   1193 O  O   . LYS A 1 148 ? 42.490  8.531   -8.844  1.00 28.50 ? 149 LYS A O   1 
ATOM   1194 C  CB  . LYS A 1 148 ? 41.685  9.296   -5.774  1.00 29.56 ? 149 LYS A CB  1 
ATOM   1195 C  CG  . LYS A 1 148 ? 42.552  8.033   -5.719  1.00 31.66 ? 149 LYS A CG  1 
ATOM   1196 C  CD  . LYS A 1 148 ? 43.259  7.886   -4.375  1.00 35.78 ? 149 LYS A CD  1 
ATOM   1197 C  CE  . LYS A 1 148 ? 44.703  8.416   -4.435  1.00 38.26 ? 149 LYS A CE  1 
ATOM   1198 N  NZ  . LYS A 1 148 ? 44.782  9.881   -4.749  1.00 39.54 ? 149 LYS A NZ  1 
ATOM   1199 N  N   . ALA A 1 149 ? 40.244  8.649   -8.594  1.00 27.55 ? 150 ALA A N   1 
ATOM   1200 C  CA  . ALA A 1 149 ? 39.963  7.711   -9.680  1.00 26.77 ? 150 ALA A CA  1 
ATOM   1201 C  C   . ALA A 1 149 ? 40.409  8.266   -11.038 1.00 26.50 ? 150 ALA A C   1 
ATOM   1202 O  O   . ALA A 1 149 ? 40.771  7.501   -11.930 1.00 26.18 ? 150 ALA A O   1 
ATOM   1203 C  CB  . ALA A 1 149 ? 38.491  7.347   -9.710  1.00 26.41 ? 150 ALA A CB  1 
ATOM   1204 N  N   . GLY A 1 150 ? 40.368  9.593   -11.184 1.00 26.25 ? 151 GLY A N   1 
ATOM   1205 C  CA  . GLY A 1 150 ? 40.838  10.268  -12.397 1.00 25.87 ? 151 GLY A CA  1 
ATOM   1206 C  C   . GLY A 1 150 ? 39.904  10.180  -13.591 1.00 25.85 ? 151 GLY A C   1 
ATOM   1207 O  O   . GLY A 1 150 ? 40.213  10.695  -14.659 1.00 25.66 ? 151 GLY A O   1 
ATOM   1208 N  N   . SER A 1 151 ? 38.752  9.541   -13.413 1.00 25.99 ? 152 SER A N   1 
ATOM   1209 C  CA  . SER A 1 151 ? 37.809  9.335   -14.513 1.00 26.12 ? 152 SER A CA  1 
ATOM   1210 C  C   . SER A 1 151 ? 36.594  10.264  -14.464 1.00 26.23 ? 152 SER A C   1 
ATOM   1211 O  O   . SER A 1 151 ? 35.679  10.106  -15.269 1.00 26.66 ? 152 SER A O   1 
ATOM   1212 C  CB  . SER A 1 151 ? 37.344  7.878   -14.524 1.00 25.96 ? 152 SER A CB  1 
ATOM   1213 O  OG  . SER A 1 151 ? 36.929  7.486   -13.225 1.00 26.44 ? 152 SER A OG  1 
ATOM   1214 N  N   . GLY A 1 152 ? 36.585  11.217  -13.525 1.00 26.36 ? 153 GLY A N   1 
ATOM   1215 C  CA  . GLY A 1 152 ? 35.425  12.099  -13.282 1.00 26.30 ? 153 GLY A CA  1 
ATOM   1216 C  C   . GLY A 1 152 ? 34.253  11.350  -12.663 1.00 26.24 ? 153 GLY A C   1 
ATOM   1217 O  O   . GLY A 1 152 ? 33.083  11.724  -12.816 1.00 26.35 ? 153 GLY A O   1 
ATOM   1218 N  N   . ASN A 1 153 ? 34.583  10.324  -11.898 1.00 26.15 ? 154 ASN A N   1 
ATOM   1219 C  CA  . ASN A 1 153 ? 33.704  9.196   -11.696 1.00 25.95 ? 154 ASN A CA  1 
ATOM   1220 C  C   . ASN A 1 153 ? 34.162  8.409   -10.464 1.00 24.82 ? 154 ASN A C   1 
ATOM   1221 O  O   . ASN A 1 153 ? 35.354  8.307   -10.229 1.00 24.51 ? 154 ASN A O   1 
ATOM   1222 C  CB  . ASN A 1 153 ? 33.892  8.329   -12.947 1.00 26.89 ? 154 ASN A CB  1 
ATOM   1223 C  CG  . ASN A 1 153 ? 32.925  7.216   -13.037 1.00 27.87 ? 154 ASN A CG  1 
ATOM   1224 O  OD1 . ASN A 1 153 ? 31.816  7.397   -13.520 1.00 32.12 ? 154 ASN A OD1 1 
ATOM   1225 N  ND2 . ASN A 1 153 ? 33.343  6.032   -12.611 1.00 28.38 ? 154 ASN A ND2 1 
ATOM   1226 N  N   . TYR A 1 154 ? 33.236  7.860   -9.679  1.00 23.81 ? 155 TYR A N   1 
ATOM   1227 C  CA  . TYR A 1 154 ? 33.607  6.841   -8.682  1.00 22.76 ? 155 TYR A CA  1 
ATOM   1228 C  C   . TYR A 1 154 ? 32.617  5.674   -8.592  1.00 22.18 ? 155 TYR A C   1 
ATOM   1229 O  O   . TYR A 1 154 ? 31.417  5.873   -8.380  1.00 22.03 ? 155 TYR A O   1 
ATOM   1230 C  CB  . TYR A 1 154 ? 33.884  7.441   -7.291  1.00 22.27 ? 155 TYR A CB  1 
ATOM   1231 C  CG  . TYR A 1 154 ? 34.147  6.388   -6.224  1.00 22.23 ? 155 TYR A CG  1 
ATOM   1232 C  CD1 . TYR A 1 154 ? 35.301  5.594   -6.264  1.00 22.07 ? 155 TYR A CD1 1 
ATOM   1233 C  CD2 . TYR A 1 154 ? 33.238  6.179   -5.179  1.00 21.70 ? 155 TYR A CD2 1 
ATOM   1234 C  CE1 . TYR A 1 154 ? 35.545  4.620   -5.295  1.00 23.04 ? 155 TYR A CE1 1 
ATOM   1235 C  CE2 . TYR A 1 154 ? 33.470  5.213   -4.199  1.00 23.19 ? 155 TYR A CE2 1 
ATOM   1236 C  CZ  . TYR A 1 154 ? 34.623  4.436   -4.263  1.00 25.04 ? 155 TYR A CZ  1 
ATOM   1237 O  OH  . TYR A 1 154 ? 34.854  3.476   -3.303  1.00 27.53 ? 155 TYR A OH  1 
ATOM   1238 N  N   . SER A 1 155 ? 33.145  4.462   -8.751  1.00 21.43 ? 156 SER A N   1 
ATOM   1239 C  CA  . SER A 1 155 ? 32.372  3.228   -8.598  1.00 20.99 ? 156 SER A CA  1 
ATOM   1240 C  C   . SER A 1 155 ? 32.902  2.409   -7.440  1.00 20.91 ? 156 SER A C   1 
ATOM   1241 O  O   . SER A 1 155 ? 34.114  2.211   -7.309  1.00 20.84 ? 156 SER A O   1 
ATOM   1242 C  CB  . SER A 1 155 ? 32.434  2.370   -9.861  1.00 20.67 ? 156 SER A CB  1 
ATOM   1243 O  OG  . SER A 1 155 ? 31.925  3.068   -10.971 1.00 21.48 ? 156 SER A OG  1 
ATOM   1244 N  N   . GLY A 1 156 ? 31.983  1.914   -6.616  1.00 20.76 ? 157 GLY A N   1 
ATOM   1245 C  CA  . GLY A 1 156 ? 32.335  1.083   -5.480  1.00 20.15 ? 157 GLY A CA  1 
ATOM   1246 C  C   . GLY A 1 156 ? 31.135  0.653   -4.656  1.00 20.38 ? 157 GLY A C   1 
ATOM   1247 O  O   . GLY A 1 156 ? 30.049  1.246   -4.732  1.00 19.62 ? 157 GLY A O   1 
ATOM   1248 N  N   . ASP A 1 157 ? 31.348  -0.414  -3.894  1.00 20.37 ? 158 ASP A N   1 
ATOM   1249 C  CA  . ASP A 1 157 ? 30.478  -0.816  -2.807  1.00 20.79 ? 158 ASP A CA  1 
ATOM   1250 C  C   . ASP A 1 157 ? 30.791  0.129   -1.639  1.00 20.31 ? 158 ASP A C   1 
ATOM   1251 O  O   . ASP A 1 157 ? 31.912  0.141   -1.128  1.00 20.63 ? 158 ASP A O   1 
ATOM   1252 C  CB  . ASP A 1 157 ? 30.804  -2.273  -2.452  1.00 21.24 ? 158 ASP A CB  1 
ATOM   1253 C  CG  . ASP A 1 157 ? 29.953  -2.832  -1.321  1.00 23.03 ? 158 ASP A CG  1 
ATOM   1254 O  OD1 . ASP A 1 157 ? 29.254  -2.069  -0.623  1.00 24.01 ? 158 ASP A OD1 1 
ATOM   1255 O  OD2 . ASP A 1 157 ? 30.010  -4.070  -1.118  1.00 26.55 ? 158 ASP A OD2 1 
ATOM   1256 N  N   . ILE A 1 158 ? 29.815  0.924   -1.220  1.00 19.54 ? 159 ILE A N   1 
ATOM   1257 C  CA  . ILE A 1 158 ? 30.032  1.842   -0.104  1.00 18.87 ? 159 ILE A CA  1 
ATOM   1258 C  C   . ILE A 1 158 ? 29.366  1.424   1.217   1.00 18.71 ? 159 ILE A C   1 
ATOM   1259 O  O   . ILE A 1 158 ? 29.181  2.259   2.105   1.00 18.21 ? 159 ILE A O   1 
ATOM   1260 C  CB  . ILE A 1 158 ? 29.641  3.313   -0.466  1.00 19.08 ? 159 ILE A CB  1 
ATOM   1261 C  CG1 . ILE A 1 158 ? 28.149  3.423   -0.800  1.00 18.49 ? 159 ILE A CG1 1 
ATOM   1262 C  CG2 . ILE A 1 158 ? 30.519  3.835   -1.612  1.00 18.46 ? 159 ILE A CG2 1 
ATOM   1263 C  CD1 . ILE A 1 158 ? 27.571  4.799   -0.587  1.00 17.12 ? 159 ILE A CD1 1 
ATOM   1264 N  N   . SER A 1 159 ? 29.042  0.136   1.361   1.00 18.20 ? 160 SER A N   1 
ATOM   1265 C  CA  . SER A 1 159 ? 28.354  -0.339  2.566   1.00 18.35 ? 160 SER A CA  1 
ATOM   1266 C  C   . SER A 1 159 ? 29.173  -0.085  3.842   1.00 18.50 ? 160 SER A C   1 
ATOM   1267 O  O   . SER A 1 159 ? 28.623  0.362   4.849   1.00 17.84 ? 160 SER A O   1 
ATOM   1268 C  CB  . SER A 1 159 ? 27.967  -1.819  2.450   1.00 18.27 ? 160 SER A CB  1 
ATOM   1269 O  OG  . SER A 1 159 ? 29.099  -2.638  2.181   1.00 19.14 ? 160 SER A OG  1 
ATOM   1270 N  N   . ASP A 1 160 ? 30.479  -0.353  3.778   1.00 18.73 ? 161 ASP A N   1 
ATOM   1271 C  CA  . ASP A 1 160 ? 31.389  -0.115  4.903   1.00 19.76 ? 161 ASP A CA  1 
ATOM   1272 C  C   . ASP A 1 160 ? 31.454  1.357   5.274   1.00 19.12 ? 161 ASP A C   1 
ATOM   1273 O  O   . ASP A 1 160 ? 31.488  1.701   6.450   1.00 19.14 ? 161 ASP A O   1 
ATOM   1274 C  CB  . ASP A 1 160 ? 32.810  -0.625  4.598   1.00 20.23 ? 161 ASP A CB  1 
ATOM   1275 C  CG  . ASP A 1 160 ? 32.896  -2.148  4.551   1.00 23.30 ? 161 ASP A CG  1 
ATOM   1276 O  OD1 . ASP A 1 160 ? 31.977  -2.834  5.056   1.00 25.83 ? 161 ASP A OD1 1 
ATOM   1277 O  OD2 . ASP A 1 160 ? 33.895  -2.662  3.995   1.00 27.63 ? 161 ASP A OD2 1 
ATOM   1278 N  N   . ASP A 1 161 ? 31.488  2.213   4.258   1.00 18.92 ? 162 ASP A N   1 
ATOM   1279 C  CA  . ASP A 1 161 ? 31.450  3.658   4.450   1.00 18.69 ? 162 ASP A CA  1 
ATOM   1280 C  C   . ASP A 1 161 ? 30.117  4.121   5.049   1.00 18.09 ? 162 ASP A C   1 
ATOM   1281 O  O   . ASP A 1 161 ? 30.089  5.064   5.836   1.00 18.08 ? 162 ASP A O   1 
ATOM   1282 C  CB  . ASP A 1 161 ? 31.730  4.376   3.131   1.00 18.89 ? 162 ASP A CB  1 
ATOM   1283 C  CG  . ASP A 1 161 ? 33.017  3.893   2.470   1.00 20.23 ? 162 ASP A CG  1 
ATOM   1284 O  OD1 . ASP A 1 161 ? 34.101  4.070   3.068   1.00 22.03 ? 162 ASP A OD1 1 
ATOM   1285 O  OD2 . ASP A 1 161 ? 32.945  3.317   1.359   1.00 21.87 ? 162 ASP A OD2 1 
ATOM   1286 N  N   . LEU A 1 162 ? 29.023  3.454   4.684   1.00 17.51 ? 163 LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 162 ? 27.719  3.799   5.228   1.00 17.14 ? 163 LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 162 ? 27.621  3.415   6.700   1.00 16.78 ? 163 LEU A C   1 
ATOM   1289 O  O   . LEU A 1 162 ? 27.056  4.174   7.486   1.00 16.63 ? 163 LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 162 ? 26.573  3.209   4.396   1.00 16.84 ? 163 LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 162 ? 26.303  3.955   3.077   1.00 17.45 ? 163 LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 162 ? 25.373  3.163   2.182   1.00 16.24 ? 163 LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 162 ? 25.743  5.360   3.319   1.00 15.60 ? 163 LEU A CD2 1 
ATOM   1294 N  N   . PHE A 1 163 ? 28.194  2.267   7.080   1.00 16.51 ? 164 PHE A N   1 
ATOM   1295 C  CA  . PHE A 1 163 ? 28.296  1.904   8.509   1.00 16.27 ? 164 PHE A CA  1 
ATOM   1296 C  C   . PHE A 1 163 ? 29.093  2.948   9.298   1.00 15.87 ? 164 PHE A C   1 
ATOM   1297 O  O   . PHE A 1 163 ? 28.674  3.359   10.383  1.00 16.07 ? 164 PHE A O   1 
ATOM   1298 C  CB  . PHE A 1 163 ? 28.903  0.512   8.726   1.00 16.37 ? 164 PHE A CB  1 
ATOM   1299 C  CG  . PHE A 1 163 ? 28.107  -0.608  8.115   1.00 18.10 ? 164 PHE A CG  1 
ATOM   1300 C  CD1 . PHE A 1 163 ? 28.717  -1.525  7.270   1.00 19.39 ? 164 PHE A CD1 1 
ATOM   1301 C  CD2 . PHE A 1 163 ? 26.748  -0.743  8.375   1.00 18.93 ? 164 PHE A CD2 1 
ATOM   1302 C  CE1 . PHE A 1 163 ? 27.980  -2.558  6.683   1.00 20.49 ? 164 PHE A CE1 1 
ATOM   1303 C  CE2 . PHE A 1 163 ? 26.010  -1.781  7.806   1.00 20.40 ? 164 PHE A CE2 1 
ATOM   1304 C  CZ  . PHE A 1 163 ? 26.624  -2.683  6.962   1.00 21.12 ? 164 PHE A CZ  1 
ATOM   1305 N  N   . ARG A 1 164 ? 30.228  3.378   8.751   1.00 14.69 ? 165 ARG A N   1 
ATOM   1306 C  CA  . ARG A 1 164 ? 31.027  4.427   9.385   1.00 14.75 ? 165 ARG A CA  1 
ATOM   1307 C  C   . ARG A 1 164 ? 30.273  5.760   9.490   1.00 14.46 ? 165 ARG A C   1 
ATOM   1308 O  O   . ARG A 1 164 ? 30.355  6.437   10.514  1.00 14.67 ? 165 ARG A O   1 
ATOM   1309 C  CB  . ARG A 1 164 ? 32.386  4.606   8.688   1.00 14.23 ? 165 ARG A CB  1 
ATOM   1310 C  CG  . ARG A 1 164 ? 33.384  3.523   9.057   1.00 14.81 ? 165 ARG A CG  1 
ATOM   1311 C  CD  . ARG A 1 164 ? 34.783  3.735   8.444   1.00 15.95 ? 165 ARG A CD  1 
ATOM   1312 N  NE  . ARG A 1 164 ? 34.808  3.494   6.997   1.00 18.37 ? 165 ARG A NE  1 
ATOM   1313 C  CZ  . ARG A 1 164 ? 34.997  2.301   6.430   1.00 18.27 ? 165 ARG A CZ  1 
ATOM   1314 N  NH1 . ARG A 1 164 ? 35.183  1.220   7.183   1.00 19.52 ? 165 ARG A NH1 1 
ATOM   1315 N  NH2 . ARG A 1 164 ? 34.990  2.185   5.109   1.00 15.54 ? 165 ARG A NH2 1 
ATOM   1316 N  N   . PHE A 1 165 ? 29.535  6.121   8.441   1.00 13.92 ? 166 PHE A N   1 
ATOM   1317 C  CA  . PHE A 1 165 ? 28.716  7.327   8.454   1.00 13.89 ? 166 PHE A CA  1 
ATOM   1318 C  C   . PHE A 1 165 ? 27.653  7.281   9.570   1.00 13.91 ? 166 PHE A C   1 
ATOM   1319 O  O   . PHE A 1 165 ? 27.459  8.257   10.305  1.00 13.54 ? 166 PHE A O   1 
ATOM   1320 C  CB  . PHE A 1 165 ? 28.021  7.514   7.099   1.00 13.84 ? 166 PHE A CB  1 
ATOM   1321 C  CG  . PHE A 1 165 ? 26.851  8.453   7.154   1.00 14.04 ? 166 PHE A CG  1 
ATOM   1322 C  CD1 . PHE A 1 165 ? 27.049  9.834   7.176   1.00 13.56 ? 166 PHE A CD1 1 
ATOM   1323 C  CD2 . PHE A 1 165 ? 25.547  7.960   7.201   1.00 14.24 ? 166 PHE A CD2 1 
ATOM   1324 C  CE1 . PHE A 1 165 ? 25.961  10.713  7.247   1.00 13.67 ? 166 PHE A CE1 1 
ATOM   1325 C  CE2 . PHE A 1 165 ? 24.463  8.827   7.263   1.00 13.81 ? 166 PHE A CE2 1 
ATOM   1326 C  CZ  . PHE A 1 165 ? 24.667  10.204  7.295   1.00 13.86 ? 166 PHE A CZ  1 
ATOM   1327 N  N   . ALA A 1 166 ? 26.959  6.151   9.665   1.00 13.86 ? 167 ALA A N   1 
ATOM   1328 C  CA  . ALA A 1 166 ? 25.910  5.966   10.662  1.00 14.60 ? 167 ALA A CA  1 
ATOM   1329 C  C   . ALA A 1 166 ? 26.486  6.071   12.075  1.00 14.99 ? 167 ALA A C   1 
ATOM   1330 O  O   . ALA A 1 166 ? 25.864  6.662   12.959  1.00 15.56 ? 167 ALA A O   1 
ATOM   1331 C  CB  . ALA A 1 166 ? 25.207  4.615   10.454  1.00 14.10 ? 167 ALA A CB  1 
ATOM   1332 N  N   . PHE A 1 167 ? 27.684  5.515   12.270  1.00 15.44 ? 168 PHE A N   1 
ATOM   1333 C  CA  . PHE A 1 167 ? 28.392  5.594   13.550  1.00 15.63 ? 168 PHE A CA  1 
ATOM   1334 C  C   . PHE A 1 167 ? 28.831  7.018   13.924  1.00 15.70 ? 168 PHE A C   1 
ATOM   1335 O  O   . PHE A 1 167 ? 28.605  7.438   15.059  1.00 15.18 ? 168 PHE A O   1 
ATOM   1336 C  CB  . PHE A 1 167 ? 29.587  4.638   13.564  1.00 15.66 ? 168 PHE A CB  1 
ATOM   1337 C  CG  . PHE A 1 167 ? 30.333  4.606   14.878  1.00 17.23 ? 168 PHE A CG  1 
ATOM   1338 C  CD1 . PHE A 1 167 ? 29.887  3.814   15.932  1.00 18.42 ? 168 PHE A CD1 1 
ATOM   1339 C  CD2 . PHE A 1 167 ? 31.483  5.367   15.056  1.00 18.23 ? 168 PHE A CD2 1 
ATOM   1340 C  CE1 . PHE A 1 167 ? 30.585  3.788   17.149  1.00 20.08 ? 168 PHE A CE1 1 
ATOM   1341 C  CE2 . PHE A 1 167 ? 32.184  5.347   16.268  1.00 19.60 ? 168 PHE A CE2 1 
ATOM   1342 C  CZ  . PHE A 1 167 ? 31.740  4.556   17.308  1.00 19.81 ? 168 PHE A CZ  1 
ATOM   1343 N  N   . GLU A 1 168 ? 29.463  7.743   12.992  1.00 16.10 ? 169 GLU A N   1 
ATOM   1344 C  CA  . GLU A 1 168 ? 29.792  9.171   13.184  1.00 16.86 ? 169 GLU A CA  1 
ATOM   1345 C  C   . GLU A 1 168 ? 28.575  9.969   13.628  1.00 16.35 ? 169 GLU A C   1 
ATOM   1346 O  O   . GLU A 1 168 ? 28.668  10.805  14.539  1.00 16.60 ? 169 GLU A O   1 
ATOM   1347 C  CB  . GLU A 1 168 ? 30.275  9.833   11.884  1.00 17.64 ? 169 GLU A CB  1 
ATOM   1348 C  CG  . GLU A 1 168 ? 31.772  9.897   11.597  1.00 20.59 ? 169 GLU A CG  1 
ATOM   1349 C  CD  . GLU A 1 168 ? 32.640  10.296  12.770  1.00 21.59 ? 169 GLU A CD  1 
ATOM   1350 O  OE1 . GLU A 1 168 ? 32.912  11.500  12.974  1.00 23.68 ? 169 GLU A OE1 1 
ATOM   1351 O  OE2 . GLU A 1 168 ? 33.112  9.376   13.450  1.00 22.50 ? 169 GLU A OE2 1 
ATOM   1352 N  N   . SER A 1 169 ? 27.444  9.719   12.966  1.00 15.62 ? 170 SER A N   1 
ATOM   1353 C  CA  . SER A 1 169 ? 26.219  10.488  13.187  1.00 15.53 ? 170 SER A CA  1 
ATOM   1354 C  C   . SER A 1 169 ? 25.660  10.272  14.590  1.00 15.52 ? 170 SER A C   1 
ATOM   1355 O  O   . SER A 1 169 ? 25.446  11.234  15.329  1.00 15.85 ? 170 SER A O   1 
ATOM   1356 C  CB  . SER A 1 169 ? 25.161  10.145  12.130  1.00 15.31 ? 170 SER A CB  1 
ATOM   1357 O  OG  . SER A 1 169 ? 25.639  10.420  10.823  1.00 13.83 ? 170 SER A OG  1 
ATOM   1358 N  N   . ILE A 1 170 ? 25.446  9.008   14.956  1.00 15.45 ? 171 ILE A N   1 
ATOM   1359 C  CA  . ILE A 1 170 ? 24.897  8.671   16.265  1.00 14.76 ? 171 ILE A CA  1 
ATOM   1360 C  C   . ILE A 1 170 ? 25.811  9.122   17.415  1.00 14.89 ? 171 ILE A C   1 
ATOM   1361 O  O   . ILE A 1 170 ? 25.322  9.609   18.429  1.00 14.51 ? 171 ILE A O   1 
ATOM   1362 C  CB  . ILE A 1 170 ? 24.515  7.159   16.382  1.00 14.93 ? 171 ILE A CB  1 
ATOM   1363 C  CG1 . ILE A 1 170 ? 23.572  6.925   17.568  1.00 14.41 ? 171 ILE A CG1 1 
ATOM   1364 C  CG2 . ILE A 1 170 ? 25.756  6.246   16.449  1.00 13.74 ? 171 ILE A CG2 1 
ATOM   1365 C  CD1 . ILE A 1 170 ? 22.215  7.657   17.434  1.00 13.64 ? 171 ILE A CD1 1 
ATOM   1366 N  N   . THR A 1 171 ? 27.126  8.989   17.231  1.00 14.83 ? 172 THR A N   1 
ATOM   1367 C  CA  . THR A 1 171 ? 28.090  9.433   18.227  1.00 15.00 ? 172 THR A CA  1 
ATOM   1368 C  C   . THR A 1 171 ? 28.139  10.952  18.336  1.00 14.95 ? 172 THR A C   1 
ATOM   1369 O  O   . THR A 1 171 ? 28.293  11.483  19.423  1.00 14.49 ? 172 THR A O   1 
ATOM   1370 C  CB  . THR A 1 171 ? 29.527  8.874   17.982  1.00 14.78 ? 172 THR A CB  1 
ATOM   1371 O  OG1 . THR A 1 171 ? 29.967  9.200   16.656  1.00 14.79 ? 172 THR A OG1 1 
ATOM   1372 C  CG2 . THR A 1 171 ? 29.566  7.382   18.182  1.00 14.22 ? 172 THR A CG2 1 
ATOM   1373 N  N   . ASN A 1 172 ? 27.988  11.646  17.214  1.00 16.00 ? 173 ASN A N   1 
ATOM   1374 C  CA  . ASN A 1 172 ? 27.975  13.110  17.236  1.00 16.49 ? 173 ASN A CA  1 
ATOM   1375 C  C   . ASN A 1 172 ? 26.770  13.678  17.991  1.00 16.87 ? 173 ASN A C   1 
ATOM   1376 O  O   . ASN A 1 172 ? 26.920  14.638  18.744  1.00 16.65 ? 173 ASN A O   1 
ATOM   1377 C  CB  . ASN A 1 172 ? 28.053  13.703  15.826  1.00 16.76 ? 173 ASN A CB  1 
ATOM   1378 C  CG  . ASN A 1 172 ? 28.816  15.030  15.784  1.00 17.25 ? 173 ASN A CG  1 
ATOM   1379 O  OD1 . ASN A 1 172 ? 29.627  15.340  16.673  1.00 17.85 ? 173 ASN A OD1 1 
ATOM   1380 N  ND2 . ASN A 1 172 ? 28.573  15.808  14.740  1.00 15.66 ? 173 ASN A ND2 1 
ATOM   1381 N  N   . VAL A 1 173 ? 25.587  13.084  17.811  1.00 17.25 ? 174 VAL A N   1 
ATOM   1382 C  CA  . VAL A 1 173 ? 24.396  13.585  18.520  1.00 17.58 ? 174 VAL A CA  1 
ATOM   1383 C  C   . VAL A 1 173 ? 24.389  13.191  20.009  1.00 18.07 ? 174 VAL A C   1 
ATOM   1384 O  O   . VAL A 1 173 ? 23.902  13.941  20.857  1.00 17.90 ? 174 VAL A O   1 
ATOM   1385 C  CB  . VAL A 1 173 ? 23.036  13.243  17.816  1.00 17.69 ? 174 VAL A CB  1 
ATOM   1386 C  CG1 . VAL A 1 173 ? 22.932  13.946  16.477  1.00 17.32 ? 174 VAL A CG1 1 
ATOM   1387 C  CG2 . VAL A 1 173 ? 22.818  11.735  17.663  1.00 17.61 ? 174 VAL A CG2 1 
ATOM   1388 N  N   . ILE A 1 174 ? 24.968  12.035  20.319  1.00 18.61 ? 175 ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 174 ? 25.044  11.561  21.692  1.00 18.78 ? 175 ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 174 ? 26.129  12.286  22.491  1.00 19.15 ? 175 ILE A C   1 
ATOM   1391 O  O   . ILE A 1 174 ? 25.856  12.784  23.592  1.00 19.53 ? 175 ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 174 ? 25.245  10.024  21.763  1.00 18.71 ? 175 ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 174 ? 23.969  9.297   21.324  1.00 19.32 ? 175 ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 174 ? 25.614  9.586   23.191  1.00 18.46 ? 175 ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 174 ? 24.116  7.792   21.273  1.00 19.48 ? 175 ILE A CD1 1 
ATOM   1396 N  N   . PHE A 1 175 ? 27.336  12.352  21.928  1.00 19.19 ? 176 PHE A N   1 
ATOM   1397 C  CA  . PHE A 1 175 ? 28.513  12.835  22.638  1.00 19.82 ? 176 PHE A CA  1 
ATOM   1398 C  C   . PHE A 1 175 ? 28.912  14.271  22.288  1.00 20.39 ? 176 PHE A C   1 
ATOM   1399 O  O   . PHE A 1 175 ? 29.749  14.865  22.966  1.00 19.78 ? 176 PHE A O   1 
ATOM   1400 C  CB  . PHE A 1 175 ? 29.706  11.884  22.402  1.00 19.60 ? 176 PHE A CB  1 
ATOM   1401 C  CG  . PHE A 1 175 ? 29.484  10.487  22.940  1.00 20.20 ? 176 PHE A CG  1 
ATOM   1402 C  CD1 . PHE A 1 175 ? 29.343  9.406   22.074  1.00 19.84 ? 176 PHE A CD1 1 
ATOM   1403 C  CD2 . PHE A 1 175 ? 29.386  10.259  24.310  1.00 19.50 ? 176 PHE A CD2 1 
ATOM   1404 C  CE1 . PHE A 1 175 ? 29.127  8.112   22.566  1.00 20.46 ? 176 PHE A CE1 1 
ATOM   1405 C  CE2 . PHE A 1 175 ? 29.172  8.964   24.811  1.00 20.19 ? 176 PHE A CE2 1 
ATOM   1406 C  CZ  . PHE A 1 175 ? 29.040  7.891   23.932  1.00 19.52 ? 176 PHE A CZ  1 
ATOM   1407 N  N   . GLY A 1 176 ? 28.326  14.819  21.227  1.00 20.84 ? 177 GLY A N   1 
ATOM   1408 C  CA  . GLY A 1 176 ? 28.717  16.135  20.723  1.00 21.87 ? 177 GLY A CA  1 
ATOM   1409 C  C   . GLY A 1 176 ? 30.163  16.213  20.266  1.00 22.48 ? 177 GLY A C   1 
ATOM   1410 O  O   . GLY A 1 176 ? 30.749  17.289  20.250  1.00 22.50 ? 177 GLY A O   1 
ATOM   1411 N  N   . GLU A 1 177 ? 30.737  15.070  19.897  1.00 23.27 ? 178 GLU A N   1 
ATOM   1412 C  CA  . GLU A 1 177 ? 32.139  14.999  19.487  1.00 24.32 ? 178 GLU A CA  1 
ATOM   1413 C  C   . GLU A 1 177 ? 32.302  14.086  18.275  1.00 24.03 ? 178 GLU A C   1 
ATOM   1414 O  O   . GLU A 1 177 ? 31.698  13.016  18.214  1.00 23.90 ? 178 GLU A O   1 
ATOM   1415 C  CB  . GLU A 1 177 ? 33.012  14.481  20.639  1.00 24.67 ? 178 GLU A CB  1 
ATOM   1416 C  CG  . GLU A 1 177 ? 33.055  15.395  21.866  1.00 28.94 ? 178 GLU A CG  1 
ATOM   1417 C  CD  . GLU A 1 177 ? 33.678  14.735  23.103  1.00 32.95 ? 178 GLU A CD  1 
ATOM   1418 O  OE1 . GLU A 1 177 ? 33.567  13.495  23.257  1.00 35.27 ? 178 GLU A OE1 1 
ATOM   1419 O  OE2 . GLU A 1 177 ? 34.269  15.466  23.929  1.00 33.78 ? 178 GLU A OE2 1 
ATOM   1420 N  N   . ARG A 1 178 ? 33.123  14.520  17.323  1.00 24.28 ? 179 ARG A N   1 
ATOM   1421 C  CA  . ARG A 1 178 ? 33.453  13.734  16.136  1.00 24.20 ? 179 ARG A CA  1 
ATOM   1422 C  C   . ARG A 1 178 ? 34.446  12.619  16.461  1.00 24.51 ? 179 ARG A C   1 
ATOM   1423 O  O   . ARG A 1 178 ? 35.460  12.864  17.103  1.00 24.72 ? 179 ARG A O   1 
ATOM   1424 C  CB  . ARG A 1 178 ? 34.015  14.634  15.026  1.00 23.75 ? 179 ARG A CB  1 
ATOM   1425 C  CG  . ARG A 1 178 ? 32.996  15.632  14.444  1.00 23.03 ? 179 ARG A CG  1 
ATOM   1426 C  CD  . ARG A 1 178 ? 31.808  14.944  13.725  1.00 20.46 ? 179 ARG A CD  1 
ATOM   1427 N  NE  . ARG A 1 178 ? 32.229  14.190  12.545  1.00 19.87 ? 179 ARG A NE  1 
ATOM   1428 C  CZ  . ARG A 1 178 ? 32.405  14.721  11.334  1.00 19.14 ? 179 ARG A CZ  1 
ATOM   1429 N  NH1 . ARG A 1 178 ? 32.199  16.021  11.124  1.00 19.36 ? 179 ARG A NH1 1 
ATOM   1430 N  NH2 . ARG A 1 178 ? 32.799  13.958  10.334  1.00 17.51 ? 179 ARG A NH2 1 
ATOM   1431 N  N   . GLN A 1 179 ? 34.149  11.404  15.999  1.00 24.68 ? 180 GLN A N   1 
ATOM   1432 C  CA  . GLN A 1 179 ? 35.010  10.241  16.231  1.00 25.06 ? 180 GLN A CA  1 
ATOM   1433 C  C   . GLN A 1 179 ? 36.075  10.040  15.149  1.00 25.02 ? 180 GLN A C   1 
ATOM   1434 O  O   . GLN A 1 179 ? 36.983  9.231   15.321  1.00 25.18 ? 180 GLN A O   1 
ATOM   1435 C  CB  . GLN A 1 179 ? 34.170  8.969   16.380  1.00 24.86 ? 180 GLN A CB  1 
ATOM   1436 C  CG  . GLN A 1 179 ? 33.097  9.044   17.458  1.00 26.27 ? 180 GLN A CG  1 
ATOM   1437 C  CD  . GLN A 1 179 ? 33.641  9.436   18.825  1.00 28.70 ? 180 GLN A CD  1 
ATOM   1438 O  OE1 . GLN A 1 179 ? 34.574  8.811   19.340  1.00 29.86 ? 180 GLN A OE1 1 
ATOM   1439 N  NE2 . GLN A 1 179 ? 33.054  10.472  19.421  1.00 28.53 ? 180 GLN A NE2 1 
ATOM   1440 N  N   . GLY A 1 180 ? 35.950  10.766  14.038  1.00 25.26 ? 181 GLY A N   1 
ATOM   1441 C  CA  . GLY A 1 180 ? 36.921  10.699  12.934  1.00 25.32 ? 181 GLY A CA  1 
ATOM   1442 C  C   . GLY A 1 180 ? 36.791  9.509   11.987  1.00 25.65 ? 181 GLY A C   1 
ATOM   1443 O  O   . GLY A 1 180 ? 37.736  9.194   11.257  1.00 25.44 ? 181 GLY A O   1 
ATOM   1444 N  N   . MET A 1 181 ? 35.627  8.856   11.978  1.00 25.95 ? 182 MET A N   1 
ATOM   1445 C  CA  . MET A 1 181 ? 35.424  7.653   11.161  1.00 26.53 ? 182 MET A CA  1 
ATOM   1446 C  C   . MET A 1 181 ? 35.286  7.927   9.654   1.00 26.74 ? 182 MET A C   1 
ATOM   1447 O  O   . MET A 1 181 ? 35.242  6.995   8.858   1.00 26.90 ? 182 MET A O   1 
ATOM   1448 C  CB  . MET A 1 181 ? 34.231  6.818   11.663  1.00 26.94 ? 182 MET A CB  1 
ATOM   1449 C  CG  . MET A 1 181 ? 34.356  6.312   13.088  1.00 27.61 ? 182 MET A CG  1 
ATOM   1450 S  SD  . MET A 1 181 ? 35.940  5.512   13.411  1.00 30.64 ? 182 MET A SD  1 
ATOM   1451 C  CE  . MET A 1 181 ? 35.642  3.878   12.701  1.00 28.91 ? 182 MET A CE  1 
ATOM   1452 N  N   . LEU A 1 182 ? 35.228  9.194   9.259   1.00 27.12 ? 183 LEU A N   1 
ATOM   1453 C  CA  . LEU A 1 182 ? 35.213  9.531   7.831   1.00 27.69 ? 183 LEU A CA  1 
ATOM   1454 C  C   . LEU A 1 182 ? 36.572  10.052  7.297   1.00 28.39 ? 183 LEU A C   1 
ATOM   1455 O  O   . LEU A 1 182 ? 36.699  10.366  6.115   1.00 27.95 ? 183 LEU A O   1 
ATOM   1456 C  CB  . LEU A 1 182 ? 34.038  10.462  7.488   1.00 27.07 ? 183 LEU A CB  1 
ATOM   1457 C  CG  . LEU A 1 182 ? 32.606  9.938   7.734   1.00 26.75 ? 183 LEU A CG  1 
ATOM   1458 C  CD1 . LEU A 1 182 ? 31.574  10.968  7.287   1.00 25.55 ? 183 LEU A CD1 1 
ATOM   1459 C  CD2 . LEU A 1 182 ? 32.323  8.588   7.067   1.00 25.38 ? 183 LEU A CD2 1 
ATOM   1460 N  N   . GLU A 1 183 ? 37.576  10.128  8.175   1.00 29.57 ? 184 GLU A N   1 
ATOM   1461 C  CA  . GLU A 1 183 ? 38.950  10.484  7.780   1.00 30.93 ? 184 GLU A CA  1 
ATOM   1462 C  C   . GLU A 1 183 ? 39.617  9.314   7.046   1.00 31.61 ? 184 GLU A C   1 
ATOM   1463 O  O   . GLU A 1 183 ? 39.140  8.175   7.123   1.00 31.53 ? 184 GLU A O   1 
ATOM   1464 C  CB  . GLU A 1 183 ? 39.784  10.902  9.000   1.00 31.01 ? 184 GLU A CB  1 
ATOM   1465 C  CG  . GLU A 1 183 ? 39.238  12.107  9.792   1.00 33.10 ? 184 GLU A CG  1 
ATOM   1466 C  CD  . GLU A 1 183 ? 39.282  13.429  9.013   1.00 36.88 ? 184 GLU A CD  1 
ATOM   1467 O  OE1 . GLU A 1 183 ? 40.376  13.839  8.555   1.00 38.56 ? 184 GLU A OE1 1 
ATOM   1468 O  OE2 . GLU A 1 183 ? 38.218  14.073  8.871   1.00 38.30 ? 184 GLU A OE2 1 
ATOM   1469 N  N   . GLU A 1 184 ? 40.713  9.587   6.335   1.00 32.72 ? 185 GLU A N   1 
ATOM   1470 C  CA  . GLU A 1 184 ? 41.413  8.539   5.575   1.00 33.89 ? 185 GLU A CA  1 
ATOM   1471 C  C   . GLU A 1 184 ? 41.990  7.442   6.474   1.00 34.16 ? 185 GLU A C   1 
ATOM   1472 O  O   . GLU A 1 184 ? 41.955  6.266   6.109   1.00 34.44 ? 185 GLU A O   1 
ATOM   1473 C  CB  . GLU A 1 184 ? 42.489  9.124   4.643   1.00 34.18 ? 185 GLU A CB  1 
ATOM   1474 C  CG  . GLU A 1 184 ? 41.923  9.689   3.334   1.00 36.61 ? 185 GLU A CG  1 
ATOM   1475 C  CD  . GLU A 1 184 ? 43.000  10.096  2.325   1.00 40.23 ? 185 GLU A CD  1 
ATOM   1476 O  OE1 . GLU A 1 184 ? 43.826  9.234   1.934   1.00 41.81 ? 185 GLU A OE1 1 
ATOM   1477 O  OE2 . GLU A 1 184 ? 43.010  11.279  1.909   1.00 41.43 ? 185 GLU A OE2 1 
ATOM   1478 N  N   . VAL A 1 185 ? 42.501  7.828   7.643   1.00 34.43 ? 186 VAL A N   1 
ATOM   1479 C  CA  . VAL A 1 185 ? 43.019  6.873   8.631   1.00 34.84 ? 186 VAL A CA  1 
ATOM   1480 C  C   . VAL A 1 185 ? 42.066  6.815   9.826   1.00 34.83 ? 186 VAL A C   1 
ATOM   1481 O  O   . VAL A 1 185 ? 41.785  7.831   10.461  1.00 35.08 ? 186 VAL A O   1 
ATOM   1482 C  CB  . VAL A 1 185 ? 44.459  7.226   9.096   1.00 34.87 ? 186 VAL A CB  1 
ATOM   1483 C  CG1 . VAL A 1 185 ? 44.911  6.293   10.219  1.00 35.55 ? 186 VAL A CG1 1 
ATOM   1484 C  CG2 . VAL A 1 185 ? 45.441  7.160   7.919   1.00 35.22 ? 186 VAL A CG2 1 
ATOM   1485 N  N   . VAL A 1 186 ? 41.587  5.614   10.127  1.00 34.63 ? 187 VAL A N   1 
ATOM   1486 C  CA  . VAL A 1 186 ? 40.447  5.427   11.019  1.00 34.59 ? 187 VAL A CA  1 
ATOM   1487 C  C   . VAL A 1 186 ? 40.840  4.822   12.372  1.00 34.19 ? 187 VAL A C   1 
ATOM   1488 O  O   . VAL A 1 186 ? 41.817  4.082   12.463  1.00 34.28 ? 187 VAL A O   1 
ATOM   1489 C  CB  . VAL A 1 186 ? 39.341  4.582   10.282  1.00 34.73 ? 187 VAL A CB  1 
ATOM   1490 C  CG1 . VAL A 1 186 ? 38.850  3.393   11.105  1.00 34.84 ? 187 VAL A CG1 1 
ATOM   1491 C  CG2 . VAL A 1 186 ? 38.199  5.481   9.822   1.00 34.71 ? 187 VAL A CG2 1 
ATOM   1492 N  N   . ASN A 1 187 ? 40.081  5.162   13.414  1.00 33.63 ? 188 ASN A N   1 
ATOM   1493 C  CA  . ASN A 1 187 ? 40.207  4.528   14.721  1.00 33.13 ? 188 ASN A CA  1 
ATOM   1494 C  C   . ASN A 1 187 ? 39.838  3.029   14.654  1.00 32.48 ? 188 ASN A C   1 
ATOM   1495 O  O   . ASN A 1 187 ? 38.662  2.685   14.471  1.00 32.19 ? 188 ASN A O   1 
ATOM   1496 C  CB  . ASN A 1 187 ? 39.322  5.256   15.740  1.00 33.42 ? 188 ASN A CB  1 
ATOM   1497 C  CG  . ASN A 1 187 ? 39.633  4.867   17.175  1.00 34.94 ? 188 ASN A CG  1 
ATOM   1498 O  OD1 . ASN A 1 187 ? 39.903  3.704   17.477  1.00 37.68 ? 188 ASN A OD1 1 
ATOM   1499 N  ND2 . ASN A 1 187 ? 39.593  5.844   18.073  1.00 36.61 ? 188 ASN A ND2 1 
ATOM   1500 N  N   . PRO A 1 188 ? 40.840  2.134   14.799  1.00 31.82 ? 189 PRO A N   1 
ATOM   1501 C  CA  . PRO A 1 188 ? 40.582  0.686   14.691  1.00 31.08 ? 189 PRO A CA  1 
ATOM   1502 C  C   . PRO A 1 188 ? 39.669  0.137   15.797  1.00 30.21 ? 189 PRO A C   1 
ATOM   1503 O  O   . PRO A 1 188 ? 38.996  -0.882  15.595  1.00 29.80 ? 189 PRO A O   1 
ATOM   1504 C  CB  . PRO A 1 188 ? 41.983  0.064   14.782  1.00 31.10 ? 189 PRO A CB  1 
ATOM   1505 C  CG  . PRO A 1 188 ? 42.816  1.086   15.502  1.00 31.70 ? 189 PRO A CG  1 
ATOM   1506 C  CD  . PRO A 1 188 ? 42.261  2.424   15.088  1.00 31.96 ? 189 PRO A CD  1 
ATOM   1507 N  N   . GLU A 1 189 ? 39.646  0.808   16.944  1.00 29.32 ? 190 GLU A N   1 
ATOM   1508 C  CA  . GLU A 1 189 ? 38.800  0.389   18.064  1.00 29.02 ? 190 GLU A CA  1 
ATOM   1509 C  C   . GLU A 1 189 ? 37.341  0.786   17.856  1.00 27.84 ? 190 GLU A C   1 
ATOM   1510 O  O   . GLU A 1 189 ? 36.433  0.079   18.291  1.00 27.87 ? 190 GLU A O   1 
ATOM   1511 C  CB  . GLU A 1 189 ? 39.326  0.916   19.409  1.00 29.35 ? 190 GLU A CB  1 
ATOM   1512 C  CG  . GLU A 1 189 ? 40.685  0.327   19.851  1.00 32.06 ? 190 GLU A CG  1 
ATOM   1513 C  CD  . GLU A 1 189 ? 40.725  -1.209  19.856  1.00 35.90 ? 190 GLU A CD  1 
ATOM   1514 O  OE1 . GLU A 1 189 ? 39.750  -1.853  20.313  1.00 36.93 ? 190 GLU A OE1 1 
ATOM   1515 O  OE2 . GLU A 1 189 ? 41.746  -1.775  19.402  1.00 37.92 ? 190 GLU A OE2 1 
ATOM   1516 N  N   . ALA A 1 190 ? 37.114  1.914   17.195  1.00 26.51 ? 191 ALA A N   1 
ATOM   1517 C  CA  . ALA A 1 190 ? 35.761  2.284   16.802  1.00 25.26 ? 191 ALA A CA  1 
ATOM   1518 C  C   . ALA A 1 190 ? 35.258  1.353   15.688  1.00 24.57 ? 191 ALA A C   1 
ATOM   1519 O  O   . ALA A 1 190 ? 34.089  0.970   15.689  1.00 24.11 ? 191 ALA A O   1 
ATOM   1520 C  CB  . ALA A 1 190 ? 35.692  3.737   16.386  1.00 24.99 ? 191 ALA A CB  1 
ATOM   1521 N  N   . GLN A 1 191 ? 36.147  0.967   14.767  1.00 23.63 ? 192 GLN A N   1 
ATOM   1522 C  CA  . GLN A 1 191 ? 35.802  0.000   13.724  1.00 23.29 ? 192 GLN A CA  1 
ATOM   1523 C  C   . GLN A 1 191 ? 35.413  -1.370  14.304  1.00 23.37 ? 192 GLN A C   1 
ATOM   1524 O  O   . GLN A 1 191 ? 34.521  -2.054  13.787  1.00 23.10 ? 192 GLN A O   1 
ATOM   1525 C  CB  . GLN A 1 191 ? 36.935  -0.148  12.704  1.00 23.08 ? 192 GLN A CB  1 
ATOM   1526 C  CG  . GLN A 1 191 ? 36.564  -0.993  11.490  1.00 21.95 ? 192 GLN A CG  1 
ATOM   1527 C  CD  . GLN A 1 191 ? 35.525  -0.316  10.612  1.00 22.10 ? 192 GLN A CD  1 
ATOM   1528 O  OE1 . GLN A 1 191 ? 35.803  0.706   9.992   1.00 21.72 ? 192 GLN A OE1 1 
ATOM   1529 N  NE2 . GLN A 1 191 ? 34.318  -0.885  10.558  1.00 21.21 ? 192 GLN A NE2 1 
ATOM   1530 N  N   . ARG A 1 192 ? 36.085  -1.757  15.385  1.00 23.58 ? 193 ARG A N   1 
ATOM   1531 C  CA  . ARG A 1 192 ? 35.774  -2.995  16.096  1.00 23.72 ? 193 ARG A CA  1 
ATOM   1532 C  C   . ARG A 1 192 ? 34.376  -2.940  16.736  1.00 22.76 ? 193 ARG A C   1 
ATOM   1533 O  O   . ARG A 1 192 ? 33.683  -3.957  16.803  1.00 22.64 ? 193 ARG A O   1 
ATOM   1534 C  CB  . ARG A 1 192 ? 36.844  -3.268  17.153  1.00 24.18 ? 193 ARG A CB  1 
ATOM   1535 C  CG  . ARG A 1 192 ? 37.521  -4.623  16.996  1.00 27.76 ? 193 ARG A CG  1 
ATOM   1536 C  CD  . ARG A 1 192 ? 38.765  -4.777  17.899  1.00 31.71 ? 193 ARG A CD  1 
ATOM   1537 N  NE  . ARG A 1 192 ? 38.479  -4.602  19.326  1.00 33.83 ? 193 ARG A NE  1 
ATOM   1538 C  CZ  . ARG A 1 192 ? 37.961  -5.539  20.119  1.00 35.22 ? 193 ARG A CZ  1 
ATOM   1539 N  NH1 . ARG A 1 192 ? 37.645  -6.738  19.646  1.00 35.63 ? 193 ARG A NH1 1 
ATOM   1540 N  NH2 . ARG A 1 192 ? 37.750  -5.271  21.397  1.00 36.17 ? 193 ARG A NH2 1 
ATOM   1541 N  N   . PHE A 1 193 ? 33.970  -1.757  17.198  1.00 21.59 ? 194 PHE A N   1 
ATOM   1542 C  CA  . PHE A 1 193 ? 32.613  -1.563  17.713  1.00 21.04 ? 194 PHE A CA  1 
ATOM   1543 C  C   . PHE A 1 193 ? 31.571  -1.730  16.602  1.00 20.29 ? 194 PHE A C   1 
ATOM   1544 O  O   . PHE A 1 193 ? 30.566  -2.422  16.790  1.00 20.11 ? 194 PHE A O   1 
ATOM   1545 C  CB  . PHE A 1 193 ? 32.464  -0.204  18.419  1.00 20.94 ? 194 PHE A CB  1 
ATOM   1546 C  CG  . PHE A 1 193 ? 31.082  0.041   18.992  1.00 21.74 ? 194 PHE A CG  1 
ATOM   1547 C  CD1 . PHE A 1 193 ? 30.771  -0.346  20.285  1.00 22.04 ? 194 PHE A CD1 1 
ATOM   1548 C  CD2 . PHE A 1 193 ? 30.092  0.655   18.228  1.00 22.99 ? 194 PHE A CD2 1 
ATOM   1549 C  CE1 . PHE A 1 193 ? 29.506  -0.119  20.822  1.00 21.55 ? 194 PHE A CE1 1 
ATOM   1550 C  CE2 . PHE A 1 193 ? 28.820  0.883   18.751  1.00 23.64 ? 194 PHE A CE2 1 
ATOM   1551 C  CZ  . PHE A 1 193 ? 28.529  0.489   20.058  1.00 23.34 ? 194 PHE A CZ  1 
ATOM   1552 N  N   . ILE A 1 194 ? 31.830  -1.120  15.443  1.00 19.67 ? 195 ILE A N   1 
ATOM   1553 C  CA  . ILE A 1 194 ? 30.939  -1.227  14.282  1.00 18.97 ? 195 ILE A CA  1 
ATOM   1554 C  C   . ILE A 1 194 ? 30.765  -2.682  13.847  1.00 19.08 ? 195 ILE A C   1 
ATOM   1555 O  O   . ILE A 1 194 ? 29.637  -3.136  13.648  1.00 19.11 ? 195 ILE A O   1 
ATOM   1556 C  CB  . ILE A 1 194 ? 31.429  -0.367  13.093  1.00 18.82 ? 195 ILE A CB  1 
ATOM   1557 C  CG1 . ILE A 1 194 ? 31.327  1.120   13.437  1.00 18.46 ? 195 ILE A CG1 1 
ATOM   1558 C  CG2 . ILE A 1 194 ? 30.622  -0.677  11.824  1.00 18.17 ? 195 ILE A CG2 1 
ATOM   1559 C  CD1 . ILE A 1 194 ? 32.050  2.032   12.475  1.00 17.58 ? 195 ILE A CD1 1 
ATOM   1560 N  N   . ASP A 1 195 ? 31.879  -3.405  13.713  1.00 18.83 ? 196 ASP A N   1 
ATOM   1561 C  CA  . ASP A 1 195 ? 31.859  -4.823  13.329  1.00 19.01 ? 196 ASP A CA  1 
ATOM   1562 C  C   . ASP A 1 195 ? 31.113  -5.712  14.320  1.00 18.15 ? 196 ASP A C   1 
ATOM   1563 O  O   . ASP A 1 195 ? 30.459  -6.664  13.909  1.00 18.24 ? 196 ASP A O   1 
ATOM   1564 C  CB  . ASP A 1 195 ? 33.280  -5.372  13.130  1.00 19.24 ? 196 ASP A CB  1 
ATOM   1565 C  CG  . ASP A 1 195 ? 34.070  -4.614  12.068  1.00 22.11 ? 196 ASP A CG  1 
ATOM   1566 O  OD1 . ASP A 1 195 ? 33.492  -3.828  11.264  1.00 23.20 ? 196 ASP A OD1 1 
ATOM   1567 O  OD2 . ASP A 1 195 ? 35.302  -4.817  12.038  1.00 26.80 ? 196 ASP A OD2 1 
ATOM   1568 N  N   . ALA A 1 196 ? 31.212  -5.400  15.611  1.00 17.86 ? 197 ALA A N   1 
ATOM   1569 C  CA  . ALA A 1 196 ? 30.553  -6.185  16.661  1.00 17.90 ? 197 ALA A CA  1 
ATOM   1570 C  C   . ALA A 1 196 ? 29.037  -6.075  16.584  1.00 17.79 ? 197 ALA A C   1 
ATOM   1571 O  O   . ALA A 1 196 ? 28.326  -7.058  16.815  1.00 17.83 ? 197 ALA A O   1 
ATOM   1572 C  CB  . ALA A 1 196 ? 31.031  -5.758  18.029  1.00 17.71 ? 197 ALA A CB  1 
ATOM   1573 N  N   . ILE A 1 197 ? 28.556  -4.876  16.267  1.00 17.76 ? 198 ILE A N   1 
ATOM   1574 C  CA  . ILE A 1 197 ? 27.131  -4.626  16.090  1.00 18.13 ? 198 ILE A CA  1 
ATOM   1575 C  C   . ILE A 1 197 ? 26.571  -5.535  15.012  1.00 18.26 ? 198 ILE A C   1 
ATOM   1576 O  O   . ILE A 1 197 ? 25.568  -6.205  15.233  1.00 18.15 ? 198 ILE A O   1 
ATOM   1577 C  CB  . ILE A 1 197 ? 26.849  -3.140  15.774  1.00 18.42 ? 198 ILE A CB  1 
ATOM   1578 C  CG1 . ILE A 1 197 ? 27.061  -2.308  17.041  1.00 18.78 ? 198 ILE A CG1 1 
ATOM   1579 C  CG2 . ILE A 1 197 ? 25.427  -2.948  15.254  1.00 17.83 ? 198 ILE A CG2 1 
ATOM   1580 C  CD1 . ILE A 1 197 ? 27.306  -0.875  16.774  1.00 20.98 ? 198 ILE A CD1 1 
ATOM   1581 N  N   . TYR A 1 198 ? 27.242  -5.569  13.862  1.00 18.89 ? 199 TYR A N   1 
ATOM   1582 C  CA  . TYR A 1 198 ? 26.858  -6.440  12.754  1.00 19.32 ? 199 TYR A CA  1 
ATOM   1583 C  C   . TYR A 1 198 ? 26.861  -7.911  13.181  1.00 18.86 ? 199 TYR A C   1 
ATOM   1584 O  O   . TYR A 1 198 ? 25.945  -8.657  12.848  1.00 18.47 ? 199 TYR A O   1 
ATOM   1585 C  CB  . TYR A 1 198 ? 27.798  -6.216  11.555  1.00 20.00 ? 199 TYR A CB  1 
ATOM   1586 C  CG  . TYR A 1 198 ? 27.417  -7.012  10.330  1.00 22.63 ? 199 TYR A CG  1 
ATOM   1587 C  CD1 . TYR A 1 198 ? 26.626  -6.445  9.331   1.00 25.82 ? 199 TYR A CD1 1 
ATOM   1588 C  CD2 . TYR A 1 198 ? 27.831  -8.339  10.177  1.00 24.67 ? 199 TYR A CD2 1 
ATOM   1589 C  CE1 . TYR A 1 198 ? 26.262  -7.175  8.200   1.00 28.32 ? 199 TYR A CE1 1 
ATOM   1590 C  CE2 . TYR A 1 198 ? 27.470  -9.082  9.052   1.00 27.61 ? 199 TYR A CE2 1 
ATOM   1591 C  CZ  . TYR A 1 198 ? 26.681  -8.491  8.069   1.00 28.98 ? 199 TYR A CZ  1 
ATOM   1592 O  OH  . TYR A 1 198 ? 26.312  -9.206  6.949   1.00 31.26 ? 199 TYR A OH  1 
ATOM   1593 N  N   . GLN A 1 199 ? 27.894  -8.312  13.925  1.00 18.90 ? 200 GLN A N   1 
ATOM   1594 C  CA  . GLN A 1 199 ? 28.026  -9.688  14.426  1.00 18.84 ? 200 GLN A CA  1 
ATOM   1595 C  C   . GLN A 1 199 ? 26.935  -10.064 15.434  1.00 18.11 ? 200 GLN A C   1 
ATOM   1596 O  O   . GLN A 1 199 ? 26.398  -11.163 15.387  1.00 17.92 ? 200 GLN A O   1 
ATOM   1597 C  CB  . GLN A 1 199 ? 29.419  -9.924  15.031  1.00 19.02 ? 200 GLN A CB  1 
ATOM   1598 C  CG  . GLN A 1 199 ? 30.531  -10.021 13.989  1.00 21.76 ? 200 GLN A CG  1 
ATOM   1599 C  CD  . GLN A 1 199 ? 30.283  -11.134 12.967  1.00 25.64 ? 200 GLN A CD  1 
ATOM   1600 O  OE1 . GLN A 1 199 ? 29.987  -12.280 13.337  1.00 26.22 ? 200 GLN A OE1 1 
ATOM   1601 N  NE2 . GLN A 1 199 ? 30.388  -10.795 11.674  1.00 24.40 ? 200 GLN A NE2 1 
ATOM   1602 N  N   . MET A 1 200 ? 26.622  -9.153  16.346  1.00 17.61 ? 201 MET A N   1 
ATOM   1603 C  CA  . MET A 1 200 ? 25.541  -9.371  17.308  1.00 17.11 ? 201 MET A CA  1 
ATOM   1604 C  C   . MET A 1 200 ? 24.230  -9.736  16.575  1.00 16.76 ? 201 MET A C   1 
ATOM   1605 O  O   . MET A 1 200 ? 23.590  -10.731 16.922  1.00 16.31 ? 201 MET A O   1 
ATOM   1606 C  CB  . MET A 1 200 ? 25.373  -8.144  18.199  1.00 16.84 ? 201 MET A CB  1 
ATOM   1607 C  CG  . MET A 1 200 ? 24.375  -8.315  19.333  1.00 17.81 ? 201 MET A CG  1 
ATOM   1608 S  SD  . MET A 1 200 ? 22.653  -8.143  18.823  1.00 19.38 ? 201 MET A SD  1 
ATOM   1609 C  CE  . MET A 1 200 ? 22.528  -6.362  18.702  1.00 17.59 ? 201 MET A CE  1 
ATOM   1610 N  N   . PHE A 1 201 ? 23.862  -8.956  15.554  1.00 16.35 ? 202 PHE A N   1 
ATOM   1611 C  CA  . PHE A 1 201 ? 22.675  -9.247  14.732  1.00 16.17 ? 202 PHE A CA  1 
ATOM   1612 C  C   . PHE A 1 201 ? 22.747  -10.564 13.964  1.00 16.00 ? 202 PHE A C   1 
ATOM   1613 O  O   . PHE A 1 201 ? 21.812  -11.374 14.022  1.00 15.64 ? 202 PHE A O   1 
ATOM   1614 C  CB  . PHE A 1 201 ? 22.393  -8.117  13.745  1.00 16.21 ? 202 PHE A CB  1 
ATOM   1615 C  CG  . PHE A 1 201 ? 21.753  -6.922  14.362  1.00 16.51 ? 202 PHE A CG  1 
ATOM   1616 C  CD1 . PHE A 1 201 ? 22.339  -5.671  14.239  1.00 17.77 ? 202 PHE A CD1 1 
ATOM   1617 C  CD2 . PHE A 1 201 ? 20.556  -7.040  15.064  1.00 16.77 ? 202 PHE A CD2 1 
ATOM   1618 C  CE1 . PHE A 1 201 ? 21.745  -4.540  14.815  1.00 18.58 ? 202 PHE A CE1 1 
ATOM   1619 C  CE2 . PHE A 1 201 ? 19.953  -5.924  15.635  1.00 17.67 ? 202 PHE A CE2 1 
ATOM   1620 C  CZ  . PHE A 1 201 ? 20.555  -4.669  15.515  1.00 18.13 ? 202 PHE A CZ  1 
ATOM   1621 N  N   . HIS A 1 202 ? 23.840  -10.745 13.222  1.00 15.85 ? 203 HIS A N   1 
ATOM   1622 C  CA  . HIS A 1 202 ? 24.058  -11.935 12.394  1.00 16.30 ? 203 HIS A CA  1 
ATOM   1623 C  C   . HIS A 1 202 ? 24.033  -13.219 13.241  1.00 15.56 ? 203 HIS A C   1 
ATOM   1624 O  O   . HIS A 1 202 ? 23.355  -14.185 12.893  1.00 15.16 ? 203 HIS A O   1 
ATOM   1625 C  CB  . HIS A 1 202 ? 25.372  -11.794 11.588  1.00 16.92 ? 203 HIS A CB  1 
ATOM   1626 C  CG  . HIS A 1 202 ? 25.598  -12.885 10.586  1.00 19.28 ? 203 HIS A CG  1 
ATOM   1627 N  ND1 . HIS A 1 202 ? 25.133  -12.815 9.289   1.00 22.26 ? 203 HIS A ND1 1 
ATOM   1628 C  CD2 . HIS A 1 202 ? 26.248  -14.069 10.686  1.00 21.29 ? 203 HIS A CD2 1 
ATOM   1629 C  CE1 . HIS A 1 202 ? 25.470  -13.917 8.640   1.00 22.14 ? 203 HIS A CE1 1 
ATOM   1630 N  NE2 . HIS A 1 202 ? 26.153  -14.691 9.463   1.00 22.50 ? 203 HIS A NE2 1 
ATOM   1631 N  N   . THR A 1 203 ? 24.739  -13.215 14.372  1.00 15.59 ? 204 THR A N   1 
ATOM   1632 C  CA  . THR A 1 203 ? 24.775  -14.395 15.250  1.00 15.13 ? 204 THR A CA  1 
ATOM   1633 C  C   . THR A 1 203 ? 23.457  -14.637 15.999  1.00 15.32 ? 204 THR A C   1 
ATOM   1634 O  O   . THR A 1 203 ? 23.272  -15.700 16.575  1.00 15.60 ? 204 THR A O   1 
ATOM   1635 C  CB  . THR A 1 203 ? 25.940  -14.360 16.264  1.00 15.12 ? 204 THR A CB  1 
ATOM   1636 O  OG1 . THR A 1 203 ? 25.836  -13.188 17.083  1.00 15.76 ? 204 THR A OG1 1 
ATOM   1637 C  CG2 . THR A 1 203 ? 27.288  -14.389 15.555  1.00 14.74 ? 204 THR A CG2 1 
ATOM   1638 N  N   . SER A 1 204 ? 22.535  -13.676 15.978  1.00 15.04 ? 205 SER A N   1 
ATOM   1639 C  CA  . SER A 1 204 ? 21.240  -13.872 16.640  1.00 15.43 ? 205 SER A CA  1 
ATOM   1640 C  C   . SER A 1 204 ? 20.370  -14.909 15.916  1.00 15.58 ? 205 SER A C   1 
ATOM   1641 O  O   . SER A 1 204 ? 19.578  -15.618 16.549  1.00 14.82 ? 205 SER A O   1 
ATOM   1642 C  CB  . SER A 1 204 ? 20.452  -12.565 16.713  1.00 15.02 ? 205 SER A CB  1 
ATOM   1643 O  OG  . SER A 1 204 ? 21.155  -11.575 17.428  1.00 16.68 ? 205 SER A OG  1 
ATOM   1644 N  N   . VAL A 1 205 ? 20.518  -14.971 14.591  1.00 15.57 ? 206 VAL A N   1 
ATOM   1645 C  CA  . VAL A 1 205 ? 19.627  -15.752 13.725  1.00 15.76 ? 206 VAL A CA  1 
ATOM   1646 C  C   . VAL A 1 205 ? 19.561  -17.262 14.045  1.00 16.32 ? 206 VAL A C   1 
ATOM   1647 O  O   . VAL A 1 205 ? 18.470  -17.795 14.214  1.00 16.22 ? 206 VAL A O   1 
ATOM   1648 C  CB  . VAL A 1 205 ? 19.916  -15.484 12.219  1.00 15.79 ? 206 VAL A CB  1 
ATOM   1649 C  CG1 . VAL A 1 205 ? 18.988  -16.306 11.323  1.00 15.69 ? 206 VAL A CG1 1 
ATOM   1650 C  CG2 . VAL A 1 205 ? 19.765  -13.992 11.909  1.00 14.99 ? 206 VAL A CG2 1 
ATOM   1651 N  N   . PRO A 1 206 ? 20.717  -17.953 14.138  1.00 17.09 ? 207 PRO A N   1 
ATOM   1652 C  CA  . PRO A 1 206 ? 20.606  -19.394 14.378  1.00 17.42 ? 207 PRO A CA  1 
ATOM   1653 C  C   . PRO A 1 206 ? 19.981  -19.762 15.725  1.00 18.40 ? 207 PRO A C   1 
ATOM   1654 O  O   . PRO A 1 206 ? 19.608  -20.926 15.924  1.00 18.20 ? 207 PRO A O   1 
ATOM   1655 C  CB  . PRO A 1 206 ? 22.065  -19.876 14.321  1.00 17.30 ? 207 PRO A CB  1 
ATOM   1656 C  CG  . PRO A 1 206 ? 22.774  -18.849 13.490  1.00 16.78 ? 207 PRO A CG  1 
ATOM   1657 C  CD  . PRO A 1 206 ? 22.118  -17.554 13.897  1.00 16.90 ? 207 PRO A CD  1 
ATOM   1658 N  N   . MET A 1 207 ? 19.838  -18.791 16.627  1.00 18.82 ? 208 MET A N   1 
ATOM   1659 C  CA  . MET A 1 207 ? 19.280  -19.090 17.944  1.00 20.28 ? 208 MET A CA  1 
ATOM   1660 C  C   . MET A 1 207 ? 17.801  -18.738 18.094  1.00 20.84 ? 208 MET A C   1 
ATOM   1661 O  O   . MET A 1 207 ? 17.168  -19.108 19.094  1.00 21.11 ? 208 MET A O   1 
ATOM   1662 C  CB  . MET A 1 207 ? 20.107  -18.448 19.060  1.00 20.03 ? 208 MET A CB  1 
ATOM   1663 C  CG  . MET A 1 207 ? 21.607  -18.667 18.899  1.00 21.18 ? 208 MET A CG  1 
ATOM   1664 S  SD  . MET A 1 207 ? 22.484  -18.033 20.328  1.00 20.50 ? 208 MET A SD  1 
ATOM   1665 C  CE  . MET A 1 207 ? 22.971  -19.576 21.036  1.00 25.73 ? 208 MET A CE  1 
ATOM   1666 N  N   . LEU A 1 208 ? 17.245  -18.041 17.105  1.00 21.46 ? 209 LEU A N   1 
ATOM   1667 C  CA  . LEU A 1 208 ? 15.820  -17.713 17.132  1.00 21.96 ? 209 LEU A CA  1 
ATOM   1668 C  C   . LEU A 1 208 ? 14.957  -18.976 17.057  1.00 22.08 ? 209 LEU A C   1 
ATOM   1669 O  O   . LEU A 1 208 ? 15.354  -19.993 16.461  1.00 22.26 ? 209 LEU A O   1 
ATOM   1670 C  CB  . LEU A 1 208 ? 15.454  -16.739 16.014  1.00 22.32 ? 209 LEU A CB  1 
ATOM   1671 C  CG  . LEU A 1 208 ? 15.923  -15.289 16.174  1.00 23.39 ? 209 LEU A CG  1 
ATOM   1672 C  CD1 . LEU A 1 208 ? 15.900  -14.609 14.814  1.00 24.23 ? 209 LEU A CD1 1 
ATOM   1673 C  CD2 . LEU A 1 208 ? 15.052  -14.520 17.179  1.00 23.81 ? 209 LEU A CD2 1 
ATOM   1674 N  N   . ASN A 1 209 ? 13.790  -18.893 17.686  1.00 21.79 ? 210 ASN A N   1 
ATOM   1675 C  CA  . ASN A 1 209 ? 12.807  -19.974 17.756  1.00 21.84 ? 210 ASN A CA  1 
ATOM   1676 C  C   . ASN A 1 209 ? 13.190  -21.096 18.728  1.00 21.66 ? 210 ASN A C   1 
ATOM   1677 O  O   . ASN A 1 209 ? 12.501  -22.118 18.815  1.00 21.92 ? 210 ASN A O   1 
ATOM   1678 C  CB  . ASN A 1 209 ? 12.457  -20.493 16.352  1.00 21.64 ? 210 ASN A CB  1 
ATOM   1679 C  CG  . ASN A 1 209 ? 11.937  -19.388 15.442  1.00 22.83 ? 210 ASN A CG  1 
ATOM   1680 O  OD1 . ASN A 1 209 ? 10.869  -18.822 15.687  1.00 23.14 ? 210 ASN A OD1 1 
ATOM   1681 N  ND2 . ASN A 1 209 ? 12.695  -19.069 14.396  1.00 21.46 ? 210 ASN A ND2 1 
ATOM   1682 N  N   . LEU A 1 210 ? 14.267  -20.880 19.481  1.00 21.44 ? 211 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 210 ? 14.744  -21.859 20.453  1.00 21.30 ? 211 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 210 ? 14.763  -21.286 21.864  1.00 21.34 ? 211 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 210 ? 15.093  -20.113 22.052  1.00 21.20 ? 211 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 210 ? 16.157  -22.352 20.086  1.00 21.38 ? 211 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 210 ? 16.430  -22.938 18.690  1.00 21.62 ? 211 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 210 ? 17.906  -23.303 18.552  1.00 21.23 ? 211 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 210 ? 15.541  -24.146 18.403  1.00 21.68 ? 211 LEU A CD2 1 
ATOM   1690 N  N   . PRO A 1 211 ? 14.425  -22.115 22.871  1.00 21.61 ? 212 PRO A N   1 
ATOM   1691 C  CA  . PRO A 1 211 ? 14.626  -21.669 24.259  1.00 21.66 ? 212 PRO A CA  1 
ATOM   1692 C  C   . PRO A 1 211 ? 16.129  -21.623 24.608  1.00 21.80 ? 212 PRO A C   1 
ATOM   1693 O  O   . PRO A 1 211 ? 16.920  -22.307 23.950  1.00 21.48 ? 212 PRO A O   1 
ATOM   1694 C  CB  . PRO A 1 211 ? 13.893  -22.731 25.085  1.00 21.78 ? 212 PRO A CB  1 
ATOM   1695 C  CG  . PRO A 1 211 ? 13.896  -23.961 24.229  1.00 22.01 ? 212 PRO A CG  1 
ATOM   1696 C  CD  . PRO A 1 211 ? 13.830  -23.466 22.793  1.00 21.50 ? 212 PRO A CD  1 
ATOM   1697 N  N   . PRO A 1 212 ? 16.521  -20.798 25.604  1.00 21.99 ? 213 PRO A N   1 
ATOM   1698 C  CA  . PRO A 1 212 ? 17.938  -20.679 25.963  1.00 22.70 ? 213 PRO A CA  1 
ATOM   1699 C  C   . PRO A 1 212 ? 18.596  -22.019 26.297  1.00 23.28 ? 213 PRO A C   1 
ATOM   1700 O  O   . PRO A 1 212 ? 19.749  -22.228 25.926  1.00 23.46 ? 213 PRO A O   1 
ATOM   1701 C  CB  . PRO A 1 212 ? 17.945  -19.733 27.185  1.00 22.68 ? 213 PRO A CB  1 
ATOM   1702 C  CG  . PRO A 1 212 ? 16.504  -19.468 27.532  1.00 22.41 ? 213 PRO A CG  1 
ATOM   1703 C  CD  . PRO A 1 212 ? 15.679  -19.827 26.330  1.00 22.13 ? 213 PRO A CD  1 
ATOM   1704 N  N   . ASP A 1 213 ? 17.860  -22.914 26.957  1.00 24.00 ? 214 ASP A N   1 
ATOM   1705 C  CA  . ASP A 1 213 ? 18.303  -24.293 27.221  1.00 24.90 ? 214 ASP A CA  1 
ATOM   1706 C  C   . ASP A 1 213 ? 18.829  -25.026 25.993  1.00 25.54 ? 214 ASP A C   1 
ATOM   1707 O  O   . ASP A 1 213 ? 19.690  -25.898 26.113  1.00 25.51 ? 214 ASP A O   1 
ATOM   1708 C  CB  . ASP A 1 213 ? 17.152  -25.128 27.785  1.00 24.99 ? 214 ASP A CB  1 
ATOM   1709 C  CG  . ASP A 1 213 ? 16.966  -24.954 29.280  1.00 25.61 ? 214 ASP A CG  1 
ATOM   1710 O  OD1 . ASP A 1 213 ? 17.843  -24.356 29.944  1.00 27.19 ? 214 ASP A OD1 1 
ATOM   1711 O  OD2 . ASP A 1 213 ? 15.925  -25.428 29.792  1.00 27.31 ? 214 ASP A OD2 1 
ATOM   1712 N  N   . LEU A 1 214 ? 18.287  -24.713 24.819  1.00 26.10 ? 215 LEU A N   1 
ATOM   1713 C  CA  . LEU A 1 214 ? 18.729  -25.393 23.598  1.00 26.82 ? 215 LEU A CA  1 
ATOM   1714 C  C   . LEU A 1 214 ? 19.863  -24.674 22.851  1.00 27.42 ? 215 LEU A C   1 
ATOM   1715 O  O   . LEU A 1 214 ? 20.573  -25.319 22.075  1.00 27.48 ? 215 LEU A O   1 
ATOM   1716 C  CB  . LEU A 1 214 ? 17.547  -25.739 22.677  1.00 26.67 ? 215 LEU A CB  1 
ATOM   1717 C  CG  . LEU A 1 214 ? 16.472  -26.670 23.257  1.00 27.53 ? 215 LEU A CG  1 
ATOM   1718 C  CD1 . LEU A 1 214 ? 15.427  -27.036 22.212  1.00 28.12 ? 215 LEU A CD1 1 
ATOM   1719 C  CD2 . LEU A 1 214 ? 17.052  -27.958 23.887  1.00 27.52 ? 215 LEU A CD2 1 
ATOM   1720 N  N   . PHE A 1 215 ? 20.049  -23.369 23.124  1.00 27.97 ? 216 PHE A N   1 
ATOM   1721 C  CA  . PHE A 1 215 ? 21.118  -22.541 22.518  1.00 27.87 ? 216 PHE A CA  1 
ATOM   1722 C  C   . PHE A 1 215 ? 22.443  -23.187 22.681  1.00 28.06 ? 216 PHE A C   1 
ATOM   1723 O  O   . PHE A 1 215 ? 23.111  -23.543 21.718  1.00 28.32 ? 216 PHE A O   1 
ATOM   1724 C  CB  . PHE A 1 215 ? 21.367  -21.211 23.263  1.00 27.94 ? 216 PHE A CB  1 
ATOM   1725 C  CG  . PHE A 1 215 ? 20.277  -20.212 23.181  1.00 25.77 ? 216 PHE A CG  1 
ATOM   1726 C  CD1 . PHE A 1 215 ? 20.350  -19.071 23.980  1.00 24.74 ? 216 PHE A CD1 1 
ATOM   1727 C  CD2 . PHE A 1 215 ? 19.186  -20.391 22.361  1.00 23.17 ? 216 PHE A CD2 1 
ATOM   1728 C  CE1 . PHE A 1 215 ? 19.353  -18.126 23.951  1.00 23.08 ? 216 PHE A CE1 1 
ATOM   1729 C  CE2 . PHE A 1 215 ? 18.181  -19.447 22.331  1.00 22.89 ? 216 PHE A CE2 1 
ATOM   1730 C  CZ  . PHE A 1 215 ? 18.267  -18.313 23.121  1.00 22.47 ? 216 PHE A CZ  1 
ATOM   1731 N  N   . ARG A 1 216 ? 22.843  -23.260 23.947  1.00 28.43 ? 217 ARG A N   1 
ATOM   1732 C  CA  . ARG A 1 216 ? 24.176  -23.676 24.331  1.00 28.37 ? 217 ARG A CA  1 
ATOM   1733 C  C   . ARG A 1 216 ? 24.404  -25.129 24.020  1.00 27.82 ? 217 ARG A C   1 
ATOM   1734 O  O   . ARG A 1 216 ? 25.546  -25.574 23.939  1.00 28.78 ? 217 ARG A O   1 
ATOM   1735 C  CB  . ARG A 1 216 ? 24.428  -23.399 25.821  1.00 29.24 ? 217 ARG A CB  1 
ATOM   1736 C  CG  . ARG A 1 216 ? 23.219  -23.618 26.723  1.00 29.75 ? 217 ARG A CG  1 
ATOM   1737 C  CD  . ARG A 1 216 ? 23.643  -24.284 28.043  1.00 31.60 ? 217 ARG A CD  1 
ATOM   1738 N  NE  . ARG A 1 216 ? 22.548  -24.297 29.016  1.00 32.88 ? 217 ARG A NE  1 
ATOM   1739 C  CZ  . ARG A 1 216 ? 21.576  -25.210 29.062  1.00 34.06 ? 217 ARG A CZ  1 
ATOM   1740 N  NH1 . ARG A 1 216 ? 21.539  -26.225 28.188  1.00 32.57 ? 217 ARG A NH1 1 
ATOM   1741 N  NH2 . ARG A 1 216 ? 20.632  -25.103 29.992  1.00 33.64 ? 217 ARG A NH2 1 
ATOM   1742 N  N   . LEU A 1 217 ? 23.315  -25.864 23.828  1.00 26.98 ? 218 LEU A N   1 
ATOM   1743 C  CA  . LEU A 1 217 ? 23.392  -27.290 23.553  1.00 25.93 ? 218 LEU A CA  1 
ATOM   1744 C  C   . LEU A 1 217 ? 23.572  -27.580 22.061  1.00 25.10 ? 218 LEU A C   1 
ATOM   1745 O  O   . LEU A 1 217 ? 24.381  -28.432 21.686  1.00 25.45 ? 218 LEU A O   1 
ATOM   1746 C  CB  . LEU A 1 217 ? 22.155  -27.994 24.135  1.00 26.09 ? 218 LEU A CB  1 
ATOM   1747 C  CG  . LEU A 1 217 ? 22.231  -29.474 24.516  1.00 25.92 ? 218 LEU A CG  1 
ATOM   1748 C  CD1 . LEU A 1 217 ? 23.464  -29.788 25.350  1.00 25.48 ? 218 LEU A CD1 1 
ATOM   1749 C  CD2 . LEU A 1 217 ? 20.983  -29.869 25.265  1.00 26.08 ? 218 LEU A CD2 1 
ATOM   1750 N  N   . PHE A 1 218 ? 22.849  -26.853 21.207  1.00 23.88 ? 219 PHE A N   1 
ATOM   1751 C  CA  . PHE A 1 218 ? 22.897  -27.096 19.759  1.00 22.63 ? 219 PHE A CA  1 
ATOM   1752 C  C   . PHE A 1 218 ? 23.458  -25.938 18.924  1.00 21.96 ? 219 PHE A C   1 
ATOM   1753 O  O   . PHE A 1 218 ? 23.648  -26.075 17.719  1.00 21.52 ? 219 PHE A O   1 
ATOM   1754 C  CB  . PHE A 1 218 ? 21.510  -27.482 19.237  1.00 22.31 ? 219 PHE A CB  1 
ATOM   1755 C  CG  . PHE A 1 218 ? 20.968  -28.738 19.836  1.00 22.56 ? 219 PHE A CG  1 
ATOM   1756 C  CD1 . PHE A 1 218 ? 19.852  -28.698 20.675  1.00 22.62 ? 219 PHE A CD1 1 
ATOM   1757 C  CD2 . PHE A 1 218 ? 21.574  -29.967 19.572  1.00 22.72 ? 219 PHE A CD2 1 
ATOM   1758 C  CE1 . PHE A 1 218 ? 19.336  -29.866 21.243  1.00 22.61 ? 219 PHE A CE1 1 
ATOM   1759 C  CE2 . PHE A 1 218 ? 21.073  -31.137 20.136  1.00 23.56 ? 219 PHE A CE2 1 
ATOM   1760 C  CZ  . PHE A 1 218 ? 19.945  -31.085 20.978  1.00 22.72 ? 219 PHE A CZ  1 
ATOM   1761 N  N   . ARG A 1 219 ? 23.708  -24.800 19.562  1.00 21.22 ? 220 ARG A N   1 
ATOM   1762 C  CA  . ARG A 1 219 ? 24.231  -23.625 18.867  1.00 20.78 ? 220 ARG A CA  1 
ATOM   1763 C  C   . ARG A 1 219 ? 25.360  -23.022 19.691  1.00 20.91 ? 220 ARG A C   1 
ATOM   1764 O  O   . ARG A 1 219 ? 25.451  -21.805 19.843  1.00 20.51 ? 220 ARG A O   1 
ATOM   1765 C  CB  . ARG A 1 219 ? 23.115  -22.588 18.643  1.00 20.60 ? 220 ARG A CB  1 
ATOM   1766 C  CG  . ARG A 1 219 ? 21.961  -23.050 17.747  1.00 19.92 ? 220 ARG A CG  1 
ATOM   1767 C  CD  . ARG A 1 219 ? 22.411  -23.177 16.306  1.00 18.29 ? 220 ARG A CD  1 
ATOM   1768 N  NE  . ARG A 1 219 ? 21.296  -23.476 15.410  1.00 19.29 ? 220 ARG A NE  1 
ATOM   1769 C  CZ  . ARG A 1 219 ? 21.023  -24.688 14.943  1.00 19.92 ? 220 ARG A CZ  1 
ATOM   1770 N  NH1 . ARG A 1 219 ? 21.782  -25.722 15.282  1.00 19.82 ? 220 ARG A NH1 1 
ATOM   1771 N  NH2 . ARG A 1 219 ? 19.993  -24.869 14.136  1.00 20.54 ? 220 ARG A NH2 1 
ATOM   1772 N  N   . THR A 1 220 ? 26.216  -23.893 20.221  1.00 21.08 ? 221 THR A N   1 
ATOM   1773 C  CA  . THR A 1 220 ? 27.259  -23.498 21.180  1.00 21.43 ? 221 THR A CA  1 
ATOM   1774 C  C   . THR A 1 220 ? 28.255  -22.507 20.582  1.00 20.78 ? 221 THR A C   1 
ATOM   1775 O  O   . THR A 1 220 ? 28.597  -21.520 21.228  1.00 20.66 ? 221 THR A O   1 
ATOM   1776 C  CB  . THR A 1 220 ? 28.015  -24.732 21.773  1.00 21.49 ? 221 THR A CB  1 
ATOM   1777 O  OG1 . THR A 1 220 ? 27.066  -25.738 22.159  1.00 21.93 ? 221 THR A OG1 1 
ATOM   1778 C  CG2 . THR A 1 220 ? 28.839  -24.333 23.005  1.00 22.03 ? 221 THR A CG2 1 
ATOM   1779 N  N   . LYS A 1 221 ? 28.711  -22.777 19.362  1.00 20.90 ? 222 LYS A N   1 
ATOM   1780 C  CA  . LYS A 1 221 ? 29.638  -21.884 18.659  1.00 21.19 ? 222 LYS A CA  1 
ATOM   1781 C  C   . LYS A 1 221 ? 29.024  -20.498 18.413  1.00 20.81 ? 222 LYS A C   1 
ATOM   1782 O  O   . LYS A 1 221 ? 29.683  -19.472 18.607  1.00 20.98 ? 222 LYS A O   1 
ATOM   1783 C  CB  . LYS A 1 221 ? 30.084  -22.500 17.325  1.00 21.71 ? 222 LYS A CB  1 
ATOM   1784 C  CG  . LYS A 1 221 ? 31.214  -21.734 16.642  1.00 24.33 ? 222 LYS A CG  1 
ATOM   1785 C  CD  . LYS A 1 221 ? 31.555  -22.279 15.261  1.00 28.86 ? 222 LYS A CD  1 
ATOM   1786 C  CE  . LYS A 1 221 ? 32.812  -21.592 14.721  1.00 31.94 ? 222 LYS A CE  1 
ATOM   1787 N  NZ  . LYS A 1 221 ? 33.555  -22.390 13.683  1.00 33.92 ? 222 LYS A NZ  1 
ATOM   1788 N  N   . THR A 1 222 ? 27.767  -20.484 17.973  1.00 20.17 ? 223 THR A N   1 
ATOM   1789 C  CA  . THR A 1 222 ? 27.066  -19.244 17.657  1.00 19.64 ? 223 THR A CA  1 
ATOM   1790 C  C   . THR A 1 222 ? 26.846  -18.406 18.920  1.00 19.27 ? 223 THR A C   1 
ATOM   1791 O  O   . THR A 1 222 ? 27.070  -17.195 18.911  1.00 18.64 ? 223 THR A O   1 
ATOM   1792 C  CB  . THR A 1 222 ? 25.741  -19.536 16.923  1.00 19.53 ? 223 THR A CB  1 
ATOM   1793 O  OG1 . THR A 1 222 ? 26.034  -20.084 15.627  1.00 19.86 ? 223 THR A OG1 1 
ATOM   1794 C  CG2 . THR A 1 222 ? 24.913  -18.270 16.755  1.00 19.65 ? 223 THR A CG2 1 
ATOM   1795 N  N   . TRP A 1 223 ? 26.433  -19.073 19.999  1.00 18.89 ? 224 TRP A N   1 
ATOM   1796 C  CA  . TRP A 1 223 ? 26.225  -18.436 21.290  1.00 19.06 ? 224 TRP A CA  1 
ATOM   1797 C  C   . TRP A 1 223 ? 27.505  -17.776 21.791  1.00 19.50 ? 224 TRP A C   1 
ATOM   1798 O  O   . TRP A 1 223 ? 27.479  -16.623 22.228  1.00 18.84 ? 224 TRP A O   1 
ATOM   1799 C  CB  . TRP A 1 223 ? 25.697  -19.453 22.305  1.00 18.90 ? 224 TRP A CB  1 
ATOM   1800 C  CG  . TRP A 1 223 ? 25.622  -18.957 23.723  1.00 18.10 ? 224 TRP A CG  1 
ATOM   1801 C  CD1 . TRP A 1 223 ? 26.339  -19.424 24.775  1.00 17.49 ? 224 TRP A CD1 1 
ATOM   1802 C  CD2 . TRP A 1 223 ? 24.781  -17.909 24.240  1.00 17.11 ? 224 TRP A CD2 1 
ATOM   1803 N  NE1 . TRP A 1 223 ? 26.009  -18.741 25.916  1.00 18.62 ? 224 TRP A NE1 1 
ATOM   1804 C  CE2 . TRP A 1 223 ? 25.056  -17.802 25.618  1.00 18.10 ? 224 TRP A CE2 1 
ATOM   1805 C  CE3 . TRP A 1 223 ? 23.830  -17.046 23.672  1.00 17.63 ? 224 TRP A CE3 1 
ATOM   1806 C  CZ2 . TRP A 1 223 ? 24.409  -16.866 26.451  1.00 17.55 ? 224 TRP A CZ2 1 
ATOM   1807 C  CZ3 . TRP A 1 223 ? 23.184  -16.114 24.496  1.00 16.33 ? 224 TRP A CZ3 1 
ATOM   1808 C  CH2 . TRP A 1 223 ? 23.478  -16.036 25.872  1.00 16.73 ? 224 TRP A CH2 1 
ATOM   1809 N  N   . LYS A 1 224 ? 28.617  -18.509 21.704  1.00 19.94 ? 225 LYS A N   1 
ATOM   1810 C  CA  . LYS A 1 224 ? 29.923  -17.992 22.091  1.00 20.48 ? 225 LYS A CA  1 
ATOM   1811 C  C   . LYS A 1 224 ? 30.298  -16.730 21.290  1.00 20.00 ? 225 LYS A C   1 
ATOM   1812 O  O   . LYS A 1 224 ? 30.811  -15.763 21.860  1.00 19.83 ? 225 LYS A O   1 
ATOM   1813 C  CB  . LYS A 1 224 ? 30.991  -19.080 21.918  1.00 21.06 ? 225 LYS A CB  1 
ATOM   1814 C  CG  . LYS A 1 224 ? 32.360  -18.720 22.483  1.00 24.08 ? 225 LYS A CG  1 
ATOM   1815 C  CD  . LYS A 1 224 ? 33.439  -19.746 22.110  1.00 27.74 ? 225 LYS A CD  1 
ATOM   1816 C  CE  . LYS A 1 224 ? 34.785  -19.352 22.724  1.00 30.13 ? 225 LYS A CE  1 
ATOM   1817 N  NZ  . LYS A 1 224 ? 35.903  -20.213 22.233  1.00 32.48 ? 225 LYS A NZ  1 
ATOM   1818 N  N   . ASP A 1 225 ? 30.059  -16.754 19.976  1.00 19.23 ? 226 ASP A N   1 
ATOM   1819 C  CA  . ASP A 1 225 ? 30.352  -15.611 19.099  1.00 18.91 ? 226 ASP A CA  1 
ATOM   1820 C  C   . ASP A 1 225 ? 29.442  -14.419 19.406  1.00 18.13 ? 226 ASP A C   1 
ATOM   1821 O  O   . ASP A 1 225 ? 29.853  -13.257 19.317  1.00 18.49 ? 226 ASP A O   1 
ATOM   1822 C  CB  . ASP A 1 225 ? 30.188  -16.013 17.631  1.00 19.23 ? 226 ASP A CB  1 
ATOM   1823 C  CG  . ASP A 1 225 ? 31.270  -16.984 17.157  1.00 20.91 ? 226 ASP A CG  1 
ATOM   1824 O  OD1 . ASP A 1 225 ? 32.252  -17.215 17.898  1.00 22.67 ? 226 ASP A OD1 1 
ATOM   1825 O  OD2 . ASP A 1 225 ? 31.144  -17.509 16.031  1.00 21.67 ? 226 ASP A OD2 1 
ATOM   1826 N  N   . HIS A 1 226 ? 28.203  -14.735 19.748  1.00 16.90 ? 227 HIS A N   1 
ATOM   1827 C  CA  . HIS A 1 226 ? 27.188  -13.762 20.101  1.00 16.52 ? 227 HIS A CA  1 
ATOM   1828 C  C   . HIS A 1 226 ? 27.527  -13.056 21.411  1.00 16.52 ? 227 HIS A C   1 
ATOM   1829 O  O   . HIS A 1 226 ? 27.392  -11.827 21.521  1.00 16.64 ? 227 HIS A O   1 
ATOM   1830 C  CB  . HIS A 1 226 ? 25.842  -14.467 20.239  1.00 15.39 ? 227 HIS A CB  1 
ATOM   1831 C  CG  . HIS A 1 226 ? 24.695  -13.535 20.439  1.00 14.51 ? 227 HIS A CG  1 
ATOM   1832 N  ND1 . HIS A 1 226 ? 24.197  -12.746 19.425  1.00 12.34 ? 227 HIS A ND1 1 
ATOM   1833 C  CD2 . HIS A 1 226 ? 23.937  -13.274 21.528  1.00 12.90 ? 227 HIS A CD2 1 
ATOM   1834 C  CE1 . HIS A 1 226 ? 23.185  -12.034 19.885  1.00 11.87 ? 227 HIS A CE1 1 
ATOM   1835 N  NE2 . HIS A 1 226 ? 23.007  -12.335 21.156  1.00 12.27 ? 227 HIS A NE2 1 
ATOM   1836 N  N   . VAL A 1 227 ? 27.947  -13.843 22.400  1.00 16.48 ? 228 VAL A N   1 
ATOM   1837 C  CA  . VAL A 1 227 ? 28.392  -13.321 23.691  1.00 16.21 ? 228 VAL A CA  1 
ATOM   1838 C  C   . VAL A 1 227 ? 29.584  -12.387 23.490  1.00 16.01 ? 228 VAL A C   1 
ATOM   1839 O  O   . VAL A 1 227 ? 29.622  -11.316 24.081  1.00 16.27 ? 228 VAL A O   1 
ATOM   1840 C  CB  . VAL A 1 227 ? 28.720  -14.455 24.704  1.00 16.36 ? 228 VAL A CB  1 
ATOM   1841 C  CG1 . VAL A 1 227 ? 29.418  -13.900 25.966  1.00 15.37 ? 228 VAL A CG1 1 
ATOM   1842 C  CG2 . VAL A 1 227 ? 27.448  -15.187 25.107  1.00 16.90 ? 228 VAL A CG2 1 
ATOM   1843 N  N   . ALA A 1 228 ? 30.527  -12.782 22.633  1.00 15.66 ? 229 ALA A N   1 
ATOM   1844 C  CA  . ALA A 1 228 ? 31.719  -11.984 22.362  1.00 15.44 ? 229 ALA A CA  1 
ATOM   1845 C  C   . ALA A 1 228 ? 31.383  -10.638 21.714  1.00 15.42 ? 229 ALA A C   1 
ATOM   1846 O  O   . ALA A 1 228 ? 32.040  -9.643  22.002  1.00 15.45 ? 229 ALA A O   1 
ATOM   1847 C  CB  . ALA A 1 228 ? 32.713  -12.753 21.482  1.00 15.38 ? 229 ALA A CB  1 
ATOM   1848 N  N   . ALA A 1 229 ? 30.376  -10.626 20.838  1.00 15.10 ? 230 ALA A N   1 
ATOM   1849 C  CA  . ALA A 1 229 ? 29.940  -9.405  20.149  1.00 14.87 ? 230 ALA A CA  1 
ATOM   1850 C  C   . ALA A 1 229 ? 29.293  -8.419  21.126  1.00 14.88 ? 230 ALA A C   1 
ATOM   1851 O  O   . ALA A 1 229 ? 29.666  -7.248  21.159  1.00 15.36 ? 230 ALA A O   1 
ATOM   1852 C  CB  . ALA A 1 229 ? 29.000  -9.740  18.963  1.00 13.40 ? 230 ALA A CB  1 
ATOM   1853 N  N   . TRP A 1 230 ? 28.357  -8.896  21.941  1.00 15.25 ? 231 TRP A N   1 
ATOM   1854 C  CA  . TRP A 1 230 ? 27.785  -8.065  23.005  1.00 15.98 ? 231 TRP A CA  1 
ATOM   1855 C  C   . TRP A 1 230 ? 28.835  -7.507  23.991  1.00 16.82 ? 231 TRP A C   1 
ATOM   1856 O  O   . TRP A 1 230 ? 28.725  -6.346  24.405  1.00 16.73 ? 231 TRP A O   1 
ATOM   1857 C  CB  . TRP A 1 230 ? 26.721  -8.828  23.780  1.00 15.79 ? 231 TRP A CB  1 
ATOM   1858 C  CG  . TRP A 1 230 ? 25.334  -8.819  23.201  1.00 15.46 ? 231 TRP A CG  1 
ATOM   1859 C  CD1 . TRP A 1 230 ? 24.642  -9.903  22.746  1.00 15.96 ? 231 TRP A CD1 1 
ATOM   1860 C  CD2 . TRP A 1 230 ? 24.450  -7.694  23.066  1.00 16.29 ? 231 TRP A CD2 1 
ATOM   1861 N  NE1 . TRP A 1 230 ? 23.398  -9.527  22.318  1.00 17.59 ? 231 TRP A NE1 1 
ATOM   1862 C  CE2 . TRP A 1 230 ? 23.243  -8.179  22.511  1.00 16.31 ? 231 TRP A CE2 1 
ATOM   1863 C  CE3 . TRP A 1 230 ? 24.560  -6.322  23.354  1.00 15.51 ? 231 TRP A CE3 1 
ATOM   1864 C  CZ2 . TRP A 1 230 ? 22.157  -7.346  22.224  1.00 15.66 ? 231 TRP A CZ2 1 
ATOM   1865 C  CZ3 . TRP A 1 230 ? 23.476  -5.491  23.081  1.00 15.23 ? 231 TRP A CZ3 1 
ATOM   1866 C  CH2 . TRP A 1 230 ? 22.286  -6.007  22.523  1.00 16.17 ? 231 TRP A CH2 1 
ATOM   1867 N  N   . ASP A 1 231 ? 29.843  -8.319  24.347  1.00 17.43 ? 232 ASP A N   1 
ATOM   1868 C  CA  . ASP A 1 231 ? 30.937  -7.876  25.239  1.00 18.52 ? 232 ASP A CA  1 
ATOM   1869 C  C   . ASP A 1 231 ? 31.717  -6.678  24.690  1.00 18.59 ? 232 ASP A C   1 
ATOM   1870 O  O   . ASP A 1 231 ? 32.085  -5.780  25.447  1.00 18.66 ? 232 ASP A O   1 
ATOM   1871 C  CB  . ASP A 1 231 ? 31.912  -9.020  25.572  1.00 18.83 ? 232 ASP A CB  1 
ATOM   1872 C  CG  . ASP A 1 231 ? 31.374  -9.976  26.642  1.00 20.64 ? 232 ASP A CG  1 
ATOM   1873 O  OD1 . ASP A 1 231 ? 30.404  -9.633  27.360  1.00 22.62 ? 232 ASP A OD1 1 
ATOM   1874 O  OD2 . ASP A 1 231 ? 31.938  -11.089 26.770  1.00 24.31 ? 232 ASP A OD2 1 
ATOM   1875 N  N   . VAL A 1 232 ? 31.966  -6.676  23.381  1.00 18.76 ? 233 VAL A N   1 
ATOM   1876 C  CA  . VAL A 1 232 ? 32.590  -5.541  22.698  1.00 18.56 ? 233 VAL A CA  1 
ATOM   1877 C  C   . VAL A 1 232 ? 31.669  -4.318  22.769  1.00 19.03 ? 233 VAL A C   1 
ATOM   1878 O  O   . VAL A 1 232 ? 32.100  -3.235  23.179  1.00 18.98 ? 233 VAL A O   1 
ATOM   1879 C  CB  . VAL A 1 232 ? 32.949  -5.889  21.221  1.00 18.94 ? 233 VAL A CB  1 
ATOM   1880 C  CG1 . VAL A 1 232 ? 33.509  -4.683  20.478  1.00 17.93 ? 233 VAL A CG1 1 
ATOM   1881 C  CG2 . VAL A 1 232 ? 33.950  -7.058  21.154  1.00 18.35 ? 233 VAL A CG2 1 
ATOM   1882 N  N   . ILE A 1 233 ? 30.402  -4.499  22.386  1.00 19.08 ? 234 ILE A N   1 
ATOM   1883 C  CA  . ILE A 1 233 ? 29.405  -3.435  22.464  1.00 19.30 ? 234 ILE A CA  1 
ATOM   1884 C  C   . ILE A 1 233 ? 29.396  -2.772  23.851  1.00 19.92 ? 234 ILE A C   1 
ATOM   1885 O  O   . ILE A 1 233 ? 29.509  -1.547  23.953  1.00 19.75 ? 234 ILE A O   1 
ATOM   1886 C  CB  . ILE A 1 233 ? 27.975  -3.939  22.079  1.00 19.12 ? 234 ILE A CB  1 
ATOM   1887 C  CG1 . ILE A 1 233 ? 27.932  -4.367  20.605  1.00 18.92 ? 234 ILE A CG1 1 
ATOM   1888 C  CG2 . ILE A 1 233 ? 26.918  -2.866  22.373  1.00 17.92 ? 234 ILE A CG2 1 
ATOM   1889 C  CD1 . ILE A 1 233 ? 26.755  -5.225  20.239  1.00 16.91 ? 234 ILE A CD1 1 
ATOM   1890 N  N   . PHE A 1 234 ? 29.280  -3.585  24.902  1.00 20.75 ? 235 PHE A N   1 
ATOM   1891 C  CA  . PHE A 1 234 ? 29.234  -3.082  26.275  1.00 21.60 ? 235 PHE A CA  1 
ATOM   1892 C  C   . PHE A 1 234 ? 30.544  -2.471  26.756  1.00 22.16 ? 235 PHE A C   1 
ATOM   1893 O  O   . PHE A 1 234 ? 30.520  -1.420  27.394  1.00 22.53 ? 235 PHE A O   1 
ATOM   1894 C  CB  . PHE A 1 234 ? 28.750  -4.156  27.259  1.00 21.65 ? 235 PHE A CB  1 
ATOM   1895 C  CG  . PHE A 1 234 ? 27.258  -4.209  27.400  1.00 22.08 ? 235 PHE A CG  1 
ATOM   1896 C  CD1 . PHE A 1 234 ? 26.506  -5.101  26.640  1.00 22.07 ? 235 PHE A CD1 1 
ATOM   1897 C  CD2 . PHE A 1 234 ? 26.599  -3.349  28.276  1.00 23.05 ? 235 PHE A CD2 1 
ATOM   1898 C  CE1 . PHE A 1 234 ? 25.119  -5.149  26.761  1.00 22.14 ? 235 PHE A CE1 1 
ATOM   1899 C  CE2 . PHE A 1 234 ? 25.210  -3.386  28.405  1.00 23.15 ? 235 PHE A CE2 1 
ATOM   1900 C  CZ  . PHE A 1 234 ? 24.468  -4.294  27.643  1.00 22.18 ? 235 PHE A CZ  1 
ATOM   1901 N  N   . SER A 1 235 ? 31.673  -3.112  26.455  1.00 22.65 ? 236 SER A N   1 
ATOM   1902 C  CA  . SER A 1 235 ? 32.975  -2.565  26.839  1.00 23.56 ? 236 SER A CA  1 
ATOM   1903 C  C   . SER A 1 235 ? 33.152  -1.134  26.348  1.00 23.52 ? 236 SER A C   1 
ATOM   1904 O  O   . SER A 1 235 ? 33.453  -0.239  27.127  1.00 23.65 ? 236 SER A O   1 
ATOM   1905 C  CB  . SER A 1 235 ? 34.116  -3.399  26.268  1.00 23.21 ? 236 SER A CB  1 
ATOM   1906 O  OG  . SER A 1 235 ? 34.164  -4.650  26.890  1.00 26.35 ? 236 SER A OG  1 
ATOM   1907 N  N   . LYS A 1 236 ? 32.961  -0.939  25.047  1.00 23.56 ? 237 LYS A N   1 
ATOM   1908 C  CA  . LYS A 1 236 ? 33.272  0.329   24.407  1.00 23.80 ? 237 LYS A CA  1 
ATOM   1909 C  C   . LYS A 1 236 ? 32.261  1.421   24.733  1.00 23.65 ? 237 LYS A C   1 
ATOM   1910 O  O   . LYS A 1 236 ? 32.647  2.573   24.969  1.00 23.13 ? 237 LYS A O   1 
ATOM   1911 C  CB  . LYS A 1 236 ? 33.465  0.142   22.903  1.00 23.70 ? 237 LYS A CB  1 
ATOM   1912 C  CG  . LYS A 1 236 ? 34.682  -0.733  22.612  1.00 25.32 ? 237 LYS A CG  1 
ATOM   1913 C  CD  . LYS A 1 236 ? 34.882  -1.011  21.142  1.00 27.42 ? 237 LYS A CD  1 
ATOM   1914 C  CE  . LYS A 1 236 ? 36.100  -1.910  20.924  1.00 28.45 ? 237 LYS A CE  1 
ATOM   1915 N  NZ  . LYS A 1 236 ? 37.356  -1.294  21.437  1.00 29.87 ? 237 LYS A NZ  1 
ATOM   1916 N  N   . ALA A 1 237 ? 30.979  1.059   24.772  1.00 23.64 ? 238 ALA A N   1 
ATOM   1917 C  CA  . ALA A 1 237 ? 29.942  2.015   25.159  1.00 23.93 ? 238 ALA A CA  1 
ATOM   1918 C  C   . ALA A 1 237 ? 30.200  2.523   26.584  1.00 24.04 ? 238 ALA A C   1 
ATOM   1919 O  O   . ALA A 1 237 ? 30.107  3.719   26.851  1.00 23.53 ? 238 ALA A O   1 
ATOM   1920 C  CB  . ALA A 1 237 ? 28.554  1.383   25.056  1.00 23.73 ? 238 ALA A CB  1 
ATOM   1921 N  N   . ASP A 1 238 ? 30.527  1.601   27.484  1.00 24.41 ? 239 ASP A N   1 
ATOM   1922 C  CA  . ASP A 1 238 ? 30.834  1.940   28.870  1.00 25.47 ? 239 ASP A CA  1 
ATOM   1923 C  C   . ASP A 1 238 ? 32.075  2.835   28.992  1.00 24.85 ? 239 ASP A C   1 
ATOM   1924 O  O   . ASP A 1 238 ? 32.060  3.797   29.745  1.00 24.53 ? 239 ASP A O   1 
ATOM   1925 C  CB  . ASP A 1 238 ? 30.964  0.671   29.721  1.00 25.95 ? 239 ASP A CB  1 
ATOM   1926 C  CG  . ASP A 1 238 ? 29.609  0.009   30.006  1.00 29.94 ? 239 ASP A CG  1 
ATOM   1927 O  OD1 . ASP A 1 238 ? 28.629  0.220   29.236  1.00 34.24 ? 239 ASP A OD1 1 
ATOM   1928 O  OD2 . ASP A 1 238 ? 29.516  -0.733  31.006  1.00 33.41 ? 239 ASP A OD2 1 
ATOM   1929 N  N   . ILE A 1 239 ? 33.127  2.539   28.233  1.00 24.58 ? 240 ILE A N   1 
ATOM   1930 C  CA  . ILE A 1 239 ? 34.315  3.408   28.189  1.00 24.28 ? 240 ILE A CA  1 
ATOM   1931 C  C   . ILE A 1 239 ? 33.985  4.831   27.692  1.00 24.07 ? 240 ILE A C   1 
ATOM   1932 O  O   . ILE A 1 239 ? 34.456  5.828   28.263  1.00 23.54 ? 240 ILE A O   1 
ATOM   1933 C  CB  . ILE A 1 239 ? 35.433  2.782   27.337  1.00 24.50 ? 240 ILE A CB  1 
ATOM   1934 C  CG1 . ILE A 1 239 ? 36.036  1.573   28.064  1.00 24.80 ? 240 ILE A CG1 1 
ATOM   1935 C  CG2 . ILE A 1 239 ? 36.516  3.828   26.978  1.00 25.02 ? 240 ILE A CG2 1 
ATOM   1936 C  CD1 . ILE A 1 239 ? 36.935  0.695   27.172  1.00 26.63 ? 240 ILE A CD1 1 
ATOM   1937 N  N   . TYR A 1 240 ? 33.172  4.915   26.640  1.00 23.63 ? 241 TYR A N   1 
ATOM   1938 C  CA  . TYR A 1 240 ? 32.725  6.197   26.106  1.00 23.67 ? 241 TYR A CA  1 
ATOM   1939 C  C   . TYR A 1 240 ? 31.956  7.000   27.152  1.00 22.96 ? 241 TYR A C   1 
ATOM   1940 O  O   . TYR A 1 240 ? 32.223  8.178   27.348  1.00 22.23 ? 241 TYR A O   1 
ATOM   1941 C  CB  . TYR A 1 240 ? 31.848  6.004   24.865  1.00 23.91 ? 241 TYR A CB  1 
ATOM   1942 C  CG  . TYR A 1 240 ? 32.587  5.647   23.591  1.00 26.40 ? 241 TYR A CG  1 
ATOM   1943 C  CD1 . TYR A 1 240 ? 32.016  4.772   22.664  1.00 27.96 ? 241 TYR A CD1 1 
ATOM   1944 C  CD2 . TYR A 1 240 ? 33.851  6.180   23.306  1.00 28.94 ? 241 TYR A CD2 1 
ATOM   1945 C  CE1 . TYR A 1 240 ? 32.675  4.428   21.489  1.00 29.71 ? 241 TYR A CE1 1 
ATOM   1946 C  CE2 . TYR A 1 240 ? 34.525  5.842   22.120  1.00 30.89 ? 241 TYR A CE2 1 
ATOM   1947 C  CZ  . TYR A 1 240 ? 33.923  4.963   21.219  1.00 31.31 ? 241 TYR A CZ  1 
ATOM   1948 O  OH  . TYR A 1 240 ? 34.555  4.619   20.044  1.00 33.01 ? 241 TYR A OH  1 
ATOM   1949 N  N   . THR A 1 241 ? 31.006  6.349   27.814  1.00 22.71 ? 242 THR A N   1 
ATOM   1950 C  CA  . THR A 1 241 ? 30.195  6.995   28.846  1.00 22.95 ? 242 THR A CA  1 
ATOM   1951 C  C   . THR A 1 241 ? 31.045  7.423   30.048  1.00 23.07 ? 242 THR A C   1 
ATOM   1952 O  O   . THR A 1 241 ? 30.889  8.536   30.539  1.00 23.08 ? 242 THR A O   1 
ATOM   1953 C  CB  . THR A 1 241 ? 29.025  6.090   29.292  1.00 22.81 ? 242 THR A CB  1 
ATOM   1954 O  OG1 . THR A 1 241 ? 28.258  5.715   28.142  1.00 23.42 ? 242 THR A OG1 1 
ATOM   1955 C  CG2 . THR A 1 241 ? 28.108  6.808   30.286  1.00 22.06 ? 242 THR A CG2 1 
ATOM   1956 N  N   . GLN A 1 242 ? 31.944  6.543   30.491  1.00 23.38 ? 243 GLN A N   1 
ATOM   1957 C  CA  . GLN A 1 242 ? 32.843  6.810   31.617  1.00 24.14 ? 243 GLN A CA  1 
ATOM   1958 C  C   . GLN A 1 242 ? 33.771  7.995   31.354  1.00 23.43 ? 243 GLN A C   1 
ATOM   1959 O  O   . GLN A 1 242 ? 33.846  8.908   32.176  1.00 23.39 ? 243 GLN A O   1 
ATOM   1960 C  CB  . GLN A 1 242 ? 33.658  5.558   31.982  1.00 24.39 ? 243 GLN A CB  1 
ATOM   1961 C  CG  . GLN A 1 242 ? 32.897  4.561   32.864  1.00 28.37 ? 243 GLN A CG  1 
ATOM   1962 C  CD  . GLN A 1 242 ? 33.461  3.131   32.840  1.00 31.91 ? 243 GLN A CD  1 
ATOM   1963 O  OE1 . GLN A 1 242 ? 34.581  2.876   32.376  1.00 33.57 ? 243 GLN A OE1 1 
ATOM   1964 N  NE2 . GLN A 1 242 ? 32.667  2.191   33.339  1.00 33.30 ? 243 GLN A NE2 1 
ATOM   1965 N  N   . ASN A 1 243 ? 34.470  7.970   30.219  1.00 22.94 ? 244 ASN A N   1 
ATOM   1966 C  CA  . ASN A 1 243 ? 35.309  9.090   29.787  1.00 22.95 ? 244 ASN A CA  1 
ATOM   1967 C  C   . ASN A 1 243 ? 34.547  10.416  29.718  1.00 22.51 ? 244 ASN A C   1 
ATOM   1968 O  O   . ASN A 1 243 ? 35.036  11.431  30.194  1.00 22.75 ? 244 ASN A O   1 
ATOM   1969 C  CB  . ASN A 1 243 ? 35.983  8.802   28.441  1.00 22.77 ? 244 ASN A CB  1 
ATOM   1970 C  CG  . ASN A 1 243 ? 37.021  7.698   28.531  1.00 24.58 ? 244 ASN A CG  1 
ATOM   1971 O  OD1 . ASN A 1 243 ? 37.337  7.212   29.617  1.00 26.13 ? 244 ASN A OD1 1 
ATOM   1972 N  ND2 . ASN A 1 243 ? 37.551  7.286   27.382  1.00 26.25 ? 244 ASN A ND2 1 
ATOM   1973 N  N   . PHE A 1 244 ? 33.346  10.394  29.148  1.00 21.94 ? 245 PHE A N   1 
ATOM   1974 C  CA  . PHE A 1 244 ? 32.551  11.604  28.991  1.00 21.62 ? 245 PHE A CA  1 
ATOM   1975 C  C   . PHE A 1 244 ? 32.187  12.192  30.353  1.00 21.66 ? 245 PHE A C   1 
ATOM   1976 O  O   . PHE A 1 244 ? 32.275  13.413  30.568  1.00 20.91 ? 245 PHE A O   1 
ATOM   1977 C  CB  . PHE A 1 244 ? 31.288  11.304  28.182  1.00 21.36 ? 245 PHE A CB  1 
ATOM   1978 C  CG  . PHE A 1 244 ? 30.529  12.526  27.772  1.00 22.02 ? 245 PHE A CG  1 
ATOM   1979 C  CD1 . PHE A 1 244 ? 30.805  13.154  26.566  1.00 22.44 ? 245 PHE A CD1 1 
ATOM   1980 C  CD2 . PHE A 1 244 ? 29.531  13.050  28.590  1.00 22.70 ? 245 PHE A CD2 1 
ATOM   1981 C  CE1 . PHE A 1 244 ? 30.107  14.293  26.185  1.00 22.68 ? 245 PHE A CE1 1 
ATOM   1982 C  CE2 . PHE A 1 244 ? 28.827  14.191  28.214  1.00 22.11 ? 245 PHE A CE2 1 
ATOM   1983 C  CZ  . PHE A 1 244 ? 29.113  14.808  27.012  1.00 22.61 ? 245 PHE A CZ  1 
ATOM   1984 N  N   . TYR A 1 245 ? 31.776  11.308  31.261  1.00 21.50 ? 246 TYR A N   1 
ATOM   1985 C  CA  . TYR A 1 245 ? 31.395  11.680  32.618  1.00 22.28 ? 246 TYR A CA  1 
ATOM   1986 C  C   . TYR A 1 245 ? 32.532  12.398  33.346  1.00 22.42 ? 246 TYR A C   1 
ATOM   1987 O  O   . TYR A 1 245 ? 32.316  13.433  33.962  1.00 22.26 ? 246 TYR A O   1 
ATOM   1988 C  CB  . TYR A 1 245 ? 30.972  10.423  33.376  1.00 22.20 ? 246 TYR A CB  1 
ATOM   1989 C  CG  . TYR A 1 245 ? 30.641  10.597  34.836  1.00 22.46 ? 246 TYR A CG  1 
ATOM   1990 C  CD1 . TYR A 1 245 ? 29.314  10.703  35.259  1.00 22.93 ? 246 TYR A CD1 1 
ATOM   1991 C  CD2 . TYR A 1 245 ? 31.646  10.596  35.806  1.00 22.54 ? 246 TYR A CD2 1 
ATOM   1992 C  CE1 . TYR A 1 245 ? 28.995  10.826  36.608  1.00 23.78 ? 246 TYR A CE1 1 
ATOM   1993 C  CE2 . TYR A 1 245 ? 31.336  10.717  37.169  1.00 23.27 ? 246 TYR A CE2 1 
ATOM   1994 C  CZ  . TYR A 1 245 ? 30.014  10.828  37.555  1.00 24.30 ? 246 TYR A CZ  1 
ATOM   1995 O  OH  . TYR A 1 245 ? 29.707  10.957  38.890  1.00 27.50 ? 246 TYR A OH  1 
ATOM   1996 N  N   . TRP A 1 246 ? 33.737  11.847  33.259  1.00 23.19 ? 247 TRP A N   1 
ATOM   1997 C  CA  . TRP A 1 246 ? 34.895  12.433  33.931  1.00 24.31 ? 247 TRP A CA  1 
ATOM   1998 C  C   . TRP A 1 246 ? 35.440  13.700  33.279  1.00 25.53 ? 247 TRP A C   1 
ATOM   1999 O  O   . TRP A 1 246 ? 35.787  14.645  33.989  1.00 25.20 ? 247 TRP A O   1 
ATOM   2000 C  CB  . TRP A 1 246 ? 35.993  11.392  34.144  1.00 23.52 ? 247 TRP A CB  1 
ATOM   2001 C  CG  . TRP A 1 246 ? 35.651  10.500  35.293  1.00 23.83 ? 247 TRP A CG  1 
ATOM   2002 C  CD1 . TRP A 1 246 ? 35.285  9.180   35.237  1.00 22.61 ? 247 TRP A CD1 1 
ATOM   2003 C  CD2 . TRP A 1 246 ? 35.590  10.876  36.674  1.00 22.67 ? 247 TRP A CD2 1 
ATOM   2004 N  NE1 . TRP A 1 246 ? 35.021  8.713   36.499  1.00 22.51 ? 247 TRP A NE1 1 
ATOM   2005 C  CE2 . TRP A 1 246 ? 35.200  9.730   37.400  1.00 22.45 ? 247 TRP A CE2 1 
ATOM   2006 C  CE3 . TRP A 1 246 ? 35.836  12.069  37.369  1.00 22.31 ? 247 TRP A CE3 1 
ATOM   2007 C  CZ2 . TRP A 1 246 ? 35.055  9.739   38.792  1.00 22.13 ? 247 TRP A CZ2 1 
ATOM   2008 C  CZ3 . TRP A 1 246 ? 35.692  12.080  38.754  1.00 22.83 ? 247 TRP A CZ3 1 
ATOM   2009 C  CH2 . TRP A 1 246 ? 35.299  10.922  39.448  1.00 22.69 ? 247 TRP A CH2 1 
ATOM   2010 N  N   . GLU A 1 247 ? 35.499  13.721  31.945  1.00 26.84 ? 248 GLU A N   1 
ATOM   2011 C  CA  . GLU A 1 247 ? 35.936  14.913  31.192  1.00 28.88 ? 248 GLU A CA  1 
ATOM   2012 C  C   . GLU A 1 247 ? 35.020  16.116  31.431  1.00 29.33 ? 248 GLU A C   1 
ATOM   2013 O  O   . GLU A 1 247 ? 35.477  17.263  31.452  1.00 29.27 ? 248 GLU A O   1 
ATOM   2014 C  CB  . GLU A 1 247 ? 36.045  14.616  29.692  1.00 28.83 ? 248 GLU A CB  1 
ATOM   2015 C  CG  . GLU A 1 247 ? 37.220  13.718  29.317  1.00 31.75 ? 248 GLU A CG  1 
ATOM   2016 C  CD  . GLU A 1 247 ? 37.044  13.039  27.956  1.00 35.34 ? 248 GLU A CD  1 
ATOM   2017 O  OE1 . GLU A 1 247 ? 36.142  13.450  27.189  1.00 37.75 ? 248 GLU A OE1 1 
ATOM   2018 O  OE2 . GLU A 1 247 ? 37.802  12.090  27.654  1.00 35.90 ? 248 GLU A OE2 1 
ATOM   2019 N  N   . LEU A 1 248 ? 33.734  15.835  31.626  1.00 30.31 ? 249 LEU A N   1 
ATOM   2020 C  CA  . LEU A 1 248 ? 32.739  16.835  32.021  1.00 31.46 ? 249 LEU A CA  1 
ATOM   2021 C  C   . LEU A 1 248 ? 33.101  17.525  33.340  1.00 32.49 ? 249 LEU A C   1 
ATOM   2022 O  O   . LEU A 1 248 ? 32.912  18.732  33.487  1.00 32.28 ? 249 LEU A O   1 
ATOM   2023 C  CB  . LEU A 1 248 ? 31.379  16.162  32.179  1.00 31.32 ? 249 LEU A CB  1 
ATOM   2024 C  CG  . LEU A 1 248 ? 30.120  16.983  31.954  1.00 31.98 ? 249 LEU A CG  1 
ATOM   2025 C  CD1 . LEU A 1 248 ? 30.002  17.334  30.473  1.00 32.13 ? 249 LEU A CD1 1 
ATOM   2026 C  CD2 . LEU A 1 248 ? 28.910  16.204  32.431  1.00 31.52 ? 249 LEU A CD2 1 
ATOM   2027 N  N   . ARG A 1 249 ? 33.609  16.744  34.294  1.00 33.63 ? 250 ARG A N   1 
ATOM   2028 C  CA  . ARG A 1 249 ? 34.038  17.265  35.586  1.00 35.00 ? 250 ARG A CA  1 
ATOM   2029 C  C   . ARG A 1 249 ? 35.405  17.948  35.515  1.00 35.99 ? 250 ARG A C   1 
ATOM   2030 O  O   . ARG A 1 249 ? 35.679  18.859  36.295  1.00 35.61 ? 250 ARG A O   1 
ATOM   2031 C  CB  . ARG A 1 249 ? 34.012  16.161  36.648  1.00 34.94 ? 250 ARG A CB  1 
ATOM   2032 C  CG  . ARG A 1 249 ? 32.617  15.920  37.187  1.00 35.82 ? 250 ARG A CG  1 
ATOM   2033 C  CD  . ARG A 1 249 ? 32.388  14.513  37.690  1.00 38.63 ? 250 ARG A CD  1 
ATOM   2034 N  NE  . ARG A 1 249 ? 30.990  14.145  37.453  1.00 42.37 ? 250 ARG A NE  1 
ATOM   2035 C  CZ  . ARG A 1 249 ? 30.000  14.250  38.340  1.00 43.78 ? 250 ARG A CZ  1 
ATOM   2036 N  NH1 . ARG A 1 249 ? 30.233  14.694  39.573  1.00 45.31 ? 250 ARG A NH1 1 
ATOM   2037 N  NH2 . ARG A 1 249 ? 28.766  13.900  37.994  1.00 43.09 ? 250 ARG A NH2 1 
ATOM   2038 N  N   . GLN A 1 250 ? 36.245  17.513  34.575  1.00 37.52 ? 251 GLN A N   1 
ATOM   2039 C  CA  . GLN A 1 250 ? 37.556  18.122  34.351  1.00 39.50 ? 251 GLN A CA  1 
ATOM   2040 C  C   . GLN A 1 250 ? 37.427  19.524  33.752  1.00 40.70 ? 251 GLN A C   1 
ATOM   2041 O  O   . GLN A 1 250 ? 38.204  20.418  34.089  1.00 41.10 ? 251 GLN A O   1 
ATOM   2042 C  CB  . GLN A 1 250 ? 38.424  17.248  33.441  1.00 39.45 ? 251 GLN A CB  1 
ATOM   2043 C  CG  . GLN A 1 250 ? 38.919  15.952  34.070  1.00 40.65 ? 251 GLN A CG  1 
ATOM   2044 C  CD  . GLN A 1 250 ? 39.569  15.011  33.058  1.00 42.31 ? 251 GLN A CD  1 
ATOM   2045 O  OE1 . GLN A 1 250 ? 40.415  15.424  32.261  1.00 43.77 ? 251 GLN A OE1 1 
ATOM   2046 N  NE2 . GLN A 1 250 ? 39.176  13.738  33.089  1.00 42.25 ? 251 GLN A NE2 1 
ATOM   2047 N  N   . LYS A 1 251 ? 36.443  19.703  32.872  1.00 42.05 ? 252 LYS A N   1 
ATOM   2048 C  CA  . LYS A 1 251 ? 36.202  20.976  32.190  1.00 43.41 ? 252 LYS A CA  1 
ATOM   2049 C  C   . LYS A 1 251 ? 35.124  21.815  32.881  1.00 44.26 ? 252 LYS A C   1 
ATOM   2050 O  O   . LYS A 1 251 ? 34.926  22.980  32.531  1.00 44.40 ? 252 LYS A O   1 
ATOM   2051 C  CB  . LYS A 1 251 ? 35.838  20.737  30.721  1.00 43.44 ? 252 LYS A CB  1 
ATOM   2052 C  CG  . LYS A 1 251 ? 36.986  20.158  29.904  1.00 44.45 ? 252 LYS A CG  1 
ATOM   2053 C  CD  . LYS A 1 251 ? 36.532  19.702  28.530  1.00 45.54 ? 252 LYS A CD  1 
ATOM   2054 C  CE  . LYS A 1 251 ? 37.697  19.094  27.759  1.00 46.10 ? 252 LYS A CE  1 
ATOM   2055 N  NZ  . LYS A 1 251 ? 37.299  18.633  26.401  1.00 45.99 ? 252 LYS A NZ  1 
ATOM   2056 N  N   . GLY A 1 252 ? 34.441  21.205  33.854  1.00 45.26 ? 253 GLY A N   1 
ATOM   2057 C  CA  . GLY A 1 252 ? 33.449  21.857  34.727  1.00 46.45 ? 253 GLY A CA  1 
ATOM   2058 C  C   . GLY A 1 252 ? 32.996  23.252  34.338  1.00 47.38 ? 253 GLY A C   1 
ATOM   2059 O  O   . GLY A 1 252 ? 33.294  24.237  35.031  1.00 47.61 ? 253 GLY A O   1 
ATOM   2060 N  N   . SER A 1 253 ? 32.276  23.330  33.221  1.00 47.91 ? 254 SER A N   1 
ATOM   2061 C  CA  . SER A 1 253 ? 31.787  24.598  32.692  1.00 48.28 ? 254 SER A CA  1 
ATOM   2062 C  C   . SER A 1 253 ? 30.350  24.445  32.210  1.00 48.40 ? 254 SER A C   1 
ATOM   2063 O  O   . SER A 1 253 ? 30.046  23.535  31.430  1.00 48.60 ? 254 SER A O   1 
ATOM   2064 C  CB  . SER A 1 253 ? 32.673  25.068  31.534  1.00 48.35 ? 254 SER A CB  1 
ATOM   2065 O  OG  . SER A 1 253 ? 32.621  24.150  30.450  1.00 48.54 ? 254 SER A OG  1 
ATOM   2066 N  N   . VAL A 1 254 ? 29.466  25.321  32.689  1.00 48.23 ? 255 VAL A N   1 
ATOM   2067 C  CA  . VAL A 1 254 ? 28.111  25.396  32.158  1.00 47.93 ? 255 VAL A CA  1 
ATOM   2068 C  C   . VAL A 1 254 ? 28.228  25.883  30.712  1.00 47.57 ? 255 VAL A C   1 
ATOM   2069 O  O   . VAL A 1 254 ? 28.982  26.815  30.424  1.00 47.65 ? 255 VAL A O   1 
ATOM   2070 C  CB  . VAL A 1 254 ? 27.203  26.357  32.978  1.00 48.13 ? 255 VAL A CB  1 
ATOM   2071 C  CG1 . VAL A 1 254 ? 25.730  26.206  32.559  1.00 48.12 ? 255 VAL A CG1 1 
ATOM   2072 C  CG2 . VAL A 1 254 ? 27.365  26.115  34.485  1.00 48.16 ? 255 VAL A CG2 1 
ATOM   2073 N  N   . HIS A 1 255 ? 27.514  25.221  29.805  1.00 46.90 ? 256 HIS A N   1 
ATOM   2074 C  CA  . HIS A 1 255 ? 27.534  25.589  28.396  1.00 46.03 ? 256 HIS A CA  1 
ATOM   2075 C  C   . HIS A 1 255 ? 26.198  26.155  27.959  1.00 45.28 ? 256 HIS A C   1 
ATOM   2076 O  O   . HIS A 1 255 ? 25.144  25.686  28.393  1.00 45.07 ? 256 HIS A O   1 
ATOM   2077 C  CB  . HIS A 1 255 ? 27.893  24.385  27.528  1.00 46.19 ? 256 HIS A CB  1 
ATOM   2078 C  CG  . HIS A 1 255 ? 29.350  24.048  27.543  1.00 46.95 ? 256 HIS A CG  1 
ATOM   2079 N  ND1 . HIS A 1 255 ? 30.204  24.394  26.518  1.00 48.49 ? 256 HIS A ND1 1 
ATOM   2080 C  CD2 . HIS A 1 255 ? 30.105  23.401  28.462  1.00 47.13 ? 256 HIS A CD2 1 
ATOM   2081 C  CE1 . HIS A 1 255 ? 31.423  23.974  26.805  1.00 48.53 ? 256 HIS A CE1 1 
ATOM   2082 N  NE2 . HIS A 1 255 ? 31.390  23.368  27.980  1.00 48.32 ? 256 HIS A NE2 1 
ATOM   2083 N  N   . HIS A 1 256 ? 26.255  27.170  27.101  1.00 44.30 ? 257 HIS A N   1 
ATOM   2084 C  CA  . HIS A 1 256 ? 25.058  27.723  26.475  1.00 43.39 ? 257 HIS A CA  1 
ATOM   2085 C  C   . HIS A 1 256 ? 24.813  27.046  25.123  1.00 42.36 ? 257 HIS A C   1 
ATOM   2086 O  O   . HIS A 1 256 ? 23.667  26.856  24.713  1.00 42.28 ? 257 HIS A O   1 
ATOM   2087 C  CB  . HIS A 1 256 ? 25.178  29.242  26.320  1.00 43.60 ? 257 HIS A CB  1 
ATOM   2088 C  CG  . HIS A 1 256 ? 25.200  29.988  27.623  1.00 44.48 ? 257 HIS A CG  1 
ATOM   2089 N  ND1 . HIS A 1 256 ? 24.466  31.136  27.835  1.00 45.63 ? 257 HIS A ND1 1 
ATOM   2090 C  CD2 . HIS A 1 256 ? 25.866  29.751  28.779  1.00 44.93 ? 257 HIS A CD2 1 
ATOM   2091 C  CE1 . HIS A 1 256 ? 24.680  31.574  29.063  1.00 45.58 ? 257 HIS A CE1 1 
ATOM   2092 N  NE2 . HIS A 1 256 ? 25.525  30.751  29.657  1.00 45.47 ? 257 HIS A NE2 1 
ATOM   2093 N  N   . ASP A 1 257 ? 25.893  26.679  24.438  1.00 40.99 ? 258 ASP A N   1 
ATOM   2094 C  CA  . ASP A 1 257 ? 25.789  25.911  23.199  1.00 39.77 ? 258 ASP A CA  1 
ATOM   2095 C  C   . ASP A 1 257 ? 25.382  24.476  23.516  1.00 38.56 ? 258 ASP A C   1 
ATOM   2096 O  O   . ASP A 1 257 ? 25.720  23.951  24.582  1.00 38.60 ? 258 ASP A O   1 
ATOM   2097 C  CB  . ASP A 1 257 ? 27.113  25.931  22.425  1.00 39.95 ? 258 ASP A CB  1 
ATOM   2098 C  CG  . ASP A 1 257 ? 28.279  25.362  23.228  1.00 40.66 ? 258 ASP A CG  1 
ATOM   2099 O  OD1 . ASP A 1 257 ? 28.383  25.650  24.445  1.00 41.47 ? 258 ASP A OD1 1 
ATOM   2100 O  OD2 . ASP A 1 257 ? 29.103  24.631  22.637  1.00 41.21 ? 258 ASP A OD2 1 
ATOM   2101 N  N   . TYR A 1 258 ? 24.646  23.857  22.596  1.00 36.97 ? 259 TYR A N   1 
ATOM   2102 C  CA  . TYR A 1 258 ? 24.236  22.455  22.723  1.00 35.42 ? 259 TYR A CA  1 
ATOM   2103 C  C   . TYR A 1 258 ? 25.443  21.508  22.669  1.00 34.43 ? 259 TYR A C   1 
ATOM   2104 O  O   . TYR A 1 258 ? 26.307  21.632  21.795  1.00 34.13 ? 259 TYR A O   1 
ATOM   2105 C  CB  . TYR A 1 258 ? 23.222  22.110  21.633  1.00 35.04 ? 259 TYR A CB  1 
ATOM   2106 C  CG  . TYR A 1 258 ? 22.655  20.716  21.720  1.00 34.74 ? 259 TYR A CG  1 
ATOM   2107 C  CD1 . TYR A 1 258 ? 21.652  20.405  22.646  1.00 34.42 ? 259 TYR A CD1 1 
ATOM   2108 C  CD2 . TYR A 1 258 ? 23.105  19.705  20.865  1.00 33.94 ? 259 TYR A CD2 1 
ATOM   2109 C  CE1 . TYR A 1 258 ? 21.117  19.126  22.721  1.00 33.86 ? 259 TYR A CE1 1 
ATOM   2110 C  CE2 . TYR A 1 258 ? 22.570  18.423  20.930  1.00 33.47 ? 259 TYR A CE2 1 
ATOM   2111 C  CZ  . TYR A 1 258 ? 21.583  18.142  21.862  1.00 33.25 ? 259 TYR A CZ  1 
ATOM   2112 O  OH  . TYR A 1 258 ? 21.060  16.878  21.936  1.00 32.57 ? 259 TYR A OH  1 
ATOM   2113 N  N   . ARG A 1 259 ? 25.495  20.573  23.616  1.00 33.33 ? 260 ARG A N   1 
ATOM   2114 C  CA  . ARG A 1 259 ? 26.644  19.676  23.762  1.00 32.37 ? 260 ARG A CA  1 
ATOM   2115 C  C   . ARG A 1 259 ? 26.314  18.211  23.440  1.00 30.99 ? 260 ARG A C   1 
ATOM   2116 O  O   . ARG A 1 259 ? 27.215  17.365  23.431  1.00 31.01 ? 260 ARG A O   1 
ATOM   2117 C  CB  . ARG A 1 259 ? 27.221  19.768  25.181  1.00 32.83 ? 260 ARG A CB  1 
ATOM   2118 C  CG  . ARG A 1 259 ? 27.887  21.093  25.557  1.00 35.01 ? 260 ARG A CG  1 
ATOM   2119 C  CD  . ARG A 1 259 ? 29.414  20.969  25.616  1.00 38.43 ? 260 ARG A CD  1 
ATOM   2120 N  NE  . ARG A 1 259 ? 30.066  21.497  24.417  1.00 41.84 ? 260 ARG A NE  1 
ATOM   2121 C  CZ  . ARG A 1 259 ? 31.387  21.606  24.254  1.00 43.70 ? 260 ARG A CZ  1 
ATOM   2122 N  NH1 . ARG A 1 259 ? 32.223  21.217  25.211  1.00 44.73 ? 260 ARG A NH1 1 
ATOM   2123 N  NH2 . ARG A 1 259 ? 31.877  22.103  23.123  1.00 44.21 ? 260 ARG A NH2 1 
ATOM   2124 N  N   . GLY A 1 260 ? 25.039  17.914  23.182  1.00 28.93 ? 261 GLY A N   1 
ATOM   2125 C  CA  . GLY A 1 260 ? 24.613  16.546  22.864  1.00 26.82 ? 261 GLY A CA  1 
ATOM   2126 C  C   . GLY A 1 260 ? 23.613  15.938  23.841  1.00 25.48 ? 261 GLY A C   1 
ATOM   2127 O  O   . GLY A 1 260 ? 23.343  16.504  24.906  1.00 25.02 ? 261 GLY A O   1 
ATOM   2128 N  N   . ILE A 1 261 ? 23.076  14.773  23.477  1.00 23.97 ? 262 ILE A N   1 
ATOM   2129 C  CA  . ILE A 1 261 ? 22.109  14.051  24.308  1.00 23.00 ? 262 ILE A CA  1 
ATOM   2130 C  C   . ILE A 1 261 ? 22.646  13.636  25.695  1.00 22.76 ? 262 ILE A C   1 
ATOM   2131 O  O   . ILE A 1 261 ? 21.955  13.810  26.695  1.00 22.43 ? 262 ILE A O   1 
ATOM   2132 C  CB  . ILE A 1 261 ? 21.559  12.798  23.596  1.00 22.52 ? 262 ILE A CB  1 
ATOM   2133 C  CG1 . ILE A 1 261 ? 20.893  13.166  22.270  1.00 22.52 ? 262 ILE A CG1 1 
ATOM   2134 C  CG2 . ILE A 1 261 ? 20.569  12.077  24.488  1.00 21.64 ? 262 ILE A CG2 1 
ATOM   2135 C  CD1 . ILE A 1 261 ? 20.880  12.018  21.253  1.00 21.61 ? 262 ILE A CD1 1 
ATOM   2136 N  N   . LEU A 1 262 ? 23.853  13.073  25.745  1.00 22.57 ? 263 LEU A N   1 
ATOM   2137 C  CA  . LEU A 1 262 ? 24.425  12.591  27.009  1.00 22.68 ? 263 LEU A CA  1 
ATOM   2138 C  C   . LEU A 1 262 ? 24.615  13.719  28.027  1.00 23.09 ? 263 LEU A C   1 
ATOM   2139 O  O   . LEU A 1 262 ? 24.292  13.561  29.210  1.00 22.73 ? 263 LEU A O   1 
ATOM   2140 C  CB  . LEU A 1 262 ? 25.734  11.811  26.783  1.00 21.99 ? 263 LEU A CB  1 
ATOM   2141 C  CG  . LEU A 1 262 ? 26.366  11.145  28.025  1.00 22.26 ? 263 LEU A CG  1 
ATOM   2142 C  CD1 . LEU A 1 262 ? 25.335  10.363  28.854  1.00 20.56 ? 263 LEU A CD1 1 
ATOM   2143 C  CD2 . LEU A 1 262 ? 27.552  10.251  27.671  1.00 20.08 ? 263 LEU A CD2 1 
ATOM   2144 N  N   . TYR A 1 263 ? 25.126  14.854  27.557  1.00 23.72 ? 264 TYR A N   1 
ATOM   2145 C  CA  . TYR A 1 263 ? 25.236  16.065  28.380  1.00 24.77 ? 264 TYR A CA  1 
ATOM   2146 C  C   . TYR A 1 263 ? 23.884  16.458  28.980  1.00 25.09 ? 264 TYR A C   1 
ATOM   2147 O  O   . TYR A 1 263 ? 23.802  16.791  30.158  1.00 25.30 ? 264 TYR A O   1 
ATOM   2148 C  CB  . TYR A 1 263 ? 25.803  17.217  27.546  1.00 24.82 ? 264 TYR A CB  1 
ATOM   2149 C  CG  . TYR A 1 263 ? 26.087  18.496  28.310  1.00 26.17 ? 264 TYR A CG  1 
ATOM   2150 C  CD1 . TYR A 1 263 ? 27.363  18.762  28.800  1.00 27.43 ? 264 TYR A CD1 1 
ATOM   2151 C  CD2 . TYR A 1 263 ? 25.088  19.453  28.516  1.00 26.47 ? 264 TYR A CD2 1 
ATOM   2152 C  CE1 . TYR A 1 263 ? 27.635  19.932  29.490  1.00 28.90 ? 264 TYR A CE1 1 
ATOM   2153 C  CE2 . TYR A 1 263 ? 25.351  20.627  29.210  1.00 27.70 ? 264 TYR A CE2 1 
ATOM   2154 C  CZ  . TYR A 1 263 ? 26.623  20.860  29.691  1.00 28.82 ? 264 TYR A CZ  1 
ATOM   2155 O  OH  . TYR A 1 263 ? 26.899  22.021  30.369  1.00 31.73 ? 264 TYR A OH  1 
ATOM   2156 N  N   . ARG A 1 264 ? 22.829  16.408  28.172  1.00 25.80 ? 265 ARG A N   1 
ATOM   2157 C  CA  . ARG A 1 264 ? 21.489  16.760  28.638  1.00 26.81 ? 265 ARG A CA  1 
ATOM   2158 C  C   . ARG A 1 264 ? 20.987  15.788  29.720  1.00 27.25 ? 265 ARG A C   1 
ATOM   2159 O  O   . ARG A 1 264 ? 20.452  16.211  30.746  1.00 27.22 ? 265 ARG A O   1 
ATOM   2160 C  CB  . ARG A 1 264 ? 20.512  16.809  27.464  1.00 26.92 ? 265 ARG A CB  1 
ATOM   2161 C  CG  . ARG A 1 264 ? 20.634  18.037  26.570  1.00 28.31 ? 265 ARG A CG  1 
ATOM   2162 C  CD  . ARG A 1 264 ? 19.813  19.198  27.125  1.00 30.43 ? 265 ARG A CD  1 
ATOM   2163 N  NE  . ARG A 1 264 ? 19.796  20.366  26.237  1.00 30.99 ? 265 ARG A NE  1 
ATOM   2164 C  CZ  . ARG A 1 264 ? 18.816  20.651  25.379  1.00 31.25 ? 265 ARG A CZ  1 
ATOM   2165 N  NH1 . ARG A 1 264 ? 17.758  19.851  25.270  1.00 31.20 ? 265 ARG A NH1 1 
ATOM   2166 N  NH2 . ARG A 1 264 ? 18.894  21.743  24.628  1.00 30.67 ? 265 ARG A NH2 1 
ATOM   2167 N  N   . LEU A 1 265 ? 21.182  14.490  29.491  1.00 27.66 ? 266 LEU A N   1 
ATOM   2168 C  CA  . LEU A 1 265 ? 20.723  13.469  30.428  1.00 28.32 ? 266 LEU A CA  1 
ATOM   2169 C  C   . LEU A 1 265 ? 21.527  13.461  31.731  1.00 29.04 ? 266 LEU A C   1 
ATOM   2170 O  O   . LEU A 1 265 ? 20.959  13.274  32.795  1.00 29.07 ? 266 LEU A O   1 
ATOM   2171 C  CB  . LEU A 1 265 ? 20.732  12.076  29.786  1.00 27.51 ? 266 LEU A CB  1 
ATOM   2172 C  CG  . LEU A 1 265 ? 19.719  11.762  28.686  1.00 27.31 ? 266 LEU A CG  1 
ATOM   2173 C  CD1 . LEU A 1 265 ? 20.066  10.430  28.036  1.00 25.91 ? 266 LEU A CD1 1 
ATOM   2174 C  CD2 . LEU A 1 265 ? 18.273  11.765  29.195  1.00 26.28 ? 266 LEU A CD2 1 
ATOM   2175 N  N   . LEU A 1 266 ? 22.843  13.652  31.641  1.00 30.24 ? 267 LEU A N   1 
ATOM   2176 C  CA  . LEU A 1 266 ? 23.686  13.725  32.838  1.00 31.60 ? 267 LEU A CA  1 
ATOM   2177 C  C   . LEU A 1 266 ? 23.454  15.026  33.603  1.00 32.65 ? 267 LEU A C   1 
ATOM   2178 O  O   . LEU A 1 266 ? 23.481  15.041  34.831  1.00 32.99 ? 267 LEU A O   1 
ATOM   2179 C  CB  . LEU A 1 266 ? 25.167  13.576  32.489  1.00 31.19 ? 267 LEU A CB  1 
ATOM   2180 C  CG  . LEU A 1 266 ? 25.685  12.176  32.149  1.00 31.13 ? 267 LEU A CG  1 
ATOM   2181 C  CD1 . LEU A 1 266 ? 27.113  12.263  31.643  1.00 30.30 ? 267 LEU A CD1 1 
ATOM   2182 C  CD2 . LEU A 1 266 ? 25.599  11.231  33.344  1.00 29.87 ? 267 LEU A CD2 1 
ATOM   2183 N  N   . GLY A 1 267 ? 23.201  16.104  32.865  1.00 33.70 ? 268 GLY A N   1 
ATOM   2184 C  CA  . GLY A 1 267 ? 22.993  17.421  33.448  1.00 35.11 ? 268 GLY A CA  1 
ATOM   2185 C  C   . GLY A 1 267 ? 21.667  17.600  34.160  1.00 36.07 ? 268 GLY A C   1 
ATOM   2186 O  O   . GLY A 1 267 ? 21.621  18.183  35.238  1.00 36.39 ? 268 GLY A O   1 
ATOM   2187 N  N   . ASP A 1 268 ? 20.585  17.113  33.557  1.00 37.00 ? 269 ASP A N   1 
ATOM   2188 C  CA  . ASP A 1 268 ? 19.242  17.327  34.103  1.00 38.00 ? 269 ASP A CA  1 
ATOM   2189 C  C   . ASP A 1 268 ? 18.217  16.313  33.590  1.00 37.93 ? 269 ASP A C   1 
ATOM   2190 O  O   . ASP A 1 268 ? 17.508  16.578  32.619  1.00 38.04 ? 269 ASP A O   1 
ATOM   2191 C  CB  . ASP A 1 268 ? 18.760  18.768  33.809  1.00 38.51 ? 269 ASP A CB  1 
ATOM   2192 C  CG  . ASP A 1 268 ? 17.386  19.080  34.421  1.00 40.04 ? 269 ASP A CG  1 
ATOM   2193 O  OD1 . ASP A 1 268 ? 17.002  18.438  35.429  1.00 41.49 ? 269 ASP A OD1 1 
ATOM   2194 O  OD2 . ASP A 1 268 ? 16.692  19.981  33.893  1.00 41.66 ? 269 ASP A OD2 1 
ATOM   2195 N  N   . SER A 1 269 ? 18.146  15.157  34.248  1.00 38.01 ? 270 SER A N   1 
ATOM   2196 C  CA  . SER A 1 269 ? 17.071  14.188  34.013  1.00 37.83 ? 270 SER A CA  1 
ATOM   2197 C  C   . SER A 1 269 ? 16.801  13.367  35.274  1.00 37.65 ? 270 SER A C   1 
ATOM   2198 O  O   . SER A 1 269 ? 17.609  13.366  36.200  1.00 37.70 ? 270 SER A O   1 
ATOM   2199 C  CB  . SER A 1 269 ? 17.388  13.279  32.812  1.00 38.08 ? 270 SER A CB  1 
ATOM   2200 O  OG  . SER A 1 269 ? 17.915  12.025  33.202  1.00 37.87 ? 270 SER A OG  1 
ATOM   2201 N  N   . LYS A 1 270 ? 15.669  12.668  35.304  1.00 37.37 ? 271 LYS A N   1 
ATOM   2202 C  CA  . LYS A 1 270 ? 15.305  11.840  36.457  1.00 37.04 ? 271 LYS A CA  1 
ATOM   2203 C  C   . LYS A 1 270 ? 15.998  10.472  36.460  1.00 36.68 ? 271 LYS A C   1 
ATOM   2204 O  O   . LYS A 1 270 ? 15.858  9.695   37.418  1.00 36.63 ? 271 LYS A O   1 
ATOM   2205 C  CB  . LYS A 1 270 ? 13.786  11.669  36.527  1.00 37.28 ? 271 LYS A CB  1 
ATOM   2206 C  CG  . LYS A 1 270 ? 13.029  12.970  36.744  1.00 38.15 ? 271 LYS A CG  1 
ATOM   2207 C  CD  . LYS A 1 270 ? 11.534  12.757  36.618  1.00 39.73 ? 271 LYS A CD  1 
ATOM   2208 C  CE  . LYS A 1 270 ? 10.782  14.012  36.993  1.00 40.20 ? 271 LYS A CE  1 
ATOM   2209 N  NZ  . LYS A 1 270 ? 9.325   13.746  37.034  1.00 41.52 ? 271 LYS A NZ  1 
ATOM   2210 N  N   . MET A 1 271 ? 16.739  10.185  35.389  1.00 35.84 ? 272 MET A N   1 
ATOM   2211 C  CA  . MET A 1 271 ? 17.447  8.915   35.230  1.00 35.07 ? 272 MET A CA  1 
ATOM   2212 C  C   . MET A 1 271 ? 18.706  8.832   36.088  1.00 34.31 ? 272 MET A C   1 
ATOM   2213 O  O   . MET A 1 271 ? 19.495  9.784   36.160  1.00 34.60 ? 272 MET A O   1 
ATOM   2214 C  CB  . MET A 1 271 ? 17.842  8.696   33.762  1.00 35.21 ? 272 MET A CB  1 
ATOM   2215 C  CG  . MET A 1 271 ? 16.930  7.786   32.966  1.00 35.98 ? 272 MET A CG  1 
ATOM   2216 S  SD  . MET A 1 271 ? 17.605  7.412   31.324  1.00 37.75 ? 272 MET A SD  1 
ATOM   2217 C  CE  . MET A 1 271 ? 16.257  6.493   30.648  1.00 37.18 ? 272 MET A CE  1 
ATOM   2218 N  N   . SER A 1 272 ? 18.900  7.678   36.715  1.00 33.03 ? 273 SER A N   1 
ATOM   2219 C  CA  . SER A 1 272 ? 20.160  7.361   37.366  1.00 32.26 ? 273 SER A CA  1 
ATOM   2220 C  C   . SER A 1 272 ? 21.252  7.203   36.308  1.00 31.53 ? 273 SER A C   1 
ATOM   2221 O  O   . SER A 1 272 ? 20.959  6.946   35.135  1.00 31.15 ? 273 SER A O   1 
ATOM   2222 C  CB  . SER A 1 272 ? 20.026  6.073   38.179  1.00 32.22 ? 273 SER A CB  1 
ATOM   2223 O  OG  . SER A 1 272 ? 19.530  5.020   37.368  1.00 32.81 ? 273 SER A OG  1 
ATOM   2224 N  N   . PHE A 1 273 ? 22.505  7.362   36.723  1.00 30.68 ? 274 PHE A N   1 
ATOM   2225 C  CA  . PHE A 1 273 ? 23.642  7.168   35.832  1.00 30.12 ? 274 PHE A CA  1 
ATOM   2226 C  C   . PHE A 1 273 ? 23.638  5.778   35.186  1.00 30.15 ? 274 PHE A C   1 
ATOM   2227 O  O   . PHE A 1 273 ? 23.983  5.632   34.007  1.00 29.89 ? 274 PHE A O   1 
ATOM   2228 C  CB  . PHE A 1 273 ? 24.962  7.391   36.566  1.00 29.72 ? 274 PHE A CB  1 
ATOM   2229 C  CG  . PHE A 1 273 ? 26.166  7.060   35.740  1.00 28.98 ? 274 PHE A CG  1 
ATOM   2230 C  CD1 . PHE A 1 273 ? 26.640  7.960   34.792  1.00 27.21 ? 274 PHE A CD1 1 
ATOM   2231 C  CD2 . PHE A 1 273 ? 26.816  5.833   35.891  1.00 27.71 ? 274 PHE A CD2 1 
ATOM   2232 C  CE1 . PHE A 1 273 ? 27.752  7.656   34.015  1.00 26.42 ? 274 PHE A CE1 1 
ATOM   2233 C  CE2 . PHE A 1 273 ? 27.922  5.520   35.116  1.00 27.05 ? 274 PHE A CE2 1 
ATOM   2234 C  CZ  . PHE A 1 273 ? 28.393  6.433   34.176  1.00 26.55 ? 274 PHE A CZ  1 
ATOM   2235 N  N   . GLU A 1 274 ? 23.245  4.767   35.958  1.00 29.86 ? 275 GLU A N   1 
ATOM   2236 C  CA  . GLU A 1 274 ? 23.240  3.396   35.462  1.00 29.87 ? 275 GLU A CA  1 
ATOM   2237 C  C   . GLU A 1 274 ? 22.176  3.146   34.377  1.00 29.15 ? 275 GLU A C   1 
ATOM   2238 O  O   . GLU A 1 274 ? 22.438  2.416   33.416  1.00 29.23 ? 275 GLU A O   1 
ATOM   2239 C  CB  . GLU A 1 274 ? 23.212  2.349   36.602  1.00 30.25 ? 275 GLU A CB  1 
ATOM   2240 C  CG  . GLU A 1 274 ? 22.677  2.802   37.975  1.00 32.56 ? 275 GLU A CG  1 
ATOM   2241 C  CD  . GLU A 1 274 ? 23.637  3.707   38.762  1.00 34.66 ? 275 GLU A CD  1 
ATOM   2242 O  OE1 . GLU A 1 274 ? 24.793  3.307   39.040  1.00 36.00 ? 275 GLU A OE1 1 
ATOM   2243 O  OE2 . GLU A 1 274 ? 23.223  4.832   39.111  1.00 35.91 ? 275 GLU A OE2 1 
ATOM   2244 N  N   . ASP A 1 275 ? 21.002  3.764   34.520  1.00 28.01 ? 276 ASP A N   1 
ATOM   2245 C  CA  . ASP A 1 275 ? 19.978  3.743   33.475  1.00 27.26 ? 276 ASP A CA  1 
ATOM   2246 C  C   . ASP A 1 275 ? 20.457  4.486   32.226  1.00 26.20 ? 276 ASP A C   1 
ATOM   2247 O  O   . ASP A 1 275 ? 20.239  4.037   31.097  1.00 25.62 ? 276 ASP A O   1 
ATOM   2248 C  CB  . ASP A 1 275 ? 18.667  4.379   33.969  1.00 27.83 ? 276 ASP A CB  1 
ATOM   2249 C  CG  . ASP A 1 275 ? 17.892  3.484   34.944  1.00 29.17 ? 276 ASP A CG  1 
ATOM   2250 O  OD1 . ASP A 1 275 ? 17.985  2.238   34.854  1.00 29.66 ? 276 ASP A OD1 1 
ATOM   2251 O  OD2 . ASP A 1 275 ? 17.170  4.043   35.796  1.00 30.81 ? 276 ASP A OD2 1 
ATOM   2252 N  N   . ILE A 1 276 ? 21.106  5.623   32.446  1.00 24.90 ? 277 ILE A N   1 
ATOM   2253 C  CA  . ILE A 1 276 ? 21.645  6.429   31.368  1.00 24.13 ? 277 ILE A CA  1 
ATOM   2254 C  C   . ILE A 1 276 ? 22.664  5.636   30.549  1.00 23.77 ? 277 ILE A C   1 
ATOM   2255 O  O   . ILE A 1 276 ? 22.558  5.577   29.329  1.00 23.63 ? 277 ILE A O   1 
ATOM   2256 C  CB  . ILE A 1 276 ? 22.263  7.748   31.900  1.00 24.01 ? 277 ILE A CB  1 
ATOM   2257 C  CG1 . ILE A 1 276 ? 21.150  8.704   32.347  1.00 23.75 ? 277 ILE A CG1 1 
ATOM   2258 C  CG2 . ILE A 1 276 ? 23.134  8.415   30.834  1.00 22.87 ? 277 ILE A CG2 1 
ATOM   2259 C  CD1 . ILE A 1 276 ? 21.642  9.925   33.133  1.00 22.77 ? 277 ILE A CD1 1 
ATOM   2260 N  N   . LYS A 1 277 ? 23.629  5.024   31.233  1.00 23.37 ? 278 LYS A N   1 
ATOM   2261 C  CA  . LYS A 1 277 ? 24.673  4.220   30.596  1.00 23.29 ? 278 LYS A CA  1 
ATOM   2262 C  C   . LYS A 1 277 ? 24.097  3.019   29.827  1.00 22.89 ? 278 LYS A C   1 
ATOM   2263 O  O   . LYS A 1 277 ? 24.540  2.718   28.716  1.00 22.42 ? 278 LYS A O   1 
ATOM   2264 C  CB  . LYS A 1 277 ? 25.671  3.731   31.643  1.00 23.37 ? 278 LYS A CB  1 
ATOM   2265 C  CG  . LYS A 1 277 ? 26.978  3.192   31.069  1.00 25.08 ? 278 LYS A CG  1 
ATOM   2266 C  CD  . LYS A 1 277 ? 27.501  1.988   31.847  1.00 27.31 ? 278 LYS A CD  1 
ATOM   2267 C  CE  . LYS A 1 277 ? 28.003  2.356   33.219  1.00 29.88 ? 278 LYS A CE  1 
ATOM   2268 N  NZ  . LYS A 1 277 ? 28.793  1.233   33.818  1.00 31.42 ? 278 LYS A NZ  1 
ATOM   2269 N  N   . ALA A 1 278 ? 23.118  2.341   30.428  1.00 22.23 ? 279 ALA A N   1 
ATOM   2270 C  CA  . ALA A 1 278 ? 22.430  1.233   29.767  1.00 22.08 ? 279 ALA A CA  1 
ATOM   2271 C  C   . ALA A 1 278 ? 21.777  1.684   28.460  1.00 21.66 ? 279 ALA A C   1 
ATOM   2272 O  O   . ALA A 1 278 ? 21.914  1.018   27.436  1.00 21.91 ? 279 ALA A O   1 
ATOM   2273 C  CB  . ALA A 1 278 ? 21.397  0.601   30.692  1.00 21.85 ? 279 ALA A CB  1 
ATOM   2274 N  N   . ASN A 1 279 ? 21.096  2.828   28.502  1.00 21.23 ? 280 ASN A N   1 
ATOM   2275 C  CA  . ASN A 1 279 ? 20.412  3.369   27.334  1.00 20.61 ? 280 ASN A CA  1 
ATOM   2276 C  C   . ASN A 1 279 ? 21.319  3.950   26.255  1.00 20.37 ? 280 ASN A C   1 
ATOM   2277 O  O   . ASN A 1 279 ? 21.012  3.835   25.065  1.00 20.22 ? 280 ASN A O   1 
ATOM   2278 C  CB  . ASN A 1 279 ? 19.321  4.338   27.757  1.00 20.27 ? 280 ASN A CB  1 
ATOM   2279 C  CG  . ASN A 1 279 ? 18.123  3.613   28.335  1.00 20.60 ? 280 ASN A CG  1 
ATOM   2280 O  OD1 . ASN A 1 279 ? 17.459  2.850   27.637  1.00 21.15 ? 280 ASN A OD1 1 
ATOM   2281 N  ND2 . ASN A 1 279 ? 17.859  3.820   29.621  1.00 20.70 ? 280 ASN A ND2 1 
ATOM   2282 N  N   . VAL A 1 280 ? 22.422  4.571   26.672  1.00 19.71 ? 281 VAL A N   1 
ATOM   2283 C  CA  . VAL A 1 280 ? 23.465  4.986   25.743  1.00 19.79 ? 281 VAL A CA  1 
ATOM   2284 C  C   . VAL A 1 280 ? 23.955  3.799   24.919  1.00 19.62 ? 281 VAL A C   1 
ATOM   2285 O  O   . VAL A 1 280 ? 24.085  3.902   23.698  1.00 19.36 ? 281 VAL A O   1 
ATOM   2286 C  CB  . VAL A 1 280 ? 24.651  5.674   26.461  1.00 19.85 ? 281 VAL A CB  1 
ATOM   2287 C  CG1 . VAL A 1 280 ? 25.920  5.599   25.620  1.00 20.27 ? 281 VAL A CG1 1 
ATOM   2288 C  CG2 . VAL A 1 280 ? 24.310  7.122   26.764  1.00 19.83 ? 281 VAL A CG2 1 
ATOM   2289 N  N   . THR A 1 281 ? 24.202  2.674   25.590  1.00 19.59 ? 282 THR A N   1 
ATOM   2290 C  CA  . THR A 1 281 ? 24.632  1.450   24.917  1.00 20.02 ? 282 THR A CA  1 
ATOM   2291 C  C   . THR A 1 281 ? 23.648  1.034   23.813  1.00 19.95 ? 282 THR A C   1 
ATOM   2292 O  O   . THR A 1 281 ? 24.061  0.734   22.694  1.00 20.01 ? 282 THR A O   1 
ATOM   2293 C  CB  . THR A 1 281 ? 24.826  0.291   25.927  1.00 20.09 ? 282 THR A CB  1 
ATOM   2294 O  OG1 . THR A 1 281 ? 25.709  0.713   26.976  1.00 20.76 ? 282 THR A OG1 1 
ATOM   2295 C  CG2 . THR A 1 281 ? 25.417  -0.915  25.252  1.00 19.90 ? 282 THR A CG2 1 
ATOM   2296 N  N   . GLU A 1 282 ? 22.356  1.033   24.136  1.00 20.08 ? 283 GLU A N   1 
ATOM   2297 C  CA  . GLU A 1 282 ? 21.306  0.648   23.184  1.00 20.71 ? 283 GLU A CA  1 
ATOM   2298 C  C   . GLU A 1 282 ? 21.124  1.672   22.057  1.00 20.59 ? 283 GLU A C   1 
ATOM   2299 O  O   . GLU A 1 282 ? 20.834  1.301   20.920  1.00 20.38 ? 283 GLU A O   1 
ATOM   2300 C  CB  . GLU A 1 282 ? 19.971  0.381   23.900  1.00 20.52 ? 283 GLU A CB  1 
ATOM   2301 C  CG  . GLU A 1 282 ? 20.013  -0.865  24.802  1.00 22.54 ? 283 GLU A CG  1 
ATOM   2302 C  CD  . GLU A 1 282 ? 18.705  -1.167  25.519  1.00 24.56 ? 283 GLU A CD  1 
ATOM   2303 O  OE1 . GLU A 1 282 ? 17.753  -0.364  25.404  1.00 26.84 ? 283 GLU A OE1 1 
ATOM   2304 O  OE2 . GLU A 1 282 ? 18.629  -2.216  26.212  1.00 25.95 ? 283 GLU A OE2 1 
ATOM   2305 N  N   . MET A 1 283 ? 21.296  2.953   22.367  1.00 20.53 ? 284 MET A N   1 
ATOM   2306 C  CA  . MET A 1 283 ? 21.176  3.978   21.332  1.00 21.05 ? 284 MET A CA  1 
ATOM   2307 C  C   . MET A 1 283 ? 22.303  3.872   20.314  1.00 20.75 ? 284 MET A C   1 
ATOM   2308 O  O   . MET A 1 283 ? 22.068  3.990   19.115  1.00 20.69 ? 284 MET A O   1 
ATOM   2309 C  CB  . MET A 1 283 ? 21.087  5.375   21.939  1.00 21.15 ? 284 MET A CB  1 
ATOM   2310 C  CG  . MET A 1 283 ? 19.726  5.657   22.575  1.00 23.00 ? 284 MET A CG  1 
ATOM   2311 S  SD  . MET A 1 283 ? 19.547  7.352   23.181  1.00 27.98 ? 284 MET A SD  1 
ATOM   2312 C  CE  . MET A 1 283 ? 20.070  8.295   21.744  1.00 27.22 ? 284 MET A CE  1 
ATOM   2313 N  N   . LEU A 1 284 ? 23.516  3.619   20.800  1.00 20.90 ? 285 LEU A N   1 
ATOM   2314 C  CA  . LEU A 1 284 ? 24.691  3.474   19.942  1.00 20.72 ? 285 LEU A CA  1 
ATOM   2315 C  C   . LEU A 1 284 ? 24.586  2.261   19.043  1.00 20.83 ? 285 LEU A C   1 
ATOM   2316 O  O   . LEU A 1 284 ? 24.941  2.328   17.868  1.00 21.55 ? 285 LEU A O   1 
ATOM   2317 C  CB  . LEU A 1 284 ? 25.960  3.349   20.780  1.00 20.68 ? 285 LEU A CB  1 
ATOM   2318 C  CG  . LEU A 1 284 ? 26.539  4.576   21.486  1.00 20.45 ? 285 LEU A CG  1 
ATOM   2319 C  CD1 . LEU A 1 284 ? 27.574  4.111   22.503  1.00 17.79 ? 285 LEU A CD1 1 
ATOM   2320 C  CD2 . LEU A 1 284 ? 27.153  5.551   20.480  1.00 19.81 ? 285 LEU A CD2 1 
ATOM   2321 N  N   . ALA A 1 285 ? 24.113  1.151   19.599  1.00 20.79 ? 286 ALA A N   1 
ATOM   2322 C  CA  . ALA A 1 285 ? 23.989  -0.084  18.842  1.00 21.00 ? 286 ALA A CA  1 
ATOM   2323 C  C   . ALA A 1 285 ? 22.838  0.002   17.849  1.00 21.36 ? 286 ALA A C   1 
ATOM   2324 O  O   . ALA A 1 285 ? 22.941  -0.518  16.731  1.00 21.92 ? 286 ALA A O   1 
ATOM   2325 C  CB  . ALA A 1 285 ? 23.823  -1.272  19.764  1.00 20.86 ? 286 ALA A CB  1 
ATOM   2326 N  N   . GLY A 1 286 ? 21.754  0.666   18.246  1.00 21.19 ? 287 GLY A N   1 
ATOM   2327 C  CA  . GLY A 1 286 ? 20.631  0.885   17.347  1.00 21.52 ? 287 GLY A CA  1 
ATOM   2328 C  C   . GLY A 1 286 ? 20.983  1.826   16.203  1.00 21.86 ? 287 GLY A C   1 
ATOM   2329 O  O   . GLY A 1 286 ? 20.353  1.802   15.154  1.00 21.44 ? 287 GLY A O   1 
ATOM   2330 N  N   . GLY A 1 287 ? 22.003  2.654   16.407  1.00 22.34 ? 288 GLY A N   1 
ATOM   2331 C  CA  . GLY A 1 287 ? 22.334  3.704   15.453  1.00 22.95 ? 288 GLY A CA  1 
ATOM   2332 C  C   . GLY A 1 287 ? 23.122  3.313   14.213  1.00 23.08 ? 288 GLY A C   1 
ATOM   2333 O  O   . GLY A 1 287 ? 23.279  4.131   13.312  1.00 23.68 ? 288 GLY A O   1 
ATOM   2334 N  N   . VAL A 1 288 ? 23.609  2.079   14.143  1.00 22.95 ? 289 VAL A N   1 
ATOM   2335 C  CA  . VAL A 1 288 ? 24.622  1.736   13.141  1.00 23.16 ? 289 VAL A CA  1 
ATOM   2336 C  C   . VAL A 1 288 ? 24.100  0.997   11.889  1.00 23.09 ? 289 VAL A C   1 
ATOM   2337 O  O   . VAL A 1 288 ? 24.291  1.459   10.770  1.00 23.42 ? 289 VAL A O   1 
ATOM   2338 C  CB  . VAL A 1 288 ? 25.842  1.003   13.789  1.00 23.33 ? 289 VAL A CB  1 
ATOM   2339 C  CG1 . VAL A 1 288 ? 26.870  0.628   12.740  1.00 23.34 ? 289 VAL A CG1 1 
ATOM   2340 C  CG2 . VAL A 1 288 ? 26.485  1.891   14.862  1.00 23.34 ? 289 VAL A CG2 1 
ATOM   2341 N  N   . ASP A 1 289 ? 23.450  -0.145  12.068  1.00 22.77 ? 290 ASP A N   1 
ATOM   2342 C  CA  . ASP A 1 289 ? 23.087  -0.977  10.909  1.00 22.60 ? 290 ASP A CA  1 
ATOM   2343 C  C   . ASP A 1 289 ? 21.775  -0.600  10.197  1.00 21.74 ? 290 ASP A C   1 
ATOM   2344 O  O   . ASP A 1 289 ? 21.546  -0.982  9.046   1.00 22.21 ? 290 ASP A O   1 
ATOM   2345 C  CB  . ASP A 1 289 ? 23.083  -2.448  11.302  1.00 22.95 ? 290 ASP A CB  1 
ATOM   2346 C  CG  . ASP A 1 289 ? 24.486  -3.001  11.512  1.00 25.53 ? 290 ASP A CG  1 
ATOM   2347 O  OD1 . ASP A 1 289 ? 25.470  -2.223  11.415  1.00 27.83 ? 290 ASP A OD1 1 
ATOM   2348 O  OD2 . ASP A 1 289 ? 24.602  -4.223  11.756  1.00 26.81 ? 290 ASP A OD2 1 
ATOM   2349 N  N   . THR A 1 290 ? 20.927  0.165   10.864  1.00 20.37 ? 291 THR A N   1 
ATOM   2350 C  CA  . THR A 1 290 ? 19.582  0.386   10.360  1.00 19.27 ? 291 THR A CA  1 
ATOM   2351 C  C   . THR A 1 290 ? 19.512  1.516   9.343   1.00 18.12 ? 291 THR A C   1 
ATOM   2352 O  O   . THR A 1 290 ? 19.049  1.309   8.216   1.00 17.54 ? 291 THR A O   1 
ATOM   2353 C  CB  . THR A 1 290 ? 18.590  0.605   11.509  1.00 19.37 ? 291 THR A CB  1 
ATOM   2354 O  OG1 . THR A 1 290 ? 19.102  1.606   12.395  1.00 20.23 ? 291 THR A OG1 1 
ATOM   2355 C  CG2 . THR A 1 290 ? 18.409  -0.687  12.264  1.00 19.25 ? 291 THR A CG2 1 
ATOM   2356 N  N   . THR A 1 291 ? 19.982  2.696   9.734   1.00 17.06 ? 292 THR A N   1 
ATOM   2357 C  CA  . THR A 1 291 ? 19.970  3.852   8.847   1.00 16.94 ? 292 THR A CA  1 
ATOM   2358 C  C   . THR A 1 291 ? 20.911  3.643   7.650   1.00 16.85 ? 292 THR A C   1 
ATOM   2359 O  O   . THR A 1 291 ? 20.591  4.044   6.533   1.00 16.57 ? 292 THR A O   1 
ATOM   2360 C  CB  . THR A 1 291 ? 20.287  5.171   9.600   1.00 16.75 ? 292 THR A CB  1 
ATOM   2361 O  OG1 . THR A 1 291 ? 21.593  5.096   10.160  1.00 18.08 ? 292 THR A OG1 1 
ATOM   2362 C  CG2 . THR A 1 291 ? 19.305  5.393   10.730  1.00 16.14 ? 292 THR A CG2 1 
ATOM   2363 N  N   . SER A 1 292 ? 22.042  2.978   7.884   1.00 16.72 ? 293 SER A N   1 
ATOM   2364 C  CA  . SER A 1 292 ? 22.993  2.659   6.819   1.00 17.22 ? 293 SER A CA  1 
ATOM   2365 C  C   . SER A 1 292 ? 22.429  1.681   5.761   1.00 17.04 ? 293 SER A C   1 
ATOM   2366 O  O   . SER A 1 292 ? 22.651  1.866   4.560   1.00 16.81 ? 293 SER A O   1 
ATOM   2367 C  CB  . SER A 1 292 ? 24.317  2.155   7.409   1.00 17.17 ? 293 SER A CB  1 
ATOM   2368 O  OG  . SER A 1 292 ? 24.113  1.001   8.212   1.00 20.23 ? 293 SER A OG  1 
ATOM   2369 N  N   . MET A 1 293 ? 21.694  0.655   6.192   1.00 16.90 ? 294 MET A N   1 
ATOM   2370 C  CA  . MET A 1 293 ? 21.054  -0.250  5.228   1.00 16.49 ? 294 MET A CA  1 
ATOM   2371 C  C   . MET A 1 293 ? 19.903  0.428   4.483   1.00 15.59 ? 294 MET A C   1 
ATOM   2372 O  O   . MET A 1 293 ? 19.719  0.205   3.282   1.00 14.99 ? 294 MET A O   1 
ATOM   2373 C  CB  . MET A 1 293 ? 20.602  -1.566  5.875   1.00 17.16 ? 294 MET A CB  1 
ATOM   2374 C  CG  . MET A 1 293 ? 21.755  -2.534  6.254   1.00 19.88 ? 294 MET A CG  1 
ATOM   2375 S  SD  . MET A 1 293 ? 22.909  -2.904  4.909   1.00 26.28 ? 294 MET A SD  1 
ATOM   2376 C  CE  . MET A 1 293 ? 24.013  -1.492  4.894   1.00 25.26 ? 294 MET A CE  1 
ATOM   2377 N  N   . THR A 1 294 ? 19.152  1.268   5.192   1.00 14.75 ? 295 THR A N   1 
ATOM   2378 C  CA  . THR A 1 294 ? 18.017  1.966   4.606   1.00 14.46 ? 295 THR A CA  1 
ATOM   2379 C  C   . THR A 1 294 ? 18.471  2.978   3.537   1.00 14.28 ? 295 THR A C   1 
ATOM   2380 O  O   . THR A 1 294 ? 17.900  3.035   2.447   1.00 14.43 ? 295 THR A O   1 
ATOM   2381 C  CB  . THR A 1 294 ? 17.156  2.637   5.683   1.00 14.59 ? 295 THR A CB  1 
ATOM   2382 O  OG1 . THR A 1 294 ? 16.784  1.658   6.662   1.00 14.73 ? 295 THR A OG1 1 
ATOM   2383 C  CG2 . THR A 1 294 ? 15.895  3.242   5.061   1.00 14.49 ? 295 THR A CG2 1 
ATOM   2384 N  N   . LEU A 1 295 ? 19.515  3.737   3.844   1.00 13.78 ? 296 LEU A N   1 
ATOM   2385 C  CA  . LEU A 1 295 ? 20.127  4.650   2.882   1.00 14.07 ? 296 LEU A CA  1 
ATOM   2386 C  C   . LEU A 1 295 ? 20.647  3.930   1.642   1.00 14.04 ? 296 LEU A C   1 
ATOM   2387 O  O   . LEU A 1 295 ? 20.464  4.404   0.513   1.00 13.75 ? 296 LEU A O   1 
ATOM   2388 C  CB  . LEU A 1 295 ? 21.254  5.460   3.544   1.00 13.85 ? 296 LEU A CB  1 
ATOM   2389 C  CG  . LEU A 1 295 ? 20.795  6.571   4.486   1.00 14.45 ? 296 LEU A CG  1 
ATOM   2390 C  CD1 . LEU A 1 295 ? 21.972  7.199   5.255   1.00 13.42 ? 296 LEU A CD1 1 
ATOM   2391 C  CD2 . LEU A 1 295 ? 19.999  7.624   3.705   1.00 14.08 ? 296 LEU A CD2 1 
ATOM   2392 N  N   . GLN A 1 296 ? 21.282  2.779   1.850   1.00 14.37 ? 297 GLN A N   1 
ATOM   2393 C  CA  . GLN A 1 296 ? 21.774  1.982   0.730   1.00 14.70 ? 297 GLN A CA  1 
ATOM   2394 C  C   . GLN A 1 296 ? 20.632  1.553   -0.193  1.00 14.40 ? 297 GLN A C   1 
ATOM   2395 O  O   . GLN A 1 296 ? 20.761  1.625   -1.421  1.00 14.82 ? 297 GLN A O   1 
ATOM   2396 C  CB  . GLN A 1 296 ? 22.585  0.767   1.205   1.00 14.83 ? 297 GLN A CB  1 
ATOM   2397 C  CG  . GLN A 1 296 ? 23.322  0.070   0.059   1.00 16.62 ? 297 GLN A CG  1 
ATOM   2398 C  CD  . GLN A 1 296 ? 24.274  -1.016  0.518   1.00 19.00 ? 297 GLN A CD  1 
ATOM   2399 O  OE1 . GLN A 1 296 ? 25.445  -1.025  0.143   1.00 19.28 ? 297 GLN A OE1 1 
ATOM   2400 N  NE2 . GLN A 1 296 ? 23.776  -1.941  1.332   1.00 19.91 ? 297 GLN A NE2 1 
ATOM   2401 N  N   . TRP A 1 297 ? 19.518  1.119   0.389   1.00 14.13 ? 298 TRP A N   1 
ATOM   2402 C  CA  . TRP A 1 297 ? 18.333  0.770   -0.410  1.00 13.87 ? 298 TRP A CA  1 
ATOM   2403 C  C   . TRP A 1 297 ? 17.774  1.976   -1.163  1.00 13.69 ? 298 TRP A C   1 
ATOM   2404 O  O   . TRP A 1 297 ? 17.347  1.852   -2.314  1.00 13.49 ? 298 TRP A O   1 
ATOM   2405 C  CB  . TRP A 1 297 ? 17.225  0.177   0.453   1.00 13.39 ? 298 TRP A CB  1 
ATOM   2406 C  CG  . TRP A 1 297 ? 17.383  -1.265  0.858   1.00 13.27 ? 298 TRP A CG  1 
ATOM   2407 C  CD1 . TRP A 1 297 ? 17.433  -1.742  2.123   1.00 11.65 ? 298 TRP A CD1 1 
ATOM   2408 C  CD2 . TRP A 1 297 ? 17.466  -2.414  -0.009  1.00 13.87 ? 298 TRP A CD2 1 
ATOM   2409 N  NE1 . TRP A 1 297 ? 17.550  -3.104  2.114   1.00 12.55 ? 298 TRP A NE1 1 
ATOM   2410 C  CE2 . TRP A 1 297 ? 17.576  -3.546  0.819   1.00 12.77 ? 298 TRP A CE2 1 
ATOM   2411 C  CE3 . TRP A 1 297 ? 17.471  -2.590  -1.403  1.00 14.22 ? 298 TRP A CE3 1 
ATOM   2412 C  CZ2 . TRP A 1 297 ? 17.672  -4.846  0.311   1.00 13.60 ? 298 TRP A CZ2 1 
ATOM   2413 C  CZ3 . TRP A 1 297 ? 17.572  -3.888  -1.914  1.00 14.53 ? 298 TRP A CZ3 1 
ATOM   2414 C  CH2 . TRP A 1 297 ? 17.677  -4.994  -1.058  1.00 14.59 ? 298 TRP A CH2 1 
ATOM   2415 N  N   . HIS A 1 298 ? 17.766  3.132   -0.505  1.00 13.89 ? 299 HIS A N   1 
ATOM   2416 C  CA  . HIS A 1 298 ? 17.260  4.354   -1.116  1.00 14.39 ? 299 HIS A CA  1 
ATOM   2417 C  C   . HIS A 1 298 ? 18.066  4.728   -2.368  1.00 14.52 ? 299 HIS A C   1 
ATOM   2418 O  O   . HIS A 1 298 ? 17.493  5.004   -3.431  1.00 14.03 ? 299 HIS A O   1 
ATOM   2419 C  CB  . HIS A 1 298 ? 17.250  5.517   -0.118  1.00 14.63 ? 299 HIS A CB  1 
ATOM   2420 C  CG  . HIS A 1 298 ? 16.562  6.739   -0.640  1.00 16.21 ? 299 HIS A CG  1 
ATOM   2421 N  ND1 . HIS A 1 298 ? 15.333  7.157   -0.174  1.00 17.13 ? 299 HIS A ND1 1 
ATOM   2422 C  CD2 . HIS A 1 298 ? 16.909  7.606   -1.621  1.00 16.81 ? 299 HIS A CD2 1 
ATOM   2423 C  CE1 . HIS A 1 298 ? 14.964  8.244   -0.829  1.00 17.43 ? 299 HIS A CE1 1 
ATOM   2424 N  NE2 . HIS A 1 298 ? 15.900  8.536   -1.714  1.00 18.65 ? 299 HIS A NE2 1 
ATOM   2425 N  N   . LEU A 1 299 ? 19.392  4.734   -2.239  1.00 14.66 ? 300 LEU A N   1 
ATOM   2426 C  CA  . LEU A 1 299 ? 20.267  4.989   -3.385  1.00 15.34 ? 300 LEU A CA  1 
ATOM   2427 C  C   . LEU A 1 299 ? 20.035  3.975   -4.494  1.00 15.62 ? 300 LEU A C   1 
ATOM   2428 O  O   . LEU A 1 299 ? 20.038  4.331   -5.671  1.00 16.37 ? 300 LEU A O   1 
ATOM   2429 C  CB  . LEU A 1 299 ? 21.740  4.987   -2.968  1.00 14.88 ? 300 LEU A CB  1 
ATOM   2430 C  CG  . LEU A 1 299 ? 22.180  6.050   -1.956  1.00 15.54 ? 300 LEU A CG  1 
ATOM   2431 C  CD1 . LEU A 1 299 ? 23.505  5.638   -1.273  1.00 14.30 ? 300 LEU A CD1 1 
ATOM   2432 C  CD2 . LEU A 1 299 ? 22.283  7.432   -2.600  1.00 15.25 ? 300 LEU A CD2 1 
ATOM   2433 N  N   . TYR A 1 300 ? 19.838  2.714   -4.106  1.00 16.06 ? 301 TYR A N   1 
ATOM   2434 C  CA  . TYR A 1 300 ? 19.548  1.632   -5.050  1.00 16.38 ? 301 TYR A CA  1 
ATOM   2435 C  C   . TYR A 1 300 ? 18.259  1.918   -5.816  1.00 16.69 ? 301 TYR A C   1 
ATOM   2436 O  O   . TYR A 1 300 ? 18.249  1.846   -7.044  1.00 17.14 ? 301 TYR A O   1 
ATOM   2437 C  CB  . TYR A 1 300 ? 19.503  0.280   -4.320  1.00 16.05 ? 301 TYR A CB  1 
ATOM   2438 C  CG  . TYR A 1 300 ? 18.930  -0.893  -5.102  1.00 16.32 ? 301 TYR A CG  1 
ATOM   2439 C  CD1 . TYR A 1 300 ? 19.736  -1.671  -5.945  1.00 16.92 ? 301 TYR A CD1 1 
ATOM   2440 C  CD2 . TYR A 1 300 ? 17.595  -1.258  -4.955  1.00 15.41 ? 301 TYR A CD2 1 
ATOM   2441 C  CE1 . TYR A 1 300 ? 19.206  -2.762  -6.641  1.00 17.69 ? 301 TYR A CE1 1 
ATOM   2442 C  CE2 . TYR A 1 300 ? 17.060  -2.345  -5.639  1.00 16.88 ? 301 TYR A CE2 1 
ATOM   2443 C  CZ  . TYR A 1 300 ? 17.861  -3.086  -6.478  1.00 18.65 ? 301 TYR A CZ  1 
ATOM   2444 O  OH  . TYR A 1 300 ? 17.300  -4.153  -7.149  1.00 21.51 ? 301 TYR A OH  1 
ATOM   2445 N  N   . GLU A 1 301 ? 17.190  2.270   -5.105  1.00 17.01 ? 302 GLU A N   1 
ATOM   2446 C  CA  . GLU A 1 301 ? 15.925  2.637   -5.759  1.00 18.02 ? 302 GLU A CA  1 
ATOM   2447 C  C   . GLU A 1 301 ? 16.025  3.921   -6.609  1.00 18.33 ? 302 GLU A C   1 
ATOM   2448 O  O   . GLU A 1 301 ? 15.301  4.070   -7.587  1.00 18.58 ? 302 GLU A O   1 
ATOM   2449 C  CB  . GLU A 1 301 ? 14.762  2.745   -4.756  1.00 17.71 ? 302 GLU A CB  1 
ATOM   2450 C  CG  . GLU A 1 301 ? 14.464  1.465   -3.958  1.00 19.87 ? 302 GLU A CG  1 
ATOM   2451 C  CD  . GLU A 1 301 ? 13.895  0.326   -4.811  1.00 23.75 ? 302 GLU A CD  1 
ATOM   2452 O  OE1 . GLU A 1 301 ? 13.806  -0.816  -4.308  1.00 26.02 ? 302 GLU A OE1 1 
ATOM   2453 O  OE2 . GLU A 1 301 ? 13.532  0.562   -5.978  1.00 24.22 ? 302 GLU A OE2 1 
ATOM   2454 N  N   . MET A 1 302 ? 16.913  4.840   -6.247  1.00 18.62 ? 303 MET A N   1 
ATOM   2455 C  CA  . MET A 1 302 ? 17.122  6.038   -7.072  1.00 19.48 ? 303 MET A CA  1 
ATOM   2456 C  C   . MET A 1 302 ? 17.874  5.723   -8.357  1.00 19.85 ? 303 MET A C   1 
ATOM   2457 O  O   . MET A 1 302 ? 17.603  6.323   -9.399  1.00 19.17 ? 303 MET A O   1 
ATOM   2458 C  CB  . MET A 1 302 ? 17.830  7.151   -6.295  1.00 19.56 ? 303 MET A CB  1 
ATOM   2459 C  CG  . MET A 1 302 ? 16.928  7.808   -5.268  1.00 21.32 ? 303 MET A CG  1 
ATOM   2460 S  SD  . MET A 1 302 ? 17.405  9.483   -4.815  1.00 26.38 ? 303 MET A SD  1 
ATOM   2461 C  CE  . MET A 1 302 ? 19.020  9.223   -4.087  1.00 24.72 ? 303 MET A CE  1 
ATOM   2462 N  N   . ALA A 1 303 ? 18.815  4.782   -8.271  1.00 20.18 ? 304 ALA A N   1 
ATOM   2463 C  CA  . ALA A 1 303 ? 19.554  4.318   -9.442  1.00 21.04 ? 304 ALA A CA  1 
ATOM   2464 C  C   . ALA A 1 303 ? 18.669  3.476   -10.357 1.00 21.65 ? 304 ALA A C   1 
ATOM   2465 O  O   . ALA A 1 303 ? 18.884  3.435   -11.571 1.00 21.78 ? 304 ALA A O   1 
ATOM   2466 C  CB  . ALA A 1 303 ? 20.797  3.517   -9.020  1.00 20.64 ? 304 ALA A CB  1 
ATOM   2467 N  N   . ARG A 1 304 ? 17.697  2.796   -9.756  1.00 22.63 ? 305 ARG A N   1 
ATOM   2468 C  CA  . ARG A 1 304 ? 16.747  1.946   -10.475 1.00 23.78 ? 305 ARG A CA  1 
ATOM   2469 C  C   . ARG A 1 304 ? 15.636  2.752   -11.144 1.00 23.55 ? 305 ARG A C   1 
ATOM   2470 O  O   . ARG A 1 304 ? 15.000  2.276   -12.076 1.00 23.82 ? 305 ARG A O   1 
ATOM   2471 C  CB  . ARG A 1 304 ? 16.106  0.946   -9.509  1.00 24.39 ? 305 ARG A CB  1 
ATOM   2472 C  CG  . ARG A 1 304 ? 16.725  -0.442  -9.491  1.00 27.63 ? 305 ARG A CG  1 
ATOM   2473 C  CD  . ARG A 1 304 ? 15.810  -1.448  -8.764  1.00 32.67 ? 305 ARG A CD  1 
ATOM   2474 N  NE  . ARG A 1 304 ? 14.595  -1.767  -9.516  1.00 36.01 ? 305 ARG A NE  1 
ATOM   2475 C  CZ  . ARG A 1 304 ? 13.350  -1.512  -9.107  1.00 38.84 ? 305 ARG A CZ  1 
ATOM   2476 N  NH1 . ARG A 1 304 ? 13.119  -0.943  -7.929  1.00 39.21 ? 305 ARG A NH1 1 
ATOM   2477 N  NH2 . ARG A 1 304 ? 12.319  -1.838  -9.878  1.00 39.98 ? 305 ARG A NH2 1 
ATOM   2478 N  N   . ASN A 1 305 ? 15.405  3.966   -10.646 1.00 23.56 ? 306 ASN A N   1 
ATOM   2479 C  CA  . ASN A 1 305 ? 14.280  4.798   -11.062 1.00 23.29 ? 306 ASN A CA  1 
ATOM   2480 C  C   . ASN A 1 305 ? 14.762  6.228   -11.291 1.00 22.72 ? 306 ASN A C   1 
ATOM   2481 O  O   . ASN A 1 305 ? 14.531  7.117   -10.463 1.00 22.11 ? 306 ASN A O   1 
ATOM   2482 C  CB  . ASN A 1 305 ? 13.165  4.749   -10.004 1.00 23.31 ? 306 ASN A CB  1 
ATOM   2483 C  CG  . ASN A 1 305 ? 12.700  3.324   -9.703  1.00 25.78 ? 306 ASN A CG  1 
ATOM   2484 O  OD1 . ASN A 1 305 ? 11.822  2.795   -10.388 1.00 29.69 ? 306 ASN A OD1 1 
ATOM   2485 N  ND2 . ASN A 1 305 ? 13.288  2.694   -8.675  1.00 24.86 ? 306 ASN A ND2 1 
ATOM   2486 N  N   . LEU A 1 306 ? 15.438  6.439   -12.419 1.00 22.43 ? 307 LEU A N   1 
ATOM   2487 C  CA  . LEU A 1 306 ? 16.118  7.716   -12.699 1.00 23.00 ? 307 LEU A CA  1 
ATOM   2488 C  C   . LEU A 1 306 ? 15.188  8.945   -12.803 1.00 22.90 ? 307 LEU A C   1 
ATOM   2489 O  O   . LEU A 1 306 ? 15.602  10.064  -12.489 1.00 22.75 ? 307 LEU A O   1 
ATOM   2490 C  CB  . LEU A 1 306 ? 17.029  7.602   -13.936 1.00 22.91 ? 307 LEU A CB  1 
ATOM   2491 C  CG  . LEU A 1 306 ? 18.175  6.581   -13.873 1.00 23.76 ? 307 LEU A CG  1 
ATOM   2492 C  CD1 . LEU A 1 306 ? 18.920  6.497   -15.210 1.00 24.73 ? 307 LEU A CD1 1 
ATOM   2493 C  CD2 . LEU A 1 306 ? 19.154  6.868   -12.734 1.00 23.74 ? 307 LEU A CD2 1 
ATOM   2494 N  N   . LYS A 1 307 ? 13.944  8.730   -13.221 1.00 22.80 ? 308 LYS A N   1 
ATOM   2495 C  CA  . LYS A 1 307 ? 12.928  9.792   -13.227 1.00 23.51 ? 308 LYS A CA  1 
ATOM   2496 C  C   . LYS A 1 307 ? 12.586  10.263  -11.817 1.00 22.87 ? 308 LYS A C   1 
ATOM   2497 O  O   . LYS A 1 307 ? 12.419  11.456  -11.574 1.00 22.88 ? 308 LYS A O   1 
ATOM   2498 C  CB  . LYS A 1 307 ? 11.645  9.324   -13.928 1.00 23.97 ? 308 LYS A CB  1 
ATOM   2499 C  CG  . LYS A 1 307 ? 11.495  9.764   -15.384 1.00 27.07 ? 308 LYS A CG  1 
ATOM   2500 C  CD  . LYS A 1 307 ? 12.515  9.116   -16.301 1.00 30.40 ? 308 LYS A CD  1 
ATOM   2501 C  CE  . LYS A 1 307 ? 11.906  8.831   -17.668 1.00 33.31 ? 308 LYS A CE  1 
ATOM   2502 N  NZ  . LYS A 1 307 ? 10.904  7.718   -17.572 1.00 36.10 ? 308 LYS A NZ  1 
ATOM   2503 N  N   . VAL A 1 308 ? 12.469  9.314   -10.896 1.00 22.34 ? 309 VAL A N   1 
ATOM   2504 C  CA  . VAL A 1 308 ? 12.231  9.637   -9.490  1.00 21.86 ? 309 VAL A CA  1 
ATOM   2505 C  C   . VAL A 1 308 ? 13.446  10.365  -8.901  1.00 21.27 ? 309 VAL A C   1 
ATOM   2506 O  O   . VAL A 1 308 ? 13.285  11.358  -8.190  1.00 21.48 ? 309 VAL A O   1 
ATOM   2507 C  CB  . VAL A 1 308 ? 11.853  8.378   -8.671  1.00 21.86 ? 309 VAL A CB  1 
ATOM   2508 C  CG1 . VAL A 1 308 ? 11.662  8.713   -7.191  1.00 21.64 ? 309 VAL A CG1 1 
ATOM   2509 C  CG2 . VAL A 1 308 ? 10.584  7.741   -9.241  1.00 22.59 ? 309 VAL A CG2 1 
ATOM   2510 N  N   . GLN A 1 309 ? 14.648  9.898   -9.223  1.00 20.87 ? 310 GLN A N   1 
ATOM   2511 C  CA  . GLN A 1 309 ? 15.870  10.572  -8.779  1.00 20.91 ? 310 GLN A CA  1 
ATOM   2512 C  C   . GLN A 1 309 ? 15.885  12.048  -9.225  1.00 21.43 ? 310 GLN A C   1 
ATOM   2513 O  O   . GLN A 1 309 ? 16.131  12.944  -8.408  1.00 21.58 ? 310 GLN A O   1 
ATOM   2514 C  CB  . GLN A 1 309 ? 17.138  9.819   -9.239  1.00 20.18 ? 310 GLN A CB  1 
ATOM   2515 C  CG  . GLN A 1 309 ? 18.427  10.374  -8.621  1.00 18.27 ? 310 GLN A CG  1 
ATOM   2516 C  CD  . GLN A 1 309 ? 19.700  9.714   -9.136  1.00 16.42 ? 310 GLN A CD  1 
ATOM   2517 O  OE1 . GLN A 1 309 ? 19.711  8.553   -9.543  1.00 17.49 ? 310 GLN A OE1 1 
ATOM   2518 N  NE2 . GLN A 1 309 ? 20.785  10.449  -9.091  1.00 13.89 ? 310 GLN A NE2 1 
ATOM   2519 N  N   . ASP A 1 310 ? 15.591  12.288  -10.503 1.00 22.14 ? 311 ASP A N   1 
ATOM   2520 C  CA  . ASP A 1 310 ? 15.453  13.651  -11.057 1.00 23.04 ? 311 ASP A CA  1 
ATOM   2521 C  C   . ASP A 1 310 ? 14.449  14.531  -10.306 1.00 23.01 ? 311 ASP A C   1 
ATOM   2522 O  O   . ASP A 1 310 ? 14.745  15.692  -9.987  1.00 22.46 ? 311 ASP A O   1 
ATOM   2523 C  CB  . ASP A 1 310 ? 15.035  13.594  -12.533 1.00 23.50 ? 311 ASP A CB  1 
ATOM   2524 C  CG  . ASP A 1 310 ? 16.162  13.166  -13.453 1.00 25.12 ? 311 ASP A CG  1 
ATOM   2525 O  OD1 . ASP A 1 310 ? 17.343  13.444  -13.137 1.00 28.22 ? 311 ASP A OD1 1 
ATOM   2526 O  OD2 . ASP A 1 310 ? 15.863  12.554  -14.507 1.00 26.61 ? 311 ASP A OD2 1 
ATOM   2527 N  N   . MET A 1 311 ? 13.257  13.984  -10.052 1.00 23.33 ? 312 MET A N   1 
ATOM   2528 C  CA  . MET A 1 311 ? 12.210  14.700  -9.308  1.00 23.72 ? 312 MET A CA  1 
ATOM   2529 C  C   . MET A 1 311 ? 12.715  15.093  -7.929  1.00 23.09 ? 312 MET A C   1 
ATOM   2530 O  O   . MET A 1 311 ? 12.475  16.207  -7.470  1.00 23.15 ? 312 MET A O   1 
ATOM   2531 C  CB  . MET A 1 311 ? 10.965  13.829  -9.130  1.00 24.15 ? 312 MET A CB  1 
ATOM   2532 C  CG  . MET A 1 311 ? 9.997   13.814  -10.300 1.00 27.55 ? 312 MET A CG  1 
ATOM   2533 S  SD  . MET A 1 311 ? 8.687   12.582  -10.029 1.00 34.36 ? 312 MET A SD  1 
ATOM   2534 C  CE  . MET A 1 311 ? 7.692   13.360  -8.744  1.00 32.17 ? 312 MET A CE  1 
ATOM   2535 N  N   . LEU A 1 312 ? 13.411  14.166  -7.271  1.00 22.39 ? 313 LEU A N   1 
ATOM   2536 C  CA  . LEU A 1 312 ? 13.895  14.406  -5.922  1.00 21.99 ? 313 LEU A CA  1 
ATOM   2537 C  C   . LEU A 1 312 ? 14.987  15.466  -5.910  1.00 21.68 ? 313 LEU A C   1 
ATOM   2538 O  O   . LEU A 1 312 ? 15.000  16.325  -5.029  1.00 21.35 ? 313 LEU A O   1 
ATOM   2539 C  CB  . LEU A 1 312 ? 14.367  13.104  -5.261  1.00 21.94 ? 313 LEU A CB  1 
ATOM   2540 C  CG  . LEU A 1 312 ? 13.298  12.044  -4.949  1.00 21.95 ? 313 LEU A CG  1 
ATOM   2541 C  CD1 . LEU A 1 312 ? 13.953  10.719  -4.623  1.00 21.19 ? 313 LEU A CD1 1 
ATOM   2542 C  CD2 . LEU A 1 312 ? 12.367  12.464  -3.808  1.00 22.02 ? 313 LEU A CD2 1 
ATOM   2543 N  N   . ARG A 1 313 ? 15.888  15.417  -6.893  1.00 21.51 ? 314 ARG A N   1 
ATOM   2544 C  CA  . ARG A 1 313 ? 16.937  16.425  -7.003  1.00 22.01 ? 314 ARG A CA  1 
ATOM   2545 C  C   . ARG A 1 313 ? 16.344  17.834  -7.179  1.00 22.51 ? 314 ARG A C   1 
ATOM   2546 O  O   . ARG A 1 313 ? 16.781  18.775  -6.513  1.00 22.49 ? 314 ARG A O   1 
ATOM   2547 C  CB  . ARG A 1 313 ? 17.923  16.090  -8.134  1.00 21.57 ? 314 ARG A CB  1 
ATOM   2548 C  CG  . ARG A 1 313 ? 19.107  17.038  -8.233  1.00 21.11 ? 314 ARG A CG  1 
ATOM   2549 C  CD  . ARG A 1 313 ? 20.222  16.488  -9.119  1.00 20.96 ? 314 ARG A CD  1 
ATOM   2550 N  NE  . ARG A 1 313 ? 20.864  15.326  -8.493  1.00 22.01 ? 314 ARG A NE  1 
ATOM   2551 C  CZ  . ARG A 1 313 ? 20.700  14.062  -8.882  1.00 21.56 ? 314 ARG A CZ  1 
ATOM   2552 N  NH1 . ARG A 1 313 ? 19.936  13.754  -9.928  1.00 20.58 ? 314 ARG A NH1 1 
ATOM   2553 N  NH2 . ARG A 1 313 ? 21.317  13.100  -8.223  1.00 21.50 ? 314 ARG A NH2 1 
ATOM   2554 N  N   . ALA A 1 314 ? 15.350  17.957  -8.063  1.00 22.92 ? 315 ALA A N   1 
ATOM   2555 C  CA  . ALA A 1 314 ? 14.714  19.243  -8.370  1.00 23.44 ? 315 ALA A CA  1 
ATOM   2556 C  C   . ALA A 1 314 ? 14.018  19.836  -7.145  1.00 23.89 ? 315 ALA A C   1 
ATOM   2557 O  O   . ALA A 1 314 ? 14.128  21.042  -6.891  1.00 24.12 ? 315 ALA A O   1 
ATOM   2558 C  CB  . ALA A 1 314 ? 13.729  19.103  -9.552  1.00 23.11 ? 315 ALA A CB  1 
ATOM   2559 N  N   . GLU A 1 315 ? 13.322  18.991  -6.378  1.00 24.14 ? 316 GLU A N   1 
ATOM   2560 C  CA  . GLU A 1 315 ? 12.696  19.440  -5.133  1.00 24.64 ? 316 GLU A CA  1 
ATOM   2561 C  C   . GLU A 1 315 ? 13.729  19.923  -4.105  1.00 24.29 ? 316 GLU A C   1 
ATOM   2562 O  O   . GLU A 1 315 ? 13.495  20.906  -3.406  1.00 24.20 ? 316 GLU A O   1 
ATOM   2563 C  CB  . GLU A 1 315 ? 11.813  18.353  -4.510  1.00 24.93 ? 316 GLU A CB  1 
ATOM   2564 C  CG  . GLU A 1 315 ? 10.968  18.878  -3.340  1.00 27.16 ? 316 GLU A CG  1 
ATOM   2565 C  CD  . GLU A 1 315 ? 10.377  17.782  -2.453  1.00 31.50 ? 316 GLU A CD  1 
ATOM   2566 O  OE1 . GLU A 1 315 ? 11.141  16.905  -1.982  1.00 33.70 ? 316 GLU A OE1 1 
ATOM   2567 O  OE2 . GLU A 1 315 ? 9.149   17.817  -2.199  1.00 31.56 ? 316 GLU A OE2 1 
ATOM   2568 N  N   . VAL A 1 316 ? 14.854  19.219  -4.007  1.00 24.20 ? 317 VAL A N   1 
ATOM   2569 C  CA  . VAL A 1 316 ? 15.913  19.585  -3.061  1.00 24.30 ? 317 VAL A CA  1 
ATOM   2570 C  C   . VAL A 1 316 ? 16.563  20.913  -3.445  1.00 24.15 ? 317 VAL A C   1 
ATOM   2571 O  O   . VAL A 1 316 ? 16.792  21.758  -2.579  1.00 23.96 ? 317 VAL A O   1 
ATOM   2572 C  CB  . VAL A 1 316 ? 16.975  18.467  -2.908  1.00 24.09 ? 317 VAL A CB  1 
ATOM   2573 C  CG1 . VAL A 1 316 ? 18.185  18.966  -2.146  1.00 24.08 ? 317 VAL A CG1 1 
ATOM   2574 C  CG2 . VAL A 1 316 ? 16.379  17.261  -2.185  1.00 24.60 ? 317 VAL A CG2 1 
ATOM   2575 N  N   . LEU A 1 317 ? 16.835  21.098  -4.738  1.00 24.46 ? 318 LEU A N   1 
ATOM   2576 C  CA  . LEU A 1 317 ? 17.402  22.358  -5.244  1.00 25.10 ? 318 LEU A CA  1 
ATOM   2577 C  C   . LEU A 1 317 ? 16.456  23.545  -5.041  1.00 25.19 ? 318 LEU A C   1 
ATOM   2578 O  O   . LEU A 1 317 ? 16.900  24.633  -4.662  1.00 25.02 ? 318 LEU A O   1 
ATOM   2579 C  CB  . LEU A 1 317 ? 17.804  22.243  -6.720  1.00 25.04 ? 318 LEU A CB  1 
ATOM   2580 C  CG  . LEU A 1 317 ? 18.926  21.266  -7.109  1.00 26.57 ? 318 LEU A CG  1 
ATOM   2581 C  CD1 . LEU A 1 317 ? 19.044  21.163  -8.633  1.00 26.62 ? 318 LEU A CD1 1 
ATOM   2582 C  CD2 . LEU A 1 317 ? 20.278  21.627  -6.497  1.00 26.28 ? 318 LEU A CD2 1 
ATOM   2583 N  N   . ALA A 1 318 ? 15.161  23.335  -5.281  1.00 25.37 ? 319 ALA A N   1 
ATOM   2584 C  CA  . ALA A 1 318 ? 14.162  24.377  -5.027  1.00 25.99 ? 319 ALA A CA  1 
ATOM   2585 C  C   . ALA A 1 318 ? 14.126  24.706  -3.545  1.00 26.52 ? 319 ALA A C   1 
ATOM   2586 O  O   . ALA A 1 318 ? 14.046  25.877  -3.174  1.00 26.75 ? 319 ALA A O   1 
ATOM   2587 C  CB  . ALA A 1 318 ? 12.778  23.950  -5.504  1.00 25.77 ? 319 ALA A CB  1 
ATOM   2588 N  N   . ALA A 1 319 ? 14.210  23.674  -2.701  1.00 26.80 ? 320 ALA A N   1 
ATOM   2589 C  CA  . ALA A 1 319 ? 14.087  23.866  -1.260  1.00 27.55 ? 320 ALA A CA  1 
ATOM   2590 C  C   . ALA A 1 319 ? 15.288  24.609  -0.670  1.00 28.11 ? 320 ALA A C   1 
ATOM   2591 O  O   . ALA A 1 319 ? 15.117  25.446  0.212   1.00 28.12 ? 320 ALA A O   1 
ATOM   2592 C  CB  . ALA A 1 319 ? 13.853  22.536  -0.541  1.00 27.30 ? 320 ALA A CB  1 
ATOM   2593 N  N   . ARG A 1 320 ? 16.490  24.312  -1.161  1.00 28.92 ? 321 ARG A N   1 
ATOM   2594 C  CA  . ARG A 1 320 ? 17.699  25.004  -0.707  1.00 29.99 ? 321 ARG A CA  1 
ATOM   2595 C  C   . ARG A 1 320 ? 17.633  26.501  -1.055  1.00 30.56 ? 321 ARG A C   1 
ATOM   2596 O  O   . ARG A 1 320 ? 17.964  27.354  -0.224  1.00 30.70 ? 321 ARG A O   1 
ATOM   2597 C  CB  . ARG A 1 320 ? 18.965  24.342  -1.282  1.00 29.60 ? 321 ARG A CB  1 
ATOM   2598 C  CG  . ARG A 1 320 ? 20.292  24.968  -0.835  1.00 29.78 ? 321 ARG A CG  1 
ATOM   2599 C  CD  . ARG A 1 320 ? 20.654  24.651  0.626   1.00 30.68 ? 321 ARG A CD  1 
ATOM   2600 N  NE  . ARG A 1 320 ? 21.223  23.310  0.802   1.00 29.81 ? 321 ARG A NE  1 
ATOM   2601 C  CZ  . ARG A 1 320 ? 21.685  22.828  1.957   1.00 29.81 ? 321 ARG A CZ  1 
ATOM   2602 N  NH1 . ARG A 1 320 ? 21.645  23.570  3.061   1.00 29.60 ? 321 ARG A NH1 1 
ATOM   2603 N  NH2 . ARG A 1 320 ? 22.189  21.598  2.012   1.00 27.52 ? 321 ARG A NH2 1 
ATOM   2604 N  N   . HIS A 1 321 ? 17.186  26.804  -2.272  1.00 31.42 ? 322 HIS A N   1 
ATOM   2605 C  CA  . HIS A 1 321 ? 16.988  28.182  -2.718  1.00 32.31 ? 322 HIS A CA  1 
ATOM   2606 C  C   . HIS A 1 321 ? 15.913  28.910  -1.897  1.00 32.84 ? 322 HIS A C   1 
ATOM   2607 O  O   . HIS A 1 321 ? 16.165  29.982  -1.345  1.00 32.86 ? 322 HIS A O   1 
ATOM   2608 C  CB  . HIS A 1 321 ? 16.652  28.212  -4.217  1.00 32.57 ? 322 HIS A CB  1 
ATOM   2609 C  CG  . HIS A 1 321 ? 16.345  29.583  -4.744  1.00 33.90 ? 322 HIS A CG  1 
ATOM   2610 N  ND1 . HIS A 1 321 ? 17.308  30.560  -4.887  1.00 35.00 ? 322 HIS A ND1 1 
ATOM   2611 C  CD2 . HIS A 1 321 ? 15.182  30.137  -5.161  1.00 34.16 ? 322 HIS A CD2 1 
ATOM   2612 C  CE1 . HIS A 1 321 ? 16.751  31.658  -5.366  1.00 35.46 ? 322 HIS A CE1 1 
ATOM   2613 N  NE2 . HIS A 1 321 ? 15.462  31.427  -5.544  1.00 35.84 ? 322 HIS A NE2 1 
ATOM   2614 N  N   . GLN A 1 322 ? 14.727  28.313  -1.818  1.00 33.48 ? 323 GLN A N   1 
ATOM   2615 C  CA  . GLN A 1 322 ? 13.592  28.854  -1.066  1.00 34.29 ? 323 GLN A CA  1 
ATOM   2616 C  C   . GLN A 1 322 ? 13.934  29.148  0.398   1.00 34.47 ? 323 GLN A C   1 
ATOM   2617 O  O   . GLN A 1 322 ? 13.459  30.130  0.966   1.00 34.35 ? 323 GLN A O   1 
ATOM   2618 C  CB  . GLN A 1 322 ? 12.434  27.855  -1.124  1.00 34.62 ? 323 GLN A CB  1 
ATOM   2619 C  CG  . GLN A 1 322 ? 11.069  28.418  -0.786  1.00 36.82 ? 323 GLN A CG  1 
ATOM   2620 C  CD  . GLN A 1 322 ? 10.301  28.830  -2.022  1.00 39.99 ? 323 GLN A CD  1 
ATOM   2621 O  OE1 . GLN A 1 322 ? 9.861   27.981  -2.810  1.00 41.43 ? 323 GLN A OE1 1 
ATOM   2622 N  NE2 . GLN A 1 322 ? 10.128  30.140  -2.202  1.00 40.39 ? 323 GLN A NE2 1 
ATOM   2623 N  N   . ALA A 1 323 ? 14.754  28.283  1.000   1.00 34.68 ? 324 ALA A N   1 
ATOM   2624 C  CA  . ALA A 1 323 ? 15.127  28.392  2.408   1.00 34.79 ? 324 ALA A CA  1 
ATOM   2625 C  C   . ALA A 1 323 ? 16.321  29.319  2.600   1.00 35.10 ? 324 ALA A C   1 
ATOM   2626 O  O   . ALA A 1 323 ? 16.728  29.594  3.732   1.00 35.00 ? 324 ALA A O   1 
ATOM   2627 C  CB  . ALA A 1 323 ? 15.440  27.012  2.973   1.00 34.81 ? 324 ALA A CB  1 
ATOM   2628 N  N   . GLN A 1 324 ? 16.872  29.793  1.482   1.00 35.47 ? 325 GLN A N   1 
ATOM   2629 C  CA  . GLN A 1 324 ? 18.106  30.576  1.460   1.00 35.86 ? 325 GLN A CA  1 
ATOM   2630 C  C   . GLN A 1 324 ? 19.231  29.872  2.229   1.00 35.53 ? 325 GLN A C   1 
ATOM   2631 O  O   . GLN A 1 324 ? 19.997  30.508  2.945   1.00 35.48 ? 325 GLN A O   1 
ATOM   2632 C  CB  . GLN A 1 324 ? 17.866  32.012  1.959   1.00 36.41 ? 325 GLN A CB  1 
ATOM   2633 C  CG  . GLN A 1 324 ? 16.935  32.833  1.054   1.00 38.40 ? 325 GLN A CG  1 
ATOM   2634 C  CD  . GLN A 1 324 ? 17.009  34.333  1.316   1.00 41.45 ? 325 GLN A CD  1 
ATOM   2635 O  OE1 . GLN A 1 324 ? 17.388  35.112  0.436   1.00 42.96 ? 325 GLN A OE1 1 
ATOM   2636 N  NE2 . GLN A 1 324 ? 16.646  34.744  2.524   1.00 41.19 ? 325 GLN A NE2 1 
ATOM   2637 N  N   . GLY A 1 325 ? 19.306  28.548  2.079   1.00 35.18 ? 326 GLY A N   1 
ATOM   2638 C  CA  . GLY A 1 325 ? 20.390  27.750  2.655   1.00 34.50 ? 326 GLY A CA  1 
ATOM   2639 C  C   . GLY A 1 325 ? 20.190  27.183  4.053   1.00 34.20 ? 326 GLY A C   1 
ATOM   2640 O  O   . GLY A 1 325 ? 20.981  26.341  4.487   1.00 34.36 ? 326 GLY A O   1 
ATOM   2641 N  N   . ASP A 1 326 ? 19.152  27.634  4.766   1.00 33.55 ? 327 ASP A N   1 
ATOM   2642 C  CA  . ASP A 1 326 ? 18.908  27.191  6.154   1.00 32.93 ? 327 ASP A CA  1 
ATOM   2643 C  C   . ASP A 1 326 ? 18.339  25.760  6.219   1.00 32.00 ? 327 ASP A C   1 
ATOM   2644 O  O   . ASP A 1 326 ? 17.266  25.495  5.677   1.00 31.65 ? 327 ASP A O   1 
ATOM   2645 C  CB  . ASP A 1 326 ? 17.973  28.173  6.883   1.00 33.08 ? 327 ASP A CB  1 
ATOM   2646 C  CG  . ASP A 1 326 ? 17.693  27.759  8.331   1.00 34.34 ? 327 ASP A CG  1 
ATOM   2647 O  OD1 . ASP A 1 326 ? 18.609  27.871  9.175   1.00 35.74 ? 327 ASP A OD1 1 
ATOM   2648 O  OD2 . ASP A 1 326 ? 16.554  27.331  8.634   1.00 35.83 ? 327 ASP A OD2 1 
ATOM   2649 N  N   . MET A 1 327 ? 19.051  24.853  6.894   1.00 31.08 ? 328 MET A N   1 
ATOM   2650 C  CA  . MET A 1 327 ? 18.642  23.441  6.966   1.00 30.18 ? 328 MET A CA  1 
ATOM   2651 C  C   . MET A 1 327 ? 17.287  23.239  7.651   1.00 29.53 ? 328 MET A C   1 
ATOM   2652 O  O   . MET A 1 327 ? 16.454  22.479  7.156   1.00 29.45 ? 328 MET A O   1 
ATOM   2653 C  CB  . MET A 1 327 ? 19.715  22.565  7.631   1.00 30.17 ? 328 MET A CB  1 
ATOM   2654 C  CG  . MET A 1 327 ? 19.401  21.045  7.612   1.00 30.19 ? 328 MET A CG  1 
ATOM   2655 S  SD  . MET A 1 327 ? 19.108  20.341  5.954   1.00 29.98 ? 328 MET A SD  1 
ATOM   2656 C  CE  . MET A 1 327 ? 20.755  20.415  5.245   1.00 29.18 ? 328 MET A CE  1 
ATOM   2657 N  N   . ALA A 1 328 ? 17.067  23.922  8.771   1.00 28.79 ? 329 ALA A N   1 
ATOM   2658 C  CA  . ALA A 1 328 ? 15.795  23.835  9.497   1.00 28.61 ? 329 ALA A CA  1 
ATOM   2659 C  C   . ALA A 1 328 ? 14.592  24.151  8.609   1.00 28.49 ? 329 ALA A C   1 
ATOM   2660 O  O   . ALA A 1 328 ? 13.591  23.436  8.630   1.00 28.36 ? 329 ALA A O   1 
ATOM   2661 C  CB  . ALA A 1 328 ? 15.812  24.745  10.721  1.00 28.71 ? 329 ALA A CB  1 
ATOM   2662 N  N   . THR A 1 329 ? 14.713  25.214  7.816   1.00 28.42 ? 330 THR A N   1 
ATOM   2663 C  CA  . THR A 1 329 ? 13.662  25.628  6.891   1.00 28.39 ? 330 THR A CA  1 
ATOM   2664 C  C   . THR A 1 329 ? 13.497  24.643  5.727   1.00 28.05 ? 330 THR A C   1 
ATOM   2665 O  O   . THR A 1 329 ? 12.372  24.335  5.327   1.00 28.03 ? 330 THR A O   1 
ATOM   2666 C  CB  . THR A 1 329 ? 13.946  27.044  6.348   1.00 28.42 ? 330 THR A CB  1 
ATOM   2667 O  OG1 . THR A 1 329 ? 14.270  27.914  7.442   1.00 29.12 ? 330 THR A OG1 1 
ATOM   2668 C  CG2 . THR A 1 329 ? 12.737  27.595  5.588   1.00 28.40 ? 330 THR A CG2 1 
ATOM   2669 N  N   . MET A 1 330 ? 14.624  24.173  5.195   1.00 27.82 ? 331 MET A N   1 
ATOM   2670 C  CA  . MET A 1 330 ? 14.669  23.193  4.111   1.00 28.11 ? 331 MET A CA  1 
ATOM   2671 C  C   . MET A 1 330 ? 13.867  21.936  4.421   1.00 27.89 ? 331 MET A C   1 
ATOM   2672 O  O   . MET A 1 330 ? 13.164  21.408  3.559   1.00 27.73 ? 331 MET A O   1 
ATOM   2673 C  CB  . MET A 1 330 ? 16.111  22.753  3.860   1.00 28.30 ? 331 MET A CB  1 
ATOM   2674 C  CG  . MET A 1 330 ? 16.833  23.483  2.771   1.00 29.70 ? 331 MET A CG  1 
ATOM   2675 S  SD  . MET A 1 330 ? 18.203  22.476  2.168   1.00 33.26 ? 331 MET A SD  1 
ATOM   2676 C  CE  . MET A 1 330 ? 17.359  21.415  0.990   1.00 31.38 ? 331 MET A CE  1 
ATOM   2677 N  N   . LEU A 1 331 ? 13.995  21.461  5.656   1.00 27.90 ? 332 LEU A N   1 
ATOM   2678 C  CA  . LEU A 1 331 ? 13.404  20.189  6.071   1.00 28.25 ? 332 LEU A CA  1 
ATOM   2679 C  C   . LEU A 1 331 ? 11.882  20.222  6.088   1.00 28.43 ? 332 LEU A C   1 
ATOM   2680 O  O   . LEU A 1 331 ? 11.246  19.178  6.186   1.00 28.93 ? 332 LEU A O   1 
ATOM   2681 C  CB  . LEU A 1 331 ? 13.966  19.743  7.428   1.00 27.98 ? 332 LEU A CB  1 
ATOM   2682 C  CG  . LEU A 1 331 ? 15.441  19.307  7.442   1.00 28.27 ? 332 LEU A CG  1 
ATOM   2683 C  CD1 . LEU A 1 331 ? 15.961  19.181  8.863   1.00 27.97 ? 332 LEU A CD1 1 
ATOM   2684 C  CD2 . LEU A 1 331 ? 15.661  18.006  6.665   1.00 27.78 ? 332 LEU A CD2 1 
ATOM   2685 N  N   . GLN A 1 332 ? 11.306  21.419  5.990   1.00 28.57 ? 333 GLN A N   1 
ATOM   2686 C  CA  . GLN A 1 332 ? 9.856   21.568  5.851   1.00 28.81 ? 333 GLN A CA  1 
ATOM   2687 C  C   . GLN A 1 332 ? 9.451   21.815  4.388   1.00 28.04 ? 333 GLN A C   1 
ATOM   2688 O  O   . GLN A 1 332 ? 8.274   21.986  4.086   1.00 28.28 ? 333 GLN A O   1 
ATOM   2689 C  CB  . GLN A 1 332 ? 9.321   22.673  6.774   1.00 29.08 ? 333 GLN A CB  1 
ATOM   2690 C  CG  . GLN A 1 332 ? 9.522   22.417  8.280   1.00 31.38 ? 333 GLN A CG  1 
ATOM   2691 C  CD  . GLN A 1 332 ? 8.562   21.375  8.861   1.00 35.48 ? 333 GLN A CD  1 
ATOM   2692 O  OE1 . GLN A 1 332 ? 8.991   20.324  9.350   1.00 37.36 ? 333 GLN A OE1 1 
ATOM   2693 N  NE2 . GLN A 1 332 ? 7.257   21.665  8.812   1.00 36.82 ? 333 GLN A NE2 1 
ATOM   2694 N  N   . LEU A 1 333 ? 10.424  21.799  3.481   1.00 27.39 ? 334 LEU A N   1 
ATOM   2695 C  CA  . LEU A 1 333 ? 10.162  22.076  2.068   1.00 26.46 ? 334 LEU A CA  1 
ATOM   2696 C  C   . LEU A 1 333 ? 10.498  20.906  1.140   1.00 25.94 ? 334 LEU A C   1 
ATOM   2697 O  O   . LEU A 1 333 ? 10.548  21.076  -0.079  1.00 25.80 ? 334 LEU A O   1 
ATOM   2698 C  CB  . LEU A 1 333 ? 10.903  23.350  1.629   1.00 27.08 ? 334 LEU A CB  1 
ATOM   2699 C  CG  . LEU A 1 333 ? 10.527  24.677  2.311   1.00 27.01 ? 334 LEU A CG  1 
ATOM   2700 C  CD1 . LEU A 1 333 ? 11.613  25.727  2.102   1.00 28.67 ? 334 LEU A CD1 1 
ATOM   2701 C  CD2 . LEU A 1 333 ? 9.192   25.185  1.809   1.00 27.13 ? 334 LEU A CD2 1 
ATOM   2702 N  N   . VAL A 1 334 ? 10.697  19.717  1.713   1.00 25.06 ? 335 VAL A N   1 
ATOM   2703 C  CA  . VAL A 1 334 ? 11.019  18.515  0.934   1.00 24.15 ? 335 VAL A CA  1 
ATOM   2704 C  C   . VAL A 1 334 ? 10.016  17.350  1.134   1.00 24.15 ? 335 VAL A C   1 
ATOM   2705 O  O   . VAL A 1 334 ? 10.431  16.225  1.458   1.00 24.23 ? 335 VAL A O   1 
ATOM   2706 C  CB  . VAL A 1 334 ? 12.497  18.024  1.180   1.00 24.33 ? 335 VAL A CB  1 
ATOM   2707 C  CG1 . VAL A 1 334 ? 13.519  19.007  0.587   1.00 23.22 ? 335 VAL A CG1 1 
ATOM   2708 C  CG2 . VAL A 1 334 ? 12.781  17.762  2.668   1.00 22.99 ? 335 VAL A CG2 1 
ATOM   2709 N  N   . PRO A 1 335 ? 8.698   17.600  0.932   1.00 23.69 ? 336 PRO A N   1 
ATOM   2710 C  CA  . PRO A 1 335 ? 7.720   16.537  1.196   1.00 23.13 ? 336 PRO A CA  1 
ATOM   2711 C  C   . PRO A 1 335 ? 7.899   15.265  0.351   1.00 22.63 ? 336 PRO A C   1 
ATOM   2712 O  O   . PRO A 1 335 ? 7.661   14.164  0.853   1.00 21.81 ? 336 PRO A O   1 
ATOM   2713 C  CB  . PRO A 1 335 ? 6.367   17.215  0.894   1.00 23.34 ? 336 PRO A CB  1 
ATOM   2714 C  CG  . PRO A 1 335 ? 6.691   18.367  0.025   1.00 23.04 ? 336 PRO A CG  1 
ATOM   2715 C  CD  . PRO A 1 335 ? 8.020   18.851  0.529   1.00 23.83 ? 336 PRO A CD  1 
ATOM   2716 N  N   . LEU A 1 336 ? 8.315   15.411  -0.908  1.00 21.98 ? 337 LEU A N   1 
ATOM   2717 C  CA  . LEU A 1 336 ? 8.535   14.246  -1.762  1.00 21.83 ? 337 LEU A CA  1 
ATOM   2718 C  C   . LEU A 1 336 ? 9.714   13.378  -1.297  1.00 21.29 ? 337 LEU A C   1 
ATOM   2719 O  O   . LEU A 1 336 ? 9.681   12.156  -1.451  1.00 21.00 ? 337 LEU A O   1 
ATOM   2720 C  CB  . LEU A 1 336 ? 8.731   14.657  -3.220  1.00 22.06 ? 337 LEU A CB  1 
ATOM   2721 C  CG  . LEU A 1 336 ? 8.708   13.521  -4.252  1.00 23.32 ? 337 LEU A CG  1 
ATOM   2722 C  CD1 . LEU A 1 336 ? 7.278   13.048  -4.552  1.00 24.10 ? 337 LEU A CD1 1 
ATOM   2723 C  CD2 . LEU A 1 336 ? 9.405   13.930  -5.537  1.00 25.32 ? 337 LEU A CD2 1 
ATOM   2724 N  N   . LEU A 1 337 ? 10.746  14.011  -0.740  1.00 20.68 ? 338 LEU A N   1 
ATOM   2725 C  CA  . LEU A 1 337 ? 11.919  13.289  -0.238  1.00 20.30 ? 338 LEU A CA  1 
ATOM   2726 C  C   . LEU A 1 337 ? 11.580  12.467  0.998   1.00 20.14 ? 338 LEU A C   1 
ATOM   2727 O  O   . LEU A 1 337 ? 11.973  11.295  1.112   1.00 19.98 ? 338 LEU A O   1 
ATOM   2728 C  CB  . LEU A 1 337 ? 13.077  14.247  0.065   1.00 19.82 ? 338 LEU A CB  1 
ATOM   2729 C  CG  . LEU A 1 337 ? 14.367  13.641  0.636   1.00 19.88 ? 338 LEU A CG  1 
ATOM   2730 C  CD1 . LEU A 1 337 ? 14.933  12.542  -0.287  1.00 18.93 ? 338 LEU A CD1 1 
ATOM   2731 C  CD2 . LEU A 1 337 ? 15.423  14.734  0.922   1.00 15.77 ? 338 LEU A CD2 1 
ATOM   2732 N  N   . LYS A 1 338 ? 10.855  13.091  1.921   1.00 19.77 ? 339 LYS A N   1 
ATOM   2733 C  CA  . LYS A 1 338 ? 10.360  12.403  3.097   1.00 19.82 ? 339 LYS A CA  1 
ATOM   2734 C  C   . LYS A 1 338 ? 9.435   11.250  2.731   1.00 19.36 ? 339 LYS A C   1 
ATOM   2735 O  O   . LYS A 1 338 ? 9.442   10.218  3.398   1.00 19.28 ? 339 LYS A O   1 
ATOM   2736 C  CB  . LYS A 1 338 ? 9.646   13.374  4.028   1.00 20.11 ? 339 LYS A CB  1 
ATOM   2737 C  CG  . LYS A 1 338 ? 10.537  14.489  4.539   1.00 20.72 ? 339 LYS A CG  1 
ATOM   2738 C  CD  . LYS A 1 338 ? 9.699   15.463  5.322   1.00 24.11 ? 339 LYS A CD  1 
ATOM   2739 C  CE  . LYS A 1 338 ? 9.956   15.349  6.798   1.00 25.25 ? 339 LYS A CE  1 
ATOM   2740 N  NZ  . LYS A 1 338 ? 10.823  16.481  7.235   1.00 27.45 ? 339 LYS A NZ  1 
ATOM   2741 N  N   . ALA A 1 339 ? 8.651   11.432  1.670   1.00 18.75 ? 340 ALA A N   1 
ATOM   2742 C  CA  . ALA A 1 339 ? 7.778   10.377  1.148   1.00 18.31 ? 340 ALA A CA  1 
ATOM   2743 C  C   . ALA A 1 339 ? 8.598   9.231   0.584   1.00 17.76 ? 340 ALA A C   1 
ATOM   2744 O  O   . ALA A 1 339 ? 8.211   8.085   0.711   1.00 18.29 ? 340 ALA A O   1 
ATOM   2745 C  CB  . ALA A 1 339 ? 6.827   10.930  0.062   1.00 17.80 ? 340 ALA A CB  1 
ATOM   2746 N  N   . SER A 1 340 ? 9.723   9.548   -0.050  1.00 17.31 ? 341 SER A N   1 
ATOM   2747 C  CA  . SER A 1 340 ? 10.561  8.536   -0.677  1.00 17.08 ? 341 SER A CA  1 
ATOM   2748 C  C   . SER A 1 340 ? 11.240  7.667   0.390   1.00 17.11 ? 341 SER A C   1 
ATOM   2749 O  O   . SER A 1 340 ? 11.586  6.512   0.133   1.00 17.01 ? 341 SER A O   1 
ATOM   2750 C  CB  . SER A 1 340 ? 11.597  9.183   -1.609  1.00 16.54 ? 341 SER A CB  1 
ATOM   2751 O  OG  . SER A 1 340 ? 12.520  9.993   -0.893  1.00 17.68 ? 341 SER A OG  1 
ATOM   2752 N  N   . ILE A 1 341 ? 11.418  8.235   1.581   1.00 16.97 ? 342 ILE A N   1 
ATOM   2753 C  CA  . ILE A 1 341 ? 11.919  7.495   2.730   1.00 17.24 ? 342 ILE A CA  1 
ATOM   2754 C  C   . ILE A 1 341 ? 10.867  6.495   3.253   1.00 17.65 ? 342 ILE A C   1 
ATOM   2755 O  O   . ILE A 1 341 ? 11.192  5.329   3.524   1.00 17.15 ? 342 ILE A O   1 
ATOM   2756 C  CB  . ILE A 1 341 ? 12.438  8.446   3.832   1.00 17.35 ? 342 ILE A CB  1 
ATOM   2757 C  CG1 . ILE A 1 341 ? 13.707  9.154   3.331   1.00 16.92 ? 342 ILE A CG1 1 
ATOM   2758 C  CG2 . ILE A 1 341 ? 12.746  7.670   5.123   1.00 16.91 ? 342 ILE A CG2 1 
ATOM   2759 C  CD1 . ILE A 1 341 ? 14.173  10.312  4.201   1.00 19.38 ? 342 ILE A CD1 1 
ATOM   2760 N  N   . LYS A 1 342 ? 9.618   6.948   3.370   1.00 17.46 ? 343 LYS A N   1 
ATOM   2761 C  CA  . LYS A 1 342 ? 8.494   6.054   3.663   1.00 17.65 ? 343 LYS A CA  1 
ATOM   2762 C  C   . LYS A 1 342 ? 8.413   4.939   2.622   1.00 17.40 ? 343 LYS A C   1 
ATOM   2763 O  O   . LYS A 1 342 ? 8.242   3.763   2.960   1.00 17.43 ? 343 LYS A O   1 
ATOM   2764 C  CB  . LYS A 1 342 ? 7.181   6.833   3.675   1.00 17.72 ? 343 LYS A CB  1 
ATOM   2765 C  CG  . LYS A 1 342 ? 7.050   7.828   4.812   1.00 18.38 ? 343 LYS A CG  1 
ATOM   2766 C  CD  . LYS A 1 342 ? 5.682   8.500   4.783   1.00 18.96 ? 343 LYS A CD  1 
ATOM   2767 C  CE  . LYS A 1 342 ? 5.704   9.798   5.582   1.00 20.61 ? 343 LYS A CE  1 
ATOM   2768 N  NZ  . LYS A 1 342 ? 4.401   10.490  5.473   1.00 22.20 ? 343 LYS A NZ  1 
ATOM   2769 N  N   . GLU A 1 343 ? 8.563   5.319   1.355   1.00 16.85 ? 344 GLU A N   1 
ATOM   2770 C  CA  . GLU A 1 343 ? 8.531   4.369   0.252   1.00 16.28 ? 344 GLU A CA  1 
ATOM   2771 C  C   . GLU A 1 343 ? 9.688   3.348   0.301   1.00 16.19 ? 344 GLU A C   1 
ATOM   2772 O  O   . GLU A 1 343 ? 9.499   2.171   -0.050  1.00 15.63 ? 344 GLU A O   1 
ATOM   2773 C  CB  . GLU A 1 343 ? 8.502   5.128   -1.075  1.00 16.12 ? 344 GLU A CB  1 
ATOM   2774 C  CG  . GLU A 1 343 ? 8.270   4.276   -2.326  1.00 16.48 ? 344 GLU A CG  1 
ATOM   2775 C  CD  . GLU A 1 343 ? 6.882   3.641   -2.414  1.00 17.43 ? 344 GLU A CD  1 
ATOM   2776 O  OE1 . GLU A 1 343 ? 6.121   3.623   -1.404  1.00 17.33 ? 344 GLU A OE1 1 
ATOM   2777 O  OE2 . GLU A 1 343 ? 6.561   3.147   -3.511  1.00 16.68 ? 344 GLU A OE2 1 
ATOM   2778 N  N   . THR A 1 344 ? 10.869  3.794   0.739   1.00 15.59 ? 345 THR A N   1 
ATOM   2779 C  CA  . THR A 1 344 ? 12.030  2.901   0.854   1.00 15.59 ? 345 THR A CA  1 
ATOM   2780 C  C   . THR A 1 344 ? 11.773  1.851   1.938   1.00 15.43 ? 345 THR A C   1 
ATOM   2781 O  O   . THR A 1 344 ? 11.996  0.664   1.726   1.00 15.44 ? 345 THR A O   1 
ATOM   2782 C  CB  . THR A 1 344 ? 13.335  3.679   1.139   1.00 15.16 ? 345 THR A CB  1 
ATOM   2783 O  OG1 . THR A 1 344 ? 13.626  4.524   0.023   1.00 16.21 ? 345 THR A OG1 1 
ATOM   2784 C  CG2 . THR A 1 344 ? 14.513  2.725   1.356   1.00 14.62 ? 345 THR A CG2 1 
ATOM   2785 N  N   . LEU A 1 345 ? 11.285  2.303   3.087   1.00 15.51 ? 346 LEU A N   1 
ATOM   2786 C  CA  . LEU A 1 345 ? 10.925  1.407   4.169   1.00 16.03 ? 346 LEU A CA  1 
ATOM   2787 C  C   . LEU A 1 345 ? 9.744   0.486   3.851   1.00 16.41 ? 346 LEU A C   1 
ATOM   2788 O  O   . LEU A 1 345 ? 9.676   -0.615  4.386   1.00 16.91 ? 346 LEU A O   1 
ATOM   2789 C  CB  . LEU A 1 345 ? 10.695  2.195   5.459   1.00 16.12 ? 346 LEU A CB  1 
ATOM   2790 C  CG  . LEU A 1 345 ? 12.004  2.654   6.105   1.00 16.20 ? 346 LEU A CG  1 
ATOM   2791 C  CD1 . LEU A 1 345 ? 11.722  3.737   7.109   1.00 16.67 ? 346 LEU A CD1 1 
ATOM   2792 C  CD2 . LEU A 1 345 ? 12.755  1.473   6.755   1.00 16.37 ? 346 LEU A CD2 1 
ATOM   2793 N  N   . ARG A 1 346 ? 8.829   0.909   2.980   1.00 16.68 ? 347 ARG A N   1 
ATOM   2794 C  CA  . ARG A 1 346 ? 7.739   0.025   2.553   1.00 17.14 ? 347 ARG A CA  1 
ATOM   2795 C  C   . ARG A 1 346 ? 8.286   -1.215  1.838   1.00 17.15 ? 347 ARG A C   1 
ATOM   2796 O  O   . ARG A 1 346 ? 7.929   -2.346  2.176   1.00 17.40 ? 347 ARG A O   1 
ATOM   2797 C  CB  . ARG A 1 346 ? 6.742   0.748   1.632   1.00 17.19 ? 347 ARG A CB  1 
ATOM   2798 C  CG  . ARG A 1 346 ? 5.668   -0.203  1.053   1.00 17.33 ? 347 ARG A CG  1 
ATOM   2799 C  CD  . ARG A 1 346 ? 4.764   0.470   0.022   1.00 18.55 ? 347 ARG A CD  1 
ATOM   2800 N  NE  . ARG A 1 346 ? 5.445   0.760   -1.239  1.00 17.78 ? 347 ARG A NE  1 
ATOM   2801 C  CZ  . ARG A 1 346 ? 5.683   -0.129  -2.201  1.00 20.03 ? 347 ARG A CZ  1 
ATOM   2802 N  NH1 . ARG A 1 346 ? 5.328   -1.409  -2.066  1.00 20.46 ? 347 ARG A NH1 1 
ATOM   2803 N  NH2 . ARG A 1 346 ? 6.303   0.255   -3.304  1.00 18.90 ? 347 ARG A NH2 1 
ATOM   2804 N  N   . LEU A 1 347 ? 9.135   -0.986  0.842   1.00 17.07 ? 348 LEU A N   1 
ATOM   2805 C  CA  . LEU A 1 347 ? 9.729   -2.062  0.058   1.00 17.31 ? 348 LEU A CA  1 
ATOM   2806 C  C   . LEU A 1 347 ? 10.833  -2.793  0.797   1.00 16.83 ? 348 LEU A C   1 
ATOM   2807 O  O   . LEU A 1 347 ? 11.003  -4.001  0.632   1.00 17.29 ? 348 LEU A O   1 
ATOM   2808 C  CB  . LEU A 1 347 ? 10.312  -1.505  -1.242  1.00 17.67 ? 348 LEU A CB  1 
ATOM   2809 C  CG  . LEU A 1 347 ? 9.322   -1.279  -2.374  1.00 19.26 ? 348 LEU A CG  1 
ATOM   2810 C  CD1 . LEU A 1 347 ? 9.992   -0.422  -3.445  1.00 20.68 ? 348 LEU A CD1 1 
ATOM   2811 C  CD2 . LEU A 1 347 ? 8.846   -2.622  -2.947  1.00 17.44 ? 348 LEU A CD2 1 
ATOM   2812 N  N   . HIS A 1 348 ? 11.607  -2.053  1.586   1.00 16.35 ? 349 HIS A N   1 
ATOM   2813 C  CA  . HIS A 1 348 ? 12.751  -2.627  2.277   1.00 15.57 ? 349 HIS A CA  1 
ATOM   2814 C  C   . HIS A 1 348 ? 12.714  -2.323  3.779   1.00 15.30 ? 349 HIS A C   1 
ATOM   2815 O  O   . HIS A 1 348 ? 13.516  -1.533  4.282   1.00 15.09 ? 349 HIS A O   1 
ATOM   2816 C  CB  . HIS A 1 348 ? 14.056  -2.148  1.632   1.00 15.53 ? 349 HIS A CB  1 
ATOM   2817 C  CG  . HIS A 1 348 ? 14.097  -2.320  0.143   1.00 15.54 ? 349 HIS A CG  1 
ATOM   2818 N  ND1 . HIS A 1 348 ? 14.194  -3.556  -0.464  1.00 15.99 ? 349 HIS A ND1 1 
ATOM   2819 C  CD2 . HIS A 1 348 ? 14.059  -1.410  -0.863  1.00 15.56 ? 349 HIS A CD2 1 
ATOM   2820 C  CE1 . HIS A 1 348 ? 14.202  -3.402  -1.778  1.00 15.40 ? 349 HIS A CE1 1 
ATOM   2821 N  NE2 . HIS A 1 348 ? 14.122  -2.109  -2.047  1.00 15.97 ? 349 HIS A NE2 1 
ATOM   2822 N  N   . PRO A 1 349 ? 11.766  -2.943  4.505   1.00 15.02 ? 350 PRO A N   1 
ATOM   2823 C  CA  . PRO A 1 349 ? 11.696  -2.713  5.935   1.00 14.56 ? 350 PRO A CA  1 
ATOM   2824 C  C   . PRO A 1 349 ? 12.949  -3.230  6.639   1.00 14.80 ? 350 PRO A C   1 
ATOM   2825 O  O   . PRO A 1 349 ? 13.565  -4.195  6.186   1.00 14.81 ? 350 PRO A O   1 
ATOM   2826 C  CB  . PRO A 1 349 ? 10.479  -3.542  6.356   1.00 14.62 ? 350 PRO A CB  1 
ATOM   2827 C  CG  . PRO A 1 349 ? 10.360  -4.589  5.329   1.00 14.09 ? 350 PRO A CG  1 
ATOM   2828 C  CD  . PRO A 1 349 ? 10.762  -3.930  4.065   1.00 15.14 ? 350 PRO A CD  1 
ATOM   2829 N  N   . ILE A 1 350 ? 13.332  -2.566  7.721   1.00 14.55 ? 351 ILE A N   1 
ATOM   2830 C  CA  . ILE A 1 350 ? 14.364  -3.084  8.607   1.00 14.43 ? 351 ILE A CA  1 
ATOM   2831 C  C   . ILE A 1 350 ? 13.794  -4.262  9.418   1.00 14.35 ? 351 ILE A C   1 
ATOM   2832 O  O   . ILE A 1 350 ? 14.447  -5.303  9.568   1.00 14.19 ? 351 ILE A O   1 
ATOM   2833 C  CB  . ILE A 1 350 ? 14.915  -1.958  9.529   1.00 14.10 ? 351 ILE A CB  1 
ATOM   2834 C  CG1 . ILE A 1 350 ? 15.877  -1.054  8.744   1.00 14.02 ? 351 ILE A CG1 1 
ATOM   2835 C  CG2 . ILE A 1 350 ? 15.558  -2.526  10.798  1.00 13.82 ? 351 ILE A CG2 1 
ATOM   2836 C  CD1 . ILE A 1 350 ? 17.187  -1.723  8.282   1.00 12.87 ? 351 ILE A CD1 1 
ATOM   2837 N  N   . SER A 1 351 ? 12.559  -4.098  9.882   1.00 13.78 ? 352 SER A N   1 
ATOM   2838 C  CA  . SER A 1 351 ? 11.878  -5.046  10.777  1.00 13.99 ? 352 SER A CA  1 
ATOM   2839 C  C   . SER A 1 351 ? 10.848  -5.922  10.015  1.00 13.71 ? 352 SER A C   1 
ATOM   2840 O  O   . SER A 1 351 ? 9.884   -5.386  9.459   1.00 13.70 ? 352 SER A O   1 
ATOM   2841 C  CB  . SER A 1 351 ? 11.173  -4.224  11.875  1.00 13.79 ? 352 SER A CB  1 
ATOM   2842 O  OG  . SER A 1 351 ? 10.727  -5.010  12.966  1.00 15.93 ? 352 SER A OG  1 
ATOM   2843 N  N   . VAL A 1 352 ? 11.030  -7.249  9.983   1.00 13.36 ? 353 VAL A N   1 
ATOM   2844 C  CA  . VAL A 1 352 ? 10.087  -8.114  9.258   1.00 12.93 ? 353 VAL A CA  1 
ATOM   2845 C  C   . VAL A 1 352 ? 8.672   -7.978  9.761   1.00 13.01 ? 353 VAL A C   1 
ATOM   2846 O  O   . VAL A 1 352 ? 7.738   -8.085  8.982   1.00 12.85 ? 353 VAL A O   1 
ATOM   2847 C  CB  . VAL A 1 352 ? 10.326  -9.679  9.371   1.00 13.71 ? 353 VAL A CB  1 
ATOM   2848 C  CG1 . VAL A 1 352 ? 10.536  -10.313 8.005   1.00 12.61 ? 353 VAL A CG1 1 
ATOM   2849 C  CG2 . VAL A 1 352 ? 11.326  -10.088 10.431  1.00 11.30 ? 353 VAL A CG2 1 
ATOM   2850 N  N   . THR A 1 353 ? 8.530   -7.825  11.076  1.00 12.98 ? 354 THR A N   1 
ATOM   2851 C  CA  . THR A 1 353 ? 7.233   -7.749  11.721  1.00 13.18 ? 354 THR A CA  1 
ATOM   2852 C  C   . THR A 1 353 ? 7.253   -6.681  12.795  1.00 13.84 ? 354 THR A C   1 
ATOM   2853 O  O   . THR A 1 353 ? 8.312   -6.264  13.262  1.00 14.21 ? 354 THR A O   1 
ATOM   2854 C  CB  . THR A 1 353 ? 6.812   -9.090  12.428  1.00 12.91 ? 354 THR A CB  1 
ATOM   2855 O  OG1 . THR A 1 353 ? 7.729   -9.405  13.488  1.00 12.47 ? 354 THR A OG1 1 
ATOM   2856 C  CG2 . THR A 1 353 ? 6.751   -10.248 11.456  1.00 12.19 ? 354 THR A CG2 1 
ATOM   2857 N  N   . LEU A 1 354 ? 6.058   -6.241  13.166  1.00 14.35 ? 355 LEU A N   1 
ATOM   2858 C  CA  . LEU A 1 354 ? 5.816   -5.597  14.442  1.00 14.21 ? 355 LEU A CA  1 
ATOM   2859 C  C   . LEU A 1 354 ? 5.082   -6.644  15.280  1.00 14.12 ? 355 LEU A C   1 
ATOM   2860 O  O   . LEU A 1 354 ? 4.396   -7.508  14.739  1.00 13.41 ? 355 LEU A O   1 
ATOM   2861 C  CB  . LEU A 1 354 ? 4.927   -4.370  14.259  1.00 14.18 ? 355 LEU A CB  1 
ATOM   2862 C  CG  . LEU A 1 354 ? 5.407   -3.195  13.416  1.00 14.62 ? 355 LEU A CG  1 
ATOM   2863 C  CD1 . LEU A 1 354 ? 4.336   -2.088  13.472  1.00 16.03 ? 355 LEU A CD1 1 
ATOM   2864 C  CD2 . LEU A 1 354 ? 6.753   -2.667  13.889  1.00 13.25 ? 355 LEU A CD2 1 
ATOM   2865 N  N   . GLN A 1 355 ? 5.225   -6.575  16.596  1.00 14.25 ? 356 GLN A N   1 
ATOM   2866 C  CA  . GLN A 1 355 ? 4.551   -7.547  17.460  1.00 14.28 ? 356 GLN A CA  1 
ATOM   2867 C  C   . GLN A 1 355 ? 4.012   -6.861  18.709  1.00 14.94 ? 356 GLN A C   1 
ATOM   2868 O  O   . GLN A 1 355 ? 4.626   -5.922  19.212  1.00 14.67 ? 356 GLN A O   1 
ATOM   2869 C  CB  . GLN A 1 355 ? 5.481   -8.703  17.869  1.00 13.49 ? 356 GLN A CB  1 
ATOM   2870 C  CG  . GLN A 1 355 ? 6.581   -9.081  16.878  1.00 13.03 ? 356 GLN A CG  1 
ATOM   2871 C  CD  . GLN A 1 355 ? 7.788   -8.188  17.010  1.00 12.78 ? 356 GLN A CD  1 
ATOM   2872 O  OE1 . GLN A 1 355 ? 8.182   -7.818  18.122  1.00 13.82 ? 356 GLN A OE1 1 
ATOM   2873 N  NE2 . GLN A 1 355 ? 8.380   -7.817  15.880  1.00 12.46 ? 356 GLN A NE2 1 
ATOM   2874 N  N   . ARG A 1 356 ? 2.863   -7.336  19.190  1.00 15.98 ? 357 ARG A N   1 
ATOM   2875 C  CA  . ARG A 1 356 ? 2.315   -6.929  20.481  1.00 17.29 ? 357 ARG A CA  1 
ATOM   2876 C  C   . ARG A 1 356 ? 1.711   -8.147  21.197  1.00 18.33 ? 357 ARG A C   1 
ATOM   2877 O  O   . ARG A 1 356 ? 1.062   -8.990  20.569  1.00 18.55 ? 357 ARG A O   1 
ATOM   2878 C  CB  . ARG A 1 356 ? 1.250   -5.825  20.321  1.00 17.15 ? 357 ARG A CB  1 
ATOM   2879 C  CG  . ARG A 1 356 ? 1.765   -4.446  19.864  1.00 17.14 ? 357 ARG A CG  1 
ATOM   2880 C  CD  . ARG A 1 356 ? 2.702   -3.802  20.885  1.00 16.64 ? 357 ARG A CD  1 
ATOM   2881 N  NE  . ARG A 1 356 ? 3.136   -2.448  20.510  1.00 16.95 ? 357 ARG A NE  1 
ATOM   2882 C  CZ  . ARG A 1 356 ? 4.273   -2.157  19.866  1.00 16.31 ? 357 ARG A CZ  1 
ATOM   2883 N  NH1 . ARG A 1 356 ? 5.102   -3.117  19.485  1.00 14.69 ? 357 ARG A NH1 1 
ATOM   2884 N  NH2 . ARG A 1 356 ? 4.578   -0.898  19.587  1.00 16.26 ? 357 ARG A NH2 1 
ATOM   2885 N  N   . TYR A 1 357 ? 1.953   -8.257  22.498  1.00 19.44 ? 358 TYR A N   1 
ATOM   2886 C  CA  . TYR A 1 357 ? 1.202   -9.202  23.320  1.00 21.19 ? 358 TYR A CA  1 
ATOM   2887 C  C   . TYR A 1 357 ? -0.115  -8.547  23.717  1.00 22.06 ? 358 TYR A C   1 
ATOM   2888 O  O   . TYR A 1 357 ? -0.116  -7.419  24.214  1.00 21.85 ? 358 TYR A O   1 
ATOM   2889 C  CB  . TYR A 1 357 ? 1.980   -9.588  24.574  1.00 21.05 ? 358 TYR A CB  1 
ATOM   2890 C  CG  . TYR A 1 357 ? 3.153   -10.499 24.322  1.00 21.61 ? 358 TYR A CG  1 
ATOM   2891 C  CD1 . TYR A 1 357 ? 4.442   -9.976  24.173  1.00 21.46 ? 358 TYR A CD1 1 
ATOM   2892 C  CD2 . TYR A 1 357 ? 2.984   -11.887 24.250  1.00 21.03 ? 358 TYR A CD2 1 
ATOM   2893 C  CE1 . TYR A 1 357 ? 5.540   -10.814 23.953  1.00 20.80 ? 358 TYR A CE1 1 
ATOM   2894 C  CE2 . TYR A 1 357 ? 4.073   -12.732 24.029  1.00 20.79 ? 358 TYR A CE2 1 
ATOM   2895 C  CZ  . TYR A 1 357 ? 5.345   -12.183 23.881  1.00 20.35 ? 358 TYR A CZ  1 
ATOM   2896 O  OH  . TYR A 1 357 ? 6.421   -13.002 23.662  1.00 20.47 ? 358 TYR A OH  1 
ATOM   2897 N  N   . LEU A 1 358 ? -1.229  -9.238  23.480  1.00 23.45 ? 359 LEU A N   1 
ATOM   2898 C  CA  . LEU A 1 358 ? -2.555  -8.684  23.819  1.00 25.02 ? 359 LEU A CA  1 
ATOM   2899 C  C   . LEU A 1 358 ? -2.742  -8.535  25.325  1.00 26.14 ? 359 LEU A C   1 
ATOM   2900 O  O   . LEU A 1 358 ? -2.356  -9.412  26.100  1.00 26.38 ? 359 LEU A O   1 
ATOM   2901 C  CB  . LEU A 1 358 ? -3.693  -9.527  23.227  1.00 24.78 ? 359 LEU A CB  1 
ATOM   2902 C  CG  . LEU A 1 358 ? -3.787  -9.648  21.702  1.00 24.96 ? 359 LEU A CG  1 
ATOM   2903 C  CD1 . LEU A 1 358 ? -5.006  -10.450 21.305  1.00 24.70 ? 359 LEU A CD1 1 
ATOM   2904 C  CD2 . LEU A 1 358 ? -3.813  -8.275  21.035  1.00 25.44 ? 359 LEU A CD2 1 
ATOM   2905 N  N   . VAL A 1 359 ? -3.315  -7.406  25.730  1.00 27.85 ? 360 VAL A N   1 
ATOM   2906 C  CA  . VAL A 1 359 ? -3.650  -7.163  27.138  1.00 29.36 ? 360 VAL A CA  1 
ATOM   2907 C  C   . VAL A 1 359 ? -5.043  -7.725  27.440  1.00 30.19 ? 360 VAL A C   1 
ATOM   2908 O  O   . VAL A 1 359 ? -5.270  -8.287  28.515  1.00 30.81 ? 360 VAL A O   1 
ATOM   2909 C  CB  . VAL A 1 359 ? -3.548  -5.657  27.506  1.00 29.46 ? 360 VAL A CB  1 
ATOM   2910 C  CG1 . VAL A 1 359 ? -3.874  -5.429  28.985  1.00 30.33 ? 360 VAL A CG1 1 
ATOM   2911 C  CG2 . VAL A 1 359 ? -2.149  -5.134  27.195  1.00 29.55 ? 360 VAL A CG2 1 
ATOM   2912 N  N   . ASN A 1 360 ? -5.947  -7.592  26.469  1.00 31.07 ? 361 ASN A N   1 
ATOM   2913 C  CA  . ASN A 1 360 ? -7.307  -8.136  26.533  1.00 31.81 ? 361 ASN A CA  1 
ATOM   2914 C  C   . ASN A 1 360 ? -7.655  -9.004  25.327  1.00 32.29 ? 361 ASN A C   1 
ATOM   2915 O  O   . ASN A 1 360 ? -7.046  -8.872  24.260  1.00 32.31 ? 361 ASN A O   1 
ATOM   2916 C  CB  . ASN A 1 360 ? -8.328  -6.999  26.619  1.00 31.92 ? 361 ASN A CB  1 
ATOM   2917 C  CG  . ASN A 1 360 ? -8.243  -6.245  27.919  1.00 32.36 ? 361 ASN A CG  1 
ATOM   2918 O  OD1 . ASN A 1 360 ? -8.261  -6.843  28.998  1.00 33.67 ? 361 ASN A OD1 1 
ATOM   2919 N  ND2 . ASN A 1 360 ? -8.134  -4.928  27.831  1.00 31.98 ? 361 ASN A ND2 1 
ATOM   2920 N  N   . ASP A 1 361 ? -8.652  -9.875  25.501  1.00 32.69 ? 362 ASP A N   1 
ATOM   2921 C  CA  . ASP A 1 361 ? -9.236  -10.642 24.399  1.00 32.99 ? 362 ASP A CA  1 
ATOM   2922 C  C   . ASP A 1 361 ? -9.574  -9.694  23.251  1.00 32.96 ? 362 ASP A C   1 
ATOM   2923 O  O   . ASP A 1 361 ? -9.922  -8.538  23.480  1.00 33.24 ? 362 ASP A O   1 
ATOM   2924 C  CB  . ASP A 1 361 ? -10.503 -11.386 24.858  1.00 33.18 ? 362 ASP A CB  1 
ATOM   2925 C  CG  . ASP A 1 361 ? -10.228 -12.452 25.931  1.00 33.71 ? 362 ASP A CG  1 
ATOM   2926 O  OD1 . ASP A 1 361 ? -9.081  -12.918 26.087  1.00 34.06 ? 362 ASP A OD1 1 
ATOM   2927 O  OD2 . ASP A 1 361 ? -11.183 -12.835 26.632  1.00 35.97 ? 362 ASP A OD2 1 
ATOM   2928 N  N   . LEU A 1 362 ? -9.458  -10.177 22.018  1.00 32.95 ? 363 LEU A N   1 
ATOM   2929 C  CA  . LEU A 1 362 ? -9.649  -9.329  20.844  1.00 32.81 ? 363 LEU A CA  1 
ATOM   2930 C  C   . LEU A 1 362 ? -10.160 -10.129 19.662  1.00 32.75 ? 363 LEU A C   1 
ATOM   2931 O  O   . LEU A 1 362 ? -9.689  -11.236 19.393  1.00 33.16 ? 363 LEU A O   1 
ATOM   2932 C  CB  . LEU A 1 362 ? -8.338  -8.613  20.464  1.00 32.88 ? 363 LEU A CB  1 
ATOM   2933 C  CG  . LEU A 1 362 ? -8.276  -7.879  19.113  1.00 32.78 ? 363 LEU A CG  1 
ATOM   2934 C  CD1 . LEU A 1 362 ? -9.179  -6.645  19.079  1.00 32.70 ? 363 LEU A CD1 1 
ATOM   2935 C  CD2 . LEU A 1 362 ? -6.846  -7.502  18.755  1.00 33.13 ? 363 LEU A CD2 1 
ATOM   2936 N  N   . VAL A 1 363 ? -11.116 -9.559  18.944  1.00 32.65 ? 364 VAL A N   1 
ATOM   2937 C  CA  . VAL A 1 363 ? -11.653 -10.214 17.764  1.00 32.57 ? 364 VAL A CA  1 
ATOM   2938 C  C   . VAL A 1 363 ? -11.004 -9.637  16.515  1.00 32.58 ? 364 VAL A C   1 
ATOM   2939 O  O   . VAL A 1 363 ? -11.007 -8.426  16.317  1.00 32.86 ? 364 VAL A O   1 
ATOM   2940 C  CB  . VAL A 1 363 ? -13.200 -10.115 17.705  1.00 32.56 ? 364 VAL A CB  1 
ATOM   2941 C  CG1 . VAL A 1 363 ? -13.740 -10.810 16.466  1.00 32.18 ? 364 VAL A CG1 1 
ATOM   2942 C  CG2 . VAL A 1 363 ? -13.810 -10.723 18.965  1.00 31.82 ? 364 VAL A CG2 1 
ATOM   2943 N  N   . LEU A 1 364 ? -10.419 -10.515 15.702  1.00 32.63 ? 365 LEU A N   1 
ATOM   2944 C  CA  . LEU A 1 364 ? -9.882  -10.145 14.397  1.00 32.78 ? 365 LEU A CA  1 
ATOM   2945 C  C   . LEU A 1 364 ? -10.387 -11.128 13.367  1.00 33.05 ? 365 LEU A C   1 
ATOM   2946 O  O   . LEU A 1 364 ? -10.196 -12.340 13.510  1.00 32.96 ? 365 LEU A O   1 
ATOM   2947 C  CB  . LEU A 1 364 ? -8.342  -10.132 14.393  1.00 32.69 ? 365 LEU A CB  1 
ATOM   2948 C  CG  . LEU A 1 364 ? -7.596  -9.067  15.204  1.00 32.83 ? 365 LEU A CG  1 
ATOM   2949 C  CD1 . LEU A 1 364 ? -6.085  -9.220  15.035  1.00 33.71 ? 365 LEU A CD1 1 
ATOM   2950 C  CD2 . LEU A 1 364 ? -8.023  -7.659  14.834  1.00 32.46 ? 365 LEU A CD2 1 
ATOM   2951 N  N   . ARG A 1 365 ? -11.030 -10.592 12.331  1.00 33.55 ? 366 ARG A N   1 
ATOM   2952 C  CA  . ARG A 1 365 ? -11.623 -11.382 11.249  1.00 34.05 ? 366 ARG A CA  1 
ATOM   2953 C  C   . ARG A 1 365 ? -12.535 -12.481 11.771  1.00 34.03 ? 366 ARG A C   1 
ATOM   2954 O  O   . ARG A 1 365 ? -12.451 -13.626 11.323  1.00 34.05 ? 366 ARG A O   1 
ATOM   2955 C  CB  . ARG A 1 365 ? -10.542 -11.983 10.350  1.00 34.23 ? 366 ARG A CB  1 
ATOM   2956 C  CG  . ARG A 1 365 ? -9.651  -10.960 9.719   1.00 35.46 ? 366 ARG A CG  1 
ATOM   2957 C  CD  . ARG A 1 365 ? -9.159  -11.440 8.389   1.00 36.89 ? 366 ARG A CD  1 
ATOM   2958 N  NE  . ARG A 1 365 ? -8.709  -10.308 7.590   1.00 39.27 ? 366 ARG A NE  1 
ATOM   2959 C  CZ  . ARG A 1 365 ? -9.346  -9.833  6.527   1.00 39.69 ? 366 ARG A CZ  1 
ATOM   2960 N  NH1 . ARG A 1 365 ? -10.466 -10.401 6.108   1.00 40.27 ? 366 ARG A NH1 1 
ATOM   2961 N  NH2 . ARG A 1 365 ? -8.847  -8.793  5.875   1.00 40.66 ? 366 ARG A NH2 1 
ATOM   2962 N  N   . ASP A 1 366 ? -13.393 -12.123 12.726  1.00 34.21 ? 367 ASP A N   1 
ATOM   2963 C  CA  . ASP A 1 366 ? -14.357 -13.049 13.337  1.00 34.37 ? 367 ASP A CA  1 
ATOM   2964 C  C   . ASP A 1 366 ? -13.697 -14.235 14.070  1.00 34.01 ? 367 ASP A C   1 
ATOM   2965 O  O   . ASP A 1 366 ? -14.318 -15.279 14.256  1.00 33.87 ? 367 ASP A O   1 
ATOM   2966 C  CB  . ASP A 1 366 ? -15.390 -13.530 12.296  1.00 34.82 ? 367 ASP A CB  1 
ATOM   2967 C  CG  . ASP A 1 366 ? -16.718 -13.966 12.925  1.00 36.44 ? 367 ASP A CG  1 
ATOM   2968 O  OD1 . ASP A 1 366 ? -16.944 -13.720 14.130  1.00 37.96 ? 367 ASP A OD1 1 
ATOM   2969 O  OD2 . ASP A 1 366 ? -17.544 -14.566 12.202  1.00 39.02 ? 367 ASP A OD2 1 
ATOM   2970 N  N   . TYR A 1 367 ? -12.441 -14.062 14.488  1.00 33.36 ? 368 TYR A N   1 
ATOM   2971 C  CA  . TYR A 1 367 ? -11.768 -15.032 15.353  1.00 32.65 ? 368 TYR A CA  1 
ATOM   2972 C  C   . TYR A 1 367 ? -11.470 -14.388 16.697  1.00 32.55 ? 368 TYR A C   1 
ATOM   2973 O  O   . TYR A 1 367 ? -11.025 -13.245 16.752  1.00 32.58 ? 368 TYR A O   1 
ATOM   2974 C  CB  . TYR A 1 367 ? -10.448 -15.511 14.748  1.00 32.36 ? 368 TYR A CB  1 
ATOM   2975 C  CG  . TYR A 1 367 ? -10.540 -16.294 13.460  1.00 31.10 ? 368 TYR A CG  1 
ATOM   2976 C  CD1 . TYR A 1 367 ? -10.238 -15.692 12.248  1.00 29.58 ? 368 TYR A CD1 1 
ATOM   2977 C  CD2 . TYR A 1 367 ? -10.889 -17.649 13.459  1.00 29.96 ? 368 TYR A CD2 1 
ATOM   2978 C  CE1 . TYR A 1 367 ? -10.299 -16.399 11.063  1.00 29.78 ? 368 TYR A CE1 1 
ATOM   2979 C  CE2 . TYR A 1 367 ? -10.951 -18.370 12.275  1.00 29.07 ? 368 TYR A CE2 1 
ATOM   2980 C  CZ  . TYR A 1 367 ? -10.654 -17.735 11.082  1.00 29.76 ? 368 TYR A CZ  1 
ATOM   2981 O  OH  . TYR A 1 367 ? -10.706 -18.424 9.895   1.00 31.07 ? 368 TYR A OH  1 
ATOM   2982 N  N   . MET A 1 368 ? -11.698 -15.137 17.771  1.00 32.38 ? 369 MET A N   1 
ATOM   2983 C  CA  . MET A 1 368 ? -11.432 -14.667 19.122  1.00 32.49 ? 369 MET A CA  1 
ATOM   2984 C  C   . MET A 1 368 ? -9.965  -14.927 19.468  1.00 31.90 ? 369 MET A C   1 
ATOM   2985 O  O   . MET A 1 368 ? -9.529  -16.074 19.491  1.00 31.59 ? 369 MET A O   1 
ATOM   2986 C  CB  . MET A 1 368 ? -12.333 -15.408 20.113  1.00 33.17 ? 369 MET A CB  1 
ATOM   2987 C  CG  . MET A 1 368 ? -13.113 -14.515 21.081  1.00 35.34 ? 369 MET A CG  1 
ATOM   2988 S  SD  . MET A 1 368 ? -12.090 -13.413 22.093  1.00 41.08 ? 369 MET A SD  1 
ATOM   2989 C  CE  . MET A 1 368 ? -11.089 -14.595 23.005  1.00 39.17 ? 369 MET A CE  1 
ATOM   2990 N  N   . ILE A 1 369 ? -9.207  -13.865 19.725  1.00 31.03 ? 370 ILE A N   1 
ATOM   2991 C  CA  . ILE A 1 369 ? -7.816  -14.021 20.130  1.00 30.63 ? 370 ILE A CA  1 
ATOM   2992 C  C   . ILE A 1 369 ? -7.653  -13.680 21.607  1.00 30.20 ? 370 ILE A C   1 
ATOM   2993 O  O   . ILE A 1 369 ? -7.808  -12.521 22.000  1.00 30.38 ? 370 ILE A O   1 
ATOM   2994 C  CB  . ILE A 1 369 ? -6.840  -13.202 19.255  1.00 30.78 ? 370 ILE A CB  1 
ATOM   2995 C  CG1 . ILE A 1 369 ? -7.159  -13.396 17.771  1.00 30.98 ? 370 ILE A CG1 1 
ATOM   2996 C  CG2 . ILE A 1 369 ? -5.400  -13.633 19.534  1.00 31.04 ? 370 ILE A CG2 1 
ATOM   2997 C  CD1 . ILE A 1 369 ? -6.615  -12.325 16.876  1.00 31.28 ? 370 ILE A CD1 1 
ATOM   2998 N  N   . PRO A 1 370 ? -7.348  -14.699 22.434  1.00 29.66 ? 371 PRO A N   1 
ATOM   2999 C  CA  . PRO A 1 370 ? -7.284  -14.506 23.878  1.00 29.36 ? 371 PRO A CA  1 
ATOM   3000 C  C   . PRO A 1 370 ? -6.157  -13.589 24.329  1.00 29.18 ? 371 PRO A C   1 
ATOM   3001 O  O   . PRO A 1 370 ? -5.142  -13.455 23.641  1.00 29.40 ? 371 PRO A O   1 
ATOM   3002 C  CB  . PRO A 1 370 ? -7.076  -15.929 24.427  1.00 29.20 ? 371 PRO A CB  1 
ATOM   3003 C  CG  . PRO A 1 370 ? -6.611  -16.734 23.291  1.00 29.53 ? 371 PRO A CG  1 
ATOM   3004 C  CD  . PRO A 1 370 ? -7.193  -16.116 22.059  1.00 29.59 ? 371 PRO A CD  1 
ATOM   3005 N  N   . ALA A 1 371 ? -6.347  -12.965 25.488  1.00 28.62 ? 372 ALA A N   1 
ATOM   3006 C  CA  . ALA A 1 371 ? -5.336  -12.111 26.090  1.00 27.95 ? 372 ALA A CA  1 
ATOM   3007 C  C   . ALA A 1 371 ? -4.054  -12.899 26.315  1.00 27.58 ? 372 ALA A C   1 
ATOM   3008 O  O   . ALA A 1 371 ? -4.095  -14.111 26.540  1.00 27.64 ? 372 ALA A O   1 
ATOM   3009 C  CB  . ALA A 1 371 ? -5.849  -11.523 27.405  1.00 28.13 ? 372 ALA A CB  1 
ATOM   3010 N  N   . LYS A 1 372 ? -2.923  -12.194 26.241  1.00 26.85 ? 373 LYS A N   1 
ATOM   3011 C  CA  . LYS A 1 372 ? -1.581  -12.781 26.341  1.00 26.01 ? 373 LYS A CA  1 
ATOM   3012 C  C   . LYS A 1 372 ? -1.074  -13.466 25.051  1.00 24.60 ? 373 LYS A C   1 
ATOM   3013 O  O   . LYS A 1 372 ? 0.067   -13.921 24.997  1.00 24.56 ? 373 LYS A O   1 
ATOM   3014 C  CB  . LYS A 1 372 ? -1.453  -13.695 27.572  1.00 26.40 ? 373 LYS A CB  1 
ATOM   3015 C  CG  . LYS A 1 372 ? -1.489  -12.925 28.900  1.00 28.99 ? 373 LYS A CG  1 
ATOM   3016 C  CD  . LYS A 1 372 ? -1.481  -13.853 30.107  1.00 31.97 ? 373 LYS A CD  1 
ATOM   3017 C  CE  . LYS A 1 372 ? -1.362  -13.044 31.389  1.00 34.34 ? 373 LYS A CE  1 
ATOM   3018 N  NZ  . LYS A 1 372 ? -1.849  -13.818 32.565  1.00 37.08 ? 373 LYS A NZ  1 
ATOM   3019 N  N   . THR A 1 373 ? -1.907  -13.521 24.015  1.00 22.93 ? 374 THR A N   1 
ATOM   3020 C  CA  . THR A 1 373 ? -1.447  -13.996 22.713  1.00 21.63 ? 374 THR A CA  1 
ATOM   3021 C  C   . THR A 1 373 ? -0.478  -12.982 22.087  1.00 20.67 ? 374 THR A C   1 
ATOM   3022 O  O   . THR A 1 373 ? -0.682  -11.768 22.180  1.00 20.28 ? 374 THR A O   1 
ATOM   3023 C  CB  . THR A 1 373 ? -2.614  -14.237 21.736  1.00 21.83 ? 374 THR A CB  1 
ATOM   3024 O  OG1 . THR A 1 373 ? -3.632  -15.025 22.372  1.00 22.97 ? 374 THR A OG1 1 
ATOM   3025 C  CG2 . THR A 1 373 ? -2.132  -14.956 20.488  1.00 21.08 ? 374 THR A CG2 1 
ATOM   3026 N  N   . LEU A 1 374 ? 0.576   -13.492 21.455  1.00 19.15 ? 375 LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 374 ? 1.454   -12.658 20.659  1.00 17.97 ? 375 LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 374 ? 0.859   -12.494 19.267  1.00 17.03 ? 375 LEU A C   1 
ATOM   3029 O  O   . LEU A 1 374 ? 0.584   -13.482 18.587  1.00 16.69 ? 375 LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 374 ? 2.862   -13.267 20.583  1.00 17.60 ? 375 LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 374 ? 3.928   -12.517 19.779  1.00 17.78 ? 375 LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 374 ? 4.061   -11.076 20.257  1.00 16.83 ? 375 LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 374 ? 5.268   -13.238 19.876  1.00 18.06 ? 375 LEU A CD2 1 
ATOM   3034 N  N   . VAL A 1 375 ? 0.656   -11.245 18.856  1.00 16.20 ? 376 VAL A N   1 
ATOM   3035 C  CA  . VAL A 1 375 ? 0.162   -10.939 17.510  1.00 15.61 ? 376 VAL A CA  1 
ATOM   3036 C  C   . VAL A 1 375 ? 1.255   -10.216 16.732  1.00 15.48 ? 376 VAL A C   1 
ATOM   3037 O  O   . VAL A 1 375 ? 1.840   -9.250  17.231  1.00 15.57 ? 376 VAL A O   1 
ATOM   3038 C  CB  . VAL A 1 375 ? -1.151  -10.101 17.546  1.00 15.79 ? 376 VAL A CB  1 
ATOM   3039 C  CG1 . VAL A 1 375 ? -1.683  -9.842  16.138  1.00 15.11 ? 376 VAL A CG1 1 
ATOM   3040 C  CG2 . VAL A 1 375 ? -2.224  -10.815 18.391  1.00 15.49 ? 376 VAL A CG2 1 
ATOM   3041 N  N   . GLN A 1 376 ? 1.537   -10.700 15.523  1.00 15.21 ? 377 GLN A N   1 
ATOM   3042 C  CA  . GLN A 1 376 ? 2.561   -10.106 14.664  1.00 15.26 ? 377 GLN A CA  1 
ATOM   3043 C  C   . GLN A 1 376 ? 1.962   -9.537  13.383  1.00 15.25 ? 377 GLN A C   1 
ATOM   3044 O  O   . GLN A 1 376 ? 1.165   -10.193 12.710  1.00 14.80 ? 377 GLN A O   1 
ATOM   3045 C  CB  . GLN A 1 376 ? 3.683   -11.112 14.341  1.00 15.00 ? 377 GLN A CB  1 
ATOM   3046 C  CG  . GLN A 1 376 ? 4.351   -11.719 15.594  1.00 15.77 ? 377 GLN A CG  1 
ATOM   3047 C  CD  . GLN A 1 376 ? 5.726   -12.322 15.331  1.00 17.76 ? 377 GLN A CD  1 
ATOM   3048 O  OE1 . GLN A 1 376 ? 6.542   -11.768 14.575  1.00 15.23 ? 377 GLN A OE1 1 
ATOM   3049 N  NE2 . GLN A 1 376 ? 5.995   -13.463 15.966  1.00 17.63 ? 377 GLN A NE2 1 
ATOM   3050 N  N   . VAL A 1 377 ? 2.335   -8.304  13.062  1.00 15.27 ? 378 VAL A N   1 
ATOM   3051 C  CA  . VAL A 1 377 ? 1.970   -7.715  11.775  1.00 15.81 ? 378 VAL A CA  1 
ATOM   3052 C  C   . VAL A 1 377 ? 3.122   -7.939  10.809  1.00 15.79 ? 378 VAL A C   1 
ATOM   3053 O  O   . VAL A 1 377 ? 4.226   -7.459  11.052  1.00 15.92 ? 378 VAL A O   1 
ATOM   3054 C  CB  . VAL A 1 377 ? 1.717   -6.196  11.887  1.00 15.89 ? 378 VAL A CB  1 
ATOM   3055 C  CG1 . VAL A 1 377 ? 1.276   -5.631  10.531  1.00 17.09 ? 378 VAL A CG1 1 
ATOM   3056 C  CG2 . VAL A 1 377 ? 0.682   -5.890  12.980  1.00 16.94 ? 378 VAL A CG2 1 
ATOM   3057 N  N   . ALA A 1 378 ? 2.865   -8.661  9.720   1.00 15.88 ? 379 ALA A N   1 
ATOM   3058 C  CA  . ALA A 1 378 ? 3.883   -8.923  8.710   1.00 16.16 ? 379 ALA A CA  1 
ATOM   3059 C  C   . ALA A 1 378 ? 4.156   -7.716  7.802   1.00 16.81 ? 379 ALA A C   1 
ATOM   3060 O  O   . ALA A 1 378 ? 3.579   -7.599  6.707   1.00 17.20 ? 379 ALA A O   1 
ATOM   3061 C  CB  . ALA A 1 378 ? 3.508   -10.137 7.886   1.00 15.89 ? 379 ALA A CB  1 
ATOM   3062 N  N   . ILE A 1 379 ? 5.060   -6.851  8.263   1.00 16.62 ? 380 ILE A N   1 
ATOM   3063 C  CA  . ILE A 1 379 ? 5.436   -5.603  7.592   1.00 17.17 ? 380 ILE A CA  1 
ATOM   3064 C  C   . ILE A 1 379 ? 5.959   -5.810  6.170   1.00 16.66 ? 380 ILE A C   1 
ATOM   3065 O  O   . ILE A 1 379 ? 5.521   -5.116  5.232   1.00 15.69 ? 380 ILE A O   1 
ATOM   3066 C  CB  . ILE A 1 379 ? 6.516   -4.828  8.428   1.00 18.00 ? 380 ILE A CB  1 
ATOM   3067 C  CG1 . ILE A 1 379 ? 5.929   -4.365  9.767   1.00 19.13 ? 380 ILE A CG1 1 
ATOM   3068 C  CG2 . ILE A 1 379 ? 7.077   -3.635  7.656   1.00 18.93 ? 380 ILE A CG2 1 
ATOM   3069 C  CD1 . ILE A 1 379 ? 4.487   -3.831  9.664   1.00 19.75 ? 380 ILE A CD1 1 
ATOM   3070 N  N   . TYR A 1 380 ? 6.888   -6.761  6.025   1.00 16.02 ? 381 TYR A N   1 
ATOM   3071 C  CA  . TYR A 1 380 ? 7.472   -7.086  4.733   1.00 15.91 ? 381 TYR A CA  1 
ATOM   3072 C  C   . TYR A 1 380 ? 6.424   -7.590  3.737   1.00 15.86 ? 381 TYR A C   1 
ATOM   3073 O  O   . TYR A 1 380 ? 6.368   -7.118  2.599   1.00 15.85 ? 381 TYR A O   1 
ATOM   3074 C  CB  . TYR A 1 380 ? 8.599   -8.122  4.861   1.00 15.70 ? 381 TYR A CB  1 
ATOM   3075 C  CG  . TYR A 1 380 ? 9.172   -8.498  3.515   1.00 15.75 ? 381 TYR A CG  1 
ATOM   3076 C  CD1 . TYR A 1 380 ? 10.234  -7.777  2.968   1.00 14.83 ? 381 TYR A CD1 1 
ATOM   3077 C  CD2 . TYR A 1 380 ? 8.620   -9.544  2.763   1.00 15.81 ? 381 TYR A CD2 1 
ATOM   3078 C  CE1 . TYR A 1 380 ? 10.756  -8.096  1.732   1.00 14.17 ? 381 TYR A CE1 1 
ATOM   3079 C  CE2 . TYR A 1 380 ? 9.136   -9.874  1.518   1.00 15.67 ? 381 TYR A CE2 1 
ATOM   3080 C  CZ  . TYR A 1 380 ? 10.204  -9.140  1.009   1.00 15.99 ? 381 TYR A CZ  1 
ATOM   3081 O  OH  . TYR A 1 380 ? 10.728  -9.452  -0.220  1.00 16.67 ? 381 TYR A OH  1 
ATOM   3082 N  N   . ALA A 1 381 ? 5.614   -8.560  4.163   1.00 15.68 ? 382 ALA A N   1 
ATOM   3083 C  CA  . ALA A 1 381 ? 4.562   -9.108  3.299   1.00 16.06 ? 382 ALA A CA  1 
ATOM   3084 C  C   . ALA A 1 381 ? 3.516   -8.049  2.939   1.00 16.06 ? 382 ALA A C   1 
ATOM   3085 O  O   . ALA A 1 381 ? 3.063   -7.986  1.794   1.00 16.45 ? 382 ALA A O   1 
ATOM   3086 C  CB  . ALA A 1 381 ? 3.903   -10.334 3.942   1.00 15.77 ? 382 ALA A CB  1 
ATOM   3087 N  N   . LEU A 1 382 ? 3.139   -7.222  3.910   1.00 16.40 ? 383 LEU A N   1 
ATOM   3088 C  CA  . LEU A 1 382 ? 2.224   -6.108  3.644   1.00 16.87 ? 383 LEU A CA  1 
ATOM   3089 C  C   . LEU A 1 382 ? 2.743   -5.214  2.511   1.00 17.06 ? 383 LEU A C   1 
ATOM   3090 O  O   . LEU A 1 382 ? 2.002   -4.876  1.598   1.00 17.20 ? 383 LEU A O   1 
ATOM   3091 C  CB  . LEU A 1 382 ? 1.942   -5.294  4.908   1.00 16.41 ? 383 LEU A CB  1 
ATOM   3092 C  CG  . LEU A 1 382 ? 1.267   -3.908  4.805   1.00 17.25 ? 383 LEU A CG  1 
ATOM   3093 C  CD1 . LEU A 1 382 ? -0.081  -3.968  4.122   1.00 16.94 ? 383 LEU A CD1 1 
ATOM   3094 C  CD2 . LEU A 1 382 ? 1.100   -3.297  6.183   1.00 18.54 ? 383 LEU A CD2 1 
ATOM   3095 N  N   . GLY A 1 383 ? 4.022   -4.866  2.565   1.00 17.95 ? 384 GLY A N   1 
ATOM   3096 C  CA  . GLY A 1 383 ? 4.623   -3.952  1.605   1.00 18.70 ? 384 GLY A CA  1 
ATOM   3097 C  C   . GLY A 1 383 ? 4.677   -4.475  0.185   1.00 19.30 ? 384 GLY A C   1 
ATOM   3098 O  O   . GLY A 1 383 ? 4.723   -3.687  -0.762  1.00 19.66 ? 384 GLY A O   1 
ATOM   3099 N  N   . ARG A 1 384 ? 4.688   -5.798  0.027   1.00 20.05 ? 385 ARG A N   1 
ATOM   3100 C  CA  . ARG A 1 384 ? 4.702   -6.404  -1.310  1.00 21.00 ? 385 ARG A CA  1 
ATOM   3101 C  C   . ARG A 1 384 ? 3.307   -6.826  -1.790  1.00 21.22 ? 385 ARG A C   1 
ATOM   3102 O  O   . ARG A 1 384 ? 3.165   -7.306  -2.908  1.00 21.39 ? 385 ARG A O   1 
ATOM   3103 C  CB  . ARG A 1 384 ? 5.669   -7.608  -1.389  1.00 20.99 ? 385 ARG A CB  1 
ATOM   3104 C  CG  . ARG A 1 384 ? 7.112   -7.371  -0.902  1.00 22.20 ? 385 ARG A CG  1 
ATOM   3105 C  CD  . ARG A 1 384 ? 7.732   -6.150  -1.546  1.00 23.33 ? 385 ARG A CD  1 
ATOM   3106 N  NE  . ARG A 1 384 ? 9.102   -5.886  -1.094  1.00 23.33 ? 385 ARG A NE  1 
ATOM   3107 C  CZ  . ARG A 1 384 ? 10.198  -6.326  -1.705  1.00 23.74 ? 385 ARG A CZ  1 
ATOM   3108 N  NH1 . ARG A 1 384 ? 10.105  -7.091  -2.785  1.00 24.52 ? 385 ARG A NH1 1 
ATOM   3109 N  NH2 . ARG A 1 384 ? 11.397  -6.011  -1.226  1.00 23.80 ? 385 ARG A NH2 1 
ATOM   3110 N  N   . GLU A 1 385 ? 2.292   -6.640  -0.952  1.00 21.86 ? 386 GLU A N   1 
ATOM   3111 C  CA  . GLU A 1 385 ? 0.943   -7.155  -1.210  1.00 22.80 ? 386 GLU A CA  1 
ATOM   3112 C  C   . GLU A 1 385 ? 0.131   -6.237  -2.158  1.00 22.86 ? 386 GLU A C   1 
ATOM   3113 O  O   . GLU A 1 385 ? -0.148  -5.082  -1.823  1.00 22.67 ? 386 GLU A O   1 
ATOM   3114 C  CB  . GLU A 1 385 ? 0.241   -7.398  0.135   1.00 22.90 ? 386 GLU A CB  1 
ATOM   3115 C  CG  . GLU A 1 385 ? -1.181  -7.960  0.119   1.00 25.93 ? 386 GLU A CG  1 
ATOM   3116 C  CD  . GLU A 1 385 ? -1.477  -8.958  -0.996  1.00 27.84 ? 386 GLU A CD  1 
ATOM   3117 O  OE1 . GLU A 1 385 ? -0.903  -10.068 -1.009  1.00 28.29 ? 386 GLU A OE1 1 
ATOM   3118 O  OE2 . GLU A 1 385 ? -2.319  -8.620  -1.855  1.00 28.79 ? 386 GLU A OE2 1 
ATOM   3119 N  N   . PRO A 1 386 ? -0.230  -6.747  -3.360  1.00 23.22 ? 387 PRO A N   1 
ATOM   3120 C  CA  . PRO A 1 386 ? -0.905  -5.903  -4.362  1.00 23.60 ? 387 PRO A CA  1 
ATOM   3121 C  C   . PRO A 1 386 ? -2.321  -5.446  -4.000  1.00 24.10 ? 387 PRO A C   1 
ATOM   3122 O  O   . PRO A 1 386 ? -2.843  -4.529  -4.643  1.00 24.56 ? 387 PRO A O   1 
ATOM   3123 C  CB  . PRO A 1 386 ? -0.919  -6.778  -5.624  1.00 23.63 ? 387 PRO A CB  1 
ATOM   3124 C  CG  . PRO A 1 386 ? -0.744  -8.177  -5.120  1.00 23.77 ? 387 PRO A CG  1 
ATOM   3125 C  CD  . PRO A 1 386 ? 0.132   -8.064  -3.911  1.00 22.69 ? 387 PRO A CD  1 
ATOM   3126 N  N   . THR A 1 387 ? -2.939  -6.055  -2.991  1.00 24.51 ? 388 THR A N   1 
ATOM   3127 C  CA  . THR A 1 387 ? -4.267  -5.605  -2.558  1.00 24.81 ? 388 THR A CA  1 
ATOM   3128 C  C   . THR A 1 387 ? -4.215  -4.416  -1.606  1.00 25.27 ? 388 THR A C   1 
ATOM   3129 O  O   . THR A 1 387 ? -5.230  -3.746  -1.392  1.00 25.94 ? 388 THR A O   1 
ATOM   3130 C  CB  . THR A 1 387 ? -5.119  -6.740  -1.925  1.00 24.93 ? 388 THR A CB  1 
ATOM   3131 O  OG1 . THR A 1 387 ? -4.438  -7.308  -0.798  1.00 25.52 ? 388 THR A OG1 1 
ATOM   3132 C  CG2 . THR A 1 387 ? -5.402  -7.834  -2.943  1.00 25.19 ? 388 THR A CG2 1 
ATOM   3133 N  N   . PHE A 1 388 ? -3.050  -4.158  -1.017  1.00 25.15 ? 389 PHE A N   1 
ATOM   3134 C  CA  . PHE A 1 388 ? -2.922  -3.057  -0.065  1.00 25.19 ? 389 PHE A CA  1 
ATOM   3135 C  C   . PHE A 1 388 ? -2.084  -1.893  -0.605  1.00 25.24 ? 389 PHE A C   1 
ATOM   3136 O  O   . PHE A 1 388 ? -2.111  -0.800  -0.043  1.00 25.10 ? 389 PHE A O   1 
ATOM   3137 C  CB  . PHE A 1 388 ? -2.396  -3.550  1.296   1.00 24.93 ? 389 PHE A CB  1 
ATOM   3138 C  CG  . PHE A 1 388 ? -3.222  -4.657  1.903   1.00 25.59 ? 389 PHE A CG  1 
ATOM   3139 C  CD1 . PHE A 1 388 ? -2.630  -5.853  2.281   1.00 25.79 ? 389 PHE A CD1 1 
ATOM   3140 C  CD2 . PHE A 1 388 ? -4.599  -4.513  2.068   1.00 26.53 ? 389 PHE A CD2 1 
ATOM   3141 C  CE1 . PHE A 1 388 ? -3.391  -6.884  2.830   1.00 25.94 ? 389 PHE A CE1 1 
ATOM   3142 C  CE2 . PHE A 1 388 ? -5.367  -5.537  2.612   1.00 26.10 ? 389 PHE A CE2 1 
ATOM   3143 C  CZ  . PHE A 1 388 ? -4.761  -6.722  2.998   1.00 25.66 ? 389 PHE A CZ  1 
ATOM   3144 N  N   . PHE A 1 389 ? -1.343  -2.141  -1.681  1.00 25.64 ? 390 PHE A N   1 
ATOM   3145 C  CA  . PHE A 1 389 ? -0.610  -1.097  -2.387  1.00 26.36 ? 390 PHE A CA  1 
ATOM   3146 C  C   . PHE A 1 389 ? -0.741  -1.294  -3.887  1.00 27.39 ? 390 PHE A C   1 
ATOM   3147 O  O   . PHE A 1 389 ? -0.470  -2.376  -4.400  1.00 27.41 ? 390 PHE A O   1 
ATOM   3148 C  CB  . PHE A 1 389 ? 0.880   -1.093  -2.016  1.00 25.97 ? 390 PHE A CB  1 
ATOM   3149 C  CG  . PHE A 1 389 ? 1.159   -0.693  -0.596  1.00 24.50 ? 390 PHE A CG  1 
ATOM   3150 C  CD1 . PHE A 1 389 ? 1.395   -1.665  0.379   1.00 22.83 ? 390 PHE A CD1 1 
ATOM   3151 C  CD2 . PHE A 1 389 ? 1.188   0.650   -0.229  1.00 23.40 ? 390 PHE A CD2 1 
ATOM   3152 C  CE1 . PHE A 1 389 ? 1.653   -1.309  1.690   1.00 21.62 ? 390 PHE A CE1 1 
ATOM   3153 C  CE2 . PHE A 1 389 ? 1.451   1.023   1.094   1.00 22.68 ? 390 PHE A CE2 1 
ATOM   3154 C  CZ  . PHE A 1 389 ? 1.690   0.039   2.050   1.00 22.18 ? 390 PHE A CZ  1 
ATOM   3155 N  N   . PHE A 1 390 ? -1.146  -0.236  -4.585  1.00 28.72 ? 391 PHE A N   1 
ATOM   3156 C  CA  . PHE A 1 390 ? -1.180  -0.233  -6.043  1.00 30.22 ? 391 PHE A CA  1 
ATOM   3157 C  C   . PHE A 1 390 ? 0.227   -0.390  -6.619  1.00 30.74 ? 391 PHE A C   1 
ATOM   3158 O  O   . PHE A 1 390 ? 1.144   0.350   -6.250  1.00 30.92 ? 391 PHE A O   1 
ATOM   3159 C  CB  . PHE A 1 390 ? -1.821  1.062   -6.560  1.00 30.57 ? 391 PHE A CB  1 
ATOM   3160 C  CG  . PHE A 1 390 ? -1.904  1.135   -8.059  1.00 32.95 ? 391 PHE A CG  1 
ATOM   3161 C  CD1 . PHE A 1 390 ? -2.982  0.561   -8.737  1.00 34.08 ? 391 PHE A CD1 1 
ATOM   3162 C  CD2 . PHE A 1 390 ? -0.895  1.764   -8.800  1.00 34.08 ? 391 PHE A CD2 1 
ATOM   3163 C  CE1 . PHE A 1 390 ? -3.058  0.614   -10.128 1.00 34.94 ? 391 PHE A CE1 1 
ATOM   3164 C  CE2 . PHE A 1 390 ? -0.962  1.822   -10.194 1.00 35.05 ? 391 PHE A CE2 1 
ATOM   3165 C  CZ  . PHE A 1 390 ? -2.044  1.248   -10.859 1.00 35.01 ? 391 PHE A CZ  1 
ATOM   3166 N  N   . ASP A 1 391 ? 0.379   -1.346  -7.533  1.00 31.44 ? 392 ASP A N   1 
ATOM   3167 C  CA  . ASP A 1 391 ? 1.678   -1.709  -8.121  1.00 32.49 ? 392 ASP A CA  1 
ATOM   3168 C  C   . ASP A 1 391 ? 2.828   -1.706  -7.085  1.00 32.36 ? 392 ASP A C   1 
ATOM   3169 O  O   . ASP A 1 391 ? 3.717   -0.852  -7.138  1.00 32.66 ? 392 ASP A O   1 
ATOM   3170 C  CB  . ASP A 1 391 ? 2.000   -0.821  -9.335  1.00 32.92 ? 392 ASP A CB  1 
ATOM   3171 C  CG  . ASP A 1 391 ? 3.111   -1.398  -10.213 1.00 34.97 ? 392 ASP A CG  1 
ATOM   3172 O  OD1 . ASP A 1 391 ? 3.466   -2.592  -10.051 1.00 37.68 ? 392 ASP A OD1 1 
ATOM   3173 O  OD2 . ASP A 1 391 ? 3.634   -0.651  -11.072 1.00 36.93 ? 392 ASP A OD2 1 
ATOM   3174 N  N   . PRO A 1 392 ? 2.812   -2.679  -6.151  1.00 32.19 ? 393 PRO A N   1 
ATOM   3175 C  CA  . PRO A 1 392 ? 3.744   -2.698  -5.012  1.00 31.93 ? 393 PRO A CA  1 
ATOM   3176 C  C   . PRO A 1 392 ? 5.243   -2.729  -5.370  1.00 31.66 ? 393 PRO A C   1 
ATOM   3177 O  O   . PRO A 1 392 ? 6.049   -2.187  -4.613  1.00 31.59 ? 393 PRO A O   1 
ATOM   3178 C  CB  . PRO A 1 392 ? 3.336   -3.962  -4.243  1.00 31.90 ? 393 PRO A CB  1 
ATOM   3179 C  CG  . PRO A 1 392 ? 2.652   -4.825  -5.255  1.00 31.82 ? 393 PRO A CG  1 
ATOM   3180 C  CD  . PRO A 1 392 ? 1.944   -3.877  -6.167  1.00 31.85 ? 393 PRO A CD  1 
ATOM   3181 N  N   . GLU A 1 393 ? 5.608   -3.324  -6.504  1.00 31.37 ? 394 GLU A N   1 
ATOM   3182 C  CA  . GLU A 1 393 ? 7.019   -3.368  -6.926  1.00 31.45 ? 394 GLU A CA  1 
ATOM   3183 C  C   . GLU A 1 393 ? 7.559   -2.022  -7.448  1.00 30.90 ? 394 GLU A C   1 
ATOM   3184 O  O   . GLU A 1 393 ? 8.774   -1.841  -7.578  1.00 30.51 ? 394 GLU A O   1 
ATOM   3185 C  CB  . GLU A 1 393 ? 7.273   -4.475  -7.964  1.00 31.80 ? 394 GLU A CB  1 
ATOM   3186 C  CG  . GLU A 1 393 ? 6.654   -5.856  -7.654  1.00 34.41 ? 394 GLU A CG  1 
ATOM   3187 C  CD  . GLU A 1 393 ? 6.889   -6.337  -6.222  1.00 37.82 ? 394 GLU A CD  1 
ATOM   3188 O  OE1 . GLU A 1 393 ? 8.065   -6.463  -5.812  1.00 39.98 ? 394 GLU A OE1 1 
ATOM   3189 O  OE2 . GLU A 1 393 ? 5.888   -6.602  -5.509  1.00 39.71 ? 394 GLU A OE2 1 
ATOM   3190 N  N   . ASN A 1 394 ? 6.659   -1.088  -7.756  1.00 30.14 ? 395 ASN A N   1 
ATOM   3191 C  CA  . ASN A 1 394 ? 7.066   0.226   -8.244  1.00 29.27 ? 395 ASN A CA  1 
ATOM   3192 C  C   . ASN A 1 394 ? 7.482   1.119   -7.074  1.00 28.26 ? 395 ASN A C   1 
ATOM   3193 O  O   . ASN A 1 394 ? 6.758   1.234   -6.071  1.00 27.87 ? 395 ASN A O   1 
ATOM   3194 C  CB  . ASN A 1 394 ? 5.937   0.877   -9.069  1.00 29.61 ? 395 ASN A CB  1 
ATOM   3195 C  CG  . ASN A 1 394 ? 6.388   2.141   -9.823  1.00 30.76 ? 395 ASN A CG  1 
ATOM   3196 O  OD1 . ASN A 1 394 ? 7.518   2.232   -10.319 1.00 32.00 ? 395 ASN A OD1 1 
ATOM   3197 N  ND2 . ASN A 1 394 ? 5.489   3.113   -9.921  1.00 31.62 ? 395 ASN A ND2 1 
ATOM   3198 N  N   . PHE A 1 395 ? 8.664   1.717   -7.190  1.00 27.04 ? 396 PHE A N   1 
ATOM   3199 C  CA  . PHE A 1 395 ? 9.118   2.718   -6.231  1.00 26.06 ? 396 PHE A CA  1 
ATOM   3200 C  C   . PHE A 1 395 ? 8.463   4.044   -6.619  1.00 25.83 ? 396 PHE A C   1 
ATOM   3201 O  O   . PHE A 1 395 ? 8.891   4.697   -7.571  1.00 25.44 ? 396 PHE A O   1 
ATOM   3202 C  CB  . PHE A 1 395 ? 10.653  2.798   -6.220  1.00 25.59 ? 396 PHE A CB  1 
ATOM   3203 C  CG  . PHE A 1 395 ? 11.223  3.793   -5.228  1.00 24.41 ? 396 PHE A CG  1 
ATOM   3204 C  CD1 . PHE A 1 395 ? 11.273  3.497   -3.870  1.00 22.83 ? 396 PHE A CD1 1 
ATOM   3205 C  CD2 . PHE A 1 395 ? 11.740  5.007   -5.660  1.00 22.75 ? 396 PHE A CD2 1 
ATOM   3206 C  CE1 . PHE A 1 395 ? 11.809  4.391   -2.963  1.00 22.56 ? 396 PHE A CE1 1 
ATOM   3207 C  CE2 . PHE A 1 395 ? 12.282  5.914   -4.749  1.00 23.21 ? 396 PHE A CE2 1 
ATOM   3208 C  CZ  . PHE A 1 395 ? 12.315  5.603   -3.399  1.00 22.45 ? 396 PHE A CZ  1 
ATOM   3209 N  N   . ASP A 1 396 ? 7.395   4.397   -5.898  1.00 26.01 ? 397 ASP A N   1 
ATOM   3210 C  CA  . ASP A 1 396 ? 6.598   5.611   -6.155  1.00 26.39 ? 397 ASP A CA  1 
ATOM   3211 C  C   . ASP A 1 396 ? 6.334   6.403   -4.873  1.00 26.18 ? 397 ASP A C   1 
ATOM   3212 O  O   . ASP A 1 396 ? 5.379   6.105   -4.147  1.00 25.92 ? 397 ASP A O   1 
ATOM   3213 C  CB  . ASP A 1 396 ? 5.264   5.262   -6.850  1.00 26.86 ? 397 ASP A CB  1 
ATOM   3214 C  CG  . ASP A 1 396 ? 4.394   6.504   -7.162  1.00 28.25 ? 397 ASP A CG  1 
ATOM   3215 O  OD1 . ASP A 1 396 ? 4.867   7.664   -7.045  1.00 29.67 ? 397 ASP A OD1 1 
ATOM   3216 O  OD2 . ASP A 1 396 ? 3.216   6.311   -7.538  1.00 29.92 ? 397 ASP A OD2 1 
ATOM   3217 N  N   . PRO A 1 397 ? 7.172   7.426   -4.598  1.00 26.06 ? 398 PRO A N   1 
ATOM   3218 C  CA  . PRO A 1 397 ? 7.008   8.306   -3.439  1.00 26.09 ? 398 PRO A CA  1 
ATOM   3219 C  C   . PRO A 1 397 ? 5.688   9.093   -3.393  1.00 26.25 ? 398 PRO A C   1 
ATOM   3220 O  O   . PRO A 1 397 ? 5.179   9.343   -2.303  1.00 26.33 ? 398 PRO A O   1 
ATOM   3221 C  CB  . PRO A 1 397 ? 8.198   9.270   -3.561  1.00 25.82 ? 398 PRO A CB  1 
ATOM   3222 C  CG  . PRO A 1 397 ? 9.195   8.529   -4.360  1.00 25.85 ? 398 PRO A CG  1 
ATOM   3223 C  CD  . PRO A 1 397 ? 8.402   7.746   -5.345  1.00 25.92 ? 398 PRO A CD  1 
ATOM   3224 N  N   . THR A 1 398 ? 5.139   9.477   -4.545  1.00 26.37 ? 399 THR A N   1 
ATOM   3225 C  CA  . THR A 1 398 ? 3.886   10.263  -4.576  1.00 26.95 ? 399 THR A CA  1 
ATOM   3226 C  C   . THR A 1 398 ? 2.714   9.512   -3.939  1.00 27.14 ? 399 THR A C   1 
ATOM   3227 O  O   . THR A 1 398 ? 1.754   10.123  -3.468  1.00 27.26 ? 399 THR A O   1 
ATOM   3228 C  CB  . THR A 1 398 ? 3.470   10.675  -6.011  1.00 26.88 ? 399 THR A CB  1 
ATOM   3229 O  OG1 . THR A 1 398 ? 3.029   9.516   -6.733  1.00 27.48 ? 399 THR A OG1 1 
ATOM   3230 C  CG2 . THR A 1 398 ? 4.638   11.333  -6.761  1.00 27.07 ? 399 THR A CG2 1 
ATOM   3231 N  N   . ARG A 1 399 ? 2.804   8.183   -3.952  1.00 27.22 ? 400 ARG A N   1 
ATOM   3232 C  CA  . ARG A 1 399 ? 1.876   7.296   -3.258  1.00 27.53 ? 400 ARG A CA  1 
ATOM   3233 C  C   . ARG A 1 399 ? 1.530   7.796   -1.842  1.00 27.80 ? 400 ARG A C   1 
ATOM   3234 O  O   . ARG A 1 399 ? 0.386   7.670   -1.400  1.00 27.88 ? 400 ARG A O   1 
ATOM   3235 C  CB  . ARG A 1 399 ? 2.487   5.889   -3.241  1.00 27.58 ? 400 ARG A CB  1 
ATOM   3236 C  CG  . ARG A 1 399 ? 1.883   4.887   -2.309  1.00 27.44 ? 400 ARG A CG  1 
ATOM   3237 C  CD  . ARG A 1 399 ? 2.827   3.695   -2.050  1.00 26.03 ? 400 ARG A CD  1 
ATOM   3238 N  NE  . ARG A 1 399 ? 3.449   3.096   -3.243  1.00 23.75 ? 400 ARG A NE  1 
ATOM   3239 C  CZ  . ARG A 1 399 ? 2.819   2.349   -4.154  1.00 24.36 ? 400 ARG A CZ  1 
ATOM   3240 N  NH1 . ARG A 1 399 ? 1.513   2.110   -4.060  1.00 23.63 ? 400 ARG A NH1 1 
ATOM   3241 N  NH2 . ARG A 1 399 ? 3.497   1.842   -5.177  1.00 22.72 ? 400 ARG A NH2 1 
ATOM   3242 N  N   . TRP A 1 400 ? 2.508   8.394   -1.160  1.00 28.09 ? 401 TRP A N   1 
ATOM   3243 C  CA  . TRP A 1 400 ? 2.349   8.885   0.215   1.00 28.58 ? 401 TRP A CA  1 
ATOM   3244 C  C   . TRP A 1 400 ? 1.828   10.326  0.308   1.00 30.09 ? 401 TRP A C   1 
ATOM   3245 O  O   . TRP A 1 400 ? 1.593   10.840  1.406   1.00 29.64 ? 401 TRP A O   1 
ATOM   3246 C  CB  . TRP A 1 400 ? 3.675   8.751   0.977   1.00 28.04 ? 401 TRP A CB  1 
ATOM   3247 C  CG  . TRP A 1 400 ? 4.160   7.344   1.003   1.00 25.43 ? 401 TRP A CG  1 
ATOM   3248 C  CD1 . TRP A 1 400 ? 5.044   6.765   0.140   1.00 22.77 ? 401 TRP A CD1 1 
ATOM   3249 C  CD2 . TRP A 1 400 ? 3.742   6.315   1.906   1.00 23.65 ? 401 TRP A CD2 1 
ATOM   3250 N  NE1 . TRP A 1 400 ? 5.217   5.439   0.459   1.00 22.56 ? 401 TRP A NE1 1 
ATOM   3251 C  CE2 . TRP A 1 400 ? 4.430   5.137   1.542   1.00 23.07 ? 401 TRP A CE2 1 
ATOM   3252 C  CE3 . TRP A 1 400 ? 2.863   6.277   3.000   1.00 23.21 ? 401 TRP A CE3 1 
ATOM   3253 C  CZ2 . TRP A 1 400 ? 4.266   3.928   2.234   1.00 22.52 ? 401 TRP A CZ2 1 
ATOM   3254 C  CZ3 . TRP A 1 400 ? 2.699   5.073   3.684   1.00 22.04 ? 401 TRP A CZ3 1 
ATOM   3255 C  CH2 . TRP A 1 400 ? 3.401   3.917   3.297   1.00 21.83 ? 401 TRP A CH2 1 
ATOM   3256 N  N   . LEU A 1 401 ? 1.663   10.964  -0.849  1.00 32.09 ? 402 LEU A N   1 
ATOM   3257 C  CA  . LEU A 1 401 ? 1.157   12.331  -0.941  1.00 34.45 ? 402 LEU A CA  1 
ATOM   3258 C  C   . LEU A 1 401 ? -0.305  12.381  -1.393  1.00 36.04 ? 402 LEU A C   1 
ATOM   3259 O  O   . LEU A 1 401 ? -0.907  13.456  -1.450  1.00 36.33 ? 402 LEU A O   1 
ATOM   3260 C  CB  . LEU A 1 401 ? 2.030   13.153  -1.896  1.00 34.34 ? 402 LEU A CB  1 
ATOM   3261 C  CG  . LEU A 1 401 ? 3.430   13.521  -1.394  1.00 34.79 ? 402 LEU A CG  1 
ATOM   3262 C  CD1 . LEU A 1 401 ? 4.215   14.231  -2.487  1.00 34.70 ? 402 LEU A CD1 1 
ATOM   3263 C  CD2 . LEU A 1 401 ? 3.346   14.377  -0.136  1.00 34.84 ? 402 LEU A CD2 1 
ATOM   3264 N  N   . SER A 1 402 ? -0.855  11.214  -1.721  1.00 37.76 ? 403 SER A N   1 
ATOM   3265 C  CA  . SER A 1 402 ? -2.232  11.072  -2.181  1.00 39.75 ? 403 SER A CA  1 
ATOM   3266 C  C   . SER A 1 402 ? -3.214  11.730  -1.213  1.00 40.92 ? 403 SER A C   1 
ATOM   3267 O  O   . SER A 1 402 ? -3.124  11.534  0.005   1.00 41.22 ? 403 SER A O   1 
ATOM   3268 C  CB  . SER A 1 402 ? -2.561  9.582   -2.360  1.00 39.80 ? 403 SER A CB  1 
ATOM   3269 O  OG  . SER A 1 402 ? -3.926  9.370   -2.668  1.00 40.91 ? 403 SER A OG  1 
ATOM   3270 N  N   . LYS A 1 403 ? -4.135  12.526  -1.756  1.00 42.33 ? 404 LYS A N   1 
ATOM   3271 C  CA  . LYS A 1 403 ? -5.180  13.158  -0.944  1.00 43.59 ? 404 LYS A CA  1 
ATOM   3272 C  C   . LYS A 1 403 ? -6.258  12.139  -0.561  1.00 44.16 ? 404 LYS A C   1 
ATOM   3273 O  O   . LYS A 1 403 ? -7.057  12.372  0.351   1.00 44.62 ? 404 LYS A O   1 
ATOM   3274 C  CB  . LYS A 1 403 ? -5.793  14.357  -1.670  1.00 43.92 ? 404 LYS A CB  1 
ATOM   3275 C  CG  . LYS A 1 403 ? -6.328  15.433  -0.731  1.00 44.82 ? 404 LYS A CG  1 
ATOM   3276 C  CD  . LYS A 1 403 ? -6.597  16.741  -1.468  1.00 46.69 ? 404 LYS A CD  1 
ATOM   3277 C  CE  . LYS A 1 403 ? -7.131  17.815  -0.517  1.00 47.38 ? 404 LYS A CE  1 
ATOM   3278 N  NZ  . LYS A 1 403 ? -7.444  19.090  -1.228  1.00 47.94 ? 404 LYS A NZ  1 
ATOM   3279 N  N   . ASP A 1 404 ? -6.267  11.011  -1.269  1.00 44.51 ? 405 ASP A N   1 
ATOM   3280 C  CA  . ASP A 1 404 ? -7.051  9.845   -0.888  1.00 44.81 ? 405 ASP A CA  1 
ATOM   3281 C  C   . ASP A 1 404 ? -6.481  9.275   0.418   1.00 44.81 ? 405 ASP A C   1 
ATOM   3282 O  O   . ASP A 1 404 ? -5.650  8.353   0.406   1.00 44.57 ? 405 ASP A O   1 
ATOM   3283 C  CB  . ASP A 1 404 ? -7.012  8.801   -2.016  1.00 44.80 ? 405 ASP A CB  1 
ATOM   3284 C  CG  . ASP A 1 404 ? -8.071  7.717   -1.867  1.00 45.63 ? 405 ASP A CG  1 
ATOM   3285 O  OD1 . ASP A 1 404 ? -8.601  7.517   -0.747  1.00 45.99 ? 405 ASP A OD1 1 
ATOM   3286 O  OD2 . ASP A 1 404 ? -8.366  7.052   -2.886  1.00 45.92 ? 405 ASP A OD2 1 
ATOM   3287 N  N   . LYS A 1 405 ? -6.927  9.837   1.541   1.00 44.89 ? 406 LYS A N   1 
ATOM   3288 C  CA  . LYS A 1 405 ? -6.474  9.396   2.864   1.00 44.76 ? 406 LYS A CA  1 
ATOM   3289 C  C   . LYS A 1 405 ? -7.177  8.104   3.283   1.00 44.34 ? 406 LYS A C   1 
ATOM   3290 O  O   . LYS A 1 405 ? -7.947  8.062   4.244   1.00 44.63 ? 406 LYS A O   1 
ATOM   3291 C  CB  . LYS A 1 405 ? -6.625  10.508  3.910   1.00 45.05 ? 406 LYS A CB  1 
ATOM   3292 C  CG  . LYS A 1 405 ? -5.735  11.727  3.646   1.00 45.68 ? 406 LYS A CG  1 
ATOM   3293 C  CD  . LYS A 1 405 ? -5.321  12.410  4.940   1.00 46.60 ? 406 LYS A CD  1 
ATOM   3294 C  CE  . LYS A 1 405 ? -4.277  13.492  4.685   1.00 47.81 ? 406 LYS A CE  1 
ATOM   3295 N  NZ  . LYS A 1 405 ? -3.616  13.949  5.949   1.00 47.74 ? 406 LYS A NZ  1 
ATOM   3296 N  N   . ASN A 1 406 ? -6.893  7.060   2.514   1.00 43.73 ? 407 ASN A N   1 
ATOM   3297 C  CA  . ASN A 1 406 ? -7.357  5.698   2.736   1.00 43.09 ? 407 ASN A CA  1 
ATOM   3298 C  C   . ASN A 1 406 ? -6.233  4.806   2.229   1.00 42.17 ? 407 ASN A C   1 
ATOM   3299 O  O   . ASN A 1 406 ? -5.927  3.763   2.814   1.00 42.42 ? 407 ASN A O   1 
ATOM   3300 C  CB  . ASN A 1 406 ? -8.652  5.452   1.954   1.00 43.48 ? 407 ASN A CB  1 
ATOM   3301 C  CG  . ASN A 1 406 ? -8.834  3.999   1.546   1.00 44.87 ? 407 ASN A CG  1 
ATOM   3302 O  OD1 . ASN A 1 406 ? -9.299  3.170   2.334   1.00 47.23 ? 407 ASN A OD1 1 
ATOM   3303 N  ND2 . ASN A 1 406 ? -8.484  3.686   0.301   1.00 46.12 ? 407 ASN A ND2 1 
ATOM   3304 N  N   . ILE A 1 407 ? -5.624  5.261   1.134   1.00 40.63 ? 408 ILE A N   1 
ATOM   3305 C  CA  . ILE A 1 407 ? -4.446  4.663   0.512   1.00 39.07 ? 408 ILE A CA  1 
ATOM   3306 C  C   . ILE A 1 407 ? -3.225  4.560   1.450   1.00 37.88 ? 408 ILE A C   1 
ATOM   3307 O  O   . ILE A 1 407 ? -2.363  3.699   1.255   1.00 37.77 ? 408 ILE A O   1 
ATOM   3308 C  CB  . ILE A 1 407 ? -4.100  5.443   -0.803  1.00 39.29 ? 408 ILE A CB  1 
ATOM   3309 C  CG1 . ILE A 1 407 ? -4.779  4.774   -2.006  1.00 39.28 ? 408 ILE A CG1 1 
ATOM   3310 C  CG2 . ILE A 1 407 ? -2.583  5.604   -1.010  1.00 39.07 ? 408 ILE A CG2 1 
ATOM   3311 C  CD1 . ILE A 1 407 ? -4.541  5.461   -3.341  1.00 39.08 ? 408 ILE A CD1 1 
ATOM   3312 N  N   . THR A 1 408 ? -3.163  5.428   2.459   1.00 36.13 ? 409 THR A N   1 
ATOM   3313 C  CA  . THR A 1 408 ? -2.037  5.459   3.400   1.00 34.73 ? 409 THR A CA  1 
ATOM   3314 C  C   . THR A 1 408 ? -2.413  4.981   4.815   1.00 33.51 ? 409 THR A C   1 
ATOM   3315 O  O   . THR A 1 408 ? -1.557  4.918   5.700   1.00 33.65 ? 409 THR A O   1 
ATOM   3316 C  CB  . THR A 1 408 ? -1.421  6.872   3.506   1.00 34.78 ? 409 THR A CB  1 
ATOM   3317 O  OG1 . THR A 1 408 ? -2.438  7.810   3.883   1.00 35.05 ? 409 THR A OG1 1 
ATOM   3318 C  CG2 . THR A 1 408 ? -0.791  7.298   2.183   1.00 34.85 ? 409 THR A CG2 1 
ATOM   3319 N  N   . TYR A 1 409 ? -3.684  4.642   5.020   1.00 31.73 ? 410 TYR A N   1 
ATOM   3320 C  CA  . TYR A 1 409 ? -4.187  4.206   6.325   1.00 30.34 ? 410 TYR A CA  1 
ATOM   3321 C  C   . TYR A 1 409 ? -3.417  2.998   6.884   1.00 29.01 ? 410 TYR A C   1 
ATOM   3322 O  O   . TYR A 1 409 ? -3.385  1.938   6.261   1.00 28.62 ? 410 TYR A O   1 
ATOM   3323 C  CB  . TYR A 1 409 ? -5.685  3.890   6.215   1.00 30.64 ? 410 TYR A CB  1 
ATOM   3324 C  CG  . TYR A 1 409 ? -6.357  3.605   7.532   1.00 31.28 ? 410 TYR A CG  1 
ATOM   3325 C  CD1 . TYR A 1 409 ? -6.524  4.616   8.481   1.00 32.74 ? 410 TYR A CD1 1 
ATOM   3326 C  CD2 . TYR A 1 409 ? -6.839  2.331   7.829   1.00 31.65 ? 410 TYR A CD2 1 
ATOM   3327 C  CE1 . TYR A 1 409 ? -7.151  4.362   9.701   1.00 34.01 ? 410 TYR A CE1 1 
ATOM   3328 C  CE2 . TYR A 1 409 ? -7.472  2.066   9.046   1.00 32.18 ? 410 TYR A CE2 1 
ATOM   3329 C  CZ  . TYR A 1 409 ? -7.623  3.086   9.973   1.00 33.14 ? 410 TYR A CZ  1 
ATOM   3330 O  OH  . TYR A 1 409 ? -8.236  2.844   11.177  1.00 34.57 ? 410 TYR A OH  1 
ATOM   3331 N  N   . PHE A 1 410 ? -2.807  3.186   8.057   1.00 27.71 ? 411 PHE A N   1 
ATOM   3332 C  CA  . PHE A 1 410 ? -1.938  2.192   8.723   1.00 26.62 ? 411 PHE A CA  1 
ATOM   3333 C  C   . PHE A 1 410 ? -0.969  1.471   7.774   1.00 25.84 ? 411 PHE A C   1 
ATOM   3334 O  O   . PHE A 1 410 ? -0.840  0.242   7.810   1.00 25.06 ? 411 PHE A O   1 
ATOM   3335 C  CB  . PHE A 1 410 ? -2.754  1.206   9.591   1.00 26.69 ? 411 PHE A CB  1 
ATOM   3336 C  CG  . PHE A 1 410 ? -3.176  1.781   10.921  1.00 26.73 ? 411 PHE A CG  1 
ATOM   3337 C  CD1 . PHE A 1 410 ? -4.319  2.576   11.022  1.00 26.81 ? 411 PHE A CD1 1 
ATOM   3338 C  CD2 . PHE A 1 410 ? -2.417  1.555   12.064  1.00 26.28 ? 411 PHE A CD2 1 
ATOM   3339 C  CE1 . PHE A 1 410 ? -4.704  3.128   12.243  1.00 26.31 ? 411 PHE A CE1 1 
ATOM   3340 C  CE2 . PHE A 1 410 ? -2.788  2.099   13.289  1.00 26.76 ? 411 PHE A CE2 1 
ATOM   3341 C  CZ  . PHE A 1 410 ? -3.942  2.889   13.378  1.00 27.60 ? 411 PHE A CZ  1 
ATOM   3342 N  N   . ARG A 1 411 ? -0.305  2.260   6.924   1.00 24.90 ? 412 ARG A N   1 
ATOM   3343 C  CA  . ARG A 1 411 ? 0.653   1.747   5.943   1.00 24.53 ? 412 ARG A CA  1 
ATOM   3344 C  C   . ARG A 1 411 ? 2.092   2.096   6.304   1.00 23.74 ? 412 ARG A C   1 
ATOM   3345 O  O   . ARG A 1 411 ? 3.010   1.423   5.859   1.00 23.48 ? 412 ARG A O   1 
ATOM   3346 C  CB  . ARG A 1 411 ? 0.375   2.296   4.533   1.00 24.59 ? 412 ARG A CB  1 
ATOM   3347 C  CG  . ARG A 1 411 ? -1.011  2.037   3.932   1.00 25.57 ? 412 ARG A CG  1 
ATOM   3348 C  CD  . ARG A 1 411 ? -1.334  0.574   3.781   1.00 24.86 ? 412 ARG A CD  1 
ATOM   3349 N  NE  . ARG A 1 411 ? -2.288  0.306   2.697   1.00 22.92 ? 412 ARG A NE  1 
ATOM   3350 C  CZ  . ARG A 1 411 ? -3.614  0.376   2.812   1.00 22.37 ? 412 ARG A CZ  1 
ATOM   3351 N  NH1 . ARG A 1 411 ? -4.182  0.752   3.950   1.00 20.73 ? 412 ARG A NH1 1 
ATOM   3352 N  NH2 . ARG A 1 411 ? -4.376  0.074   1.774   1.00 22.41 ? 412 ARG A NH2 1 
ATOM   3353 N  N   . ASN A 1 412 ? 2.278   3.161   7.086   1.00 23.25 ? 413 ASN A N   1 
ATOM   3354 C  CA  . ASN A 1 412 ? 3.607   3.682   7.410   1.00 22.96 ? 413 ASN A CA  1 
ATOM   3355 C  C   . ASN A 1 412 ? 4.142   3.068   8.702   1.00 22.16 ? 413 ASN A C   1 
ATOM   3356 O  O   . ASN A 1 412 ? 4.191   3.723   9.745   1.00 22.17 ? 413 ASN A O   1 
ATOM   3357 C  CB  . ASN A 1 412 ? 3.564   5.216   7.513   1.00 23.48 ? 413 ASN A CB  1 
ATOM   3358 C  CG  . ASN A 1 412 ? 4.956   5.846   7.636   1.00 24.84 ? 413 ASN A CG  1 
ATOM   3359 O  OD1 . ASN A 1 412 ? 5.960   5.270   7.210   1.00 27.32 ? 413 ASN A OD1 1 
ATOM   3360 N  ND2 . ASN A 1 412 ? 5.009   7.041   8.211   1.00 24.91 ? 413 ASN A ND2 1 
ATOM   3361 N  N   . LEU A 1 413 ? 4.560   1.811   8.628   1.00 21.05 ? 414 LEU A N   1 
ATOM   3362 C  CA  . LEU A 1 413 ? 4.802   1.037   9.843   1.00 20.37 ? 414 LEU A CA  1 
ATOM   3363 C  C   . LEU A 1 413 ? 6.268   0.690   10.122  1.00 20.20 ? 414 LEU A C   1 
ATOM   3364 O  O   . LEU A 1 413 ? 6.568   0.034   11.126  1.00 20.01 ? 414 LEU A O   1 
ATOM   3365 C  CB  . LEU A 1 413 ? 3.941   -0.228  9.833   1.00 20.36 ? 414 LEU A CB  1 
ATOM   3366 C  CG  . LEU A 1 413 ? 2.423   -0.047  9.703   1.00 20.32 ? 414 LEU A CG  1 
ATOM   3367 C  CD1 . LEU A 1 413 ? 1.751   -1.393  9.433   1.00 21.53 ? 414 LEU A CD1 1 
ATOM   3368 C  CD2 . LEU A 1 413 ? 1.848   0.590   10.945  1.00 20.61 ? 414 LEU A CD2 1 
ATOM   3369 N  N   . GLY A 1 414 ? 7.166   1.153   9.255   1.00 19.28 ? 415 GLY A N   1 
ATOM   3370 C  CA  . GLY A 1 414 ? 8.598   0.894   9.380   1.00 19.27 ? 415 GLY A CA  1 
ATOM   3371 C  C   . GLY A 1 414 ? 9.226   1.183   10.737  1.00 18.88 ? 415 GLY A C   1 
ATOM   3372 O  O   . GLY A 1 414 ? 10.146  0.478   11.147  1.00 18.68 ? 415 GLY A O   1 
ATOM   3373 N  N   . PHE A 1 415 ? 8.733   2.211   11.430  1.00 18.45 ? 416 PHE A N   1 
ATOM   3374 C  CA  . PHE A 1 415 ? 9.248   2.569   12.755  1.00 18.07 ? 416 PHE A CA  1 
ATOM   3375 C  C   . PHE A 1 415 ? 8.300   2.154   13.882  1.00 18.11 ? 416 PHE A C   1 
ATOM   3376 O  O   . PHE A 1 415 ? 8.438   2.616   15.020  1.00 17.92 ? 416 PHE A O   1 
ATOM   3377 C  CB  . PHE A 1 415 ? 9.512   4.076   12.851  1.00 17.99 ? 416 PHE A CB  1 
ATOM   3378 C  CG  . PHE A 1 415 ? 10.620  4.572   11.962  1.00 17.16 ? 416 PHE A CG  1 
ATOM   3379 C  CD1 . PHE A 1 415 ? 10.329  5.163   10.731  1.00 16.95 ? 416 PHE A CD1 1 
ATOM   3380 C  CD2 . PHE A 1 415 ? 11.944  4.500   12.373  1.00 16.61 ? 416 PHE A CD2 1 
ATOM   3381 C  CE1 . PHE A 1 415 ? 11.341  5.648   9.918   1.00 15.44 ? 416 PHE A CE1 1 
ATOM   3382 C  CE2 . PHE A 1 415 ? 12.974  4.986   11.566  1.00 16.45 ? 416 PHE A CE2 1 
ATOM   3383 C  CZ  . PHE A 1 415 ? 12.670  5.560   10.332  1.00 16.52 ? 416 PHE A CZ  1 
ATOM   3384 N  N   . GLY A 1 416 ? 7.338   1.293   13.564  1.00 18.25 ? 417 GLY A N   1 
ATOM   3385 C  CA  . GLY A 1 416 ? 6.332   0.883   14.531  1.00 18.67 ? 417 GLY A CA  1 
ATOM   3386 C  C   . GLY A 1 416 ? 5.294   1.960   14.769  1.00 19.26 ? 417 GLY A C   1 
ATOM   3387 O  O   . GLY A 1 416 ? 5.120   2.858   13.939  1.00 18.95 ? 417 GLY A O   1 
ATOM   3388 N  N   . TRP A 1 417 ? 4.630   1.889   15.920  1.00 19.77 ? 418 TRP A N   1 
ATOM   3389 C  CA  . TRP A 1 417 ? 3.474   2.738   16.207  1.00 20.91 ? 418 TRP A CA  1 
ATOM   3390 C  C   . TRP A 1 417 ? 3.349   3.004   17.707  1.00 20.27 ? 418 TRP A C   1 
ATOM   3391 O  O   . TRP A 1 417 ? 3.766   2.179   18.528  1.00 20.32 ? 418 TRP A O   1 
ATOM   3392 C  CB  . TRP A 1 417 ? 2.203   2.051   15.689  1.00 21.69 ? 418 TRP A CB  1 
ATOM   3393 C  CG  . TRP A 1 417 ? 0.922   2.853   15.848  1.00 26.17 ? 418 TRP A CG  1 
ATOM   3394 C  CD1 . TRP A 1 417 ? 0.367   3.698   14.927  1.00 28.39 ? 418 TRP A CD1 1 
ATOM   3395 C  CD2 . TRP A 1 417 ? 0.044   2.878   16.989  1.00 29.26 ? 418 TRP A CD2 1 
ATOM   3396 N  NE1 . TRP A 1 417 ? -0.790  4.249   15.421  1.00 29.48 ? 418 TRP A NE1 1 
ATOM   3397 C  CE2 . TRP A 1 417 ? -1.014  3.765   16.682  1.00 30.23 ? 418 TRP A CE2 1 
ATOM   3398 C  CE3 . TRP A 1 417 ? 0.055   2.243   18.240  1.00 31.48 ? 418 TRP A CE3 1 
ATOM   3399 C  CZ2 . TRP A 1 417 ? -2.063  4.032   17.579  1.00 31.96 ? 418 TRP A CZ2 1 
ATOM   3400 C  CZ3 . TRP A 1 417 ? -0.986  2.509   19.138  1.00 33.13 ? 418 TRP A CZ3 1 
ATOM   3401 C  CH2 . TRP A 1 417 ? -2.030  3.400   18.798  1.00 33.52 ? 418 TRP A CH2 1 
ATOM   3402 N  N   . GLY A 1 418 ? 2.788   4.161   18.055  1.00 19.87 ? 419 GLY A N   1 
ATOM   3403 C  CA  . GLY A 1 418 ? 2.381   4.460   19.430  1.00 19.45 ? 419 GLY A CA  1 
ATOM   3404 C  C   . GLY A 1 418 ? 3.525   4.804   20.356  1.00 19.79 ? 419 GLY A C   1 
ATOM   3405 O  O   . GLY A 1 418 ? 4.598   5.233   19.898  1.00 19.61 ? 419 GLY A O   1 
ATOM   3406 N  N   . VAL A 1 419 ? 3.294   4.614   21.661  1.00 19.37 ? 420 VAL A N   1 
ATOM   3407 C  CA  . VAL A 1 419 ? 4.235   5.033   22.707  1.00 18.99 ? 420 VAL A CA  1 
ATOM   3408 C  C   . VAL A 1 419 ? 5.544   4.240   22.714  1.00 18.62 ? 420 VAL A C   1 
ATOM   3409 O  O   . VAL A 1 419 ? 6.560   4.730   23.212  1.00 18.31 ? 420 VAL A O   1 
ATOM   3410 C  CB  . VAL A 1 419 ? 3.603   5.013   24.139  1.00 19.51 ? 420 VAL A CB  1 
ATOM   3411 C  CG1 . VAL A 1 419 ? 2.471   6.026   24.239  1.00 20.36 ? 420 VAL A CG1 1 
ATOM   3412 C  CG2 . VAL A 1 419 ? 3.104   3.608   24.531  1.00 19.27 ? 420 VAL A CG2 1 
ATOM   3413 N  N   . ARG A 1 420 ? 5.512   3.022   22.172  1.00 17.91 ? 421 ARG A N   1 
ATOM   3414 C  CA  . ARG A 1 420 ? 6.704   2.172   22.143  1.00 17.71 ? 421 ARG A CA  1 
ATOM   3415 C  C   . ARG A 1 420 ? 7.273   1.977   20.719  1.00 17.22 ? 421 ARG A C   1 
ATOM   3416 O  O   . ARG A 1 420 ? 8.024   1.035   20.464  1.00 17.21 ? 421 ARG A O   1 
ATOM   3417 C  CB  . ARG A 1 420 ? 6.459   0.833   22.876  1.00 17.72 ? 421 ARG A CB  1 
ATOM   3418 C  CG  . ARG A 1 420 ? 7.742   0.053   23.139  1.00 18.12 ? 421 ARG A CG  1 
ATOM   3419 C  CD  . ARG A 1 420 ? 7.657   -0.882  24.323  1.00 19.72 ? 421 ARG A CD  1 
ATOM   3420 N  NE  . ARG A 1 420 ? 8.991   -1.311  24.743  1.00 18.64 ? 421 ARG A NE  1 
ATOM   3421 C  CZ  . ARG A 1 420 ? 9.233   -2.236  25.666  1.00 19.46 ? 421 ARG A CZ  1 
ATOM   3422 N  NH1 . ARG A 1 420 ? 8.230   -2.859  26.282  1.00 17.93 ? 421 ARG A NH1 1 
ATOM   3423 N  NH2 . ARG A 1 420 ? 10.487  -2.547  25.963  1.00 18.53 ? 421 ARG A NH2 1 
ATOM   3424 N  N   . GLN A 1 421 ? 6.923   2.887   19.809  1.00 16.52 ? 422 GLN A N   1 
ATOM   3425 C  CA  . GLN A 1 421 ? 7.520   2.945   18.468  1.00 16.50 ? 422 GLN A CA  1 
ATOM   3426 C  C   . GLN A 1 421 ? 9.045   3.137   18.576  1.00 16.21 ? 422 GLN A C   1 
ATOM   3427 O  O   . GLN A 1 421 ? 9.567   3.338   19.673  1.00 16.28 ? 422 GLN A O   1 
ATOM   3428 C  CB  . GLN A 1 421 ? 6.903   4.105   17.672  1.00 16.67 ? 422 GLN A CB  1 
ATOM   3429 C  CG  . GLN A 1 421 ? 7.250   5.487   18.229  1.00 17.89 ? 422 GLN A CG  1 
ATOM   3430 C  CD  . GLN A 1 421 ? 6.618   6.627   17.445  1.00 21.49 ? 422 GLN A CD  1 
ATOM   3431 O  OE1 . GLN A 1 421 ? 5.572   7.154   17.826  1.00 23.38 ? 422 GLN A OE1 1 
ATOM   3432 N  NE2 . GLN A 1 421 ? 7.246   7.005   16.343  1.00 20.58 ? 422 GLN A NE2 1 
ATOM   3433 N  N   . CYS A 1 422 ? 9.754   3.085   17.448  1.00 16.05 ? 423 CYS A N   1 
ATOM   3434 C  CA  . CYS A 1 422 ? 11.205  3.312   17.440  1.00 15.54 ? 423 CYS A CA  1 
ATOM   3435 C  C   . CYS A 1 422 ? 11.601  4.539   18.257  1.00 15.83 ? 423 CYS A C   1 
ATOM   3436 O  O   . CYS A 1 422 ? 11.088  5.640   18.020  1.00 15.11 ? 423 CYS A O   1 
ATOM   3437 C  CB  . CYS A 1 422 ? 11.729  3.489   16.010  1.00 15.66 ? 423 CYS A CB  1 
ATOM   3438 S  SG  . CYS A 1 422 ? 13.543  3.713   15.942  1.00 15.17 ? 423 CYS A SG  1 
ATOM   3439 N  N   . LEU A 1 423 ? 12.510  4.347   19.218  1.00 15.99 ? 424 LEU A N   1 
ATOM   3440 C  CA  . LEU A 1 423 ? 13.030  5.469   20.015  1.00 16.38 ? 424 LEU A CA  1 
ATOM   3441 C  C   . LEU A 1 423 ? 13.922  6.396   19.174  1.00 16.39 ? 424 LEU A C   1 
ATOM   3442 O  O   . LEU A 1 423 ? 13.972  7.601   19.414  1.00 16.89 ? 424 LEU A O   1 
ATOM   3443 C  CB  . LEU A 1 423 ? 13.799  4.967   21.254  1.00 16.01 ? 424 LEU A CB  1 
ATOM   3444 C  CG  . LEU A 1 423 ? 14.500  5.997   22.161  1.00 17.03 ? 424 LEU A CG  1 
ATOM   3445 C  CD1 . LEU A 1 423 ? 13.489  6.865   22.933  1.00 19.32 ? 424 LEU A CD1 1 
ATOM   3446 C  CD2 . LEU A 1 423 ? 15.462  5.316   23.132  1.00 18.06 ? 424 LEU A CD2 1 
ATOM   3447 N  N   . GLY A 1 424 ? 14.637  5.824   18.208  1.00 16.20 ? 425 GLY A N   1 
ATOM   3448 C  CA  . GLY A 1 424 ? 15.551  6.593   17.371  1.00 15.88 ? 425 GLY A CA  1 
ATOM   3449 C  C   . GLY A 1 424 ? 14.897  7.161   16.125  1.00 15.78 ? 425 GLY A C   1 
ATOM   3450 O  O   . GLY A 1 424 ? 15.585  7.558   15.187  1.00 15.53 ? 425 GLY A O   1 
ATOM   3451 N  N   . ARG A 1 425 ? 13.571  7.213   16.116  1.00 15.39 ? 426 ARG A N   1 
ATOM   3452 C  CA  . ARG A 1 425 ? 12.841  7.558   14.902  1.00 16.24 ? 426 ARG A CA  1 
ATOM   3453 C  C   . ARG A 1 425 ? 13.205  8.946   14.352  1.00 16.21 ? 426 ARG A C   1 
ATOM   3454 O  O   . ARG A 1 425 ? 13.476  9.095   13.155  1.00 16.27 ? 426 ARG A O   1 
ATOM   3455 C  CB  . ARG A 1 425 ? 11.323  7.421   15.104  1.00 16.04 ? 426 ARG A CB  1 
ATOM   3456 C  CG  . ARG A 1 425 ? 10.550  7.646   13.811  1.00 17.64 ? 426 ARG A CG  1 
ATOM   3457 C  CD  . ARG A 1 425 ? 9.047   7.733   14.018  1.00 17.91 ? 426 ARG A CD  1 
ATOM   3458 N  NE  . ARG A 1 425 ? 8.377   7.724   12.715  1.00 20.15 ? 426 ARG A NE  1 
ATOM   3459 C  CZ  . ARG A 1 425 ? 7.162   7.243   12.487  1.00 20.87 ? 426 ARG A CZ  1 
ATOM   3460 N  NH1 . ARG A 1 425 ? 6.435   6.724   13.474  1.00 22.97 ? 426 ARG A NH1 1 
ATOM   3461 N  NH2 . ARG A 1 425 ? 6.673   7.277   11.260  1.00 22.18 ? 426 ARG A NH2 1 
ATOM   3462 N  N   . ARG A 1 426 ? 13.224  9.950   15.220  1.00 16.37 ? 427 ARG A N   1 
ATOM   3463 C  CA  . ARG A 1 426 ? 13.545  11.313  14.784  1.00 17.15 ? 427 ARG A CA  1 
ATOM   3464 C  C   . ARG A 1 426 ? 14.996  11.406  14.347  1.00 16.82 ? 427 ARG A C   1 
ATOM   3465 O  O   . ARG A 1 426 ? 15.299  12.037  13.346  1.00 16.68 ? 427 ARG A O   1 
ATOM   3466 C  CB  . ARG A 1 426 ? 13.251  12.338  15.885  1.00 17.51 ? 427 ARG A CB  1 
ATOM   3467 C  CG  . ARG A 1 426 ? 11.831  12.291  16.415  1.00 19.67 ? 427 ARG A CG  1 
ATOM   3468 C  CD  . ARG A 1 426 ? 10.876  13.028  15.485  1.00 25.89 ? 427 ARG A CD  1 
ATOM   3469 N  NE  . ARG A 1 426 ? 10.254  12.168  14.480  1.00 29.84 ? 427 ARG A NE  1 
ATOM   3470 C  CZ  . ARG A 1 426 ? 9.004   11.708  14.547  1.00 32.12 ? 427 ARG A CZ  1 
ATOM   3471 N  NH1 . ARG A 1 426 ? 8.226   12.011  15.584  1.00 32.89 ? 427 ARG A NH1 1 
ATOM   3472 N  NH2 . ARG A 1 426 ? 8.525   10.944  13.569  1.00 32.38 ? 427 ARG A NH2 1 
ATOM   3473 N  N   . ILE A 1 427 ? 15.886  10.767  15.100  1.00 16.68 ? 428 ILE A N   1 
ATOM   3474 C  CA  . ILE A 1 427 ? 17.303  10.766  14.768  1.00 16.62 ? 428 ILE A CA  1 
ATOM   3475 C  C   . ILE A 1 427 ? 17.508  10.150  13.390  1.00 16.71 ? 428 ILE A C   1 
ATOM   3476 O  O   . ILE A 1 427 ? 18.205  10.731  12.543  1.00 16.55 ? 428 ILE A O   1 
ATOM   3477 C  CB  . ILE A 1 427 ? 18.135  10.026  15.840  1.00 16.47 ? 428 ILE A CB  1 
ATOM   3478 C  CG1 . ILE A 1 427 ? 18.135  10.836  17.147  1.00 16.55 ? 428 ILE A CG1 1 
ATOM   3479 C  CG2 . ILE A 1 427 ? 19.564  9.764   15.340  1.00 17.35 ? 428 ILE A CG2 1 
ATOM   3480 C  CD1 . ILE A 1 427 ? 18.772  10.134  18.326  1.00 15.30 ? 428 ILE A CD1 1 
ATOM   3481 N  N   . ALA A 1 428 ? 16.873  8.993   13.170  1.00 16.36 ? 429 ALA A N   1 
ATOM   3482 C  CA  . ALA A 1 428 ? 16.988  8.255   11.923  1.00 16.64 ? 429 ALA A CA  1 
ATOM   3483 C  C   . ALA A 1 428 ? 16.402  9.036   10.744  1.00 16.88 ? 429 ALA A C   1 
ATOM   3484 O  O   . ALA A 1 428 ? 17.038  9.121   9.697   1.00 16.84 ? 429 ALA A O   1 
ATOM   3485 C  CB  . ALA A 1 428 ? 16.330  6.871   12.036  1.00 16.12 ? 429 ALA A CB  1 
ATOM   3486 N  N   . GLU A 1 429 ? 15.202  9.595   10.916  1.00 17.04 ? 430 GLU A N   1 
ATOM   3487 C  CA  . GLU A 1 429 ? 14.542  10.358  9.842   1.00 17.64 ? 430 GLU A CA  1 
ATOM   3488 C  C   . GLU A 1 429 ? 15.371  11.570  9.451   1.00 17.62 ? 430 GLU A C   1 
ATOM   3489 O  O   . GLU A 1 429 ? 15.572  11.827  8.266   1.00 18.01 ? 430 GLU A O   1 
ATOM   3490 C  CB  . GLU A 1 429 ? 13.124  10.801  10.244  1.00 17.60 ? 430 GLU A CB  1 
ATOM   3491 C  CG  . GLU A 1 429 ? 12.086  9.682   10.133  1.00 19.68 ? 430 GLU A CG  1 
ATOM   3492 C  CD  . GLU A 1 429 ? 10.726  10.019  10.753  1.00 20.91 ? 430 GLU A CD  1 
ATOM   3493 O  OE1 . GLU A 1 429 ? 10.603  10.992  11.538  1.00 21.54 ? 430 GLU A OE1 1 
ATOM   3494 O  OE2 . GLU A 1 429 ? 9.777   9.265   10.471  1.00 20.78 ? 430 GLU A OE2 1 
ATOM   3495 N  N   . LEU A 1 430 ? 15.856  12.298  10.455  1.00 17.48 ? 431 LEU A N   1 
ATOM   3496 C  CA  . LEU A 1 430 ? 16.653  13.499  10.235  1.00 17.39 ? 431 LEU A CA  1 
ATOM   3497 C  C   . LEU A 1 430 ? 18.000  13.176  9.595   1.00 17.23 ? 431 LEU A C   1 
ATOM   3498 O  O   . LEU A 1 430 ? 18.438  13.882  8.691   1.00 16.76 ? 431 LEU A O   1 
ATOM   3499 C  CB  . LEU A 1 430 ? 16.843  14.278  11.550  1.00 17.27 ? 431 LEU A CB  1 
ATOM   3500 C  CG  . LEU A 1 430 ? 15.600  14.963  12.151  1.00 17.90 ? 431 LEU A CG  1 
ATOM   3501 C  CD1 . LEU A 1 430 ? 15.873  15.494  13.557  1.00 16.75 ? 431 LEU A CD1 1 
ATOM   3502 C  CD2 . LEU A 1 430 ? 15.059  16.078  11.247  1.00 16.90 ? 431 LEU A CD2 1 
ATOM   3503 N  N   . GLU A 1 431 ? 18.637  12.102  10.065  1.00 16.98 ? 432 GLU A N   1 
ATOM   3504 C  CA  . GLU A 1 431 ? 19.928  11.668  9.554   1.00 16.97 ? 432 GLU A CA  1 
ATOM   3505 C  C   . GLU A 1 431 ? 19.809  11.265  8.092   1.00 16.70 ? 432 GLU A C   1 
ATOM   3506 O  O   . GLU A 1 431 ? 20.668  11.610  7.276   1.00 16.23 ? 432 GLU A O   1 
ATOM   3507 C  CB  . GLU A 1 431 ? 20.469  10.494  10.383  1.00 17.42 ? 432 GLU A CB  1 
ATOM   3508 C  CG  . GLU A 1 431 ? 21.786  9.915   9.878   1.00 19.90 ? 432 GLU A CG  1 
ATOM   3509 C  CD  . GLU A 1 431 ? 22.171  8.632   10.586  1.00 24.42 ? 432 GLU A CD  1 
ATOM   3510 O  OE1 . GLU A 1 431 ? 22.017  8.559   11.833  1.00 25.94 ? 432 GLU A OE1 1 
ATOM   3511 O  OE2 . GLU A 1 431 ? 22.623  7.684   9.895   1.00 26.65 ? 432 GLU A OE2 1 
ATOM   3512 N  N   . MET A 1 432 ? 18.742  10.535  7.766   1.00 15.99 ? 433 MET A N   1 
ATOM   3513 C  CA  . MET A 1 432 ? 18.529  10.096  6.398   1.00 15.65 ? 433 MET A CA  1 
ATOM   3514 C  C   . MET A 1 432 ? 18.087  11.224  5.467   1.00 15.33 ? 433 MET A C   1 
ATOM   3515 O  O   . MET A 1 432 ? 18.528  11.281  4.328   1.00 15.39 ? 433 MET A O   1 
ATOM   3516 C  CB  . MET A 1 432 ? 17.552  8.921   6.349   1.00 15.40 ? 433 MET A CB  1 
ATOM   3517 C  CG  . MET A 1 432 ? 18.113  7.669   7.012   1.00 16.47 ? 433 MET A CG  1 
ATOM   3518 S  SD  . MET A 1 432 ? 17.072  6.220   6.817   1.00 19.29 ? 433 MET A SD  1 
ATOM   3519 C  CE  . MET A 1 432 ? 15.605  6.722   7.730   1.00 16.67 ? 433 MET A CE  1 
ATOM   3520 N  N   . THR A 1 433 ? 17.214  12.113  5.933   1.00 15.23 ? 434 THR A N   1 
ATOM   3521 C  CA  . THR A 1 433 ? 16.787  13.238  5.081   1.00 15.57 ? 434 THR A CA  1 
ATOM   3522 C  C   . THR A 1 433 ? 17.947  14.204  4.796   1.00 15.13 ? 434 THR A C   1 
ATOM   3523 O  O   . THR A 1 433 ? 18.144  14.612  3.657   1.00 15.33 ? 434 THR A O   1 
ATOM   3524 C  CB  . THR A 1 433 ? 15.574  13.992  5.667   1.00 15.32 ? 434 THR A CB  1 
ATOM   3525 O  OG1 . THR A 1 433 ? 14.553  13.049  5.996   1.00 16.51 ? 434 THR A OG1 1 
ATOM   3526 C  CG2 . THR A 1 433 ? 15.011  14.963  4.651   1.00 15.31 ? 434 THR A CG2 1 
ATOM   3527 N  N   . ILE A 1 434 ? 18.707  14.548  5.836   1.00 14.98 ? 435 ILE A N   1 
ATOM   3528 C  CA  . ILE A 1 434 ? 19.891  15.394  5.709   1.00 14.89 ? 435 ILE A CA  1 
ATOM   3529 C  C   . ILE A 1 434 ? 20.962  14.745  4.820   1.00 15.13 ? 435 ILE A C   1 
ATOM   3530 O  O   . ILE A 1 434 ? 21.575  15.419  3.994   1.00 15.74 ? 435 ILE A O   1 
ATOM   3531 C  CB  . ILE A 1 434 ? 20.473  15.803  7.101   1.00 14.75 ? 435 ILE A CB  1 
ATOM   3532 C  CG1 . ILE A 1 434 ? 19.484  16.709  7.854   1.00 14.90 ? 435 ILE A CG1 1 
ATOM   3533 C  CG2 . ILE A 1 434 ? 21.773  16.572  6.943   1.00 14.90 ? 435 ILE A CG2 1 
ATOM   3534 C  CD1 . ILE A 1 434 ? 19.820  16.920  9.361   1.00 14.65 ? 435 ILE A CD1 1 
ATOM   3535 N  N   . PHE A 1 435 ? 21.168  13.437  4.971   1.00 15.36 ? 436 PHE A N   1 
ATOM   3536 C  CA  . PHE A 1 435 ? 22.124  12.712  4.127   1.00 14.96 ? 436 PHE A CA  1 
ATOM   3537 C  C   . PHE A 1 435 ? 21.743  12.828  2.657   1.00 14.99 ? 436 PHE A C   1 
ATOM   3538 O  O   . PHE A 1 435 ? 22.584  13.117  1.808   1.00 14.62 ? 436 PHE A O   1 
ATOM   3539 C  CB  . PHE A 1 435 ? 22.201  11.234  4.535   1.00 14.79 ? 436 PHE A CB  1 
ATOM   3540 C  CG  . PHE A 1 435 ? 23.025  10.380  3.605   1.00 14.35 ? 436 PHE A CG  1 
ATOM   3541 C  CD1 . PHE A 1 435 ? 24.391  10.219  3.819   1.00 12.74 ? 436 PHE A CD1 1 
ATOM   3542 C  CD2 . PHE A 1 435 ? 22.432  9.721   2.533   1.00 13.84 ? 436 PHE A CD2 1 
ATOM   3543 C  CE1 . PHE A 1 435 ? 25.158  9.424   2.975   1.00 13.67 ? 436 PHE A CE1 1 
ATOM   3544 C  CE2 . PHE A 1 435 ? 23.196  8.923   1.674   1.00 15.47 ? 436 PHE A CE2 1 
ATOM   3545 C  CZ  . PHE A 1 435 ? 24.566  8.771   1.902   1.00 14.12 ? 436 PHE A CZ  1 
ATOM   3546 N  N   . LEU A 1 436 ? 20.468  12.594  2.365   1.00 15.22 ? 437 LEU A N   1 
ATOM   3547 C  CA  . LEU A 1 436 ? 19.994  12.556  0.974   1.00 15.48 ? 437 LEU A CA  1 
ATOM   3548 C  C   . LEU A 1 436 ? 19.952  13.927  0.291   1.00 15.65 ? 437 LEU A C   1 
ATOM   3549 O  O   . LEU A 1 436 ? 20.177  14.023  -0.920  1.00 15.42 ? 437 LEU A O   1 
ATOM   3550 C  CB  . LEU A 1 436 ? 18.643  11.846  0.880   1.00 15.35 ? 437 LEU A CB  1 
ATOM   3551 C  CG  . LEU A 1 436 ? 18.685  10.351  1.237   1.00 16.24 ? 437 LEU A CG  1 
ATOM   3552 C  CD1 . LEU A 1 436 ? 17.283  9.802   1.452   1.00 17.01 ? 437 LEU A CD1 1 
ATOM   3553 C  CD2 . LEU A 1 436 ? 19.441  9.530   0.175   1.00 17.74 ? 437 LEU A CD2 1 
ATOM   3554 N  N   . ILE A 1 437 ? 19.657  14.974  1.064   1.00 15.79 ? 438 ILE A N   1 
ATOM   3555 C  CA  . ILE A 1 437 ? 19.788  16.358  0.590   1.00 16.05 ? 438 ILE A CA  1 
ATOM   3556 C  C   . ILE A 1 437 ? 21.209  16.622  0.088   1.00 16.20 ? 438 ILE A C   1 
ATOM   3557 O  O   . ILE A 1 437 ? 21.390  17.100  -1.031  1.00 16.63 ? 438 ILE A O   1 
ATOM   3558 C  CB  . ILE A 1 437 ? 19.406  17.388  1.700   1.00 16.16 ? 438 ILE A CB  1 
ATOM   3559 C  CG1 . ILE A 1 437 ? 17.885  17.413  1.919   1.00 16.42 ? 438 ILE A CG1 1 
ATOM   3560 C  CG2 . ILE A 1 437 ? 19.937  18.787  1.378   1.00 16.06 ? 438 ILE A CG2 1 
ATOM   3561 C  CD1 . ILE A 1 437 ? 17.436  18.258  3.113   1.00 17.54 ? 438 ILE A CD1 1 
ATOM   3562 N  N   . ASN A 1 438 ? 22.210  16.296  0.908   1.00 16.39 ? 439 ASN A N   1 
ATOM   3563 C  CA  . ASN A 1 438 ? 23.609  16.549  0.565   1.00 16.52 ? 439 ASN A CA  1 
ATOM   3564 C  C   . ASN A 1 438 ? 24.047  15.716  -0.632  1.00 16.29 ? 439 ASN A C   1 
ATOM   3565 O  O   . ASN A 1 438 ? 24.746  16.213  -1.517  1.00 16.06 ? 439 ASN A O   1 
ATOM   3566 C  CB  . ASN A 1 438 ? 24.528  16.318  1.774   1.00 16.65 ? 439 ASN A CB  1 
ATOM   3567 C  CG  . ASN A 1 438 ? 24.506  17.488  2.757   1.00 18.59 ? 439 ASN A CG  1 
ATOM   3568 O  OD1 . ASN A 1 438 ? 25.098  18.533  2.499   1.00 21.89 ? 439 ASN A OD1 1 
ATOM   3569 N  ND2 . ASN A 1 438 ? 23.817  17.318  3.884   1.00 18.68 ? 439 ASN A ND2 1 
ATOM   3570 N  N   . MET A 1 439 ? 23.603  14.462  -0.668  1.00 16.47 ? 440 MET A N   1 
ATOM   3571 C  CA  . MET A 1 439 ? 23.911  13.561  -1.774  1.00 16.82 ? 440 MET A CA  1 
ATOM   3572 C  C   . MET A 1 439 ? 23.277  14.009  -3.089  1.00 17.08 ? 440 MET A C   1 
ATOM   3573 O  O   . MET A 1 439 ? 23.947  14.027  -4.130  1.00 16.50 ? 440 MET A O   1 
ATOM   3574 C  CB  . MET A 1 439 ? 23.505  12.124  -1.438  1.00 16.87 ? 440 MET A CB  1 
ATOM   3575 C  CG  . MET A 1 439 ? 24.396  11.481  -0.376  1.00 17.25 ? 440 MET A CG  1 
ATOM   3576 S  SD  . MET A 1 439 ? 26.111  11.222  -0.917  1.00 18.48 ? 440 MET A SD  1 
ATOM   3577 C  CE  . MET A 1 439 ? 25.849  9.802   -1.976  1.00 15.06 ? 440 MET A CE  1 
ATOM   3578 N  N   . LEU A 1 440 ? 21.992  14.369  -3.040  1.00 17.47 ? 441 LEU A N   1 
ATOM   3579 C  CA  . LEU A 1 440 ? 21.268  14.786  -4.244  1.00 18.07 ? 441 LEU A CA  1 
ATOM   3580 C  C   . LEU A 1 440 ? 21.801  16.098  -4.811  1.00 18.53 ? 441 LEU A C   1 
ATOM   3581 O  O   . LEU A 1 440 ? 21.796  16.289  -6.014  1.00 18.68 ? 441 LEU A O   1 
ATOM   3582 C  CB  . LEU A 1 440 ? 19.761  14.866  -3.993  1.00 17.96 ? 441 LEU A CB  1 
ATOM   3583 C  CG  . LEU A 1 440 ? 19.028  13.511  -3.988  1.00 19.36 ? 441 LEU A CG  1 
ATOM   3584 C  CD1 . LEU A 1 440 ? 17.621  13.641  -3.398  1.00 19.73 ? 441 LEU A CD1 1 
ATOM   3585 C  CD2 . LEU A 1 440 ? 18.984  12.882  -5.381  1.00 19.35 ? 441 LEU A CD2 1 
ATOM   3586 N  N   . GLU A 1 441 ? 22.273  16.991  -3.945  1.00 19.34 ? 442 GLU A N   1 
ATOM   3587 C  CA  . GLU A 1 441 ? 22.877  18.252  -4.398  1.00 20.60 ? 442 GLU A CA  1 
ATOM   3588 C  C   . GLU A 1 441 ? 24.232  18.041  -5.085  1.00 20.33 ? 442 GLU A C   1 
ATOM   3589 O  O   . GLU A 1 441 ? 24.628  18.834  -5.934  1.00 20.90 ? 442 GLU A O   1 
ATOM   3590 C  CB  . GLU A 1 441 ? 23.027  19.239  -3.230  1.00 20.90 ? 442 GLU A CB  1 
ATOM   3591 C  CG  . GLU A 1 441 ? 21.742  19.981  -2.888  1.00 24.12 ? 442 GLU A CG  1 
ATOM   3592 C  CD  . GLU A 1 441 ? 21.784  20.746  -1.557  1.00 27.75 ? 442 GLU A CD  1 
ATOM   3593 O  OE1 . GLU A 1 441 ? 22.579  20.397  -0.653  1.00 28.53 ? 442 GLU A OE1 1 
ATOM   3594 O  OE2 . GLU A 1 441 ? 20.985  21.701  -1.412  1.00 30.41 ? 442 GLU A OE2 1 
ATOM   3595 N  N   . ASN A 1 442 ? 24.926  16.964  -4.734  1.00 19.72 ? 443 ASN A N   1 
ATOM   3596 C  CA  . ASN A 1 442 ? 26.315  16.787  -5.156  1.00 19.29 ? 443 ASN A CA  1 
ATOM   3597 C  C   . ASN A 1 442 ? 26.599  15.736  -6.215  1.00 19.27 ? 443 ASN A C   1 
ATOM   3598 O  O   . ASN A 1 442 ? 27.603  15.843  -6.929  1.00 18.93 ? 443 ASN A O   1 
ATOM   3599 C  CB  . ASN A 1 442 ? 27.196  16.547  -3.937  1.00 19.15 ? 443 ASN A CB  1 
ATOM   3600 C  CG  . ASN A 1 442 ? 27.461  17.824  -3.165  1.00 20.24 ? 443 ASN A CG  1 
ATOM   3601 O  OD1 . ASN A 1 442 ? 28.421  18.534  -3.451  1.00 21.09 ? 443 ASN A OD1 1 
ATOM   3602 N  ND2 . ASN A 1 442 ? 26.605  18.126  -2.186  1.00 18.61 ? 443 ASN A ND2 1 
ATOM   3603 N  N   . PHE A 1 443 ? 25.733  14.723  -6.318  1.00 19.01 ? 444 PHE A N   1 
ATOM   3604 C  CA  . PHE A 1 443 ? 25.996  13.576  -7.192  1.00 19.06 ? 444 PHE A CA  1 
ATOM   3605 C  C   . PHE A 1 443 ? 24.766  13.060  -7.907  1.00 19.33 ? 444 PHE A C   1 
ATOM   3606 O  O   . PHE A 1 443 ? 23.651  13.168  -7.400  1.00 18.92 ? 444 PHE A O   1 
ATOM   3607 C  CB  . PHE A 1 443 ? 26.594  12.402  -6.404  1.00 18.61 ? 444 PHE A CB  1 
ATOM   3608 C  CG  . PHE A 1 443 ? 27.725  12.781  -5.514  1.00 18.68 ? 444 PHE A CG  1 
ATOM   3609 C  CD1 . PHE A 1 443 ? 27.531  12.899  -4.145  1.00 17.32 ? 444 PHE A CD1 1 
ATOM   3610 C  CD2 . PHE A 1 443 ? 28.990  13.030  -6.041  1.00 19.32 ? 444 PHE A CD2 1 
ATOM   3611 C  CE1 . PHE A 1 443 ? 28.572  13.256  -3.320  1.00 18.08 ? 444 PHE A CE1 1 
ATOM   3612 C  CE2 . PHE A 1 443 ? 30.037  13.384  -5.219  1.00 17.57 ? 444 PHE A CE2 1 
ATOM   3613 C  CZ  . PHE A 1 443 ? 29.828  13.507  -3.860  1.00 17.71 ? 444 PHE A CZ  1 
ATOM   3614 N  N   . ARG A 1 444 ? 24.996  12.479  -9.080  1.00 20.08 ? 445 ARG A N   1 
ATOM   3615 C  CA  . ARG A 1 444 ? 24.025  11.602  -9.726  1.00 21.30 ? 445 ARG A CA  1 
ATOM   3616 C  C   . ARG A 1 444 ? 24.453  10.162  -9.431  1.00 21.56 ? 445 ARG A C   1 
ATOM   3617 O  O   . ARG A 1 444 ? 25.647  9.835   -9.500  1.00 21.45 ? 445 ARG A O   1 
ATOM   3618 C  CB  . ARG A 1 444 ? 23.969  11.861  -11.241 1.00 21.76 ? 445 ARG A CB  1 
ATOM   3619 C  CG  . ARG A 1 444 ? 23.278  13.169  -11.629 1.00 24.83 ? 445 ARG A CG  1 
ATOM   3620 C  CD  . ARG A 1 444 ? 23.307  13.428  -13.152 1.00 30.73 ? 445 ARG A CD  1 
ATOM   3621 N  NE  . ARG A 1 444 ? 22.734  14.741  -13.486 1.00 35.05 ? 445 ARG A NE  1 
ATOM   3622 C  CZ  . ARG A 1 444 ? 22.858  15.363  -14.662 1.00 37.91 ? 445 ARG A CZ  1 
ATOM   3623 N  NH1 . ARG A 1 444 ? 23.540  14.811  -15.666 1.00 38.16 ? 445 ARG A NH1 1 
ATOM   3624 N  NH2 . ARG A 1 444 ? 22.296  16.556  -14.837 1.00 39.00 ? 445 ARG A NH2 1 
ATOM   3625 N  N   . VAL A 1 445 ? 23.485  9.311   -9.092  1.00 21.95 ? 446 VAL A N   1 
ATOM   3626 C  CA  . VAL A 1 445 ? 23.765  7.927   -8.716  1.00 22.81 ? 446 VAL A CA  1 
ATOM   3627 C  C   . VAL A 1 445 ? 23.237  6.939   -9.753  1.00 23.57 ? 446 VAL A C   1 
ATOM   3628 O  O   . VAL A 1 445 ? 22.082  7.031   -10.191 1.00 23.67 ? 446 VAL A O   1 
ATOM   3629 C  CB  . VAL A 1 445 ? 23.188  7.569   -7.315  1.00 22.82 ? 446 VAL A CB  1 
ATOM   3630 C  CG1 . VAL A 1 445 ? 23.813  6.291   -6.802  1.00 21.89 ? 446 VAL A CG1 1 
ATOM   3631 C  CG2 . VAL A 1 445 ? 23.425  8.708   -6.315  1.00 23.68 ? 446 VAL A CG2 1 
ATOM   3632 N  N   . GLU A 1 446 ? 24.100  6.001   -10.138 1.00 24.23 ? 447 GLU A N   1 
ATOM   3633 C  CA  . GLU A 1 446 ? 23.756  4.943   -11.079 1.00 25.42 ? 447 GLU A CA  1 
ATOM   3634 C  C   . GLU A 1 446 ? 24.289  3.580   -10.622 1.00 25.55 ? 447 GLU A C   1 
ATOM   3635 O  O   . GLU A 1 446 ? 25.214  3.504   -9.807  1.00 24.58 ? 447 GLU A O   1 
ATOM   3636 C  CB  . GLU A 1 446 ? 24.318  5.273   -12.463 1.00 25.89 ? 447 GLU A CB  1 
ATOM   3637 C  CG  . GLU A 1 446 ? 23.634  6.455   -13.145 1.00 28.84 ? 447 GLU A CG  1 
ATOM   3638 C  CD  . GLU A 1 446 ? 24.216  6.779   -14.513 1.00 33.38 ? 447 GLU A CD  1 
ATOM   3639 O  OE1 . GLU A 1 446 ? 25.289  6.229   -14.869 1.00 35.85 ? 447 GLU A OE1 1 
ATOM   3640 O  OE2 . GLU A 1 446 ? 23.598  7.602   -15.231 1.00 35.13 ? 447 GLU A OE2 1 
ATOM   3641 N  N   . ILE A 1 447 ? 23.695  2.511   -11.144 1.00 26.23 ? 448 ILE A N   1 
ATOM   3642 C  CA  . ILE A 1 447 ? 24.270  1.175   -11.009 1.00 27.67 ? 448 ILE A CA  1 
ATOM   3643 C  C   . ILE A 1 447 ? 24.499  0.601   -12.399 1.00 28.94 ? 448 ILE A C   1 
ATOM   3644 O  O   . ILE A 1 447 ? 23.559  0.453   -13.181 1.00 29.08 ? 448 ILE A O   1 
ATOM   3645 C  CB  . ILE A 1 447 ? 23.380  0.211   -10.182 1.00 27.54 ? 448 ILE A CB  1 
ATOM   3646 C  CG1 . ILE A 1 447 ? 23.219  0.720   -8.746  1.00 27.05 ? 448 ILE A CG1 1 
ATOM   3647 C  CG2 . ILE A 1 447 ? 23.959  -1.225  -10.188 1.00 26.82 ? 448 ILE A CG2 1 
ATOM   3648 C  CD1 . ILE A 1 447 ? 22.064  0.056   -7.991  1.00 26.95 ? 448 ILE A CD1 1 
ATOM   3649 N  N   . GLN A 1 448 ? 25.758  0.307   -12.701 1.00 30.64 ? 449 GLN A N   1 
ATOM   3650 C  CA  . GLN A 1 448 ? 26.133  -0.372  -13.937 1.00 32.36 ? 449 GLN A CA  1 
ATOM   3651 C  C   . GLN A 1 448 ? 25.778  -1.848  -13.822 1.00 33.13 ? 449 GLN A C   1 
ATOM   3652 O  O   . GLN A 1 448 ? 25.945  -2.453  -12.757 1.00 33.34 ? 449 GLN A O   1 
ATOM   3653 C  CB  . GLN A 1 448 ? 27.630  -0.209  -14.191 1.00 32.40 ? 449 GLN A CB  1 
ATOM   3654 C  CG  . GLN A 1 448 ? 28.041  1.236   -14.434 1.00 34.48 ? 449 GLN A CG  1 
ATOM   3655 C  CD  . GLN A 1 448 ? 29.540  1.472   -14.314 1.00 37.68 ? 449 GLN A CD  1 
ATOM   3656 O  OE1 . GLN A 1 448 ? 30.322  0.545   -14.053 1.00 39.08 ? 449 GLN A OE1 1 
ATOM   3657 N  NE2 . GLN A 1 448 ? 29.947  2.724   -14.498 1.00 38.09 ? 449 GLN A NE2 1 
ATOM   3658 N  N   . HIS A 1 449 ? 25.286  -2.426  -14.914 1.00 34.16 ? 450 HIS A N   1 
ATOM   3659 C  CA  . HIS A 1 449 ? 24.827  -3.822  -14.910 1.00 35.27 ? 450 HIS A CA  1 
ATOM   3660 C  C   . HIS A 1 449 ? 23.813  -4.047  -13.788 1.00 35.68 ? 450 HIS A C   1 
ATOM   3661 O  O   . HIS A 1 449 ? 23.949  -4.960  -12.963 1.00 35.97 ? 450 HIS A O   1 
ATOM   3662 C  CB  . HIS A 1 449 ? 26.013  -4.797  -14.822 1.00 35.46 ? 450 HIS A CB  1 
ATOM   3663 C  CG  . HIS A 1 449 ? 27.035  -4.585  -15.897 1.00 37.02 ? 450 HIS A CG  1 
ATOM   3664 N  ND1 . HIS A 1 449 ? 26.772  -4.826  -17.229 1.00 38.06 ? 450 HIS A ND1 1 
ATOM   3665 C  CD2 . HIS A 1 449 ? 28.308  -4.124  -15.841 1.00 38.43 ? 450 HIS A CD2 1 
ATOM   3666 C  CE1 . HIS A 1 449 ? 27.843  -4.535  -17.946 1.00 38.79 ? 450 HIS A CE1 1 
ATOM   3667 N  NE2 . HIS A 1 449 ? 28.790  -4.109  -17.129 1.00 38.79 ? 450 HIS A NE2 1 
ATOM   3668 N  N   . LEU A 1 450 ? 22.809  -3.176  -13.766 1.00 36.01 ? 451 LEU A N   1 
ATOM   3669 C  CA  . LEU A 1 450 ? 21.722  -3.232  -12.801 1.00 36.28 ? 451 LEU A CA  1 
ATOM   3670 C  C   . LEU A 1 450 ? 21.029  -4.588  -12.836 1.00 36.05 ? 451 LEU A C   1 
ATOM   3671 O  O   . LEU A 1 450 ? 20.719  -5.109  -13.909 1.00 36.41 ? 451 LEU A O   1 
ATOM   3672 C  CB  . LEU A 1 450 ? 20.714  -2.115  -13.091 1.00 36.40 ? 451 LEU A CB  1 
ATOM   3673 C  CG  . LEU A 1 450 ? 19.533  -1.912  -12.133 1.00 37.60 ? 451 LEU A CG  1 
ATOM   3674 C  CD1 . LEU A 1 450 ? 20.011  -1.610  -10.716 1.00 36.94 ? 451 LEU A CD1 1 
ATOM   3675 C  CD2 . LEU A 1 450 ? 18.616  -0.801  -12.654 1.00 37.53 ? 451 LEU A CD2 1 
ATOM   3676 N  N   . SER A 1 451 ? 20.823  -5.158  -11.652 1.00 35.80 ? 452 SER A N   1 
ATOM   3677 C  CA  . SER A 1 451 ? 20.043  -6.385  -11.481 1.00 35.43 ? 452 SER A CA  1 
ATOM   3678 C  C   . SER A 1 451 ? 19.271  -6.302  -10.169 1.00 34.82 ? 452 SER A C   1 
ATOM   3679 O  O   . SER A 1 451 ? 19.642  -5.540  -9.273  1.00 35.17 ? 452 SER A O   1 
ATOM   3680 C  CB  . SER A 1 451 ? 20.942  -7.624  -11.509 1.00 35.39 ? 452 SER A CB  1 
ATOM   3681 O  OG  . SER A 1 451 ? 21.873  -7.610  -10.440 1.00 36.56 ? 452 SER A OG  1 
ATOM   3682 N  N   . ASP A 1 452 ? 18.192  -7.073  -10.069 1.00 33.86 ? 453 ASP A N   1 
ATOM   3683 C  CA  . ASP A 1 452 ? 17.355  -7.091  -8.873  1.00 32.73 ? 453 ASP A CA  1 
ATOM   3684 C  C   . ASP A 1 452 ? 18.111  -7.704  -7.703  1.00 31.37 ? 453 ASP A C   1 
ATOM   3685 O  O   . ASP A 1 452 ? 18.650  -8.804  -7.810  1.00 31.52 ? 453 ASP A O   1 
ATOM   3686 C  CB  . ASP A 1 452 ? 16.055  -7.859  -9.132  1.00 33.15 ? 453 ASP A CB  1 
ATOM   3687 C  CG  . ASP A 1 452 ? 15.351  -7.403  -10.396 1.00 34.35 ? 453 ASP A CG  1 
ATOM   3688 O  OD1 . ASP A 1 452 ? 15.023  -6.198  -10.499 1.00 35.17 ? 453 ASP A OD1 1 
ATOM   3689 O  OD2 . ASP A 1 452 ? 15.124  -8.253  -11.287 1.00 36.43 ? 453 ASP A OD2 1 
ATOM   3690 N  N   . VAL A 1 453 ? 18.164  -6.969  -6.599  1.00 29.45 ? 454 VAL A N   1 
ATOM   3691 C  CA  . VAL A 1 453 ? 18.865  -7.423  -5.408  1.00 27.60 ? 454 VAL A CA  1 
ATOM   3692 C  C   . VAL A 1 453 ? 17.833  -7.871  -4.381  1.00 26.61 ? 454 VAL A C   1 
ATOM   3693 O  O   . VAL A 1 453 ? 16.931  -7.110  -4.014  1.00 25.99 ? 454 VAL A O   1 
ATOM   3694 C  CB  . VAL A 1 453 ? 19.802  -6.322  -4.849  1.00 27.81 ? 454 VAL A CB  1 
ATOM   3695 C  CG1 . VAL A 1 453 ? 20.255  -6.635  -3.420  1.00 26.80 ? 454 VAL A CG1 1 
ATOM   3696 C  CG2 . VAL A 1 453 ? 21.011  -6.148  -5.771  1.00 27.73 ? 454 VAL A CG2 1 
ATOM   3697 N  N   . GLY A 1 454 ? 17.959  -9.123  -3.949  1.00 25.22 ? 455 GLY A N   1 
ATOM   3698 C  CA  . GLY A 1 454 ? 17.041  -9.692  -2.985  1.00 23.81 ? 455 GLY A CA  1 
ATOM   3699 C  C   . GLY A 1 454 ? 17.371  -9.293  -1.560  1.00 23.00 ? 455 GLY A C   1 
ATOM   3700 O  O   . GLY A 1 454 ? 18.269  -8.484  -1.308  1.00 22.50 ? 455 GLY A O   1 
ATOM   3701 N  N   . THR A 1 455 ? 16.650  -9.906  -0.630  1.00 22.02 ? 456 THR A N   1 
ATOM   3702 C  CA  . THR A 1 455 ? 16.722  -9.561  0.774   1.00 21.16 ? 456 THR A CA  1 
ATOM   3703 C  C   . THR A 1 455 ? 17.064  -10.804 1.592   1.00 20.30 ? 456 THR A C   1 
ATOM   3704 O  O   . THR A 1 455 ? 16.588  -11.909 1.310   1.00 19.78 ? 456 THR A O   1 
ATOM   3705 C  CB  . THR A 1 455 ? 15.381  -8.956  1.217   1.00 21.09 ? 456 THR A CB  1 
ATOM   3706 O  OG1 . THR A 1 455 ? 15.136  -7.773  0.447   1.00 21.79 ? 456 THR A OG1 1 
ATOM   3707 C  CG2 . THR A 1 455 ? 15.375  -8.598  2.680   1.00 21.34 ? 456 THR A CG2 1 
ATOM   3708 N  N   . THR A 1 456 ? 17.916  -10.621 2.588   1.00 19.15 ? 457 THR A N   1 
ATOM   3709 C  CA  . THR A 1 456 ? 18.218  -11.696 3.511   1.00 18.97 ? 457 THR A CA  1 
ATOM   3710 C  C   . THR A 1 456 ? 17.913  -11.277 4.954   1.00 17.98 ? 457 THR A C   1 
ATOM   3711 O  O   . THR A 1 456 ? 18.081  -10.119 5.316   1.00 18.09 ? 457 THR A O   1 
ATOM   3712 C  CB  . THR A 1 456 ? 19.667  -12.223 3.348   1.00 18.64 ? 457 THR A CB  1 
ATOM   3713 O  OG1 . THR A 1 456 ? 19.851  -13.345 4.217   1.00 20.65 ? 457 THR A OG1 1 
ATOM   3714 C  CG2 . THR A 1 456 ? 20.688  -11.156 3.703   1.00 19.75 ? 457 THR A CG2 1 
ATOM   3715 N  N   . PHE A 1 457 ? 17.442  -12.220 5.758   1.00 17.25 ? 458 PHE A N   1 
ATOM   3716 C  CA  . PHE A 1 457 ? 17.124  -11.947 7.153   1.00 17.12 ? 458 PHE A CA  1 
ATOM   3717 C  C   . PHE A 1 457 ? 18.337  -12.249 8.035   1.00 17.37 ? 458 PHE A C   1 
ATOM   3718 O  O   . PHE A 1 457 ? 18.704  -13.414 8.229   1.00 17.71 ? 458 PHE A O   1 
ATOM   3719 C  CB  . PHE A 1 457 ? 15.885  -12.747 7.578   1.00 16.67 ? 458 PHE A CB  1 
ATOM   3720 C  CG  . PHE A 1 457 ? 15.569  -12.679 9.050   1.00 16.19 ? 458 PHE A CG  1 
ATOM   3721 C  CD1 . PHE A 1 457 ? 14.845  -11.611 9.583   1.00 15.32 ? 458 PHE A CD1 1 
ATOM   3722 C  CD2 . PHE A 1 457 ? 15.956  -13.712 9.900   1.00 15.24 ? 458 PHE A CD2 1 
ATOM   3723 C  CE1 . PHE A 1 457 ? 14.534  -11.569 10.951  1.00 15.14 ? 458 PHE A CE1 1 
ATOM   3724 C  CE2 . PHE A 1 457 ? 15.648  -13.678 11.264  1.00 14.84 ? 458 PHE A CE2 1 
ATOM   3725 C  CZ  . PHE A 1 457 ? 14.940  -12.612 11.789  1.00 14.28 ? 458 PHE A CZ  1 
ATOM   3726 N  N   . ASN A 1 458 ? 18.966  -11.179 8.524   1.00 17.52 ? 459 ASN A N   1 
ATOM   3727 C  CA  . ASN A 1 458 ? 20.054  -11.248 9.501   1.00 17.87 ? 459 ASN A CA  1 
ATOM   3728 C  C   . ASN A 1 458 ? 19.623  -10.544 10.773  1.00 17.64 ? 459 ASN A C   1 
ATOM   3729 O  O   . ASN A 1 458 ? 20.288  -9.615  11.238  1.00 17.43 ? 459 ASN A O   1 
ATOM   3730 C  CB  . ASN A 1 458 ? 21.319  -10.594 8.946   1.00 18.07 ? 459 ASN A CB  1 
ATOM   3731 C  CG  . ASN A 1 458 ? 22.013  -11.459 7.902   1.00 20.61 ? 459 ASN A CG  1 
ATOM   3732 O  OD1 . ASN A 1 458 ? 22.084  -12.686 8.031   1.00 22.55 ? 459 ASN A OD1 1 
ATOM   3733 N  ND2 . ASN A 1 458 ? 22.529  -10.820 6.862   1.00 22.15 ? 459 ASN A ND2 1 
ATOM   3734 N  N   . LEU A 1 459 ? 18.510  -11.017 11.335  1.00 17.70 ? 460 LEU A N   1 
ATOM   3735 C  CA  . LEU A 1 459 ? 17.763  -10.347 12.420  1.00 18.07 ? 460 LEU A CA  1 
ATOM   3736 C  C   . LEU A 1 459 ? 17.105  -9.064  11.901  1.00 18.32 ? 460 LEU A C   1 
ATOM   3737 O  O   . LEU A 1 459 ? 15.883  -8.932  11.939  1.00 18.36 ? 460 LEU A O   1 
ATOM   3738 C  CB  . LEU A 1 459 ? 18.593  -10.107 13.698  1.00 17.82 ? 460 LEU A CB  1 
ATOM   3739 C  CG  . LEU A 1 459 ? 17.698  -10.025 14.964  1.00 19.63 ? 460 LEU A CG  1 
ATOM   3740 C  CD1 . LEU A 1 459 ? 18.441  -10.394 16.189  1.00 21.95 ? 460 LEU A CD1 1 
ATOM   3741 C  CD2 . LEU A 1 459 ? 17.039  -8.668  15.183  1.00 17.36 ? 460 LEU A CD2 1 
ATOM   3742 N  N   . ILE A 1 460 ? 17.917  -8.125  11.424  1.00 18.43 ? 461 ILE A N   1 
ATOM   3743 C  CA  . ILE A 1 460 ? 17.403  -7.047  10.595  1.00 18.75 ? 461 ILE A CA  1 
ATOM   3744 C  C   . ILE A 1 460 ? 17.430  -7.533  9.149   1.00 18.85 ? 461 ILE A C   1 
ATOM   3745 O  O   . ILE A 1 460 ? 18.257  -8.386  8.785   1.00 18.77 ? 461 ILE A O   1 
ATOM   3746 C  CB  . ILE A 1 460 ? 18.226  -5.741  10.742  1.00 19.08 ? 461 ILE A CB  1 
ATOM   3747 C  CG1 . ILE A 1 460 ? 19.710  -6.008  10.494  1.00 19.40 ? 461 ILE A CG1 1 
ATOM   3748 C  CG2 . ILE A 1 460 ? 18.011  -5.113  12.127  1.00 18.24 ? 461 ILE A CG2 1 
ATOM   3749 C  CD1 . ILE A 1 460 ? 20.529  -4.756  10.366  1.00 22.23 ? 461 ILE A CD1 1 
ATOM   3750 N  N   . LEU A 1 461 ? 16.519  -7.020  8.330   1.00 18.72 ? 462 LEU A N   1 
ATOM   3751 C  CA  . LEU A 1 461 ? 16.518  -7.359  6.911   1.00 18.80 ? 462 LEU A CA  1 
ATOM   3752 C  C   . LEU A 1 461 ? 17.615  -6.566  6.205   1.00 18.95 ? 462 LEU A C   1 
ATOM   3753 O  O   . LEU A 1 461 ? 17.849  -5.400  6.528   1.00 18.28 ? 462 LEU A O   1 
ATOM   3754 C  CB  . LEU A 1 461 ? 15.141  -7.136  6.274   1.00 18.19 ? 462 LEU A CB  1 
ATOM   3755 C  CG  . LEU A 1 461 ? 14.020  -8.049  6.793   1.00 18.48 ? 462 LEU A CG  1 
ATOM   3756 C  CD1 . LEU A 1 461 ? 12.653  -7.527  6.382   1.00 17.31 ? 462 LEU A CD1 1 
ATOM   3757 C  CD2 . LEU A 1 461 ? 14.211  -9.509  6.349   1.00 17.60 ? 462 LEU A CD2 1 
ATOM   3758 N  N   . MET A 1 462 ? 18.296  -7.221  5.267   1.00 19.61 ? 463 MET A N   1 
ATOM   3759 C  CA  . MET A 1 462 ? 19.467  -6.653  4.595   1.00 20.80 ? 463 MET A CA  1 
ATOM   3760 C  C   . MET A 1 462 ? 19.521  -7.072  3.139   1.00 20.74 ? 463 MET A C   1 
ATOM   3761 O  O   . MET A 1 462 ? 18.992  -8.127  2.792   1.00 20.47 ? 463 MET A O   1 
ATOM   3762 C  CB  . MET A 1 462 ? 20.735  -7.169  5.257   1.00 21.34 ? 463 MET A CB  1 
ATOM   3763 C  CG  . MET A 1 462 ? 21.126  -6.440  6.513   1.00 24.43 ? 463 MET A CG  1 
ATOM   3764 S  SD  . MET A 1 462 ? 22.436  -7.359  7.307   1.00 30.47 ? 463 MET A SD  1 
ATOM   3765 C  CE  . MET A 1 462 ? 23.098  -6.054  8.341   1.00 30.43 ? 463 MET A CE  1 
ATOM   3766 N  N   . PRO A 1 463 ? 20.189  -6.264  2.283   1.00 20.94 ? 464 PRO A N   1 
ATOM   3767 C  CA  . PRO A 1 463 ? 20.456  -6.705  0.909   1.00 21.02 ? 464 PRO A CA  1 
ATOM   3768 C  C   . PRO A 1 463 ? 21.167  -8.048  0.930   1.00 21.45 ? 464 PRO A C   1 
ATOM   3769 O  O   . PRO A 1 463 ? 22.050  -8.264  1.759   1.00 21.30 ? 464 PRO A O   1 
ATOM   3770 C  CB  . PRO A 1 463 ? 21.376  -5.609  0.341   1.00 20.95 ? 464 PRO A CB  1 
ATOM   3771 C  CG  . PRO A 1 463 ? 21.854  -4.827  1.541   1.00 21.22 ? 464 PRO A CG  1 
ATOM   3772 C  CD  . PRO A 1 463 ? 20.743  -4.924  2.542   1.00 20.82 ? 464 PRO A CD  1 
ATOM   3773 N  N   . GLU A 1 464 ? 20.758  -8.938  0.032   1.00 21.72 ? 465 GLU A N   1 
ATOM   3774 C  CA  . GLU A 1 464 ? 21.272  -10.301 -0.029  1.00 22.56 ? 465 GLU A CA  1 
ATOM   3775 C  C   . GLU A 1 464 ? 22.684  -10.390 -0.624  1.00 22.00 ? 465 GLU A C   1 
ATOM   3776 O  O   . GLU A 1 464 ? 23.387  -11.361 -0.390  1.00 22.06 ? 465 GLU A O   1 
ATOM   3777 C  CB  . GLU A 1 464 ? 20.297  -11.178 -0.828  1.00 23.19 ? 465 GLU A CB  1 
ATOM   3778 C  CG  . GLU A 1 464 ? 20.577  -12.670 -0.760  1.00 27.31 ? 465 GLU A CG  1 
ATOM   3779 C  CD  . GLU A 1 464 ? 19.650  -13.486 -1.650  1.00 32.01 ? 465 GLU A CD  1 
ATOM   3780 O  OE1 . GLU A 1 464 ? 19.192  -12.958 -2.696  1.00 34.27 ? 465 GLU A OE1 1 
ATOM   3781 O  OE2 . GLU A 1 464 ? 19.382  -14.657 -1.298  1.00 33.31 ? 465 GLU A OE2 1 
ATOM   3782 N  N   . LYS A 1 465 ? 23.093  -9.376  -1.382  1.00 21.66 ? 466 LYS A N   1 
ATOM   3783 C  CA  . LYS A 1 465 ? 24.414  -9.351  -2.010  1.00 21.54 ? 466 LYS A CA  1 
ATOM   3784 C  C   . LYS A 1 465 ? 24.890  -7.897  -2.159  1.00 21.08 ? 466 LYS A C   1 
ATOM   3785 O  O   . LYS A 1 465 ? 24.080  -6.976  -2.070  1.00 20.49 ? 466 LYS A O   1 
ATOM   3786 C  CB  . LYS A 1 465 ? 24.375  -10.072 -3.367  1.00 21.44 ? 466 LYS A CB  1 
ATOM   3787 C  CG  . LYS A 1 465 ? 23.601  -9.328  -4.441  1.00 22.49 ? 466 LYS A CG  1 
ATOM   3788 C  CD  . LYS A 1 465 ? 23.244  -10.235 -5.601  1.00 24.58 ? 466 LYS A CD  1 
ATOM   3789 C  CE  . LYS A 1 465 ? 22.520  -9.450  -6.692  1.00 26.36 ? 466 LYS A CE  1 
ATOM   3790 N  NZ  . LYS A 1 465 ? 22.412  -10.229 -7.963  1.00 28.41 ? 466 LYS A NZ  1 
ATOM   3791 N  N   . PRO A 1 466 ? 26.204  -7.686  -2.375  1.00 20.85 ? 467 PRO A N   1 
ATOM   3792 C  CA  . PRO A 1 466 ? 26.723  -6.321  -2.507  1.00 20.55 ? 467 PRO A CA  1 
ATOM   3793 C  C   . PRO A 1 466 ? 26.096  -5.532  -3.658  1.00 20.62 ? 467 PRO A C   1 
ATOM   3794 O  O   . PRO A 1 466 ? 25.690  -6.114  -4.666  1.00 20.22 ? 467 PRO A O   1 
ATOM   3795 C  CB  . PRO A 1 466 ? 28.220  -6.537  -2.763  1.00 20.55 ? 467 PRO A CB  1 
ATOM   3796 C  CG  . PRO A 1 466 ? 28.520  -7.851  -2.123  1.00 20.30 ? 467 PRO A CG  1 
ATOM   3797 C  CD  . PRO A 1 466 ? 27.293  -8.684  -2.362  1.00 21.06 ? 467 PRO A CD  1 
ATOM   3798 N  N   . ILE A 1 467 ? 26.016  -4.216  -3.478  1.00 20.88 ? 468 ILE A N   1 
ATOM   3799 C  CA  . ILE A 1 467 ? 25.531  -3.290  -4.495  1.00 21.23 ? 468 ILE A CA  1 
ATOM   3800 C  C   . ILE A 1 467 ? 26.658  -2.311  -4.816  1.00 21.29 ? 468 ILE A C   1 
ATOM   3801 O  O   . ILE A 1 467 ? 27.152  -1.621  -3.931  1.00 20.97 ? 468 ILE A O   1 
ATOM   3802 C  CB  . ILE A 1 467 ? 24.309  -2.473  -3.992  1.00 21.35 ? 468 ILE A CB  1 
ATOM   3803 C  CG1 . ILE A 1 467 ? 23.143  -3.391  -3.605  1.00 21.64 ? 468 ILE A CG1 1 
ATOM   3804 C  CG2 . ILE A 1 467 ? 23.878  -1.428  -5.037  1.00 21.85 ? 468 ILE A CG2 1 
ATOM   3805 C  CD1 . ILE A 1 467 ? 22.040  -2.693  -2.811  1.00 22.47 ? 468 ILE A CD1 1 
ATOM   3806 N  N   . SER A 1 468 ? 27.062  -2.249  -6.081  1.00 21.60 ? 469 SER A N   1 
ATOM   3807 C  CA  . SER A 1 468 ? 28.145  -1.347  -6.473  1.00 22.11 ? 469 SER A CA  1 
ATOM   3808 C  C   . SER A 1 468 ? 27.608  -0.128  -7.230  1.00 21.62 ? 469 SER A C   1 
ATOM   3809 O  O   . SER A 1 468 ? 27.070  -0.259  -8.330  1.00 21.82 ? 469 SER A O   1 
ATOM   3810 C  CB  . SER A 1 468 ? 29.200  -2.097  -7.297  1.00 22.26 ? 469 SER A CB  1 
ATOM   3811 O  OG  . SER A 1 468 ? 30.314  -1.257  -7.553  1.00 24.61 ? 469 SER A OG  1 
ATOM   3812 N  N   . PHE A 1 469 ? 27.740  1.051   -6.629  1.00 21.14 ? 470 PHE A N   1 
ATOM   3813 C  CA  . PHE A 1 469 ? 27.217  2.294   -7.218  1.00 20.42 ? 470 PHE A CA  1 
ATOM   3814 C  C   . PHE A 1 469 ? 28.271  3.013   -8.036  1.00 20.74 ? 470 PHE A C   1 
ATOM   3815 O  O   . PHE A 1 469 ? 29.462  2.872   -7.770  1.00 20.71 ? 470 PHE A O   1 
ATOM   3816 C  CB  . PHE A 1 469 ? 26.760  3.269   -6.128  1.00 20.20 ? 470 PHE A CB  1 
ATOM   3817 C  CG  . PHE A 1 469 ? 25.593  2.789   -5.317  1.00 19.34 ? 470 PHE A CG  1 
ATOM   3818 C  CD1 . PHE A 1 469 ? 25.786  2.302   -4.032  1.00 18.47 ? 470 PHE A CD1 1 
ATOM   3819 C  CD2 . PHE A 1 469 ? 24.299  2.840   -5.834  1.00 18.21 ? 470 PHE A CD2 1 
ATOM   3820 C  CE1 . PHE A 1 469 ? 24.706  1.861   -3.264  1.00 19.52 ? 470 PHE A CE1 1 
ATOM   3821 C  CE2 . PHE A 1 469 ? 23.216  2.407   -5.086  1.00 18.32 ? 470 PHE A CE2 1 
ATOM   3822 C  CZ  . PHE A 1 469 ? 23.417  1.914   -3.790  1.00 19.14 ? 470 PHE A CZ  1 
ATOM   3823 N  N   . THR A 1 470 ? 27.813  3.802   -9.009  1.00 20.82 ? 471 THR A N   1 
ATOM   3824 C  CA  . THR A 1 470 ? 28.633  4.788   -9.698  1.00 20.93 ? 471 THR A CA  1 
ATOM   3825 C  C   . THR A 1 470 ? 28.075  6.177   -9.389  1.00 21.00 ? 471 THR A C   1 
ATOM   3826 O  O   . THR A 1 470 ? 26.868  6.424   -9.539  1.00 20.99 ? 471 THR A O   1 
ATOM   3827 C  CB  . THR A 1 470 ? 28.683  4.554   -11.233 1.00 20.90 ? 471 THR A CB  1 
ATOM   3828 O  OG1 . THR A 1 470 ? 29.295  3.286   -11.506 1.00 21.28 ? 471 THR A OG1 1 
ATOM   3829 C  CG2 . THR A 1 470 ? 29.488  5.656   -11.927 1.00 20.66 ? 471 THR A CG2 1 
ATOM   3830 N  N   . PHE A 1 471 ? 28.963  7.064   -8.942  1.00 20.94 ? 472 PHE A N   1 
ATOM   3831 C  CA  . PHE A 1 471 ? 28.623  8.444   -8.604  1.00 21.52 ? 472 PHE A CA  1 
ATOM   3832 C  C   . PHE A 1 471 ? 29.272  9.412   -9.596  1.00 22.15 ? 472 PHE A C   1 
ATOM   3833 O  O   . PHE A 1 471 ? 30.476  9.330   -9.849  1.00 21.66 ? 472 PHE A O   1 
ATOM   3834 C  CB  . PHE A 1 471 ? 29.086  8.782   -7.181  1.00 21.20 ? 472 PHE A CB  1 
ATOM   3835 C  CG  . PHE A 1 471 ? 28.425  7.958   -6.114  1.00 21.52 ? 472 PHE A CG  1 
ATOM   3836 C  CD1 . PHE A 1 471 ? 29.026  6.798   -5.639  1.00 20.34 ? 472 PHE A CD1 1 
ATOM   3837 C  CD2 . PHE A 1 471 ? 27.191  8.337   -5.584  1.00 22.04 ? 472 PHE A CD2 1 
ATOM   3838 C  CE1 . PHE A 1 471 ? 28.409  6.030   -4.646  1.00 21.33 ? 472 PHE A CE1 1 
ATOM   3839 C  CE2 . PHE A 1 471 ? 26.568  7.563   -4.595  1.00 21.23 ? 472 PHE A CE2 1 
ATOM   3840 C  CZ  . PHE A 1 471 ? 27.179  6.411   -4.129  1.00 19.77 ? 472 PHE A CZ  1 
ATOM   3841 N  N   . TRP A 1 472 ? 28.463  10.311  -10.160 1.00 22.83 ? 473 TRP A N   1 
ATOM   3842 C  CA  . TRP A 1 472 ? 28.960  11.386  -11.021 1.00 23.99 ? 473 TRP A CA  1 
ATOM   3843 C  C   . TRP A 1 472 ? 28.728  12.723  -10.313 1.00 24.55 ? 473 TRP A C   1 
ATOM   3844 O  O   . TRP A 1 472 ? 27.636  12.949  -9.795  1.00 24.15 ? 473 TRP A O   1 
ATOM   3845 C  CB  . TRP A 1 472 ? 28.222  11.397  -12.370 1.00 23.87 ? 473 TRP A CB  1 
ATOM   3846 C  CG  . TRP A 1 472 ? 28.209  10.087  -13.100 1.00 25.12 ? 473 TRP A CG  1 
ATOM   3847 C  CD1 . TRP A 1 472 ? 27.386  9.026   -12.863 1.00 25.65 ? 473 TRP A CD1 1 
ATOM   3848 C  CD2 . TRP A 1 472 ? 29.052  9.706   -14.195 1.00 26.67 ? 473 TRP A CD2 1 
ATOM   3849 N  NE1 . TRP A 1 472 ? 27.666  8.004   -13.737 1.00 27.78 ? 473 TRP A NE1 1 
ATOM   3850 C  CE2 . TRP A 1 472 ? 28.685  8.395   -14.566 1.00 27.74 ? 473 TRP A CE2 1 
ATOM   3851 C  CE3 . TRP A 1 472 ? 30.081  10.346  -14.898 1.00 27.77 ? 473 TRP A CE3 1 
ATOM   3852 C  CZ2 . TRP A 1 472 ? 29.313  7.706   -15.611 1.00 28.78 ? 473 TRP A CZ2 1 
ATOM   3853 C  CZ3 . TRP A 1 472 ? 30.709  9.662   -15.938 1.00 28.77 ? 473 TRP A CZ3 1 
ATOM   3854 C  CH2 . TRP A 1 472 ? 30.322  8.356   -16.283 1.00 28.97 ? 473 TRP A CH2 1 
ATOM   3855 N  N   . PRO A 1 473 ? 29.741  13.615  -10.295 1.00 25.58 ? 474 PRO A N   1 
ATOM   3856 C  CA  . PRO A 1 473 ? 29.539  14.950  -9.707  1.00 26.63 ? 474 PRO A CA  1 
ATOM   3857 C  C   . PRO A 1 473 ? 28.469  15.700  -10.505 1.00 27.68 ? 474 PRO A C   1 
ATOM   3858 O  O   . PRO A 1 473 ? 28.436  15.592  -11.731 1.00 28.01 ? 474 PRO A O   1 
ATOM   3859 C  CB  . PRO A 1 473 ? 30.905  15.633  -9.862  1.00 26.79 ? 474 PRO A CB  1 
ATOM   3860 C  CG  . PRO A 1 473 ? 31.852  14.593  -10.367 1.00 25.85 ? 474 PRO A CG  1 
ATOM   3861 C  CD  . PRO A 1 473 ? 31.046  13.494  -10.969 1.00 25.78 ? 474 PRO A CD  1 
ATOM   3862 N  N   . PHE A 1 474 ? 27.575  16.405  -9.815  1.00 28.90 ? 475 PHE A N   1 
ATOM   3863 C  CA  . PHE A 1 474 ? 26.425  17.046  -10.469 1.00 29.95 ? 475 PHE A CA  1 
ATOM   3864 C  C   . PHE A 1 474 ? 26.616  18.553  -10.593 1.00 30.16 ? 475 PHE A C   1 
ATOM   3865 O  O   . PHE A 1 474 ? 27.297  19.169  -9.767  1.00 30.74 ? 475 PHE A O   1 
ATOM   3866 C  CB  . PHE A 1 474 ? 25.116  16.712  -9.729  1.00 30.17 ? 475 PHE A CB  1 
ATOM   3867 C  CG  . PHE A 1 474 ? 23.949  17.584  -10.125 1.00 31.65 ? 475 PHE A CG  1 
ATOM   3868 C  CD1 . PHE A 1 474 ? 23.269  17.366  -11.321 1.00 32.70 ? 475 PHE A CD1 1 
ATOM   3869 C  CD2 . PHE A 1 474 ? 23.532  18.632  -9.300  1.00 32.95 ? 475 PHE A CD2 1 
ATOM   3870 C  CE1 . PHE A 1 474 ? 22.187  18.179  -11.687 1.00 32.76 ? 475 PHE A CE1 1 
ATOM   3871 C  CE2 . PHE A 1 474 ? 22.459  19.447  -9.659  1.00 32.96 ? 475 PHE A CE2 1 
ATOM   3872 C  CZ  . PHE A 1 474 ? 21.786  19.220  -10.854 1.00 33.04 ? 475 PHE A CZ  1 
ATOM   3873 N  N   . PRO B 1 5   ? 71.938  14.694  -55.673 1.00 40.61 ? 6   PRO B N   1 
ATOM   3874 C  CA  . PRO B 1 5   ? 71.047  14.739  -54.512 1.00 40.31 ? 6   PRO B CA  1 
ATOM   3875 C  C   . PRO B 1 5   ? 71.063  16.116  -53.863 1.00 40.19 ? 6   PRO B C   1 
ATOM   3876 O  O   . PRO B 1 5   ? 72.109  16.772  -53.828 1.00 40.30 ? 6   PRO B O   1 
ATOM   3877 C  CB  . PRO B 1 5   ? 71.643  13.694  -53.556 1.00 40.32 ? 6   PRO B CB  1 
ATOM   3878 C  CG  . PRO B 1 5   ? 72.677  12.943  -54.360 1.00 40.63 ? 6   PRO B CG  1 
ATOM   3879 C  CD  . PRO B 1 5   ? 73.148  13.901  -55.405 1.00 40.58 ? 6   PRO B CD  1 
ATOM   3880 N  N   . ARG B 1 6   ? 69.910  16.549  -53.356 1.00 39.79 ? 7   ARG B N   1 
ATOM   3881 C  CA  . ARG B 1 6   ? 69.789  17.873  -52.755 1.00 39.32 ? 7   ARG B CA  1 
ATOM   3882 C  C   . ARG B 1 6   ? 70.523  17.946  -51.414 1.00 38.83 ? 7   ARG B C   1 
ATOM   3883 O  O   . ARG B 1 6   ? 70.648  16.931  -50.721 1.00 38.83 ? 7   ARG B O   1 
ATOM   3884 C  CB  . ARG B 1 6   ? 68.320  18.281  -52.611 1.00 39.47 ? 7   ARG B CB  1 
ATOM   3885 C  CG  . ARG B 1 6   ? 67.591  18.445  -53.941 1.00 40.22 ? 7   ARG B CG  1 
ATOM   3886 C  CD  . ARG B 1 6   ? 66.644  17.288  -54.197 1.00 41.90 ? 7   ARG B CD  1 
ATOM   3887 N  NE  . ARG B 1 6   ? 65.247  17.642  -53.927 1.00 42.89 ? 7   ARG B NE  1 
ATOM   3888 C  CZ  . ARG B 1 6   ? 64.341  16.816  -53.397 1.00 43.02 ? 7   ARG B CZ  1 
ATOM   3889 N  NH1 . ARG B 1 6   ? 64.676  15.581  -53.032 1.00 42.56 ? 7   ARG B NH1 1 
ATOM   3890 N  NH2 . ARG B 1 6   ? 63.097  17.232  -53.209 1.00 42.61 ? 7   ARG B NH2 1 
ATOM   3891 N  N   . PRO B 1 7   ? 71.049  19.138  -51.063 1.00 38.27 ? 8   PRO B N   1 
ATOM   3892 C  CA  . PRO B 1 7   ? 71.743  19.295  -49.778 1.00 37.64 ? 8   PRO B CA  1 
ATOM   3893 C  C   . PRO B 1 7   ? 70.794  19.213  -48.579 1.00 36.95 ? 8   PRO B C   1 
ATOM   3894 O  O   . PRO B 1 7   ? 69.587  19.424  -48.726 1.00 36.83 ? 8   PRO B O   1 
ATOM   3895 C  CB  . PRO B 1 7   ? 72.363  20.699  -49.871 1.00 37.72 ? 8   PRO B CB  1 
ATOM   3896 C  CG  . PRO B 1 7   ? 71.605  21.402  -50.942 1.00 37.98 ? 8   PRO B CG  1 
ATOM   3897 C  CD  . PRO B 1 7   ? 71.168  20.345  -51.908 1.00 38.22 ? 8   PRO B CD  1 
ATOM   3898 N  N   . PHE B 1 8   ? 71.363  18.905  -47.415 1.00 35.94 ? 9   PHE B N   1 
ATOM   3899 C  CA  . PHE B 1 8   ? 70.641  18.781  -46.149 1.00 35.22 ? 9   PHE B CA  1 
ATOM   3900 C  C   . PHE B 1 8   ? 69.670  19.938  -45.882 1.00 34.72 ? 9   PHE B C   1 
ATOM   3901 O  O   . PHE B 1 8   ? 68.527  19.712  -45.467 1.00 34.60 ? 9   PHE B O   1 
ATOM   3902 C  CB  . PHE B 1 8   ? 71.657  18.637  -45.007 1.00 35.19 ? 9   PHE B CB  1 
ATOM   3903 C  CG  . PHE B 1 8   ? 71.047  18.560  -43.640 1.00 35.60 ? 9   PHE B CG  1 
ATOM   3904 C  CD1 . PHE B 1 8   ? 70.555  17.352  -43.148 1.00 35.85 ? 9   PHE B CD1 1 
ATOM   3905 C  CD2 . PHE B 1 8   ? 70.995  19.690  -42.826 1.00 36.31 ? 9   PHE B CD2 1 
ATOM   3906 C  CE1 . PHE B 1 8   ? 70.001  17.274  -41.871 1.00 35.74 ? 9   PHE B CE1 1 
ATOM   3907 C  CE2 . PHE B 1 8   ? 70.441  19.626  -41.547 1.00 36.62 ? 9   PHE B CE2 1 
ATOM   3908 C  CZ  . PHE B 1 8   ? 69.941  18.409  -41.071 1.00 36.69 ? 9   PHE B CZ  1 
ATOM   3909 N  N   . ASN B 1 9   ? 70.122  21.165  -46.138 1.00 33.95 ? 10  ASN B N   1 
ATOM   3910 C  CA  . ASN B 1 9   ? 69.324  22.371  -45.884 1.00 33.14 ? 10  ASN B CA  1 
ATOM   3911 C  C   . ASN B 1 9   ? 68.033  22.492  -46.703 1.00 32.39 ? 10  ASN B C   1 
ATOM   3912 O  O   . ASN B 1 9   ? 67.185  23.328  -46.391 1.00 32.50 ? 10  ASN B O   1 
ATOM   3913 C  CB  . ASN B 1 9   ? 70.175  23.633  -46.054 1.00 33.32 ? 10  ASN B CB  1 
ATOM   3914 C  CG  . ASN B 1 9   ? 70.732  23.773  -47.455 1.00 34.31 ? 10  ASN B CG  1 
ATOM   3915 O  OD1 . ASN B 1 9   ? 71.789  23.232  -47.769 1.00 36.01 ? 10  ASN B OD1 1 
ATOM   3916 N  ND2 . ASN B 1 9   ? 70.021  24.503  -48.307 1.00 35.80 ? 10  ASN B ND2 1 
ATOM   3917 N  N   . GLU B 1 10  ? 67.878  21.665  -47.737 1.00 31.33 ? 11  GLU B N   1 
ATOM   3918 C  CA  . GLU B 1 10  ? 66.663  21.708  -48.563 1.00 30.48 ? 11  GLU B CA  1 
ATOM   3919 C  C   . GLU B 1 10  ? 65.533  20.814  -48.039 1.00 29.46 ? 11  GLU B C   1 
ATOM   3920 O  O   . GLU B 1 10  ? 64.392  20.931  -48.474 1.00 29.00 ? 11  GLU B O   1 
ATOM   3921 C  CB  . GLU B 1 10  ? 66.974  21.457  -50.045 1.00 30.57 ? 11  GLU B CB  1 
ATOM   3922 C  CG  . GLU B 1 10  ? 67.489  22.725  -50.742 1.00 31.82 ? 11  GLU B CG  1 
ATOM   3923 C  CD  . GLU B 1 10  ? 67.892  22.534  -52.199 1.00 33.87 ? 11  GLU B CD  1 
ATOM   3924 O  OE1 . GLU B 1 10  ? 67.413  21.584  -52.862 1.00 34.24 ? 11  GLU B OE1 1 
ATOM   3925 O  OE2 . GLU B 1 10  ? 68.696  23.360  -52.689 1.00 35.11 ? 11  GLU B OE2 1 
ATOM   3926 N  N   . ILE B 1 11  ? 65.856  19.946  -47.084 1.00 28.61 ? 12  ILE B N   1 
ATOM   3927 C  CA  . ILE B 1 11  ? 64.843  19.180  -46.362 1.00 27.42 ? 12  ILE B CA  1 
ATOM   3928 C  C   . ILE B 1 11  ? 63.878  20.172  -45.714 1.00 27.15 ? 12  ILE B C   1 
ATOM   3929 O  O   . ILE B 1 11  ? 64.313  21.088  -45.020 1.00 27.43 ? 12  ILE B O   1 
ATOM   3930 C  CB  . ILE B 1 11  ? 65.492  18.227  -45.319 1.00 27.20 ? 12  ILE B CB  1 
ATOM   3931 C  CG1 . ILE B 1 11  ? 66.340  17.178  -46.040 1.00 26.34 ? 12  ILE B CG1 1 
ATOM   3932 C  CG2 . ILE B 1 11  ? 64.426  17.554  -44.432 1.00 26.58 ? 12  ILE B CG2 1 
ATOM   3933 C  CD1 . ILE B 1 11  ? 67.178  16.277  -45.151 1.00 26.18 ? 12  ILE B CD1 1 
ATOM   3934 N  N   . PRO B 1 12  ? 62.568  20.019  -45.969 1.00 26.88 ? 13  PRO B N   1 
ATOM   3935 C  CA  . PRO B 1 12  ? 61.578  20.914  -45.375 1.00 26.79 ? 13  PRO B CA  1 
ATOM   3936 C  C   . PRO B 1 12  ? 61.710  20.968  -43.850 1.00 26.79 ? 13  PRO B C   1 
ATOM   3937 O  O   . PRO B 1 12  ? 62.077  19.965  -43.221 1.00 26.20 ? 13  PRO B O   1 
ATOM   3938 C  CB  . PRO B 1 12  ? 60.244  20.272  -45.772 1.00 26.77 ? 13  PRO B CB  1 
ATOM   3939 C  CG  . PRO B 1 12  ? 60.537  19.527  -46.995 1.00 26.51 ? 13  PRO B CG  1 
ATOM   3940 C  CD  . PRO B 1 12  ? 61.937  19.012  -46.844 1.00 27.06 ? 13  PRO B CD  1 
ATOM   3941 N  N   . SER B 1 13  ? 61.425  22.138  -43.279 1.00 26.96 ? 14  SER B N   1 
ATOM   3942 C  CA  . SER B 1 13  ? 61.587  22.374  -41.848 1.00 27.57 ? 14  SER B CA  1 
ATOM   3943 C  C   . SER B 1 13  ? 60.872  23.650  -41.392 1.00 27.56 ? 14  SER B C   1 
ATOM   3944 O  O   . SER B 1 13  ? 60.744  24.589  -42.169 1.00 27.74 ? 14  SER B O   1 
ATOM   3945 C  CB  . SER B 1 13  ? 63.078  22.451  -41.495 1.00 27.51 ? 14  SER B CB  1 
ATOM   3946 O  OG  . SER B 1 13  ? 63.490  23.761  -41.175 1.00 29.39 ? 14  SER B OG  1 
ATOM   3947 N  N   . PRO B 1 14  ? 60.429  23.700  -40.120 1.00 27.94 ? 15  PRO B N   1 
ATOM   3948 C  CA  . PRO B 1 14  ? 59.835  24.935  -39.568 1.00 28.02 ? 15  PRO B CA  1 
ATOM   3949 C  C   . PRO B 1 14  ? 60.796  26.124  -39.497 1.00 28.04 ? 15  PRO B C   1 
ATOM   3950 O  O   . PRO B 1 14  ? 60.349  27.246  -39.274 1.00 28.99 ? 15  PRO B O   1 
ATOM   3951 C  CB  . PRO B 1 14  ? 59.430  24.524  -38.148 1.00 28.10 ? 15  PRO B CB  1 
ATOM   3952 C  CG  . PRO B 1 14  ? 60.306  23.350  -37.830 1.00 27.83 ? 15  PRO B CG  1 
ATOM   3953 C  CD  . PRO B 1 14  ? 60.420  22.610  -39.126 1.00 27.67 ? 15  PRO B CD  1 
ATOM   3954 N  N   . GLY B 1 15  ? 62.092  25.883  -39.680 1.00 27.62 ? 16  GLY B N   1 
ATOM   3955 C  CA  . GLY B 1 15  ? 63.110  26.928  -39.546 1.00 27.09 ? 16  GLY B CA  1 
ATOM   3956 C  C   . GLY B 1 15  ? 64.280  26.477  -38.684 1.00 26.73 ? 16  GLY B C   1 
ATOM   3957 O  O   . GLY B 1 15  ? 64.216  25.423  -38.047 1.00 26.58 ? 16  GLY B O   1 
ATOM   3958 N  N   . ASP B 1 16  ? 65.335  27.288  -38.644 1.00 26.32 ? 17  ASP B N   1 
ATOM   3959 C  CA  . ASP B 1 16  ? 66.596  26.916  -37.999 1.00 26.49 ? 17  ASP B CA  1 
ATOM   3960 C  C   . ASP B 1 16  ? 66.704  27.296  -36.523 1.00 25.80 ? 17  ASP B C   1 
ATOM   3961 O  O   . ASP B 1 16  ? 67.635  26.876  -35.842 1.00 25.81 ? 17  ASP B O   1 
ATOM   3962 C  CB  . ASP B 1 16  ? 67.779  27.516  -38.764 1.00 27.34 ? 17  ASP B CB  1 
ATOM   3963 C  CG  . ASP B 1 16  ? 67.998  26.858  -40.120 1.00 29.73 ? 17  ASP B CG  1 
ATOM   3964 O  OD1 . ASP B 1 16  ? 67.381  25.802  -40.397 1.00 31.93 ? 17  ASP B OD1 1 
ATOM   3965 O  OD2 . ASP B 1 16  ? 68.801  27.400  -40.909 1.00 33.35 ? 17  ASP B OD2 1 
ATOM   3966 N  N   . ASN B 1 17  ? 65.766  28.097  -36.033 1.00 24.81 ? 18  ASN B N   1 
ATOM   3967 C  CA  . ASN B 1 17  ? 65.800  28.518  -34.642 1.00 24.10 ? 18  ASN B CA  1 
ATOM   3968 C  C   . ASN B 1 17  ? 65.134  27.478  -33.735 1.00 23.16 ? 18  ASN B C   1 
ATOM   3969 O  O   . ASN B 1 17  ? 63.911  27.430  -33.614 1.00 22.93 ? 18  ASN B O   1 
ATOM   3970 C  CB  . ASN B 1 17  ? 65.179  29.915  -34.486 1.00 24.10 ? 18  ASN B CB  1 
ATOM   3971 C  CG  . ASN B 1 17  ? 65.395  30.501  -33.105 1.00 24.63 ? 18  ASN B CG  1 
ATOM   3972 O  OD1 . ASN B 1 17  ? 65.514  29.775  -32.114 1.00 24.41 ? 18  ASN B OD1 1 
ATOM   3973 N  ND2 . ASN B 1 17  ? 65.444  31.826  -33.030 1.00 25.78 ? 18  ASN B ND2 1 
ATOM   3974 N  N   . GLY B 1 18  ? 65.961  26.643  -33.110 1.00 22.72 ? 19  GLY B N   1 
ATOM   3975 C  CA  . GLY B 1 18  ? 65.495  25.586  -32.208 1.00 21.92 ? 19  GLY B CA  1 
ATOM   3976 C  C   . GLY B 1 18  ? 64.636  26.060  -31.047 1.00 21.66 ? 19  GLY B C   1 
ATOM   3977 O  O   . GLY B 1 18  ? 63.742  25.334  -30.593 1.00 21.51 ? 19  GLY B O   1 
ATOM   3978 N  N   . TRP B 1 19  ? 64.901  27.277  -30.570 1.00 20.92 ? 20  TRP B N   1 
ATOM   3979 C  CA  . TRP B 1 19  ? 64.177  27.832  -29.425 1.00 20.81 ? 20  TRP B CA  1 
ATOM   3980 C  C   . TRP B 1 19  ? 62.806  28.350  -29.822 1.00 20.10 ? 20  TRP B C   1 
ATOM   3981 O  O   . TRP B 1 19  ? 61.840  28.162  -29.095 1.00 19.63 ? 20  TRP B O   1 
ATOM   3982 C  CB  . TRP B 1 19  ? 65.000  28.921  -28.726 1.00 20.72 ? 20  TRP B CB  1 
ATOM   3983 C  CG  . TRP B 1 19  ? 66.321  28.408  -28.303 1.00 22.25 ? 20  TRP B CG  1 
ATOM   3984 C  CD1 . TRP B 1 19  ? 67.542  28.772  -28.800 1.00 22.97 ? 20  TRP B CD1 1 
ATOM   3985 C  CD2 . TRP B 1 19  ? 66.572  27.399  -27.316 1.00 22.38 ? 20  TRP B CD2 1 
ATOM   3986 N  NE1 . TRP B 1 19  ? 68.534  28.059  -28.175 1.00 23.80 ? 20  TRP B NE1 1 
ATOM   3987 C  CE2 . TRP B 1 19  ? 67.966  27.209  -27.262 1.00 23.08 ? 20  TRP B CE2 1 
ATOM   3988 C  CE3 . TRP B 1 19  ? 65.751  26.639  -26.472 1.00 23.36 ? 20  TRP B CE3 1 
ATOM   3989 C  CZ2 . TRP B 1 19  ? 68.563  26.288  -26.398 1.00 24.48 ? 20  TRP B CZ2 1 
ATOM   3990 C  CZ3 . TRP B 1 19  ? 66.344  25.718  -25.613 1.00 23.47 ? 20  TRP B CZ3 1 
ATOM   3991 C  CH2 . TRP B 1 19  ? 67.735  25.554  -25.582 1.00 24.02 ? 20  TRP B CH2 1 
ATOM   3992 N  N   . LEU B 1 20  ? 62.736  28.999  -30.980 1.00 20.18 ? 21  LEU B N   1 
ATOM   3993 C  CA  . LEU B 1 20  ? 61.456  29.420  -31.558 1.00 20.17 ? 21  LEU B CA  1 
ATOM   3994 C  C   . LEU B 1 20  ? 60.589  28.203  -31.908 1.00 19.37 ? 21  LEU B C   1 
ATOM   3995 O  O   . LEU B 1 20  ? 59.377  28.209  -31.670 1.00 19.45 ? 21  LEU B O   1 
ATOM   3996 C  CB  . LEU B 1 20  ? 61.685  30.315  -32.790 1.00 20.11 ? 21  LEU B CB  1 
ATOM   3997 C  CG  . LEU B 1 20  ? 60.504  31.042  -33.452 1.00 21.42 ? 21  LEU B CG  1 
ATOM   3998 C  CD1 . LEU B 1 20  ? 59.675  31.916  -32.473 1.00 21.09 ? 21  LEU B CD1 1 
ATOM   3999 C  CD2 . LEU B 1 20  ? 61.018  31.884  -34.614 1.00 21.74 ? 21  LEU B CD2 1 
ATOM   4000 N  N   . ASN B 1 21  ? 61.213  27.164  -32.452 1.00 18.73 ? 22  ASN B N   1 
ATOM   4001 C  CA  . ASN B 1 21  ? 60.500  25.911  -32.760 1.00 18.51 ? 22  ASN B CA  1 
ATOM   4002 C  C   . ASN B 1 21  ? 59.915  25.258  -31.517 1.00 18.57 ? 22  ASN B C   1 
ATOM   4003 O  O   . ASN B 1 21  ? 58.765  24.806  -31.521 1.00 18.21 ? 22  ASN B O   1 
ATOM   4004 C  CB  . ASN B 1 21  ? 61.413  24.926  -33.493 1.00 18.31 ? 22  ASN B CB  1 
ATOM   4005 C  CG  . ASN B 1 21  ? 61.783  25.404  -34.879 1.00 18.01 ? 22  ASN B CG  1 
ATOM   4006 O  OD1 . ASN B 1 21  ? 61.041  26.158  -35.497 1.00 19.61 ? 22  ASN B OD1 1 
ATOM   4007 N  ND2 . ASN B 1 21  ? 62.935  24.978  -35.369 1.00 16.29 ? 22  ASN B ND2 1 
ATOM   4008 N  N   . LEU B 1 22  ? 60.712  25.229  -30.450 1.00 18.79 ? 23  LEU B N   1 
ATOM   4009 C  CA  . LEU B 1 22  ? 60.285  24.676  -29.173 1.00 19.29 ? 23  LEU B CA  1 
ATOM   4010 C  C   . LEU B 1 22  ? 59.102  25.465  -28.612 1.00 19.72 ? 23  LEU B C   1 
ATOM   4011 O  O   . LEU B 1 22  ? 58.138  24.886  -28.098 1.00 19.83 ? 23  LEU B O   1 
ATOM   4012 C  CB  . LEU B 1 22  ? 61.446  24.674  -28.178 1.00 18.90 ? 23  LEU B CB  1 
ATOM   4013 C  CG  . LEU B 1 22  ? 61.269  23.887  -26.879 1.00 19.36 ? 23  LEU B CG  1 
ATOM   4014 C  CD1 . LEU B 1 22  ? 60.869  22.425  -27.137 1.00 18.67 ? 23  LEU B CD1 1 
ATOM   4015 C  CD2 . LEU B 1 22  ? 62.550  23.951  -26.061 1.00 18.75 ? 23  LEU B CD2 1 
ATOM   4016 N  N   . TYR B 1 23  ? 59.186  26.788  -28.729 1.00 20.01 ? 24  TYR B N   1 
ATOM   4017 C  CA  . TYR B 1 23  ? 58.112  27.672  -28.307 1.00 20.59 ? 24  TYR B CA  1 
ATOM   4018 C  C   . TYR B 1 23  ? 56.785  27.364  -29.014 1.00 20.23 ? 24  TYR B C   1 
ATOM   4019 O  O   . TYR B 1 23  ? 55.756  27.252  -28.366 1.00 20.29 ? 24  TYR B O   1 
ATOM   4020 C  CB  . TYR B 1 23  ? 58.527  29.139  -28.499 1.00 21.02 ? 24  TYR B CB  1 
ATOM   4021 C  CG  . TYR B 1 23  ? 57.406  30.127  -28.290 1.00 22.90 ? 24  TYR B CG  1 
ATOM   4022 C  CD1 . TYR B 1 23  ? 56.988  30.478  -27.005 1.00 25.56 ? 24  TYR B CD1 1 
ATOM   4023 C  CD2 . TYR B 1 23  ? 56.762  30.708  -29.376 1.00 25.43 ? 24  TYR B CD2 1 
ATOM   4024 C  CE1 . TYR B 1 23  ? 55.952  31.387  -26.806 1.00 27.22 ? 24  TYR B CE1 1 
ATOM   4025 C  CE2 . TYR B 1 23  ? 55.722  31.615  -29.193 1.00 28.41 ? 24  TYR B CE2 1 
ATOM   4026 C  CZ  . TYR B 1 23  ? 55.330  31.952  -27.906 1.00 28.97 ? 24  TYR B CZ  1 
ATOM   4027 O  OH  . TYR B 1 23  ? 54.306  32.845  -27.730 1.00 31.99 ? 24  TYR B OH  1 
ATOM   4028 N  N   . HIS B 1 24  ? 56.809  27.229  -30.335 1.00 20.48 ? 25  HIS B N   1 
ATOM   4029 C  CA  . HIS B 1 24  ? 55.581  26.929  -31.079 1.00 20.85 ? 25  HIS B CA  1 
ATOM   4030 C  C   . HIS B 1 24  ? 55.043  25.527  -30.776 1.00 20.43 ? 25  HIS B C   1 
ATOM   4031 O  O   . HIS B 1 24  ? 53.833  25.342  -30.694 1.00 20.16 ? 25  HIS B O   1 
ATOM   4032 C  CB  . HIS B 1 24  ? 55.779  27.113  -32.583 1.00 21.12 ? 25  HIS B CB  1 
ATOM   4033 C  CG  . HIS B 1 24  ? 55.940  28.540  -32.995 1.00 22.86 ? 25  HIS B CG  1 
ATOM   4034 N  ND1 . HIS B 1 24  ? 55.068  29.533  -32.596 1.00 24.64 ? 25  HIS B ND1 1 
ATOM   4035 C  CD2 . HIS B 1 24  ? 56.860  29.141  -33.786 1.00 23.07 ? 25  HIS B CD2 1 
ATOM   4036 C  CE1 . HIS B 1 24  ? 55.457  30.685  -33.110 1.00 24.78 ? 25  HIS B CE1 1 
ATOM   4037 N  NE2 . HIS B 1 24  ? 56.538  30.474  -33.839 1.00 23.66 ? 25  HIS B NE2 1 
ATOM   4038 N  N   . PHE B 1 25  ? 55.942  24.556  -30.612 1.00 20.23 ? 26  PHE B N   1 
ATOM   4039 C  CA  . PHE B 1 25  ? 55.552  23.203  -30.205 1.00 20.35 ? 26  PHE B CA  1 
ATOM   4040 C  C   . PHE B 1 25  ? 54.772  23.232  -28.874 1.00 20.89 ? 26  PHE B C   1 
ATOM   4041 O  O   . PHE B 1 25  ? 53.662  22.715  -28.812 1.00 20.14 ? 26  PHE B O   1 
ATOM   4042 C  CB  . PHE B 1 25  ? 56.773  22.270  -30.150 1.00 20.11 ? 26  PHE B CB  1 
ATOM   4043 C  CG  . PHE B 1 25  ? 56.522  20.942  -29.468 1.00 20.35 ? 26  PHE B CG  1 
ATOM   4044 C  CD1 . PHE B 1 25  ? 55.383  20.187  -29.748 1.00 20.10 ? 26  PHE B CD1 1 
ATOM   4045 C  CD2 . PHE B 1 25  ? 57.456  20.427  -28.572 1.00 20.89 ? 26  PHE B CD2 1 
ATOM   4046 C  CE1 . PHE B 1 25  ? 55.163  18.968  -29.125 1.00 19.38 ? 26  PHE B CE1 1 
ATOM   4047 C  CE2 . PHE B 1 25  ? 57.248  19.202  -27.943 1.00 19.82 ? 26  PHE B CE2 1 
ATOM   4048 C  CZ  . PHE B 1 25  ? 56.104  18.469  -28.223 1.00 20.00 ? 26  PHE B CZ  1 
ATOM   4049 N  N   . TRP B 1 26  ? 55.334  23.865  -27.841 1.00 21.69 ? 27  TRP B N   1 
ATOM   4050 C  CA  . TRP B 1 26  ? 54.648  23.959  -26.540 1.00 22.89 ? 27  TRP B CA  1 
ATOM   4051 C  C   . TRP B 1 26  ? 53.320  24.702  -26.615 1.00 23.85 ? 27  TRP B C   1 
ATOM   4052 O  O   . TRP B 1 26  ? 52.335  24.258  -26.041 1.00 24.00 ? 27  TRP B O   1 
ATOM   4053 C  CB  . TRP B 1 26  ? 55.537  24.573  -25.453 1.00 22.50 ? 27  TRP B CB  1 
ATOM   4054 C  CG  . TRP B 1 26  ? 56.752  23.763  -25.116 1.00 22.16 ? 27  TRP B CG  1 
ATOM   4055 C  CD1 . TRP B 1 26  ? 57.033  22.495  -25.525 1.00 21.28 ? 27  TRP B CD1 1 
ATOM   4056 C  CD2 . TRP B 1 26  ? 57.844  24.168  -24.283 1.00 21.86 ? 27  TRP B CD2 1 
ATOM   4057 N  NE1 . TRP B 1 26  ? 58.233  22.085  -25.008 1.00 22.10 ? 27  TRP B NE1 1 
ATOM   4058 C  CE2 . TRP B 1 26  ? 58.754  23.092  -24.239 1.00 21.96 ? 27  TRP B CE2 1 
ATOM   4059 C  CE3 . TRP B 1 26  ? 58.136  25.335  -23.561 1.00 22.88 ? 27  TRP B CE3 1 
ATOM   4060 C  CZ2 . TRP B 1 26  ? 59.944  23.144  -23.509 1.00 22.46 ? 27  TRP B CZ2 1 
ATOM   4061 C  CZ3 . TRP B 1 26  ? 59.320  25.390  -22.835 1.00 24.34 ? 27  TRP B CZ3 1 
ATOM   4062 C  CH2 . TRP B 1 26  ? 60.213  24.299  -22.820 1.00 24.27 ? 27  TRP B CH2 1 
ATOM   4063 N  N   . ARG B 1 27  ? 53.297  25.814  -27.346 1.00 25.42 ? 28  ARG B N   1 
ATOM   4064 C  CA  . ARG B 1 27  ? 52.095  26.642  -27.463 1.00 26.64 ? 28  ARG B CA  1 
ATOM   4065 C  C   . ARG B 1 27  ? 50.945  25.950  -28.214 1.00 26.52 ? 28  ARG B C   1 
ATOM   4066 O  O   . ARG B 1 27  ? 49.827  25.899  -27.710 1.00 26.20 ? 28  ARG B O   1 
ATOM   4067 C  CB  . ARG B 1 27  ? 52.437  28.000  -28.106 1.00 27.11 ? 28  ARG B CB  1 
ATOM   4068 C  CG  . ARG B 1 27  ? 51.397  29.111  -27.855 1.00 29.98 ? 28  ARG B CG  1 
ATOM   4069 C  CD  . ARG B 1 27  ? 51.571  30.271  -28.840 1.00 34.74 ? 28  ARG B CD  1 
ATOM   4070 N  NE  . ARG B 1 27  ? 51.451  29.800  -30.220 1.00 39.23 ? 28  ARG B NE  1 
ATOM   4071 C  CZ  . ARG B 1 27  ? 51.998  30.383  -31.284 1.00 40.86 ? 28  ARG B CZ  1 
ATOM   4072 N  NH1 . ARG B 1 27  ? 52.725  31.488  -31.156 1.00 42.64 ? 28  ARG B NH1 1 
ATOM   4073 N  NH2 . ARG B 1 27  ? 51.817  29.853  -32.484 1.00 41.80 ? 28  ARG B NH2 1 
ATOM   4074 N  N   . GLU B 1 28  ? 51.233  25.419  -29.404 1.00 26.87 ? 29  GLU B N   1 
ATOM   4075 C  CA  . GLU B 1 28  ? 50.219  24.834  -30.289 1.00 27.40 ? 29  GLU B CA  1 
ATOM   4076 C  C   . GLU B 1 28  ? 49.771  23.421  -29.900 1.00 27.08 ? 29  GLU B C   1 
ATOM   4077 O  O   . GLU B 1 28  ? 48.597  23.078  -30.063 1.00 27.23 ? 29  GLU B O   1 
ATOM   4078 C  CB  . GLU B 1 28  ? 50.721  24.788  -31.742 1.00 27.85 ? 29  GLU B CB  1 
ATOM   4079 C  CG  . GLU B 1 28  ? 51.019  26.137  -32.395 1.00 30.67 ? 29  GLU B CG  1 
ATOM   4080 C  CD  . GLU B 1 28  ? 51.707  25.991  -33.757 1.00 34.74 ? 29  GLU B CD  1 
ATOM   4081 O  OE1 . GLU B 1 28  ? 51.227  25.197  -34.604 1.00 36.30 ? 29  GLU B OE1 1 
ATOM   4082 O  OE2 . GLU B 1 28  ? 52.733  26.674  -33.984 1.00 37.20 ? 29  GLU B OE2 1 
ATOM   4083 N  N   . THR B 1 29  ? 50.702  22.603  -29.410 1.00 26.58 ? 30  THR B N   1 
ATOM   4084 C  CA  . THR B 1 29  ? 50.459  21.167  -29.244 1.00 26.23 ? 30  THR B CA  1 
ATOM   4085 C  C   . THR B 1 29  ? 50.687  20.683  -27.808 1.00 25.81 ? 30  THR B C   1 
ATOM   4086 O  O   . THR B 1 29  ? 49.862  19.948  -27.271 1.00 25.86 ? 30  THR B O   1 
ATOM   4087 C  CB  . THR B 1 29  ? 51.310  20.336  -30.252 1.00 26.26 ? 30  THR B CB  1 
ATOM   4088 O  OG1 . THR B 1 29  ? 51.178  20.901  -31.562 1.00 26.90 ? 30  THR B OG1 1 
ATOM   4089 C  CG2 . THR B 1 29  ? 50.846  18.890  -30.313 1.00 26.07 ? 30  THR B CG2 1 
ATOM   4090 N  N   . GLY B 1 30  ? 51.795  21.103  -27.195 1.00 25.19 ? 31  GLY B N   1 
ATOM   4091 C  CA  . GLY B 1 30  ? 52.127  20.709  -25.825 1.00 24.55 ? 31  GLY B CA  1 
ATOM   4092 C  C   . GLY B 1 30  ? 53.063  19.510  -25.734 1.00 24.28 ? 31  GLY B C   1 
ATOM   4093 O  O   . GLY B 1 30  ? 53.076  18.647  -26.629 1.00 23.68 ? 31  GLY B O   1 
ATOM   4094 N  N   . THR B 1 31  ? 53.830  19.445  -24.641 1.00 23.84 ? 32  THR B N   1 
ATOM   4095 C  CA  . THR B 1 31  ? 54.833  18.380  -24.453 1.00 23.84 ? 32  THR B CA  1 
ATOM   4096 C  C   . THR B 1 31  ? 54.236  16.981  -24.387 1.00 23.24 ? 32  THR B C   1 
ATOM   4097 O  O   . THR B 1 31  ? 54.862  16.015  -24.844 1.00 23.42 ? 32  THR B O   1 
ATOM   4098 C  CB  . THR B 1 31  ? 55.682  18.584  -23.188 1.00 24.11 ? 32  THR B CB  1 
ATOM   4099 O  OG1 . THR B 1 31  ? 54.850  19.056  -22.124 1.00 24.23 ? 32  THR B OG1 1 
ATOM   4100 C  CG2 . THR B 1 31  ? 56.780  19.583  -23.441 1.00 24.96 ? 32  THR B CG2 1 
ATOM   4101 N  N   . HIS B 1 32  ? 53.034  16.881  -23.827 1.00 21.95 ? 33  HIS B N   1 
ATOM   4102 C  CA  . HIS B 1 32  ? 52.365  15.599  -23.646 1.00 21.73 ? 33  HIS B CA  1 
ATOM   4103 C  C   . HIS B 1 32  ? 51.683  15.077  -24.921 1.00 20.89 ? 33  HIS B C   1 
ATOM   4104 O  O   . HIS B 1 32  ? 51.059  14.020  -24.906 1.00 20.65 ? 33  HIS B O   1 
ATOM   4105 C  CB  . HIS B 1 32  ? 51.387  15.668  -22.453 1.00 21.78 ? 33  HIS B CB  1 
ATOM   4106 C  CG  . HIS B 1 32  ? 52.066  15.935  -21.145 1.00 23.47 ? 33  HIS B CG  1 
ATOM   4107 N  ND1 . HIS B 1 32  ? 51.818  17.062  -20.390 1.00 25.89 ? 33  HIS B ND1 1 
ATOM   4108 C  CD2 . HIS B 1 32  ? 53.016  15.236  -20.476 1.00 24.43 ? 33  HIS B CD2 1 
ATOM   4109 C  CE1 . HIS B 1 32  ? 52.576  17.039  -19.306 1.00 26.55 ? 33  HIS B CE1 1 
ATOM   4110 N  NE2 . HIS B 1 32  ? 53.314  15.943  -19.336 1.00 25.88 ? 33  HIS B NE2 1 
ATOM   4111 N  N   . LYS B 1 33  ? 51.838  15.815  -26.021 1.00 20.20 ? 34  LYS B N   1 
ATOM   4112 C  CA  . LYS B 1 33  ? 51.241  15.471  -27.307 1.00 19.62 ? 34  LYS B CA  1 
ATOM   4113 C  C   . LYS B 1 33  ? 52.274  15.486  -28.443 1.00 19.13 ? 34  LYS B C   1 
ATOM   4114 O  O   . LYS B 1 33  ? 51.950  15.801  -29.584 1.00 18.17 ? 34  LYS B O   1 
ATOM   4115 C  CB  . LYS B 1 33  ? 50.077  16.428  -27.623 1.00 19.62 ? 34  LYS B CB  1 
ATOM   4116 C  CG  . LYS B 1 33  ? 48.942  16.420  -26.593 1.00 21.44 ? 34  LYS B CG  1 
ATOM   4117 C  CD  . LYS B 1 33  ? 48.138  15.129  -26.668 1.00 24.62 ? 34  LYS B CD  1 
ATOM   4118 C  CE  . LYS B 1 33  ? 47.129  15.012  -25.539 1.00 26.03 ? 34  LYS B CE  1 
ATOM   4119 N  NZ  . LYS B 1 33  ? 46.209  13.858  -25.751 1.00 26.80 ? 34  LYS B NZ  1 
ATOM   4120 N  N   . VAL B 1 34  ? 53.516  15.131  -28.128 1.00 19.23 ? 35  VAL B N   1 
ATOM   4121 C  CA  . VAL B 1 34  ? 54.589  15.085  -29.132 1.00 19.35 ? 35  VAL B CA  1 
ATOM   4122 C  C   . VAL B 1 34  ? 54.239  14.160  -30.323 1.00 19.26 ? 35  VAL B C   1 
ATOM   4123 O  O   . VAL B 1 34  ? 54.612  14.434  -31.469 1.00 19.62 ? 35  VAL B O   1 
ATOM   4124 C  CB  . VAL B 1 34  ? 55.956  14.684  -28.494 1.00 19.53 ? 35  VAL B CB  1 
ATOM   4125 C  CG1 . VAL B 1 34  ? 55.976  13.222  -28.118 1.00 19.10 ? 35  VAL B CG1 1 
ATOM   4126 C  CG2 . VAL B 1 34  ? 57.109  14.993  -29.442 1.00 20.58 ? 35  VAL B CG2 1 
ATOM   4127 N  N   . HIS B 1 35  ? 53.516  13.077  -30.044 1.00 18.81 ? 36  HIS B N   1 
ATOM   4128 C  CA  . HIS B 1 35  ? 53.066  12.145  -31.085 1.00 18.58 ? 36  HIS B CA  1 
ATOM   4129 C  C   . HIS B 1 35  ? 52.157  12.811  -32.121 1.00 18.33 ? 36  HIS B C   1 
ATOM   4130 O  O   . HIS B 1 35  ? 52.264  12.525  -33.319 1.00 17.88 ? 36  HIS B O   1 
ATOM   4131 C  CB  . HIS B 1 35  ? 52.400  10.904  -30.469 1.00 18.31 ? 36  HIS B CB  1 
ATOM   4132 C  CG  . HIS B 1 35  ? 51.262  11.209  -29.541 1.00 19.08 ? 36  HIS B CG  1 
ATOM   4133 N  ND1 . HIS B 1 35  ? 51.429  11.878  -28.346 1.00 18.97 ? 36  HIS B ND1 1 
ATOM   4134 C  CD2 . HIS B 1 35  ? 49.942  10.915  -29.625 1.00 18.83 ? 36  HIS B CD2 1 
ATOM   4135 C  CE1 . HIS B 1 35  ? 50.263  11.982  -27.735 1.00 19.54 ? 36  HIS B CE1 1 
ATOM   4136 N  NE2 . HIS B 1 35  ? 49.344  11.407  -28.489 1.00 20.40 ? 36  HIS B NE2 1 
ATOM   4137 N  N   . LEU B 1 36  ? 51.284  13.708  -31.657 1.00 18.31 ? 37  LEU B N   1 
ATOM   4138 C  CA  . LEU B 1 36  ? 50.418  14.486  -32.553 1.00 18.63 ? 37  LEU B CA  1 
ATOM   4139 C  C   . LEU B 1 36  ? 51.209  15.524  -33.318 1.00 18.21 ? 37  LEU B C   1 
ATOM   4140 O  O   . LEU B 1 36  ? 50.899  15.831  -34.455 1.00 18.46 ? 37  LEU B O   1 
ATOM   4141 C  CB  . LEU B 1 36  ? 49.268  15.158  -31.799 1.00 18.44 ? 37  LEU B CB  1 
ATOM   4142 C  CG  . LEU B 1 36  ? 48.332  14.273  -30.966 1.00 19.29 ? 37  LEU B CG  1 
ATOM   4143 C  CD1 . LEU B 1 36  ? 47.159  15.106  -30.440 1.00 18.51 ? 37  LEU B CD1 1 
ATOM   4144 C  CD2 . LEU B 1 36  ? 47.823  13.042  -31.740 1.00 19.89 ? 37  LEU B CD2 1 
ATOM   4145 N  N   . HIS B 1 37  ? 52.245  16.054  -32.685 1.00 18.56 ? 38  HIS B N   1 
ATOM   4146 C  CA  . HIS B 1 37  ? 53.135  17.016  -33.313 1.00 18.24 ? 38  HIS B CA  1 
ATOM   4147 C  C   . HIS B 1 37  ? 53.764  16.366  -34.550 1.00 18.15 ? 38  HIS B C   1 
ATOM   4148 O  O   . HIS B 1 37  ? 53.783  16.973  -35.624 1.00 17.70 ? 38  HIS B O   1 
ATOM   4149 C  CB  . HIS B 1 37  ? 54.184  17.473  -32.292 1.00 18.39 ? 38  HIS B CB  1 
ATOM   4150 C  CG  . HIS B 1 37  ? 55.208  18.416  -32.834 1.00 18.91 ? 38  HIS B CG  1 
ATOM   4151 N  ND1 . HIS B 1 37  ? 54.895  19.685  -33.273 1.00 19.17 ? 38  HIS B ND1 1 
ATOM   4152 C  CD2 . HIS B 1 37  ? 56.552  18.293  -32.963 1.00 20.89 ? 38  HIS B CD2 1 
ATOM   4153 C  CE1 . HIS B 1 37  ? 55.998  20.293  -33.674 1.00 19.79 ? 38  HIS B CE1 1 
ATOM   4154 N  NE2 . HIS B 1 37  ? 57.019  19.476  -33.486 1.00 20.03 ? 38  HIS B NE2 1 
ATOM   4155 N  N   . HIS B 1 38  ? 54.236  15.126  -34.405 1.00 18.01 ? 39  HIS B N   1 
ATOM   4156 C  CA  . HIS B 1 38  ? 54.765  14.359  -35.544 1.00 18.51 ? 39  HIS B CA  1 
ATOM   4157 C  C   . HIS B 1 38  ? 53.736  14.133  -36.646 1.00 18.70 ? 39  HIS B C   1 
ATOM   4158 O  O   . HIS B 1 38  ? 54.034  14.338  -37.820 1.00 18.95 ? 39  HIS B O   1 
ATOM   4159 C  CB  . HIS B 1 38  ? 55.340  13.009  -35.109 1.00 18.39 ? 39  HIS B CB  1 
ATOM   4160 C  CG  . HIS B 1 38  ? 56.466  13.116  -34.130 1.00 18.58 ? 39  HIS B CG  1 
ATOM   4161 N  ND1 . HIS B 1 38  ? 56.828  12.076  -33.299 1.00 17.48 ? 39  HIS B ND1 1 
ATOM   4162 C  CD2 . HIS B 1 38  ? 57.304  14.140  -33.841 1.00 17.59 ? 39  HIS B CD2 1 
ATOM   4163 C  CE1 . HIS B 1 38  ? 57.851  12.452  -32.552 1.00 18.27 ? 39  HIS B CE1 1 
ATOM   4164 N  NE2 . HIS B 1 38  ? 58.157  13.701  -32.860 1.00 17.73 ? 39  HIS B NE2 1 
ATOM   4165 N  N   . VAL B 1 39  ? 52.535  13.702  -36.274 1.00 18.99 ? 40  VAL B N   1 
ATOM   4166 C  CA  . VAL B 1 39  ? 51.473  13.459  -37.265 1.00 19.26 ? 40  VAL B CA  1 
ATOM   4167 C  C   . VAL B 1 39  ? 51.212  14.735  -38.081 1.00 19.45 ? 40  VAL B C   1 
ATOM   4168 O  O   . VAL B 1 39  ? 51.220  14.703  -39.308 1.00 19.14 ? 40  VAL B O   1 
ATOM   4169 C  CB  . VAL B 1 39  ? 50.167  12.931  -36.616 1.00 18.76 ? 40  VAL B CB  1 
ATOM   4170 C  CG1 . VAL B 1 39  ? 49.010  12.934  -37.622 1.00 18.48 ? 40  VAL B CG1 1 
ATOM   4171 C  CG2 . VAL B 1 39  ? 50.378  11.524  -36.076 1.00 19.27 ? 40  VAL B CG2 1 
ATOM   4172 N  N   . GLN B 1 40  ? 51.021  15.845  -37.373 1.00 19.85 ? 41  GLN B N   1 
ATOM   4173 C  CA  . GLN B 1 40  ? 50.801  17.156  -37.980 1.00 20.74 ? 41  GLN B CA  1 
ATOM   4174 C  C   . GLN B 1 40  ? 51.964  17.626  -38.862 1.00 20.45 ? 41  GLN B C   1 
ATOM   4175 O  O   . GLN B 1 40  ? 51.737  18.217  -39.909 1.00 20.78 ? 41  GLN B O   1 
ATOM   4176 C  CB  . GLN B 1 40  ? 50.495  18.190  -36.895 1.00 20.62 ? 41  GLN B CB  1 
ATOM   4177 C  CG  . GLN B 1 40  ? 49.109  18.000  -36.270 1.00 23.65 ? 41  GLN B CG  1 
ATOM   4178 C  CD  . GLN B 1 40  ? 48.913  18.747  -34.955 1.00 26.68 ? 41  GLN B CD  1 
ATOM   4179 O  OE1 . GLN B 1 40  ? 49.863  19.263  -34.364 1.00 28.86 ? 41  GLN B OE1 1 
ATOM   4180 N  NE2 . GLN B 1 40  ? 47.669  18.803  -34.494 1.00 28.05 ? 41  GLN B NE2 1 
ATOM   4181 N  N   . ASN B 1 41  ? 53.195  17.360  -38.443 1.00 20.26 ? 42  ASN B N   1 
ATOM   4182 C  CA  . ASN B 1 41  ? 54.363  17.763  -39.219 1.00 20.36 ? 42  ASN B CA  1 
ATOM   4183 C  C   . ASN B 1 41  ? 54.451  17.047  -40.575 1.00 20.66 ? 42  ASN B C   1 
ATOM   4184 O  O   . ASN B 1 41  ? 54.718  17.692  -41.589 1.00 20.89 ? 42  ASN B O   1 
ATOM   4185 C  CB  . ASN B 1 41  ? 55.652  17.559  -38.422 1.00 20.20 ? 42  ASN B CB  1 
ATOM   4186 C  CG  . ASN B 1 41  ? 55.915  18.672  -37.400 1.00 20.98 ? 42  ASN B CG  1 
ATOM   4187 O  OD1 . ASN B 1 41  ? 55.340  19.760  -37.470 1.00 21.43 ? 42  ASN B OD1 1 
ATOM   4188 N  ND2 . ASN B 1 41  ? 56.797  18.392  -36.445 1.00 19.80 ? 42  ASN B ND2 1 
ATOM   4189 N  N   . PHE B 1 42  ? 54.218  15.728  -40.590 1.00 20.33 ? 43  PHE B N   1 
ATOM   4190 C  CA  . PHE B 1 42  ? 54.171  14.960  -41.845 1.00 20.33 ? 43  PHE B CA  1 
ATOM   4191 C  C   . PHE B 1 42  ? 53.064  15.423  -42.802 1.00 21.00 ? 43  PHE B C   1 
ATOM   4192 O  O   . PHE B 1 42  ? 53.260  15.409  -44.015 1.00 20.97 ? 43  PHE B O   1 
ATOM   4193 C  CB  . PHE B 1 42  ? 54.062  13.448  -41.585 1.00 19.89 ? 43  PHE B CB  1 
ATOM   4194 C  CG  . PHE B 1 42  ? 55.309  12.845  -41.002 1.00 17.54 ? 43  PHE B CG  1 
ATOM   4195 C  CD1 . PHE B 1 42  ? 55.285  12.250  -39.739 1.00 15.44 ? 43  PHE B CD1 1 
ATOM   4196 C  CD2 . PHE B 1 42  ? 56.510  12.891  -41.703 1.00 14.59 ? 43  PHE B CD2 1 
ATOM   4197 C  CE1 . PHE B 1 42  ? 56.437  11.713  -39.185 1.00 13.91 ? 43  PHE B CE1 1 
ATOM   4198 C  CE2 . PHE B 1 42  ? 57.668  12.359  -41.171 1.00 14.20 ? 43  PHE B CE2 1 
ATOM   4199 C  CZ  . PHE B 1 42  ? 57.636  11.763  -39.904 1.00 15.52 ? 43  PHE B CZ  1 
ATOM   4200 N  N   . GLN B 1 43  ? 51.916  15.831  -42.256 1.00 21.95 ? 44  GLN B N   1 
ATOM   4201 C  CA  . GLN B 1 43  ? 50.833  16.390  -43.062 1.00 23.00 ? 44  GLN B CA  1 
ATOM   4202 C  C   . GLN B 1 43  ? 51.257  17.718  -43.691 1.00 23.19 ? 44  GLN B C   1 
ATOM   4203 O  O   . GLN B 1 43  ? 50.907  18.007  -44.837 1.00 23.24 ? 44  GLN B O   1 
ATOM   4204 C  CB  . GLN B 1 43  ? 49.565  16.594  -42.227 1.00 23.28 ? 44  GLN B CB  1 
ATOM   4205 C  CG  . GLN B 1 43  ? 48.873  15.311  -41.764 1.00 25.93 ? 44  GLN B CG  1 
ATOM   4206 C  CD  . GLN B 1 43  ? 47.772  15.585  -40.743 1.00 29.94 ? 44  GLN B CD  1 
ATOM   4207 O  OE1 . GLN B 1 43  ? 47.629  16.710  -40.243 1.00 32.04 ? 44  GLN B OE1 1 
ATOM   4208 N  NE2 . GLN B 1 43  ? 46.985  14.554  -40.426 1.00 30.48 ? 44  GLN B NE2 1 
ATOM   4209 N  N   . LYS B 1 44  ? 52.023  18.510  -42.941 1.00 23.16 ? 45  LYS B N   1 
ATOM   4210 C  CA  . LYS B 1 44  ? 52.539  19.800  -43.419 1.00 23.41 ? 45  LYS B CA  1 
ATOM   4211 C  C   . LYS B 1 44  ? 53.704  19.709  -44.410 1.00 22.62 ? 45  LYS B C   1 
ATOM   4212 O  O   . LYS B 1 44  ? 53.751  20.476  -45.360 1.00 22.59 ? 45  LYS B O   1 
ATOM   4213 C  CB  . LYS B 1 44  ? 52.999  20.667  -42.241 1.00 23.81 ? 45  LYS B CB  1 
ATOM   4214 C  CG  . LYS B 1 44  ? 51.949  21.602  -41.677 1.00 26.23 ? 45  LYS B CG  1 
ATOM   4215 C  CD  . LYS B 1 44  ? 52.592  22.914  -41.210 1.00 29.97 ? 45  LYS B CD  1 
ATOM   4216 C  CE  . LYS B 1 44  ? 53.623  22.713  -40.097 1.00 31.55 ? 45  LYS B CE  1 
ATOM   4217 N  NZ  . LYS B 1 44  ? 52.990  22.568  -38.749 1.00 33.95 ? 45  LYS B NZ  1 
ATOM   4218 N  N   . TYR B 1 45  ? 54.652  18.803  -44.168 1.00 21.98 ? 46  TYR B N   1 
ATOM   4219 C  CA  . TYR B 1 45  ? 55.931  18.818  -44.896 1.00 21.68 ? 46  TYR B CA  1 
ATOM   4220 C  C   . TYR B 1 45  ? 56.148  17.683  -45.894 1.00 21.16 ? 46  TYR B C   1 
ATOM   4221 O  O   . TYR B 1 45  ? 57.048  17.751  -46.739 1.00 20.82 ? 46  TYR B O   1 
ATOM   4222 C  CB  . TYR B 1 45  ? 57.111  18.855  -43.919 1.00 21.67 ? 46  TYR B CB  1 
ATOM   4223 C  CG  . TYR B 1 45  ? 57.123  20.058  -42.999 1.00 23.58 ? 46  TYR B CG  1 
ATOM   4224 C  CD1 . TYR B 1 45  ? 57.123  19.891  -41.616 1.00 24.74 ? 46  TYR B CD1 1 
ATOM   4225 C  CD2 . TYR B 1 45  ? 57.140  21.366  -43.509 1.00 24.94 ? 46  TYR B CD2 1 
ATOM   4226 C  CE1 . TYR B 1 45  ? 57.137  20.980  -40.763 1.00 26.75 ? 46  TYR B CE1 1 
ATOM   4227 C  CE2 . TYR B 1 45  ? 57.149  22.471  -42.655 1.00 26.61 ? 46  TYR B CE2 1 
ATOM   4228 C  CZ  . TYR B 1 45  ? 57.143  22.260  -41.281 1.00 27.26 ? 46  TYR B CZ  1 
ATOM   4229 O  OH  . TYR B 1 45  ? 57.151  23.324  -40.410 1.00 30.84 ? 46  TYR B OH  1 
ATOM   4230 N  N   . GLY B 1 46  ? 55.336  16.638  -45.788 1.00 20.65 ? 47  GLY B N   1 
ATOM   4231 C  CA  . GLY B 1 46  ? 55.562  15.434  -46.569 1.00 20.27 ? 47  GLY B CA  1 
ATOM   4232 C  C   . GLY B 1 46  ? 56.228  14.363  -45.732 1.00 20.23 ? 47  GLY B C   1 
ATOM   4233 O  O   . GLY B 1 46  ? 56.323  14.494  -44.504 1.00 20.57 ? 47  GLY B O   1 
ATOM   4234 N  N   . PRO B 1 47  ? 56.715  13.302  -46.391 1.00 20.05 ? 48  PRO B N   1 
ATOM   4235 C  CA  . PRO B 1 47  ? 57.208  12.104  -45.700 1.00 19.58 ? 48  PRO B CA  1 
ATOM   4236 C  C   . PRO B 1 47  ? 58.613  12.217  -45.101 1.00 19.25 ? 48  PRO B C   1 
ATOM   4237 O  O   . PRO B 1 47  ? 59.091  11.264  -44.478 1.00 18.94 ? 48  PRO B O   1 
ATOM   4238 C  CB  . PRO B 1 47  ? 57.170  11.031  -46.794 1.00 19.70 ? 48  PRO B CB  1 
ATOM   4239 C  CG  . PRO B 1 47  ? 57.340  11.798  -48.082 1.00 20.10 ? 48  PRO B CG  1 
ATOM   4240 C  CD  . PRO B 1 47  ? 56.777  13.174  -47.863 1.00 19.83 ? 48  PRO B CD  1 
ATOM   4241 N  N   . ILE B 1 48  ? 59.265  13.363  -45.279 1.00 18.86 ? 49  ILE B N   1 
ATOM   4242 C  CA  . ILE B 1 48  ? 60.542  13.630  -44.607 1.00 18.98 ? 49  ILE B CA  1 
ATOM   4243 C  C   . ILE B 1 48  ? 60.662  15.095  -44.200 1.00 18.72 ? 49  ILE B C   1 
ATOM   4244 O  O   . ILE B 1 48  ? 60.343  15.995  -44.971 1.00 18.51 ? 49  ILE B O   1 
ATOM   4245 C  CB  . ILE B 1 48  ? 61.796  13.176  -45.446 1.00 18.91 ? 49  ILE B CB  1 
ATOM   4246 C  CG1 . ILE B 1 48  ? 63.086  13.345  -44.630 1.00 19.41 ? 49  ILE B CG1 1 
ATOM   4247 C  CG2 . ILE B 1 48  ? 61.883  13.937  -46.771 1.00 19.38 ? 49  ILE B CG2 1 
ATOM   4248 C  CD1 . ILE B 1 48  ? 64.327  12.623  -45.205 1.00 19.96 ? 49  ILE B CD1 1 
ATOM   4249 N  N   . TYR B 1 49  ? 61.101  15.332  -42.970 1.00 19.13 ? 50  TYR B N   1 
ATOM   4250 C  CA  . TYR B 1 49  ? 61.357  16.700  -42.529 1.00 19.04 ? 50  TYR B CA  1 
ATOM   4251 C  C   . TYR B 1 49  ? 62.483  16.762  -41.513 1.00 19.01 ? 50  TYR B C   1 
ATOM   4252 O  O   . TYR B 1 49  ? 62.915  15.739  -40.994 1.00 18.37 ? 50  TYR B O   1 
ATOM   4253 C  CB  . TYR B 1 49  ? 60.070  17.378  -42.018 1.00 19.22 ? 50  TYR B CB  1 
ATOM   4254 C  CG  . TYR B 1 49  ? 59.561  16.879  -40.684 1.00 19.76 ? 50  TYR B CG  1 
ATOM   4255 C  CD1 . TYR B 1 49  ? 59.966  17.487  -39.491 1.00 20.25 ? 50  TYR B CD1 1 
ATOM   4256 C  CD2 . TYR B 1 49  ? 58.672  15.804  -40.609 1.00 19.69 ? 50  TYR B CD2 1 
ATOM   4257 C  CE1 . TYR B 1 49  ? 59.496  17.034  -38.244 1.00 19.70 ? 50  TYR B CE1 1 
ATOM   4258 C  CE2 . TYR B 1 49  ? 58.199  15.345  -39.369 1.00 20.60 ? 50  TYR B CE2 1 
ATOM   4259 C  CZ  . TYR B 1 49  ? 58.621  15.966  -38.194 1.00 20.46 ? 50  TYR B CZ  1 
ATOM   4260 O  OH  . TYR B 1 49  ? 58.160  15.526  -36.970 1.00 22.09 ? 50  TYR B OH  1 
ATOM   4261 N  N   . ARG B 1 50  ? 62.985  17.967  -41.270 1.00 19.78 ? 51  ARG B N   1 
ATOM   4262 C  CA  . ARG B 1 50  ? 63.965  18.183  -40.220 1.00 20.88 ? 51  ARG B CA  1 
ATOM   4263 C  C   . ARG B 1 50  ? 63.433  19.227  -39.247 1.00 21.26 ? 51  ARG B C   1 
ATOM   4264 O  O   . ARG B 1 50  ? 62.742  20.168  -39.640 1.00 21.07 ? 51  ARG B O   1 
ATOM   4265 C  CB  . ARG B 1 50  ? 65.341  18.566  -40.783 1.00 21.21 ? 51  ARG B CB  1 
ATOM   4266 C  CG  . ARG B 1 50  ? 65.390  19.881  -41.518 1.00 23.01 ? 51  ARG B CG  1 
ATOM   4267 C  CD  . ARG B 1 50  ? 66.797  20.200  -42.005 1.00 26.84 ? 51  ARG B CD  1 
ATOM   4268 N  NE  . ARG B 1 50  ? 66.780  21.302  -42.972 1.00 30.06 ? 51  ARG B NE  1 
ATOM   4269 C  CZ  . ARG B 1 50  ? 66.881  22.594  -42.660 1.00 32.00 ? 51  ARG B CZ  1 
ATOM   4270 N  NH1 . ARG B 1 50  ? 67.021  22.968  -41.394 1.00 32.43 ? 51  ARG B NH1 1 
ATOM   4271 N  NH2 . ARG B 1 50  ? 66.852  23.517  -43.620 1.00 32.37 ? 51  ARG B NH2 1 
ATOM   4272 N  N   . GLU B 1 51  ? 63.715  19.030  -37.969 1.00 21.60 ? 52  GLU B N   1 
ATOM   4273 C  CA  . GLU B 1 51  ? 63.303  19.987  -36.951 1.00 22.43 ? 52  GLU B CA  1 
ATOM   4274 C  C   . GLU B 1 51  ? 64.340  19.984  -35.853 1.00 22.66 ? 52  GLU B C   1 
ATOM   4275 O  O   . GLU B 1 51  ? 64.694  18.924  -35.311 1.00 22.32 ? 52  GLU B O   1 
ATOM   4276 C  CB  . GLU B 1 51  ? 61.903  19.679  -36.389 1.00 22.66 ? 52  GLU B CB  1 
ATOM   4277 C  CG  . GLU B 1 51  ? 61.324  20.785  -35.463 1.00 24.76 ? 52  GLU B CG  1 
ATOM   4278 C  CD  . GLU B 1 51  ? 59.856  20.558  -35.054 1.00 28.53 ? 52  GLU B CD  1 
ATOM   4279 O  OE1 . GLU B 1 51  ? 59.451  19.397  -34.840 1.00 28.70 ? 52  GLU B OE1 1 
ATOM   4280 O  OE2 . GLU B 1 51  ? 59.100  21.555  -34.930 1.00 31.14 ? 52  GLU B OE2 1 
ATOM   4281 N  N   . LYS B 1 52  ? 64.858  21.177  -35.571 1.00 22.80 ? 53  LYS B N   1 
ATOM   4282 C  CA  . LYS B 1 52  ? 65.657  21.406  -34.384 1.00 23.61 ? 53  LYS B CA  1 
ATOM   4283 C  C   . LYS B 1 52  ? 64.718  21.841  -33.250 1.00 23.57 ? 53  LYS B C   1 
ATOM   4284 O  O   . LYS B 1 52  ? 63.996  22.836  -33.373 1.00 23.12 ? 53  LYS B O   1 
ATOM   4285 C  CB  . LYS B 1 52  ? 66.721  22.472  -34.650 1.00 23.48 ? 53  LYS B CB  1 
ATOM   4286 C  CG  . LYS B 1 52  ? 67.759  22.614  -33.547 1.00 25.05 ? 53  LYS B CG  1 
ATOM   4287 C  CD  . LYS B 1 52  ? 68.746  23.716  -33.907 1.00 29.09 ? 53  LYS B CD  1 
ATOM   4288 C  CE  . LYS B 1 52  ? 69.987  23.659  -33.052 1.00 31.12 ? 53  LYS B CE  1 
ATOM   4289 N  NZ  . LYS B 1 52  ? 70.973  24.703  -33.477 1.00 33.36 ? 53  LYS B NZ  1 
ATOM   4290 N  N   . LEU B 1 53  ? 64.716  21.066  -32.171 1.00 23.94 ? 54  LEU B N   1 
ATOM   4291 C  CA  . LEU B 1 53  ? 63.957  21.406  -30.968 1.00 24.84 ? 54  LEU B CA  1 
ATOM   4292 C  C   . LEU B 1 53  ? 64.916  21.701  -29.826 1.00 25.23 ? 54  LEU B C   1 
ATOM   4293 O  O   . LEU B 1 53  ? 65.609  20.807  -29.331 1.00 25.57 ? 54  LEU B O   1 
ATOM   4294 C  CB  . LEU B 1 53  ? 62.971  20.296  -30.596 1.00 24.73 ? 54  LEU B CB  1 
ATOM   4295 C  CG  . LEU B 1 53  ? 61.692  20.243  -31.438 1.00 24.64 ? 54  LEU B CG  1 
ATOM   4296 C  CD1 . LEU B 1 53  ? 60.803  19.069  -31.009 1.00 24.22 ? 54  LEU B CD1 1 
ATOM   4297 C  CD2 . LEU B 1 53  ? 60.921  21.560  -31.380 1.00 22.21 ? 54  LEU B CD2 1 
ATOM   4298 N  N   . GLY B 1 54  ? 64.978  22.973  -29.446 1.00 25.58 ? 55  GLY B N   1 
ATOM   4299 C  CA  . GLY B 1 54  ? 65.965  23.439  -28.485 1.00 26.34 ? 55  GLY B CA  1 
ATOM   4300 C  C   . GLY B 1 54  ? 67.370  23.285  -29.032 1.00 26.88 ? 55  GLY B C   1 
ATOM   4301 O  O   . GLY B 1 54  ? 67.765  23.972  -29.976 1.00 26.64 ? 55  GLY B O   1 
ATOM   4302 N  N   . ASN B 1 55  ? 68.121  22.364  -28.438 1.00 27.56 ? 56  ASN B N   1 
ATOM   4303 C  CA  . ASN B 1 55  ? 69.497  22.090  -28.851 1.00 28.34 ? 56  ASN B CA  1 
ATOM   4304 C  C   . ASN B 1 55  ? 69.657  20.952  -29.873 1.00 28.45 ? 56  ASN B C   1 
ATOM   4305 O  O   . ASN B 1 55  ? 70.645  20.933  -30.616 1.00 29.05 ? 56  ASN B O   1 
ATOM   4306 C  CB  . ASN B 1 55  ? 70.405  21.867  -27.622 1.00 28.65 ? 56  ASN B CB  1 
ATOM   4307 C  CG  . ASN B 1 55  ? 69.807  20.891  -26.585 1.00 29.94 ? 56  ASN B CG  1 
ATOM   4308 O  OD1 . ASN B 1 55  ? 70.546  20.105  -25.973 1.00 31.06 ? 56  ASN B OD1 1 
ATOM   4309 N  ND2 . ASN B 1 55  ? 68.484  20.952  -26.370 1.00 30.07 ? 56  ASN B ND2 1 
ATOM   4310 N  N   . VAL B 1 56  ? 68.687  20.030  -29.921 1.00 27.95 ? 57  VAL B N   1 
ATOM   4311 C  CA  . VAL B 1 56  ? 68.773  18.833  -30.782 1.00 27.15 ? 57  VAL B CA  1 
ATOM   4312 C  C   . VAL B 1 56  ? 68.012  18.920  -32.121 1.00 26.43 ? 57  VAL B C   1 
ATOM   4313 O  O   . VAL B 1 56  ? 66.803  19.176  -32.176 1.00 25.81 ? 57  VAL B O   1 
ATOM   4314 C  CB  . VAL B 1 56  ? 68.426  17.511  -30.015 1.00 27.32 ? 57  VAL B CB  1 
ATOM   4315 C  CG1 . VAL B 1 56  ? 66.952  17.407  -29.710 1.00 27.53 ? 57  VAL B CG1 1 
ATOM   4316 C  CG2 . VAL B 1 56  ? 68.868  16.285  -30.811 1.00 27.99 ? 57  VAL B CG2 1 
ATOM   4317 N  N   . GLU B 1 57  ? 68.763  18.694  -33.194 1.00 25.68 ? 58  GLU B N   1 
ATOM   4318 C  CA  . GLU B 1 57  ? 68.226  18.621  -34.535 1.00 25.18 ? 58  GLU B CA  1 
ATOM   4319 C  C   . GLU B 1 57  ? 68.085  17.164  -34.965 1.00 24.08 ? 58  GLU B C   1 
ATOM   4320 O  O   . GLU B 1 57  ? 69.011  16.355  -34.802 1.00 23.97 ? 58  GLU B O   1 
ATOM   4321 C  CB  . GLU B 1 57  ? 69.142  19.358  -35.514 1.00 25.66 ? 58  GLU B CB  1 
ATOM   4322 C  CG  . GLU B 1 57  ? 68.564  19.509  -36.917 1.00 27.85 ? 58  GLU B CG  1 
ATOM   4323 C  CD  . GLU B 1 57  ? 69.503  20.249  -37.865 1.00 32.34 ? 58  GLU B CD  1 
ATOM   4324 O  OE1 . GLU B 1 57  ? 70.733  19.984  -37.839 1.00 34.25 ? 58  GLU B OE1 1 
ATOM   4325 O  OE2 . GLU B 1 57  ? 69.006  21.091  -38.643 1.00 33.22 ? 58  GLU B OE2 1 
ATOM   4326 N  N   . SER B 1 58  ? 66.926  16.838  -35.519 1.00 22.54 ? 59  SER B N   1 
ATOM   4327 C  CA  . SER B 1 58  ? 66.700  15.512  -36.065 1.00 21.58 ? 59  SER B CA  1 
ATOM   4328 C  C   . SER B 1 58  ? 66.107  15.583  -37.459 1.00 20.50 ? 59  SER B C   1 
ATOM   4329 O  O   . SER B 1 58  ? 65.432  16.545  -37.818 1.00 19.91 ? 59  SER B O   1 
ATOM   4330 C  CB  . SER B 1 58  ? 65.764  14.693  -35.159 1.00 21.78 ? 59  SER B CB  1 
ATOM   4331 O  OG  . SER B 1 58  ? 66.163  14.749  -33.799 1.00 22.16 ? 59  SER B OG  1 
ATOM   4332 N  N   . VAL B 1 59  ? 66.370  14.545  -38.235 1.00 19.79 ? 60  VAL B N   1 
ATOM   4333 C  CA  . VAL B 1 59  ? 65.621  14.286  -39.450 1.00 19.43 ? 60  VAL B CA  1 
ATOM   4334 C  C   . VAL B 1 59  ? 64.559  13.242  -39.115 1.00 19.21 ? 60  VAL B C   1 
ATOM   4335 O  O   . VAL B 1 59  ? 64.860  12.223  -38.483 1.00 18.95 ? 60  VAL B O   1 
ATOM   4336 C  CB  . VAL B 1 59  ? 66.541  13.760  -40.578 1.00 19.09 ? 60  VAL B CB  1 
ATOM   4337 C  CG1 . VAL B 1 59  ? 65.723  13.154  -41.710 1.00 18.49 ? 60  VAL B CG1 1 
ATOM   4338 C  CG2 . VAL B 1 59  ? 67.437  14.882  -41.094 1.00 19.70 ? 60  VAL B CG2 1 
ATOM   4339 N  N   . TYR B 1 60  ? 63.327  13.498  -39.544 1.00 19.16 ? 61  TYR B N   1 
ATOM   4340 C  CA  . TYR B 1 60  ? 62.215  12.598  -39.273 1.00 19.29 ? 61  TYR B CA  1 
ATOM   4341 C  C   . TYR B 1 60  ? 61.727  11.914  -40.545 1.00 19.53 ? 61  TYR B C   1 
ATOM   4342 O  O   . TYR B 1 60  ? 61.553  12.565  -41.581 1.00 19.40 ? 61  TYR B O   1 
ATOM   4343 C  CB  . TYR B 1 60  ? 61.055  13.358  -38.624 1.00 19.20 ? 61  TYR B CB  1 
ATOM   4344 C  CG  . TYR B 1 60  ? 61.353  13.925  -37.250 1.00 19.57 ? 61  TYR B CG  1 
ATOM   4345 C  CD1 . TYR B 1 60  ? 61.966  15.177  -37.109 1.00 19.36 ? 61  TYR B CD1 1 
ATOM   4346 C  CD2 . TYR B 1 60  ? 61.017  13.218  -36.092 1.00 18.40 ? 61  TYR B CD2 1 
ATOM   4347 C  CE1 . TYR B 1 60  ? 62.234  15.713  -35.852 1.00 20.12 ? 61  TYR B CE1 1 
ATOM   4348 C  CE2 . TYR B 1 60  ? 61.289  13.746  -34.823 1.00 19.46 ? 61  TYR B CE2 1 
ATOM   4349 C  CZ  . TYR B 1 60  ? 61.892  14.991  -34.716 1.00 19.96 ? 61  TYR B CZ  1 
ATOM   4350 O  OH  . TYR B 1 60  ? 62.170  15.522  -33.478 1.00 22.09 ? 61  TYR B OH  1 
ATOM   4351 N  N   . VAL B 1 61  ? 61.498  10.604  -40.443 1.00 19.77 ? 62  VAL B N   1 
ATOM   4352 C  CA  . VAL B 1 61  ? 60.981  9.783   -41.542 1.00 20.40 ? 62  VAL B CA  1 
ATOM   4353 C  C   . VAL B 1 61  ? 59.776  8.956   -41.102 1.00 21.08 ? 62  VAL B C   1 
ATOM   4354 O  O   . VAL B 1 61  ? 59.605  8.658   -39.909 1.00 20.83 ? 62  VAL B O   1 
ATOM   4355 C  CB  . VAL B 1 61  ? 62.064  8.838   -42.139 1.00 20.44 ? 62  VAL B CB  1 
ATOM   4356 C  CG1 . VAL B 1 61  ? 63.152  9.632   -42.869 1.00 19.68 ? 62  VAL B CG1 1 
ATOM   4357 C  CG2 . VAL B 1 61  ? 62.665  7.946   -41.061 1.00 19.72 ? 62  VAL B CG2 1 
ATOM   4358 N  N   . ILE B 1 62  ? 58.953  8.585   -42.080 1.00 22.10 ? 63  ILE B N   1 
ATOM   4359 C  CA  . ILE B 1 62  ? 57.717  7.831   -41.846 1.00 22.81 ? 63  ILE B CA  1 
ATOM   4360 C  C   . ILE B 1 62  ? 57.586  6.595   -42.765 1.00 23.61 ? 63  ILE B C   1 
ATOM   4361 O  O   . ILE B 1 62  ? 57.082  5.553   -42.336 1.00 24.11 ? 63  ILE B O   1 
ATOM   4362 C  CB  . ILE B 1 62  ? 56.467  8.765   -41.942 1.00 22.75 ? 63  ILE B CB  1 
ATOM   4363 C  CG1 . ILE B 1 62  ? 55.229  8.104   -41.317 1.00 21.94 ? 63  ILE B CG1 1 
ATOM   4364 C  CG2 . ILE B 1 62  ? 56.224  9.232   -43.391 1.00 22.25 ? 63  ILE B CG2 1 
ATOM   4365 C  CD1 . ILE B 1 62  ? 54.004  9.011   -41.261 1.00 20.34 ? 63  ILE B CD1 1 
ATOM   4366 N  N   . ASP B 1 63  ? 58.060  6.708   -44.008 1.00 24.28 ? 64  ASP B N   1 
ATOM   4367 C  CA  . ASP B 1 63  ? 57.959  5.631   -45.014 1.00 24.72 ? 64  ASP B CA  1 
ATOM   4368 C  C   . ASP B 1 63  ? 58.821  4.415   -44.668 1.00 24.93 ? 64  ASP B C   1 
ATOM   4369 O  O   . ASP B 1 63  ? 60.033  4.541   -44.521 1.00 24.75 ? 64  ASP B O   1 
ATOM   4370 C  CB  . ASP B 1 63  ? 58.352  6.169   -46.404 1.00 25.25 ? 64  ASP B CB  1 
ATOM   4371 C  CG  . ASP B 1 63  ? 57.994  5.215   -47.562 1.00 25.61 ? 64  ASP B CG  1 
ATOM   4372 O  OD1 . ASP B 1 63  ? 57.957  3.976   -47.397 1.00 26.50 ? 64  ASP B OD1 1 
ATOM   4373 O  OD2 . ASP B 1 63  ? 57.761  5.727   -48.669 1.00 26.85 ? 64  ASP B OD2 1 
ATOM   4374 N  N   . PRO B 1 64  ? 58.200  3.222   -44.562 1.00 25.39 ? 65  PRO B N   1 
ATOM   4375 C  CA  . PRO B 1 64  ? 58.955  1.993   -44.302 1.00 26.02 ? 65  PRO B CA  1 
ATOM   4376 C  C   . PRO B 1 64  ? 60.132  1.777   -45.256 1.00 26.86 ? 65  PRO B C   1 
ATOM   4377 O  O   . PRO B 1 64  ? 61.139  1.173   -44.865 1.00 27.19 ? 65  PRO B O   1 
ATOM   4378 C  CB  . PRO B 1 64  ? 57.901  0.902   -44.487 1.00 25.90 ? 65  PRO B CB  1 
ATOM   4379 C  CG  . PRO B 1 64  ? 56.645  1.550   -44.054 1.00 25.32 ? 65  PRO B CG  1 
ATOM   4380 C  CD  . PRO B 1 64  ? 56.747  2.967   -44.566 1.00 25.28 ? 65  PRO B CD  1 
ATOM   4381 N  N   . GLU B 1 65  ? 60.012  2.285   -46.479 1.00 27.64 ? 66  GLU B N   1 
ATOM   4382 C  CA  . GLU B 1 65  ? 61.070  2.168   -47.483 1.00 29.13 ? 66  GLU B CA  1 
ATOM   4383 C  C   . GLU B 1 65  ? 62.342  2.903   -47.053 1.00 28.85 ? 66  GLU B C   1 
ATOM   4384 O  O   . GLU B 1 65  ? 63.448  2.374   -47.186 1.00 28.97 ? 66  GLU B O   1 
ATOM   4385 C  CB  . GLU B 1 65  ? 60.582  2.709   -48.830 1.00 29.58 ? 66  GLU B CB  1 
ATOM   4386 C  CG  . GLU B 1 65  ? 60.923  1.822   -50.015 1.00 33.43 ? 66  GLU B CG  1 
ATOM   4387 C  CD  . GLU B 1 65  ? 60.079  0.551   -50.061 1.00 38.04 ? 66  GLU B CD  1 
ATOM   4388 O  OE1 . GLU B 1 65  ? 58.829  0.662   -50.030 1.00 40.98 ? 66  GLU B OE1 1 
ATOM   4389 O  OE2 . GLU B 1 65  ? 60.662  -0.557  -50.137 1.00 39.06 ? 66  GLU B OE2 1 
ATOM   4390 N  N   . ASP B 1 66  ? 62.167  4.120   -46.536 1.00 28.64 ? 67  ASP B N   1 
ATOM   4391 C  CA  . ASP B 1 66  ? 63.265  4.914   -45.975 1.00 28.45 ? 67  ASP B CA  1 
ATOM   4392 C  C   . ASP B 1 66  ? 63.782  4.321   -44.671 1.00 27.73 ? 67  ASP B C   1 
ATOM   4393 O  O   . ASP B 1 66  ? 64.979  4.381   -44.391 1.00 27.78 ? 67  ASP B O   1 
ATOM   4394 C  CB  . ASP B 1 66  ? 62.825  6.374   -45.770 1.00 28.78 ? 67  ASP B CB  1 
ATOM   4395 C  CG  . ASP B 1 66  ? 62.359  7.031   -47.067 1.00 30.12 ? 67  ASP B CG  1 
ATOM   4396 O  OD1 . ASP B 1 66  ? 62.880  6.662   -48.145 1.00 30.97 ? 67  ASP B OD1 1 
ATOM   4397 O  OD2 . ASP B 1 66  ? 61.472  7.910   -47.015 1.00 31.19 ? 67  ASP B OD2 1 
ATOM   4398 N  N   . VAL B 1 67  ? 62.872  3.748   -43.885 1.00 27.19 ? 68  VAL B N   1 
ATOM   4399 C  CA  . VAL B 1 67  ? 63.217  3.075   -42.633 1.00 26.62 ? 68  VAL B CA  1 
ATOM   4400 C  C   . VAL B 1 67  ? 64.178  1.916   -42.903 1.00 26.53 ? 68  VAL B C   1 
ATOM   4401 O  O   . VAL B 1 67  ? 65.188  1.765   -42.218 1.00 26.43 ? 68  VAL B O   1 
ATOM   4402 C  CB  . VAL B 1 67  ? 61.946  2.568   -41.887 1.00 26.61 ? 68  VAL B CB  1 
ATOM   4403 C  CG1 . VAL B 1 67  ? 62.312  1.750   -40.661 1.00 25.65 ? 68  VAL B CG1 1 
ATOM   4404 C  CG2 . VAL B 1 67  ? 61.058  3.733   -41.497 1.00 26.51 ? 68  VAL B CG2 1 
ATOM   4405 N  N   . ALA B 1 68  ? 63.859  1.122   -43.920 1.00 26.62 ? 69  ALA B N   1 
ATOM   4406 C  CA  . ALA B 1 68  ? 64.697  -0.001  -44.352 1.00 26.71 ? 69  ALA B CA  1 
ATOM   4407 C  C   . ALA B 1 68  ? 66.112  0.435   -44.733 1.00 26.71 ? 69  ALA B C   1 
ATOM   4408 O  O   . ALA B 1 68  ? 67.084  -0.233  -44.386 1.00 26.39 ? 69  ALA B O   1 
ATOM   4409 C  CB  . ALA B 1 68  ? 64.037  -0.732  -45.511 1.00 26.65 ? 69  ALA B CB  1 
ATOM   4410 N  N   . LEU B 1 69  ? 66.220  1.563   -45.428 1.00 27.07 ? 70  LEU B N   1 
ATOM   4411 C  CA  . LEU B 1 69  ? 67.523  2.091   -45.824 1.00 27.86 ? 70  LEU B CA  1 
ATOM   4412 C  C   . LEU B 1 69  ? 68.337  2.567   -44.630 1.00 28.02 ? 70  LEU B C   1 
ATOM   4413 O  O   . LEU B 1 69  ? 69.563  2.434   -44.617 1.00 27.92 ? 70  LEU B O   1 
ATOM   4414 C  CB  . LEU B 1 69  ? 67.371  3.215   -46.848 1.00 28.19 ? 70  LEU B CB  1 
ATOM   4415 C  CG  . LEU B 1 69  ? 66.862  2.817   -48.235 1.00 29.30 ? 70  LEU B CG  1 
ATOM   4416 C  CD1 . LEU B 1 69  ? 66.571  4.066   -49.058 1.00 29.46 ? 70  LEU B CD1 1 
ATOM   4417 C  CD2 . LEU B 1 69  ? 67.860  1.908   -48.962 1.00 29.93 ? 70  LEU B CD2 1 
ATOM   4418 N  N   . LEU B 1 70  ? 67.650  3.105   -43.622 1.00 28.27 ? 71  LEU B N   1 
ATOM   4419 C  CA  . LEU B 1 70  ? 68.316  3.590   -42.419 1.00 28.88 ? 71  LEU B CA  1 
ATOM   4420 C  C   . LEU B 1 70  ? 68.963  2.430   -41.673 1.00 29.72 ? 71  LEU B C   1 
ATOM   4421 O  O   . LEU B 1 70  ? 70.119  2.502   -41.268 1.00 29.43 ? 71  LEU B O   1 
ATOM   4422 C  CB  . LEU B 1 70  ? 67.334  4.346   -41.508 1.00 28.43 ? 71  LEU B CB  1 
ATOM   4423 C  CG  . LEU B 1 70  ? 67.830  4.682   -40.101 1.00 27.92 ? 71  LEU B CG  1 
ATOM   4424 C  CD1 . LEU B 1 70  ? 68.950  5.713   -40.165 1.00 27.85 ? 71  LEU B CD1 1 
ATOM   4425 C  CD2 . LEU B 1 70  ? 66.699  5.170   -39.207 1.00 27.59 ? 71  LEU B CD2 1 
ATOM   4426 N  N   . PHE B 1 71  ? 68.211  1.352   -41.512 1.00 31.13 ? 72  PHE B N   1 
ATOM   4427 C  CA  . PHE B 1 71  ? 68.717  0.203   -40.789 1.00 32.82 ? 72  PHE B CA  1 
ATOM   4428 C  C   . PHE B 1 71  ? 69.704  -0.641  -41.609 1.00 33.71 ? 72  PHE B C   1 
ATOM   4429 O  O   . PHE B 1 71  ? 70.553  -1.315  -41.032 1.00 34.03 ? 72  PHE B O   1 
ATOM   4430 C  CB  . PHE B 1 71  ? 67.563  -0.614  -40.201 1.00 32.85 ? 72  PHE B CB  1 
ATOM   4431 C  CG  . PHE B 1 71  ? 66.854  0.080   -39.049 1.00 33.76 ? 72  PHE B CG  1 
ATOM   4432 C  CD1 . PHE B 1 71  ? 65.524  0.468   -39.161 1.00 34.41 ? 72  PHE B CD1 1 
ATOM   4433 C  CD2 . PHE B 1 71  ? 67.528  0.356   -37.858 1.00 34.47 ? 72  PHE B CD2 1 
ATOM   4434 C  CE1 . PHE B 1 71  ? 64.875  1.111   -38.102 1.00 35.18 ? 72  PHE B CE1 1 
ATOM   4435 C  CE2 . PHE B 1 71  ? 66.886  0.994   -36.800 1.00 34.52 ? 72  PHE B CE2 1 
ATOM   4436 C  CZ  . PHE B 1 71  ? 65.561  1.376   -36.922 1.00 34.43 ? 72  PHE B CZ  1 
ATOM   4437 N  N   . LYS B 1 72  ? 69.619  -0.579  -42.940 1.00 34.80 ? 73  LYS B N   1 
ATOM   4438 C  CA  . LYS B 1 72  ? 70.625  -1.228  -43.806 1.00 35.92 ? 73  LYS B CA  1 
ATOM   4439 C  C   . LYS B 1 72  ? 72.012  -0.588  -43.650 1.00 36.06 ? 73  LYS B C   1 
ATOM   4440 O  O   . LYS B 1 72  ? 73.032  -1.254  -43.819 1.00 36.31 ? 73  LYS B O   1 
ATOM   4441 C  CB  . LYS B 1 72  ? 70.225  -1.191  -45.294 1.00 36.26 ? 73  LYS B CB  1 
ATOM   4442 C  CG  . LYS B 1 72  ? 68.938  -1.931  -45.675 1.00 37.97 ? 73  LYS B CG  1 
ATOM   4443 C  CD  . LYS B 1 72  ? 69.075  -3.448  -45.613 1.00 40.64 ? 73  LYS B CD  1 
ATOM   4444 C  CE  . LYS B 1 72  ? 67.714  -4.128  -45.720 1.00 41.29 ? 73  LYS B CE  1 
ATOM   4445 N  NZ  . LYS B 1 72  ? 67.850  -5.613  -45.648 1.00 43.04 ? 73  LYS B NZ  1 
ATOM   4446 N  N   . SER B 1 73  ? 72.043  0.703   -43.328 1.00 36.20 ? 74  SER B N   1 
ATOM   4447 C  CA  . SER B 1 73  ? 73.304  1.441   -43.236 1.00 36.28 ? 74  SER B CA  1 
ATOM   4448 C  C   . SER B 1 73  ? 73.846  1.471   -41.818 1.00 36.23 ? 74  SER B C   1 
ATOM   4449 O  O   . SER B 1 73  ? 74.762  2.235   -41.512 1.00 36.71 ? 74  SER B O   1 
ATOM   4450 C  CB  . SER B 1 73  ? 73.114  2.871   -43.730 1.00 36.28 ? 74  SER B CB  1 
ATOM   4451 O  OG  . SER B 1 73  ? 72.254  3.572   -42.855 1.00 36.98 ? 74  SER B OG  1 
ATOM   4452 N  N   . GLU B 1 74  ? 73.278  0.636   -40.957 1.00 35.85 ? 75  GLU B N   1 
ATOM   4453 C  CA  . GLU B 1 74  ? 73.634  0.611   -39.547 1.00 35.22 ? 75  GLU B CA  1 
ATOM   4454 C  C   . GLU B 1 74  ? 75.031  0.028   -39.299 1.00 34.81 ? 75  GLU B C   1 
ATOM   4455 O  O   . GLU B 1 74  ? 75.396  -1.016  -39.854 1.00 34.58 ? 75  GLU B O   1 
ATOM   4456 C  CB  . GLU B 1 74  ? 72.586  -0.186  -38.774 1.00 35.24 ? 75  GLU B CB  1 
ATOM   4457 C  CG  . GLU B 1 74  ? 72.605  0.054   -37.288 1.00 35.81 ? 75  GLU B CG  1 
ATOM   4458 C  CD  . GLU B 1 74  ? 71.358  -0.448  -36.613 1.00 35.26 ? 75  GLU B CD  1 
ATOM   4459 O  OE1 . GLU B 1 74  ? 71.276  -1.665  -36.324 1.00 35.27 ? 75  GLU B OE1 1 
ATOM   4460 O  OE2 . GLU B 1 74  ? 70.468  0.385   -36.369 1.00 35.07 ? 75  GLU B OE2 1 
ATOM   4461 N  N   . GLY B 1 75  ? 75.796  0.715   -38.455 1.00 34.05 ? 76  GLY B N   1 
ATOM   4462 C  CA  . GLY B 1 75  ? 77.108  0.247   -38.028 1.00 33.21 ? 76  GLY B CA  1 
ATOM   4463 C  C   . GLY B 1 75  ? 77.032  -0.880  -37.012 1.00 32.47 ? 76  GLY B C   1 
ATOM   4464 O  O   . GLY B 1 75  ? 75.936  -1.300  -36.622 1.00 32.67 ? 76  GLY B O   1 
ATOM   4465 N  N   . PRO B 1 76  ? 78.200  -1.382  -36.575 1.00 31.69 ? 77  PRO B N   1 
ATOM   4466 C  CA  . PRO B 1 76  ? 78.253  -2.505  -35.633 1.00 30.80 ? 77  PRO B CA  1 
ATOM   4467 C  C   . PRO B 1 76  ? 77.826  -2.145  -34.204 1.00 29.88 ? 77  PRO B C   1 
ATOM   4468 O  O   . PRO B 1 76  ? 77.358  -3.019  -33.466 1.00 29.74 ? 77  PRO B O   1 
ATOM   4469 C  CB  . PRO B 1 76  ? 79.733  -2.917  -35.661 1.00 30.96 ? 77  PRO B CB  1 
ATOM   4470 C  CG  . PRO B 1 76  ? 80.465  -1.695  -36.089 1.00 31.37 ? 77  PRO B CG  1 
ATOM   4471 C  CD  . PRO B 1 76  ? 79.544  -0.994  -37.050 1.00 31.70 ? 77  PRO B CD  1 
ATOM   4472 N  N   . ASN B 1 77  ? 78.002  -0.878  -33.827 1.00 28.63 ? 78  ASN B N   1 
ATOM   4473 C  CA  . ASN B 1 77  ? 77.656  -0.391  -32.489 1.00 27.22 ? 78  ASN B CA  1 
ATOM   4474 C  C   . ASN B 1 77  ? 76.695  0.806   -32.578 1.00 25.85 ? 78  ASN B C   1 
ATOM   4475 O  O   . ASN B 1 77  ? 77.109  1.953   -32.388 1.00 24.95 ? 78  ASN B O   1 
ATOM   4476 C  CB  . ASN B 1 77  ? 78.923  0.003   -31.714 1.00 27.41 ? 78  ASN B CB  1 
ATOM   4477 C  CG  . ASN B 1 77  ? 79.870  -1.173  -31.475 1.00 28.75 ? 78  ASN B CG  1 
ATOM   4478 O  OD1 . ASN B 1 77  ? 79.499  -2.191  -30.872 1.00 30.11 ? 78  ASN B OD1 1 
ATOM   4479 N  ND2 . ASN B 1 77  ? 81.106  -1.025  -31.930 1.00 28.04 ? 78  ASN B ND2 1 
ATOM   4480 N  N   . PRO B 1 78  ? 75.403  0.538   -32.857 1.00 24.87 ? 79  PRO B N   1 
ATOM   4481 C  CA  . PRO B 1 78  ? 74.414  1.598   -33.076 1.00 24.22 ? 79  PRO B CA  1 
ATOM   4482 C  C   . PRO B 1 78  ? 74.212  2.480   -31.848 1.00 23.58 ? 79  PRO B C   1 
ATOM   4483 O  O   . PRO B 1 78  ? 74.363  2.018   -30.716 1.00 23.50 ? 79  PRO B O   1 
ATOM   4484 C  CB  . PRO B 1 78  ? 73.119  0.828   -33.362 1.00 24.18 ? 79  PRO B CB  1 
ATOM   4485 C  CG  . PRO B 1 78  ? 73.509  -0.570  -33.565 1.00 24.30 ? 79  PRO B CG  1 
ATOM   4486 C  CD  . PRO B 1 78  ? 74.777  -0.793  -32.838 1.00 24.77 ? 79  PRO B CD  1 
ATOM   4487 N  N   . GLU B 1 79  ? 73.883  3.745   -32.084 1.00 22.98 ? 80  GLU B N   1 
ATOM   4488 C  CA  . GLU B 1 79  ? 73.572  4.679   -31.010 1.00 22.49 ? 80  GLU B CA  1 
ATOM   4489 C  C   . GLU B 1 79  ? 72.202  5.298   -31.278 1.00 21.46 ? 80  GLU B C   1 
ATOM   4490 O  O   . GLU B 1 79  ? 71.920  5.731   -32.399 1.00 21.07 ? 80  GLU B O   1 
ATOM   4491 C  CB  . GLU B 1 79  ? 74.654  5.771   -30.898 1.00 23.06 ? 80  GLU B CB  1 
ATOM   4492 C  CG  . GLU B 1 79  ? 76.077  5.244   -30.649 1.00 25.34 ? 80  GLU B CG  1 
ATOM   4493 C  CD  . GLU B 1 79  ? 77.141  6.343   -30.712 1.00 30.09 ? 80  GLU B CD  1 
ATOM   4494 O  OE1 . GLU B 1 79  ? 77.382  7.004   -29.678 1.00 30.85 ? 80  GLU B OE1 1 
ATOM   4495 O  OE2 . GLU B 1 79  ? 77.741  6.542   -31.801 1.00 32.25 ? 80  GLU B OE2 1 
ATOM   4496 N  N   . ARG B 1 80  ? 71.343  5.298   -30.260 1.00 20.07 ? 81  ARG B N   1 
ATOM   4497 C  CA  . ARG B 1 80  ? 70.054  5.983   -30.342 1.00 19.08 ? 81  ARG B CA  1 
ATOM   4498 C  C   . ARG B 1 80  ? 70.147  7.292   -29.562 1.00 18.58 ? 81  ARG B C   1 
ATOM   4499 O  O   . ARG B 1 80  ? 71.204  7.619   -29.022 1.00 18.32 ? 81  ARG B O   1 
ATOM   4500 C  CB  . ARG B 1 80  ? 68.920  5.104   -29.797 1.00 18.69 ? 81  ARG B CB  1 
ATOM   4501 C  CG  . ARG B 1 80  ? 68.896  4.956   -28.270 1.00 17.80 ? 81  ARG B CG  1 
ATOM   4502 C  CD  . ARG B 1 80  ? 67.663  4.213   -27.789 1.00 15.94 ? 81  ARG B CD  1 
ATOM   4503 N  NE  . ARG B 1 80  ? 67.689  2.777   -28.096 1.00 15.75 ? 81  ARG B NE  1 
ATOM   4504 C  CZ  . ARG B 1 80  ? 68.341  1.854   -27.385 1.00 15.19 ? 81  ARG B CZ  1 
ATOM   4505 N  NH1 . ARG B 1 80  ? 69.069  2.190   -26.328 1.00 14.27 ? 81  ARG B NH1 1 
ATOM   4506 N  NH2 . ARG B 1 80  ? 68.274  0.581   -27.742 1.00 14.88 ? 81  ARG B NH2 1 
ATOM   4507 N  N   . PHE B 1 81  ? 69.045  8.031   -29.497 1.00 18.42 ? 82  PHE B N   1 
ATOM   4508 C  CA  . PHE B 1 81  ? 69.004  9.263   -28.723 1.00 17.97 ? 82  PHE B CA  1 
ATOM   4509 C  C   . PHE B 1 81  ? 68.994  8.952   -27.227 1.00 17.96 ? 82  PHE B C   1 
ATOM   4510 O  O   . PHE B 1 81  ? 68.179  8.149   -26.761 1.00 17.91 ? 82  PHE B O   1 
ATOM   4511 C  CB  . PHE B 1 81  ? 67.787  10.103  -29.107 1.00 17.88 ? 82  PHE B CB  1 
ATOM   4512 C  CG  . PHE B 1 81  ? 67.684  11.399  -28.349 1.00 17.83 ? 82  PHE B CG  1 
ATOM   4513 C  CD1 . PHE B 1 81  ? 68.584  12.438  -28.596 1.00 17.12 ? 82  PHE B CD1 1 
ATOM   4514 C  CD2 . PHE B 1 81  ? 66.693  11.577  -27.378 1.00 17.25 ? 82  PHE B CD2 1 
ATOM   4515 C  CE1 . PHE B 1 81  ? 68.502  13.641  -27.887 1.00 17.61 ? 82  PHE B CE1 1 
ATOM   4516 C  CE2 . PHE B 1 81  ? 66.603  12.781  -26.654 1.00 17.94 ? 82  PHE B CE2 1 
ATOM   4517 C  CZ  . PHE B 1 81  ? 67.507  13.808  -26.908 1.00 17.39 ? 82  PHE B CZ  1 
ATOM   4518 N  N   . LEU B 1 82  ? 69.914  9.579   -26.491 1.00 17.51 ? 83  LEU B N   1 
ATOM   4519 C  CA  . LEU B 1 82  ? 70.005  9.422   -25.038 1.00 17.46 ? 83  LEU B CA  1 
ATOM   4520 C  C   . LEU B 1 82  ? 69.199  10.511  -24.333 1.00 17.24 ? 83  LEU B C   1 
ATOM   4521 O  O   . LEU B 1 82  ? 69.296  11.688  -24.687 1.00 17.43 ? 83  LEU B O   1 
ATOM   4522 C  CB  . LEU B 1 82  ? 71.469  9.458   -24.580 1.00 17.49 ? 83  LEU B CB  1 
ATOM   4523 C  CG  . LEU B 1 82  ? 72.437  8.357   -25.040 1.00 18.26 ? 83  LEU B CG  1 
ATOM   4524 C  CD1 . LEU B 1 82  ? 73.895  8.780   -24.793 1.00 17.42 ? 83  LEU B CD1 1 
ATOM   4525 C  CD2 . LEU B 1 82  ? 72.134  7.035   -24.329 1.00 18.66 ? 83  LEU B CD2 1 
ATOM   4526 N  N   . ILE B 1 83  ? 68.404  10.114  -23.343 1.00 16.93 ? 84  ILE B N   1 
ATOM   4527 C  CA  . ILE B 1 83  ? 67.569  11.052  -22.584 1.00 16.33 ? 84  ILE B CA  1 
ATOM   4528 C  C   . ILE B 1 83  ? 68.434  11.882  -21.623 1.00 16.31 ? 84  ILE B C   1 
ATOM   4529 O  O   . ILE B 1 83  ? 69.035  11.334  -20.693 1.00 16.54 ? 84  ILE B O   1 
ATOM   4530 C  CB  . ILE B 1 83  ? 66.453  10.319  -21.797 1.00 16.48 ? 84  ILE B CB  1 
ATOM   4531 C  CG1 . ILE B 1 83  ? 65.729  9.275   -22.678 1.00 16.45 ? 84  ILE B CG1 1 
ATOM   4532 C  CG2 . ILE B 1 83  ? 65.473  11.318  -21.200 1.00 14.99 ? 84  ILE B CG2 1 
ATOM   4533 C  CD1 . ILE B 1 83  ? 64.909  9.869   -23.842 1.00 18.36 ? 84  ILE B CD1 1 
ATOM   4534 N  N   . PRO B 1 84  ? 68.510  13.208  -21.847 1.00 16.22 ? 85  PRO B N   1 
ATOM   4535 C  CA  . PRO B 1 84  ? 69.474  14.029  -21.081 1.00 16.24 ? 85  PRO B CA  1 
ATOM   4536 C  C   . PRO B 1 84  ? 69.272  14.043  -19.553 1.00 15.97 ? 85  PRO B C   1 
ATOM   4537 O  O   . PRO B 1 84  ? 70.250  13.913  -18.825 1.00 15.91 ? 85  PRO B O   1 
ATOM   4538 C  CB  . PRO B 1 84  ? 69.310  15.428  -21.696 1.00 16.38 ? 85  PRO B CB  1 
ATOM   4539 C  CG  . PRO B 1 84  ? 68.810  15.149  -23.089 1.00 16.09 ? 85  PRO B CG  1 
ATOM   4540 C  CD  . PRO B 1 84  ? 67.853  13.996  -22.908 1.00 15.79 ? 85  PRO B CD  1 
ATOM   4541 N  N   . PRO B 1 85  ? 68.022  14.183  -19.060 1.00 16.14 ? 86  PRO B N   1 
ATOM   4542 C  CA  . PRO B 1 85  ? 67.894  14.021  -17.606 1.00 16.09 ? 86  PRO B CA  1 
ATOM   4543 C  C   . PRO B 1 85  ? 68.430  12.687  -17.074 1.00 15.96 ? 86  PRO B C   1 
ATOM   4544 O  O   . PRO B 1 85  ? 68.958  12.652  -15.963 1.00 16.31 ? 86  PRO B O   1 
ATOM   4545 C  CB  . PRO B 1 85  ? 66.379  14.114  -17.362 1.00 15.84 ? 86  PRO B CB  1 
ATOM   4546 C  CG  . PRO B 1 85  ? 65.747  13.973  -18.698 1.00 16.46 ? 86  PRO B CG  1 
ATOM   4547 C  CD  . PRO B 1 85  ? 66.729  14.529  -19.673 1.00 15.88 ? 86  PRO B CD  1 
ATOM   4548 N  N   . TRP B 1 86  ? 68.300  11.607  -17.843 1.00 15.74 ? 87  TRP B N   1 
ATOM   4549 C  CA  . TRP B 1 86  ? 68.814  10.294  -17.405 1.00 16.23 ? 87  TRP B CA  1 
ATOM   4550 C  C   . TRP B 1 86  ? 70.334  10.275  -17.358 1.00 16.53 ? 87  TRP B C   1 
ATOM   4551 O  O   . TRP B 1 86  ? 70.924  9.854   -16.357 1.00 16.79 ? 87  TRP B O   1 
ATOM   4552 C  CB  . TRP B 1 86  ? 68.307  9.153   -18.300 1.00 15.74 ? 87  TRP B CB  1 
ATOM   4553 C  CG  . TRP B 1 86  ? 66.811  8.981   -18.319 1.00 15.82 ? 87  TRP B CG  1 
ATOM   4554 C  CD1 . TRP B 1 86  ? 65.874  9.791   -17.733 1.00 14.06 ? 87  TRP B CD1 1 
ATOM   4555 C  CD2 . TRP B 1 86  ? 66.079  7.953   -19.003 1.00 16.10 ? 87  TRP B CD2 1 
ATOM   4556 N  NE1 . TRP B 1 86  ? 64.608  9.317   -17.992 1.00 14.97 ? 87  TRP B NE1 1 
ATOM   4557 C  CE2 . TRP B 1 86  ? 64.704  8.187   -18.762 1.00 15.69 ? 87  TRP B CE2 1 
ATOM   4558 C  CE3 . TRP B 1 86  ? 66.453  6.850   -19.783 1.00 17.53 ? 87  TRP B CE3 1 
ATOM   4559 C  CZ2 . TRP B 1 86  ? 63.703  7.369   -19.281 1.00 15.79 ? 87  TRP B CZ2 1 
ATOM   4560 C  CZ3 . TRP B 1 86  ? 65.452  6.029   -20.303 1.00 18.42 ? 87  TRP B CZ3 1 
ATOM   4561 C  CH2 . TRP B 1 86  ? 64.089  6.300   -20.049 1.00 18.14 ? 87  TRP B CH2 1 
ATOM   4562 N  N   . VAL B 1 87  ? 70.954  10.721  -18.451 1.00 17.02 ? 88  VAL B N   1 
ATOM   4563 C  CA  . VAL B 1 87  ? 72.406  10.839  -18.547 1.00 17.92 ? 88  VAL B CA  1 
ATOM   4564 C  C   . VAL B 1 87  ? 72.938  11.724  -17.413 1.00 18.30 ? 88  VAL B C   1 
ATOM   4565 O  O   . VAL B 1 87  ? 73.822  11.306  -16.666 1.00 18.66 ? 88  VAL B O   1 
ATOM   4566 C  CB  . VAL B 1 87  ? 72.837  11.384  -19.947 1.00 18.36 ? 88  VAL B CB  1 
ATOM   4567 C  CG1 . VAL B 1 87  ? 74.316  11.791  -19.969 1.00 18.56 ? 88  VAL B CG1 1 
ATOM   4568 C  CG2 . VAL B 1 87  ? 72.552  10.343  -21.034 1.00 18.63 ? 88  VAL B CG2 1 
ATOM   4569 N  N   . ALA B 1 88  ? 72.370  12.921  -17.258 1.00 18.51 ? 89  ALA B N   1 
ATOM   4570 C  CA  . ALA B 1 88  ? 72.851  13.867  -16.237 1.00 18.82 ? 89  ALA B CA  1 
ATOM   4571 C  C   . ALA B 1 88  ? 72.764  13.313  -14.822 1.00 19.07 ? 89  ALA B C   1 
ATOM   4572 O  O   . ALA B 1 88  ? 73.670  13.525  -14.018 1.00 19.14 ? 89  ALA B O   1 
ATOM   4573 C  CB  . ALA B 1 88  ? 72.115  15.209  -16.330 1.00 18.68 ? 89  ALA B CB  1 
ATOM   4574 N  N   . TYR B 1 89  ? 71.678  12.604  -14.514 1.00 19.41 ? 90  TYR B N   1 
ATOM   4575 C  CA  . TYR B 1 89  ? 71.549  11.975  -13.208 1.00 20.03 ? 90  TYR B CA  1 
ATOM   4576 C  C   . TYR B 1 89  ? 72.665  10.948  -12.944 1.00 20.77 ? 90  TYR B C   1 
ATOM   4577 O  O   . TYR B 1 89  ? 73.241  10.926  -11.866 1.00 20.77 ? 90  TYR B O   1 
ATOM   4578 C  CB  . TYR B 1 89  ? 70.172  11.330  -13.021 1.00 19.54 ? 90  TYR B CB  1 
ATOM   4579 C  CG  . TYR B 1 89  ? 70.130  10.440  -11.807 1.00 18.79 ? 90  TYR B CG  1 
ATOM   4580 C  CD1 . TYR B 1 89  ? 69.801  10.956  -10.555 1.00 17.27 ? 90  TYR B CD1 1 
ATOM   4581 C  CD2 . TYR B 1 89  ? 70.453  9.081   -11.902 1.00 17.29 ? 90  TYR B CD2 1 
ATOM   4582 C  CE1 . TYR B 1 89  ? 69.781  10.141  -9.434  1.00 17.18 ? 90  TYR B CE1 1 
ATOM   4583 C  CE2 . TYR B 1 89  ? 70.441  8.263   -10.785 1.00 16.72 ? 90  TYR B CE2 1 
ATOM   4584 C  CZ  . TYR B 1 89  ? 70.110  8.800   -9.555  1.00 16.32 ? 90  TYR B CZ  1 
ATOM   4585 O  OH  . TYR B 1 89  ? 70.082  7.994   -8.449  1.00 15.96 ? 90  TYR B OH  1 
ATOM   4586 N  N   . HIS B 1 90  ? 72.960  10.102  -13.923 1.00 22.01 ? 91  HIS B N   1 
ATOM   4587 C  CA  . HIS B 1 90  ? 73.971  9.060   -13.738 1.00 23.63 ? 91  HIS B CA  1 
ATOM   4588 C  C   . HIS B 1 90  ? 75.371  9.660   -13.611 1.00 24.89 ? 91  HIS B C   1 
ATOM   4589 O  O   . HIS B 1 90  ? 76.171  9.197   -12.800 1.00 24.53 ? 91  HIS B O   1 
ATOM   4590 C  CB  . HIS B 1 90  ? 73.944  8.045   -14.880 1.00 23.54 ? 91  HIS B CB  1 
ATOM   4591 C  CG  . HIS B 1 90  ? 72.787  7.099   -14.824 1.00 23.59 ? 91  HIS B CG  1 
ATOM   4592 N  ND1 . HIS B 1 90  ? 71.515  7.458   -15.210 1.00 25.20 ? 91  HIS B ND1 1 
ATOM   4593 C  CD2 . HIS B 1 90  ? 72.712  5.804   -14.442 1.00 24.04 ? 91  HIS B CD2 1 
ATOM   4594 C  CE1 . HIS B 1 90  ? 70.704  6.427   -15.062 1.00 24.47 ? 91  HIS B CE1 1 
ATOM   4595 N  NE2 . HIS B 1 90  ? 71.405  5.411   -14.594 1.00 24.08 ? 91  HIS B NE2 1 
ATOM   4596 N  N   . GLN B 1 91  ? 75.646  10.690  -14.413 1.00 26.36 ? 92  GLN B N   1 
ATOM   4597 C  CA  . GLN B 1 91  ? 76.944  11.361  -14.410 1.00 28.05 ? 92  GLN B CA  1 
ATOM   4598 C  C   . GLN B 1 91  ? 77.162  12.156  -13.126 1.00 28.70 ? 92  GLN B C   1 
ATOM   4599 O  O   . GLN B 1 91  ? 78.205  12.020  -12.481 1.00 29.00 ? 92  GLN B O   1 
ATOM   4600 C  CB  . GLN B 1 91  ? 77.119  12.238  -15.661 1.00 28.12 ? 92  GLN B CB  1 
ATOM   4601 C  CG  . GLN B 1 91  ? 77.348  11.410  -16.935 1.00 30.25 ? 92  GLN B CG  1 
ATOM   4602 C  CD  . GLN B 1 91  ? 77.521  12.232  -18.216 1.00 32.80 ? 92  GLN B CD  1 
ATOM   4603 O  OE1 . GLN B 1 91  ? 77.208  13.429  -18.266 1.00 34.74 ? 92  GLN B OE1 1 
ATOM   4604 N  NE2 . GLN B 1 91  ? 78.000  11.573  -19.270 1.00 32.27 ? 92  GLN B NE2 1 
ATOM   4605 N  N   . TYR B 1 92  ? 76.169  12.952  -12.735 1.00 29.68 ? 93  TYR B N   1 
ATOM   4606 C  CA  . TYR B 1 92  ? 76.298  13.798  -11.547 1.00 30.65 ? 93  TYR B CA  1 
ATOM   4607 C  C   . TYR B 1 92  ? 76.371  13.008  -10.241 1.00 30.80 ? 93  TYR B C   1 
ATOM   4608 O  O   . TYR B 1 92  ? 77.195  13.312  -9.378  1.00 30.77 ? 93  TYR B O   1 
ATOM   4609 C  CB  . TYR B 1 92  ? 75.189  14.851  -11.477 1.00 30.98 ? 93  TYR B CB  1 
ATOM   4610 C  CG  . TYR B 1 92  ? 75.421  15.907  -10.413 1.00 32.68 ? 93  TYR B CG  1 
ATOM   4611 C  CD1 . TYR B 1 92  ? 76.292  16.980  -10.641 1.00 34.37 ? 93  TYR B CD1 1 
ATOM   4612 C  CD2 . TYR B 1 92  ? 74.771  15.837  -9.177  1.00 34.65 ? 93  TYR B CD2 1 
ATOM   4613 C  CE1 . TYR B 1 92  ? 76.511  17.959  -9.659  1.00 35.77 ? 93  TYR B CE1 1 
ATOM   4614 C  CE2 . TYR B 1 92  ? 74.981  16.813  -8.186  1.00 35.83 ? 93  TYR B CE2 1 
ATOM   4615 C  CZ  . TYR B 1 92  ? 75.852  17.865  -8.438  1.00 36.55 ? 93  TYR B CZ  1 
ATOM   4616 O  OH  . TYR B 1 92  ? 76.060  18.827  -7.471  1.00 38.39 ? 93  TYR B OH  1 
ATOM   4617 N  N   . TYR B 1 93  ? 75.523  11.993  -10.103 1.00 30.94 ? 94  TYR B N   1 
ATOM   4618 C  CA  . TYR B 1 93  ? 75.510  11.168  -8.895  1.00 31.33 ? 94  TYR B CA  1 
ATOM   4619 C  C   . TYR B 1 93  ? 76.377  9.910   -9.028  1.00 31.56 ? 94  TYR B C   1 
ATOM   4620 O  O   . TYR B 1 93  ? 76.348  9.026   -8.170  1.00 31.82 ? 94  TYR B O   1 
ATOM   4621 C  CB  . TYR B 1 93  ? 74.068  10.855  -8.475  1.00 31.34 ? 94  TYR B CB  1 
ATOM   4622 C  CG  . TYR B 1 93  ? 73.321  12.095  -8.031  1.00 31.91 ? 94  TYR B CG  1 
ATOM   4623 C  CD1 . TYR B 1 93  ? 72.611  12.878  -8.949  1.00 31.72 ? 94  TYR B CD1 1 
ATOM   4624 C  CD2 . TYR B 1 93  ? 73.359  12.514  -6.698  1.00 31.94 ? 94  TYR B CD2 1 
ATOM   4625 C  CE1 . TYR B 1 93  ? 71.938  14.034  -8.543  1.00 31.62 ? 94  TYR B CE1 1 
ATOM   4626 C  CE2 . TYR B 1 93  ? 72.689  13.665  -6.286  1.00 31.69 ? 94  TYR B CE2 1 
ATOM   4627 C  CZ  . TYR B 1 93  ? 71.982  14.420  -7.211  1.00 31.82 ? 94  TYR B CZ  1 
ATOM   4628 O  OH  . TYR B 1 93  ? 71.319  15.559  -6.799  1.00 31.78 ? 94  TYR B OH  1 
ATOM   4629 N  N   . GLN B 1 94  ? 77.166  9.855   -10.098 1.00 31.89 ? 95  GLN B N   1 
ATOM   4630 C  CA  . GLN B 1 94  ? 78.109  8.753   -10.344 1.00 32.40 ? 95  GLN B CA  1 
ATOM   4631 C  C   . GLN B 1 94  ? 77.494  7.349   -10.196 1.00 32.12 ? 95  GLN B C   1 
ATOM   4632 O  O   . GLN B 1 94  ? 78.062  6.465   -9.540  1.00 32.34 ? 95  GLN B O   1 
ATOM   4633 C  CB  . GLN B 1 94  ? 79.343  8.898   -9.454  1.00 32.64 ? 95  GLN B CB  1 
ATOM   4634 C  CG  . GLN B 1 94  ? 80.086  10.211  -9.625  1.00 34.38 ? 95  GLN B CG  1 
ATOM   4635 C  CD  . GLN B 1 94  ? 81.289  10.287  -8.717  1.00 37.05 ? 95  GLN B CD  1 
ATOM   4636 O  OE1 . GLN B 1 94  ? 81.152  10.410  -7.492  1.00 37.98 ? 95  GLN B OE1 1 
ATOM   4637 N  NE2 . GLN B 1 94  ? 82.481  10.188  -9.305  1.00 36.79 ? 95  GLN B NE2 1 
ATOM   4638 N  N   . ARG B 1 95  ? 76.336  7.150   -10.817 1.00 31.61 ? 96  ARG B N   1 
ATOM   4639 C  CA  . ARG B 1 95  ? 75.668  5.858   -10.780 1.00 31.31 ? 96  ARG B CA  1 
ATOM   4640 C  C   . ARG B 1 95  ? 76.177  4.988   -11.918 1.00 30.79 ? 96  ARG B C   1 
ATOM   4641 O  O   . ARG B 1 95  ? 76.239  5.442   -13.058 1.00 30.99 ? 96  ARG B O   1 
ATOM   4642 C  CB  . ARG B 1 95  ? 74.158  6.031   -10.888 1.00 31.61 ? 96  ARG B CB  1 
ATOM   4643 C  CG  . ARG B 1 95  ? 73.569  6.977   -9.866  1.00 32.55 ? 96  ARG B CG  1 
ATOM   4644 C  CD  . ARG B 1 95  ? 73.129  6.260   -8.602  1.00 35.05 ? 96  ARG B CD  1 
ATOM   4645 N  NE  . ARG B 1 95  ? 73.026  7.205   -7.494  1.00 37.58 ? 96  ARG B NE  1 
ATOM   4646 C  CZ  . ARG B 1 95  ? 72.671  6.891   -6.254  1.00 39.39 ? 96  ARG B CZ  1 
ATOM   4647 N  NH1 . ARG B 1 95  ? 72.364  5.634   -5.936  1.00 39.68 ? 96  ARG B NH1 1 
ATOM   4648 N  NH2 . ARG B 1 95  ? 72.623  7.845   -5.328  1.00 39.87 ? 96  ARG B NH2 1 
ATOM   4649 N  N   . PRO B 1 96  ? 76.548  3.731   -11.616 1.00 30.29 ? 97  PRO B N   1 
ATOM   4650 C  CA  . PRO B 1 96  ? 77.025  2.838   -12.672 1.00 29.71 ? 97  PRO B CA  1 
ATOM   4651 C  C   . PRO B 1 96  ? 75.945  2.626   -13.728 1.00 29.13 ? 97  PRO B C   1 
ATOM   4652 O  O   . PRO B 1 96  ? 74.772  2.411   -13.399 1.00 28.98 ? 97  PRO B O   1 
ATOM   4653 C  CB  . PRO B 1 96  ? 77.339  1.537   -11.931 1.00 29.84 ? 97  PRO B CB  1 
ATOM   4654 C  CG  . PRO B 1 96  ? 76.580  1.636   -10.641 1.00 30.58 ? 97  PRO B CG  1 
ATOM   4655 C  CD  . PRO B 1 96  ? 76.514  3.074   -10.297 1.00 30.04 ? 97  PRO B CD  1 
ATOM   4656 N  N   . ILE B 1 97  ? 76.354  2.720   -14.987 1.00 28.29 ? 98  ILE B N   1 
ATOM   4657 C  CA  . ILE B 1 97  ? 75.434  2.698   -16.108 1.00 27.57 ? 98  ILE B CA  1 
ATOM   4658 C  C   . ILE B 1 97  ? 75.354  1.296   -16.678 1.00 27.25 ? 98  ILE B C   1 
ATOM   4659 O  O   . ILE B 1 97  ? 76.327  0.530   -16.635 1.00 27.34 ? 98  ILE B O   1 
ATOM   4660 C  CB  . ILE B 1 97  ? 75.849  3.710   -17.219 1.00 27.42 ? 98  ILE B CB  1 
ATOM   4661 C  CG1 . ILE B 1 97  ? 77.256  3.400   -17.747 1.00 26.77 ? 98  ILE B CG1 1 
ATOM   4662 C  CG2 . ILE B 1 97  ? 75.765  5.148   -16.691 1.00 27.29 ? 98  ILE B CG2 1 
ATOM   4663 C  CD1 . ILE B 1 97  ? 77.716  4.305   -18.872 1.00 26.80 ? 98  ILE B CD1 1 
ATOM   4664 N  N   . GLY B 1 98  ? 74.183  0.956   -17.197 1.00 26.35 ? 99  GLY B N   1 
ATOM   4665 C  CA  . GLY B 1 98  ? 74.000  -0.319  -17.854 1.00 25.17 ? 99  GLY B CA  1 
ATOM   4666 C  C   . GLY B 1 98  ? 74.003  -0.160  -19.358 1.00 24.57 ? 99  GLY B C   1 
ATOM   4667 O  O   . GLY B 1 98  ? 74.396  0.876   -19.895 1.00 24.47 ? 99  GLY B O   1 
ATOM   4668 N  N   . VAL B 1 99  ? 73.528  -1.199  -20.028 1.00 23.93 ? 100 VAL B N   1 
ATOM   4669 C  CA  . VAL B 1 99  ? 73.557  -1.305  -21.474 1.00 23.10 ? 100 VAL B CA  1 
ATOM   4670 C  C   . VAL B 1 99  ? 72.842  -0.118  -22.156 1.00 22.96 ? 100 VAL B C   1 
ATOM   4671 O  O   . VAL B 1 99  ? 73.272  0.357   -23.216 1.00 22.72 ? 100 VAL B O   1 
ATOM   4672 C  CB  . VAL B 1 99  ? 73.015  -2.706  -21.895 1.00 23.27 ? 100 VAL B CB  1 
ATOM   4673 C  CG1 . VAL B 1 99  ? 71.479  -2.788  -21.814 1.00 22.75 ? 100 VAL B CG1 1 
ATOM   4674 C  CG2 . VAL B 1 99  ? 73.543  -3.128  -23.252 1.00 23.71 ? 100 VAL B CG2 1 
ATOM   4675 N  N   . LEU B 1 100 ? 71.782  0.386   -21.526 1.00 22.47 ? 101 LEU B N   1 
ATOM   4676 C  CA  . LEU B 1 100 ? 71.027  1.514   -22.073 1.00 22.30 ? 101 LEU B CA  1 
ATOM   4677 C  C   . LEU B 1 100 ? 71.871  2.773   -22.318 1.00 22.23 ? 101 LEU B C   1 
ATOM   4678 O  O   . LEU B 1 100 ? 71.683  3.474   -23.307 1.00 21.40 ? 101 LEU B O   1 
ATOM   4679 C  CB  . LEU B 1 100 ? 69.840  1.853   -21.166 1.00 22.22 ? 101 LEU B CB  1 
ATOM   4680 C  CG  . LEU B 1 100 ? 68.946  3.019   -21.599 1.00 22.28 ? 101 LEU B CG  1 
ATOM   4681 C  CD1 . LEU B 1 100 ? 68.050  2.596   -22.731 1.00 21.75 ? 101 LEU B CD1 1 
ATOM   4682 C  CD2 . LEU B 1 100 ? 68.129  3.523   -20.432 1.00 22.50 ? 101 LEU B CD2 1 
ATOM   4683 N  N   . LEU B 1 101 ? 72.789  3.061   -21.406 1.00 22.68 ? 102 LEU B N   1 
ATOM   4684 C  CA  . LEU B 1 101 ? 73.526  4.317   -21.464 1.00 23.52 ? 102 LEU B CA  1 
ATOM   4685 C  C   . LEU B 1 101 ? 74.952  4.168   -21.985 1.00 23.88 ? 102 LEU B C   1 
ATOM   4686 O  O   . LEU B 1 101 ? 75.706  5.139   -22.007 1.00 24.46 ? 102 LEU B O   1 
ATOM   4687 C  CB  . LEU B 1 101 ? 73.517  5.007   -20.102 1.00 23.42 ? 102 LEU B CB  1 
ATOM   4688 C  CG  . LEU B 1 101 ? 72.166  5.482   -19.547 1.00 24.70 ? 102 LEU B CG  1 
ATOM   4689 C  CD1 . LEU B 1 101 ? 72.406  6.324   -18.310 1.00 25.77 ? 102 LEU B CD1 1 
ATOM   4690 C  CD2 . LEU B 1 101 ? 71.365  6.274   -20.566 1.00 24.56 ? 102 LEU B CD2 1 
ATOM   4691 N  N   . LYS B 1 102 ? 75.309  2.961   -22.414 1.00 24.04 ? 103 LYS B N   1 
ATOM   4692 C  CA  . LYS B 1 102 ? 76.640  2.693   -22.950 1.00 24.27 ? 103 LYS B CA  1 
ATOM   4693 C  C   . LYS B 1 102 ? 76.692  2.845   -24.470 1.00 24.67 ? 103 LYS B C   1 
ATOM   4694 O  O   . LYS B 1 102 ? 75.653  2.952   -25.136 1.00 24.66 ? 103 LYS B O   1 
ATOM   4695 C  CB  . LYS B 1 102 ? 77.129  1.304   -22.515 1.00 24.10 ? 103 LYS B CB  1 
ATOM   4696 C  CG  . LYS B 1 102 ? 77.474  1.218   -21.035 1.00 24.03 ? 103 LYS B CG  1 
ATOM   4697 C  CD  . LYS B 1 102 ? 78.081  -0.126  -20.655 1.00 25.04 ? 103 LYS B CD  1 
ATOM   4698 C  CE  . LYS B 1 102 ? 78.351  -0.172  -19.163 1.00 24.45 ? 103 LYS B CE  1 
ATOM   4699 N  NZ  . LYS B 1 102 ? 78.863  -1.481  -18.712 1.00 24.93 ? 103 LYS B NZ  1 
ATOM   4700 N  N   . LYS B 1 103 ? 77.911  2.881   -25.004 1.00 25.11 ? 104 LYS B N   1 
ATOM   4701 C  CA  . LYS B 1 103 ? 78.151  2.930   -26.447 1.00 25.94 ? 104 LYS B CA  1 
ATOM   4702 C  C   . LYS B 1 103 ? 79.399  2.116   -26.803 1.00 25.79 ? 104 LYS B C   1 
ATOM   4703 O  O   . LYS B 1 103 ? 80.135  1.684   -25.912 1.00 25.43 ? 104 LYS B O   1 
ATOM   4704 C  CB  . LYS B 1 103 ? 78.308  4.379   -26.927 1.00 26.22 ? 104 LYS B CB  1 
ATOM   4705 C  CG  . LYS B 1 103 ? 79.470  5.145   -26.285 1.00 28.94 ? 104 LYS B CG  1 
ATOM   4706 C  CD  . LYS B 1 103 ? 79.545  6.576   -26.795 1.00 31.55 ? 104 LYS B CD  1 
ATOM   4707 C  CE  . LYS B 1 103 ? 80.520  7.400   -25.973 1.00 33.87 ? 104 LYS B CE  1 
ATOM   4708 N  NZ  . LYS B 1 103 ? 80.650  8.797   -26.504 1.00 35.98 ? 104 LYS B NZ  1 
ATOM   4709 N  N   . SER B 1 104 ? 79.608  1.897   -28.101 1.00 26.08 ? 105 SER B N   1 
ATOM   4710 C  CA  . SER B 1 104 ? 80.845  1.311   -28.630 1.00 26.37 ? 105 SER B CA  1 
ATOM   4711 C  C   . SER B 1 104 ? 81.121  -0.081  -28.046 1.00 26.21 ? 105 SER B C   1 
ATOM   4712 O  O   . SER B 1 104 ? 80.179  -0.844  -27.783 1.00 26.14 ? 105 SER B O   1 
ATOM   4713 C  CB  . SER B 1 104 ? 82.029  2.268   -28.398 1.00 26.56 ? 105 SER B CB  1 
ATOM   4714 O  OG  . SER B 1 104 ? 83.108  1.978   -29.270 1.00 28.43 ? 105 SER B OG  1 
ATOM   4715 N  N   . ALA B 1 105 ? 82.402  -0.405  -27.846 1.00 25.75 ? 106 ALA B N   1 
ATOM   4716 C  CA  . ALA B 1 105 ? 82.816  -1.732  -27.367 1.00 25.39 ? 106 ALA B CA  1 
ATOM   4717 C  C   . ALA B 1 105 ? 82.296  -2.059  -25.971 1.00 24.97 ? 106 ALA B C   1 
ATOM   4718 O  O   . ALA B 1 105 ? 81.970  -3.222  -25.688 1.00 24.86 ? 106 ALA B O   1 
ATOM   4719 C  CB  . ALA B 1 105 ? 84.344  -1.879  -27.408 1.00 25.41 ? 106 ALA B CB  1 
ATOM   4720 N  N   . ALA B 1 106 ? 82.229  -1.048  -25.100 1.00 24.20 ? 107 ALA B N   1 
ATOM   4721 C  CA  . ALA B 1 106 ? 81.690  -1.248  -23.757 1.00 23.99 ? 107 ALA B CA  1 
ATOM   4722 C  C   . ALA B 1 106 ? 80.214  -1.666  -23.799 1.00 23.78 ? 107 ALA B C   1 
ATOM   4723 O  O   . ALA B 1 106 ? 79.777  -2.457  -22.965 1.00 23.57 ? 107 ALA B O   1 
ATOM   4724 C  CB  . ALA B 1 106 ? 81.885  -0.014  -22.883 1.00 23.93 ? 107 ALA B CB  1 
ATOM   4725 N  N   . TRP B 1 107 ? 79.460  -1.147  -24.770 1.00 23.38 ? 108 TRP B N   1 
ATOM   4726 C  CA  . TRP B 1 107 ? 78.070  -1.560  -24.949 1.00 23.51 ? 108 TRP B CA  1 
ATOM   4727 C  C   . TRP B 1 107 ? 77.982  -2.988  -25.475 1.00 24.00 ? 108 TRP B C   1 
ATOM   4728 O  O   . TRP B 1 107 ? 77.155  -3.772  -25.018 1.00 23.99 ? 108 TRP B O   1 
ATOM   4729 C  CB  . TRP B 1 107 ? 77.304  -0.624  -25.897 1.00 22.79 ? 108 TRP B CB  1 
ATOM   4730 C  CG  . TRP B 1 107 ? 76.001  -1.231  -26.328 1.00 21.55 ? 108 TRP B CG  1 
ATOM   4731 C  CD1 . TRP B 1 107 ? 74.821  -1.214  -25.635 1.00 20.73 ? 108 TRP B CD1 1 
ATOM   4732 C  CD2 . TRP B 1 107 ? 75.755  -1.995  -27.518 1.00 20.94 ? 108 TRP B CD2 1 
ATOM   4733 N  NE1 . TRP B 1 107 ? 73.854  -1.899  -26.327 1.00 20.11 ? 108 TRP B NE1 1 
ATOM   4734 C  CE2 . TRP B 1 107 ? 74.399  -2.397  -27.482 1.00 20.81 ? 108 TRP B CE2 1 
ATOM   4735 C  CE3 . TRP B 1 107 ? 76.544  -2.373  -28.613 1.00 19.65 ? 108 TRP B CE3 1 
ATOM   4736 C  CZ2 . TRP B 1 107 ? 73.813  -3.160  -28.502 1.00 19.97 ? 108 TRP B CZ2 1 
ATOM   4737 C  CZ3 . TRP B 1 107 ? 75.959  -3.135  -29.629 1.00 20.15 ? 108 TRP B CZ3 1 
ATOM   4738 C  CH2 . TRP B 1 107 ? 74.603  -3.515  -29.563 1.00 20.00 ? 108 TRP B CH2 1 
ATOM   4739 N  N   . LYS B 1 108 ? 78.825  -3.298  -26.455 1.00 24.72 ? 109 LYS B N   1 
ATOM   4740 C  CA  . LYS B 1 108 ? 78.845  -4.600  -27.121 1.00 25.72 ? 109 LYS B CA  1 
ATOM   4741 C  C   . LYS B 1 108 ? 79.099  -5.742  -26.130 1.00 25.87 ? 109 LYS B C   1 
ATOM   4742 O  O   . LYS B 1 108 ? 78.455  -6.791  -26.205 1.00 25.73 ? 109 LYS B O   1 
ATOM   4743 C  CB  . LYS B 1 108 ? 79.904  -4.591  -28.235 1.00 25.85 ? 109 LYS B CB  1 
ATOM   4744 C  CG  . LYS B 1 108 ? 80.025  -5.883  -29.042 1.00 28.23 ? 109 LYS B CG  1 
ATOM   4745 C  CD  . LYS B 1 108 ? 78.841  -6.099  -29.988 1.00 30.61 ? 109 LYS B CD  1 
ATOM   4746 C  CE  . LYS B 1 108 ? 79.157  -7.189  -31.005 1.00 33.59 ? 109 LYS B CE  1 
ATOM   4747 N  NZ  . LYS B 1 108 ? 78.045  -7.375  -31.979 1.00 35.03 ? 109 LYS B NZ  1 
ATOM   4748 N  N   . LYS B 1 109 ? 80.018  -5.506  -25.193 1.00 26.07 ? 110 LYS B N   1 
ATOM   4749 C  CA  . LYS B 1 109 ? 80.411  -6.496  -24.194 1.00 26.70 ? 110 LYS B CA  1 
ATOM   4750 C  C   . LYS B 1 109 ? 79.262  -6.840  -23.227 1.00 26.55 ? 110 LYS B C   1 
ATOM   4751 O  O   . LYS B 1 109 ? 79.013  -8.015  -22.958 1.00 26.61 ? 110 LYS B O   1 
ATOM   4752 C  CB  . LYS B 1 109 ? 81.636  -5.996  -23.425 1.00 26.94 ? 110 LYS B CB  1 
ATOM   4753 C  CG  . LYS B 1 109 ? 82.301  -7.033  -22.532 1.00 28.91 ? 110 LYS B CG  1 
ATOM   4754 C  CD  . LYS B 1 109 ? 83.197  -6.351  -21.502 1.00 31.29 ? 110 LYS B CD  1 
ATOM   4755 C  CE  . LYS B 1 109 ? 84.075  -7.359  -20.791 1.00 32.94 ? 110 LYS B CE  1 
ATOM   4756 N  NZ  . LYS B 1 109 ? 84.912  -6.699  -19.745 1.00 34.91 ? 110 LYS B NZ  1 
ATOM   4757 N  N   . ASP B 1 110 ? 78.573  -5.822  -22.707 1.00 26.28 ? 111 ASP B N   1 
ATOM   4758 C  CA  . ASP B 1 110 ? 77.364  -6.044  -21.895 1.00 25.98 ? 111 ASP B CA  1 
ATOM   4759 C  C   . ASP B 1 110 ? 76.262  -6.730  -22.695 1.00 25.26 ? 111 ASP B C   1 
ATOM   4760 O  O   . ASP B 1 110 ? 75.703  -7.728  -22.251 1.00 25.60 ? 111 ASP B O   1 
ATOM   4761 C  CB  . ASP B 1 110 ? 76.835  -4.734  -21.308 1.00 26.26 ? 111 ASP B CB  1 
ATOM   4762 C  CG  . ASP B 1 110 ? 77.547  -4.335  -20.028 1.00 28.21 ? 111 ASP B CG  1 
ATOM   4763 O  OD1 . ASP B 1 110 ? 78.662  -4.853  -19.779 1.00 30.30 ? 111 ASP B OD1 1 
ATOM   4764 O  OD2 . ASP B 1 110 ? 76.989  -3.501  -19.270 1.00 29.31 ? 111 ASP B OD2 1 
ATOM   4765 N  N   . ARG B 1 111 ? 75.967  -6.205  -23.880 1.00 24.73 ? 112 ARG B N   1 
ATOM   4766 C  CA  . ARG B 1 111 ? 74.890  -6.745  -24.705 1.00 24.30 ? 112 ARG B CA  1 
ATOM   4767 C  C   . ARG B 1 111 ? 75.058  -8.239  -25.014 1.00 24.50 ? 112 ARG B C   1 
ATOM   4768 O  O   . ARG B 1 111 ? 74.109  -9.012  -24.857 1.00 24.78 ? 112 ARG B O   1 
ATOM   4769 C  CB  . ARG B 1 111 ? 74.707  -5.932  -25.993 1.00 23.63 ? 112 ARG B CB  1 
ATOM   4770 C  CG  . ARG B 1 111 ? 73.442  -6.277  -26.778 1.00 21.66 ? 112 ARG B CG  1 
ATOM   4771 C  CD  . ARG B 1 111 ? 72.171  -6.059  -25.955 1.00 19.50 ? 112 ARG B CD  1 
ATOM   4772 N  NE  . ARG B 1 111 ? 70.993  -6.628  -26.612 1.00 17.94 ? 112 ARG B NE  1 
ATOM   4773 C  CZ  . ARG B 1 111 ? 69.962  -5.922  -27.072 1.00 18.44 ? 112 ARG B CZ  1 
ATOM   4774 N  NH1 . ARG B 1 111 ? 69.924  -4.595  -26.935 1.00 16.27 ? 112 ARG B NH1 1 
ATOM   4775 N  NH2 . ARG B 1 111 ? 68.944  -6.548  -27.648 1.00 16.61 ? 112 ARG B NH2 1 
ATOM   4776 N  N   . VAL B 1 112 ? 76.258  -8.638  -25.436 1.00 24.62 ? 113 VAL B N   1 
ATOM   4777 C  CA  . VAL B 1 112 ? 76.531  -10.039 -25.776 1.00 24.72 ? 113 VAL B CA  1 
ATOM   4778 C  C   . VAL B 1 112 ? 76.363  -10.949 -24.558 1.00 24.63 ? 113 VAL B C   1 
ATOM   4779 O  O   . VAL B 1 112 ? 75.747  -12.011 -24.657 1.00 24.98 ? 113 VAL B O   1 
ATOM   4780 C  CB  . VAL B 1 112 ? 77.933  -10.235 -26.417 1.00 24.91 ? 113 VAL B CB  1 
ATOM   4781 C  CG1 . VAL B 1 112 ? 78.332  -11.719 -26.417 1.00 25.84 ? 113 VAL B CG1 1 
ATOM   4782 C  CG2 . VAL B 1 112 ? 77.944  -9.699  -27.835 1.00 24.47 ? 113 VAL B CG2 1 
ATOM   4783 N  N   . ALA B 1 113 ? 76.899  -10.529 -23.416 1.00 24.04 ? 114 ALA B N   1 
ATOM   4784 C  CA  . ALA B 1 113 ? 76.733  -11.288 -22.182 1.00 23.77 ? 114 ALA B CA  1 
ATOM   4785 C  C   . ALA B 1 113 ? 75.262  -11.382 -21.750 1.00 23.86 ? 114 ALA B C   1 
ATOM   4786 O  O   . ALA B 1 113 ? 74.806  -12.445 -21.314 1.00 23.77 ? 114 ALA B O   1 
ATOM   4787 C  CB  . ALA B 1 113 ? 77.581  -10.699 -21.075 1.00 23.57 ? 114 ALA B CB  1 
ATOM   4788 N  N   . LEU B 1 114 ? 74.523  -10.280 -21.892 1.00 23.65 ? 115 LEU B N   1 
ATOM   4789 C  CA  . LEU B 1 114 ? 73.117  -10.261 -21.499 1.00 23.60 ? 115 LEU B CA  1 
ATOM   4790 C  C   . LEU B 1 114 ? 72.227  -11.069 -22.443 1.00 23.66 ? 115 LEU B C   1 
ATOM   4791 O  O   . LEU B 1 114 ? 71.330  -11.778 -21.983 1.00 23.22 ? 115 LEU B O   1 
ATOM   4792 C  CB  . LEU B 1 114 ? 72.595  -8.830  -21.357 1.00 23.43 ? 115 LEU B CB  1 
ATOM   4793 C  CG  . LEU B 1 114 ? 73.146  -7.994  -20.200 1.00 23.62 ? 115 LEU B CG  1 
ATOM   4794 C  CD1 . LEU B 1 114 ? 72.734  -6.540  -20.363 1.00 22.92 ? 115 LEU B CD1 1 
ATOM   4795 C  CD2 . LEU B 1 114 ? 72.708  -8.540  -18.846 1.00 22.14 ? 115 LEU B CD2 1 
ATOM   4796 N  N   . ASN B 1 115 ? 72.495  -10.965 -23.747 1.00 23.80 ? 116 ASN B N   1 
ATOM   4797 C  CA  . ASN B 1 115 ? 71.722  -11.662 -24.774 1.00 24.24 ? 116 ASN B CA  1 
ATOM   4798 C  C   . ASN B 1 115 ? 71.641  -13.172 -24.578 1.00 24.98 ? 116 ASN B C   1 
ATOM   4799 O  O   . ASN B 1 115 ? 70.608  -13.781 -24.858 1.00 24.85 ? 116 ASN B O   1 
ATOM   4800 C  CB  . ASN B 1 115 ? 72.266  -11.356 -26.174 1.00 24.21 ? 116 ASN B CB  1 
ATOM   4801 C  CG  . ASN B 1 115 ? 71.737  -10.048 -26.742 1.00 24.03 ? 116 ASN B CG  1 
ATOM   4802 O  OD1 . ASN B 1 115 ? 70.925  -9.369  -26.123 1.00 22.84 ? 116 ASN B OD1 1 
ATOM   4803 N  ND2 . ASN B 1 115 ? 72.200  -9.695  -27.935 1.00 23.78 ? 116 ASN B ND2 1 
ATOM   4804 N  N   . GLN B 1 116 ? 72.717  -13.786 -24.099 1.00 25.91 ? 117 GLN B N   1 
ATOM   4805 C  CA  . GLN B 1 116 ? 72.681  -15.228 -23.912 1.00 27.02 ? 117 GLN B CA  1 
ATOM   4806 C  C   . GLN B 1 116 ? 71.869  -15.676 -22.682 1.00 26.97 ? 117 GLN B C   1 
ATOM   4807 O  O   . GLN B 1 116 ? 71.467  -16.837 -22.594 1.00 27.03 ? 117 GLN B O   1 
ATOM   4808 C  CB  . GLN B 1 116 ? 74.078  -15.872 -24.011 1.00 27.63 ? 117 GLN B CB  1 
ATOM   4809 C  CG  . GLN B 1 116 ? 75.098  -15.485 -22.968 1.00 29.71 ? 117 GLN B CG  1 
ATOM   4810 C  CD  . GLN B 1 116 ? 76.394  -16.300 -23.109 1.00 33.02 ? 117 GLN B CD  1 
ATOM   4811 O  OE1 . GLN B 1 116 ? 77.233  -16.020 -23.976 1.00 33.13 ? 117 GLN B OE1 1 
ATOM   4812 N  NE2 . GLN B 1 116 ? 76.554  -17.312 -22.257 1.00 33.12 ? 117 GLN B NE2 1 
ATOM   4813 N  N   . GLU B 1 117 ? 71.583  -14.746 -21.774 1.00 26.80 ? 118 GLU B N   1 
ATOM   4814 C  CA  . GLU B 1 117 ? 70.701  -15.047 -20.646 1.00 26.74 ? 118 GLU B CA  1 
ATOM   4815 C  C   . GLU B 1 117 ? 69.253  -14.541 -20.789 1.00 26.40 ? 118 GLU B C   1 
ATOM   4816 O  O   . GLU B 1 117 ? 68.358  -15.049 -20.111 1.00 25.99 ? 118 GLU B O   1 
ATOM   4817 C  CB  . GLU B 1 117 ? 71.310  -14.582 -19.318 1.00 27.06 ? 118 GLU B CB  1 
ATOM   4818 C  CG  . GLU B 1 117 ? 72.599  -15.326 -18.889 1.00 28.68 ? 118 GLU B CG  1 
ATOM   4819 C  CD  . GLU B 1 117 ? 72.501  -16.850 -18.981 1.00 31.32 ? 118 GLU B CD  1 
ATOM   4820 O  OE1 . GLU B 1 117 ? 71.385  -17.414 -18.851 1.00 31.75 ? 118 GLU B OE1 1 
ATOM   4821 O  OE2 . GLU B 1 117 ? 73.558  -17.490 -19.184 1.00 33.22 ? 118 GLU B OE2 1 
ATOM   4822 N  N   . VAL B 1 118 ? 69.012  -13.572 -21.672 1.00 26.24 ? 119 VAL B N   1 
ATOM   4823 C  CA  . VAL B 1 118 ? 67.673  -12.959 -21.762 1.00 25.93 ? 119 VAL B CA  1 
ATOM   4824 C  C   . VAL B 1 118 ? 67.030  -12.970 -23.159 1.00 25.95 ? 119 VAL B C   1 
ATOM   4825 O  O   . VAL B 1 118 ? 65.820  -12.774 -23.279 1.00 25.65 ? 119 VAL B O   1 
ATOM   4826 C  CB  . VAL B 1 118 ? 67.629  -11.519 -21.134 1.00 26.02 ? 119 VAL B CB  1 
ATOM   4827 C  CG1 . VAL B 1 118 ? 68.456  -11.456 -19.850 1.00 25.83 ? 119 VAL B CG1 1 
ATOM   4828 C  CG2 . VAL B 1 118 ? 68.103  -10.471 -22.120 1.00 25.45 ? 119 VAL B CG2 1 
ATOM   4829 N  N   . MET B 1 119 ? 67.831  -13.205 -24.199 1.00 26.45 ? 120 MET B N   1 
ATOM   4830 C  CA  . MET B 1 119 ? 67.336  -13.227 -25.582 1.00 27.11 ? 120 MET B CA  1 
ATOM   4831 C  C   . MET B 1 119 ? 67.387  -14.625 -26.205 1.00 27.20 ? 120 MET B C   1 
ATOM   4832 O  O   . MET B 1 119 ? 66.495  -14.992 -26.970 1.00 26.96 ? 120 MET B O   1 
ATOM   4833 C  CB  . MET B 1 119 ? 68.105  -12.237 -26.478 1.00 27.34 ? 120 MET B CB  1 
ATOM   4834 C  CG  . MET B 1 119 ? 67.828  -10.744 -26.247 1.00 29.73 ? 120 MET B CG  1 
ATOM   4835 S  SD  . MET B 1 119 ? 66.200  -10.151 -26.796 1.00 35.88 ? 120 MET B SD  1 
ATOM   4836 C  CE  . MET B 1 119 ? 66.371  -10.072 -28.578 1.00 33.47 ? 120 MET B CE  1 
ATOM   4837 N  N   . ALA B 1 120 ? 68.425  -15.397 -25.879 1.00 27.46 ? 121 ALA B N   1 
ATOM   4838 C  CA  . ALA B 1 120 ? 68.651  -16.710 -26.513 1.00 28.06 ? 121 ALA B CA  1 
ATOM   4839 C  C   . ALA B 1 120 ? 67.552  -17.737 -26.204 1.00 28.38 ? 121 ALA B C   1 
ATOM   4840 O  O   . ALA B 1 120 ? 67.175  -17.908 -25.038 1.00 28.25 ? 121 ALA B O   1 
ATOM   4841 C  CB  . ALA B 1 120 ? 70.028  -17.265 -26.133 1.00 27.76 ? 121 ALA B CB  1 
ATOM   4842 N  N   . PRO B 1 121 ? 67.048  -18.435 -27.248 1.00 28.81 ? 122 PRO B N   1 
ATOM   4843 C  CA  . PRO B 1 121 ? 65.979  -19.429 -27.079 1.00 29.22 ? 122 PRO B CA  1 
ATOM   4844 C  C   . PRO B 1 121 ? 66.273  -20.460 -25.990 1.00 29.46 ? 122 PRO B C   1 
ATOM   4845 O  O   . PRO B 1 121 ? 65.355  -20.890 -25.291 1.00 29.49 ? 122 PRO B O   1 
ATOM   4846 C  CB  . PRO B 1 121 ? 65.912  -20.108 -28.449 1.00 29.14 ? 122 PRO B CB  1 
ATOM   4847 C  CG  . PRO B 1 121 ? 66.351  -19.042 -29.401 1.00 29.36 ? 122 PRO B CG  1 
ATOM   4848 C  CD  . PRO B 1 121 ? 67.424  -18.274 -28.667 1.00 28.97 ? 122 PRO B CD  1 
ATOM   4849 N  N   . GLU B 1 122 ? 67.543  -20.824 -25.833 1.00 29.73 ? 123 GLU B N   1 
ATOM   4850 C  CA  . GLU B 1 122 ? 67.958  -21.814 -24.834 1.00 30.19 ? 123 GLU B CA  1 
ATOM   4851 C  C   . GLU B 1 122 ? 67.827  -21.289 -23.412 1.00 29.68 ? 123 GLU B C   1 
ATOM   4852 O  O   . GLU B 1 122 ? 67.609  -22.062 -22.478 1.00 29.89 ? 123 GLU B O   1 
ATOM   4853 C  CB  . GLU B 1 122 ? 69.397  -22.274 -25.089 1.00 30.83 ? 123 GLU B CB  1 
ATOM   4854 C  CG  . GLU B 1 122 ? 69.581  -23.055 -26.402 1.00 33.40 ? 123 GLU B CG  1 
ATOM   4855 C  CD  . GLU B 1 122 ? 69.790  -22.155 -27.619 1.00 37.26 ? 123 GLU B CD  1 
ATOM   4856 O  OE1 . GLU B 1 122 ? 69.863  -20.908 -27.463 1.00 37.18 ? 123 GLU B OE1 1 
ATOM   4857 O  OE2 . GLU B 1 122 ? 69.887  -22.707 -28.743 1.00 39.60 ? 123 GLU B OE2 1 
ATOM   4858 N  N   . ALA B 1 123 ? 67.981  -19.975 -23.253 1.00 29.06 ? 124 ALA B N   1 
ATOM   4859 C  CA  . ALA B 1 123 ? 67.731  -19.322 -21.975 1.00 28.41 ? 124 ALA B CA  1 
ATOM   4860 C  C   . ALA B 1 123 ? 66.238  -19.068 -21.757 1.00 27.70 ? 124 ALA B C   1 
ATOM   4861 O  O   . ALA B 1 123 ? 65.729  -19.320 -20.669 1.00 27.88 ? 124 ALA B O   1 
ATOM   4862 C  CB  . ALA B 1 123 ? 68.518  -18.014 -21.870 1.00 28.16 ? 124 ALA B CB  1 
ATOM   4863 N  N   . THR B 1 124 ? 65.542  -18.591 -22.789 1.00 26.90 ? 125 THR B N   1 
ATOM   4864 C  CA  . THR B 1 124 ? 64.168  -18.099 -22.621 1.00 26.53 ? 125 THR B CA  1 
ATOM   4865 C  C   . THR B 1 124 ? 63.133  -19.192 -22.355 1.00 26.38 ? 125 THR B C   1 
ATOM   4866 O  O   . THR B 1 124 ? 62.105  -18.923 -21.720 1.00 25.89 ? 125 THR B O   1 
ATOM   4867 C  CB  . THR B 1 124 ? 63.685  -17.204 -23.795 1.00 26.51 ? 125 THR B CB  1 
ATOM   4868 O  OG1 . THR B 1 124 ? 63.569  -17.988 -24.988 1.00 26.46 ? 125 THR B OG1 1 
ATOM   4869 C  CG2 . THR B 1 124 ? 64.633  -16.012 -24.016 1.00 26.06 ? 125 THR B CG2 1 
ATOM   4870 N  N   . LYS B 1 125 ? 63.407  -20.412 -22.824 1.00 26.06 ? 126 LYS B N   1 
ATOM   4871 C  CA  . LYS B 1 125 ? 62.543  -21.569 -22.540 1.00 26.34 ? 126 LYS B CA  1 
ATOM   4872 C  C   . LYS B 1 125 ? 62.327  -21.768 -21.033 1.00 25.68 ? 126 LYS B C   1 
ATOM   4873 O  O   . LYS B 1 125 ? 61.282  -22.230 -20.610 1.00 26.00 ? 126 LYS B O   1 
ATOM   4874 C  CB  . LYS B 1 125 ? 63.098  -22.851 -23.184 1.00 26.54 ? 126 LYS B CB  1 
ATOM   4875 C  CG  . LYS B 1 125 ? 64.386  -23.357 -22.552 1.00 28.77 ? 126 LYS B CG  1 
ATOM   4876 C  CD  . LYS B 1 125 ? 64.951  -24.592 -23.248 1.00 32.02 ? 126 LYS B CD  1 
ATOM   4877 C  CE  . LYS B 1 125 ? 66.243  -25.039 -22.558 1.00 34.13 ? 126 LYS B CE  1 
ATOM   4878 N  NZ  . LYS B 1 125 ? 67.175  -25.750 -23.498 1.00 36.46 ? 126 LYS B NZ  1 
ATOM   4879 N  N   . ASN B 1 126 ? 63.314  -21.391 -20.229 1.00 25.62 ? 127 ASN B N   1 
ATOM   4880 C  CA  . ASN B 1 126 ? 63.203  -21.464 -18.769 1.00 25.01 ? 127 ASN B CA  1 
ATOM   4881 C  C   . ASN B 1 126 ? 62.303  -20.386 -18.148 1.00 24.52 ? 127 ASN B C   1 
ATOM   4882 O  O   . ASN B 1 126 ? 61.957  -20.467 -16.965 1.00 24.26 ? 127 ASN B O   1 
ATOM   4883 C  CB  . ASN B 1 126 ? 64.589  -21.412 -18.147 1.00 25.36 ? 127 ASN B CB  1 
ATOM   4884 C  CG  . ASN B 1 126 ? 65.445  -22.591 -18.546 1.00 26.32 ? 127 ASN B CG  1 
ATOM   4885 O  OD1 . ASN B 1 126 ? 65.161  -23.723 -18.173 1.00 29.34 ? 127 ASN B OD1 1 
ATOM   4886 N  ND2 . ASN B 1 126 ? 66.496  -22.334 -19.304 1.00 27.02 ? 127 ASN B ND2 1 
ATOM   4887 N  N   . PHE B 1 127 ? 61.922  -19.387 -18.943 1.00 23.80 ? 128 PHE B N   1 
ATOM   4888 C  CA  . PHE B 1 127 ? 61.052  -18.317 -18.447 1.00 23.59 ? 128 PHE B CA  1 
ATOM   4889 C  C   . PHE B 1 127 ? 59.603  -18.776 -18.307 1.00 23.43 ? 128 PHE B C   1 
ATOM   4890 O  O   . PHE B 1 127 ? 58.883  -18.294 -17.435 1.00 23.55 ? 128 PHE B O   1 
ATOM   4891 C  CB  . PHE B 1 127 ? 61.104  -17.063 -19.338 1.00 23.18 ? 128 PHE B CB  1 
ATOM   4892 C  CG  . PHE B 1 127 ? 62.463  -16.392 -19.405 1.00 23.14 ? 128 PHE B CG  1 
ATOM   4893 C  CD1 . PHE B 1 127 ? 63.441  -16.632 -18.443 1.00 23.71 ? 128 PHE B CD1 1 
ATOM   4894 C  CD2 . PHE B 1 127 ? 62.742  -15.486 -20.425 1.00 23.00 ? 128 PHE B CD2 1 
ATOM   4895 C  CE1 . PHE B 1 127 ? 64.686  -16.000 -18.510 1.00 24.05 ? 128 PHE B CE1 1 
ATOM   4896 C  CE2 . PHE B 1 127 ? 63.978  -14.845 -20.501 1.00 23.42 ? 128 PHE B CE2 1 
ATOM   4897 C  CZ  . PHE B 1 127 ? 64.952  -15.101 -19.541 1.00 23.51 ? 128 PHE B CZ  1 
ATOM   4898 N  N   . LEU B 1 128 ? 59.187  -19.708 -19.165 1.00 23.16 ? 129 LEU B N   1 
ATOM   4899 C  CA  . LEU B 1 128 ? 57.777  -20.113 -19.275 1.00 22.86 ? 129 LEU B CA  1 
ATOM   4900 C  C   . LEU B 1 128 ? 57.065  -20.431 -17.947 1.00 22.40 ? 129 LEU B C   1 
ATOM   4901 O  O   . LEU B 1 128 ? 56.041  -19.818 -17.658 1.00 22.37 ? 129 LEU B O   1 
ATOM   4902 C  CB  . LEU B 1 128 ? 57.585  -21.240 -20.308 1.00 22.99 ? 129 LEU B CB  1 
ATOM   4903 C  CG  . LEU B 1 128 ? 58.270  -21.096 -21.678 1.00 23.82 ? 129 LEU B CG  1 
ATOM   4904 C  CD1 . LEU B 1 128 ? 57.679  -22.079 -22.674 1.00 24.87 ? 129 LEU B CD1 1 
ATOM   4905 C  CD2 . LEU B 1 128 ? 58.199  -19.685 -22.250 1.00 23.62 ? 129 LEU B CD2 1 
ATOM   4906 N  N   . PRO B 1 129 ? 57.602  -21.368 -17.134 1.00 22.03 ? 130 PRO B N   1 
ATOM   4907 C  CA  . PRO B 1 129 ? 56.907  -21.687 -15.869 1.00 21.61 ? 130 PRO B CA  1 
ATOM   4908 C  C   . PRO B 1 129 ? 56.882  -20.526 -14.873 1.00 21.22 ? 130 PRO B C   1 
ATOM   4909 O  O   . PRO B 1 129 ? 55.910  -20.380 -14.106 1.00 21.16 ? 130 PRO B O   1 
ATOM   4910 C  CB  . PRO B 1 129 ? 57.732  -22.840 -15.279 1.00 21.76 ? 130 PRO B CB  1 
ATOM   4911 C  CG  . PRO B 1 129 ? 58.666  -23.283 -16.370 1.00 21.90 ? 130 PRO B CG  1 
ATOM   4912 C  CD  . PRO B 1 129 ? 58.856  -22.134 -17.285 1.00 21.88 ? 130 PRO B CD  1 
ATOM   4913 N  N   . LEU B 1 130 ? 57.944  -19.717 -14.886 1.00 20.49 ? 131 LEU B N   1 
ATOM   4914 C  CA  . LEU B 1 130 ? 58.072  -18.575 -13.981 1.00 19.73 ? 131 LEU B CA  1 
ATOM   4915 C  C   . LEU B 1 130 ? 57.065  -17.476 -14.332 1.00 19.43 ? 131 LEU B C   1 
ATOM   4916 O  O   . LEU B 1 130 ? 56.527  -16.813 -13.434 1.00 19.34 ? 131 LEU B O   1 
ATOM   4917 C  CB  . LEU B 1 130 ? 59.507  -18.022 -13.993 1.00 19.50 ? 131 LEU B CB  1 
ATOM   4918 C  CG  . LEU B 1 130 ? 60.638  -18.896 -13.415 1.00 19.60 ? 131 LEU B CG  1 
ATOM   4919 C  CD1 . LEU B 1 130 ? 61.995  -18.295 -13.732 1.00 18.27 ? 131 LEU B CD1 1 
ATOM   4920 C  CD2 . LEU B 1 130 ? 60.501  -19.101 -11.906 1.00 18.49 ? 131 LEU B CD2 1 
ATOM   4921 N  N   . LEU B 1 131 ? 56.810  -17.291 -15.628 1.00 18.31 ? 132 LEU B N   1 
ATOM   4922 C  CA  . LEU B 1 131 ? 55.845  -16.289 -16.079 1.00 18.29 ? 132 LEU B CA  1 
ATOM   4923 C  C   . LEU B 1 131 ? 54.413  -16.818 -16.009 1.00 18.14 ? 132 LEU B C   1 
ATOM   4924 O  O   . LEU B 1 131 ? 53.483  -16.063 -15.744 1.00 18.33 ? 132 LEU B O   1 
ATOM   4925 C  CB  . LEU B 1 131 ? 56.163  -15.788 -17.500 1.00 18.00 ? 132 LEU B CB  1 
ATOM   4926 C  CG  . LEU B 1 131 ? 57.465  -15.000 -17.749 1.00 17.53 ? 132 LEU B CG  1 
ATOM   4927 C  CD1 . LEU B 1 131 ? 57.792  -14.951 -19.241 1.00 16.23 ? 132 LEU B CD1 1 
ATOM   4928 C  CD2 . LEU B 1 131 ? 57.402  -13.591 -17.177 1.00 16.80 ? 132 LEU B CD2 1 
ATOM   4929 N  N   . ASP B 1 132 ? 54.245  -18.115 -16.252 1.00 18.06 ? 133 ASP B N   1 
ATOM   4930 C  CA  . ASP B 1 132 ? 52.935  -18.745 -16.204 1.00 18.27 ? 133 ASP B CA  1 
ATOM   4931 C  C   . ASP B 1 132 ? 52.359  -18.772 -14.780 1.00 17.84 ? 133 ASP B C   1 
ATOM   4932 O  O   . ASP B 1 132 ? 51.185  -18.460 -14.589 1.00 17.25 ? 133 ASP B O   1 
ATOM   4933 C  CB  . ASP B 1 132 ? 52.994  -20.142 -16.806 1.00 18.77 ? 133 ASP B CB  1 
ATOM   4934 C  CG  . ASP B 1 132 ? 51.635  -20.660 -17.198 1.00 21.53 ? 133 ASP B CG  1 
ATOM   4935 O  OD1 . ASP B 1 132 ? 51.493  -21.898 -17.278 1.00 25.22 ? 133 ASP B OD1 1 
ATOM   4936 O  OD2 . ASP B 1 132 ? 50.712  -19.837 -17.429 1.00 23.48 ? 133 ASP B OD2 1 
ATOM   4937 N  N   . ALA B 1 133 ? 53.200  -19.113 -13.799 1.00 17.91 ? 134 ALA B N   1 
ATOM   4938 C  CA  . ALA B 1 133 ? 52.858  -18.988 -12.366 1.00 18.36 ? 134 ALA B CA  1 
ATOM   4939 C  C   . ALA B 1 133 ? 52.283  -17.622 -11.980 1.00 18.21 ? 134 ALA B C   1 
ATOM   4940 O  O   . ALA B 1 133 ? 51.309  -17.547 -11.233 1.00 18.48 ? 134 ALA B O   1 
ATOM   4941 C  CB  . ALA B 1 133 ? 54.071  -19.313 -11.479 1.00 18.29 ? 134 ALA B CB  1 
ATOM   4942 N  N   . VAL B 1 134 ? 52.880  -16.545 -12.487 1.00 18.45 ? 135 VAL B N   1 
ATOM   4943 C  CA  . VAL B 1 134 ? 52.427  -15.198 -12.135 1.00 18.30 ? 135 VAL B CA  1 
ATOM   4944 C  C   . VAL B 1 134 ? 51.079  -14.882 -12.802 1.00 18.58 ? 135 VAL B C   1 
ATOM   4945 O  O   . VAL B 1 134 ? 50.174  -14.357 -12.154 1.00 18.01 ? 135 VAL B O   1 
ATOM   4946 C  CB  . VAL B 1 134 ? 53.500  -14.114 -12.427 1.00 18.31 ? 135 VAL B CB  1 
ATOM   4947 C  CG1 . VAL B 1 134 ? 52.997  -12.734 -12.031 1.00 17.20 ? 135 VAL B CG1 1 
ATOM   4948 C  CG2 . VAL B 1 134 ? 54.793  -14.425 -11.663 1.00 18.19 ? 135 VAL B CG2 1 
ATOM   4949 N  N   . SER B 1 135 ? 50.946  -15.247 -14.076 1.00 19.23 ? 136 SER B N   1 
ATOM   4950 C  CA  . SER B 1 135 ? 49.697  -15.050 -14.821 1.00 20.28 ? 136 SER B CA  1 
ATOM   4951 C  C   . SER B 1 135 ? 48.528  -15.850 -14.250 1.00 20.60 ? 136 SER B C   1 
ATOM   4952 O  O   . SER B 1 135 ? 47.401  -15.363 -14.244 1.00 20.41 ? 136 SER B O   1 
ATOM   4953 C  CB  . SER B 1 135 ? 49.884  -15.378 -16.299 1.00 20.07 ? 136 SER B CB  1 
ATOM   4954 O  OG  . SER B 1 135 ? 50.491  -14.291 -16.952 1.00 21.39 ? 136 SER B OG  1 
ATOM   4955 N  N   . ARG B 1 136 ? 48.808  -17.066 -13.776 1.00 21.08 ? 137 ARG B N   1 
ATOM   4956 C  CA  . ARG B 1 136 ? 47.806  -17.878 -13.080 1.00 22.27 ? 137 ARG B CA  1 
ATOM   4957 C  C   . ARG B 1 136 ? 47.305  -17.201 -11.813 1.00 21.87 ? 137 ARG B C   1 
ATOM   4958 O  O   . ARG B 1 136 ? 46.112  -17.196 -11.547 1.00 21.79 ? 137 ARG B O   1 
ATOM   4959 C  CB  . ARG B 1 136 ? 48.354  -19.254 -12.727 1.00 22.52 ? 137 ARG B CB  1 
ATOM   4960 C  CG  . ARG B 1 136 ? 48.351  -20.250 -13.865 1.00 25.75 ? 137 ARG B CG  1 
ATOM   4961 C  CD  . ARG B 1 136 ? 48.539  -21.640 -13.281 1.00 30.91 ? 137 ARG B CD  1 
ATOM   4962 N  NE  . ARG B 1 136 ? 49.219  -22.549 -14.194 1.00 36.16 ? 137 ARG B NE  1 
ATOM   4963 C  CZ  . ARG B 1 136 ? 50.541  -22.720 -14.249 1.00 39.71 ? 137 ARG B CZ  1 
ATOM   4964 N  NH1 . ARG B 1 136 ? 51.349  -22.031 -13.445 1.00 40.66 ? 137 ARG B NH1 1 
ATOM   4965 N  NH2 . ARG B 1 136 ? 51.063  -23.585 -15.118 1.00 40.75 ? 137 ARG B NH2 1 
ATOM   4966 N  N   . ASP B 1 137 ? 48.229  -16.643 -11.032 1.00 22.27 ? 138 ASP B N   1 
ATOM   4967 C  CA  . ASP B 1 137 ? 47.881  -15.891 -9.831  1.00 22.30 ? 138 ASP B CA  1 
ATOM   4968 C  C   . ASP B 1 137 ? 47.076  -14.632 -10.148 1.00 22.14 ? 138 ASP B C   1 
ATOM   4969 O  O   . ASP B 1 137 ? 46.201  -14.249 -9.372  1.00 22.63 ? 138 ASP B O   1 
ATOM   4970 C  CB  . ASP B 1 137 ? 49.134  -15.559 -9.009  1.00 22.59 ? 138 ASP B CB  1 
ATOM   4971 C  CG  . ASP B 1 137 ? 49.688  -16.775 -8.269  1.00 24.12 ? 138 ASP B CG  1 
ATOM   4972 O  OD1 . ASP B 1 137 ? 48.972  -17.797 -8.165  1.00 23.81 ? 138 ASP B OD1 1 
ATOM   4973 O  OD2 . ASP B 1 137 ? 50.845  -16.708 -7.791  1.00 25.57 ? 138 ASP B OD2 1 
ATOM   4974 N  N   . PHE B 1 138 ? 47.358  -13.998 -11.287 1.00 21.57 ? 139 PHE B N   1 
ATOM   4975 C  CA  . PHE B 1 138 ? 46.553  -12.860 -11.730 1.00 21.51 ? 139 PHE B CA  1 
ATOM   4976 C  C   . PHE B 1 138 ? 45.100  -13.254 -12.000 1.00 21.59 ? 139 PHE B C   1 
ATOM   4977 O  O   . PHE B 1 138 ? 44.180  -12.544 -11.595 1.00 21.29 ? 139 PHE B O   1 
ATOM   4978 C  CB  . PHE B 1 138 ? 47.144  -12.188 -12.969 1.00 21.06 ? 139 PHE B CB  1 
ATOM   4979 C  CG  . PHE B 1 138 ? 46.571  -10.837 -13.230 1.00 20.97 ? 139 PHE B CG  1 
ATOM   4980 C  CD1 . PHE B 1 138 ? 47.096  -9.714  -12.593 1.00 20.57 ? 139 PHE B CD1 1 
ATOM   4981 C  CD2 . PHE B 1 138 ? 45.486  -10.678 -14.090 1.00 20.51 ? 139 PHE B CD2 1 
ATOM   4982 C  CE1 . PHE B 1 138 ? 46.560  -8.445  -12.822 1.00 20.58 ? 139 PHE B CE1 1 
ATOM   4983 C  CE2 . PHE B 1 138 ? 44.939  -9.414  -14.323 1.00 20.56 ? 139 PHE B CE2 1 
ATOM   4984 C  CZ  . PHE B 1 138 ? 45.480  -8.292  -13.684 1.00 19.97 ? 139 PHE B CZ  1 
ATOM   4985 N  N   . VAL B 1 139 ? 44.913  -14.373 -12.704 1.00 21.70 ? 140 VAL B N   1 
ATOM   4986 C  CA  . VAL B 1 139 ? 43.591  -14.955 -12.939 1.00 22.09 ? 140 VAL B CA  1 
ATOM   4987 C  C   . VAL B 1 139 ? 42.847  -15.174 -11.607 1.00 22.54 ? 140 VAL B C   1 
ATOM   4988 O  O   . VAL B 1 139 ? 41.681  -14.791 -11.474 1.00 22.11 ? 140 VAL B O   1 
ATOM   4989 C  CB  . VAL B 1 139 ? 43.698  -16.284 -13.758 1.00 22.13 ? 140 VAL B CB  1 
ATOM   4990 C  CG1 . VAL B 1 139 ? 42.388  -17.054 -13.756 1.00 21.78 ? 140 VAL B CG1 1 
ATOM   4991 C  CG2 . VAL B 1 139 ? 44.123  -15.990 -15.195 1.00 22.67 ? 140 VAL B CG2 1 
ATOM   4992 N  N   . SER B 1 140 ? 43.537  -15.763 -10.628 1.00 22.84 ? 141 SER B N   1 
ATOM   4993 C  CA  . SER B 1 140 ? 42.955  -15.999 -9.299  1.00 23.76 ? 141 SER B CA  1 
ATOM   4994 C  C   . SER B 1 140 ? 42.507  -14.723 -8.595  1.00 24.27 ? 141 SER B C   1 
ATOM   4995 O  O   . SER B 1 140 ? 41.442  -14.706 -7.987  1.00 25.01 ? 141 SER B O   1 
ATOM   4996 C  CB  . SER B 1 140 ? 43.919  -16.772 -8.399  1.00 23.75 ? 141 SER B CB  1 
ATOM   4997 O  OG  . SER B 1 140 ? 44.263  -18.011 -8.980  1.00 23.93 ? 141 SER B OG  1 
ATOM   4998 N  N   . VAL B 1 141 ? 43.313  -13.663 -8.676  1.00 24.66 ? 142 VAL B N   1 
ATOM   4999 C  CA  . VAL B 1 141 ? 42.924  -12.352 -8.137  1.00 24.88 ? 142 VAL B CA  1 
ATOM   5000 C  C   . VAL B 1 141 ? 41.589  -11.901 -8.731  1.00 25.06 ? 142 VAL B C   1 
ATOM   5001 O  O   . VAL B 1 141 ? 40.667  -11.529 -7.994  1.00 25.04 ? 142 VAL B O   1 
ATOM   5002 C  CB  . VAL B 1 141 ? 44.009  -11.272 -8.384  1.00 24.95 ? 142 VAL B CB  1 
ATOM   5003 C  CG1 . VAL B 1 141 ? 43.478  -9.875  -8.081  1.00 24.79 ? 142 VAL B CG1 1 
ATOM   5004 C  CG2 . VAL B 1 141 ? 45.235  -11.560 -7.536  1.00 26.07 ? 142 VAL B CG2 1 
ATOM   5005 N  N   . LEU B 1 142 ? 41.481  -11.957 -10.057 1.00 24.52 ? 143 LEU B N   1 
ATOM   5006 C  CA  . LEU B 1 142 ? 40.251  -11.547 -10.724 1.00 24.70 ? 143 LEU B CA  1 
ATOM   5007 C  C   . LEU B 1 142 ? 39.044  -12.410 -10.332 1.00 24.48 ? 143 LEU B C   1 
ATOM   5008 O  O   . LEU B 1 142 ? 37.967  -11.870 -10.106 1.00 23.30 ? 143 LEU B O   1 
ATOM   5009 C  CB  . LEU B 1 142 ? 40.421  -11.467 -12.245 1.00 24.45 ? 143 LEU B CB  1 
ATOM   5010 C  CG  . LEU B 1 142 ? 41.174  -10.248 -12.784 1.00 25.46 ? 143 LEU B CG  1 
ATOM   5011 C  CD1 . LEU B 1 142 ? 41.266  -10.314 -14.298 1.00 25.67 ? 143 LEU B CD1 1 
ATOM   5012 C  CD2 . LEU B 1 142 ? 40.515  -8.943  -12.360 1.00 26.45 ? 143 LEU B CD2 1 
ATOM   5013 N  N   . HIS B 1 143 ? 39.241  -13.729 -10.228 1.00 24.95 ? 144 HIS B N   1 
ATOM   5014 C  CA  . HIS B 1 143 ? 38.175  -14.636 -9.770  1.00 26.02 ? 144 HIS B CA  1 
ATOM   5015 C  C   . HIS B 1 143 ? 37.687  -14.330 -8.352  1.00 26.53 ? 144 HIS B C   1 
ATOM   5016 O  O   . HIS B 1 143 ? 36.501  -14.475 -8.069  1.00 26.96 ? 144 HIS B O   1 
ATOM   5017 C  CB  . HIS B 1 143 ? 38.580  -16.115 -9.869  1.00 25.73 ? 144 HIS B CB  1 
ATOM   5018 C  CG  . HIS B 1 143 ? 38.402  -16.704 -11.233 1.00 25.81 ? 144 HIS B CG  1 
ATOM   5019 N  ND1 . HIS B 1 143 ? 37.210  -16.634 -11.927 1.00 25.76 ? 144 HIS B ND1 1 
ATOM   5020 C  CD2 . HIS B 1 143 ? 39.262  -17.384 -12.029 1.00 24.42 ? 144 HIS B CD2 1 
ATOM   5021 C  CE1 . HIS B 1 143 ? 37.348  -17.239 -13.094 1.00 25.72 ? 144 HIS B CE1 1 
ATOM   5022 N  NE2 . HIS B 1 143 ? 38.585  -17.701 -13.182 1.00 24.87 ? 144 HIS B NE2 1 
ATOM   5023 N  N   . ARG B 1 144 ? 38.595  -13.913 -7.471  1.00 27.17 ? 145 ARG B N   1 
ATOM   5024 C  CA  . ARG B 1 144 ? 38.217  -13.529 -6.104  1.00 27.97 ? 145 ARG B CA  1 
ATOM   5025 C  C   . ARG B 1 144 ? 37.414  -12.233 -6.058  1.00 27.89 ? 145 ARG B C   1 
ATOM   5026 O  O   . ARG B 1 144 ? 36.475  -12.115 -5.261  1.00 27.99 ? 145 ARG B O   1 
ATOM   5027 C  CB  . ARG B 1 144 ? 39.440  -13.423 -5.192  1.00 28.12 ? 145 ARG B CB  1 
ATOM   5028 C  CG  . ARG B 1 144 ? 40.041  -14.762 -4.870  1.00 30.30 ? 145 ARG B CG  1 
ATOM   5029 C  CD  . ARG B 1 144 ? 41.296  -14.665 -4.014  1.00 33.37 ? 145 ARG B CD  1 
ATOM   5030 N  NE  . ARG B 1 144 ? 42.164  -15.815 -4.280  1.00 35.60 ? 145 ARG B NE  1 
ATOM   5031 C  CZ  . ARG B 1 144 ? 43.459  -15.741 -4.572  1.00 35.28 ? 145 ARG B CZ  1 
ATOM   5032 N  NH1 . ARG B 1 144 ? 44.078  -14.567 -4.604  1.00 34.90 ? 145 ARG B NH1 1 
ATOM   5033 N  NH2 . ARG B 1 144 ? 44.140  -16.855 -4.807  1.00 36.94 ? 145 ARG B NH2 1 
ATOM   5034 N  N   . ARG B 1 145 ? 37.783  -11.272 -6.906  1.00 27.49 ? 146 ARG B N   1 
ATOM   5035 C  CA  . ARG B 1 145 ? 37.075  -9.995  -6.968  1.00 27.58 ? 146 ARG B CA  1 
ATOM   5036 C  C   . ARG B 1 145 ? 35.667  -10.142 -7.549  1.00 27.50 ? 146 ARG B C   1 
ATOM   5037 O  O   . ARG B 1 145 ? 34.755  -9.418  -7.148  1.00 27.32 ? 146 ARG B O   1 
ATOM   5038 C  CB  . ARG B 1 145 ? 37.873  -8.953  -7.753  1.00 27.63 ? 146 ARG B CB  1 
ATOM   5039 C  CG  . ARG B 1 145 ? 39.138  -8.511  -7.051  1.00 28.09 ? 146 ARG B CG  1 
ATOM   5040 C  CD  . ARG B 1 145 ? 39.815  -7.390  -7.810  1.00 29.31 ? 146 ARG B CD  1 
ATOM   5041 N  NE  . ARG B 1 145 ? 41.140  -7.113  -7.273  1.00 29.67 ? 146 ARG B NE  1 
ATOM   5042 C  CZ  . ARG B 1 145 ? 41.956  -6.168  -7.726  1.00 29.71 ? 146 ARG B CZ  1 
ATOM   5043 N  NH1 . ARG B 1 145 ? 41.590  -5.386  -8.735  1.00 29.48 ? 146 ARG B NH1 1 
ATOM   5044 N  NH2 . ARG B 1 145 ? 43.143  -6.007  -7.163  1.00 29.47 ? 146 ARG B NH2 1 
ATOM   5045 N  N   . ILE B 1 146 ? 35.516  -11.073 -8.493  1.00 27.41 ? 147 ILE B N   1 
ATOM   5046 C  CA  . ILE B 1 146 ? 34.223  -11.431 -9.071  1.00 27.53 ? 147 ILE B CA  1 
ATOM   5047 C  C   . ILE B 1 146 ? 33.327  -12.071 -8.007  1.00 28.13 ? 147 ILE B C   1 
ATOM   5048 O  O   . ILE B 1 146 ? 32.176  -11.663 -7.830  1.00 28.05 ? 147 ILE B O   1 
ATOM   5049 C  CB  . ILE B 1 146 ? 34.391  -12.379 -10.290 1.00 27.29 ? 147 ILE B CB  1 
ATOM   5050 C  CG1 . ILE B 1 146 ? 34.933  -11.604 -11.503 1.00 26.62 ? 147 ILE B CG1 1 
ATOM   5051 C  CG2 . ILE B 1 146 ? 33.065  -13.084 -10.634 1.00 26.58 ? 147 ILE B CG2 1 
ATOM   5052 C  CD1 . ILE B 1 146 ? 35.450  -12.475 -12.648 1.00 25.68 ? 147 ILE B CD1 1 
ATOM   5053 N  N   . LYS B 1 147 ? 33.865  -13.062 -7.295  1.00 28.70 ? 148 LYS B N   1 
ATOM   5054 C  CA  . LYS B 1 147 ? 33.124  -13.731 -6.229  1.00 29.69 ? 148 LYS B CA  1 
ATOM   5055 C  C   . LYS B 1 147 ? 32.671  -12.728 -5.164  1.00 29.54 ? 148 LYS B C   1 
ATOM   5056 O  O   . LYS B 1 147 ? 31.505  -12.716 -4.789  1.00 29.60 ? 148 LYS B O   1 
ATOM   5057 C  CB  . LYS B 1 147 ? 33.960  -14.852 -5.598  1.00 30.07 ? 148 LYS B CB  1 
ATOM   5058 C  CG  . LYS B 1 147 ? 33.237  -15.610 -4.491  1.00 32.01 ? 148 LYS B CG  1 
ATOM   5059 C  CD  . LYS B 1 147 ? 34.143  -16.617 -3.789  1.00 35.01 ? 148 LYS B CD  1 
ATOM   5060 C  CE  . LYS B 1 147 ? 33.339  -17.472 -2.805  1.00 36.44 ? 148 LYS B CE  1 
ATOM   5061 N  NZ  . LYS B 1 147 ? 32.406  -18.401 -3.526  1.00 37.30 ? 148 LYS B NZ  1 
ATOM   5062 N  N   . LYS B 1 148 ? 33.600  -11.887 -4.707  1.00 29.72 ? 149 LYS B N   1 
ATOM   5063 C  CA  . LYS B 1 148 ? 33.330  -10.845 -3.712  1.00 29.81 ? 149 LYS B CA  1 
ATOM   5064 C  C   . LYS B 1 148 ? 32.315  -9.788  -4.181  1.00 29.35 ? 149 LYS B C   1 
ATOM   5065 O  O   . LYS B 1 148 ? 31.510  -9.299  -3.375  1.00 29.36 ? 149 LYS B O   1 
ATOM   5066 C  CB  . LYS B 1 148 ? 34.629  -10.154 -3.289  1.00 30.23 ? 149 LYS B CB  1 
ATOM   5067 C  CG  . LYS B 1 148 ? 34.455  -9.177  -2.126  1.00 32.00 ? 149 LYS B CG  1 
ATOM   5068 C  CD  . LYS B 1 148 ? 35.519  -8.099  -2.129  1.00 35.36 ? 149 LYS B CD  1 
ATOM   5069 C  CE  . LYS B 1 148 ? 35.336  -7.152  -0.943  1.00 37.23 ? 149 LYS B CE  1 
ATOM   5070 N  NZ  . LYS B 1 148 ? 36.465  -6.176  -0.865  1.00 38.89 ? 149 LYS B NZ  1 
ATOM   5071 N  N   . ALA B 1 149 ? 32.366  -9.432  -5.466  1.00 28.21 ? 150 ALA B N   1 
ATOM   5072 C  CA  . ALA B 1 149 ? 31.409  -8.480  -6.045  1.00 27.46 ? 150 ALA B CA  1 
ATOM   5073 C  C   . ALA B 1 149 ? 29.985  -9.045  -6.064  1.00 26.99 ? 150 ALA B C   1 
ATOM   5074 O  O   . ALA B 1 149 ? 29.022  -8.290  -6.094  1.00 26.55 ? 150 ALA B O   1 
ATOM   5075 C  CB  . ALA B 1 149 ? 31.835  -8.067  -7.441  1.00 27.08 ? 150 ALA B CB  1 
ATOM   5076 N  N   . GLY B 1 150 ? 29.872  -10.372 -6.074  1.00 26.86 ? 151 GLY B N   1 
ATOM   5077 C  CA  . GLY B 1 150 ? 28.600  -11.063 -5.856  1.00 26.90 ? 151 GLY B CA  1 
ATOM   5078 C  C   . GLY B 1 150 ? 27.599  -11.163 -6.996  1.00 27.09 ? 151 GLY B C   1 
ATOM   5079 O  O   . GLY B 1 150 ? 26.634  -11.919 -6.893  1.00 27.15 ? 151 GLY B O   1 
ATOM   5080 N  N   . SER B 1 151 ? 27.801  -10.407 -8.075  1.00 27.26 ? 152 SER B N   1 
ATOM   5081 C  CA  . SER B 1 151 ? 26.844  -10.415 -9.194  1.00 27.65 ? 152 SER B CA  1 
ATOM   5082 C  C   . SER B 1 151 ? 27.333  -11.106 -10.473 1.00 27.38 ? 152 SER B C   1 
ATOM   5083 O  O   . SER B 1 151 ? 26.766  -10.890 -11.545 1.00 27.69 ? 152 SER B O   1 
ATOM   5084 C  CB  . SER B 1 151 ? 26.365  -8.996  -9.511  1.00 27.61 ? 152 SER B CB  1 
ATOM   5085 O  OG  . SER B 1 151 ? 25.306  -8.636  -8.644  1.00 29.24 ? 152 SER B OG  1 
ATOM   5086 N  N   . GLY B 1 152 ? 28.373  -11.926 -10.363 1.00 26.82 ? 153 GLY B N   1 
ATOM   5087 C  CA  . GLY B 1 152 ? 28.869  -12.678 -11.515 1.00 26.44 ? 153 GLY B CA  1 
ATOM   5088 C  C   . GLY B 1 152 ? 29.853  -11.950 -12.422 1.00 26.22 ? 153 GLY B C   1 
ATOM   5089 O  O   . GLY B 1 152 ? 30.212  -12.468 -13.484 1.00 26.21 ? 153 GLY B O   1 
ATOM   5090 N  N   . ASN B 1 153 ? 30.281  -10.754 -12.011 1.00 25.63 ? 154 ASN B N   1 
ATOM   5091 C  CA  . ASN B 1 153 ? 31.257  -9.957  -12.762 1.00 25.18 ? 154 ASN B CA  1 
ATOM   5092 C  C   . ASN B 1 153 ? 32.089  -9.022  -11.873 1.00 24.53 ? 154 ASN B C   1 
ATOM   5093 O  O   . ASN B 1 153 ? 31.799  -8.858  -10.692 1.00 24.32 ? 154 ASN B O   1 
ATOM   5094 C  CB  . ASN B 1 153 ? 30.571  -9.164  -13.885 1.00 25.39 ? 154 ASN B CB  1 
ATOM   5095 C  CG  . ASN B 1 153 ? 29.643  -8.078  -13.363 1.00 27.32 ? 154 ASN B CG  1 
ATOM   5096 O  OD1 . ASN B 1 153 ? 30.086  -7.004  -12.941 1.00 28.93 ? 154 ASN B OD1 1 
ATOM   5097 N  ND2 . ASN B 1 153 ? 28.345  -8.343  -13.414 1.00 29.42 ? 154 ASN B ND2 1 
ATOM   5098 N  N   . TYR B 1 154 ? 33.127  -8.426  -12.453 1.00 23.95 ? 155 TYR B N   1 
ATOM   5099 C  CA  . TYR B 1 154 ? 33.931  -7.406  -11.785 1.00 23.21 ? 155 TYR B CA  1 
ATOM   5100 C  C   . TYR B 1 154 ? 34.235  -6.275  -12.755 1.00 22.92 ? 155 TYR B C   1 
ATOM   5101 O  O   . TYR B 1 154 ? 34.723  -6.516  -13.857 1.00 22.89 ? 155 TYR B O   1 
ATOM   5102 C  CB  . TYR B 1 154 ? 35.236  -7.997  -11.230 1.00 23.31 ? 155 TYR B CB  1 
ATOM   5103 C  CG  . TYR B 1 154 ? 36.197  -6.955  -10.677 1.00 23.46 ? 155 TYR B CG  1 
ATOM   5104 C  CD1 . TYR B 1 154 ? 35.883  -6.237  -9.515  1.00 23.66 ? 155 TYR B CD1 1 
ATOM   5105 C  CD2 . TYR B 1 154 ? 37.417  -6.696  -11.306 1.00 23.44 ? 155 TYR B CD2 1 
ATOM   5106 C  CE1 . TYR B 1 154 ? 36.743  -5.277  -9.004  1.00 24.98 ? 155 TYR B CE1 1 
ATOM   5107 C  CE2 . TYR B 1 154 ? 38.300  -5.740  -10.796 1.00 25.27 ? 155 TYR B CE2 1 
ATOM   5108 C  CZ  . TYR B 1 154 ? 37.954  -5.033  -9.646  1.00 26.60 ? 155 TYR B CZ  1 
ATOM   5109 O  OH  . TYR B 1 154 ? 38.810  -4.081  -9.130  1.00 29.65 ? 155 TYR B OH  1 
ATOM   5110 N  N   . SER B 1 155 ? 33.939  -5.047  -12.334 1.00 22.44 ? 156 SER B N   1 
ATOM   5111 C  CA  . SER B 1 155 ? 34.246  -3.851  -13.104 1.00 22.39 ? 156 SER B CA  1 
ATOM   5112 C  C   . SER B 1 155 ? 35.232  -3.000  -12.333 1.00 22.02 ? 156 SER B C   1 
ATOM   5113 O  O   . SER B 1 155 ? 35.112  -2.850  -11.114 1.00 21.91 ? 156 SER B O   1 
ATOM   5114 C  CB  . SER B 1 155 ? 32.988  -3.019  -13.367 1.00 22.56 ? 156 SER B CB  1 
ATOM   5115 O  OG  . SER B 1 155 ? 32.064  -3.734  -14.162 1.00 24.29 ? 156 SER B OG  1 
ATOM   5116 N  N   . GLY B 1 156 ? 36.198  -2.436  -13.050 1.00 21.46 ? 157 GLY B N   1 
ATOM   5117 C  CA  . GLY B 1 156 ? 37.207  -1.599  -12.433 1.00 20.75 ? 157 GLY B CA  1 
ATOM   5118 C  C   . GLY B 1 156 ? 38.384  -1.245  -13.325 1.00 20.48 ? 157 GLY B C   1 
ATOM   5119 O  O   . GLY B 1 156 ? 38.604  -1.846  -14.380 1.00 20.01 ? 157 GLY B O   1 
ATOM   5120 N  N   . ASP B 1 157 ? 39.124  -0.237  -12.881 1.00 20.21 ? 158 ASP B N   1 
ATOM   5121 C  CA  . ASP B 1 157 ? 40.395  0.156   -13.466 1.00 20.29 ? 158 ASP B CA  1 
ATOM   5122 C  C   . ASP B 1 157 ? 41.442  -0.788  -12.877 1.00 19.76 ? 158 ASP B C   1 
ATOM   5123 O  O   . ASP B 1 157 ? 41.626  -0.835  -11.660 1.00 20.09 ? 158 ASP B O   1 
ATOM   5124 C  CB  . ASP B 1 157 ? 40.660  1.618   -13.088 1.00 20.42 ? 158 ASP B CB  1 
ATOM   5125 C  CG  . ASP B 1 157 ? 42.013  2.139   -13.550 1.00 21.25 ? 158 ASP B CG  1 
ATOM   5126 O  OD1 . ASP B 1 157 ? 42.899  1.363   -13.967 1.00 19.88 ? 158 ASP B OD1 1 
ATOM   5127 O  OD2 . ASP B 1 157 ? 42.192  3.373   -13.465 1.00 23.92 ? 158 ASP B OD2 1 
ATOM   5128 N  N   . ILE B 1 158 ? 42.109  -1.556  -13.736 1.00 19.12 ? 159 ILE B N   1 
ATOM   5129 C  CA  . ILE B 1 158 ? 43.100  -2.533  -13.271 1.00 18.51 ? 159 ILE B CA  1 
ATOM   5130 C  C   . ILE B 1 158 ? 44.561  -2.126  -13.519 1.00 18.33 ? 159 ILE B C   1 
ATOM   5131 O  O   . ILE B 1 158 ? 45.468  -2.960  -13.404 1.00 18.15 ? 159 ILE B O   1 
ATOM   5132 C  CB  . ILE B 1 158 ? 42.822  -3.981  -13.811 1.00 18.52 ? 159 ILE B CB  1 
ATOM   5133 C  CG1 . ILE B 1 158 ? 42.923  -4.037  -15.337 1.00 18.60 ? 159 ILE B CG1 1 
ATOM   5134 C  CG2 . ILE B 1 158 ? 41.460  -4.512  -13.298 1.00 17.58 ? 159 ILE B CG2 1 
ATOM   5135 C  CD1 . ILE B 1 158 ? 43.126  -5.450  -15.881 1.00 16.26 ? 159 ILE B CD1 1 
ATOM   5136 N  N   . SER B 1 159 ? 44.788  -0.849  -13.834 1.00 17.81 ? 160 SER B N   1 
ATOM   5137 C  CA  . SER B 1 159 ? 46.143  -0.358  -14.117 1.00 18.21 ? 160 SER B CA  1 
ATOM   5138 C  C   . SER B 1 159 ? 47.147  -0.673  -12.997 1.00 18.33 ? 160 SER B C   1 
ATOM   5139 O  O   . SER B 1 159 ? 48.262  -1.129  -13.284 1.00 17.52 ? 160 SER B O   1 
ATOM   5140 C  CB  . SER B 1 159 ? 46.146  1.144   -14.427 1.00 17.93 ? 160 SER B CB  1 
ATOM   5141 O  OG  . SER B 1 159 ? 45.523  1.881   -13.384 1.00 19.04 ? 160 SER B OG  1 
ATOM   5142 N  N   . ASP B 1 160 ? 46.752  -0.440  -11.738 1.00 18.27 ? 161 ASP B N   1 
ATOM   5143 C  CA  . ASP B 1 160 ? 47.647  -0.667  -10.589 1.00 19.01 ? 161 ASP B CA  1 
ATOM   5144 C  C   . ASP B 1 160 ? 47.963  -2.142  -10.412 1.00 18.61 ? 161 ASP B C   1 
ATOM   5145 O  O   . ASP B 1 160 ? 49.074  -2.501  -10.032 1.00 18.50 ? 161 ASP B O   1 
ATOM   5146 C  CB  . ASP B 1 160 ? 47.056  -0.120  -9.282  1.00 19.49 ? 161 ASP B CB  1 
ATOM   5147 C  CG  . ASP B 1 160 ? 46.926  1.391   -9.277  1.00 22.27 ? 161 ASP B CG  1 
ATOM   5148 O  OD1 . ASP B 1 160 ? 47.637  2.078   -10.043 1.00 23.70 ? 161 ASP B OD1 1 
ATOM   5149 O  OD2 . ASP B 1 160 ? 46.093  1.901   -8.491  1.00 27.68 ? 161 ASP B OD2 1 
ATOM   5150 N  N   . ASP B 1 161 ? 46.971  -2.987  -10.672 1.00 18.56 ? 162 ASP B N   1 
ATOM   5151 C  CA  . ASP B 1 161 ? 47.157  -4.435  -10.649 1.00 18.71 ? 162 ASP B CA  1 
ATOM   5152 C  C   . ASP B 1 161 ? 48.095  -4.903  -11.765 1.00 17.91 ? 162 ASP B C   1 
ATOM   5153 O  O   . ASP B 1 161 ? 48.894  -5.821  -11.568 1.00 17.61 ? 162 ASP B O   1 
ATOM   5154 C  CB  . ASP B 1 161 ? 45.811  -5.140  -10.768 1.00 19.15 ? 162 ASP B CB  1 
ATOM   5155 C  CG  . ASP B 1 161 ? 44.824  -4.691  -9.703  1.00 21.42 ? 162 ASP B CG  1 
ATOM   5156 O  OD1 . ASP B 1 161 ? 45.144  -4.810  -8.496  1.00 23.53 ? 162 ASP B OD1 1 
ATOM   5157 O  OD2 . ASP B 1 161 ? 43.721  -4.226  -10.074 1.00 23.76 ? 162 ASP B OD2 1 
ATOM   5158 N  N   . LEU B 1 162 ? 47.991  -4.272  -12.930 1.00 17.07 ? 163 LEU B N   1 
ATOM   5159 C  CA  . LEU B 1 162 ? 48.845  -4.619  -14.062 1.00 16.45 ? 163 LEU B CA  1 
ATOM   5160 C  C   . LEU B 1 162 ? 50.298  -4.237  -13.793 1.00 16.24 ? 163 LEU B C   1 
ATOM   5161 O  O   . LEU B 1 162 ? 51.200  -5.006  -14.121 1.00 16.20 ? 163 LEU B O   1 
ATOM   5162 C  CB  . LEU B 1 162 ? 48.334  -3.982  -15.366 1.00 16.23 ? 163 LEU B CB  1 
ATOM   5163 C  CG  . LEU B 1 162 ? 47.052  -4.580  -15.964 1.00 16.43 ? 163 LEU B CG  1 
ATOM   5164 C  CD1 . LEU B 1 162 ? 46.612  -3.785  -17.180 1.00 15.99 ? 163 LEU B CD1 1 
ATOM   5165 C  CD2 . LEU B 1 162 ? 47.255  -6.047  -16.327 1.00 15.77 ? 163 LEU B CD2 1 
ATOM   5166 N  N   . PHE B 1 163 ? 50.522  -3.064  -13.191 1.00 16.04 ? 164 PHE B N   1 
ATOM   5167 C  CA  . PHE B 1 163 ? 51.876  -2.668  -12.746 1.00 16.17 ? 164 PHE B CA  1 
ATOM   5168 C  C   . PHE B 1 163 ? 52.477  -3.676  -11.761 1.00 15.72 ? 164 PHE B C   1 
ATOM   5169 O  O   . PHE B 1 163 ? 53.650  -4.042  -11.891 1.00 15.73 ? 164 PHE B O   1 
ATOM   5170 C  CB  . PHE B 1 163 ? 51.908  -1.265  -12.111 1.00 16.19 ? 164 PHE B CB  1 
ATOM   5171 C  CG  . PHE B 1 163 ? 51.571  -0.140  -13.059 1.00 17.77 ? 164 PHE B CG  1 
ATOM   5172 C  CD1 . PHE B 1 163 ? 50.620  0.812   -12.710 1.00 19.10 ? 164 PHE B CD1 1 
ATOM   5173 C  CD2 . PHE B 1 163 ? 52.212  -0.015  -14.284 1.00 19.64 ? 164 PHE B CD2 1 
ATOM   5174 C  CE1 . PHE B 1 163 ? 50.299  1.866   -13.581 1.00 19.86 ? 164 PHE B CE1 1 
ATOM   5175 C  CE2 . PHE B 1 163 ? 51.903  1.035   -15.155 1.00 20.94 ? 164 PHE B CE2 1 
ATOM   5176 C  CZ  . PHE B 1 163 ? 50.945  1.974   -14.798 1.00 21.17 ? 164 PHE B CZ  1 
ATOM   5177 N  N   . ARG B 1 164 ? 51.675  -4.114  -10.785 1.00 14.58 ? 165 ARG B N   1 
ATOM   5178 C  CA  . ARG B 1 164 ? 52.104  -5.140  -9.839  1.00 14.71 ? 165 ARG B CA  1 
ATOM   5179 C  C   . ARG B 1 164 ? 52.329  -6.494  -10.516 1.00 14.42 ? 165 ARG B C   1 
ATOM   5180 O  O   . ARG B 1 164 ? 53.229  -7.246  -10.124 1.00 14.74 ? 165 ARG B O   1 
ATOM   5181 C  CB  . ARG B 1 164 ? 51.104  -5.289  -8.685  1.00 14.24 ? 165 ARG B CB  1 
ATOM   5182 C  CG  . ARG B 1 164 ? 51.243  -4.224  -7.605  1.00 14.81 ? 165 ARG B CG  1 
ATOM   5183 C  CD  . ARG B 1 164 ? 50.282  -4.470  -6.421  1.00 15.28 ? 165 ARG B CD  1 
ATOM   5184 N  NE  . ARG B 1 164 ? 48.877  -4.239  -6.758  1.00 17.09 ? 165 ARG B NE  1 
ATOM   5185 C  CZ  . ARG B 1 164 ? 48.266  -3.055  -6.685  1.00 18.47 ? 165 ARG B CZ  1 
ATOM   5186 N  NH1 . ARG B 1 164 ? 48.934  -1.968  -6.294  1.00 18.07 ? 165 ARG B NH1 1 
ATOM   5187 N  NH2 . ARG B 1 164 ? 46.982  -2.951  -7.010  1.00 18.19 ? 165 ARG B NH2 1 
ATOM   5188 N  N   . PHE B 1 165 ? 51.504  -6.811  -11.515 1.00 13.93 ? 166 PHE B N   1 
ATOM   5189 C  CA  . PHE B 1 165 ? 51.709  -8.021  -12.308 1.00 14.05 ? 166 PHE B CA  1 
ATOM   5190 C  C   . PHE B 1 165 ? 53.052  -7.976  -13.057 1.00 14.06 ? 166 PHE B C   1 
ATOM   5191 O  O   . PHE B 1 165 ? 53.822  -8.942  -13.048 1.00 13.55 ? 166 PHE B O   1 
ATOM   5192 C  CB  . PHE B 1 165 ? 50.578  -8.228  -13.321 1.00 13.87 ? 166 PHE B CB  1 
ATOM   5193 C  CG  . PHE B 1 165 ? 50.912  -9.243  -14.377 1.00 14.20 ? 166 PHE B CG  1 
ATOM   5194 C  CD1 . PHE B 1 165 ? 50.869  -10.604 -14.087 1.00 13.53 ? 166 PHE B CD1 1 
ATOM   5195 C  CD2 . PHE B 1 165 ? 51.317  -8.842  -15.648 1.00 14.28 ? 166 PHE B CD2 1 
ATOM   5196 C  CE1 . PHE B 1 165 ? 51.204  -11.555 -15.056 1.00 14.39 ? 166 PHE B CE1 1 
ATOM   5197 C  CE2 . PHE B 1 165 ? 51.647  -9.792  -16.625 1.00 14.05 ? 166 PHE B CE2 1 
ATOM   5198 C  CZ  . PHE B 1 165 ? 51.602  -11.146 -16.319 1.00 13.41 ? 166 PHE B CZ  1 
ATOM   5199 N  N   . ALA B 1 166 ? 53.307  -6.850  -13.720 1.00 14.40 ? 167 ALA B N   1 
ATOM   5200 C  CA  . ALA B 1 166 ? 54.539  -6.664  -14.482 1.00 14.79 ? 167 ALA B CA  1 
ATOM   5201 C  C   . ALA B 1 166 ? 55.771  -6.783  -13.572 1.00 14.88 ? 167 ALA B C   1 
ATOM   5202 O  O   . ALA B 1 166 ? 56.769  -7.399  -13.946 1.00 14.91 ? 167 ALA B O   1 
ATOM   5203 C  CB  . ALA B 1 166 ? 54.516  -5.316  -15.208 1.00 14.60 ? 167 ALA B CB  1 
ATOM   5204 N  N   . PHE B 1 167 ? 55.675  -6.225  -12.367 1.00 15.36 ? 168 PHE B N   1 
ATOM   5205 C  CA  . PHE B 1 167 ? 56.773  -6.283  -11.386 1.00 15.64 ? 168 PHE B CA  1 
ATOM   5206 C  C   . PHE B 1 167 ? 57.045  -7.695  -10.826 1.00 15.69 ? 168 PHE B C   1 
ATOM   5207 O  O   . PHE B 1 167 ? 58.206  -8.106  -10.740 1.00 15.32 ? 168 PHE B O   1 
ATOM   5208 C  CB  . PHE B 1 167 ? 56.537  -5.279  -10.260 1.00 15.66 ? 168 PHE B CB  1 
ATOM   5209 C  CG  . PHE B 1 167 ? 57.578  -5.331  -9.161  1.00 17.52 ? 168 PHE B CG  1 
ATOM   5210 C  CD1 . PHE B 1 167 ? 58.731  -4.565  -9.242  1.00 18.70 ? 168 PHE B CD1 1 
ATOM   5211 C  CD2 . PHE B 1 167 ? 57.392  -6.140  -8.051  1.00 17.29 ? 168 PHE B CD2 1 
ATOM   5212 C  CE1 . PHE B 1 167 ? 59.687  -4.611  -8.230  1.00 20.68 ? 168 PHE B CE1 1 
ATOM   5213 C  CE2 . PHE B 1 167 ? 58.335  -6.192  -7.039  1.00 19.85 ? 168 PHE B CE2 1 
ATOM   5214 C  CZ  . PHE B 1 167 ? 59.484  -5.422  -7.123  1.00 19.49 ? 168 PHE B CZ  1 
ATOM   5215 N  N   . GLU B 1 168 ? 55.986  -8.410  -10.434 1.00 15.70 ? 169 GLU B N   1 
ATOM   5216 C  CA  . GLU B 1 168 ? 56.060  -9.833  -10.085 1.00 15.96 ? 169 GLU B CA  1 
ATOM   5217 C  C   . GLU B 1 168 ? 56.744  -10.639 -11.184 1.00 15.18 ? 169 GLU B C   1 
ATOM   5218 O  O   . GLU B 1 168 ? 57.591  -11.479 -10.899 1.00 14.55 ? 169 GLU B O   1 
ATOM   5219 C  CB  . GLU B 1 168 ? 54.664  -10.442 -9.894  1.00 16.29 ? 169 GLU B CB  1 
ATOM   5220 C  CG  . GLU B 1 168 ? 54.053  -10.402 -8.499  1.00 20.13 ? 169 GLU B CG  1 
ATOM   5221 C  CD  . GLU B 1 168 ? 54.957  -10.928 -7.395  1.00 21.69 ? 169 GLU B CD  1 
ATOM   5222 O  OE1 . GLU B 1 168 ? 55.054  -12.163 -7.186  1.00 22.55 ? 169 GLU B OE1 1 
ATOM   5223 O  OE2 . GLU B 1 168 ? 55.540  -10.077 -6.706  1.00 22.59 ? 169 GLU B OE2 1 
ATOM   5224 N  N   . SER B 1 169 ? 56.353  -10.388 -12.434 1.00 15.01 ? 170 SER B N   1 
ATOM   5225 C  CA  . SER B 1 169 ? 56.874  -11.144 -13.584 1.00 14.92 ? 170 SER B CA  1 
ATOM   5226 C  C   . SER B 1 169 ? 58.380  -10.950 -13.786 1.00 15.08 ? 170 SER B C   1 
ATOM   5227 O  O   . SER B 1 169 ? 59.130  -11.927 -13.860 1.00 15.18 ? 170 SER B O   1 
ATOM   5228 C  CB  . SER B 1 169 ? 56.102  -10.796 -14.867 1.00 14.95 ? 170 SER B CB  1 
ATOM   5229 O  OG  . SER B 1 169 ? 54.735  -11.174 -14.759 1.00 13.65 ? 170 SER B OG  1 
ATOM   5230 N  N   . ILE B 1 170 ? 58.820  -9.694  -13.865 1.00 14.94 ? 171 ILE B N   1 
ATOM   5231 C  CA  . ILE B 1 170 ? 60.233  -9.399  -14.101 1.00 14.81 ? 171 ILE B CA  1 
ATOM   5232 C  C   . ILE B 1 170 ? 61.131  -9.867  -12.941 1.00 15.13 ? 171 ILE B C   1 
ATOM   5233 O  O   . ILE B 1 170 ? 62.224  -10.377 -13.173 1.00 14.75 ? 171 ILE B O   1 
ATOM   5234 C  CB  . ILE B 1 170 ? 60.478  -7.896  -14.460 1.00 14.81 ? 171 ILE B CB  1 
ATOM   5235 C  CG1 . ILE B 1 170 ? 61.903  -7.683  -14.985 1.00 15.15 ? 171 ILE B CG1 1 
ATOM   5236 C  CG2 . ILE B 1 170 ? 60.154  -6.957  -13.296 1.00 13.89 ? 171 ILE B CG2 1 
ATOM   5237 C  CD1 . ILE B 1 170 ? 62.152  -8.328  -16.362 1.00 15.29 ? 171 ILE B CD1 1 
ATOM   5238 N  N   . THR B 1 171 ? 60.654  -9.708  -11.705 1.00 15.45 ? 172 THR B N   1 
ATOM   5239 C  CA  . THR B 1 171 ? 61.408  -10.145 -10.532 1.00 15.72 ? 172 THR B CA  1 
ATOM   5240 C  C   . THR B 1 171 ? 61.472  -11.662 -10.458 1.00 15.80 ? 172 THR B C   1 
ATOM   5241 O  O   . THR B 1 171 ? 62.482  -12.219 -10.052 1.00 15.28 ? 172 THR B O   1 
ATOM   5242 C  CB  . THR B 1 171 ? 60.834  -9.591  -9.198  1.00 15.97 ? 172 THR B CB  1 
ATOM   5243 O  OG1 . THR B 1 171 ? 59.449  -9.951  -9.067  1.00 15.79 ? 172 THR B OG1 1 
ATOM   5244 C  CG2 . THR B 1 171 ? 60.984  -8.071  -9.130  1.00 15.19 ? 172 THR B CG2 1 
ATOM   5245 N  N   . ASN B 1 172 ? 60.396  -12.331 -10.859 1.00 16.68 ? 173 ASN B N   1 
ATOM   5246 C  CA  . ASN B 1 172 ? 60.392  -13.790 -10.867 1.00 17.11 ? 173 ASN B CA  1 
ATOM   5247 C  C   . ASN B 1 172 ? 61.413  -14.389 -11.836 1.00 17.41 ? 173 ASN B C   1 
ATOM   5248 O  O   . ASN B 1 172 ? 62.087  -15.362 -11.491 1.00 17.04 ? 173 ASN B O   1 
ATOM   5249 C  CB  . ASN B 1 172 ? 58.994  -14.366 -11.121 1.00 17.28 ? 173 ASN B CB  1 
ATOM   5250 C  CG  . ASN B 1 172 ? 58.802  -15.740 -10.470 1.00 18.04 ? 173 ASN B CG  1 
ATOM   5251 O  OD1 . ASN B 1 172 ? 59.485  -16.084 -9.497  1.00 17.18 ? 173 ASN B OD1 1 
ATOM   5252 N  ND2 . ASN B 1 172 ? 57.869  -16.520 -10.996 1.00 17.73 ? 173 ASN B ND2 1 
ATOM   5253 N  N   . VAL B 1 173 ? 61.543  -13.805 -13.031 1.00 17.50 ? 174 VAL B N   1 
ATOM   5254 C  CA  . VAL B 1 173 ? 62.516  -14.317 -14.006 1.00 17.77 ? 174 VAL B CA  1 
ATOM   5255 C  C   . VAL B 1 173 ? 63.950  -13.887 -13.670 1.00 18.13 ? 174 VAL B C   1 
ATOM   5256 O  O   . VAL B 1 173 ? 64.901  -14.582 -14.016 1.00 18.38 ? 174 VAL B O   1 
ATOM   5257 C  CB  . VAL B 1 173 ? 62.153  -14.001 -15.502 1.00 17.68 ? 174 VAL B CB  1 
ATOM   5258 C  CG1 . VAL B 1 173 ? 60.841  -14.676 -15.893 1.00 17.33 ? 174 VAL B CG1 1 
ATOM   5259 C  CG2 . VAL B 1 173 ? 62.083  -12.500 -15.767 1.00 16.74 ? 174 VAL B CG2 1 
ATOM   5260 N  N   . ILE B 1 174 ? 64.098  -12.757 -12.982 1.00 18.47 ? 175 ILE B N   1 
ATOM   5261 C  CA  . ILE B 1 174 ? 65.422  -12.285 -12.591 1.00 18.78 ? 175 ILE B CA  1 
ATOM   5262 C  C   . ILE B 1 174 ? 65.940  -12.981 -11.328 1.00 19.14 ? 175 ILE B C   1 
ATOM   5263 O  O   . ILE B 1 174 ? 67.088  -13.437 -11.301 1.00 19.01 ? 175 ILE B O   1 
ATOM   5264 C  CB  . ILE B 1 174 ? 65.489  -10.740 -12.431 1.00 18.61 ? 175 ILE B CB  1 
ATOM   5265 C  CG1 . ILE B 1 174 ? 65.402  -10.051 -13.794 1.00 18.76 ? 175 ILE B CG1 1 
ATOM   5266 C  CG2 . ILE B 1 174 ? 66.802  -10.315 -11.752 1.00 18.65 ? 175 ILE B CG2 1 
ATOM   5267 C  CD1 . ILE B 1 174 ? 65.321  -8.537  -13.697 1.00 18.47 ? 175 ILE B CD1 1 
ATOM   5268 N  N   . PHE B 1 175 ? 65.091  -13.059 -10.304 1.00 19.26 ? 176 PHE B N   1 
ATOM   5269 C  CA  . PHE B 1 175 ? 65.491  -13.550 -8.992  1.00 20.06 ? 176 PHE B CA  1 
ATOM   5270 C  C   . PHE B 1 175 ? 65.046  -14.991 -8.713  1.00 20.75 ? 176 PHE B C   1 
ATOM   5271 O  O   . PHE B 1 175 ? 65.499  -15.614 -7.748  1.00 19.96 ? 176 PHE B O   1 
ATOM   5272 C  CB  . PHE B 1 175 ? 64.983  -12.605 -7.891  1.00 19.78 ? 176 PHE B CB  1 
ATOM   5273 C  CG  . PHE B 1 175 ? 65.519  -11.193 -8.002  1.00 20.08 ? 176 PHE B CG  1 
ATOM   5274 C  CD1 . PHE B 1 175 ? 64.693  -10.149 -8.413  1.00 19.95 ? 176 PHE B CD1 1 
ATOM   5275 C  CD2 . PHE B 1 175 ? 66.853  -10.910 -7.699  1.00 19.80 ? 176 PHE B CD2 1 
ATOM   5276 C  CE1 . PHE B 1 175 ? 65.191  -8.834  -8.515  1.00 21.15 ? 176 PHE B CE1 1 
ATOM   5277 C  CE2 . PHE B 1 175 ? 67.358  -9.599  -7.800  1.00 20.45 ? 176 PHE B CE2 1 
ATOM   5278 C  CZ  . PHE B 1 175 ? 66.524  -8.563  -8.213  1.00 19.06 ? 176 PHE B CZ  1 
ATOM   5279 N  N   . GLY B 1 176 ? 64.162  -15.515 -9.562  1.00 21.46 ? 177 GLY B N   1 
ATOM   5280 C  CA  . GLY B 1 176 ? 63.572  -16.838 -9.340  1.00 22.31 ? 177 GLY B CA  1 
ATOM   5281 C  C   . GLY B 1 176 ? 62.788  -16.928 -8.039  1.00 22.81 ? 177 GLY B C   1 
ATOM   5282 O  O   . GLY B 1 176 ? 62.599  -18.021 -7.512  1.00 23.04 ? 177 GLY B O   1 
ATOM   5283 N  N   . GLU B 1 177 ? 62.355  -15.780 -7.515  1.00 23.09 ? 178 GLU B N   1 
ATOM   5284 C  CA  . GLU B 1 177 ? 61.573  -15.728 -6.284  1.00 24.31 ? 178 GLU B CA  1 
ATOM   5285 C  C   . GLU B 1 177 ? 60.338  -14.845 -6.461  1.00 24.18 ? 178 GLU B C   1 
ATOM   5286 O  O   . GLU B 1 177 ? 60.403  -13.808 -7.118  1.00 23.92 ? 178 GLU B O   1 
ATOM   5287 C  CB  . GLU B 1 177 ? 62.402  -15.174 -5.112  1.00 24.57 ? 178 GLU B CB  1 
ATOM   5288 C  CG  . GLU B 1 177 ? 63.882  -15.550 -5.123  1.00 28.00 ? 178 GLU B CG  1 
ATOM   5289 C  CD  . GLU B 1 177 ? 64.589  -15.296 -3.800  1.00 31.80 ? 178 GLU B CD  1 
ATOM   5290 O  OE1 . GLU B 1 177 ? 64.353  -14.234 -3.166  1.00 34.75 ? 178 GLU B OE1 1 
ATOM   5291 O  OE2 . GLU B 1 177 ? 65.395  -16.165 -3.400  1.00 33.18 ? 178 GLU B OE2 1 
ATOM   5292 N  N   . ARG B 1 178 ? 59.231  -15.259 -5.846  1.00 24.53 ? 179 ARG B N   1 
ATOM   5293 C  CA  . ARG B 1 178 ? 58.002  -14.470 -5.800  1.00 24.63 ? 179 ARG B CA  1 
ATOM   5294 C  C   . ARG B 1 178 ? 58.103  -13.361 -4.760  1.00 25.16 ? 179 ARG B C   1 
ATOM   5295 O  O   . ARG B 1 178 ? 58.522  -13.599 -3.630  1.00 25.81 ? 179 ARG B O   1 
ATOM   5296 C  CB  . ARG B 1 178 ? 56.788  -15.363 -5.503  1.00 24.31 ? 179 ARG B CB  1 
ATOM   5297 C  CG  . ARG B 1 178 ? 56.485  -16.400 -6.600  1.00 23.24 ? 179 ARG B CG  1 
ATOM   5298 C  CD  . ARG B 1 178 ? 56.145  -15.738 -7.952  1.00 22.18 ? 179 ARG B CD  1 
ATOM   5299 N  NE  . ARG B 1 178 ? 54.912  -14.955 -7.879  1.00 20.72 ? 179 ARG B NE  1 
ATOM   5300 C  CZ  . ARG B 1 178 ? 53.693  -15.456 -8.072  1.00 20.33 ? 179 ARG B CZ  1 
ATOM   5301 N  NH1 . ARG B 1 178 ? 53.527  -16.749 -8.360  1.00 19.95 ? 179 ARG B NH1 1 
ATOM   5302 N  NH2 . ARG B 1 178 ? 52.638  -14.668 -7.965  1.00 18.98 ? 179 ARG B NH2 1 
ATOM   5303 N  N   . GLN B 1 179 ? 57.711  -12.152 -5.149  1.00 25.44 ? 180 GLN B N   1 
ATOM   5304 C  CA  . GLN B 1 179 ? 57.734  -10.997 -4.251  1.00 25.60 ? 180 GLN B CA  1 
ATOM   5305 C  C   . GLN B 1 179 ? 56.409  -10.785 -3.514  1.00 25.38 ? 180 GLN B C   1 
ATOM   5306 O  O   . GLN B 1 179 ? 56.334  -9.982  -2.585  1.00 25.29 ? 180 GLN B O   1 
ATOM   5307 C  CB  . GLN B 1 179 ? 58.116  -9.740  -5.033  1.00 25.56 ? 180 GLN B CB  1 
ATOM   5308 C  CG  . GLN B 1 179 ? 59.362  -9.916  -5.887  1.00 26.57 ? 180 GLN B CG  1 
ATOM   5309 C  CD  . GLN B 1 179 ? 60.626  -10.106 -5.066  1.00 28.81 ? 180 GLN B CD  1 
ATOM   5310 O  OE1 . GLN B 1 179 ? 60.854  -9.392  -4.086  1.00 29.26 ? 180 GLN B OE1 1 
ATOM   5311 N  NE2 . GLN B 1 179 ? 61.458  -11.069 -5.464  1.00 28.03 ? 180 GLN B NE2 1 
ATOM   5312 N  N   . GLY B 1 180 ? 55.368  -11.500 -3.935  1.00 25.49 ? 181 GLY B N   1 
ATOM   5313 C  CA  . GLY B 1 180 ? 54.064  -11.443 -3.262  1.00 25.58 ? 181 GLY B CA  1 
ATOM   5314 C  C   . GLY B 1 180 ? 53.169  -10.268 -3.631  1.00 25.68 ? 181 GLY B C   1 
ATOM   5315 O  O   . GLY B 1 180 ? 52.230  -9.957  -2.895  1.00 25.43 ? 181 GLY B O   1 
ATOM   5316 N  N   . MET B 1 181 ? 53.430  -9.626  -4.773  1.00 25.67 ? 182 MET B N   1 
ATOM   5317 C  CA  . MET B 1 181 ? 52.674  -8.417  -5.159  1.00 26.07 ? 182 MET B CA  1 
ATOM   5318 C  C   . MET B 1 181 ? 51.257  -8.691  -5.692  1.00 26.09 ? 182 MET B C   1 
ATOM   5319 O  O   . MET B 1 181 ? 50.515  -7.756  -5.984  1.00 25.59 ? 182 MET B O   1 
ATOM   5320 C  CB  . MET B 1 181 ? 53.464  -7.540  -6.152  1.00 26.48 ? 182 MET B CB  1 
ATOM   5321 C  CG  . MET B 1 181 ? 54.846  -7.097  -5.675  1.00 27.15 ? 182 MET B CG  1 
ATOM   5322 S  SD  . MET B 1 181 ? 54.769  -6.182  -4.121  1.00 30.68 ? 182 MET B SD  1 
ATOM   5323 C  CE  . MET B 1 181 ? 54.197  -4.579  -4.715  1.00 28.36 ? 182 MET B CE  1 
ATOM   5324 N  N   . LEU B 1 182 ? 50.880  -9.961  -5.811  1.00 26.64 ? 183 LEU B N   1 
ATOM   5325 C  CA  . LEU B 1 182 ? 49.512  -10.306 -6.205  1.00 27.83 ? 183 LEU B CA  1 
ATOM   5326 C  C   . LEU B 1 182 ? 48.629  -10.805 -5.039  1.00 28.97 ? 183 LEU B C   1 
ATOM   5327 O  O   . LEU B 1 182 ? 47.449  -11.102 -5.230  1.00 28.93 ? 183 LEU B O   1 
ATOM   5328 C  CB  . LEU B 1 182 ? 49.501  -11.280 -7.396  1.00 27.17 ? 183 LEU B CB  1 
ATOM   5329 C  CG  . LEU B 1 182 ? 50.048  -10.792 -8.756  1.00 26.54 ? 183 LEU B CG  1 
ATOM   5330 C  CD1 . LEU B 1 182 ? 49.802  -11.848 -9.834  1.00 24.45 ? 183 LEU B CD1 1 
ATOM   5331 C  CD2 . LEU B 1 182 ? 49.473  -9.439  -9.197  1.00 24.89 ? 183 LEU B CD2 1 
ATOM   5332 N  N   . GLU B 1 183 ? 49.204  -10.871 -3.839  1.00 30.61 ? 184 GLU B N   1 
ATOM   5333 C  CA  . GLU B 1 183 ? 48.459  -11.224 -2.621  1.00 32.35 ? 184 GLU B CA  1 
ATOM   5334 C  C   . GLU B 1 183 ? 47.665  -10.022 -2.097  1.00 33.03 ? 184 GLU B C   1 
ATOM   5335 O  O   . GLU B 1 183 ? 47.892  -8.885  -2.525  1.00 32.89 ? 184 GLU B O   1 
ATOM   5336 C  CB  . GLU B 1 183 ? 49.414  -11.722 -1.537  1.00 32.63 ? 184 GLU B CB  1 
ATOM   5337 C  CG  . GLU B 1 183 ? 50.145  -13.019 -1.878  1.00 34.96 ? 184 GLU B CG  1 
ATOM   5338 C  CD  . GLU B 1 183 ? 51.443  -13.166 -1.103  1.00 38.80 ? 184 GLU B CD  1 
ATOM   5339 O  OE1 . GLU B 1 183 ? 51.859  -12.183 -0.444  1.00 41.18 ? 184 GLU B OE1 1 
ATOM   5340 O  OE2 . GLU B 1 183 ? 52.054  -14.261 -1.150  1.00 40.57 ? 184 GLU B OE2 1 
ATOM   5341 N  N   . GLU B 1 184 ? 46.749  -10.279 -1.164  1.00 34.20 ? 185 GLU B N   1 
ATOM   5342 C  CA  . GLU B 1 184 ? 45.875  -9.237  -0.607  1.00 35.25 ? 185 GLU B CA  1 
ATOM   5343 C  C   . GLU B 1 184 ? 46.643  -8.141  0.142   1.00 35.37 ? 185 GLU B C   1 
ATOM   5344 O  O   . GLU B 1 184 ? 46.370  -6.955  -0.045  1.00 35.66 ? 185 GLU B O   1 
ATOM   5345 C  CB  . GLU B 1 184 ? 44.799  -9.852  0.298   1.00 35.63 ? 185 GLU B CB  1 
ATOM   5346 C  CG  . GLU B 1 184 ? 43.670  -10.554 -0.453  1.00 38.01 ? 185 GLU B CG  1 
ATOM   5347 C  CD  . GLU B 1 184 ? 42.443  -10.807 0.420   1.00 41.78 ? 185 GLU B CD  1 
ATOM   5348 O  OE1 . GLU B 1 184 ? 41.401  -10.152 0.181   1.00 42.44 ? 185 GLU B OE1 1 
ATOM   5349 O  OE2 . GLU B 1 184 ? 42.523  -11.650 1.352   1.00 43.27 ? 185 GLU B OE2 1 
ATOM   5350 N  N   . VAL B 1 185 ? 47.593  -8.545  0.982   1.00 35.50 ? 186 VAL B N   1 
ATOM   5351 C  CA  . VAL B 1 185 ? 48.457  -7.604  1.704   1.00 35.77 ? 186 VAL B CA  1 
ATOM   5352 C  C   . VAL B 1 185 ? 49.826  -7.553  1.025   1.00 35.75 ? 186 VAL B C   1 
ATOM   5353 O  O   . VAL B 1 185 ? 50.531  -8.561  0.939   1.00 35.76 ? 186 VAL B O   1 
ATOM   5354 C  CB  . VAL B 1 185 ? 48.588  -7.965  3.212   1.00 35.75 ? 186 VAL B CB  1 
ATOM   5355 C  CG1 . VAL B 1 185 ? 49.634  -7.088  3.900   1.00 36.11 ? 186 VAL B CG1 1 
ATOM   5356 C  CG2 . VAL B 1 185 ? 47.238  -7.821  3.908   1.00 36.08 ? 186 VAL B CG2 1 
ATOM   5357 N  N   . VAL B 1 186 ? 50.188  -6.366  0.549   1.00 35.68 ? 187 VAL B N   1 
ATOM   5358 C  CA  . VAL B 1 186 ? 51.331  -6.195  -0.345  1.00 35.50 ? 187 VAL B CA  1 
ATOM   5359 C  C   . VAL B 1 186 ? 52.521  -5.547  0.378   1.00 35.02 ? 187 VAL B C   1 
ATOM   5360 O  O   . VAL B 1 186 ? 52.333  -4.782  1.322   1.00 34.98 ? 187 VAL B O   1 
ATOM   5361 C  CB  . VAL B 1 186 ? 50.883  -5.415  -1.632  1.00 35.78 ? 187 VAL B CB  1 
ATOM   5362 C  CG1 . VAL B 1 186 ? 51.956  -4.480  -2.156  1.00 36.00 ? 187 VAL B CG1 1 
ATOM   5363 C  CG2 . VAL B 1 186 ? 50.396  -6.395  -2.720  1.00 35.87 ? 187 VAL B CG2 1 
ATOM   5364 N  N   . ASN B 1 187 ? 53.737  -5.887  -0.052  1.00 34.32 ? 188 ASN B N   1 
ATOM   5365 C  CA  . ASN B 1 187 ? 54.953  -5.257  0.456   1.00 33.65 ? 188 ASN B CA  1 
ATOM   5366 C  C   . ASN B 1 187 ? 55.013  -3.769  0.073   1.00 32.68 ? 188 ASN B C   1 
ATOM   5367 O  O   . ASN B 1 187 ? 55.115  -3.436  -1.114  1.00 32.62 ? 188 ASN B O   1 
ATOM   5368 C  CB  . ASN B 1 187 ? 56.186  -5.997  -0.072  1.00 33.95 ? 188 ASN B CB  1 
ATOM   5369 C  CG  . ASN B 1 187 ? 57.465  -5.626  0.673   1.00 35.25 ? 188 ASN B CG  1 
ATOM   5370 O  OD1 . ASN B 1 187 ? 57.673  -4.472  1.058   1.00 36.94 ? 188 ASN B OD1 1 
ATOM   5371 N  ND2 . ASN B 1 187 ? 58.335  -6.612  0.877   1.00 36.50 ? 188 ASN B ND2 1 
ATOM   5372 N  N   . PRO B 1 188 ? 54.952  -2.869  1.078   1.00 31.71 ? 189 PRO B N   1 
ATOM   5373 C  CA  . PRO B 1 188 ? 54.914  -1.430  0.777   1.00 30.78 ? 189 PRO B CA  1 
ATOM   5374 C  C   . PRO B 1 188 ? 56.213  -0.887  0.168   1.00 29.62 ? 189 PRO B C   1 
ATOM   5375 O  O   . PRO B 1 188 ? 56.184  0.137   -0.518  1.00 29.21 ? 189 PRO B O   1 
ATOM   5376 C  CB  . PRO B 1 188 ? 54.629  -0.786  2.141   1.00 30.80 ? 189 PRO B CB  1 
ATOM   5377 C  CG  . PRO B 1 188 ? 55.078  -1.789  3.145   1.00 31.24 ? 189 PRO B CG  1 
ATOM   5378 C  CD  . PRO B 1 188 ? 54.892  -3.137  2.530   1.00 31.57 ? 189 PRO B CD  1 
ATOM   5379 N  N   . GLU B 1 189 ? 57.329  -1.570  0.409   1.00 28.47 ? 190 GLU B N   1 
ATOM   5380 C  CA  . GLU B 1 189 ? 58.610  -1.155  -0.160  1.00 27.71 ? 190 GLU B CA  1 
ATOM   5381 C  C   . GLU B 1 189 ? 58.740  -1.508  -1.645  1.00 26.31 ? 190 GLU B C   1 
ATOM   5382 O  O   . GLU B 1 189 ? 59.348  -0.762  -2.409  1.00 25.74 ? 190 GLU B O   1 
ATOM   5383 C  CB  . GLU B 1 189 ? 59.793  -1.698  0.648   1.00 28.10 ? 190 GLU B CB  1 
ATOM   5384 C  CG  . GLU B 1 189 ? 59.970  -1.044  2.028   1.00 31.09 ? 190 GLU B CG  1 
ATOM   5385 C  CD  . GLU B 1 189 ? 60.060  0.488   1.976   1.00 35.35 ? 190 GLU B CD  1 
ATOM   5386 O  OE1 . GLU B 1 189 ? 60.841  1.029   1.157   1.00 37.33 ? 190 GLU B OE1 1 
ATOM   5387 O  OE2 . GLU B 1 189 ? 59.352  1.155   2.767   1.00 37.02 ? 190 GLU B OE2 1 
ATOM   5388 N  N   . ALA B 1 190 ? 58.168  -2.639  -2.046  1.00 25.01 ? 191 ALA B N   1 
ATOM   5389 C  CA  . ALA B 1 190 ? 58.101  -2.996  -3.459  1.00 23.83 ? 191 ALA B CA  1 
ATOM   5390 C  C   . ALA B 1 190 ? 57.133  -2.073  -4.211  1.00 23.05 ? 191 ALA B C   1 
ATOM   5391 O  O   . ALA B 1 190 ? 57.390  -1.716  -5.359  1.00 22.35 ? 191 ALA B O   1 
ATOM   5392 C  CB  . ALA B 1 190 ? 57.714  -4.450  -3.635  1.00 23.81 ? 191 ALA B CB  1 
ATOM   5393 N  N   . GLN B 1 191 ? 56.043  -1.670  -3.558  1.00 22.22 ? 192 GLN B N   1 
ATOM   5394 C  CA  . GLN B 1 191 ? 55.122  -0.704  -4.156  1.00 22.20 ? 192 GLN B CA  1 
ATOM   5395 C  C   . GLN B 1 191 ? 55.791  0.664   -4.379  1.00 22.35 ? 192 GLN B C   1 
ATOM   5396 O  O   . GLN B 1 191 ? 55.571  1.311   -5.412  1.00 22.00 ? 192 GLN B O   1 
ATOM   5397 C  CB  . GLN B 1 191 ? 53.839  -0.561  -3.336  1.00 22.01 ? 192 GLN B CB  1 
ATOM   5398 C  CG  . GLN B 1 191 ? 52.740  0.258   -4.025  1.00 21.44 ? 192 GLN B CG  1 
ATOM   5399 C  CD  . GLN B 1 191 ? 52.151  -0.425  -5.255  1.00 21.19 ? 192 GLN B CD  1 
ATOM   5400 O  OE1 . GLN B 1 191 ? 51.523  -1.481  -5.155  1.00 20.42 ? 192 GLN B OE1 1 
ATOM   5401 N  NE2 . GLN B 1 191 ? 52.337  0.193   -6.424  1.00 19.94 ? 192 GLN B NE2 1 
ATOM   5402 N  N   . ARG B 1 192 ? 56.607  1.092   -3.415  1.00 22.05 ? 193 ARG B N   1 
ATOM   5403 C  CA  . ARG B 1 192 ? 57.401  2.310   -3.567  1.00 22.24 ? 193 ARG B CA  1 
ATOM   5404 C  C   . ARG B 1 192 ? 58.302  2.244   -4.805  1.00 21.25 ? 193 ARG B C   1 
ATOM   5405 O  O   . ARG B 1 192 ? 58.431  3.232   -5.521  1.00 20.79 ? 193 ARG B O   1 
ATOM   5406 C  CB  . ARG B 1 192 ? 58.233  2.595   -2.307  1.00 22.64 ? 193 ARG B CB  1 
ATOM   5407 C  CG  . ARG B 1 192 ? 57.532  3.493   -1.287  1.00 25.58 ? 193 ARG B CG  1 
ATOM   5408 C  CD  . ARG B 1 192 ? 58.383  3.731   -0.020  1.00 30.29 ? 193 ARG B CD  1 
ATOM   5409 N  NE  . ARG B 1 192 ? 59.811  3.962   -0.282  1.00 33.78 ? 193 ARG B NE  1 
ATOM   5410 C  CZ  . ARG B 1 192 ? 60.350  5.125   -0.654  1.00 35.48 ? 193 ARG B CZ  1 
ATOM   5411 N  NH1 . ARG B 1 192 ? 59.593  6.203   -0.838  1.00 37.27 ? 193 ARG B NH1 1 
ATOM   5412 N  NH2 . ARG B 1 192 ? 61.657  5.213   -0.856  1.00 35.84 ? 193 ARG B NH2 1 
ATOM   5413 N  N   . PHE B 1 193 ? 58.908  1.081   -5.058  1.00 20.24 ? 194 PHE B N   1 
ATOM   5414 C  CA  . PHE B 1 193 ? 59.749  0.910   -6.244  1.00 19.86 ? 194 PHE B CA  1 
ATOM   5415 C  C   . PHE B 1 193 ? 58.937  1.085   -7.540  1.00 19.12 ? 194 PHE B C   1 
ATOM   5416 O  O   . PHE B 1 193 ? 59.392  1.747   -8.469  1.00 18.41 ? 194 PHE B O   1 
ATOM   5417 C  CB  . PHE B 1 193 ? 60.472  -0.443  -6.223  1.00 20.04 ? 194 PHE B CB  1 
ATOM   5418 C  CG  . PHE B 1 193 ? 61.333  -0.696  -7.440  1.00 21.36 ? 194 PHE B CG  1 
ATOM   5419 C  CD1 . PHE B 1 193 ? 62.661  -0.291  -7.469  1.00 22.14 ? 194 PHE B CD1 1 
ATOM   5420 C  CD2 . PHE B 1 193 ? 60.807  -1.334  -8.561  1.00 23.35 ? 194 PHE B CD2 1 
ATOM   5421 C  CE1 . PHE B 1 193 ? 63.462  -0.524  -8.584  1.00 22.65 ? 194 PHE B CE1 1 
ATOM   5422 C  CE2 . PHE B 1 193 ? 61.599  -1.571  -9.686  1.00 24.84 ? 194 PHE B CE2 1 
ATOM   5423 C  CZ  . PHE B 1 193 ? 62.932  -1.160  -9.694  1.00 24.28 ? 194 PHE B CZ  1 
ATOM   5424 N  N   . ILE B 1 194 ? 57.741  0.494   -7.570  1.00 18.57 ? 195 ILE B N   1 
ATOM   5425 C  CA  . ILE B 1 194 ? 56.825  0.559   -8.709  1.00 18.30 ? 195 ILE B CA  1 
ATOM   5426 C  C   . ILE B 1 194 ? 56.432  2.000   -9.019  1.00 18.35 ? 195 ILE B C   1 
ATOM   5427 O  O   . ILE B 1 194 ? 56.506  2.429   -10.177 1.00 18.23 ? 195 ILE B O   1 
ATOM   5428 C  CB  . ILE B 1 194 ? 55.534  -0.287  -8.474  1.00 18.06 ? 195 ILE B CB  1 
ATOM   5429 C  CG1 . ILE B 1 194 ? 55.862  -1.778  -8.528  1.00 18.73 ? 195 ILE B CG1 1 
ATOM   5430 C  CG2 . ILE B 1 194 ? 54.443  0.076   -9.498  1.00 17.23 ? 195 ILE B CG2 1 
ATOM   5431 C  CD1 . ILE B 1 194 ? 54.716  -2.711  -8.126  1.00 18.69 ? 195 ILE B CD1 1 
ATOM   5432 N  N   . ASP B 1 195 ? 56.006  2.721   -7.984  1.00 18.12 ? 196 ASP B N   1 
ATOM   5433 C  CA  . ASP B 1 195 ? 55.660  4.141   -8.086  1.00 18.89 ? 196 ASP B CA  1 
ATOM   5434 C  C   . ASP B 1 195 ? 56.841  5.004   -8.523  1.00 18.08 ? 196 ASP B C   1 
ATOM   5435 O  O   . ASP B 1 195 ? 56.647  5.975   -9.233  1.00 18.54 ? 196 ASP B O   1 
ATOM   5436 C  CB  . ASP B 1 195 ? 55.109  4.677   -6.753  1.00 19.29 ? 196 ASP B CB  1 
ATOM   5437 C  CG  . ASP B 1 195 ? 53.886  3.908   -6.260  1.00 22.39 ? 196 ASP B CG  1 
ATOM   5438 O  OD1 . ASP B 1 195 ? 53.272  3.127   -7.034  1.00 24.25 ? 196 ASP B OD1 1 
ATOM   5439 O  OD2 . ASP B 1 195 ? 53.525  4.100   -5.075  1.00 27.34 ? 196 ASP B OD2 1 
ATOM   5440 N  N   . ALA B 1 196 ? 58.052  4.654   -8.096  1.00 17.63 ? 197 ALA B N   1 
ATOM   5441 C  CA  . ALA B 1 196 ? 59.247  5.418   -8.456  1.00 17.96 ? 197 ALA B CA  1 
ATOM   5442 C  C   . ALA B 1 196 ? 59.540  5.335   -9.949  1.00 18.33 ? 197 ALA B C   1 
ATOM   5443 O  O   . ALA B 1 196 ? 60.004  6.303   -10.551 1.00 18.46 ? 197 ALA B O   1 
ATOM   5444 C  CB  . ALA B 1 196 ? 60.440  4.941   -7.675  1.00 17.74 ? 197 ALA B CB  1 
ATOM   5445 N  N   . ILE B 1 197 ? 59.256  4.177   -10.536 1.00 18.71 ? 198 ILE B N   1 
ATOM   5446 C  CA  . ILE B 1 197 ? 59.483  3.953   -11.955 1.00 19.40 ? 198 ILE B CA  1 
ATOM   5447 C  C   . ILE B 1 197 ? 58.585  4.850   -12.788 1.00 19.65 ? 198 ILE B C   1 
ATOM   5448 O  O   . ILE B 1 197 ? 59.049  5.521   -13.714 1.00 19.04 ? 198 ILE B O   1 
ATOM   5449 C  CB  . ILE B 1 197 ? 59.295  2.467   -12.323 1.00 19.69 ? 198 ILE B CB  1 
ATOM   5450 C  CG1 . ILE B 1 197 ? 60.483  1.670   -11.776 1.00 19.89 ? 198 ILE B CG1 1 
ATOM   5451 C  CG2 . ILE B 1 197 ? 59.140  2.286   -13.846 1.00 18.89 ? 198 ILE B CG2 1 
ATOM   5452 C  CD1 . ILE B 1 197 ? 60.282  0.199   -11.816 1.00 22.56 ? 198 ILE B CD1 1 
ATOM   5453 N  N   . TYR B 1 198 ? 57.303  4.865   -12.436 1.00 20.25 ? 199 TYR B N   1 
ATOM   5454 C  CA  . TYR B 1 198 ? 56.334  5.721   -13.093 1.00 21.00 ? 199 TYR B CA  1 
ATOM   5455 C  C   . TYR B 1 198 ? 56.755  7.186   -12.967 1.00 20.51 ? 199 TYR B C   1 
ATOM   5456 O  O   . TYR B 1 198 ? 56.733  7.928   -13.950 1.00 20.52 ? 199 TYR B O   1 
ATOM   5457 C  CB  . TYR B 1 198 ? 54.949  5.494   -12.484 1.00 21.63 ? 199 TYR B CB  1 
ATOM   5458 C  CG  . TYR B 1 198 ? 53.858  6.336   -13.096 1.00 24.91 ? 199 TYR B CG  1 
ATOM   5459 C  CD1 . TYR B 1 198 ? 53.093  5.849   -14.151 1.00 28.63 ? 199 TYR B CD1 1 
ATOM   5460 C  CD2 . TYR B 1 198 ? 53.582  7.617   -12.612 1.00 27.42 ? 199 TYR B CD2 1 
ATOM   5461 C  CE1 . TYR B 1 198 ? 52.080  6.617   -14.716 1.00 31.44 ? 199 TYR B CE1 1 
ATOM   5462 C  CE2 . TYR B 1 198 ? 52.575  8.395   -13.167 1.00 29.96 ? 199 TYR B CE2 1 
ATOM   5463 C  CZ  . TYR B 1 198 ? 51.829  7.889   -14.221 1.00 31.93 ? 199 TYR B CZ  1 
ATOM   5464 O  OH  . TYR B 1 198 ? 50.826  8.649   -14.784 1.00 34.46 ? 199 TYR B OH  1 
ATOM   5465 N  N   . GLN B 1 199 ? 57.149  7.583   -11.757 1.00 20.02 ? 200 GLN B N   1 
ATOM   5466 C  CA  . GLN B 1 199 ? 57.614  8.947   -11.490 1.00 19.84 ? 200 GLN B CA  1 
ATOM   5467 C  C   . GLN B 1 199 ? 58.857  9.319   -12.291 1.00 18.73 ? 200 GLN B C   1 
ATOM   5468 O  O   . GLN B 1 199 ? 58.945  10.430  -12.808 1.00 18.50 ? 200 GLN B O   1 
ATOM   5469 C  CB  . GLN B 1 199 ? 57.861  9.171   -9.987  1.00 20.25 ? 200 GLN B CB  1 
ATOM   5470 C  CG  . GLN B 1 199 ? 56.588  9.392   -9.194  1.00 23.25 ? 200 GLN B CG  1 
ATOM   5471 C  CD  . GLN B 1 199 ? 55.749  10.547  -9.758  1.00 28.41 ? 200 GLN B CD  1 
ATOM   5472 O  OE1 . GLN B 1 199 ? 56.262  11.656  -10.002 1.00 29.14 ? 200 GLN B OE1 1 
ATOM   5473 N  NE2 . GLN B 1 199 ? 54.459  10.284  -9.980  1.00 27.97 ? 200 GLN B NE2 1 
ATOM   5474 N  N   . MET B 1 200 ? 59.812  8.395   -12.388 1.00 17.59 ? 201 MET B N   1 
ATOM   5475 C  CA  . MET B 1 200 ? 61.005  8.623   -13.206 1.00 16.89 ? 201 MET B CA  1 
ATOM   5476 C  C   . MET B 1 200 ? 60.635  9.012   -14.653 1.00 16.50 ? 201 MET B C   1 
ATOM   5477 O  O   . MET B 1 200 ? 61.142  10.010  -15.177 1.00 16.36 ? 201 MET B O   1 
ATOM   5478 C  CB  . MET B 1 200 ? 61.931  7.408   -13.164 1.00 16.76 ? 201 MET B CB  1 
ATOM   5479 C  CG  . MET B 1 200 ? 63.277  7.635   -13.845 1.00 16.89 ? 201 MET B CG  1 
ATOM   5480 S  SD  . MET B 1 200 ? 63.214  7.421   -15.636 1.00 18.70 ? 201 MET B SD  1 
ATOM   5481 C  CE  . MET B 1 200 ? 63.110  5.633   -15.720 1.00 16.04 ? 201 MET B CE  1 
ATOM   5482 N  N   . PHE B 1 201 ? 59.734  8.247   -15.272 1.00 15.89 ? 202 PHE B N   1 
ATOM   5483 C  CA  . PHE B 1 201 ? 59.268  8.537   -16.634 1.00 15.97 ? 202 PHE B CA  1 
ATOM   5484 C  C   . PHE B 1 201 ? 58.521  9.868   -16.752 1.00 15.64 ? 202 PHE B C   1 
ATOM   5485 O  O   . PHE B 1 201 ? 58.857  10.692  -17.610 1.00 15.12 ? 202 PHE B O   1 
ATOM   5486 C  CB  . PHE B 1 201 ? 58.384  7.406   -17.163 1.00 15.95 ? 202 PHE B CB  1 
ATOM   5487 C  CG  . PHE B 1 201 ? 59.138  6.183   -17.573 1.00 16.84 ? 202 PHE B CG  1 
ATOM   5488 C  CD1 . PHE B 1 201 ? 58.859  4.954   -16.985 1.00 18.12 ? 202 PHE B CD1 1 
ATOM   5489 C  CD2 . PHE B 1 201 ? 60.112  6.245   -18.572 1.00 17.05 ? 202 PHE B CD2 1 
ATOM   5490 C  CE1 . PHE B 1 201 ? 59.561  3.799   -17.375 1.00 19.06 ? 202 PHE B CE1 1 
ATOM   5491 C  CE2 . PHE B 1 201 ? 60.808  5.101   -18.968 1.00 17.68 ? 202 PHE B CE2 1 
ATOM   5492 C  CZ  . PHE B 1 201 ? 60.535  3.880   -18.367 1.00 18.03 ? 202 PHE B CZ  1 
ATOM   5493 N  N   . HIS B 1 202 ? 57.510  10.050  -15.897 1.00 15.48 ? 203 HIS B N   1 
ATOM   5494 C  CA  . HIS B 1 202 ? 56.667  11.255  -15.859 1.00 15.94 ? 203 HIS B CA  1 
ATOM   5495 C  C   . HIS B 1 202 ? 57.479  12.546  -15.688 1.00 15.43 ? 203 HIS B C   1 
ATOM   5496 O  O   . HIS B 1 202 ? 57.275  13.525  -16.421 1.00 15.04 ? 203 HIS B O   1 
ATOM   5497 C  CB  . HIS B 1 202 ? 55.603  11.128  -14.745 1.00 16.49 ? 203 HIS B CB  1 
ATOM   5498 C  CG  . HIS B 1 202 ? 54.560  12.206  -14.762 1.00 19.73 ? 203 HIS B CG  1 
ATOM   5499 N  ND1 . HIS B 1 202 ? 53.340  12.054  -15.390 1.00 23.41 ? 203 HIS B ND1 1 
ATOM   5500 C  CD2 . HIS B 1 202 ? 54.545  13.447  -14.214 1.00 22.41 ? 203 HIS B CD2 1 
ATOM   5501 C  CE1 . HIS B 1 202 ? 52.627  13.158  -15.242 1.00 22.66 ? 203 HIS B CE1 1 
ATOM   5502 N  NE2 . HIS B 1 202 ? 53.334  14.018  -14.530 1.00 22.39 ? 203 HIS B NE2 1 
ATOM   5503 N  N   . THR B 1 203 ? 58.409  12.546  -14.737 1.00 15.23 ? 204 THR B N   1 
ATOM   5504 C  CA  . THR B 1 203 ? 59.219  13.743  -14.479 1.00 14.87 ? 204 THR B CA  1 
ATOM   5505 C  C   . THR B 1 203 ? 60.290  13.968  -15.542 1.00 14.93 ? 204 THR B C   1 
ATOM   5506 O  O   . THR B 1 203 ? 60.923  15.014  -15.548 1.00 15.73 ? 204 THR B O   1 
ATOM   5507 C  CB  . THR B 1 203 ? 59.885  13.733  -13.082 1.00 14.74 ? 204 THR B CB  1 
ATOM   5508 O  OG1 . THR B 1 203 ? 60.749  12.599  -12.962 1.00 14.93 ? 204 THR B OG1 1 
ATOM   5509 C  CG2 . THR B 1 203 ? 58.843  13.707  -11.978 1.00 14.99 ? 204 THR B CG2 1 
ATOM   5510 N  N   . SER B 1 204 ? 60.488  13.010  -16.448 1.00 14.59 ? 205 SER B N   1 
ATOM   5511 C  CA  . SER B 1 204 ? 61.458  13.188  -17.532 1.00 14.88 ? 205 SER B CA  1 
ATOM   5512 C  C   . SER B 1 204 ? 60.976  14.241  -18.527 1.00 14.79 ? 205 SER B C   1 
ATOM   5513 O  O   . SER B 1 204 ? 61.781  14.983  -19.092 1.00 14.19 ? 205 SER B O   1 
ATOM   5514 C  CB  . SER B 1 204 ? 61.713  11.883  -18.291 1.00 14.31 ? 205 SER B CB  1 
ATOM   5515 O  OG  . SER B 1 204 ? 62.161  10.852  -17.432 1.00 16.23 ? 205 SER B OG  1 
ATOM   5516 N  N   . VAL B 1 205 ? 59.657  14.297  -18.719 1.00 14.98 ? 206 VAL B N   1 
ATOM   5517 C  CA  . VAL B 1 205 ? 59.041  15.059  -19.814 1.00 15.27 ? 206 VAL B CA  1 
ATOM   5518 C  C   . VAL B 1 205 ? 59.318  16.579  -19.782 1.00 15.81 ? 206 VAL B C   1 
ATOM   5519 O  O   . VAL B 1 205 ? 59.747  17.135  -20.789 1.00 15.71 ? 206 VAL B O   1 
ATOM   5520 C  CB  . VAL B 1 205 ? 57.525  14.705  -19.971 1.00 15.38 ? 206 VAL B CB  1 
ATOM   5521 C  CG1 . VAL B 1 205 ? 56.853  15.555  -21.058 1.00 15.13 ? 206 VAL B CG1 1 
ATOM   5522 C  CG2 . VAL B 1 205 ? 57.379  13.220  -20.300 1.00 15.06 ? 206 VAL B CG2 1 
ATOM   5523 N  N   . PRO B 1 206 ? 59.113  17.246  -18.624 1.00 16.55 ? 207 PRO B N   1 
ATOM   5524 C  CA  . PRO B 1 206 ? 59.371  18.691  -18.622 1.00 16.93 ? 207 PRO B CA  1 
ATOM   5525 C  C   . PRO B 1 206 ? 60.829  19.052  -18.907 1.00 17.54 ? 207 PRO B C   1 
ATOM   5526 O  O   . PRO B 1 206 ? 61.130  20.224  -19.145 1.00 17.53 ? 207 PRO B O   1 
ATOM   5527 C  CB  . PRO B 1 206 ? 59.001  19.115  -17.194 1.00 16.59 ? 207 PRO B CB  1 
ATOM   5528 C  CG  . PRO B 1 206 ? 58.019  18.107  -16.742 1.00 16.92 ? 207 PRO B CG  1 
ATOM   5529 C  CD  . PRO B 1 206 ? 58.529  16.805  -17.341 1.00 16.27 ? 207 PRO B CD  1 
ATOM   5530 N  N   . MET B 1 207 ? 61.716  18.062  -18.911 1.00 17.77 ? 208 MET B N   1 
ATOM   5531 C  CA  . MET B 1 207 ? 63.128  18.340  -19.093 1.00 19.04 ? 208 MET B CA  1 
ATOM   5532 C  C   . MET B 1 207 ? 63.656  17.988  -20.481 1.00 19.65 ? 208 MET B C   1 
ATOM   5533 O  O   . MET B 1 207 ? 64.828  18.251  -20.792 1.00 19.57 ? 208 MET B O   1 
ATOM   5534 C  CB  . MET B 1 207 ? 63.962  17.661  -18.002 1.00 19.01 ? 208 MET B CB  1 
ATOM   5535 C  CG  . MET B 1 207 ? 63.636  18.167  -16.597 1.00 19.09 ? 208 MET B CG  1 
ATOM   5536 S  SD  . MET B 1 207 ? 64.776  17.503  -15.388 1.00 18.74 ? 208 MET B SD  1 
ATOM   5537 C  CE  . MET B 1 207 ? 64.163  15.823  -15.231 1.00 17.22 ? 208 MET B CE  1 
ATOM   5538 N  N   . LEU B 1 208 ? 62.797  17.398  -21.311 1.00 20.24 ? 209 LEU B N   1 
ATOM   5539 C  CA  . LEU B 1 208 ? 63.183  17.047  -22.671 1.00 20.67 ? 209 LEU B CA  1 
ATOM   5540 C  C   . LEU B 1 208 ? 63.363  18.296  -23.517 1.00 20.71 ? 209 LEU B C   1 
ATOM   5541 O  O   . LEU B 1 208 ? 62.708  19.328  -23.288 1.00 21.14 ? 209 LEU B O   1 
ATOM   5542 C  CB  . LEU B 1 208 ? 62.150  16.124  -23.319 1.00 20.99 ? 209 LEU B CB  1 
ATOM   5543 C  CG  . LEU B 1 208 ? 62.129  14.641  -22.939 1.00 21.80 ? 209 LEU B CG  1 
ATOM   5544 C  CD1 . LEU B 1 208 ? 60.945  14.014  -23.649 1.00 21.43 ? 209 LEU B CD1 1 
ATOM   5545 C  CD2 . LEU B 1 208 ? 63.436  13.898  -23.308 1.00 21.22 ? 209 LEU B CD2 1 
ATOM   5546 N  N   . ASN B 1 209 ? 64.265  18.191  -24.483 1.00 21.00 ? 210 ASN B N   1 
ATOM   5547 C  CA  . ASN B 1 209 ? 64.577  19.259  -25.426 1.00 21.23 ? 210 ASN B CA  1 
ATOM   5548 C  C   . ASN B 1 209 ? 65.475  20.354  -24.847 1.00 21.53 ? 210 ASN B C   1 
ATOM   5549 O  O   . ASN B 1 209 ? 65.805  21.321  -25.546 1.00 22.26 ? 210 ASN B O   1 
ATOM   5550 C  CB  . ASN B 1 209 ? 63.295  19.832  -26.066 1.00 21.04 ? 210 ASN B CB  1 
ATOM   5551 C  CG  . ASN B 1 209 ? 62.529  18.789  -26.861 1.00 21.42 ? 210 ASN B CG  1 
ATOM   5552 O  OD1 . ASN B 1 209 ? 63.015  18.291  -27.882 1.00 21.55 ? 210 ASN B OD1 1 
ATOM   5553 N  ND2 . ASN B 1 209 ? 61.332  18.445  -26.398 1.00 19.15 ? 210 ASN B ND2 1 
ATOM   5554 N  N   . LEU B 1 210 ? 65.890  20.183  -23.590 1.00 21.43 ? 211 LEU B N   1 
ATOM   5555 C  CA  . LEU B 1 210 ? 66.742  21.157  -22.898 1.00 21.43 ? 211 LEU B CA  1 
ATOM   5556 C  C   . LEU B 1 210 ? 68.111  20.587  -22.535 1.00 21.62 ? 211 LEU B C   1 
ATOM   5557 O  O   . LEU B 1 210 ? 68.214  19.430  -22.126 1.00 21.82 ? 211 LEU B O   1 
ATOM   5558 C  CB  . LEU B 1 210 ? 66.060  21.657  -21.609 1.00 21.52 ? 211 LEU B CB  1 
ATOM   5559 C  CG  . LEU B 1 210 ? 64.651  22.257  -21.697 1.00 21.25 ? 211 LEU B CG  1 
ATOM   5560 C  CD1 . LEU B 1 210 ? 64.097  22.564  -20.306 1.00 22.07 ? 211 LEU B CD1 1 
ATOM   5561 C  CD2 . LEU B 1 210 ? 64.642  23.496  -22.581 1.00 20.82 ? 211 LEU B CD2 1 
ATOM   5562 N  N   . PRO B 1 211 ? 69.173  21.406  -22.659 1.00 21.92 ? 212 PRO B N   1 
ATOM   5563 C  CA  . PRO B 1 211 ? 70.470  20.972  -22.133 1.00 22.01 ? 212 PRO B CA  1 
ATOM   5564 C  C   . PRO B 1 211 ? 70.444  20.933  -20.599 1.00 21.91 ? 212 PRO B C   1 
ATOM   5565 O  O   . PRO B 1 211 ? 69.608  21.609  -19.988 1.00 21.68 ? 212 PRO B O   1 
ATOM   5566 C  CB  . PRO B 1 211 ? 71.446  22.033  -22.657 1.00 22.10 ? 212 PRO B CB  1 
ATOM   5567 C  CG  . PRO B 1 211 ? 70.611  23.232  -22.931 1.00 22.24 ? 212 PRO B CG  1 
ATOM   5568 C  CD  . PRO B 1 211 ? 69.245  22.732  -23.303 1.00 21.91 ? 212 PRO B CD  1 
ATOM   5569 N  N   . PRO B 1 212 ? 71.323  20.121  -19.979 1.00 22.07 ? 213 PRO B N   1 
ATOM   5570 C  CA  . PRO B 1 212 ? 71.306  20.028  -18.515 1.00 22.57 ? 213 PRO B CA  1 
ATOM   5571 C  C   . PRO B 1 212 ? 71.520  21.369  -17.805 1.00 22.88 ? 213 PRO B C   1 
ATOM   5572 O  O   . PRO B 1 212 ? 70.969  21.565  -16.726 1.00 22.96 ? 213 PRO B O   1 
ATOM   5573 C  CB  . PRO B 1 212 ? 72.429  19.022  -18.189 1.00 22.47 ? 213 PRO B CB  1 
ATOM   5574 C  CG  . PRO B 1 212 ? 73.197  18.826  -19.461 1.00 22.65 ? 213 PRO B CG  1 
ATOM   5575 C  CD  . PRO B 1 212 ? 72.287  19.185  -20.591 1.00 22.11 ? 213 PRO B CD  1 
ATOM   5576 N  N   . ASP B 1 213 ? 72.278  22.282  -18.418 1.00 23.32 ? 214 ASP B N   1 
ATOM   5577 C  CA  . ASP B 1 213 ? 72.444  23.655  -17.899 1.00 23.97 ? 214 ASP B CA  1 
ATOM   5578 C  C   . ASP B 1 213 ? 71.135  24.402  -17.675 1.00 24.29 ? 214 ASP B C   1 
ATOM   5579 O  O   . ASP B 1 213 ? 71.031  25.216  -16.749 1.00 23.97 ? 214 ASP B O   1 
ATOM   5580 C  CB  . ASP B 1 213 ? 73.293  24.507  -18.853 1.00 23.94 ? 214 ASP B CB  1 
ATOM   5581 C  CG  . ASP B 1 213 ? 74.785  24.320  -18.647 1.00 24.84 ? 214 ASP B CG  1 
ATOM   5582 O  OD1 . ASP B 1 213 ? 75.188  23.738  -17.617 1.00 24.85 ? 214 ASP B OD1 1 
ATOM   5583 O  OD2 . ASP B 1 213 ? 75.558  24.763  -19.532 1.00 26.92 ? 214 ASP B OD2 1 
ATOM   5584 N  N   . LEU B 1 214 ? 70.157  24.163  -18.550 1.00 24.48 ? 215 LEU B N   1 
ATOM   5585 C  CA  . LEU B 1 214 ? 68.894  24.901  -18.494 1.00 24.86 ? 215 LEU B CA  1 
ATOM   5586 C  C   . LEU B 1 214 ? 67.825  24.213  -17.645 1.00 25.11 ? 215 LEU B C   1 
ATOM   5587 O  O   . LEU B 1 214 ? 67.084  24.886  -16.927 1.00 25.22 ? 215 LEU B O   1 
ATOM   5588 C  CB  . LEU B 1 214 ? 68.360  25.238  -19.894 1.00 24.51 ? 215 LEU B CB  1 
ATOM   5589 C  CG  . LEU B 1 214 ? 69.138  26.248  -20.748 1.00 25.54 ? 215 LEU B CG  1 
ATOM   5590 C  CD1 . LEU B 1 214 ? 68.351  26.586  -22.003 1.00 25.09 ? 215 LEU B CD1 1 
ATOM   5591 C  CD2 . LEU B 1 214 ? 69.500  27.539  -19.993 1.00 25.06 ? 215 LEU B CD2 1 
ATOM   5592 N  N   . PHE B 1 215 ? 67.738  22.884  -17.697 1.00 25.67 ? 216 PHE B N   1 
ATOM   5593 C  CA  . PHE B 1 215 ? 66.703  22.242  -16.879 1.00 25.71 ? 216 PHE B CA  1 
ATOM   5594 C  C   . PHE B 1 215 ? 66.944  22.334  -15.361 1.00 26.15 ? 216 PHE B C   1 
ATOM   5595 O  O   . PHE B 1 215 ? 65.997  22.439  -14.586 1.00 26.38 ? 216 PHE B O   1 
ATOM   5596 C  CB  . PHE B 1 215 ? 66.245  20.856  -17.394 1.00 25.20 ? 216 PHE B CB  1 
ATOM   5597 C  CG  . PHE B 1 215 ? 67.305  19.772  -17.408 1.00 23.75 ? 216 PHE B CG  1 
ATOM   5598 C  CD1 . PHE B 1 215 ? 67.921  19.342  -16.239 1.00 22.94 ? 216 PHE B CD1 1 
ATOM   5599 C  CD2 . PHE B 1 215 ? 67.603  19.107  -18.599 1.00 22.88 ? 216 PHE B CD2 1 
ATOM   5600 C  CE1 . PHE B 1 215 ? 68.863  18.308  -16.263 1.00 22.82 ? 216 PHE B CE1 1 
ATOM   5601 C  CE2 . PHE B 1 215 ? 68.526  18.064  -18.637 1.00 22.37 ? 216 PHE B CE2 1 
ATOM   5602 C  CZ  . PHE B 1 215 ? 69.161  17.661  -17.468 1.00 22.49 ? 216 PHE B CZ  1 
ATOM   5603 N  N   . ARG B 1 216 ? 68.204  22.389  -14.948 1.00 26.72 ? 217 ARG B N   1 
ATOM   5604 C  CA  . ARG B 1 216 ? 68.534  22.667  -13.542 1.00 27.25 ? 217 ARG B CA  1 
ATOM   5605 C  C   . ARG B 1 216 ? 68.090  24.064  -13.064 1.00 27.16 ? 217 ARG B C   1 
ATOM   5606 O  O   . ARG B 1 216 ? 67.948  24.311  -11.862 1.00 27.89 ? 217 ARG B O   1 
ATOM   5607 C  CB  . ARG B 1 216 ? 70.040  22.482  -13.308 1.00 27.93 ? 217 ARG B CB  1 
ATOM   5608 C  CG  . ARG B 1 216 ? 70.516  21.038  -13.443 1.00 30.31 ? 217 ARG B CG  1 
ATOM   5609 C  CD  . ARG B 1 216 ? 71.815  20.804  -12.680 1.00 34.69 ? 217 ARG B CD  1 
ATOM   5610 N  NE  . ARG B 1 216 ? 72.394  19.486  -12.948 1.00 36.51 ? 217 ARG B NE  1 
ATOM   5611 C  CZ  . ARG B 1 216 ? 73.408  19.254  -13.784 1.00 38.46 ? 217 ARG B CZ  1 
ATOM   5612 N  NH1 . ARG B 1 216 ? 73.978  20.255  -14.455 1.00 38.71 ? 217 ARG B NH1 1 
ATOM   5613 N  NH2 . ARG B 1 216 ? 73.855  18.013  -13.948 1.00 38.38 ? 217 ARG B NH2 1 
ATOM   5614 N  N   . LEU B 1 217 ? 67.848  24.960  -14.019 1.00 26.86 ? 218 LEU B N   1 
ATOM   5615 C  CA  . LEU B 1 217 ? 67.587  26.378  -13.771 1.00 26.03 ? 218 LEU B CA  1 
ATOM   5616 C  C   . LEU B 1 217 ? 66.107  26.760  -13.938 1.00 25.44 ? 218 LEU B C   1 
ATOM   5617 O  O   . LEU B 1 217 ? 65.602  27.640  -13.243 1.00 25.41 ? 218 LEU B O   1 
ATOM   5618 C  CB  . LEU B 1 217 ? 68.468  27.191  -14.728 1.00 25.97 ? 218 LEU B CB  1 
ATOM   5619 C  CG  . LEU B 1 217 ? 68.765  28.680  -14.576 1.00 26.19 ? 218 LEU B CG  1 
ATOM   5620 C  CD1 . LEU B 1 217 ? 69.292  29.044  -13.188 1.00 24.25 ? 218 LEU B CD1 1 
ATOM   5621 C  CD2 . LEU B 1 217 ? 69.764  29.081  -15.649 1.00 25.15 ? 218 LEU B CD2 1 
ATOM   5622 N  N   . PHE B 1 218 ? 65.414  26.093  -14.857 1.00 24.80 ? 219 PHE B N   1 
ATOM   5623 C  CA  . PHE B 1 218 ? 64.003  26.393  -15.127 1.00 24.02 ? 219 PHE B CA  1 
ATOM   5624 C  C   . PHE B 1 218 ? 63.055  25.237  -14.799 1.00 23.51 ? 219 PHE B C   1 
ATOM   5625 O  O   . PHE B 1 218 ? 61.834  25.372  -14.906 1.00 23.55 ? 219 PHE B O   1 
ATOM   5626 C  CB  . PHE B 1 218 ? 63.824  26.798  -16.587 1.00 23.82 ? 219 PHE B CB  1 
ATOM   5627 C  CG  . PHE B 1 218 ? 64.597  28.020  -16.976 1.00 23.59 ? 219 PHE B CG  1 
ATOM   5628 C  CD1 . PHE B 1 218 ? 65.712  27.914  -17.804 1.00 24.45 ? 219 PHE B CD1 1 
ATOM   5629 C  CD2 . PHE B 1 218 ? 64.207  29.275  -16.525 1.00 23.51 ? 219 PHE B CD2 1 
ATOM   5630 C  CE1 . PHE B 1 218 ? 66.433  29.042  -18.185 1.00 24.26 ? 219 PHE B CE1 1 
ATOM   5631 C  CE2 . PHE B 1 218 ? 64.916  30.414  -16.898 1.00 24.77 ? 219 PHE B CE2 1 
ATOM   5632 C  CZ  . PHE B 1 218 ? 66.038  30.296  -17.730 1.00 24.35 ? 219 PHE B CZ  1 
ATOM   5633 N  N   . ARG B 1 219 ? 63.629  24.103  -14.415 1.00 22.88 ? 220 ARG B N   1 
ATOM   5634 C  CA  . ARG B 1 219 ? 62.861  22.905  -14.099 1.00 22.45 ? 220 ARG B CA  1 
ATOM   5635 C  C   . ARG B 1 219 ? 63.406  22.319  -12.805 1.00 22.54 ? 220 ARG B C   1 
ATOM   5636 O  O   . ARG B 1 219 ? 63.511  21.102  -12.660 1.00 22.26 ? 220 ARG B O   1 
ATOM   5637 C  CB  . ARG B 1 219 ? 62.975  21.885  -15.241 1.00 22.31 ? 220 ARG B CB  1 
ATOM   5638 C  CG  . ARG B 1 219 ? 62.374  22.347  -16.575 1.00 22.28 ? 220 ARG B CG  1 
ATOM   5639 C  CD  . ARG B 1 219 ? 60.864  22.388  -16.496 1.00 20.86 ? 220 ARG B CD  1 
ATOM   5640 N  NE  . ARG B 1 219 ? 60.248  22.793  -17.757 1.00 21.68 ? 220 ARG B NE  1 
ATOM   5641 C  CZ  . ARG B 1 219 ? 59.896  24.038  -18.056 1.00 21.95 ? 220 ARG B CZ  1 
ATOM   5642 N  NH1 . ARG B 1 219 ? 60.107  25.024  -17.193 1.00 21.01 ? 220 ARG B NH1 1 
ATOM   5643 N  NH2 . ARG B 1 219 ? 59.332  24.297  -19.225 1.00 23.19 ? 220 ARG B NH2 1 
ATOM   5644 N  N   . THR B 1 220 ? 63.754  23.201  -11.869 1.00 22.52 ? 221 THR B N   1 
ATOM   5645 C  CA  . THR B 1 220 ? 64.422  22.812  -10.623 1.00 22.69 ? 221 THR B CA  1 
ATOM   5646 C  C   . THR B 1 220 ? 63.587  21.827  -9.807  1.00 22.33 ? 221 THR B C   1 
ATOM   5647 O  O   . THR B 1 220 ? 64.114  20.827  -9.317  1.00 22.48 ? 221 THR B O   1 
ATOM   5648 C  CB  . THR B 1 220 ? 64.808  24.055  -9.760  1.00 22.98 ? 221 THR B CB  1 
ATOM   5649 O  OG1 . THR B 1 220 ? 65.396  25.064  -10.601 1.00 23.65 ? 221 THR B OG1 1 
ATOM   5650 C  CG2 . THR B 1 220 ? 65.807  23.673  -8.669  1.00 22.51 ? 221 THR B CG2 1 
ATOM   5651 N  N   . LYS B 1 221 ? 62.291  22.099  -9.679  1.00 22.09 ? 222 LYS B N   1 
ATOM   5652 C  CA  . LYS B 1 221 ? 61.390  21.218  -8.934  1.00 22.31 ? 222 LYS B CA  1 
ATOM   5653 C  C   . LYS B 1 221 ? 61.277  19.823  -9.587  1.00 21.67 ? 222 LYS B C   1 
ATOM   5654 O  O   . LYS B 1 221 ? 61.398  18.800  -8.915  1.00 21.59 ? 222 LYS B O   1 
ATOM   5655 C  CB  . LYS B 1 221 ? 60.001  21.854  -8.797  1.00 22.75 ? 222 LYS B CB  1 
ATOM   5656 C  CG  . LYS B 1 221 ? 59.234  21.360  -7.591  1.00 25.43 ? 222 LYS B CG  1 
ATOM   5657 C  CD  . LYS B 1 221 ? 57.758  21.176  -7.896  1.00 29.69 ? 222 LYS B CD  1 
ATOM   5658 C  CE  . LYS B 1 221 ? 57.137  20.145  -6.940  1.00 31.82 ? 222 LYS B CE  1 
ATOM   5659 N  NZ  . LYS B 1 221 ? 55.824  19.652  -7.450  1.00 32.91 ? 222 LYS B NZ  1 
ATOM   5660 N  N   . THR B 1 222 ? 61.050  19.796  -10.899 1.00 21.04 ? 223 THR B N   1 
ATOM   5661 C  CA  . THR B 1 222 ? 60.941  18.542  -11.648 1.00 20.20 ? 223 THR B CA  1 
ATOM   5662 C  C   . THR B 1 222 ? 62.236  17.728  -11.543 1.00 19.76 ? 223 THR B C   1 
ATOM   5663 O  O   . THR B 1 222 ? 62.194  16.512  -11.352 1.00 18.98 ? 223 THR B O   1 
ATOM   5664 C  CB  . THR B 1 222 ? 60.571  18.807  -13.128 1.00 20.20 ? 223 THR B CB  1 
ATOM   5665 O  OG1 . THR B 1 222 ? 59.251  19.369  -13.191 1.00 20.81 ? 223 THR B OG1 1 
ATOM   5666 C  CG2 . THR B 1 222 ? 60.600  17.530  -13.937 1.00 19.27 ? 223 THR B CG2 1 
ATOM   5667 N  N   . TRP B 1 223 ? 63.372  18.415  -11.654 1.00 19.33 ? 224 TRP B N   1 
ATOM   5668 C  CA  . TRP B 1 223 ? 64.676  17.777  -11.587 1.00 19.43 ? 224 TRP B CA  1 
ATOM   5669 C  C   . TRP B 1 223 ? 64.893  17.129  -10.215 1.00 20.03 ? 224 TRP B C   1 
ATOM   5670 O  O   . TRP B 1 223 ? 65.323  15.968  -10.127 1.00 19.97 ? 224 TRP B O   1 
ATOM   5671 C  CB  . TRP B 1 223 ? 65.782  18.783  -11.920 1.00 19.34 ? 224 TRP B CB  1 
ATOM   5672 C  CG  . TRP B 1 223 ? 67.162  18.303  -11.589 1.00 18.44 ? 224 TRP B CG  1 
ATOM   5673 C  CD1 . TRP B 1 223 ? 67.960  18.760  -10.590 1.00 17.80 ? 224 TRP B CD1 1 
ATOM   5674 C  CD2 . TRP B 1 223 ? 67.894  17.262  -12.246 1.00 17.42 ? 224 TRP B CD2 1 
ATOM   5675 N  NE1 . TRP B 1 223 ? 69.150  18.080  -10.584 1.00 18.90 ? 224 TRP B NE1 1 
ATOM   5676 C  CE2 . TRP B 1 223 ? 69.137  17.152  -11.591 1.00 18.91 ? 224 TRP B CE2 1 
ATOM   5677 C  CE3 . TRP B 1 223 ? 67.620  16.413  -13.324 1.00 18.42 ? 224 TRP B CE3 1 
ATOM   5678 C  CZ2 . TRP B 1 223 ? 70.116  16.229  -11.982 1.00 19.00 ? 224 TRP B CZ2 1 
ATOM   5679 C  CZ3 . TRP B 1 223 ? 68.589  15.489  -13.711 1.00 18.06 ? 224 TRP B CZ3 1 
ATOM   5680 C  CH2 . TRP B 1 223 ? 69.823  15.406  -13.042 1.00 18.50 ? 224 TRP B CH2 1 
ATOM   5681 N  N   . LYS B 1 224 ? 64.566  17.873  -9.157  1.00 20.26 ? 225 LYS B N   1 
ATOM   5682 C  CA  . LYS B 1 224 ? 64.607  17.356  -7.794  1.00 20.70 ? 225 LYS B CA  1 
ATOM   5683 C  C   . LYS B 1 224 ? 63.778  16.059  -7.645  1.00 20.18 ? 225 LYS B C   1 
ATOM   5684 O  O   . LYS B 1 224 ? 64.254  15.090  -7.048  1.00 20.10 ? 225 LYS B O   1 
ATOM   5685 C  CB  . LYS B 1 224 ? 64.139  18.435  -6.801  1.00 21.06 ? 225 LYS B CB  1 
ATOM   5686 C  CG  . LYS B 1 224 ? 63.859  17.925  -5.388  1.00 23.71 ? 225 LYS B CG  1 
ATOM   5687 C  CD  . LYS B 1 224 ? 63.775  19.050  -4.343  1.00 27.29 ? 225 LYS B CD  1 
ATOM   5688 C  CE  . LYS B 1 224 ? 63.728  18.458  -2.929  1.00 29.92 ? 225 LYS B CE  1 
ATOM   5689 N  NZ  . LYS B 1 224 ? 63.710  19.488  -1.839  1.00 32.02 ? 225 LYS B NZ  1 
ATOM   5690 N  N   . ASP B 1 225 ? 62.551  16.058  -8.179  1.00 19.50 ? 226 ASP B N   1 
ATOM   5691 C  CA  . ASP B 1 225 ? 61.654  14.895  -8.107  1.00 18.93 ? 226 ASP B CA  1 
ATOM   5692 C  C   . ASP B 1 225 ? 62.188  13.720  -8.917  1.00 18.07 ? 226 ASP B C   1 
ATOM   5693 O  O   . ASP B 1 225 ? 62.105  12.566  -8.499  1.00 18.62 ? 226 ASP B O   1 
ATOM   5694 C  CB  . ASP B 1 225 ? 60.258  15.258  -8.622  1.00 19.37 ? 226 ASP B CB  1 
ATOM   5695 C  CG  . ASP B 1 225 ? 59.527  16.250  -7.722  1.00 20.75 ? 226 ASP B CG  1 
ATOM   5696 O  OD1 . ASP B 1 225 ? 59.953  16.470  -6.573  1.00 22.37 ? 226 ASP B OD1 1 
ATOM   5697 O  OD2 . ASP B 1 225 ? 58.502  16.799  -8.169  1.00 22.49 ? 226 ASP B OD2 1 
ATOM   5698 N  N   . HIS B 1 226 ? 62.707  14.034  -10.093 1.00 16.96 ? 227 HIS B N   1 
ATOM   5699 C  CA  . HIS B 1 226 ? 63.326  13.066  -10.975 1.00 16.42 ? 227 HIS B CA  1 
ATOM   5700 C  C   . HIS B 1 226 ? 64.493  12.342  -10.293 1.00 16.32 ? 227 HIS B C   1 
ATOM   5701 O  O   . HIS B 1 226 ? 64.560  11.111  -10.318 1.00 16.54 ? 227 HIS B O   1 
ATOM   5702 C  CB  . HIS B 1 226 ? 63.815  13.779  -12.229 1.00 15.49 ? 227 HIS B CB  1 
ATOM   5703 C  CG  . HIS B 1 226 ? 64.292  12.852  -13.291 1.00 14.12 ? 227 HIS B CG  1 
ATOM   5704 N  ND1 . HIS B 1 226 ? 63.436  12.050  -14.010 1.00 11.36 ? 227 HIS B ND1 1 
ATOM   5705 C  CD2 . HIS B 1 226 ? 65.535  12.594  -13.755 1.00 13.30 ? 227 HIS B CD2 1 
ATOM   5706 C  CE1 . HIS B 1 226 ? 64.135  11.330  -14.867 1.00 12.05 ? 227 HIS B CE1 1 
ATOM   5707 N  NE2 . HIS B 1 226 ? 65.408  11.647  -14.739 1.00 12.72 ? 227 HIS B NE2 1 
ATOM   5708 N  N   . VAL B 1 227 ? 65.403  13.117  -9.700  1.00 16.15 ? 228 VAL B N   1 
ATOM   5709 C  CA  . VAL B 1 227 ? 66.510  12.594  -8.890  1.00 15.96 ? 228 VAL B CA  1 
ATOM   5710 C  C   . VAL B 1 227 ? 65.997  11.690  -7.764  1.00 16.10 ? 228 VAL B C   1 
ATOM   5711 O  O   . VAL B 1 227 ? 66.537  10.618  -7.547  1.00 16.25 ? 228 VAL B O   1 
ATOM   5712 C  CB  . VAL B 1 227 ? 67.411  13.738  -8.318  1.00 16.30 ? 228 VAL B CB  1 
ATOM   5713 C  CG1 . VAL B 1 227 ? 68.343  13.231  -7.188  1.00 14.52 ? 228 VAL B CG1 1 
ATOM   5714 C  CG2 . VAL B 1 227 ? 68.224  14.386  -9.434  1.00 16.09 ? 228 VAL B CG2 1 
ATOM   5715 N  N   . ALA B 1 228 ? 64.941  12.106  -7.070  1.00 16.27 ? 229 ALA B N   1 
ATOM   5716 C  CA  . ALA B 1 228 ? 64.391  11.292  -5.991  1.00 16.05 ? 229 ALA B CA  1 
ATOM   5717 C  C   . ALA B 1 228 ? 63.875  9.941   -6.493  1.00 16.25 ? 229 ALA B C   1 
ATOM   5718 O  O   . ALA B 1 228 ? 64.012  8.925   -5.802  1.00 15.96 ? 229 ALA B O   1 
ATOM   5719 C  CB  . ALA B 1 228 ? 63.294  12.045  -5.231  1.00 15.97 ? 229 ALA B CB  1 
ATOM   5720 N  N   . ALA B 1 229 ? 63.289  9.935   -7.693  1.00 16.46 ? 230 ALA B N   1 
ATOM   5721 C  CA  . ALA B 1 229 ? 62.716  8.720   -8.273  1.00 16.23 ? 230 ALA B CA  1 
ATOM   5722 C  C   . ALA B 1 229 ? 63.801  7.708   -8.630  1.00 16.32 ? 230 ALA B C   1 
ATOM   5723 O  O   . ALA B 1 229 ? 63.696  6.539   -8.271  1.00 16.51 ? 230 ALA B O   1 
ATOM   5724 C  CB  . ALA B 1 229 ? 61.844  9.045   -9.480  1.00 15.66 ? 230 ALA B CB  1 
ATOM   5725 N  N   . TRP B 1 230 ? 64.845  8.162   -9.317  1.00 16.52 ? 231 TRP B N   1 
ATOM   5726 C  CA  . TRP B 1 230 ? 65.991  7.311   -9.617  1.00 17.26 ? 231 TRP B CA  1 
ATOM   5727 C  C   . TRP B 1 230 ? 66.678  6.789   -8.341  1.00 18.16 ? 231 TRP B C   1 
ATOM   5728 O  O   . TRP B 1 230 ? 67.152  5.653   -8.323  1.00 18.19 ? 231 TRP B O   1 
ATOM   5729 C  CB  . TRP B 1 230 ? 67.023  8.060   -10.448 1.00 16.85 ? 231 TRP B CB  1 
ATOM   5730 C  CG  . TRP B 1 230 ? 66.818  8.087   -11.943 1.00 16.19 ? 231 TRP B CG  1 
ATOM   5731 C  CD1 . TRP B 1 230 ? 66.568  9.193   -12.706 1.00 15.70 ? 231 TRP B CD1 1 
ATOM   5732 C  CD2 . TRP B 1 230 ? 66.902  6.984   -12.854 1.00 15.56 ? 231 TRP B CD2 1 
ATOM   5733 N  NE1 . TRP B 1 230 ? 66.473  8.849   -14.026 1.00 16.02 ? 231 TRP B NE1 1 
ATOM   5734 C  CE2 . TRP B 1 230 ? 66.680  7.501   -14.153 1.00 15.03 ? 231 TRP B CE2 1 
ATOM   5735 C  CE3 . TRP B 1 230 ? 67.136  5.608   -12.704 1.00 14.55 ? 231 TRP B CE3 1 
ATOM   5736 C  CZ2 . TRP B 1 230 ? 66.679  6.696   -15.291 1.00 13.95 ? 231 TRP B CZ2 1 
ATOM   5737 C  CZ3 . TRP B 1 230 ? 67.140  4.806   -13.836 1.00 13.28 ? 231 TRP B CZ3 1 
ATOM   5738 C  CH2 . TRP B 1 230 ? 66.913  5.352   -15.117 1.00 14.37 ? 231 TRP B CH2 1 
ATOM   5739 N  N   . ASP B 1 231 ? 66.734  7.619   -7.294  1.00 18.86 ? 232 ASP B N   1 
ATOM   5740 C  CA  . ASP B 1 231 ? 67.346  7.229   -6.018  1.00 19.94 ? 232 ASP B CA  1 
ATOM   5741 C  C   . ASP B 1 231 ? 66.636  6.029   -5.377  1.00 20.07 ? 232 ASP B C   1 
ATOM   5742 O  O   . ASP B 1 231 ? 67.287  5.161   -4.802  1.00 20.28 ? 232 ASP B O   1 
ATOM   5743 C  CB  . ASP B 1 231 ? 67.388  8.405   -5.034  1.00 19.95 ? 232 ASP B CB  1 
ATOM   5744 C  CG  . ASP B 1 231 ? 68.613  9.309   -5.233  1.00 21.61 ? 232 ASP B CG  1 
ATOM   5745 O  OD1 . ASP B 1 231 ? 69.552  8.933   -5.980  1.00 22.99 ? 232 ASP B OD1 1 
ATOM   5746 O  OD2 . ASP B 1 231 ? 68.637  10.410  -4.625  1.00 23.12 ? 232 ASP B OD2 1 
ATOM   5747 N  N   . VAL B 1 232 ? 65.311  5.986   -5.491  1.00 20.19 ? 233 VAL B N   1 
ATOM   5748 C  CA  . VAL B 1 232 ? 64.536  4.833   -5.037  1.00 20.10 ? 233 VAL B CA  1 
ATOM   5749 C  C   . VAL B 1 232 ? 64.847  3.631   -5.931  1.00 20.47 ? 233 VAL B C   1 
ATOM   5750 O  O   . VAL B 1 232 ? 65.093  2.532   -5.430  1.00 20.10 ? 233 VAL B O   1 
ATOM   5751 C  CB  . VAL B 1 232 ? 63.015  5.117   -5.034  1.00 20.10 ? 233 VAL B CB  1 
ATOM   5752 C  CG1 . VAL B 1 232 ? 62.230  3.858   -4.712  1.00 19.13 ? 233 VAL B CG1 1 
ATOM   5753 C  CG2 . VAL B 1 232 ? 62.661  6.245   -4.048  1.00 19.56 ? 233 VAL B CG2 1 
ATOM   5754 N  N   . ILE B 1 233 ? 64.851  3.850   -7.250  1.00 20.60 ? 234 ILE B N   1 
ATOM   5755 C  CA  . ILE B 1 233 ? 65.166  2.789   -8.197  1.00 21.03 ? 234 ILE B CA  1 
ATOM   5756 C  C   . ILE B 1 233 ? 66.520  2.141   -7.880  1.00 21.45 ? 234 ILE B C   1 
ATOM   5757 O  O   . ILE B 1 233 ? 66.614  0.910   -7.788  1.00 21.46 ? 234 ILE B O   1 
ATOM   5758 C  CB  . ILE B 1 233 ? 65.103  3.268   -9.690  1.00 21.01 ? 234 ILE B CB  1 
ATOM   5759 C  CG1 . ILE B 1 233 ? 63.656  3.590   -10.093 1.00 21.17 ? 234 ILE B CG1 1 
ATOM   5760 C  CG2 . ILE B 1 233 ? 65.692  2.202   -10.620 1.00 20.51 ? 234 ILE B CG2 1 
ATOM   5761 C  CD1 . ILE B 1 233 ? 63.515  4.383   -11.387 1.00 19.94 ? 234 ILE B CD1 1 
ATOM   5762 N  N   . PHE B 1 234 ? 67.553  2.962   -7.699  1.00 21.70 ? 235 PHE B N   1 
ATOM   5763 C  CA  . PHE B 1 234 ? 68.888  2.440   -7.414  1.00 22.30 ? 235 PHE B CA  1 
ATOM   5764 C  C   . PHE B 1 234 ? 69.005  1.787   -6.043  1.00 23.01 ? 235 PHE B C   1 
ATOM   5765 O  O   . PHE B 1 234 ? 69.609  0.725   -5.930  1.00 23.43 ? 235 PHE B O   1 
ATOM   5766 C  CB  . PHE B 1 234 ? 69.974  3.505   -7.622  1.00 22.29 ? 235 PHE B CB  1 
ATOM   5767 C  CG  . PHE B 1 234 ? 70.478  3.566   -9.031  1.00 21.79 ? 235 PHE B CG  1 
ATOM   5768 C  CD1 . PHE B 1 234 ? 69.928  4.460   -9.940  1.00 21.50 ? 235 PHE B CD1 1 
ATOM   5769 C  CD2 . PHE B 1 234 ? 71.476  2.693   -9.462  1.00 21.99 ? 235 PHE B CD2 1 
ATOM   5770 C  CE1 . PHE B 1 234 ? 70.377  4.502   -11.265 1.00 21.07 ? 235 PHE B CE1 1 
ATOM   5771 C  CE2 . PHE B 1 234 ? 71.932  2.724   -10.779 1.00 22.26 ? 235 PHE B CE2 1 
ATOM   5772 C  CZ  . PHE B 1 234 ? 71.377  3.636   -11.683 1.00 21.59 ? 235 PHE B CZ  1 
ATOM   5773 N  N   . SER B 1 235 ? 68.419  2.402   -5.018  1.00 23.47 ? 236 SER B N   1 
ATOM   5774 C  CA  . SER B 1 235 ? 68.451  1.829   -3.671  1.00 24.69 ? 236 SER B CA  1 
ATOM   5775 C  C   . SER B 1 235 ? 67.850  0.428   -3.615  1.00 24.62 ? 236 SER B C   1 
ATOM   5776 O  O   . SER B 1 235 ? 68.476  -0.487  -3.097  1.00 24.38 ? 236 SER B O   1 
ATOM   5777 C  CB  . SER B 1 235 ? 67.706  2.717   -2.679  1.00 24.44 ? 236 SER B CB  1 
ATOM   5778 O  OG  . SER B 1 235 ? 68.244  4.020   -2.693  1.00 27.24 ? 236 SER B OG  1 
ATOM   5779 N  N   . LYS B 1 236 ? 66.630  0.289   -4.140  1.00 24.93 ? 237 LYS B N   1 
ATOM   5780 C  CA  . LYS B 1 236 ? 65.896  -0.977  -4.125  1.00 25.06 ? 237 LYS B CA  1 
ATOM   5781 C  C   . LYS B 1 236 ? 66.590  -2.052  -4.947  1.00 24.72 ? 237 LYS B C   1 
ATOM   5782 O  O   . LYS B 1 236 ? 66.772  -3.174  -4.470  1.00 24.13 ? 237 LYS B O   1 
ATOM   5783 C  CB  . LYS B 1 236 ? 64.463  -0.782  -4.620  1.00 25.28 ? 237 LYS B CB  1 
ATOM   5784 C  CG  . LYS B 1 236 ? 63.432  -0.542  -3.524  1.00 27.96 ? 237 LYS B CG  1 
ATOM   5785 C  CD  . LYS B 1 236 ? 63.721  0.700   -2.701  1.00 31.09 ? 237 LYS B CD  1 
ATOM   5786 C  CE  . LYS B 1 236 ? 62.998  0.648   -1.363  1.00 32.89 ? 237 LYS B CE  1 
ATOM   5787 N  NZ  . LYS B 1 236 ? 61.548  0.887   -1.531  1.00 33.50 ? 237 LYS B NZ  1 
ATOM   5788 N  N   . ALA B 1 237 ? 66.982  -1.705  -6.176  1.00 24.49 ? 238 ALA B N   1 
ATOM   5789 C  CA  . ALA B 1 237 ? 67.631  -2.665  -7.071  1.00 24.57 ? 238 ALA B CA  1 
ATOM   5790 C  C   . ALA B 1 237 ? 68.913  -3.204  -6.447  1.00 24.74 ? 238 ALA B C   1 
ATOM   5791 O  O   . ALA B 1 237 ? 69.211  -4.391  -6.553  1.00 24.49 ? 238 ALA B O   1 
ATOM   5792 C  CB  . ALA B 1 237 ? 67.934  -2.034  -8.417  1.00 24.18 ? 238 ALA B CB  1 
ATOM   5793 N  N   . ASP B 1 238 ? 69.663  -2.319  -5.799  1.00 24.83 ? 239 ASP B N   1 
ATOM   5794 C  CA  . ASP B 1 238 ? 70.935  -2.697  -5.215  1.00 25.54 ? 239 ASP B CA  1 
ATOM   5795 C  C   . ASP B 1 238 ? 70.773  -3.582  -3.966  1.00 24.93 ? 239 ASP B C   1 
ATOM   5796 O  O   . ASP B 1 238 ? 71.483  -4.566  -3.816  1.00 24.51 ? 239 ASP B O   1 
ATOM   5797 C  CB  . ASP B 1 238 ? 71.809  -1.460  -4.985  1.00 25.77 ? 239 ASP B CB  1 
ATOM   5798 C  CG  . ASP B 1 238 ? 72.375  -0.896  -6.303  1.00 29.12 ? 239 ASP B CG  1 
ATOM   5799 O  OD1 . ASP B 1 238 ? 72.026  -1.418  -7.397  1.00 32.35 ? 239 ASP B OD1 1 
ATOM   5800 O  OD2 . ASP B 1 238 ? 73.171  0.067   -6.260  1.00 31.43 ? 239 ASP B OD2 1 
ATOM   5801 N  N   . ILE B 1 239 ? 69.815  -3.255  -3.106  1.00 24.74 ? 240 ILE B N   1 
ATOM   5802 C  CA  . ILE B 1 239 ? 69.473  -4.119  -1.973  1.00 24.84 ? 240 ILE B CA  1 
ATOM   5803 C  C   . ILE B 1 239 ? 69.075  -5.534  -2.434  1.00 24.83 ? 240 ILE B C   1 
ATOM   5804 O  O   . ILE B 1 239 ? 69.531  -6.524  -1.854  1.00 24.65 ? 240 ILE B O   1 
ATOM   5805 C  CB  . ILE B 1 239 ? 68.373  -3.486  -1.087  1.00 25.02 ? 240 ILE B CB  1 
ATOM   5806 C  CG1 . ILE B 1 239 ? 68.906  -2.208  -0.428  1.00 25.17 ? 240 ILE B CG1 1 
ATOM   5807 C  CG2 . ILE B 1 239 ? 67.863  -4.481  -0.021  1.00 24.97 ? 240 ILE B CG2 1 
ATOM   5808 C  CD1 . ILE B 1 239 ? 67.823  -1.300  0.152   1.00 27.19 ? 240 ILE B CD1 1 
ATOM   5809 N  N   . TYR B 1 240 ? 68.253  -5.623  -3.481  1.00 24.66 ? 241 TYR B N   1 
ATOM   5810 C  CA  . TYR B 1 240 ? 67.870  -6.915  -4.064  1.00 24.75 ? 241 TYR B CA  1 
ATOM   5811 C  C   . TYR B 1 240 ? 69.079  -7.717  -4.566  1.00 24.09 ? 241 TYR B C   1 
ATOM   5812 O  O   . TYR B 1 240 ? 69.217  -8.897  -4.254  1.00 23.39 ? 241 TYR B O   1 
ATOM   5813 C  CB  . TYR B 1 240 ? 66.865  -6.747  -5.210  1.00 24.87 ? 241 TYR B CB  1 
ATOM   5814 C  CG  . TYR B 1 240 ? 65.442  -6.379  -4.811  1.00 27.96 ? 241 TYR B CG  1 
ATOM   5815 C  CD1 . TYR B 1 240 ? 64.726  -5.423  -5.542  1.00 29.37 ? 241 TYR B CD1 1 
ATOM   5816 C  CD2 . TYR B 1 240 ? 64.805  -6.985  -3.719  1.00 30.74 ? 241 TYR B CD2 1 
ATOM   5817 C  CE1 . TYR B 1 240 ? 63.426  -5.070  -5.202  1.00 31.45 ? 241 TYR B CE1 1 
ATOM   5818 C  CE2 . TYR B 1 240 ? 63.491  -6.635  -3.363  1.00 32.00 ? 241 TYR B CE2 1 
ATOM   5819 C  CZ  . TYR B 1 240 ? 62.811  -5.675  -4.118  1.00 32.70 ? 241 TYR B CZ  1 
ATOM   5820 O  OH  . TYR B 1 240 ? 61.522  -5.314  -3.800  1.00 33.13 ? 241 TYR B OH  1 
ATOM   5821 N  N   . THR B 1 241 ? 69.937  -7.070  -5.349  1.00 24.06 ? 242 THR B N   1 
ATOM   5822 C  CA  . THR B 1 241 ? 71.113  -7.725  -5.921  1.00 24.32 ? 242 THR B CA  1 
ATOM   5823 C  C   . THR B 1 241 ? 72.076  -8.200  -4.832  1.00 24.23 ? 242 THR B C   1 
ATOM   5824 O  O   . THR B 1 241 ? 72.510  -9.346  -4.851  1.00 23.93 ? 242 THR B O   1 
ATOM   5825 C  CB  . THR B 1 241 ? 71.845  -6.808  -6.927  1.00 24.11 ? 242 THR B CB  1 
ATOM   5826 O  OG1 . THR B 1 241 ? 70.925  -6.398  -7.945  1.00 25.10 ? 242 THR B OG1 1 
ATOM   5827 C  CG2 . THR B 1 241 ? 73.006  -7.544  -7.589  1.00 23.82 ? 242 THR B CG2 1 
ATOM   5828 N  N   . GLN B 1 242 ? 72.378  -7.321  -3.880  1.00 24.47 ? 243 GLN B N   1 
ATOM   5829 C  CA  . GLN B 1 242 ? 73.304  -7.628  -2.788  1.00 25.11 ? 243 GLN B CA  1 
ATOM   5830 C  C   . GLN B 1 242 ? 72.812  -8.748  -1.876  1.00 24.42 ? 243 GLN B C   1 
ATOM   5831 O  O   . GLN B 1 242 ? 73.595  -9.628  -1.523  1.00 24.22 ? 243 GLN B O   1 
ATOM   5832 C  CB  . GLN B 1 242 ? 73.594  -6.380  -1.954  1.00 25.57 ? 243 GLN B CB  1 
ATOM   5833 C  CG  . GLN B 1 242 ? 74.422  -5.328  -2.678  1.00 29.22 ? 243 GLN B CG  1 
ATOM   5834 C  CD  . GLN B 1 242 ? 74.815  -4.179  -1.771  1.00 33.10 ? 243 GLN B CD  1 
ATOM   5835 O  OE1 . GLN B 1 242 ? 75.074  -4.373  -0.575  1.00 35.47 ? 243 GLN B OE1 1 
ATOM   5836 N  NE2 . GLN B 1 242 ? 74.866  -2.975  -2.333  1.00 34.38 ? 243 GLN B NE2 1 
ATOM   5837 N  N   . ASN B 1 243 ? 71.531  -8.703  -1.496  1.00 23.77 ? 244 ASN B N   1 
ATOM   5838 C  CA  . ASN B 1 243 ? 70.891  -9.790  -0.744  1.00 23.83 ? 244 ASN B CA  1 
ATOM   5839 C  C   . ASN B 1 243 ? 70.955  -11.142 -1.453  1.00 23.50 ? 244 ASN B C   1 
ATOM   5840 O  O   . ASN B 1 243 ? 71.237  -12.157 -0.826  1.00 23.81 ? 244 ASN B O   1 
ATOM   5841 C  CB  . ASN B 1 243 ? 69.425  -9.472  -0.431  1.00 23.85 ? 244 ASN B CB  1 
ATOM   5842 C  CG  . ASN B 1 243 ? 69.267  -8.436  0.655   1.00 25.26 ? 244 ASN B CG  1 
ATOM   5843 O  OD1 . ASN B 1 243 ? 70.249  -7.956  1.223   1.00 26.73 ? 244 ASN B OD1 1 
ATOM   5844 N  ND2 . ASN B 1 243 ? 68.019  -8.076  0.951   1.00 26.30 ? 244 ASN B ND2 1 
ATOM   5845 N  N   . PHE B 1 244 ? 70.681  -11.149 -2.754  1.00 22.95 ? 245 PHE B N   1 
ATOM   5846 C  CA  . PHE B 1 244 ? 70.698  -12.375 -3.545  1.00 22.67 ? 245 PHE B CA  1 
ATOM   5847 C  C   . PHE B 1 244 ? 72.115  -12.955 -3.584  1.00 22.71 ? 245 PHE B C   1 
ATOM   5848 O  O   . PHE B 1 244 ? 72.313  -14.168 -3.447  1.00 21.95 ? 245 PHE B O   1 
ATOM   5849 C  CB  . PHE B 1 244 ? 70.204  -12.070 -4.961  1.00 22.48 ? 245 PHE B CB  1 
ATOM   5850 C  CG  . PHE B 1 244 ? 70.142  -13.270 -5.862  1.00 22.92 ? 245 PHE B CG  1 
ATOM   5851 C  CD1 . PHE B 1 244 ? 68.954  -13.973 -6.016  1.00 24.01 ? 245 PHE B CD1 1 
ATOM   5852 C  CD2 . PHE B 1 244 ? 71.265  -13.681 -6.578  1.00 23.61 ? 245 PHE B CD2 1 
ATOM   5853 C  CE1 . PHE B 1 244 ? 68.885  -15.081 -6.855  1.00 24.22 ? 245 PHE B CE1 1 
ATOM   5854 C  CE2 . PHE B 1 244 ? 71.206  -14.792 -7.425  1.00 23.94 ? 245 PHE B CE2 1 
ATOM   5855 C  CZ  . PHE B 1 244 ? 70.016  -15.488 -7.564  1.00 23.98 ? 245 PHE B CZ  1 
ATOM   5856 N  N   . TYR B 1 245 ? 73.086  -12.064 -3.778  1.00 22.63 ? 246 TYR B N   1 
ATOM   5857 C  CA  . TYR B 1 245 ? 74.499  -12.413 -3.810  1.00 23.27 ? 246 TYR B CA  1 
ATOM   5858 C  C   . TYR B 1 245 ? 74.931  -13.110 -2.519  1.00 23.38 ? 246 TYR B C   1 
ATOM   5859 O  O   . TYR B 1 245 ? 75.596  -14.132 -2.563  1.00 23.30 ? 246 TYR B O   1 
ATOM   5860 C  CB  . TYR B 1 245 ? 75.315  -11.144 -4.053  1.00 23.15 ? 246 TYR B CB  1 
ATOM   5861 C  CG  . TYR B 1 245 ? 76.818  -11.274 -3.987  1.00 23.67 ? 246 TYR B CG  1 
ATOM   5862 C  CD1 . TYR B 1 245 ? 77.577  -11.385 -5.154  1.00 23.43 ? 246 TYR B CD1 1 
ATOM   5863 C  CD2 . TYR B 1 245 ? 77.491  -11.239 -2.760  1.00 23.76 ? 246 TYR B CD2 1 
ATOM   5864 C  CE1 . TYR B 1 245 ? 78.960  -11.468 -5.106  1.00 23.63 ? 246 TYR B CE1 1 
ATOM   5865 C  CE2 . TYR B 1 245 ? 78.880  -11.323 -2.702  1.00 23.70 ? 246 TYR B CE2 1 
ATOM   5866 C  CZ  . TYR B 1 245 ? 79.602  -11.430 -3.878  1.00 24.40 ? 246 TYR B CZ  1 
ATOM   5867 O  OH  . TYR B 1 245 ? 80.974  -11.519 -3.826  1.00 27.44 ? 246 TYR B OH  1 
ATOM   5868 N  N   . TRP B 1 246 ? 74.524  -12.570 -1.377  1.00 24.20 ? 247 TRP B N   1 
ATOM   5869 C  CA  . TRP B 1 246 ? 74.921  -13.147 -0.101  1.00 25.23 ? 247 TRP B CA  1 
ATOM   5870 C  C   . TRP B 1 246 ? 74.174  -14.427 0.259   1.00 26.58 ? 247 TRP B C   1 
ATOM   5871 O  O   . TRP B 1 246 ? 74.789  -15.367 0.754   1.00 25.99 ? 247 TRP B O   1 
ATOM   5872 C  CB  . TRP B 1 246 ? 74.868  -12.107 1.012   1.00 24.73 ? 247 TRP B CB  1 
ATOM   5873 C  CG  . TRP B 1 246 ? 76.086  -11.238 0.987   1.00 25.05 ? 247 TRP B CG  1 
ATOM   5874 C  CD1 . TRP B 1 246 ? 76.144  -9.907  0.675   1.00 24.46 ? 247 TRP B CD1 1 
ATOM   5875 C  CD2 . TRP B 1 246 ? 77.439  -11.649 1.248   1.00 24.64 ? 247 TRP B CD2 1 
ATOM   5876 N  NE1 . TRP B 1 246 ? 77.443  -9.463  0.749   1.00 24.17 ? 247 TRP B NE1 1 
ATOM   5877 C  CE2 . TRP B 1 246 ? 78.258  -10.510 1.094   1.00 23.60 ? 247 TRP B CE2 1 
ATOM   5878 C  CE3 . TRP B 1 246 ? 78.034  -12.870 1.601   1.00 23.45 ? 247 TRP B CE3 1 
ATOM   5879 C  CZ2 . TRP B 1 246 ? 79.643  -10.551 1.285   1.00 23.60 ? 247 TRP B CZ2 1 
ATOM   5880 C  CZ3 . TRP B 1 246 ? 79.412  -12.909 1.795   1.00 24.53 ? 247 TRP B CZ3 1 
ATOM   5881 C  CH2 . TRP B 1 246 ? 80.201  -11.755 1.632   1.00 23.84 ? 247 TRP B CH2 1 
ATOM   5882 N  N   . GLU B 1 247 ? 72.867  -14.467 -0.022  1.00 28.38 ? 248 GLU B N   1 
ATOM   5883 C  CA  . GLU B 1 247 ? 72.046  -15.673 0.170   1.00 30.60 ? 248 GLU B CA  1 
ATOM   5884 C  C   . GLU B 1 247 ? 72.522  -16.856 -0.669  1.00 31.35 ? 248 GLU B C   1 
ATOM   5885 O  O   . GLU B 1 247 ? 72.352  -18.009 -0.270  1.00 31.49 ? 248 GLU B O   1 
ATOM   5886 C  CB  . GLU B 1 247 ? 70.573  -15.392 -0.128  1.00 30.69 ? 248 GLU B CB  1 
ATOM   5887 C  CG  . GLU B 1 247 ? 69.835  -14.682 0.993   1.00 33.70 ? 248 GLU B CG  1 
ATOM   5888 C  CD  . GLU B 1 247 ? 68.508  -14.084 0.537   1.00 37.51 ? 248 GLU B CD  1 
ATOM   5889 O  OE1 . GLU B 1 247 ? 67.943  -14.572 -0.471  1.00 39.33 ? 248 GLU B OE1 1 
ATOM   5890 O  OE2 . GLU B 1 247 ? 68.031  -13.122 1.184   1.00 39.00 ? 248 GLU B OE2 1 
ATOM   5891 N  N   . LEU B 1 248 ? 73.112  -16.554 -1.824  1.00 32.62 ? 249 LEU B N   1 
ATOM   5892 C  CA  . LEU B 1 248 ? 73.752  -17.546 -2.685  1.00 34.08 ? 249 LEU B CA  1 
ATOM   5893 C  C   . LEU B 1 248 ? 74.920  -18.237 -1.963  1.00 35.08 ? 249 LEU B C   1 
ATOM   5894 O  O   . LEU B 1 248 ? 75.077  -19.457 -2.048  1.00 35.03 ? 249 LEU B O   1 
ATOM   5895 C  CB  . LEU B 1 248 ? 74.270  -16.860 -3.951  1.00 34.06 ? 249 LEU B CB  1 
ATOM   5896 C  CG  . LEU B 1 248 ? 74.349  -17.595 -5.283  1.00 34.81 ? 249 LEU B CG  1 
ATOM   5897 C  CD1 . LEU B 1 248 ? 72.947  -17.803 -5.829  1.00 35.29 ? 249 LEU B CD1 1 
ATOM   5898 C  CD2 . LEU B 1 248 ? 75.190  -16.787 -6.270  1.00 34.83 ? 249 LEU B CD2 1 
ATOM   5899 N  N   . ARG B 1 249 ? 75.739  -17.448 -1.265  1.00 36.09 ? 250 ARG B N   1 
ATOM   5900 C  CA  . ARG B 1 249 ? 76.851  -17.985 -0.481  1.00 37.21 ? 250 ARG B CA  1 
ATOM   5901 C  C   . ARG B 1 249 ? 76.380  -18.700 0.787   1.00 38.02 ? 250 ARG B C   1 
ATOM   5902 O  O   . ARG B 1 249 ? 77.036  -19.631 1.253   1.00 37.95 ? 250 ARG B O   1 
ATOM   5903 C  CB  . ARG B 1 249 ? 77.866  -16.894 -0.135  1.00 37.20 ? 250 ARG B CB  1 
ATOM   5904 C  CG  . ARG B 1 249 ? 78.837  -16.583 -1.252  1.00 37.73 ? 250 ARG B CG  1 
ATOM   5905 C  CD  . ARG B 1 249 ? 78.545  -15.262 -1.900  1.00 39.70 ? 250 ARG B CD  1 
ATOM   5906 N  NE  . ARG B 1 249 ? 78.945  -15.252 -3.310  1.00 41.96 ? 250 ARG B NE  1 
ATOM   5907 C  CZ  . ARG B 1 249 ? 80.101  -14.776 -3.765  1.00 42.21 ? 250 ARG B CZ  1 
ATOM   5908 N  NH1 . ARG B 1 249 ? 80.992  -14.263 -2.922  1.00 42.50 ? 250 ARG B NH1 1 
ATOM   5909 N  NH2 . ARG B 1 249 ? 80.366  -14.811 -5.065  1.00 41.66 ? 250 ARG B NH2 1 
ATOM   5910 N  N   . GLN B 1 250 ? 75.244  -18.266 1.331   1.00 39.19 ? 251 GLN B N   1 
ATOM   5911 C  CA  . GLN B 1 250 ? 74.650  -18.898 2.511   1.00 40.80 ? 251 GLN B CA  1 
ATOM   5912 C  C   . GLN B 1 250 ? 74.111  -20.293 2.186   1.00 41.84 ? 251 GLN B C   1 
ATOM   5913 O  O   . GLN B 1 250 ? 74.539  -21.285 2.779   1.00 41.96 ? 251 GLN B O   1 
ATOM   5914 C  CB  . GLN B 1 250 ? 73.544  -18.024 3.107   1.00 40.69 ? 251 GLN B CB  1 
ATOM   5915 C  CG  . GLN B 1 250 ? 74.029  -16.716 3.720   1.00 41.23 ? 251 GLN B CG  1 
ATOM   5916 C  CD  . GLN B 1 250 ? 72.884  -15.810 4.165   1.00 42.02 ? 251 GLN B CD  1 
ATOM   5917 O  OE1 . GLN B 1 250 ? 71.877  -16.279 4.701   1.00 43.16 ? 251 GLN B OE1 1 
ATOM   5918 N  NE2 . GLN B 1 250 ? 73.035  -14.506 3.944   1.00 40.80 ? 251 GLN B NE2 1 
ATOM   5919 N  N   . LYS B 1 251 ? 73.188  -20.358 1.230   1.00 43.09 ? 252 LYS B N   1 
ATOM   5920 C  CA  . LYS B 1 251 ? 72.629  -21.619 0.752   1.00 44.40 ? 252 LYS B CA  1 
ATOM   5921 C  C   . LYS B 1 251 ? 73.611  -22.374 -0.155  1.00 45.26 ? 252 LYS B C   1 
ATOM   5922 O  O   . LYS B 1 251 ? 73.280  -23.439 -0.677  1.00 45.42 ? 252 LYS B O   1 
ATOM   5923 C  CB  . LYS B 1 251 ? 71.298  -21.368 0.032   1.00 44.57 ? 252 LYS B CB  1 
ATOM   5924 C  CG  . LYS B 1 251 ? 70.176  -20.908 0.967   1.00 45.41 ? 252 LYS B CG  1 
ATOM   5925 C  CD  . LYS B 1 251 ? 68.960  -20.402 0.204   1.00 46.94 ? 252 LYS B CD  1 
ATOM   5926 C  CE  . LYS B 1 251 ? 67.899  -19.872 1.169   1.00 48.09 ? 252 LYS B CE  1 
ATOM   5927 N  NZ  . LYS B 1 251 ? 66.670  -19.383 0.478   1.00 48.47 ? 252 LYS B NZ  1 
ATOM   5928 N  N   . GLY B 1 252 ? 74.813  -21.810 -0.315  1.00 46.20 ? 253 GLY B N   1 
ATOM   5929 C  CA  . GLY B 1 252 ? 75.911  -22.356 -1.135  1.00 47.27 ? 253 GLY B CA  1 
ATOM   5930 C  C   . GLY B 1 252 ? 75.790  -23.787 -1.623  1.00 48.06 ? 253 GLY B C   1 
ATOM   5931 O  O   . GLY B 1 252 ? 76.374  -24.709 -1.039  1.00 48.29 ? 253 GLY B O   1 
ATOM   5932 N  N   . SER B 1 253 ? 75.037  -23.964 -2.707  1.00 48.72 ? 254 SER B N   1 
ATOM   5933 C  CA  . SER B 1 253 ? 74.748  -25.294 -3.251  1.00 49.23 ? 254 SER B CA  1 
ATOM   5934 C  C   . SER B 1 253 ? 74.584  -25.250 -4.768  1.00 49.41 ? 254 SER B C   1 
ATOM   5935 O  O   . SER B 1 253 ? 73.958  -24.329 -5.307  1.00 49.63 ? 254 SER B O   1 
ATOM   5936 C  CB  . SER B 1 253 ? 73.471  -25.849 -2.621  1.00 49.24 ? 254 SER B CB  1 
ATOM   5937 O  OG  . SER B 1 253 ? 72.380  -24.963 -2.849  1.00 49.57 ? 254 SER B OG  1 
ATOM   5938 N  N   . VAL B 1 254 ? 75.145  -26.245 -5.454  1.00 49.38 ? 255 VAL B N   1 
ATOM   5939 C  CA  . VAL B 1 254 ? 74.929  -26.383 -6.893  1.00 49.22 ? 255 VAL B CA  1 
ATOM   5940 C  C   . VAL B 1 254 ? 73.452  -26.721 -7.126  1.00 48.94 ? 255 VAL B C   1 
ATOM   5941 O  O   . VAL B 1 254 ? 72.864  -27.513 -6.386  1.00 49.00 ? 255 VAL B O   1 
ATOM   5942 C  CB  . VAL B 1 254 ? 75.842  -27.468 -7.535  1.00 49.35 ? 255 VAL B CB  1 
ATOM   5943 C  CG1 . VAL B 1 254 ? 75.891  -27.299 -9.063  1.00 49.70 ? 255 VAL B CG1 1 
ATOM   5944 C  CG2 . VAL B 1 254 ? 77.256  -27.419 -6.949  1.00 49.35 ? 255 VAL B CG2 1 
ATOM   5945 N  N   . HIS B 1 255 ? 72.853  -26.081 -8.127  1.00 48.57 ? 256 HIS B N   1 
ATOM   5946 C  CA  . HIS B 1 255 ? 71.456  -26.314 -8.475  1.00 47.96 ? 256 HIS B CA  1 
ATOM   5947 C  C   . HIS B 1 255 ? 71.341  -26.891 -9.874  1.00 47.24 ? 256 HIS B C   1 
ATOM   5948 O  O   . HIS B 1 255 ? 72.062  -26.473 -10.786 1.00 47.08 ? 256 HIS B O   1 
ATOM   5949 C  CB  . HIS B 1 255 ? 70.650  -25.017 -8.389  1.00 48.23 ? 256 HIS B CB  1 
ATOM   5950 C  CG  . HIS B 1 255 ? 70.146  -24.710 -7.015  1.00 49.34 ? 256 HIS B CG  1 
ATOM   5951 N  ND1 . HIS B 1 255 ? 68.865  -25.019 -6.608  1.00 50.74 ? 256 HIS B ND1 1 
ATOM   5952 C  CD2 . HIS B 1 255 ? 70.747  -24.121 -5.954  1.00 49.91 ? 256 HIS B CD2 1 
ATOM   5953 C  CE1 . HIS B 1 255 ? 68.701  -24.634 -5.354  1.00 51.00 ? 256 HIS B CE1 1 
ATOM   5954 N  NE2 . HIS B 1 255 ? 69.827  -24.087 -4.934  1.00 50.57 ? 256 HIS B NE2 1 
ATOM   5955 N  N   . HIS B 1 256 ? 70.432  -27.853 -10.029 1.00 46.25 ? 257 HIS B N   1 
ATOM   5956 C  CA  . HIS B 1 256 ? 70.119  -28.426 -11.339 1.00 45.37 ? 257 HIS B CA  1 
ATOM   5957 C  C   . HIS B 1 256 ? 68.886  -27.759 -11.952 1.00 44.38 ? 257 HIS B C   1 
ATOM   5958 O  O   . HIS B 1 256 ? 68.807  -27.594 -13.172 1.00 44.44 ? 257 HIS B O   1 
ATOM   5959 C  CB  . HIS B 1 256 ? 69.935  -29.942 -11.242 1.00 45.51 ? 257 HIS B CB  1 
ATOM   5960 C  CG  . HIS B 1 256 ? 71.198  -30.686 -10.928 1.00 46.38 ? 257 HIS B CG  1 
ATOM   5961 N  ND1 . HIS B 1 256 ? 71.675  -31.711 -11.717 1.00 47.68 ? 257 HIS B ND1 1 
ATOM   5962 C  CD2 . HIS B 1 256 ? 72.085  -30.552 -9.912  1.00 47.04 ? 257 HIS B CD2 1 
ATOM   5963 C  CE1 . HIS B 1 256 ? 72.798  -32.178 -11.200 1.00 47.63 ? 257 HIS B CE1 1 
ATOM   5964 N  NE2 . HIS B 1 256 ? 73.069  -31.490 -10.105 1.00 47.83 ? 257 HIS B NE2 1 
ATOM   5965 N  N   . ASP B 1 257 ? 67.935  -27.375 -11.102 1.00 43.12 ? 258 ASP B N   1 
ATOM   5966 C  CA  . ASP B 1 257 ? 66.750  -26.634 -11.541 1.00 41.99 ? 258 ASP B CA  1 
ATOM   5967 C  C   . ASP B 1 257 ? 67.124  -25.195 -11.879 1.00 40.80 ? 258 ASP B C   1 
ATOM   5968 O  O   . ASP B 1 257 ? 68.081  -24.647 -11.323 1.00 40.86 ? 258 ASP B O   1 
ATOM   5969 C  CB  . ASP B 1 257 ? 65.653  -26.663 -10.468 1.00 42.22 ? 258 ASP B CB  1 
ATOM   5970 C  CG  . ASP B 1 257 ? 66.074  -25.983 -9.164  1.00 43.11 ? 258 ASP B CG  1 
ATOM   5971 O  OD1 . ASP B 1 257 ? 67.261  -26.095 -8.775  1.00 44.29 ? 258 ASP B OD1 1 
ATOM   5972 O  OD2 . ASP B 1 257 ? 65.211  -25.346 -8.521  1.00 43.18 ? 258 ASP B OD2 1 
ATOM   5973 N  N   . TYR B 1 258 ? 66.374  -24.590 -12.795 1.00 39.24 ? 259 TYR B N   1 
ATOM   5974 C  CA  . TYR B 1 258 ? 66.607  -23.196 -13.174 1.00 37.75 ? 259 TYR B CA  1 
ATOM   5975 C  C   . TYR B 1 258 ? 66.277  -22.244 -12.024 1.00 36.78 ? 259 TYR B C   1 
ATOM   5976 O  O   . TYR B 1 258 ? 65.240  -22.371 -11.371 1.00 36.55 ? 259 TYR B O   1 
ATOM   5977 C  CB  . TYR B 1 258 ? 65.803  -22.838 -14.417 1.00 37.38 ? 259 TYR B CB  1 
ATOM   5978 C  CG  . TYR B 1 258 ? 66.057  -21.439 -14.928 1.00 36.97 ? 259 TYR B CG  1 
ATOM   5979 C  CD1 . TYR B 1 258 ? 67.236  -21.129 -15.620 1.00 35.82 ? 259 TYR B CD1 1 
ATOM   5980 C  CD2 . TYR B 1 258 ? 65.113  -20.426 -14.735 1.00 35.62 ? 259 TYR B CD2 1 
ATOM   5981 C  CE1 . TYR B 1 258 ? 67.469  -19.843 -16.102 1.00 35.34 ? 259 TYR B CE1 1 
ATOM   5982 C  CE2 . TYR B 1 258 ? 65.334  -19.137 -15.218 1.00 35.45 ? 259 TYR B CE2 1 
ATOM   5983 C  CZ  . TYR B 1 258 ? 66.513  -18.853 -15.897 1.00 34.93 ? 259 TYR B CZ  1 
ATOM   5984 O  OH  . TYR B 1 258 ? 66.737  -17.584 -16.368 1.00 33.24 ? 259 TYR B OH  1 
ATOM   5985 N  N   . ARG B 1 259 ? 67.170  -21.291 -11.783 1.00 35.87 ? 260 ARG B N   1 
ATOM   5986 C  CA  . ARG B 1 259 ? 67.051  -20.415 -10.624 1.00 35.05 ? 260 ARG B CA  1 
ATOM   5987 C  C   . ARG B 1 259 ? 66.838  -18.942 -10.974 1.00 33.76 ? 260 ARG B C   1 
ATOM   5988 O  O   . ARG B 1 259 ? 66.630  -18.122 -10.074 1.00 33.82 ? 260 ARG B O   1 
ATOM   5989 C  CB  . ARG B 1 259 ? 68.283  -20.564 -9.714  1.00 35.70 ? 260 ARG B CB  1 
ATOM   5990 C  CG  . ARG B 1 259 ? 68.490  -21.963 -9.118  1.00 37.12 ? 260 ARG B CG  1 
ATOM   5991 C  CD  . ARG B 1 259 ? 67.472  -22.294 -8.024  1.00 40.39 ? 260 ARG B CD  1 
ATOM   5992 N  NE  . ARG B 1 259 ? 67.634  -21.459 -6.835  1.00 42.83 ? 260 ARG B NE  1 
ATOM   5993 C  CZ  . ARG B 1 259 ? 66.989  -21.651 -5.683  1.00 45.20 ? 260 ARG B CZ  1 
ATOM   5994 N  NH1 . ARG B 1 259 ? 66.132  -22.661 -5.545  1.00 45.27 ? 260 ARG B NH1 1 
ATOM   5995 N  NH2 . ARG B 1 259 ? 67.204  -20.828 -4.658  1.00 45.79 ? 260 ARG B NH2 1 
ATOM   5996 N  N   . GLY B 1 260 ? 66.891  -18.611 -12.267 1.00 32.07 ? 261 GLY B N   1 
ATOM   5997 C  CA  . GLY B 1 260 ? 66.704  -17.231 -12.725 1.00 30.02 ? 261 GLY B CA  1 
ATOM   5998 C  C   . GLY B 1 260 ? 67.888  -16.646 -13.480 1.00 28.62 ? 261 GLY B C   1 
ATOM   5999 O  O   . GLY B 1 260 ? 68.956  -17.263 -13.559 1.00 28.20 ? 261 GLY B O   1 
ATOM   6000 N  N   . ILE B 1 261 ? 67.689  -15.446 -14.027 1.00 27.13 ? 262 ILE B N   1 
ATOM   6001 C  CA  . ILE B 1 261 ? 68.713  -14.736 -14.794 1.00 25.67 ? 262 ILE B CA  1 
ATOM   6002 C  C   . ILE B 1 261 ? 69.937  -14.311 -13.962 1.00 25.33 ? 262 ILE B C   1 
ATOM   6003 O  O   . ILE B 1 261 ? 71.069  -14.452 -14.420 1.00 25.02 ? 262 ILE B O   1 
ATOM   6004 C  CB  . ILE B 1 261 ? 68.130  -13.486 -15.502 1.00 25.49 ? 262 ILE B CB  1 
ATOM   6005 C  CG1 . ILE B 1 261 ? 67.059  -13.876 -16.522 1.00 24.73 ? 262 ILE B CG1 1 
ATOM   6006 C  CG2 . ILE B 1 261 ? 69.233  -12.678 -16.179 1.00 24.68 ? 262 ILE B CG2 1 
ATOM   6007 C  CD1 . ILE B 1 261 ? 66.135  -12.721 -16.886 1.00 23.80 ? 262 ILE B CD1 1 
ATOM   6008 N  N   . LEU B 1 262 ? 69.707  -13.767 -12.767 1.00 24.90 ? 263 LEU B N   1 
ATOM   6009 C  CA  . LEU B 1 262 ? 70.796  -13.274 -11.917 1.00 25.03 ? 263 LEU B CA  1 
ATOM   6010 C  C   . LEU B 1 262 ? 71.739  -14.398 -11.470 1.00 25.28 ? 263 LEU B C   1 
ATOM   6011 O  O   . LEU B 1 262 ? 72.961  -14.230 -11.466 1.00 25.01 ? 263 LEU B O   1 
ATOM   6012 C  CB  . LEU B 1 262 ? 70.256  -12.505 -10.699 1.00 24.49 ? 263 LEU B CB  1 
ATOM   6013 C  CG  . LEU B 1 262 ? 71.301  -11.816 -9.797  1.00 24.60 ? 263 LEU B CG  1 
ATOM   6014 C  CD1 . LEU B 1 262 ? 72.303  -10.990 -10.605 1.00 23.58 ? 263 LEU B CD1 1 
ATOM   6015 C  CD2 . LEU B 1 262 ? 70.656  -10.963 -8.719  1.00 23.98 ? 263 LEU B CD2 1 
ATOM   6016 N  N   . TYR B 1 263 ? 71.151  -15.532 -11.100 1.00 25.62 ? 264 TYR B N   1 
ATOM   6017 C  CA  . TYR B 1 263 ? 71.897  -16.738 -10.745 1.00 26.53 ? 264 TYR B CA  1 
ATOM   6018 C  C   . TYR B 1 263 ? 72.847  -17.169 -11.867 1.00 26.73 ? 264 TYR B C   1 
ATOM   6019 O  O   . TYR B 1 263 ? 73.970  -17.608 -11.609 1.00 26.74 ? 264 TYR B O   1 
ATOM   6020 C  CB  . TYR B 1 263 ? 70.915  -17.867 -10.417 1.00 26.46 ? 264 TYR B CB  1 
ATOM   6021 C  CG  . TYR B 1 263 ? 71.555  -19.159 -9.957  1.00 27.93 ? 264 TYR B CG  1 
ATOM   6022 C  CD1 . TYR B 1 263 ? 71.764  -19.406 -8.600  1.00 28.35 ? 264 TYR B CD1 1 
ATOM   6023 C  CD2 . TYR B 1 263 ? 71.934  -20.143 -10.876 1.00 27.58 ? 264 TYR B CD2 1 
ATOM   6024 C  CE1 . TYR B 1 263 ? 72.345  -20.584 -8.169  1.00 29.38 ? 264 TYR B CE1 1 
ATOM   6025 C  CE2 . TYR B 1 263 ? 72.520  -21.329 -10.453 1.00 28.81 ? 264 TYR B CE2 1 
ATOM   6026 C  CZ  . TYR B 1 263 ? 72.720  -21.542 -9.100  1.00 29.62 ? 264 TYR B CZ  1 
ATOM   6027 O  OH  . TYR B 1 263 ? 73.285  -22.715 -8.663  1.00 32.06 ? 264 TYR B OH  1 
ATOM   6028 N  N   . ARG B 1 264 ? 72.395  -17.040 -13.110 1.00 27.15 ? 265 ARG B N   1 
ATOM   6029 C  CA  . ARG B 1 264 ? 73.206  -17.421 -14.256 1.00 28.00 ? 265 ARG B CA  1 
ATOM   6030 C  C   . ARG B 1 264 ? 74.326  -16.421 -14.575 1.00 28.26 ? 265 ARG B C   1 
ATOM   6031 O  O   . ARG B 1 264 ? 75.444  -16.822 -14.905 1.00 28.21 ? 265 ARG B O   1 
ATOM   6032 C  CB  . ARG B 1 264 ? 72.322  -17.665 -15.469 1.00 28.24 ? 265 ARG B CB  1 
ATOM   6033 C  CG  . ARG B 1 264 ? 71.602  -18.984 -15.406 1.00 29.62 ? 265 ARG B CG  1 
ATOM   6034 C  CD  . ARG B 1 264 ? 71.584  -19.596 -16.770 1.00 32.68 ? 265 ARG B CD  1 
ATOM   6035 N  NE  . ARG B 1 264 ? 70.964  -20.912 -16.814 1.00 33.61 ? 265 ARG B NE  1 
ATOM   6036 C  CZ  . ARG B 1 264 ? 70.424  -21.426 -17.914 1.00 34.00 ? 265 ARG B CZ  1 
ATOM   6037 N  NH1 . ARG B 1 264 ? 70.421  -20.718 -19.039 1.00 34.57 ? 265 ARG B NH1 1 
ATOM   6038 N  NH2 . ARG B 1 264 ? 69.883  -22.637 -17.888 1.00 33.73 ? 265 ARG B NH2 1 
ATOM   6039 N  N   . LEU B 1 265 ? 74.027  -15.129 -14.460 1.00 28.53 ? 266 LEU B N   1 
ATOM   6040 C  CA  . LEU B 1 265 ? 75.037  -14.093 -14.647 1.00 29.06 ? 266 LEU B CA  1 
ATOM   6041 C  C   . LEU B 1 265 ? 76.113  -14.145 -13.556 1.00 29.67 ? 266 LEU B C   1 
ATOM   6042 O  O   . LEU B 1 265 ? 77.294  -13.992 -13.847 1.00 29.30 ? 266 LEU B O   1 
ATOM   6043 C  CB  . LEU B 1 265 ? 74.404  -12.697 -14.697 1.00 28.49 ? 266 LEU B CB  1 
ATOM   6044 C  CG  . LEU B 1 265 ? 73.481  -12.321 -15.861 1.00 28.20 ? 266 LEU B CG  1 
ATOM   6045 C  CD1 . LEU B 1 265 ? 72.903  -10.921 -15.637 1.00 26.98 ? 266 LEU B CD1 1 
ATOM   6046 C  CD2 . LEU B 1 265 ? 74.179  -12.418 -17.228 1.00 27.01 ? 266 LEU B CD2 1 
ATOM   6047 N  N   . LEU B 1 266 ? 75.699  -14.355 -12.308 1.00 30.56 ? 267 LEU B N   1 
ATOM   6048 C  CA  . LEU B 1 266 ? 76.645  -14.451 -11.195 1.00 32.00 ? 267 LEU B CA  1 
ATOM   6049 C  C   . LEU B 1 266 ? 77.421  -15.771 -11.218 1.00 33.04 ? 267 LEU B C   1 
ATOM   6050 O  O   . LEU B 1 266 ? 78.577  -15.821 -10.810 1.00 33.32 ? 267 LEU B O   1 
ATOM   6051 C  CB  . LEU B 1 266 ? 75.935  -14.279 -9.849  1.00 31.68 ? 267 LEU B CB  1 
ATOM   6052 C  CG  . LEU B 1 266 ? 75.438  -12.880 -9.469  1.00 31.37 ? 267 LEU B CG  1 
ATOM   6053 C  CD1 . LEU B 1 266 ? 74.555  -12.964 -8.232  1.00 30.77 ? 267 LEU B CD1 1 
ATOM   6054 C  CD2 . LEU B 1 266 ? 76.591  -11.898 -9.243  1.00 29.94 ? 267 LEU B CD2 1 
ATOM   6055 N  N   . GLY B 1 267 ? 76.776  -16.827 -11.707 1.00 34.27 ? 268 GLY B N   1 
ATOM   6056 C  CA  . GLY B 1 267 ? 77.374  -18.154 -11.762 1.00 35.63 ? 268 GLY B CA  1 
ATOM   6057 C  C   . GLY B 1 267 ? 78.358  -18.339 -12.900 1.00 36.78 ? 268 GLY B C   1 
ATOM   6058 O  O   . GLY B 1 267 ? 79.404  -18.957 -12.714 1.00 36.99 ? 268 GLY B O   1 
ATOM   6059 N  N   . ASP B 1 268 ? 78.029  -17.812 -14.080 1.00 37.64 ? 269 ASP B N   1 
ATOM   6060 C  CA  . ASP B 1 268 ? 78.862  -18.019 -15.271 1.00 38.58 ? 269 ASP B CA  1 
ATOM   6061 C  C   . ASP B 1 268 ? 78.686  -16.922 -16.325 1.00 38.46 ? 269 ASP B C   1 
ATOM   6062 O  O   . ASP B 1 268 ? 77.999  -17.118 -17.322 1.00 38.68 ? 269 ASP B O   1 
ATOM   6063 C  CB  . ASP B 1 268 ? 78.594  -19.408 -15.892 1.00 39.06 ? 269 ASP B CB  1 
ATOM   6064 C  CG  . ASP B 1 268 ? 79.578  -19.762 -17.012 1.00 40.63 ? 269 ASP B CG  1 
ATOM   6065 O  OD1 . ASP B 1 268 ? 80.641  -19.104 -17.124 1.00 41.78 ? 269 ASP B OD1 1 
ATOM   6066 O  OD2 . ASP B 1 268 ? 79.284  -20.707 -17.784 1.00 42.54 ? 269 ASP B OD2 1 
ATOM   6067 N  N   . SER B 1 269 ? 79.329  -15.781 -16.104 1.00 38.54 ? 270 SER B N   1 
ATOM   6068 C  CA  . SER B 1 269 ? 79.293  -14.677 -17.059 1.00 38.43 ? 270 SER B CA  1 
ATOM   6069 C  C   . SER B 1 269 ? 80.662  -14.025 -17.198 1.00 38.43 ? 270 SER B C   1 
ATOM   6070 O  O   . SER B 1 269 ? 81.523  -14.184 -16.338 1.00 38.50 ? 270 SER B O   1 
ATOM   6071 C  CB  . SER B 1 269 ? 78.263  -13.626 -16.632 1.00 38.26 ? 270 SER B CB  1 
ATOM   6072 O  OG  . SER B 1 269 ? 78.158  -12.584 -17.588 1.00 37.93 ? 270 SER B OG  1 
ATOM   6073 N  N   . LYS B 1 270 ? 80.852  -13.284 -18.285 1.00 38.42 ? 271 LYS B N   1 
ATOM   6074 C  CA  . LYS B 1 270 ? 82.059  -12.489 -18.464 1.00 38.43 ? 271 LYS B CA  1 
ATOM   6075 C  C   . LYS B 1 270 ? 81.930  -11.102 -17.823 1.00 38.19 ? 271 LYS B C   1 
ATOM   6076 O  O   . LYS B 1 270 ? 82.875  -10.314 -17.846 1.00 38.30 ? 271 LYS B O   1 
ATOM   6077 C  CB  . LYS B 1 270 ? 82.399  -12.374 -19.950 1.00 38.69 ? 271 LYS B CB  1 
ATOM   6078 C  CG  . LYS B 1 270 ? 82.842  -13.691 -20.570 1.00 39.93 ? 271 LYS B CG  1 
ATOM   6079 C  CD  . LYS B 1 270 ? 83.061  -13.550 -22.053 1.00 41.51 ? 271 LYS B CD  1 
ATOM   6080 C  CE  . LYS B 1 270 ? 83.730  -14.784 -22.613 1.00 42.46 ? 271 LYS B CE  1 
ATOM   6081 N  NZ  . LYS B 1 270 ? 84.004  -14.598 -24.061 1.00 43.48 ? 271 LYS B NZ  1 
ATOM   6082 N  N   . MET B 1 271 ? 80.763  -10.817 -17.244 1.00 37.67 ? 272 MET B N   1 
ATOM   6083 C  CA  . MET B 1 271 ? 80.492  -9.511  -16.635 1.00 37.07 ? 272 MET B CA  1 
ATOM   6084 C  C   . MET B 1 271 ? 81.034  -9.419  -15.212 1.00 36.27 ? 272 MET B C   1 
ATOM   6085 O  O   . MET B 1 271 ? 80.953  -10.376 -14.431 1.00 36.59 ? 272 MET B O   1 
ATOM   6086 C  CB  . MET B 1 271 ? 78.984  -9.216  -16.606 1.00 37.28 ? 272 MET B CB  1 
ATOM   6087 C  CG  . MET B 1 271 ? 78.304  -9.132  -17.964 1.00 38.50 ? 272 MET B CG  1 
ATOM   6088 S  SD  . MET B 1 271 ? 76.521  -8.800  -17.848 1.00 42.22 ? 272 MET B SD  1 
ATOM   6089 C  CE  . MET B 1 271 ? 76.521  -7.043  -17.628 1.00 37.99 ? 272 MET B CE  1 
ATOM   6090 N  N   . SER B 1 272 ? 81.566  -8.254  -14.870 1.00 35.06 ? 273 SER B N   1 
ATOM   6091 C  CA  . SER B 1 272 ? 81.919  -7.963  -13.493 1.00 34.21 ? 273 SER B CA  1 
ATOM   6092 C  C   . SER B 1 272 ? 80.632  -7.831  -12.672 1.00 33.46 ? 273 SER B C   1 
ATOM   6093 O  O   . SER B 1 272 ? 79.547  -7.630  -13.234 1.00 33.31 ? 273 SER B O   1 
ATOM   6094 C  CB  . SER B 1 272 ? 82.748  -6.678  -13.417 1.00 34.18 ? 273 SER B CB  1 
ATOM   6095 O  OG  . SER B 1 272 ? 82.021  -5.582  -13.941 1.00 34.15 ? 273 SER B OG  1 
ATOM   6096 N  N   . PHE B 1 273 ? 80.748  -7.949  -11.353 1.00 32.32 ? 274 PHE B N   1 
ATOM   6097 C  CA  . PHE B 1 273 ? 79.596  -7.780  -10.479 1.00 31.62 ? 274 PHE B CA  1 
ATOM   6098 C  C   . PHE B 1 273 ? 78.989  -6.385  -10.648 1.00 31.48 ? 274 PHE B C   1 
ATOM   6099 O  O   . PHE B 1 273 ? 77.773  -6.204  -10.521 1.00 31.32 ? 274 PHE B O   1 
ATOM   6100 C  CB  . PHE B 1 273 ? 79.970  -8.011  -9.014  1.00 31.25 ? 274 PHE B CB  1 
ATOM   6101 C  CG  . PHE B 1 273 ? 78.857  -7.692  -8.056  1.00 30.26 ? 274 PHE B CG  1 
ATOM   6102 C  CD1 . PHE B 1 273 ? 77.825  -8.606  -7.838  1.00 29.02 ? 274 PHE B CD1 1 
ATOM   6103 C  CD2 . PHE B 1 273 ? 78.824  -6.468  -7.393  1.00 28.39 ? 274 PHE B CD2 1 
ATOM   6104 C  CE1 . PHE B 1 273 ? 76.784  -8.309  -6.957  1.00 28.09 ? 274 PHE B CE1 1 
ATOM   6105 C  CE2 . PHE B 1 273 ? 77.791  -6.163  -6.516  1.00 27.92 ? 274 PHE B CE2 1 
ATOM   6106 C  CZ  . PHE B 1 273 ? 76.766  -7.084  -6.299  1.00 28.04 ? 274 PHE B CZ  1 
ATOM   6107 N  N   . GLU B 1 274 ? 79.857  -5.415  -10.934 1.00 31.01 ? 275 GLU B N   1 
ATOM   6108 C  CA  . GLU B 1 274 ? 79.475  -4.025  -11.124 1.00 30.76 ? 275 GLU B CA  1 
ATOM   6109 C  C   . GLU B 1 274 ? 78.560  -3.845  -12.342 1.00 30.08 ? 275 GLU B C   1 
ATOM   6110 O  O   . GLU B 1 274 ? 77.553  -3.134  -12.262 1.00 30.08 ? 275 GLU B O   1 
ATOM   6111 C  CB  . GLU B 1 274 ? 80.728  -3.143  -11.254 1.00 31.14 ? 275 GLU B CB  1 
ATOM   6112 C  CG  . GLU B 1 274 ? 81.544  -2.962  -9.955  1.00 32.13 ? 275 GLU B CG  1 
ATOM   6113 C  CD  . GLU B 1 274 ? 82.310  -4.218  -9.511  1.00 34.44 ? 275 GLU B CD  1 
ATOM   6114 O  OE1 . GLU B 1 274 ? 82.801  -4.977  -10.380 1.00 35.31 ? 275 GLU B OE1 1 
ATOM   6115 O  OE2 . GLU B 1 274 ? 82.429  -4.437  -8.281  1.00 34.27 ? 275 GLU B OE2 1 
ATOM   6116 N  N   . ASP B 1 275 ? 78.916  -4.479  -13.459 1.00 28.99 ? 276 ASP B N   1 
ATOM   6117 C  CA  . ASP B 1 275 ? 78.099  -4.427  -14.674 1.00 28.35 ? 276 ASP B CA  1 
ATOM   6118 C  C   . ASP B 1 275 ? 76.778  -5.195  -14.535 1.00 27.28 ? 276 ASP B C   1 
ATOM   6119 O  O   . ASP B 1 275 ? 75.749  -4.776  -15.069 1.00 26.74 ? 276 ASP B O   1 
ATOM   6120 C  CB  . ASP B 1 275 ? 78.883  -4.940  -15.884 1.00 28.86 ? 276 ASP B CB  1 
ATOM   6121 C  CG  . ASP B 1 275 ? 79.930  -3.945  -16.376 1.00 30.34 ? 276 ASP B CG  1 
ATOM   6122 O  OD1 . ASP B 1 275 ? 79.702  -2.717  -16.277 1.00 32.70 ? 276 ASP B OD1 1 
ATOM   6123 O  OD2 . ASP B 1 275 ? 80.977  -4.397  -16.877 1.00 31.02 ? 276 ASP B OD2 1 
ATOM   6124 N  N   . ILE B 1 276 ? 76.824  -6.313  -13.816 1.00 25.99 ? 277 ILE B N   1 
ATOM   6125 C  CA  . ILE B 1 276 ? 75.650  -7.115  -13.536 1.00 25.03 ? 277 ILE B CA  1 
ATOM   6126 C  C   . ILE B 1 276 ? 74.628  -6.292  -12.742 1.00 24.55 ? 277 ILE B C   1 
ATOM   6127 O  O   . ILE B 1 276 ? 73.461  -6.212  -13.127 1.00 24.12 ? 277 ILE B O   1 
ATOM   6128 C  CB  . ILE B 1 276 ? 76.026  -8.420  -12.775 1.00 25.07 ? 277 ILE B CB  1 
ATOM   6129 C  CG1 . ILE B 1 276 ? 76.730  -9.401  -13.720 1.00 25.72 ? 277 ILE B CG1 1 
ATOM   6130 C  CG2 . ILE B 1 276 ? 74.790  -9.070  -12.148 1.00 24.04 ? 277 ILE B CG2 1 
ATOM   6131 C  CD1 . ILE B 1 276 ? 77.490  -10.542 -13.017 1.00 26.13 ? 277 ILE B CD1 1 
ATOM   6132 N  N   . LYS B 1 277 ? 75.079  -5.682  -11.646 1.00 23.72 ? 278 LYS B N   1 
ATOM   6133 C  CA  . LYS B 1 277 ? 74.222  -4.858  -10.788 1.00 23.40 ? 278 LYS B CA  1 
ATOM   6134 C  C   . LYS B 1 277 ? 73.626  -3.663  -11.551 1.00 22.67 ? 278 LYS B C   1 
ATOM   6135 O  O   . LYS B 1 277 ? 72.435  -3.349  -11.402 1.00 22.18 ? 278 LYS B O   1 
ATOM   6136 C  CB  . LYS B 1 277 ? 75.001  -4.380  -9.554  1.00 23.72 ? 278 LYS B CB  1 
ATOM   6137 C  CG  . LYS B 1 277 ? 74.188  -3.541  -8.558  1.00 25.34 ? 278 LYS B CG  1 
ATOM   6138 C  CD  . LYS B 1 277 ? 75.078  -2.827  -7.539  1.00 27.72 ? 278 LYS B CD  1 
ATOM   6139 C  CE  . LYS B 1 277 ? 75.309  -3.674  -6.305  1.00 31.09 ? 278 LYS B CE  1 
ATOM   6140 N  NZ  . LYS B 1 277 ? 76.091  -2.958  -5.232  1.00 34.14 ? 278 LYS B NZ  1 
ATOM   6141 N  N   . ALA B 1 278 ? 74.452  -3.008  -12.367 1.00 21.65 ? 279 ALA B N   1 
ATOM   6142 C  CA  . ALA B 1 278 ? 73.973  -1.908  -13.204 1.00 21.30 ? 279 ALA B CA  1 
ATOM   6143 C  C   . ALA B 1 278 ? 72.850  -2.376  -14.135 1.00 20.73 ? 279 ALA B C   1 
ATOM   6144 O  O   . ALA B 1 278 ? 71.813  -1.708  -14.242 1.00 20.84 ? 279 ALA B O   1 
ATOM   6145 C  CB  . ALA B 1 278 ? 75.120  -1.266  -13.998 1.00 21.10 ? 279 ALA B CB  1 
ATOM   6146 N  N   . ASN B 1 279 ? 73.043  -3.534  -14.767 1.00 19.92 ? 280 ASN B N   1 
ATOM   6147 C  CA  . ASN B 1 279 ? 72.063  -4.072  -15.713 1.00 19.78 ? 280 ASN B CA  1 
ATOM   6148 C  C   . ASN B 1 279 ? 70.806  -4.669  -15.085 1.00 19.36 ? 280 ASN B C   1 
ATOM   6149 O  O   . ASN B 1 279 ? 69.725  -4.590  -15.668 1.00 19.31 ? 280 ASN B O   1 
ATOM   6150 C  CB  . ASN B 1 279 ? 72.721  -5.026  -16.720 1.00 19.57 ? 280 ASN B CB  1 
ATOM   6151 C  CG  . ASN B 1 279 ? 73.610  -4.285  -17.713 1.00 20.65 ? 280 ASN B CG  1 
ATOM   6152 O  OD1 . ASN B 1 279 ? 73.149  -3.414  -18.446 1.00 21.62 ? 280 ASN B OD1 1 
ATOM   6153 N  ND2 . ASN B 1 279 ? 74.892  -4.607  -17.717 1.00 22.27 ? 280 ASN B ND2 1 
ATOM   6154 N  N   . VAL B 1 280 ? 70.944  -5.256  -13.902 1.00 19.21 ? 281 VAL B N   1 
ATOM   6155 C  CA  . VAL B 1 280 ? 69.780  -5.689  -13.131 1.00 19.32 ? 281 VAL B CA  1 
ATOM   6156 C  C   . VAL B 1 280 ? 68.856  -4.506  -12.858 1.00 19.14 ? 281 VAL B C   1 
ATOM   6157 O  O   . VAL B 1 280 ? 67.637  -4.620  -13.018 1.00 19.09 ? 281 VAL B O   1 
ATOM   6158 C  CB  . VAL B 1 280 ? 70.177  -6.386  -11.811 1.00 19.36 ? 281 VAL B CB  1 
ATOM   6159 C  CG1 . VAL B 1 280 ? 68.981  -6.494  -10.872 1.00 19.65 ? 281 VAL B CG1 1 
ATOM   6160 C  CG2 . VAL B 1 280 ? 70.736  -7.773  -12.099 1.00 20.58 ? 281 VAL B CG2 1 
ATOM   6161 N  N   . THR B 1 281 ? 69.444  -3.370  -12.473 1.00 19.32 ? 282 THR B N   1 
ATOM   6162 C  CA  . THR B 1 281 ? 68.687  -2.159  -12.184 1.00 19.61 ? 282 THR B CA  1 
ATOM   6163 C  C   . THR B 1 281 ? 67.847  -1.740  -13.392 1.00 19.78 ? 282 THR B C   1 
ATOM   6164 O  O   . THR B 1 281 ? 66.654  -1.468  -13.254 1.00 19.81 ? 282 THR B O   1 
ATOM   6165 C  CB  . THR B 1 281 ? 69.608  -0.990  -11.748 1.00 19.98 ? 282 THR B CB  1 
ATOM   6166 O  OG1 . THR B 1 281 ? 70.362  -1.378  -10.595 1.00 20.80 ? 282 THR B OG1 1 
ATOM   6167 C  CG2 . THR B 1 281 ? 68.792  0.248   -11.409 1.00 19.25 ? 282 THR B CG2 1 
ATOM   6168 N  N   . GLU B 1 282 ? 68.478  -1.717  -14.566 1.00 20.01 ? 283 GLU B N   1 
ATOM   6169 C  CA  . GLU B 1 282 ? 67.818  -1.332  -15.816 1.00 20.61 ? 283 GLU B CA  1 
ATOM   6170 C  C   . GLU B 1 282 ? 66.764  -2.340  -16.267 1.00 20.66 ? 283 GLU B C   1 
ATOM   6171 O  O   . GLU B 1 282 ? 65.719  -1.949  -16.777 1.00 20.73 ? 283 GLU B O   1 
ATOM   6172 C  CB  . GLU B 1 282 ? 68.842  -1.083  -16.938 1.00 20.42 ? 283 GLU B CB  1 
ATOM   6173 C  CG  . GLU B 1 282 ? 69.689  0.174   -16.717 1.00 21.64 ? 283 GLU B CG  1 
ATOM   6174 C  CD  . GLU B 1 282 ? 70.660  0.478   -17.859 1.00 23.16 ? 283 GLU B CD  1 
ATOM   6175 O  OE1 . GLU B 1 282 ? 70.749  -0.328  -18.810 1.00 23.84 ? 283 GLU B OE1 1 
ATOM   6176 O  OE2 . GLU B 1 282 ? 71.340  1.537   -17.803 1.00 24.76 ? 283 GLU B OE2 1 
ATOM   6177 N  N   . MET B 1 283 ? 67.038  -3.631  -16.091 1.00 20.91 ? 284 MET B N   1 
ATOM   6178 C  CA  . MET B 1 283 ? 66.060  -4.659  -16.458 1.00 21.56 ? 284 MET B CA  1 
ATOM   6179 C  C   . MET B 1 283 ? 64.800  -4.566  -15.593 1.00 21.38 ? 284 MET B C   1 
ATOM   6180 O  O   . MET B 1 283 ? 63.684  -4.671  -16.104 1.00 21.08 ? 284 MET B O   1 
ATOM   6181 C  CB  . MET B 1 283 ? 66.672  -6.056  -16.403 1.00 21.75 ? 284 MET B CB  1 
ATOM   6182 C  CG  . MET B 1 283 ? 67.615  -6.363  -17.578 1.00 23.78 ? 284 MET B CG  1 
ATOM   6183 S  SD  . MET B 1 283 ? 68.232  -8.070  -17.531 1.00 29.56 ? 284 MET B SD  1 
ATOM   6184 C  CE  . MET B 1 283 ? 66.711  -9.003  -17.743 1.00 28.54 ? 284 MET B CE  1 
ATOM   6185 N  N   . LEU B 1 284 ? 64.992  -4.336  -14.294 1.00 21.63 ? 285 LEU B N   1 
ATOM   6186 C  CA  . LEU B 1 284 ? 63.882  -4.161  -13.352 1.00 21.86 ? 285 LEU B CA  1 
ATOM   6187 C  C   . LEU B 1 284 ? 63.025  -2.954  -13.706 1.00 21.91 ? 285 LEU B C   1 
ATOM   6188 O  O   . LEU B 1 284 ? 61.800  -3.048  -13.724 1.00 22.37 ? 285 LEU B O   1 
ATOM   6189 C  CB  . LEU B 1 284 ? 64.398  -4.020  -11.921 1.00 21.93 ? 285 LEU B CB  1 
ATOM   6190 C  CG  . LEU B 1 284 ? 64.885  -5.266  -11.175 1.00 22.69 ? 285 LEU B CG  1 
ATOM   6191 C  CD1 . LEU B 1 284 ? 65.504  -4.841  -9.850  1.00 21.80 ? 285 LEU B CD1 1 
ATOM   6192 C  CD2 . LEU B 1 284 ? 63.744  -6.265  -10.958 1.00 22.53 ? 285 LEU B CD2 1 
ATOM   6193 N  N   . ALA B 1 285 ? 63.678  -1.830  -13.992 1.00 22.07 ? 286 ALA B N   1 
ATOM   6194 C  CA  . ALA B 1 285 ? 62.988  -0.599  -14.347 1.00 22.38 ? 286 ALA B CA  1 
ATOM   6195 C  C   . ALA B 1 285 ? 62.265  -0.737  -15.684 1.00 22.72 ? 286 ALA B C   1 
ATOM   6196 O  O   . ALA B 1 285 ? 61.131  -0.276  -15.826 1.00 23.39 ? 286 ALA B O   1 
ATOM   6197 C  CB  . ALA B 1 285 ? 63.955  0.574   -14.378 1.00 22.25 ? 286 ALA B CB  1 
ATOM   6198 N  N   . GLY B 1 286 ? 62.916  -1.372  -16.653 1.00 22.38 ? 287 GLY B N   1 
ATOM   6199 C  CA  . GLY B 1 286 ? 62.302  -1.612  -17.953 1.00 22.65 ? 287 GLY B CA  1 
ATOM   6200 C  C   . GLY B 1 286 ? 61.078  -2.515  -17.895 1.00 22.64 ? 287 GLY B C   1 
ATOM   6201 O  O   . GLY B 1 286 ? 60.171  -2.381  -18.699 1.00 22.19 ? 287 GLY B O   1 
ATOM   6202 N  N   . GLY B 1 287 ? 61.050  -3.423  -16.926 1.00 23.04 ? 288 GLY B N   1 
ATOM   6203 C  CA  . GLY B 1 287 ? 60.018  -4.452  -16.862 1.00 23.55 ? 288 GLY B CA  1 
ATOM   6204 C  C   . GLY B 1 287 ? 58.662  -4.103  -16.262 1.00 23.58 ? 288 GLY B C   1 
ATOM   6205 O  O   . GLY B 1 287 ? 57.786  -4.968  -16.189 1.00 23.93 ? 288 GLY B O   1 
ATOM   6206 N  N   . VAL B 1 288 ? 58.469  -2.858  -15.841 1.00 23.20 ? 289 VAL B N   1 
ATOM   6207 C  CA  . VAL B 1 288 ? 57.251  -2.509  -15.102 1.00 23.35 ? 289 VAL B CA  1 
ATOM   6208 C  C   . VAL B 1 288 ? 56.192  -1.733  -15.926 1.00 23.45 ? 289 VAL B C   1 
ATOM   6209 O  O   . VAL B 1 288 ? 55.073  -2.202  -16.090 1.00 24.20 ? 289 VAL B O   1 
ATOM   6210 C  CB  . VAL B 1 288 ? 57.576  -1.802  -13.743 1.00 23.33 ? 289 VAL B CB  1 
ATOM   6211 C  CG1 . VAL B 1 288 ? 56.300  -1.430  -13.008 1.00 23.15 ? 289 VAL B CG1 1 
ATOM   6212 C  CG2 . VAL B 1 288 ? 58.426  -2.712  -12.861 1.00 23.05 ? 289 VAL B CG2 1 
ATOM   6213 N  N   . ASP B 1 289 ? 56.536  -0.564  -16.447 1.00 23.20 ? 290 ASP B N   1 
ATOM   6214 C  CA  . ASP B 1 289 ? 55.526  0.280   -17.099 1.00 23.34 ? 290 ASP B CA  1 
ATOM   6215 C  C   . ASP B 1 289 ? 55.162  -0.103  -18.552 1.00 22.56 ? 290 ASP B C   1 
ATOM   6216 O  O   . ASP B 1 289 ? 54.123  0.310   -19.064 1.00 23.11 ? 290 ASP B O   1 
ATOM   6217 C  CB  . ASP B 1 289 ? 55.936  1.753   -17.017 1.00 23.66 ? 290 ASP B CB  1 
ATOM   6218 C  CG  . ASP B 1 289 ? 55.654  2.370   -15.651 1.00 25.82 ? 290 ASP B CG  1 
ATOM   6219 O  OD1 . ASP B 1 289 ? 55.295  1.636   -14.695 1.00 28.63 ? 290 ASP B OD1 1 
ATOM   6220 O  OD2 . ASP B 1 289 ? 55.782  3.606   -15.535 1.00 27.50 ? 290 ASP B OD2 1 
ATOM   6221 N  N   . THR B 1 290 ? 55.989  -0.907  -19.205 1.00 21.36 ? 291 THR B N   1 
ATOM   6222 C  CA  . THR B 1 290 ? 55.806  -1.138  -20.631 1.00 20.13 ? 291 THR B CA  1 
ATOM   6223 C  C   . THR B 1 290 ? 54.839  -2.269  -20.974 1.00 19.07 ? 291 THR B C   1 
ATOM   6224 O  O   . THR B 1 290 ? 53.864  -2.054  -21.707 1.00 18.66 ? 291 THR B O   1 
ATOM   6225 C  CB  . THR B 1 290 ? 57.153  -1.288  -21.356 1.00 20.52 ? 291 THR B CB  1 
ATOM   6226 O  OG1 . THR B 1 290 ? 57.966  -2.245  -20.670 1.00 20.79 ? 291 THR B OG1 1 
ATOM   6227 C  CG2 . THR B 1 290 ? 57.862  0.052   -21.379 1.00 20.62 ? 291 THR B CG2 1 
ATOM   6228 N  N   . THR B 1 291 ? 55.106  -3.463  -20.453 1.00 17.71 ? 292 THR B N   1 
ATOM   6229 C  CA  . THR B 1 291 ? 54.230  -4.600  -20.684 1.00 17.28 ? 292 THR B CA  1 
ATOM   6230 C  C   . THR B 1 291 ? 52.823  -4.333  -20.152 1.00 16.95 ? 292 THR B C   1 
ATOM   6231 O  O   . THR B 1 291 ? 51.848  -4.689  -20.806 1.00 16.39 ? 292 THR B O   1 
ATOM   6232 C  CB  . THR B 1 291 ? 54.771  -5.889  -20.042 1.00 17.34 ? 292 THR B CB  1 
ATOM   6233 O  OG1 . THR B 1 291 ? 55.058  -5.638  -18.666 1.00 18.04 ? 292 THR B OG1 1 
ATOM   6234 C  CG2 . THR B 1 291 ? 56.026  -6.353  -20.743 1.00 16.61 ? 292 THR B CG2 1 
ATOM   6235 N  N   . SER B 1 292 ? 52.736  -3.672  -18.993 1.00 16.42 ? 293 SER B N   1 
ATOM   6236 C  CA  . SER B 1 292 ? 51.459  -3.364  -18.351 1.00 17.13 ? 293 SER B CA  1 
ATOM   6237 C  C   . SER B 1 292 ? 50.569  -2.383  -19.147 1.00 17.13 ? 293 SER B C   1 
ATOM   6238 O  O   . SER B 1 292 ? 49.363  -2.605  -19.248 1.00 17.17 ? 293 SER B O   1 
ATOM   6239 C  CB  . SER B 1 292 ? 51.672  -2.882  -16.901 1.00 16.93 ? 293 SER B CB  1 
ATOM   6240 O  OG  . SER B 1 292 ? 52.506  -1.735  -16.857 1.00 19.06 ? 293 SER B OG  1 
ATOM   6241 N  N   . MET B 1 293 ? 51.151  -1.320  -19.708 1.00 17.15 ? 294 MET B N   1 
ATOM   6242 C  CA  . MET B 1 293 ? 50.398  -0.413  -20.596 1.00 17.29 ? 294 MET B CA  1 
ATOM   6243 C  C   . MET B 1 293 ? 49.951  -1.109  -21.880 1.00 16.48 ? 294 MET B C   1 
ATOM   6244 O  O   . MET B 1 293 ? 48.828  -0.917  -22.330 1.00 16.12 ? 294 MET B O   1 
ATOM   6245 C  CB  . MET B 1 293 ? 51.188  0.861   -20.941 1.00 17.74 ? 294 MET B CB  1 
ATOM   6246 C  CG  . MET B 1 293 ? 51.327  1.875   -19.798 1.00 20.74 ? 294 MET B CG  1 
ATOM   6247 S  SD  . MET B 1 293 ? 49.789  2.353   -18.976 1.00 27.00 ? 294 MET B SD  1 
ATOM   6248 C  CE  . MET B 1 293 ? 49.425  0.944   -17.920 1.00 25.39 ? 294 MET B CE  1 
ATOM   6249 N  N   . THR B 1 294 ? 50.835  -1.925  -22.450 1.00 16.11 ? 295 THR B N   1 
ATOM   6250 C  CA  . THR B 1 294 ? 50.538  -2.656  -23.675 1.00 15.73 ? 295 THR B CA  1 
ATOM   6251 C  C   . THR B 1 294 ? 49.425  -3.678  -23.476 1.00 15.46 ? 295 THR B C   1 
ATOM   6252 O  O   . THR B 1 294 ? 48.540  -3.807  -24.320 1.00 15.86 ? 295 THR B O   1 
ATOM   6253 C  CB  . THR B 1 294 ? 51.800  -3.330  -24.237 1.00 15.74 ? 295 THR B CB  1 
ATOM   6254 O  OG1 . THR B 1 294 ? 52.814  -2.335  -24.395 1.00 16.10 ? 295 THR B OG1 1 
ATOM   6255 C  CG2 . THR B 1 294 ? 51.518  -3.972  -25.595 1.00 15.63 ? 295 THR B CG2 1 
ATOM   6256 N  N   . LEU B 1 295 ? 49.461  -4.390  -22.355 1.00 15.07 ? 296 LEU B N   1 
ATOM   6257 C  CA  . LEU B 1 295 ? 48.416  -5.353  -22.025 1.00 14.91 ? 296 LEU B CA  1 
ATOM   6258 C  C   . LEU B 1 295 ? 47.080  -4.670  -21.788 1.00 14.40 ? 296 LEU B C   1 
ATOM   6259 O  O   . LEU B 1 295 ? 46.038  -5.183  -22.191 1.00 13.92 ? 296 LEU B O   1 
ATOM   6260 C  CB  . LEU B 1 295 ? 48.810  -6.182  -20.800 1.00 15.08 ? 296 LEU B CB  1 
ATOM   6261 C  CG  . LEU B 1 295 ? 49.844  -7.257  -21.113 1.00 15.87 ? 296 LEU B CG  1 
ATOM   6262 C  CD1 . LEU B 1 295 ? 50.372  -7.904  -19.834 1.00 14.65 ? 296 LEU B CD1 1 
ATOM   6263 C  CD2 . LEU B 1 295 ? 49.254  -8.294  -22.091 1.00 14.54 ? 296 LEU B CD2 1 
ATOM   6264 N  N   . GLN B 1 296 ? 47.116  -3.505  -21.143 1.00 14.25 ? 297 GLN B N   1 
ATOM   6265 C  CA  . GLN B 1 296 ? 45.899  -2.725  -20.942 1.00 14.07 ? 297 GLN B CA  1 
ATOM   6266 C  C   . GLN B 1 296 ? 45.284  -2.306  -22.286 1.00 13.69 ? 297 GLN B C   1 
ATOM   6267 O  O   . GLN B 1 296 ? 44.062  -2.365  -22.456 1.00 13.92 ? 297 GLN B O   1 
ATOM   6268 C  CB  . GLN B 1 296 ? 46.156  -1.500  -20.061 1.00 14.31 ? 297 GLN B CB  1 
ATOM   6269 C  CG  . GLN B 1 296 ? 44.865  -0.767  -19.667 1.00 14.89 ? 297 GLN B CG  1 
ATOM   6270 C  CD  . GLN B 1 296 ? 45.073  0.338   -18.639 1.00 17.16 ? 297 GLN B CD  1 
ATOM   6271 O  OE1 . GLN B 1 296 ? 44.394  0.379   -17.600 1.00 16.96 ? 297 GLN B OE1 1 
ATOM   6272 N  NE2 . GLN B 1 296 ? 45.994  1.261   -18.936 1.00 16.17 ? 297 GLN B NE2 1 
ATOM   6273 N  N   . TRP B 1 297 ? 46.125  -1.887  -23.229 1.00 12.90 ? 298 TRP B N   1 
ATOM   6274 C  CA  . TRP B 1 297 ? 45.650  -1.511  -24.582 1.00 12.55 ? 298 TRP B CA  1 
ATOM   6275 C  C   . TRP B 1 297 ? 45.098  -2.721  -25.337 1.00 12.56 ? 298 TRP B C   1 
ATOM   6276 O  O   . TRP B 1 297 ? 44.083  -2.623  -26.036 1.00 12.83 ? 298 TRP B O   1 
ATOM   6277 C  CB  . TRP B 1 297 ? 46.778  -0.906  -25.416 1.00 11.80 ? 298 TRP B CB  1 
ATOM   6278 C  CG  . TRP B 1 297 ? 47.099  0.541   -25.169 1.00 11.00 ? 298 TRP B CG  1 
ATOM   6279 C  CD1 . TRP B 1 297 ? 48.308  1.051   -24.825 1.00 10.59 ? 298 TRP B CD1 1 
ATOM   6280 C  CD2 . TRP B 1 297 ? 46.213  1.665   -25.299 1.00 11.78 ? 298 TRP B CD2 1 
ATOM   6281 N  NE1 . TRP B 1 297 ? 48.239  2.416   -24.722 1.00 10.59 ? 298 TRP B NE1 1 
ATOM   6282 C  CE2 . TRP B 1 297 ? 46.960  2.818   -24.997 1.00 10.55 ? 298 TRP B CE2 1 
ATOM   6283 C  CE3 . TRP B 1 297 ? 44.849  1.803   -25.620 1.00 12.18 ? 298 TRP B CE3 1 
ATOM   6284 C  CZ2 . TRP B 1 297 ? 46.405  4.100   -25.019 1.00 11.40 ? 298 TRP B CZ2 1 
ATOM   6285 C  CZ3 . TRP B 1 297 ? 44.295  3.085   -25.629 1.00 11.57 ? 298 TRP B CZ3 1 
ATOM   6286 C  CH2 . TRP B 1 297 ? 45.071  4.208   -25.327 1.00 11.00 ? 298 TRP B CH2 1 
ATOM   6287 N  N   . HIS B 1 298 ? 45.782  -3.854  -25.208 1.00 12.36 ? 299 HIS B N   1 
ATOM   6288 C  CA  . HIS B 1 298 ? 45.324  -5.080  -25.827 1.00 12.69 ? 299 HIS B CA  1 
ATOM   6289 C  C   . HIS B 1 298 ? 43.932  -5.449  -25.308 1.00 12.76 ? 299 HIS B C   1 
ATOM   6290 O  O   . HIS B 1 298 ? 43.014  -5.711  -26.094 1.00 11.65 ? 299 HIS B O   1 
ATOM   6291 C  CB  . HIS B 1 298 ? 46.301  -6.230  -25.592 1.00 12.81 ? 299 HIS B CB  1 
ATOM   6292 C  CG  . HIS B 1 298 ? 45.945  -7.465  -26.353 1.00 13.77 ? 299 HIS B CG  1 
ATOM   6293 N  ND1 . HIS B 1 298 ? 46.688  -7.923  -27.421 1.00 13.73 ? 299 HIS B ND1 1 
ATOM   6294 C  CD2 . HIS B 1 298 ? 44.890  -8.309  -26.236 1.00 13.76 ? 299 HIS B CD2 1 
ATOM   6295 C  CE1 . HIS B 1 298 ? 46.122  -9.013  -27.912 1.00 14.34 ? 299 HIS B CE1 1 
ATOM   6296 N  NE2 . HIS B 1 298 ? 45.026  -9.264  -27.216 1.00 14.87 ? 299 HIS B NE2 1 
ATOM   6297 N  N   . LEU B 1 299 ? 43.778  -5.456  -23.985 1.00 12.76 ? 300 LEU B N   1 
ATOM   6298 C  CA  . LEU B 1 299 ? 42.472  -5.732  -23.397 1.00 13.40 ? 300 LEU B CA  1 
ATOM   6299 C  C   . LEU B 1 299 ? 41.430  -4.762  -23.927 1.00 13.70 ? 300 LEU B C   1 
ATOM   6300 O  O   . LEU B 1 299 ? 40.331  -5.183  -24.295 1.00 14.15 ? 300 LEU B O   1 
ATOM   6301 C  CB  . LEU B 1 299 ? 42.519  -5.719  -21.862 1.00 13.00 ? 300 LEU B CB  1 
ATOM   6302 C  CG  . LEU B 1 299 ? 43.295  -6.890  -21.244 1.00 13.65 ? 300 LEU B CG  1 
ATOM   6303 C  CD1 . LEU B 1 299 ? 43.504  -6.657  -19.759 1.00 13.99 ? 300 LEU B CD1 1 
ATOM   6304 C  CD2 . LEU B 1 299 ? 42.612  -8.249  -21.499 1.00 13.69 ? 300 LEU B CD2 1 
ATOM   6305 N  N   . TYR B 1 300 ? 41.791  -3.479  -23.985 1.00 13.69 ? 301 TYR B N   1 
ATOM   6306 C  CA  . TYR B 1 300 ? 40.931  -2.432  -24.543 1.00 14.16 ? 301 TYR B CA  1 
ATOM   6307 C  C   . TYR B 1 300 ? 40.509  -2.708  -25.994 1.00 14.57 ? 301 TYR B C   1 
ATOM   6308 O  O   . TYR B 1 300 ? 39.326  -2.593  -26.334 1.00 14.71 ? 301 TYR B O   1 
ATOM   6309 C  CB  . TYR B 1 300 ? 41.626  -1.072  -24.409 1.00 14.04 ? 301 TYR B CB  1 
ATOM   6310 C  CG  . TYR B 1 300 ? 40.942  0.109   -25.072 1.00 14.48 ? 301 TYR B CG  1 
ATOM   6311 C  CD1 . TYR B 1 300 ? 39.901  0.789   -24.438 1.00 17.12 ? 301 TYR B CD1 1 
ATOM   6312 C  CD2 . TYR B 1 300 ? 41.372  0.575   -26.305 1.00 15.01 ? 301 TYR B CD2 1 
ATOM   6313 C  CE1 . TYR B 1 300 ? 39.290  1.894   -25.036 1.00 18.00 ? 301 TYR B CE1 1 
ATOM   6314 C  CE2 . TYR B 1 300 ? 40.775  1.674   -26.911 1.00 17.27 ? 301 TYR B CE2 1 
ATOM   6315 C  CZ  . TYR B 1 300 ? 39.736  2.322   -26.278 1.00 18.98 ? 301 TYR B CZ  1 
ATOM   6316 O  OH  . TYR B 1 300 ? 39.149  3.408   -26.891 1.00 22.26 ? 301 TYR B OH  1 
ATOM   6317 N  N   . GLU B 1 301 ? 41.466  -3.081  -26.839 1.00 15.13 ? 302 GLU B N   1 
ATOM   6318 C  CA  . GLU B 1 301 ? 41.162  -3.418  -28.234 1.00 16.22 ? 302 GLU B CA  1 
ATOM   6319 C  C   . GLU B 1 301 ? 40.270  -4.661  -28.350 1.00 16.58 ? 302 GLU B C   1 
ATOM   6320 O  O   . GLU B 1 301 ? 39.410  -4.721  -29.215 1.00 17.05 ? 302 GLU B O   1 
ATOM   6321 C  CB  . GLU B 1 301 ? 42.443  -3.579  -29.069 1.00 16.10 ? 302 GLU B CB  1 
ATOM   6322 C  CG  . GLU B 1 301 ? 43.273  -2.288  -29.196 1.00 17.91 ? 302 GLU B CG  1 
ATOM   6323 C  CD  . GLU B 1 301 ? 42.521  -1.160  -29.895 1.00 20.86 ? 302 GLU B CD  1 
ATOM   6324 O  OE1 . GLU B 1 301 ? 43.011  -0.011  -29.899 1.00 23.35 ? 302 GLU B OE1 1 
ATOM   6325 O  OE2 . GLU B 1 301 ? 41.432  -1.416  -30.440 1.00 22.24 ? 302 GLU B OE2 1 
ATOM   6326 N  N   . MET B 1 302 ? 40.443  -5.628  -27.458 1.00 16.82 ? 303 MET B N   1 
ATOM   6327 C  CA  . MET B 1 302 ? 39.581  -6.815  -27.465 1.00 17.56 ? 303 MET B CA  1 
ATOM   6328 C  C   . MET B 1 302 ? 38.142  -6.515  -27.040 1.00 17.96 ? 303 MET B C   1 
ATOM   6329 O  O   . MET B 1 302 ? 37.206  -7.108  -27.570 1.00 17.73 ? 303 MET B O   1 
ATOM   6330 C  CB  . MET B 1 302 ? 40.165  -7.923  -26.595 1.00 17.43 ? 303 MET B CB  1 
ATOM   6331 C  CG  . MET B 1 302 ? 41.379  -8.596  -27.199 1.00 18.47 ? 303 MET B CG  1 
ATOM   6332 S  SD  . MET B 1 302 ? 41.593  -10.262 -26.544 1.00 23.12 ? 303 MET B SD  1 
ATOM   6333 C  CE  . MET B 1 302 ? 42.087  -9.907  -24.853 1.00 20.61 ? 303 MET B CE  1 
ATOM   6334 N  N   . ALA B 1 303 ? 37.973  -5.608  -26.081 1.00 18.58 ? 304 ALA B N   1 
ATOM   6335 C  CA  . ALA B 1 303 ? 36.638  -5.190  -25.644 1.00 19.75 ? 304 ALA B CA  1 
ATOM   6336 C  C   . ALA B 1 303 ? 35.931  -4.334  -26.694 1.00 20.49 ? 304 ALA B C   1 
ATOM   6337 O  O   . ALA B 1 303 ? 34.700  -4.340  -26.772 1.00 20.67 ? 304 ALA B O   1 
ATOM   6338 C  CB  . ALA B 1 303 ? 36.710  -4.444  -24.307 1.00 19.50 ? 304 ALA B CB  1 
ATOM   6339 N  N   . ARG B 1 304 ? 36.716  -3.584  -27.470 1.00 21.76 ? 305 ARG B N   1 
ATOM   6340 C  CA  . ARG B 1 304 ? 36.208  -2.733  -28.557 1.00 23.10 ? 305 ARG B CA  1 
ATOM   6341 C  C   . ARG B 1 304 ? 35.835  -3.556  -29.782 1.00 23.29 ? 305 ARG B C   1 
ATOM   6342 O  O   . ARG B 1 304 ? 35.003  -3.141  -30.582 1.00 23.64 ? 305 ARG B O   1 
ATOM   6343 C  CB  . ARG B 1 304 ? 37.278  -1.729  -28.999 1.00 23.52 ? 305 ARG B CB  1 
ATOM   6344 C  CG  . ARG B 1 304 ? 37.237  -0.365  -28.340 1.00 26.20 ? 305 ARG B CG  1 
ATOM   6345 C  CD  . ARG B 1 304 ? 38.343  0.539   -28.915 1.00 30.35 ? 305 ARG B CD  1 
ATOM   6346 N  NE  . ARG B 1 304 ? 38.005  1.145   -30.211 1.00 33.04 ? 305 ARG B NE  1 
ATOM   6347 C  CZ  . ARG B 1 304 ? 38.593  0.853   -31.376 1.00 35.64 ? 305 ARG B CZ  1 
ATOM   6348 N  NH1 . ARG B 1 304 ? 39.569  -0.042  -31.444 1.00 36.12 ? 305 ARG B NH1 1 
ATOM   6349 N  NH2 . ARG B 1 304 ? 38.206  1.464   -32.492 1.00 36.63 ? 305 ARG B NH2 1 
ATOM   6350 N  N   . ASN B 1 305 ? 36.485  -4.707  -29.930 1.00 23.52 ? 306 ASN B N   1 
ATOM   6351 C  CA  . ASN B 1 305 ? 36.372  -5.530  -31.117 1.00 23.78 ? 306 ASN B CA  1 
ATOM   6352 C  C   . ASN B 1 305 ? 36.014  -6.970  -30.724 1.00 23.43 ? 306 ASN B C   1 
ATOM   6353 O  O   . ASN B 1 305 ? 36.860  -7.861  -30.748 1.00 23.25 ? 306 ASN B O   1 
ATOM   6354 C  CB  . ASN B 1 305 ? 37.685  -5.465  -31.917 1.00 23.88 ? 306 ASN B CB  1 
ATOM   6355 C  CG  . ASN B 1 305 ? 38.058  -4.033  -32.337 1.00 26.18 ? 306 ASN B CG  1 
ATOM   6356 O  OD1 . ASN B 1 305 ? 37.610  -3.557  -33.382 1.00 30.21 ? 306 ASN B OD1 1 
ATOM   6357 N  ND2 . ASN B 1 305 ? 38.891  -3.351  -31.532 1.00 24.00 ? 306 ASN B ND2 1 
ATOM   6358 N  N   . LEU B 1 306 ? 34.755  -7.187  -30.349 1.00 23.61 ? 307 LEU B N   1 
ATOM   6359 C  CA  . LEU B 1 306 ? 34.319  -8.485  -29.794 1.00 23.97 ? 307 LEU B CA  1 
ATOM   6360 C  C   . LEU B 1 306 ? 34.484  -9.701  -30.722 1.00 23.83 ? 307 LEU B C   1 
ATOM   6361 O  O   . LEU B 1 306 ? 34.711  -10.811 -30.238 1.00 23.74 ? 307 LEU B O   1 
ATOM   6362 C  CB  . LEU B 1 306 ? 32.883  -8.410  -29.257 1.00 24.03 ? 307 LEU B CB  1 
ATOM   6363 C  CG  . LEU B 1 306 ? 32.628  -7.424  -28.107 1.00 24.71 ? 307 LEU B CG  1 
ATOM   6364 C  CD1 . LEU B 1 306 ? 31.132  -7.244  -27.851 1.00 24.71 ? 307 LEU B CD1 1 
ATOM   6365 C  CD2 . LEU B 1 306 ? 33.358  -7.816  -26.825 1.00 24.67 ? 307 LEU B CD2 1 
ATOM   6366 N  N   . LYS B 1 307 ? 34.372  -9.493  -32.036 1.00 23.82 ? 308 LYS B N   1 
ATOM   6367 C  CA  . LYS B 1 307 ? 34.596  -10.559 -33.024 1.00 24.10 ? 308 LYS B CA  1 
ATOM   6368 C  C   . LYS B 1 307 ? 36.044  -11.032 -32.982 1.00 23.35 ? 308 LYS B C   1 
ATOM   6369 O  O   . LYS B 1 307 ? 36.318  -12.237 -32.980 1.00 22.94 ? 308 LYS B O   1 
ATOM   6370 C  CB  . LYS B 1 307 ? 34.251  -10.081 -34.443 1.00 25.00 ? 308 LYS B CB  1 
ATOM   6371 C  CG  . LYS B 1 307 ? 32.848  -10.451 -34.961 1.00 27.91 ? 308 LYS B CG  1 
ATOM   6372 C  CD  . LYS B 1 307 ? 31.727  -9.758  -34.185 1.00 32.01 ? 308 LYS B CD  1 
ATOM   6373 C  CE  . LYS B 1 307 ? 30.444  -9.645  -35.012 1.00 34.17 ? 308 LYS B CE  1 
ATOM   6374 N  NZ  . LYS B 1 307 ? 30.581  -8.625  -36.096 1.00 36.95 ? 308 LYS B NZ  1 
ATOM   6375 N  N   . VAL B 1 308 ? 36.968  -10.073 -32.944 1.00 22.69 ? 309 VAL B N   1 
ATOM   6376 C  CA  . VAL B 1 308 ? 38.387  -10.384 -32.782 1.00 22.08 ? 309 VAL B CA  1 
ATOM   6377 C  C   . VAL B 1 308 ? 38.620  -11.096 -31.439 1.00 21.43 ? 309 VAL B C   1 
ATOM   6378 O  O   . VAL B 1 308 ? 39.357  -12.076 -31.380 1.00 21.13 ? 309 VAL B O   1 
ATOM   6379 C  CB  . VAL B 1 308 ? 39.286  -9.124  -32.947 1.00 22.18 ? 309 VAL B CB  1 
ATOM   6380 C  CG1 . VAL B 1 308 ? 40.740  -9.424  -32.579 1.00 21.34 ? 309 VAL B CG1 1 
ATOM   6381 C  CG2 . VAL B 1 308 ? 39.202  -8.605  -34.376 1.00 22.51 ? 309 VAL B CG2 1 
ATOM   6382 N  N   . GLN B 1 309 ? 37.972  -10.625 -30.377 1.00 21.09 ? 310 GLN B N   1 
ATOM   6383 C  CA  . GLN B 1 309 ? 38.115  -11.271 -29.071 1.00 21.24 ? 310 GLN B CA  1 
ATOM   6384 C  C   . GLN B 1 309 ? 37.706  -12.755 -29.130 1.00 21.78 ? 310 GLN B C   1 
ATOM   6385 O  O   . GLN B 1 309 ? 38.428  -13.612 -28.615 1.00 22.03 ? 310 GLN B O   1 
ATOM   6386 C  CB  . GLN B 1 309 ? 37.353  -10.516 -27.969 1.00 20.51 ? 310 GLN B CB  1 
ATOM   6387 C  CG  . GLN B 1 309 ? 37.659  -11.035 -26.553 1.00 18.94 ? 310 GLN B CG  1 
ATOM   6388 C  CD  . GLN B 1 309 ? 36.886  -10.318 -25.463 1.00 19.10 ? 310 GLN B CD  1 
ATOM   6389 O  OE1 . GLN B 1 309 ? 36.481  -9.157  -25.614 1.00 20.07 ? 310 GLN B OE1 1 
ATOM   6390 N  NE2 . GLN B 1 309 ? 36.685  -11.000 -24.348 1.00 17.44 ? 310 GLN B NE2 1 
ATOM   6391 N  N   . ASP B 1 310 ? 36.567  -13.044 -29.770 1.00 22.22 ? 311 ASP B N   1 
ATOM   6392 C  CA  . ASP B 1 310 ? 36.103  -14.429 -30.007 1.00 23.04 ? 311 ASP B CA  1 
ATOM   6393 C  C   . ASP B 1 310 ? 37.097  -15.284 -30.798 1.00 23.00 ? 311 ASP B C   1 
ATOM   6394 O  O   . ASP B 1 310 ? 37.344  -16.449 -30.454 1.00 22.88 ? 311 ASP B O   1 
ATOM   6395 C  CB  . ASP B 1 310 ? 34.756  -14.442 -30.745 1.00 23.31 ? 311 ASP B CB  1 
ATOM   6396 C  CG  . ASP B 1 310 ? 33.609  -13.917 -29.898 1.00 24.91 ? 311 ASP B CG  1 
ATOM   6397 O  OD1 . ASP B 1 310 ? 33.599  -14.157 -28.666 1.00 26.51 ? 311 ASP B OD1 1 
ATOM   6398 O  OD2 . ASP B 1 310 ? 32.700  -13.270 -30.478 1.00 26.92 ? 311 ASP B OD2 1 
ATOM   6399 N  N   . MET B 1 311 ? 37.652  -14.710 -31.863 1.00 23.19 ? 312 MET B N   1 
ATOM   6400 C  CA  . MET B 1 311 ? 38.636  -15.410 -32.687 1.00 23.17 ? 312 MET B CA  1 
ATOM   6401 C  C   . MET B 1 311 ? 39.877  -15.777 -31.885 1.00 22.41 ? 312 MET B C   1 
ATOM   6402 O  O   . MET B 1 311 ? 40.371  -16.898 -31.988 1.00 22.52 ? 312 MET B O   1 
ATOM   6403 C  CB  . MET B 1 311 ? 39.034  -14.567 -33.896 1.00 23.76 ? 312 MET B CB  1 
ATOM   6404 C  CG  . MET B 1 311 ? 38.110  -14.687 -35.096 1.00 26.86 ? 312 MET B CG  1 
ATOM   6405 S  SD  . MET B 1 311 ? 38.561  -13.472 -36.366 1.00 34.80 ? 312 MET B SD  1 
ATOM   6406 C  CE  . MET B 1 311 ? 40.062  -14.192 -37.062 1.00 31.67 ? 312 MET B CE  1 
ATOM   6407 N  N   . LEU B 1 312 ? 40.381  -14.838 -31.083 1.00 21.45 ? 313 LEU B N   1 
ATOM   6408 C  CA  . LEU B 1 312 ? 41.560  -15.113 -30.269 1.00 20.70 ? 313 LEU B CA  1 
ATOM   6409 C  C   . LEU B 1 312 ? 41.292  -16.193 -29.216 1.00 20.27 ? 313 LEU B C   1 
ATOM   6410 O  O   . LEU B 1 312 ? 42.140  -17.053 -28.982 1.00 20.11 ? 313 LEU B O   1 
ATOM   6411 C  CB  . LEU B 1 312 ? 42.115  -13.834 -29.628 1.00 20.43 ? 313 LEU B CB  1 
ATOM   6412 C  CG  . LEU B 1 312 ? 42.595  -12.720 -30.580 1.00 20.79 ? 313 LEU B CG  1 
ATOM   6413 C  CD1 . LEU B 1 312 ? 42.820  -11.407 -29.835 1.00 20.01 ? 313 LEU B CD1 1 
ATOM   6414 C  CD2 . LEU B 1 312 ? 43.857  -13.116 -31.348 1.00 19.74 ? 313 LEU B CD2 1 
ATOM   6415 N  N   . ARG B 1 313 ? 40.120  -16.150 -28.585 1.00 19.83 ? 314 ARG B N   1 
ATOM   6416 C  CA  . ARG B 1 313 ? 39.777  -17.144 -27.569 1.00 20.05 ? 314 ARG B CA  1 
ATOM   6417 C  C   . ARG B 1 313 ? 39.673  -18.545 -28.193 1.00 20.03 ? 314 ARG B C   1 
ATOM   6418 O  O   . ARG B 1 313 ? 40.225  -19.500 -27.649 1.00 19.43 ? 314 ARG B O   1 
ATOM   6419 C  CB  . ARG B 1 313 ? 38.490  -16.765 -26.818 1.00 19.91 ? 314 ARG B CB  1 
ATOM   6420 C  CG  . ARG B 1 313 ? 38.060  -17.757 -25.738 1.00 19.33 ? 314 ARG B CG  1 
ATOM   6421 C  CD  . ARG B 1 313 ? 36.856  -17.251 -24.943 1.00 20.21 ? 314 ARG B CD  1 
ATOM   6422 N  NE  . ARG B 1 313 ? 37.197  -16.034 -24.203 1.00 21.90 ? 314 ARG B NE  1 
ATOM   6423 C  CZ  . ARG B 1 313 ? 36.770  -14.808 -24.513 1.00 21.45 ? 314 ARG B CZ  1 
ATOM   6424 N  NH1 . ARG B 1 313 ? 35.928  -14.609 -25.523 1.00 18.78 ? 314 ARG B NH1 1 
ATOM   6425 N  NH2 . ARG B 1 313 ? 37.177  -13.778 -23.787 1.00 21.18 ? 314 ARG B NH2 1 
ATOM   6426 N  N   . ALA B 1 314 ? 38.990  -18.645 -29.338 1.00 20.49 ? 315 ALA B N   1 
ATOM   6427 C  CA  . ALA B 1 314 ? 38.863  -19.917 -30.077 1.00 21.18 ? 315 ALA B CA  1 
ATOM   6428 C  C   . ALA B 1 314 ? 40.225  -20.492 -30.467 1.00 21.78 ? 315 ALA B C   1 
ATOM   6429 O  O   . ALA B 1 314 ? 40.432  -21.707 -30.397 1.00 22.09 ? 315 ALA B O   1 
ATOM   6430 C  CB  . ALA B 1 314 ? 37.962  -19.754 -31.324 1.00 20.66 ? 315 ALA B CB  1 
ATOM   6431 N  N   . GLU B 1 315 ? 41.161  -19.628 -30.857 1.00 22.22 ? 316 GLU B N   1 
ATOM   6432 C  CA  . GLU B 1 315 ? 42.512  -20.097 -31.194 1.00 22.82 ? 316 GLU B CA  1 
ATOM   6433 C  C   . GLU B 1 315 ? 43.279  -20.606 -29.966 1.00 22.55 ? 316 GLU B C   1 
ATOM   6434 O  O   . GLU B 1 315 ? 43.986  -21.612 -30.048 1.00 22.74 ? 316 GLU B O   1 
ATOM   6435 C  CB  . GLU B 1 315 ? 43.321  -19.012 -31.913 1.00 23.20 ? 316 GLU B CB  1 
ATOM   6436 C  CG  . GLU B 1 315 ? 44.625  -19.534 -32.513 1.00 25.55 ? 316 GLU B CG  1 
ATOM   6437 C  CD  . GLU B 1 315 ? 45.595  -18.429 -32.913 1.00 29.74 ? 316 GLU B CD  1 
ATOM   6438 O  OE1 . GLU B 1 315 ? 45.858  -17.523 -32.083 1.00 32.16 ? 316 GLU B OE1 1 
ATOM   6439 O  OE2 . GLU B 1 315 ? 46.115  -18.478 -34.050 1.00 30.31 ? 316 GLU B OE2 1 
ATOM   6440 N  N   . VAL B 1 316 ? 43.134  -19.907 -28.839 1.00 22.13 ? 317 VAL B N   1 
ATOM   6441 C  CA  . VAL B 1 316 ? 43.795  -20.282 -27.587 1.00 21.71 ? 317 VAL B CA  1 
ATOM   6442 C  C   . VAL B 1 316 ? 43.246  -21.614 -27.043 1.00 21.77 ? 317 VAL B C   1 
ATOM   6443 O  O   . VAL B 1 316 ? 44.021  -22.491 -26.643 1.00 21.33 ? 317 VAL B O   1 
ATOM   6444 C  CB  . VAL B 1 316 ? 43.699  -19.144 -26.526 1.00 21.80 ? 317 VAL B CB  1 
ATOM   6445 C  CG1 . VAL B 1 316 ? 44.070  -19.637 -25.151 1.00 21.13 ? 317 VAL B CG1 1 
ATOM   6446 C  CG2 . VAL B 1 316 ? 44.595  -17.947 -26.916 1.00 21.97 ? 317 VAL B CG2 1 
ATOM   6447 N  N   . LEU B 1 317 ? 41.922  -21.763 -27.046 1.00 21.94 ? 318 LEU B N   1 
ATOM   6448 C  CA  . LEU B 1 317 ? 41.276  -23.019 -26.641 1.00 22.30 ? 318 LEU B CA  1 
ATOM   6449 C  C   . LEU B 1 317 ? 41.719  -24.200 -27.510 1.00 22.52 ? 318 LEU B C   1 
ATOM   6450 O  O   . LEU B 1 317 ? 42.000  -25.279 -26.989 1.00 22.74 ? 318 LEU B O   1 
ATOM   6451 C  CB  . LEU B 1 317 ? 39.749  -22.888 -26.659 1.00 22.30 ? 318 LEU B CB  1 
ATOM   6452 C  CG  . LEU B 1 317 ? 39.033  -21.939 -25.685 1.00 23.39 ? 318 LEU B CG  1 
ATOM   6453 C  CD1 . LEU B 1 317 ? 37.512  -21.989 -25.912 1.00 23.43 ? 318 LEU B CD1 1 
ATOM   6454 C  CD2 . LEU B 1 317 ? 39.363  -22.240 -24.220 1.00 22.08 ? 318 LEU B CD2 1 
ATOM   6455 N  N   . ALA B 1 318 ? 41.796  -23.990 -28.824 1.00 22.88 ? 319 ALA B N   1 
ATOM   6456 C  CA  . ALA B 1 318 ? 42.282  -25.020 -29.747 1.00 23.40 ? 319 ALA B CA  1 
ATOM   6457 C  C   . ALA B 1 318 ? 43.724  -25.382 -29.438 1.00 23.76 ? 319 ALA B C   1 
ATOM   6458 O  O   . ALA B 1 318 ? 44.066  -26.562 -29.378 1.00 23.88 ? 319 ALA B O   1 
ATOM   6459 C  CB  . ALA B 1 318 ? 42.152  -24.560 -31.206 1.00 23.26 ? 319 ALA B CB  1 
ATOM   6460 N  N   . ALA B 1 319 ? 44.561  -24.363 -29.230 1.00 24.31 ? 320 ALA B N   1 
ATOM   6461 C  CA  . ALA B 1 319 ? 45.978  -24.576 -28.955 1.00 25.01 ? 320 ALA B CA  1 
ATOM   6462 C  C   . ALA B 1 319 ? 46.198  -25.341 -27.652 1.00 25.50 ? 320 ALA B C   1 
ATOM   6463 O  O   . ALA B 1 319 ? 47.042  -26.230 -27.600 1.00 25.59 ? 320 ALA B O   1 
ATOM   6464 C  CB  . ALA B 1 319 ? 46.741  -23.249 -28.936 1.00 25.07 ? 320 ALA B CB  1 
ATOM   6465 N  N   . ARG B 1 320 ? 45.450  -24.992 -26.608 1.00 26.19 ? 321 ARG B N   1 
ATOM   6466 C  CA  . ARG B 1 320 ? 45.582  -25.671 -25.318 1.00 27.41 ? 321 ARG B CA  1 
ATOM   6467 C  C   . ARG B 1 320 ? 45.292  -27.170 -25.454 1.00 28.14 ? 321 ARG B C   1 
ATOM   6468 O  O   . ARG B 1 320 ? 46.070  -28.000 -24.976 1.00 28.45 ? 321 ARG B O   1 
ATOM   6469 C  CB  . ARG B 1 320 ? 44.683  -25.031 -24.247 1.00 26.84 ? 321 ARG B CB  1 
ATOM   6470 C  CG  . ARG B 1 320 ? 44.805  -25.671 -22.853 1.00 26.73 ? 321 ARG B CG  1 
ATOM   6471 C  CD  . ARG B 1 320 ? 46.144  -25.357 -22.169 1.00 27.67 ? 321 ARG B CD  1 
ATOM   6472 N  NE  . ARG B 1 320 ? 46.157  -24.031 -21.542 1.00 27.61 ? 321 ARG B NE  1 
ATOM   6473 C  CZ  . ARG B 1 320 ? 47.092  -23.597 -20.696 1.00 26.82 ? 321 ARG B CZ  1 
ATOM   6474 N  NH1 . ARG B 1 320 ? 48.117  -24.378 -20.371 1.00 25.75 ? 321 ARG B NH1 1 
ATOM   6475 N  NH2 . ARG B 1 320 ? 46.994  -22.379 -20.165 1.00 23.85 ? 321 ARG B NH2 1 
ATOM   6476 N  N   . HIS B 1 321 ? 44.187  -27.496 -26.126 1.00 29.13 ? 322 HIS B N   1 
ATOM   6477 C  CA  . HIS B 1 321 ? 43.797  -28.886 -26.389 1.00 30.26 ? 322 HIS B CA  1 
ATOM   6478 C  C   . HIS B 1 321 ? 44.821  -29.637 -27.254 1.00 30.65 ? 322 HIS B C   1 
ATOM   6479 O  O   . HIS B 1 321 ? 45.191  -30.772 -26.937 1.00 30.70 ? 322 HIS B O   1 
ATOM   6480 C  CB  . HIS B 1 321 ? 42.393  -28.938 -27.013 1.00 30.52 ? 322 HIS B CB  1 
ATOM   6481 C  CG  . HIS B 1 321 ? 41.987  -30.300 -27.493 1.00 31.85 ? 322 HIS B CG  1 
ATOM   6482 N  ND1 . HIS B 1 321 ? 41.591  -31.306 -26.635 1.00 33.28 ? 322 HIS B ND1 1 
ATOM   6483 C  CD2 . HIS B 1 321 ? 41.909  -30.819 -28.741 1.00 32.52 ? 322 HIS B CD2 1 
ATOM   6484 C  CE1 . HIS B 1 321 ? 41.295  -32.387 -27.335 1.00 33.71 ? 322 HIS B CE1 1 
ATOM   6485 N  NE2 . HIS B 1 321 ? 41.476  -32.117 -28.616 1.00 33.83 ? 322 HIS B NE2 1 
ATOM   6486 N  N   . GLN B 1 322 ? 45.277  -29.004 -28.334 1.00 31.22 ? 323 GLN B N   1 
ATOM   6487 C  CA  . GLN B 1 322 ? 46.247  -29.624 -29.246 1.00 32.01 ? 323 GLN B CA  1 
ATOM   6488 C  C   . GLN B 1 322 ? 47.585  -29.907 -28.565 1.00 32.16 ? 323 GLN B C   1 
ATOM   6489 O  O   . GLN B 1 322 ? 48.219  -30.930 -28.835 1.00 32.21 ? 323 GLN B O   1 
ATOM   6490 C  CB  . GLN B 1 322 ? 46.449  -28.759 -30.502 1.00 32.37 ? 323 GLN B CB  1 
ATOM   6491 C  CG  . GLN B 1 322 ? 45.687  -29.227 -31.749 1.00 34.54 ? 323 GLN B CG  1 
ATOM   6492 C  CD  . GLN B 1 322 ? 44.215  -29.557 -31.485 1.00 37.79 ? 323 GLN B CD  1 
ATOM   6493 O  OE1 . GLN B 1 322 ? 43.376  -28.660 -31.311 1.00 38.79 ? 323 GLN B OE1 1 
ATOM   6494 N  NE2 . GLN B 1 322 ? 43.898  -30.851 -31.464 1.00 37.73 ? 323 GLN B NE2 1 
ATOM   6495 N  N   . ALA B 1 323 ? 47.996  -29.003 -27.675 1.00 32.26 ? 324 ALA B N   1 
ATOM   6496 C  CA  . ALA B 1 323 ? 49.256  -29.126 -26.938 1.00 32.32 ? 324 ALA B CA  1 
ATOM   6497 C  C   . ALA B 1 323 ? 49.128  -30.040 -25.722 1.00 32.53 ? 324 ALA B C   1 
ATOM   6498 O  O   . ALA B 1 323 ? 50.126  -30.339 -25.053 1.00 32.22 ? 324 ALA B O   1 
ATOM   6499 C  CB  . ALA B 1 323 ? 49.751  -27.742 -26.509 1.00 32.41 ? 324 ALA B CB  1 
ATOM   6500 N  N   . GLN B 1 324 ? 47.895  -30.479 -25.449 1.00 32.83 ? 325 GLN B N   1 
ATOM   6501 C  CA  . GLN B 1 324 ? 47.550  -31.267 -24.258 1.00 33.16 ? 325 GLN B CA  1 
ATOM   6502 C  C   . GLN B 1 324 ? 48.021  -30.585 -22.974 1.00 32.94 ? 325 GLN B C   1 
ATOM   6503 O  O   . GLN B 1 324 ? 48.600  -31.220 -22.098 1.00 33.11 ? 325 GLN B O   1 
ATOM   6504 C  CB  . GLN B 1 324 ? 48.078  -32.713 -24.357 1.00 33.58 ? 325 GLN B CB  1 
ATOM   6505 C  CG  . GLN B 1 324 ? 47.400  -33.562 -25.442 1.00 35.04 ? 325 GLN B CG  1 
ATOM   6506 C  CD  . GLN B 1 324 ? 47.973  -34.974 -25.537 1.00 37.39 ? 325 GLN B CD  1 
ATOM   6507 O  OE1 . GLN B 1 324 ? 47.807  -35.793 -24.626 1.00 37.89 ? 325 GLN B OE1 1 
ATOM   6508 N  NE2 . GLN B 1 324 ? 48.641  -35.268 -26.653 1.00 37.61 ? 325 GLN B NE2 1 
ATOM   6509 N  N   . GLY B 1 325 ? 47.778  -29.279 -22.879 1.00 32.77 ? 326 GLY B N   1 
ATOM   6510 C  CA  . GLY B 1 325 ? 48.118  -28.515 -21.679 1.00 32.39 ? 326 GLY B CA  1 
ATOM   6511 C  C   . GLY B 1 325 ? 49.493  -27.865 -21.639 1.00 32.19 ? 326 GLY B C   1 
ATOM   6512 O  O   . GLY B 1 325 ? 49.686  -26.894 -20.902 1.00 32.54 ? 326 GLY B O   1 
ATOM   6513 N  N   . ASP B 1 326 ? 50.445  -28.380 -22.425 1.00 31.61 ? 327 ASP B N   1 
ATOM   6514 C  CA  . ASP B 1 326 ? 51.847  -27.906 -22.384 1.00 31.10 ? 327 ASP B CA  1 
ATOM   6515 C  C   . ASP B 1 326 ? 52.032  -26.467 -22.900 1.00 30.22 ? 327 ASP B C   1 
ATOM   6516 O  O   . ASP B 1 326 ? 51.725  -26.174 -24.055 1.00 29.99 ? 327 ASP B O   1 
ATOM   6517 C  CB  . ASP B 1 326 ? 52.773  -28.856 -23.162 1.00 31.09 ? 327 ASP B CB  1 
ATOM   6518 C  CG  . ASP B 1 326 ? 54.249  -28.495 -23.007 1.00 32.46 ? 327 ASP B CG  1 
ATOM   6519 O  OD1 . ASP B 1 326 ? 54.707  -28.354 -21.850 1.00 34.22 ? 327 ASP B OD1 1 
ATOM   6520 O  OD2 . ASP B 1 326 ? 54.954  -28.351 -24.033 1.00 32.86 ? 327 ASP B OD2 1 
ATOM   6521 N  N   . MET B 1 327 ? 52.558  -25.588 -22.048 1.00 29.39 ? 328 MET B N   1 
ATOM   6522 C  CA  . MET B 1 327 ? 52.732  -24.172 -22.406 1.00 28.58 ? 328 MET B CA  1 
ATOM   6523 C  C   . MET B 1 327 ? 53.734  -23.963 -23.549 1.00 28.03 ? 328 MET B C   1 
ATOM   6524 O  O   . MET B 1 327 ? 53.466  -23.194 -24.469 1.00 27.97 ? 328 MET B O   1 
ATOM   6525 C  CB  . MET B 1 327 ? 53.098  -23.321 -21.178 1.00 28.52 ? 328 MET B CB  1 
ATOM   6526 C  CG  . MET B 1 327 ? 53.133  -21.800 -21.433 1.00 28.25 ? 328 MET B CG  1 
ATOM   6527 S  SD  . MET B 1 327 ? 51.631  -21.100 -22.178 1.00 28.29 ? 328 MET B SD  1 
ATOM   6528 C  CE  . MET B 1 327 ? 50.505  -21.093 -20.780 1.00 28.27 ? 328 MET B CE  1 
ATOM   6529 N  N   . ALA B 1 328 ? 54.869  -24.658 -23.500 1.00 27.28 ? 329 ALA B N   1 
ATOM   6530 C  CA  . ALA B 1 328 ? 55.875  -24.568 -24.563 1.00 26.96 ? 329 ALA B CA  1 
ATOM   6531 C  C   . ALA B 1 328 ? 55.308  -24.901 -25.944 1.00 26.69 ? 329 ALA B C   1 
ATOM   6532 O  O   . ALA B 1 328 ? 55.510  -24.161 -26.904 1.00 26.61 ? 329 ALA B O   1 
ATOM   6533 C  CB  . ALA B 1 328 ? 57.071  -25.462 -24.242 1.00 27.06 ? 329 ALA B CB  1 
ATOM   6534 N  N   . THR B 1 329 ? 54.586  -26.014 -26.028 1.00 26.66 ? 330 THR B N   1 
ATOM   6535 C  CA  . THR B 1 329 ? 53.969  -26.454 -27.277 1.00 26.51 ? 330 THR B CA  1 
ATOM   6536 C  C   . THR B 1 329 ? 52.913  -25.450 -27.755 1.00 26.14 ? 330 THR B C   1 
ATOM   6537 O  O   . THR B 1 329 ? 52.853  -25.106 -28.934 1.00 25.88 ? 330 THR B O   1 
ATOM   6538 C  CB  . THR B 1 329 ? 53.352  -27.864 -27.109 1.00 26.50 ? 330 THR B CB  1 
ATOM   6539 O  OG1 . THR B 1 329 ? 54.336  -28.753 -26.554 1.00 27.62 ? 330 THR B OG1 1 
ATOM   6540 C  CG2 . THR B 1 329 ? 52.860  -28.414 -28.448 1.00 26.59 ? 330 THR B CG2 1 
ATOM   6541 N  N   . MET B 1 330 ? 52.111  -24.976 -26.813 1.00 26.00 ? 331 MET B N   1 
ATOM   6542 C  CA  . MET B 1 330 ? 51.008  -24.061 -27.060 1.00 26.52 ? 331 MET B CA  1 
ATOM   6543 C  C   . MET B 1 330 ? 51.441  -22.744 -27.703 1.00 26.49 ? 331 MET B C   1 
ATOM   6544 O  O   . MET B 1 330 ? 50.722  -22.187 -28.529 1.00 26.11 ? 331 MET B O   1 
ATOM   6545 C  CB  . MET B 1 330 ? 50.344  -23.750 -25.729 1.00 26.54 ? 331 MET B CB  1 
ATOM   6546 C  CG  . MET B 1 330 ? 48.867  -23.634 -25.800 1.00 28.72 ? 331 MET B CG  1 
ATOM   6547 S  SD  . MET B 1 330 ? 48.224  -23.168 -24.192 1.00 31.29 ? 331 MET B SD  1 
ATOM   6548 C  CE  . MET B 1 330 ? 46.834  -22.180 -24.742 1.00 29.82 ? 331 MET B CE  1 
ATOM   6549 N  N   . LEU B 1 331 ? 52.615  -22.255 -27.304 1.00 26.61 ? 332 LEU B N   1 
ATOM   6550 C  CA  . LEU B 1 331 ? 53.131  -20.966 -27.754 1.00 27.26 ? 332 LEU B CA  1 
ATOM   6551 C  C   . LEU B 1 331 ? 53.518  -20.977 -29.230 1.00 27.66 ? 332 LEU B C   1 
ATOM   6552 O  O   . LEU B 1 331 ? 53.719  -19.920 -29.829 1.00 27.71 ? 332 LEU B O   1 
ATOM   6553 C  CB  . LEU B 1 331 ? 54.323  -20.522 -26.886 1.00 27.01 ? 332 LEU B CB  1 
ATOM   6554 C  CG  . LEU B 1 331 ? 53.993  -20.041 -25.466 1.00 26.69 ? 332 LEU B CG  1 
ATOM   6555 C  CD1 . LEU B 1 331 ? 55.254  -19.937 -24.633 1.00 26.33 ? 332 LEU B CD1 1 
ATOM   6556 C  CD2 . LEU B 1 331 ? 53.239  -18.711 -25.478 1.00 25.64 ? 332 LEU B CD2 1 
ATOM   6557 N  N   . GLN B 1 332 ? 53.628  -22.175 -29.805 1.00 27.95 ? 333 GLN B N   1 
ATOM   6558 C  CA  . GLN B 1 332 ? 53.837  -22.320 -31.244 1.00 28.17 ? 333 GLN B CA  1 
ATOM   6559 C  C   . GLN B 1 332 ? 52.513  -22.561 -31.991 1.00 27.67 ? 333 GLN B C   1 
ATOM   6560 O  O   . GLN B 1 332 ? 52.509  -22.796 -33.199 1.00 28.02 ? 333 GLN B O   1 
ATOM   6561 C  CB  . GLN B 1 332 ? 54.855  -23.434 -31.535 1.00 28.50 ? 333 GLN B CB  1 
ATOM   6562 C  CG  . GLN B 1 332 ? 56.262  -23.161 -30.986 1.00 30.41 ? 333 GLN B CG  1 
ATOM   6563 C  CD  . GLN B 1 332 ? 56.872  -21.865 -31.525 1.00 34.40 ? 333 GLN B CD  1 
ATOM   6564 O  OE1 . GLN B 1 332 ? 57.170  -20.938 -30.763 1.00 37.10 ? 333 GLN B OE1 1 
ATOM   6565 N  NE2 . GLN B 1 332 ? 57.047  -21.792 -32.844 1.00 35.73 ? 333 GLN B NE2 1 
ATOM   6566 N  N   . LEU B 1 333 ? 51.391  -22.494 -31.277 1.00 26.99 ? 334 LEU B N   1 
ATOM   6567 C  CA  . LEU B 1 333 ? 50.089  -22.773 -31.893 1.00 26.14 ? 334 LEU B CA  1 
ATOM   6568 C  C   . LEU B 1 333 ? 49.107  -21.604 -31.828 1.00 25.64 ? 334 LEU B C   1 
ATOM   6569 O  O   . LEU B 1 333 ? 47.928  -21.770 -32.149 1.00 25.41 ? 334 LEU B O   1 
ATOM   6570 C  CB  . LEU B 1 333 ? 49.473  -24.048 -31.300 1.00 26.33 ? 334 LEU B CB  1 
ATOM   6571 C  CG  . LEU B 1 333 ? 50.341  -25.318 -31.327 1.00 26.26 ? 334 LEU B CG  1 
ATOM   6572 C  CD1 . LEU B 1 333 ? 49.664  -26.467 -30.589 1.00 26.35 ? 334 LEU B CD1 1 
ATOM   6573 C  CD2 . LEU B 1 333 ? 50.688  -25.717 -32.754 1.00 26.55 ? 334 LEU B CD2 1 
ATOM   6574 N  N   . VAL B 1 334 ? 49.603  -20.425 -31.443 1.00 24.81 ? 335 VAL B N   1 
ATOM   6575 C  CA  . VAL B 1 334 ? 48.778  -19.215 -31.340 1.00 24.15 ? 335 VAL B CA  1 
ATOM   6576 C  C   . VAL B 1 334 ? 49.248  -18.065 -32.268 1.00 24.20 ? 335 VAL B C   1 
ATOM   6577 O  O   . VAL B 1 334 ? 49.521  -16.957 -31.786 1.00 24.11 ? 335 VAL B O   1 
ATOM   6578 C  CB  . VAL B 1 334 ? 48.662  -18.708 -29.853 1.00 24.36 ? 335 VAL B CB  1 
ATOM   6579 C  CG1 . VAL B 1 334 ? 47.839  -19.674 -29.007 1.00 23.46 ? 335 VAL B CG1 1 
ATOM   6580 C  CG2 . VAL B 1 334 ? 50.044  -18.466 -29.216 1.00 22.97 ? 335 VAL B CG2 1 
ATOM   6581 N  N   . PRO B 1 335 ? 49.336  -18.314 -33.600 1.00 23.97 ? 336 PRO B N   1 
ATOM   6582 C  CA  . PRO B 1 335 ? 49.840  -17.257 -34.490 1.00 23.44 ? 336 PRO B CA  1 
ATOM   6583 C  C   . PRO B 1 335 ? 49.004  -15.964 -34.510 1.00 22.89 ? 336 PRO B C   1 
ATOM   6584 O  O   . PRO B 1 335 ? 49.572  -14.877 -34.590 1.00 22.48 ? 336 PRO B O   1 
ATOM   6585 C  CB  . PRO B 1 335 ? 49.864  -17.938 -35.873 1.00 23.30 ? 336 PRO B CB  1 
ATOM   6586 C  CG  . PRO B 1 335 ? 48.946  -19.098 -35.752 1.00 23.82 ? 336 PRO B CG  1 
ATOM   6587 C  CD  . PRO B 1 335 ? 49.124  -19.572 -34.346 1.00 23.96 ? 336 PRO B CD  1 
ATOM   6588 N  N   . LEU B 1 336 ? 47.682  -16.081 -34.425 1.00 22.50 ? 337 LEU B N   1 
ATOM   6589 C  CA  . LEU B 1 336 ? 46.812  -14.904 -34.404 1.00 22.41 ? 337 LEU B CA  1 
ATOM   6590 C  C   . LEU B 1 336 ? 46.961  -14.069 -33.120 1.00 22.03 ? 337 LEU B C   1 
ATOM   6591 O  O   . LEU B 1 336 ? 46.807  -12.849 -33.157 1.00 21.53 ? 337 LEU B O   1 
ATOM   6592 C  CB  . LEU B 1 336 ? 45.344  -15.298 -34.629 1.00 22.81 ? 337 LEU B CB  1 
ATOM   6593 C  CG  . LEU B 1 336 ? 44.327  -14.188 -34.938 1.00 23.03 ? 337 LEU B CG  1 
ATOM   6594 C  CD1 . LEU B 1 336 ? 44.520  -13.595 -36.328 1.00 24.00 ? 337 LEU B CD1 1 
ATOM   6595 C  CD2 . LEU B 1 336 ? 42.910  -14.715 -34.800 1.00 25.32 ? 337 LEU B CD2 1 
ATOM   6596 N  N   . LEU B 1 337 ? 47.258  -14.726 -32.000 1.00 21.52 ? 338 LEU B N   1 
ATOM   6597 C  CA  . LEU B 1 337 ? 47.483  -14.023 -30.734 1.00 21.39 ? 338 LEU B CA  1 
ATOM   6598 C  C   . LEU B 1 337 ? 48.793  -13.229 -30.768 1.00 21.28 ? 338 LEU B C   1 
ATOM   6599 O  O   . LEU B 1 337 ? 48.833  -12.068 -30.344 1.00 21.42 ? 338 LEU B O   1 
ATOM   6600 C  CB  . LEU B 1 337 ? 47.446  -14.985 -29.538 1.00 20.97 ? 338 LEU B CB  1 
ATOM   6601 C  CG  . LEU B 1 337 ? 47.577  -14.399 -28.122 1.00 20.84 ? 338 LEU B CG  1 
ATOM   6602 C  CD1 . LEU B 1 337 ? 46.494  -13.359 -27.820 1.00 19.37 ? 338 LEU B CD1 1 
ATOM   6603 C  CD2 . LEU B 1 337 ? 47.567  -15.507 -27.069 1.00 17.15 ? 338 LEU B CD2 1 
ATOM   6604 N  N   . LYS B 1 338 ? 49.846  -13.846 -31.296 1.00 20.85 ? 339 LYS B N   1 
ATOM   6605 C  CA  . LYS B 1 338 ? 51.112  -13.157 -31.513 1.00 20.65 ? 339 LYS B CA  1 
ATOM   6606 C  C   . LYS B 1 338 ? 50.984  -11.981 -32.478 1.00 20.13 ? 339 LYS B C   1 
ATOM   6607 O  O   . LYS B 1 338 ? 51.646  -10.958 -32.307 1.00 19.92 ? 339 LYS B O   1 
ATOM   6608 C  CB  . LYS B 1 338 ? 52.187  -14.131 -31.992 1.00 21.01 ? 339 LYS B CB  1 
ATOM   6609 C  CG  . LYS B 1 338 ? 52.582  -15.124 -30.919 1.00 21.83 ? 339 LYS B CG  1 
ATOM   6610 C  CD  . LYS B 1 338 ? 53.805  -15.902 -31.326 1.00 24.64 ? 339 LYS B CD  1 
ATOM   6611 C  CE  . LYS B 1 338 ? 54.361  -16.675 -30.143 1.00 26.91 ? 339 LYS B CE  1 
ATOM   6612 N  NZ  . LYS B 1 338 ? 55.262  -17.776 -30.589 1.00 28.75 ? 339 LYS B NZ  1 
ATOM   6613 N  N   . ALA B 1 339 ? 50.128  -12.140 -33.483 1.00 19.51 ? 340 ALA B N   1 
ATOM   6614 C  CA  . ALA B 1 339 ? 49.814  -11.069 -34.421 1.00 18.65 ? 340 ALA B CA  1 
ATOM   6615 C  C   . ALA B 1 339 ? 49.032  -9.949  -33.745 1.00 18.05 ? 340 ALA B C   1 
ATOM   6616 O  O   . ALA B 1 339 ? 49.212  -8.786  -34.072 1.00 18.37 ? 340 ALA B O   1 
ATOM   6617 C  CB  . ALA B 1 339 ? 49.028  -11.617 -35.609 1.00 18.49 ? 340 ALA B CB  1 
ATOM   6618 N  N   . SER B 1 340 ? 48.160  -10.294 -32.803 1.00 17.42 ? 341 SER B N   1 
ATOM   6619 C  CA  . SER B 1 340 ? 47.360  -9.286  -32.120 1.00 16.96 ? 341 SER B CA  1 
ATOM   6620 C  C   . SER B 1 340 ? 48.242  -8.378  -31.244 1.00 17.00 ? 341 SER B C   1 
ATOM   6621 O  O   . SER B 1 340 ? 47.901  -7.221  -31.009 1.00 16.73 ? 341 SER B O   1 
ATOM   6622 C  CB  . SER B 1 340 ? 46.232  -9.928  -31.307 1.00 16.50 ? 341 SER B CB  1 
ATOM   6623 O  OG  . SER B 1 340 ? 46.753  -10.761 -30.286 1.00 17.60 ? 341 SER B OG  1 
ATOM   6624 N  N   . ILE B 1 341 ? 49.378  -8.912  -30.793 1.00 17.01 ? 342 ILE B N   1 
ATOM   6625 C  CA  . ILE B 1 341 ? 50.353  -8.154  -30.014 1.00 17.25 ? 342 ILE B CA  1 
ATOM   6626 C  C   . ILE B 1 341 ? 51.099  -7.145  -30.893 1.00 17.38 ? 342 ILE B C   1 
ATOM   6627 O  O   . ILE B 1 341 ? 51.302  -5.993  -30.484 1.00 16.76 ? 342 ILE B O   1 
ATOM   6628 C  CB  . ILE B 1 341 ? 51.325  -9.088  -29.261 1.00 17.30 ? 342 ILE B CB  1 
ATOM   6629 C  CG1 . ILE B 1 341 ? 50.553  -9.867  -28.185 1.00 17.65 ? 342 ILE B CG1 1 
ATOM   6630 C  CG2 . ILE B 1 341 ? 52.472  -8.292  -28.630 1.00 17.09 ? 342 ILE B CG2 1 
ATOM   6631 C  CD1 . ILE B 1 341 ? 51.393  -10.850 -27.384 1.00 17.81 ? 342 ILE B CD1 1 
ATOM   6632 N  N   . LYS B 1 342 ? 51.485  -7.575  -32.100 1.00 17.20 ? 343 LYS B N   1 
ATOM   6633 C  CA  . LYS B 1 342 ? 52.053  -6.670  -33.104 1.00 16.84 ? 343 LYS B CA  1 
ATOM   6634 C  C   . LYS B 1 342 ? 51.049  -5.576  -33.458 1.00 16.83 ? 343 LYS B C   1 
ATOM   6635 O  O   . LYS B 1 342 ? 51.401  -4.390  -33.545 1.00 16.94 ? 343 LYS B O   1 
ATOM   6636 C  CB  . LYS B 1 342 ? 52.425  -7.439  -34.369 1.00 17.20 ? 343 LYS B CB  1 
ATOM   6637 C  CG  . LYS B 1 342 ? 53.471  -8.516  -34.179 1.00 16.78 ? 343 LYS B CG  1 
ATOM   6638 C  CD  . LYS B 1 342 ? 53.690  -9.270  -35.483 1.00 17.89 ? 343 LYS B CD  1 
ATOM   6639 C  CE  . LYS B 1 342 ? 54.699  -10.397 -35.294 1.00 19.88 ? 343 LYS B CE  1 
ATOM   6640 N  NZ  . LYS B 1 342 ? 54.798  -11.223 -36.522 1.00 21.27 ? 343 LYS B NZ  1 
ATOM   6641 N  N   . GLU B 1 343 ? 49.795  -5.980  -33.640 1.00 16.17 ? 344 GLU B N   1 
ATOM   6642 C  CA  . GLU B 1 343 ? 48.706  -5.055  -33.937 1.00 15.69 ? 344 GLU B CA  1 
ATOM   6643 C  C   . GLU B 1 343 ? 48.449  -4.037  -32.810 1.00 15.92 ? 344 GLU B C   1 
ATOM   6644 O  O   . GLU B 1 343 ? 48.175  -2.852  -33.087 1.00 15.68 ? 344 GLU B O   1 
ATOM   6645 C  CB  . GLU B 1 343 ? 47.441  -5.844  -34.293 1.00 15.74 ? 344 GLU B CB  1 
ATOM   6646 C  CG  . GLU B 1 343 ? 46.274  -5.019  -34.867 1.00 15.53 ? 344 GLU B CG  1 
ATOM   6647 C  CD  . GLU B 1 343 ? 46.567  -4.350  -36.218 1.00 17.16 ? 344 GLU B CD  1 
ATOM   6648 O  OE1 . GLU B 1 343 ? 47.731  -4.387  -36.706 1.00 18.36 ? 344 GLU B OE1 1 
ATOM   6649 O  OE2 . GLU B 1 343 ? 45.621  -3.766  -36.787 1.00 15.29 ? 344 GLU B OE2 1 
ATOM   6650 N  N   . THR B 1 344 ? 48.555  -4.486  -31.554 1.00 15.53 ? 345 THR B N   1 
ATOM   6651 C  CA  . THR B 1 344 ? 48.402  -3.596  -30.397 1.00 15.36 ? 345 THR B CA  1 
ATOM   6652 C  C   . THR B 1 344 ? 49.520  -2.548  -30.351 1.00 15.27 ? 345 THR B C   1 
ATOM   6653 O  O   . THR B 1 344 ? 49.261  -1.373  -30.131 1.00 15.01 ? 345 THR B O   1 
ATOM   6654 C  CB  . THR B 1 344 ? 48.339  -4.377  -29.061 1.00 15.40 ? 345 THR B CB  1 
ATOM   6655 O  OG1 . THR B 1 344 ? 47.181  -5.214  -29.055 1.00 15.56 ? 345 THR B OG1 1 
ATOM   6656 C  CG2 . THR B 1 344 ? 48.247  -3.427  -27.864 1.00 14.49 ? 345 THR B CG2 1 
ATOM   6657 N  N   . LEU B 1 345 ? 50.754  -2.987  -30.568 1.00 15.51 ? 346 LEU B N   1 
ATOM   6658 C  CA  . LEU B 1 345 ? 51.899  -2.088  -30.612 1.00 16.11 ? 346 LEU B CA  1 
ATOM   6659 C  C   . LEU B 1 345 ? 51.918  -1.169  -31.843 1.00 16.62 ? 346 LEU B C   1 
ATOM   6660 O  O   . LEU B 1 345 ? 52.493  -0.087  -31.796 1.00 17.36 ? 346 LEU B O   1 
ATOM   6661 C  CB  . LEU B 1 345 ? 53.201  -2.880  -30.505 1.00 16.03 ? 346 LEU B CB  1 
ATOM   6662 C  CG  . LEU B 1 345 ? 53.534  -3.303  -29.073 1.00 16.13 ? 346 LEU B CG  1 
ATOM   6663 C  CD1 . LEU B 1 345 ? 54.601  -4.382  -29.076 1.00 13.50 ? 346 LEU B CD1 1 
ATOM   6664 C  CD2 . LEU B 1 345 ? 53.972  -2.088  -28.230 1.00 14.42 ? 346 LEU B CD2 1 
ATOM   6665 N  N   . ARG B 1 346 ? 51.285  -1.596  -32.932 1.00 17.02 ? 347 ARG B N   1 
ATOM   6666 C  CA  . ARG B 1 346 ? 51.101  -0.751  -34.118 1.00 17.40 ? 347 ARG B CA  1 
ATOM   6667 C  C   . ARG B 1 346 ? 50.279  0.501   -33.785 1.00 16.93 ? 347 ARG B C   1 
ATOM   6668 O  O   . ARG B 1 346 ? 50.689  1.637   -34.064 1.00 16.55 ? 347 ARG B O   1 
ATOM   6669 C  CB  . ARG B 1 346 ? 50.383  -1.560  -35.199 1.00 17.58 ? 347 ARG B CB  1 
ATOM   6670 C  CG  . ARG B 1 346 ? 50.760  -1.196  -36.628 1.00 19.05 ? 347 ARG B CG  1 
ATOM   6671 C  CD  . ARG B 1 346 ? 49.604  -0.682  -37.462 1.00 17.55 ? 347 ARG B CD  1 
ATOM   6672 N  NE  . ARG B 1 346 ? 48.317  -1.320  -37.190 1.00 15.90 ? 347 ARG B NE  1 
ATOM   6673 C  CZ  . ARG B 1 346 ? 47.168  -0.642  -37.201 1.00 16.88 ? 347 ARG B CZ  1 
ATOM   6674 N  NH1 . ARG B 1 346 ? 47.168  0.663   -37.459 1.00 16.92 ? 347 ARG B NH1 1 
ATOM   6675 N  NH2 . ARG B 1 346 ? 46.024  -1.246  -36.944 1.00 17.44 ? 347 ARG B NH2 1 
ATOM   6676 N  N   . LEU B 1 347 ? 49.114  0.274   -33.189 1.00 16.89 ? 348 LEU B N   1 
ATOM   6677 C  CA  . LEU B 1 347 ? 48.196  1.337   -32.817 1.00 17.20 ? 348 LEU B CA  1 
ATOM   6678 C  C   . LEU B 1 347 ? 48.641  2.072   -31.562 1.00 16.78 ? 348 LEU B C   1 
ATOM   6679 O  O   . LEU B 1 347 ? 48.427  3.273   -31.444 1.00 17.10 ? 348 LEU B O   1 
ATOM   6680 C  CB  . LEU B 1 347 ? 46.804  0.764   -32.562 1.00 17.53 ? 348 LEU B CB  1 
ATOM   6681 C  CG  . LEU B 1 347 ? 45.757  0.732   -33.670 1.00 19.66 ? 348 LEU B CG  1 
ATOM   6682 C  CD1 . LEU B 1 347 ? 44.452  0.195   -33.074 1.00 20.32 ? 348 LEU B CD1 1 
ATOM   6683 C  CD2 . LEU B 1 347 ? 45.538  2.115   -34.287 1.00 18.47 ? 348 LEU B CD2 1 
ATOM   6684 N  N   . HIS B 1 348 ? 49.229  1.340   -30.616 1.00 16.17 ? 349 HIS B N   1 
ATOM   6685 C  CA  . HIS B 1 348 ? 49.621  1.908   -29.332 1.00 15.51 ? 349 HIS B CA  1 
ATOM   6686 C  C   . HIS B 1 348 ? 51.083  1.631   -28.987 1.00 15.31 ? 349 HIS B C   1 
ATOM   6687 O  O   . HIS B 1 348 ? 51.365  0.895   -28.040 1.00 15.57 ? 349 HIS B O   1 
ATOM   6688 C  CB  . HIS B 1 348 ? 48.714  1.369   -28.224 1.00 15.69 ? 349 HIS B CB  1 
ATOM   6689 C  CG  . HIS B 1 348 ? 47.252  1.514   -28.514 1.00 15.78 ? 349 HIS B CG  1 
ATOM   6690 N  ND1 . HIS B 1 348 ? 46.624  2.740   -28.576 1.00 16.19 ? 349 HIS B ND1 1 
ATOM   6691 C  CD2 . HIS B 1 348 ? 46.293  0.586   -28.754 1.00 15.89 ? 349 HIS B CD2 1 
ATOM   6692 C  CE1 . HIS B 1 348 ? 45.342  2.565   -28.849 1.00 16.35 ? 349 HIS B CE1 1 
ATOM   6693 N  NE2 . HIS B 1 348 ? 45.115  1.266   -28.961 1.00 16.99 ? 349 HIS B NE2 1 
ATOM   6694 N  N   . PRO B 1 349 ? 52.028  2.224   -29.746 1.00 14.92 ? 350 PRO B N   1 
ATOM   6695 C  CA  . PRO B 1 349 ? 53.428  1.998   -29.426 1.00 14.33 ? 350 PRO B CA  1 
ATOM   6696 C  C   . PRO B 1 349 ? 53.791  2.572   -28.053 1.00 14.26 ? 350 PRO B C   1 
ATOM   6697 O  O   . PRO B 1 349 ? 53.242  3.589   -27.628 1.00 14.37 ? 350 PRO B O   1 
ATOM   6698 C  CB  . PRO B 1 349 ? 54.163  2.786   -30.520 1.00 14.01 ? 350 PRO B CB  1 
ATOM   6699 C  CG  . PRO B 1 349 ? 53.236  3.877   -30.855 1.00 14.32 ? 350 PRO B CG  1 
ATOM   6700 C  CD  . PRO B 1 349 ? 51.875  3.249   -30.795 1.00 14.80 ? 350 PRO B CD  1 
ATOM   6701 N  N   . ILE B 1 350 ? 54.708  1.907   -27.371 1.00 14.26 ? 351 ILE B N   1 
ATOM   6702 C  CA  . ILE B 1 350 ? 55.321  2.441   -26.162 1.00 14.04 ? 351 ILE B CA  1 
ATOM   6703 C  C   . ILE B 1 350 ? 56.274  3.605   -26.511 1.00 14.10 ? 351 ILE B C   1 
ATOM   6704 O  O   . ILE B 1 350 ? 56.301  4.629   -25.817 1.00 14.18 ? 351 ILE B O   1 
ATOM   6705 C  CB  . ILE B 1 350 ? 56.075  1.301   -25.407 1.00 13.94 ? 351 ILE B CB  1 
ATOM   6706 C  CG1 . ILE B 1 350 ? 55.082  0.427   -24.626 1.00 13.70 ? 351 ILE B CG1 1 
ATOM   6707 C  CG2 . ILE B 1 350 ? 57.197  1.844   -24.527 1.00 13.69 ? 351 ILE B CG2 1 
ATOM   6708 C  CD1 . ILE B 1 350 ? 54.239  1.170   -23.577 1.00 11.99 ? 351 ILE B CD1 1 
ATOM   6709 N  N   . SER B 1 351 ? 57.020  3.434   -27.602 1.00 13.68 ? 352 SER B N   1 
ATOM   6710 C  CA  . SER B 1 351 ? 58.082  4.356   -28.047 1.00 13.68 ? 352 SER B CA  1 
ATOM   6711 C  C   . SER B 1 351 ? 57.598  5.238   -29.213 1.00 13.19 ? 352 SER B C   1 
ATOM   6712 O  O   . SER B 1 351 ? 57.304  4.712   -30.297 1.00 12.77 ? 352 SER B O   1 
ATOM   6713 C  CB  . SER B 1 351 ? 59.272  3.500   -28.509 1.00 13.68 ? 352 SER B CB  1 
ATOM   6714 O  OG  . SER B 1 351 ? 60.464  4.244   -28.680 1.00 15.56 ? 352 SER B OG  1 
ATOM   6715 N  N   . VAL B 1 352 ? 57.510  6.562   -29.019 1.00 12.64 ? 353 VAL B N   1 
ATOM   6716 C  CA  . VAL B 1 352 ? 57.021  7.434   -30.101 1.00 12.58 ? 353 VAL B CA  1 
ATOM   6717 C  C   . VAL B 1 352 ? 57.831  7.322   -31.376 1.00 12.12 ? 353 VAL B C   1 
ATOM   6718 O  O   . VAL B 1 352 ? 57.288  7.488   -32.454 1.00 11.61 ? 353 VAL B O   1 
ATOM   6719 C  CB  . VAL B 1 352 ? 57.060  8.982   -29.829 1.00 12.98 ? 353 VAL B CB  1 
ATOM   6720 C  CG1 . VAL B 1 352 ? 55.669  9.577   -29.852 1.00 12.83 ? 353 VAL B CG1 1 
ATOM   6721 C  CG2 . VAL B 1 352 ? 57.935  9.391   -28.647 1.00 11.75 ? 353 VAL B CG2 1 
ATOM   6722 N  N   . THR B 1 353 ? 59.136  7.117   -31.226 1.00 12.27 ? 354 THR B N   1 
ATOM   6723 C  CA  . THR B 1 353 ? 60.060  7.063   -32.348 1.00 12.60 ? 354 THR B CA  1 
ATOM   6724 C  C   . THR B 1 353 ? 61.103  5.993   -32.089 1.00 13.39 ? 354 THR B C   1 
ATOM   6725 O  O   . THR B 1 353 ? 61.273  5.531   -30.957 1.00 13.65 ? 354 THR B O   1 
ATOM   6726 C  CB  . THR B 1 353 ? 60.854  8.384   -32.543 1.00 12.19 ? 354 THR B CB  1 
ATOM   6727 O  OG1 . THR B 1 353 ? 61.671  8.633   -31.389 1.00 12.64 ? 354 THR B OG1 1 
ATOM   6728 C  CG2 . THR B 1 353 ? 59.937  9.577   -32.806 1.00 12.41 ? 354 THR B CG2 1 
ATOM   6729 N  N   . LEU B 1 354 ? 61.785  5.603   -33.163 1.00 13.66 ? 355 LEU B N   1 
ATOM   6730 C  CA  . LEU B 1 354 ? 63.099  4.981   -33.073 1.00 14.22 ? 355 LEU B CA  1 
ATOM   6731 C  C   . LEU B 1 354 ? 64.100  6.029   -33.543 1.00 14.28 ? 355 LEU B C   1 
ATOM   6732 O  O   . LEU B 1 354 ? 63.751  6.895   -34.333 1.00 14.09 ? 355 LEU B O   1 
ATOM   6733 C  CB  . LEU B 1 354 ? 63.175  3.759   -33.979 1.00 13.81 ? 355 LEU B CB  1 
ATOM   6734 C  CG  . LEU B 1 354 ? 62.235  2.592   -33.708 1.00 14.46 ? 355 LEU B CG  1 
ATOM   6735 C  CD1 . LEU B 1 354 ? 62.480  1.500   -34.753 1.00 15.53 ? 355 LEU B CD1 1 
ATOM   6736 C  CD2 . LEU B 1 354 ? 62.404  2.039   -32.288 1.00 14.38 ? 355 LEU B CD2 1 
ATOM   6737 N  N   . GLN B 1 355 ? 65.331  5.966   -33.050 1.00 14.69 ? 356 GLN B N   1 
ATOM   6738 C  CA  . GLN B 1 355 ? 66.359  6.915   -33.473 1.00 15.23 ? 356 GLN B CA  1 
ATOM   6739 C  C   . GLN B 1 355 ? 67.694  6.204   -33.671 1.00 15.77 ? 356 GLN B C   1 
ATOM   6740 O  O   . GLN B 1 355 ? 68.029  5.281   -32.933 1.00 15.72 ? 356 GLN B O   1 
ATOM   6741 C  CB  . GLN B 1 355 ? 66.532  8.086   -32.477 1.00 14.72 ? 356 GLN B CB  1 
ATOM   6742 C  CG  . GLN B 1 355 ? 65.332  8.424   -31.578 1.00 14.93 ? 356 GLN B CG  1 
ATOM   6743 C  CD  . GLN B 1 355 ? 65.205  7.474   -30.409 1.00 15.86 ? 356 GLN B CD  1 
ATOM   6744 O  OE1 . GLN B 1 355 ? 66.207  7.085   -29.804 1.00 16.46 ? 356 GLN B OE1 1 
ATOM   6745 N  NE2 . GLN B 1 355 ? 63.969  7.076   -30.090 1.00 14.88 ? 356 GLN B NE2 1 
ATOM   6746 N  N   . ARG B 1 356 ? 68.434  6.635   -34.688 1.00 16.88 ? 357 ARG B N   1 
ATOM   6747 C  CA  . ARG B 1 356 ? 69.814  6.219   -34.894 1.00 17.76 ? 357 ARG B CA  1 
ATOM   6748 C  C   . ARG B 1 356 ? 70.659  7.425   -35.335 1.00 18.57 ? 357 ARG B C   1 
ATOM   6749 O  O   . ARG B 1 356 ? 70.200  8.255   -36.126 1.00 18.37 ? 357 ARG B O   1 
ATOM   6750 C  CB  . ARG B 1 356 ? 69.901  5.095   -35.942 1.00 17.83 ? 357 ARG B CB  1 
ATOM   6751 C  CG  . ARG B 1 356 ? 69.352  3.717   -35.512 1.00 17.53 ? 357 ARG B CG  1 
ATOM   6752 C  CD  . ARG B 1 356 ? 70.167  3.072   -34.386 1.00 16.60 ? 357 ARG B CD  1 
ATOM   6753 N  NE  . ARG B 1 356 ? 69.696  1.719   -34.068 1.00 16.80 ? 357 ARG B NE  1 
ATOM   6754 C  CZ  . ARG B 1 356 ? 68.720  1.431   -33.196 1.00 16.02 ? 357 ARG B CZ  1 
ATOM   6755 N  NH1 . ARG B 1 356 ? 68.077  2.399   -32.550 1.00 12.34 ? 357 ARG B NH1 1 
ATOM   6756 N  NH2 . ARG B 1 356 ? 68.372  0.166   -32.984 1.00 15.05 ? 357 ARG B NH2 1 
ATOM   6757 N  N   . TYR B 1 357 ? 71.871  7.543   -34.798 1.00 19.57 ? 358 TYR B N   1 
ATOM   6758 C  CA  . TYR B 1 357 ? 72.843  8.494   -35.338 1.00 21.20 ? 358 TYR B CA  1 
ATOM   6759 C  C   . TYR B 1 357 ? 73.534  7.853   -36.532 1.00 22.09 ? 358 TYR B C   1 
ATOM   6760 O  O   . TYR B 1 357 ? 73.976  6.708   -36.452 1.00 22.48 ? 358 TYR B O   1 
ATOM   6761 C  CB  . TYR B 1 357 ? 73.886  8.887   -34.292 1.00 20.79 ? 358 TYR B CB  1 
ATOM   6762 C  CG  . TYR B 1 357 ? 73.365  9.822   -33.225 1.00 20.99 ? 358 TYR B CG  1 
ATOM   6763 C  CD1 . TYR B 1 357 ? 72.831  9.315   -32.036 1.00 19.63 ? 358 TYR B CD1 1 
ATOM   6764 C  CD2 . TYR B 1 357 ? 73.409  11.212  -33.396 1.00 19.72 ? 358 TYR B CD2 1 
ATOM   6765 C  CE1 . TYR B 1 357 ? 72.362  10.158  -31.042 1.00 19.35 ? 358 TYR B CE1 1 
ATOM   6766 C  CE2 . TYR B 1 357 ? 72.930  12.071  -32.401 1.00 19.74 ? 358 TYR B CE2 1 
ATOM   6767 C  CZ  . TYR B 1 357 ? 72.412  11.527  -31.227 1.00 19.34 ? 358 TYR B CZ  1 
ATOM   6768 O  OH  . TYR B 1 357 ? 71.932  12.341  -30.235 1.00 19.34 ? 358 TYR B OH  1 
ATOM   6769 N  N   . LEU B 1 358 ? 73.608  8.579   -37.641 1.00 23.47 ? 359 LEU B N   1 
ATOM   6770 C  CA  . LEU B 1 358 ? 74.231  8.044   -38.854 1.00 24.91 ? 359 LEU B CA  1 
ATOM   6771 C  C   . LEU B 1 358 ? 75.733  7.890   -38.673 1.00 26.04 ? 359 LEU B C   1 
ATOM   6772 O  O   . LEU B 1 358 ? 76.391  8.777   -38.140 1.00 26.44 ? 359 LEU B O   1 
ATOM   6773 C  CB  . LEU B 1 358 ? 73.924  8.922   -40.070 1.00 24.38 ? 359 LEU B CB  1 
ATOM   6774 C  CG  . LEU B 1 358 ? 72.494  8.943   -40.608 1.00 24.45 ? 359 LEU B CG  1 
ATOM   6775 C  CD1 . LEU B 1 358 ? 72.411  9.780   -41.865 1.00 23.60 ? 359 LEU B CD1 1 
ATOM   6776 C  CD2 . LEU B 1 358 ? 71.976  7.532   -40.869 1.00 23.34 ? 359 LEU B CD2 1 
ATOM   6777 N  N   . VAL B 1 359 ? 76.264  6.750   -39.099 1.00 27.83 ? 360 VAL B N   1 
ATOM   6778 C  CA  . VAL B 1 359 ? 77.710  6.505   -39.061 1.00 29.46 ? 360 VAL B CA  1 
ATOM   6779 C  C   . VAL B 1 359 ? 78.359  7.107   -40.311 1.00 30.08 ? 360 VAL B C   1 
ATOM   6780 O  O   . VAL B 1 359 ? 79.389  7.776   -40.221 1.00 30.80 ? 360 VAL B O   1 
ATOM   6781 C  CB  . VAL B 1 359 ? 78.035  4.995   -38.906 1.00 29.43 ? 360 VAL B CB  1 
ATOM   6782 C  CG1 . VAL B 1 359 ? 79.538  4.730   -39.049 1.00 30.51 ? 360 VAL B CG1 1 
ATOM   6783 C  CG2 . VAL B 1 359 ? 77.550  4.492   -37.556 1.00 30.13 ? 360 VAL B CG2 1 
ATOM   6784 N  N   . ASN B 1 360 ? 77.722  6.883   -41.457 1.00 30.95 ? 361 ASN B N   1 
ATOM   6785 C  CA  . ASN B 1 360 ? 78.135  7.438   -42.744 1.00 31.64 ? 361 ASN B CA  1 
ATOM   6786 C  C   . ASN B 1 360 ? 77.047  8.312   -43.363 1.00 31.74 ? 361 ASN B C   1 
ATOM   6787 O  O   . ASN B 1 360 ? 75.874  8.216   -42.988 1.00 31.75 ? 361 ASN B O   1 
ATOM   6788 C  CB  . ASN B 1 360 ? 78.450  6.302   -43.726 1.00 32.02 ? 361 ASN B CB  1 
ATOM   6789 C  CG  . ASN B 1 360 ? 79.662  5.492   -43.319 1.00 33.01 ? 361 ASN B CG  1 
ATOM   6790 O  OD1 . ASN B 1 360 ? 80.739  6.039   -43.079 1.00 34.85 ? 361 ASN B OD1 1 
ATOM   6791 N  ND2 . ASN B 1 360 ? 79.498  4.177   -43.251 1.00 34.22 ? 361 ASN B ND2 1 
ATOM   6792 N  N   . ASP B 1 361 ? 77.446  9.153   -44.318 1.00 31.58 ? 362 ASP B N   1 
ATOM   6793 C  CA  . ASP B 1 361 ? 76.512  9.877   -45.178 1.00 31.52 ? 362 ASP B CA  1 
ATOM   6794 C  C   . ASP B 1 361 ? 75.458  8.923   -45.725 1.00 31.42 ? 362 ASP B C   1 
ATOM   6795 O  O   . ASP B 1 361 ? 75.736  7.742   -45.948 1.00 31.55 ? 362 ASP B O   1 
ATOM   6796 C  CB  . ASP B 1 361 ? 77.257  10.538  -46.350 1.00 31.77 ? 362 ASP B CB  1 
ATOM   6797 C  CG  . ASP B 1 361 ? 78.069  11.772  -45.933 1.00 32.18 ? 362 ASP B CG  1 
ATOM   6798 O  OD1 . ASP B 1 361 ? 78.216  12.056  -44.723 1.00 32.37 ? 362 ASP B OD1 1 
ATOM   6799 O  OD2 . ASP B 1 361 ? 78.570  12.469  -46.841 1.00 33.96 ? 362 ASP B OD2 1 
ATOM   6800 N  N   . LEU B 1 362 ? 74.250  9.433   -45.938 1.00 31.15 ? 363 LEU B N   1 
ATOM   6801 C  CA  . LEU B 1 362 ? 73.144  8.598   -46.390 1.00 31.11 ? 363 LEU B CA  1 
ATOM   6802 C  C   . LEU B 1 362 ? 72.139  9.403   -47.186 1.00 31.04 ? 363 LEU B C   1 
ATOM   6803 O  O   . LEU B 1 362 ? 71.828  10.548  -46.845 1.00 31.10 ? 363 LEU B O   1 
ATOM   6804 C  CB  . LEU B 1 362 ? 72.441  7.923   -45.201 1.00 31.04 ? 363 LEU B CB  1 
ATOM   6805 C  CG  . LEU B 1 362 ? 71.266  6.983   -45.521 1.00 31.22 ? 363 LEU B CG  1 
ATOM   6806 C  CD1 . LEU B 1 362 ? 71.687  5.820   -46.441 1.00 30.82 ? 363 LEU B CD1 1 
ATOM   6807 C  CD2 . LEU B 1 362 ? 70.633  6.455   -44.244 1.00 31.52 ? 363 LEU B CD2 1 
ATOM   6808 N  N   . VAL B 1 363 ? 71.623  8.789   -48.241 1.00 30.91 ? 364 VAL B N   1 
ATOM   6809 C  CA  . VAL B 1 363 ? 70.632  9.437   -49.077 1.00 31.09 ? 364 VAL B CA  1 
ATOM   6810 C  C   . VAL B 1 363 ? 69.243  8.886   -48.779 1.00 31.18 ? 364 VAL B C   1 
ATOM   6811 O  O   . VAL B 1 363 ? 69.008  7.687   -48.899 1.00 31.47 ? 364 VAL B O   1 
ATOM   6812 C  CB  . VAL B 1 363 ? 70.974  9.303   -50.579 1.00 31.04 ? 364 VAL B CB  1 
ATOM   6813 C  CG1 . VAL B 1 363 ? 70.070  10.197  -51.405 1.00 30.62 ? 364 VAL B CG1 1 
ATOM   6814 C  CG2 . VAL B 1 363 ? 72.430  9.672   -50.819 1.00 30.55 ? 364 VAL B CG2 1 
ATOM   6815 N  N   . LEU B 1 364 ? 68.338  9.772   -48.371 1.00 31.36 ? 365 LEU B N   1 
ATOM   6816 C  CA  . LEU B 1 364 ? 66.928  9.437   -48.210 1.00 31.65 ? 365 LEU B CA  1 
ATOM   6817 C  C   . LEU B 1 364 ? 66.083  10.429  -48.987 1.00 32.07 ? 365 LEU B C   1 
ATOM   6818 O  O   . LEU B 1 364 ? 66.177  11.640  -48.770 1.00 31.84 ? 365 LEU B O   1 
ATOM   6819 C  CB  . LEU B 1 364 ? 66.515  9.416   -46.725 1.00 31.36 ? 365 LEU B CB  1 
ATOM   6820 C  CG  . LEU B 1 364 ? 67.151  8.330   -45.846 1.00 31.16 ? 365 LEU B CG  1 
ATOM   6821 C  CD1 . LEU B 1 364 ? 66.771  8.500   -44.373 1.00 31.51 ? 365 LEU B CD1 1 
ATOM   6822 C  CD2 . LEU B 1 364 ? 66.795  6.938   -46.336 1.00 29.31 ? 365 LEU B CD2 1 
ATOM   6823 N  N   . ARG B 1 365 ? 65.265  9.898   -49.896 1.00 32.86 ? 366 ARG B N   1 
ATOM   6824 C  CA  . ARG B 1 365 ? 64.369  10.689  -50.750 1.00 33.70 ? 366 ARG B CA  1 
ATOM   6825 C  C   . ARG B 1 365 ? 65.098  11.773  -51.537 1.00 33.66 ? 366 ARG B C   1 
ATOM   6826 O  O   . ARG B 1 365 ? 64.610  12.900  -51.639 1.00 33.74 ? 366 ARG B O   1 
ATOM   6827 C  CB  . ARG B 1 365 ? 63.240  11.321  -49.933 1.00 33.79 ? 366 ARG B CB  1 
ATOM   6828 C  CG  . ARG B 1 365 ? 62.437  10.337  -49.146 1.00 35.45 ? 366 ARG B CG  1 
ATOM   6829 C  CD  . ARG B 1 365 ? 61.063  10.873  -48.857 1.00 36.73 ? 366 ARG B CD  1 
ATOM   6830 N  NE  . ARG B 1 365 ? 60.151  9.759   -48.648 1.00 39.28 ? 366 ARG B NE  1 
ATOM   6831 C  CZ  . ARG B 1 365 ? 59.356  9.245   -49.580 1.00 39.09 ? 366 ARG B CZ  1 
ATOM   6832 N  NH1 . ARG B 1 365 ? 59.327  9.759   -50.800 1.00 39.36 ? 366 ARG B NH1 1 
ATOM   6833 N  NH2 . ARG B 1 365 ? 58.575  8.221   -49.278 1.00 39.61 ? 366 ARG B NH2 1 
ATOM   6834 N  N   . ASP B 1 366 ? 66.262  11.422  -52.080 1.00 33.82 ? 367 ASP B N   1 
ATOM   6835 C  CA  . ASP B 1 366 ? 67.098  12.344  -52.864 1.00 34.10 ? 367 ASP B CA  1 
ATOM   6836 C  C   . ASP B 1 366 ? 67.645  13.549  -52.075 1.00 33.64 ? 367 ASP B C   1 
ATOM   6837 O  O   . ASP B 1 366 ? 68.030  14.563  -52.662 1.00 33.45 ? 367 ASP B O   1 
ATOM   6838 C  CB  . ASP B 1 366 ? 66.386  12.780  -54.161 1.00 34.57 ? 367 ASP B CB  1 
ATOM   6839 C  CG  . ASP B 1 366 ? 66.306  11.653  -55.198 1.00 36.73 ? 367 ASP B CG  1 
ATOM   6840 O  OD1 . ASP B 1 366 ? 67.195  10.762  -55.206 1.00 39.33 ? 367 ASP B OD1 1 
ATOM   6841 O  OD2 . ASP B 1 366 ? 65.354  11.659  -56.013 1.00 38.62 ? 367 ASP B OD2 1 
ATOM   6842 N  N   . TYR B 1 367 ? 67.692  13.417  -50.747 1.00 33.01 ? 368 TYR B N   1 
ATOM   6843 C  CA  . TYR B 1 367 ? 68.391  14.378  -49.897 1.00 32.30 ? 368 TYR B CA  1 
ATOM   6844 C  C   . TYR B 1 367 ? 69.615  13.721  -49.272 1.00 32.24 ? 368 TYR B C   1 
ATOM   6845 O  O   . TYR B 1 367 ? 69.553  12.582  -48.815 1.00 32.04 ? 368 TYR B O   1 
ATOM   6846 C  CB  . TYR B 1 367 ? 67.492  14.886  -48.770 1.00 31.93 ? 368 TYR B CB  1 
ATOM   6847 C  CG  . TYR B 1 367 ? 66.244  15.635  -49.184 1.00 30.48 ? 368 TYR B CG  1 
ATOM   6848 C  CD1 . TYR B 1 367 ? 65.003  15.007  -49.176 1.00 29.38 ? 368 TYR B CD1 1 
ATOM   6849 C  CD2 . TYR B 1 367 ? 66.297  16.987  -49.530 1.00 29.05 ? 368 TYR B CD2 1 
ATOM   6850 C  CE1 . TYR B 1 367 ? 63.847  15.693  -49.528 1.00 28.61 ? 368 TYR B CE1 1 
ATOM   6851 C  CE2 . TYR B 1 367 ? 65.148  17.684  -49.874 1.00 28.13 ? 368 TYR B CE2 1 
ATOM   6852 C  CZ  . TYR B 1 367 ? 63.930  17.029  -49.873 1.00 28.25 ? 368 TYR B CZ  1 
ATOM   6853 O  OH  . TYR B 1 367 ? 62.789  17.705  -50.222 1.00 29.64 ? 368 TYR B OH  1 
ATOM   6854 N  N   . MET B 1 368 ? 70.718  14.459  -49.235 1.00 32.16 ? 369 MET B N   1 
ATOM   6855 C  CA  . MET B 1 368 ? 71.949  13.979  -48.637 1.00 32.42 ? 369 MET B CA  1 
ATOM   6856 C  C   . MET B 1 368 ? 71.904  14.236  -47.130 1.00 31.84 ? 369 MET B C   1 
ATOM   6857 O  O   . MET B 1 368 ? 71.750  15.378  -46.697 1.00 31.70 ? 369 MET B O   1 
ATOM   6858 C  CB  . MET B 1 368 ? 73.145  14.711  -49.257 1.00 33.07 ? 369 MET B CB  1 
ATOM   6859 C  CG  . MET B 1 368 ? 74.270  13.811  -49.776 1.00 35.42 ? 369 MET B CG  1 
ATOM   6860 S  SD  . MET B 1 368 ? 74.983  12.674  -48.563 1.00 41.36 ? 369 MET B SD  1 
ATOM   6861 C  CE  . MET B 1 368 ? 75.485  13.812  -47.262 1.00 40.17 ? 369 MET B CE  1 
ATOM   6862 N  N   . ILE B 1 369 ? 72.027  13.178  -46.334 1.00 30.99 ? 370 ILE B N   1 
ATOM   6863 C  CA  . ILE B 1 369 ? 72.033  13.334  -44.885 1.00 30.46 ? 370 ILE B CA  1 
ATOM   6864 C  C   . ILE B 1 369 ? 73.411  12.981  -44.316 1.00 30.24 ? 370 ILE B C   1 
ATOM   6865 O  O   . ILE B 1 369 ? 73.821  11.818  -44.338 1.00 30.38 ? 370 ILE B O   1 
ATOM   6866 C  CB  . ILE B 1 369 ? 70.879  12.554  -44.196 1.00 30.52 ? 370 ILE B CB  1 
ATOM   6867 C  CG1 . ILE B 1 369 ? 69.543  12.883  -44.871 1.00 30.24 ? 370 ILE B CG1 1 
ATOM   6868 C  CG2 . ILE B 1 369 ? 70.794  12.922  -42.708 1.00 30.62 ? 370 ILE B CG2 1 
ATOM   6869 C  CD1 . ILE B 1 369 ? 68.444  11.898  -44.604 1.00 30.77 ? 370 ILE B CD1 1 
ATOM   6870 N  N   . PRO B 1 370 ? 74.134  13.996  -43.810 1.00 29.85 ? 371 PRO B N   1 
ATOM   6871 C  CA  . PRO B 1 370 ? 75.507  13.792  -43.365 1.00 29.68 ? 371 PRO B CA  1 
ATOM   6872 C  C   . PRO B 1 370 ? 75.649  12.834  -42.188 1.00 29.35 ? 371 PRO B C   1 
ATOM   6873 O  O   . PRO B 1 370 ? 74.719  12.672  -41.392 1.00 29.64 ? 371 PRO B O   1 
ATOM   6874 C  CB  . PRO B 1 370 ? 75.976  15.204  -42.976 1.00 29.72 ? 371 PRO B CB  1 
ATOM   6875 C  CG  . PRO B 1 370 ? 74.748  16.013  -42.839 1.00 30.05 ? 371 PRO B CG  1 
ATOM   6876 C  CD  . PRO B 1 370 ? 73.730  15.412  -43.737 1.00 29.91 ? 371 PRO B CD  1 
ATOM   6877 N  N   . ALA B 1 371 ? 76.815  12.199  -42.104 1.00 28.72 ? 372 ALA B N   1 
ATOM   6878 C  CA  . ALA B 1 371 ? 77.195  11.371  -40.965 1.00 27.99 ? 372 ALA B CA  1 
ATOM   6879 C  C   . ALA B 1 371 ? 77.036  12.137  -39.656 1.00 27.43 ? 372 ALA B C   1 
ATOM   6880 O  O   . ALA B 1 371 ? 77.184  13.360  -39.621 1.00 27.41 ? 372 ALA B O   1 
ATOM   6881 C  CB  . ALA B 1 371 ? 78.640  10.893  -41.129 1.00 28.19 ? 372 ALA B CB  1 
ATOM   6882 N  N   . LYS B 1 372 ? 76.727  11.405  -38.585 1.00 26.74 ? 373 LYS B N   1 
ATOM   6883 C  CA  . LYS B 1 372 ? 76.504  11.974  -37.242 1.00 25.71 ? 373 LYS B CA  1 
ATOM   6884 C  C   . LYS B 1 372 ? 75.148  12.693  -37.066 1.00 24.46 ? 373 LYS B C   1 
ATOM   6885 O  O   . LYS B 1 372 ? 74.838  13.174  -35.972 1.00 24.35 ? 373 LYS B O   1 
ATOM   6886 C  CB  . LYS B 1 372 ? 77.674  12.875  -36.806 1.00 26.07 ? 373 LYS B CB  1 
ATOM   6887 C  CG  . LYS B 1 372 ? 79.035  12.169  -36.722 1.00 27.73 ? 373 LYS B CG  1 
ATOM   6888 C  CD  . LYS B 1 372 ? 80.130  13.165  -36.358 1.00 30.65 ? 373 LYS B CD  1 
ATOM   6889 C  CE  . LYS B 1 372 ? 81.514  12.537  -36.450 1.00 33.49 ? 373 LYS B CE  1 
ATOM   6890 N  NZ  . LYS B 1 372 ? 82.574  13.565  -36.760 1.00 35.67 ? 373 LYS B NZ  1 
ATOM   6891 N  N   . THR B 1 373 ? 74.346  12.761  -38.127 1.00 22.78 ? 374 THR B N   1 
ATOM   6892 C  CA  . THR B 1 373 ? 72.983  13.291  -38.017 1.00 21.65 ? 374 THR B CA  1 
ATOM   6893 C  C   . THR B 1 373 ? 72.074  12.299  -37.286 1.00 20.30 ? 374 THR B C   1 
ATOM   6894 O  O   . THR B 1 373 ? 72.121  11.092  -37.529 1.00 19.94 ? 374 THR B O   1 
ATOM   6895 C  CB  . THR B 1 373 ? 72.349  13.590  -39.403 1.00 21.92 ? 374 THR B CB  1 
ATOM   6896 O  OG1 . THR B 1 373 ? 73.236  14.404  -40.186 1.00 23.46 ? 374 THR B OG1 1 
ATOM   6897 C  CG2 . THR B 1 373 ? 71.028  14.312  -39.245 1.00 20.57 ? 374 THR B CG2 1 
ATOM   6898 N  N   . LEU B 1 374 ? 71.234  12.823  -36.405 1.00 19.01 ? 375 LEU B N   1 
ATOM   6899 C  CA  . LEU B 1 374 ? 70.225  12.020  -35.749 1.00 17.80 ? 375 LEU B CA  1 
ATOM   6900 C  C   . LEU B 1 374 ? 69.023  11.848  -36.666 1.00 16.99 ? 375 LEU B C   1 
ATOM   6901 O  O   . LEU B 1 374 ? 68.442  12.835  -37.132 1.00 16.70 ? 375 LEU B O   1 
ATOM   6902 C  CB  . LEU B 1 374 ? 69.796  12.663  -34.429 1.00 17.47 ? 375 LEU B CB  1 
ATOM   6903 C  CG  . LEU B 1 374 ? 68.787  11.852  -33.615 1.00 17.46 ? 375 LEU B CG  1 
ATOM   6904 C  CD1 . LEU B 1 374 ? 69.342  10.453  -33.315 1.00 17.16 ? 375 LEU B CD1 1 
ATOM   6905 C  CD2 . LEU B 1 374 ? 68.439  12.596  -32.337 1.00 16.80 ? 375 LEU B CD2 1 
ATOM   6906 N  N   . VAL B 1 375 ? 68.658  10.590  -36.913 1.00 16.11 ? 376 VAL B N   1 
ATOM   6907 C  CA  . VAL B 1 375 ? 67.483  10.257  -37.719 1.00 15.46 ? 376 VAL B CA  1 
ATOM   6908 C  C   . VAL B 1 375 ? 66.448  9.523   -36.868 1.00 15.22 ? 376 VAL B C   1 
ATOM   6909 O  O   . VAL B 1 375 ? 66.775  8.548   -36.178 1.00 15.40 ? 376 VAL B O   1 
ATOM   6910 C  CB  . VAL B 1 375 ? 67.874  9.469   -39.006 1.00 15.51 ? 376 VAL B CB  1 
ATOM   6911 C  CG1 . VAL B 1 375 ? 66.646  9.150   -39.871 1.00 14.46 ? 376 VAL B CG1 1 
ATOM   6912 C  CG2 . VAL B 1 375 ? 68.891  10.293  -39.835 1.00 15.52 ? 376 VAL B CG2 1 
ATOM   6913 N  N   . GLN B 1 376 ? 65.210  10.013  -36.904 1.00 15.40 ? 377 GLN B N   1 
ATOM   6914 C  CA  . GLN B 1 376 ? 64.116  9.437   -36.110 1.00 16.04 ? 377 GLN B CA  1 
ATOM   6915 C  C   . GLN B 1 376 ? 63.018  8.853   -36.994 1.00 16.26 ? 377 GLN B C   1 
ATOM   6916 O  O   . GLN B 1 376 ? 62.568  9.485   -37.949 1.00 16.27 ? 377 GLN B O   1 
ATOM   6917 C  CB  . GLN B 1 376 ? 63.536  10.466  -35.120 1.00 15.74 ? 377 GLN B CB  1 
ATOM   6918 C  CG  . GLN B 1 376 ? 64.584  11.041  -34.137 1.00 16.35 ? 377 GLN B CG  1 
ATOM   6919 C  CD  . GLN B 1 376 ? 63.986  11.657  -32.873 1.00 17.66 ? 377 GLN B CD  1 
ATOM   6920 O  OE1 . GLN B 1 376 ? 62.987  11.171  -32.332 1.00 16.79 ? 377 GLN B OE1 1 
ATOM   6921 N  NE2 . GLN B 1 376 ? 64.619  12.721  -32.384 1.00 17.57 ? 377 GLN B NE2 1 
ATOM   6922 N  N   . VAL B 1 377 ? 62.601  7.635   -36.676 1.00 16.78 ? 378 VAL B N   1 
ATOM   6923 C  CA  . VAL B 1 377 ? 61.488  7.001   -37.376 1.00 16.95 ? 378 VAL B CA  1 
ATOM   6924 C  C   . VAL B 1 377 ? 60.230  7.206   -36.537 1.00 17.17 ? 378 VAL B C   1 
ATOM   6925 O  O   . VAL B 1 377 ? 60.139  6.675   -35.431 1.00 17.53 ? 378 VAL B O   1 
ATOM   6926 C  CB  . VAL B 1 377 ? 61.743  5.493   -37.576 1.00 17.24 ? 378 VAL B CB  1 
ATOM   6927 C  CG1 . VAL B 1 377 ? 60.547  4.827   -38.251 1.00 17.66 ? 378 VAL B CG1 1 
ATOM   6928 C  CG2 . VAL B 1 377 ? 63.018  5.266   -38.387 1.00 16.85 ? 378 VAL B CG2 1 
ATOM   6929 N  N   . ALA B 1 378 ? 59.275  7.977   -37.058 1.00 16.94 ? 379 ALA B N   1 
ATOM   6930 C  CA  . ALA B 1 378 ? 58.058  8.288   -36.333 1.00 17.11 ? 379 ALA B CA  1 
ATOM   6931 C  C   . ALA B 1 378 ? 57.105  7.103   -36.336 1.00 17.79 ? 379 ALA B C   1 
ATOM   6932 O  O   . ALA B 1 378 ? 56.209  6.994   -37.184 1.00 18.23 ? 379 ALA B O   1 
ATOM   6933 C  CB  . ALA B 1 378 ? 57.394  9.516   -36.898 1.00 16.77 ? 379 ALA B CB  1 
ATOM   6934 N  N   . ILE B 1 379 ? 57.307  6.224   -35.362 1.00 17.84 ? 380 ILE B N   1 
ATOM   6935 C  CA  . ILE B 1 379 ? 56.585  4.966   -35.271 1.00 18.38 ? 380 ILE B CA  1 
ATOM   6936 C  C   . ILE B 1 379 ? 55.096  5.131   -34.969 1.00 17.77 ? 380 ILE B C   1 
ATOM   6937 O  O   . ILE B 1 379 ? 54.273  4.424   -35.561 1.00 17.04 ? 380 ILE B O   1 
ATOM   6938 C  CB  . ILE B 1 379 ? 57.308  3.982   -34.302 1.00 19.20 ? 380 ILE B CB  1 
ATOM   6939 C  CG1 . ILE B 1 379 ? 57.927  2.854   -35.112 1.00 20.15 ? 380 ILE B CG1 1 
ATOM   6940 C  CG2 . ILE B 1 379 ? 56.369  3.362   -33.293 1.00 20.43 ? 380 ILE B CG2 1 
ATOM   6941 C  CD1 . ILE B 1 379 ? 59.258  3.181   -35.665 1.00 22.24 ? 380 ILE B CD1 1 
ATOM   6942 N  N   . TYR B 1 380 ? 54.749  6.084   -34.095 1.00 17.31 ? 381 TYR B N   1 
ATOM   6943 C  CA  . TYR B 1 380 ? 53.342  6.402   -33.852 1.00 16.98 ? 381 TYR B CA  1 
ATOM   6944 C  C   . TYR B 1 380 ? 52.653  6.942   -35.118 1.00 17.03 ? 381 TYR B C   1 
ATOM   6945 O  O   . TYR B 1 380 ? 51.546  6.508   -35.463 1.00 17.00 ? 381 TYR B O   1 
ATOM   6946 C  CB  . TYR B 1 380 ? 53.163  7.399   -32.702 1.00 16.85 ? 381 TYR B CB  1 
ATOM   6947 C  CG  . TYR B 1 380 ? 51.708  7.783   -32.490 1.00 17.45 ? 381 TYR B CG  1 
ATOM   6948 C  CD1 . TYR B 1 380 ? 50.906  7.073   -31.588 1.00 17.13 ? 381 TYR B CD1 1 
ATOM   6949 C  CD2 . TYR B 1 380 ? 51.125  8.835   -33.212 1.00 17.38 ? 381 TYR B CD2 1 
ATOM   6950 C  CE1 . TYR B 1 380 ? 49.574  7.408   -31.396 1.00 17.80 ? 381 TYR B CE1 1 
ATOM   6951 C  CE2 . TYR B 1 380 ? 49.788  9.178   -33.032 1.00 17.74 ? 381 TYR B CE2 1 
ATOM   6952 C  CZ  . TYR B 1 380 ? 49.015  8.454   -32.125 1.00 18.70 ? 381 TYR B CZ  1 
ATOM   6953 O  OH  . TYR B 1 380 ? 47.688  8.782   -31.932 1.00 18.63 ? 381 TYR B OH  1 
ATOM   6954 N  N   . ALA B 1 381 ? 53.294  7.900   -35.790 1.00 16.73 ? 382 ALA B N   1 
ATOM   6955 C  CA  . ALA B 1 381 ? 52.715  8.474   -37.017 1.00 17.06 ? 382 ALA B CA  1 
ATOM   6956 C  C   . ALA B 1 381 ? 52.591  7.413   -38.112 1.00 16.90 ? 382 ALA B C   1 
ATOM   6957 O  O   . ALA B 1 381 ? 51.587  7.355   -38.821 1.00 16.96 ? 382 ALA B O   1 
ATOM   6958 C  CB  . ALA B 1 381 ? 53.530  9.672   -37.508 1.00 16.49 ? 382 ALA B CB  1 
ATOM   6959 N  N   . LEU B 1 382 ? 53.612  6.570   -38.237 1.00 17.22 ? 383 LEU B N   1 
ATOM   6960 C  CA  . LEU B 1 382 ? 53.572  5.460   -39.187 1.00 17.63 ? 383 LEU B CA  1 
ATOM   6961 C  C   . LEU B 1 382 ? 52.343  4.560   -38.968 1.00 17.79 ? 383 LEU B C   1 
ATOM   6962 O  O   . LEU B 1 382 ? 51.623  4.248   -39.910 1.00 18.00 ? 383 LEU B O   1 
ATOM   6963 C  CB  . LEU B 1 382 ? 54.882  4.674   -39.146 1.00 17.44 ? 383 LEU B CB  1 
ATOM   6964 C  CG  . LEU B 1 382 ? 54.979  3.265   -39.742 1.00 18.62 ? 383 LEU B CG  1 
ATOM   6965 C  CD1 . LEU B 1 382 ? 54.514  3.204   -41.198 1.00 18.34 ? 383 LEU B CD1 1 
ATOM   6966 C  CD2 . LEU B 1 382 ? 56.416  2.797   -39.625 1.00 18.26 ? 383 LEU B CD2 1 
ATOM   6967 N  N   . GLY B 1 383 ? 52.086  4.192   -37.719 1.00 18.26 ? 384 GLY B N   1 
ATOM   6968 C  CA  . GLY B 1 383 ? 50.998  3.288   -37.380 1.00 18.78 ? 384 GLY B CA  1 
ATOM   6969 C  C   . GLY B 1 383 ? 49.605  3.796   -37.692 1.00 19.56 ? 384 GLY B C   1 
ATOM   6970 O  O   . GLY B 1 383 ? 48.690  2.995   -37.909 1.00 20.05 ? 384 GLY B O   1 
ATOM   6971 N  N   . ARG B 1 384 ? 49.433  5.117   -37.701 1.00 20.15 ? 385 ARG B N   1 
ATOM   6972 C  CA  . ARG B 1 384 ? 48.127  5.724   -37.999 1.00 21.03 ? 385 ARG B CA  1 
ATOM   6973 C  C   . ARG B 1 384 ? 47.995  6.210   -39.452 1.00 21.12 ? 385 ARG B C   1 
ATOM   6974 O  O   . ARG B 1 384 ? 46.996  6.819   -39.803 1.00 21.30 ? 385 ARG B O   1 
ATOM   6975 C  CB  . ARG B 1 384 ? 47.817  6.903   -37.044 1.00 20.85 ? 385 ARG B CB  1 
ATOM   6976 C  CG  . ARG B 1 384 ? 48.019  6.641   -35.552 1.00 21.49 ? 385 ARG B CG  1 
ATOM   6977 C  CD  . ARG B 1 384 ? 47.125  5.531   -35.062 1.00 22.53 ? 385 ARG B CD  1 
ATOM   6978 N  NE  . ARG B 1 384 ? 47.295  5.238   -33.638 1.00 23.49 ? 385 ARG B NE  1 
ATOM   6979 C  CZ  . ARG B 1 384 ? 46.480  5.670   -32.678 1.00 24.18 ? 385 ARG B CZ  1 
ATOM   6980 N  NH1 . ARG B 1 384 ? 45.447  6.446   -32.972 1.00 24.67 ? 385 ARG B NH1 1 
ATOM   6981 N  NH2 . ARG B 1 384 ? 46.702  5.331   -31.416 1.00 24.97 ? 385 ARG B NH2 1 
ATOM   6982 N  N   . GLU B 1 385 ? 48.993  5.947   -40.282 1.00 21.64 ? 386 GLU B N   1 
ATOM   6983 C  CA  . GLU B 1 385 ? 49.030  6.506   -41.634 1.00 22.83 ? 386 GLU B CA  1 
ATOM   6984 C  C   . GLU B 1 385 ? 48.331  5.580   -42.667 1.00 22.98 ? 386 GLU B C   1 
ATOM   6985 O  O   . GLU B 1 385 ? 48.732  4.423   -42.841 1.00 22.45 ? 386 GLU B O   1 
ATOM   6986 C  CB  . GLU B 1 385 ? 50.483  6.843   -42.001 1.00 22.79 ? 386 GLU B CB  1 
ATOM   6987 C  CG  . GLU B 1 385 ? 50.764  7.266   -43.439 1.00 25.73 ? 386 GLU B CG  1 
ATOM   6988 C  CD  . GLU B 1 385 ? 49.826  8.334   -43.988 1.00 26.27 ? 386 GLU B CD  1 
ATOM   6989 O  OE1 . GLU B 1 385 ? 49.801  9.468   -43.467 1.00 26.31 ? 386 GLU B OE1 1 
ATOM   6990 O  OE2 . GLU B 1 385 ? 49.125  8.025   -44.971 1.00 27.98 ? 386 GLU B OE2 1 
ATOM   6991 N  N   . PRO B 1 386 ? 47.259  6.083   -43.325 1.00 23.33 ? 387 PRO B N   1 
ATOM   6992 C  CA  . PRO B 1 386 ? 46.477  5.212   -44.223 1.00 23.75 ? 387 PRO B CA  1 
ATOM   6993 C  C   . PRO B 1 386 ? 47.148  4.802   -45.538 1.00 24.23 ? 387 PRO B C   1 
ATOM   6994 O  O   . PRO B 1 386 ? 46.629  3.913   -46.221 1.00 24.71 ? 387 PRO B O   1 
ATOM   6995 C  CB  . PRO B 1 386 ? 45.180  5.996   -44.478 1.00 23.86 ? 387 PRO B CB  1 
ATOM   6996 C  CG  . PRO B 1 386 ? 45.453  7.391   -44.039 1.00 24.22 ? 387 PRO B CG  1 
ATOM   6997 C  CD  . PRO B 1 386 ? 46.559  7.344   -43.020 1.00 23.17 ? 387 PRO B CD  1 
ATOM   6998 N  N   . THR B 1 387 ? 48.279  5.418   -45.891 1.00 24.55 ? 388 THR B N   1 
ATOM   6999 C  CA  . THR B 1 387 ? 49.053  4.960   -47.053 1.00 24.66 ? 388 THR B CA  1 
ATOM   7000 C  C   . THR B 1 387 ? 49.934  3.764   -46.726 1.00 24.91 ? 388 THR B C   1 
ATOM   7001 O  O   . THR B 1 387 ? 50.363  3.051   -47.627 1.00 25.28 ? 388 THR B O   1 
ATOM   7002 C  CB  . THR B 1 387 ? 49.924  6.077   -47.712 1.00 24.89 ? 388 THR B CB  1 
ATOM   7003 O  OG1 . THR B 1 387 ? 50.813  6.656   -46.746 1.00 25.30 ? 388 THR B OG1 1 
ATOM   7004 C  CG2 . THR B 1 387 ? 49.046  7.169   -48.314 1.00 24.22 ? 388 THR B CG2 1 
ATOM   7005 N  N   . PHE B 1 388 ? 50.218  3.539   -45.444 1.00 24.91 ? 389 PHE B N   1 
ATOM   7006 C  CA  . PHE B 1 388 ? 51.079  2.419   -45.066 1.00 25.04 ? 389 PHE B CA  1 
ATOM   7007 C  C   . PHE B 1 388 ? 50.329  1.255   -44.409 1.00 24.77 ? 389 PHE B C   1 
ATOM   7008 O  O   . PHE B 1 388 ? 50.832  0.140   -44.375 1.00 24.21 ? 389 PHE B O   1 
ATOM   7009 C  CB  . PHE B 1 388 ? 52.256  2.878   -44.194 1.00 24.96 ? 389 PHE B CB  1 
ATOM   7010 C  CG  . PHE B 1 388 ? 53.073  3.975   -44.808 1.00 26.32 ? 389 PHE B CG  1 
ATOM   7011 C  CD1 . PHE B 1 388 ? 53.290  5.161   -44.123 1.00 26.59 ? 389 PHE B CD1 1 
ATOM   7012 C  CD2 . PHE B 1 388 ? 53.626  3.829   -46.080 1.00 27.24 ? 389 PHE B CD2 1 
ATOM   7013 C  CE1 . PHE B 1 388 ? 54.047  6.178   -44.691 1.00 26.84 ? 389 PHE B CE1 1 
ATOM   7014 C  CE2 . PHE B 1 388 ? 54.380  4.843   -46.652 1.00 26.55 ? 389 PHE B CE2 1 
ATOM   7015 C  CZ  . PHE B 1 388 ? 54.588  6.018   -45.958 1.00 26.31 ? 389 PHE B CZ  1 
ATOM   7016 N  N   . PHE B 1 389 ? 49.142  1.523   -43.876 1.00 25.03 ? 390 PHE B N   1 
ATOM   7017 C  CA  . PHE B 1 389 ? 48.290  0.471   -43.338 1.00 25.82 ? 390 PHE B CA  1 
ATOM   7018 C  C   . PHE B 1 389 ? 46.876  0.662   -43.842 1.00 26.84 ? 390 PHE B C   1 
ATOM   7019 O  O   . PHE B 1 389 ? 46.311  1.743   -43.716 1.00 26.97 ? 390 PHE B O   1 
ATOM   7020 C  CB  . PHE B 1 389 ? 48.299  0.445   -41.797 1.00 25.28 ? 390 PHE B CB  1 
ATOM   7021 C  CG  . PHE B 1 389 ? 49.623  0.066   -41.206 1.00 23.92 ? 390 PHE B CG  1 
ATOM   7022 C  CD1 . PHE B 1 389 ? 50.493  1.046   -40.734 1.00 22.42 ? 390 PHE B CD1 1 
ATOM   7023 C  CD2 . PHE B 1 389 ? 50.015  -1.267  -41.136 1.00 22.90 ? 390 PHE B CD2 1 
ATOM   7024 C  CE1 . PHE B 1 389 ? 51.730  0.702   -40.192 1.00 22.20 ? 390 PHE B CE1 1 
ATOM   7025 C  CE2 . PHE B 1 389 ? 51.260  -1.620  -40.592 1.00 22.60 ? 390 PHE B CE2 1 
ATOM   7026 C  CZ  . PHE B 1 389 ? 52.115  -0.627  -40.120 1.00 20.99 ? 390 PHE B CZ  1 
ATOM   7027 N  N   . PHE B 1 390 ? 46.313  -0.397  -44.411 1.00 28.35 ? 391 PHE B N   1 
ATOM   7028 C  CA  . PHE B 1 390 ? 44.930  -0.381  -44.847 1.00 30.02 ? 391 PHE B CA  1 
ATOM   7029 C  C   . PHE B 1 390 ? 44.009  -0.221  -43.647 1.00 30.48 ? 391 PHE B C   1 
ATOM   7030 O  O   . PHE B 1 390 ? 44.061  -1.023  -42.710 1.00 30.67 ? 391 PHE B O   1 
ATOM   7031 C  CB  . PHE B 1 390 ? 44.583  -1.665  -45.610 1.00 30.43 ? 391 PHE B CB  1 
ATOM   7032 C  CG  . PHE B 1 390 ? 43.140  -1.749  -46.006 1.00 32.41 ? 391 PHE B CG  1 
ATOM   7033 C  CD1 . PHE B 1 390 ? 42.698  -1.168  -47.193 1.00 33.76 ? 391 PHE B CD1 1 
ATOM   7034 C  CD2 . PHE B 1 390 ? 42.213  -2.390  -45.181 1.00 33.81 ? 391 PHE B CD2 1 
ATOM   7035 C  CE1 . PHE B 1 390 ? 41.351  -1.231  -47.560 1.00 34.59 ? 391 PHE B CE1 1 
ATOM   7036 C  CE2 . PHE B 1 390 ? 40.864  -2.459  -45.537 1.00 35.14 ? 391 PHE B CE2 1 
ATOM   7037 C  CZ  . PHE B 1 390 ? 40.432  -1.877  -46.729 1.00 34.98 ? 391 PHE B CZ  1 
ATOM   7038 N  N   . ASP B 1 391 ? 43.174  0.815   -43.684 1.00 31.34 ? 392 ASP B N   1 
ATOM   7039 C  CA  . ASP B 1 391 ? 42.231  1.114   -42.596 1.00 32.56 ? 392 ASP B CA  1 
ATOM   7040 C  C   . ASP B 1 391 ? 42.942  1.056   -41.223 1.00 32.51 ? 392 ASP B C   1 
ATOM   7041 O  O   . ASP B 1 391 ? 42.668  0.169   -40.415 1.00 32.94 ? 392 ASP B O   1 
ATOM   7042 C  CB  . ASP B 1 391 ? 41.021  0.159   -42.667 1.00 32.99 ? 392 ASP B CB  1 
ATOM   7043 C  CG  . ASP B 1 391 ? 39.866  0.586   -41.769 1.00 34.83 ? 392 ASP B CG  1 
ATOM   7044 O  OD1 . ASP B 1 391 ? 39.781  1.776   -41.398 1.00 37.09 ? 392 ASP B OD1 1 
ATOM   7045 O  OD2 . ASP B 1 391 ? 39.032  -0.282  -41.429 1.00 37.48 ? 392 ASP B OD2 1 
ATOM   7046 N  N   . PRO B 1 392 ? 43.860  2.012   -40.963 1.00 32.58 ? 393 PRO B N   1 
ATOM   7047 C  CA  . PRO B 1 392 ? 44.769  1.958   -39.801 1.00 32.34 ? 393 PRO B CA  1 
ATOM   7048 C  C   . PRO B 1 392 ? 44.098  2.043   -38.419 1.00 32.02 ? 393 PRO B C   1 
ATOM   7049 O  O   . PRO B 1 392 ? 44.623  1.493   -37.451 1.00 31.94 ? 393 PRO B O   1 
ATOM   7050 C  CB  . PRO B 1 392 ? 45.705  3.153   -40.031 1.00 32.31 ? 393 PRO B CB  1 
ATOM   7051 C  CG  . PRO B 1 392 ? 44.918  4.097   -40.868 1.00 32.36 ? 393 PRO B CG  1 
ATOM   7052 C  CD  . PRO B 1 392 ? 44.029  3.261   -41.736 1.00 32.30 ? 393 PRO B CD  1 
ATOM   7053 N  N   . GLU B 1 393 ? 42.952  2.707   -38.333 1.00 31.85 ? 394 GLU B N   1 
ATOM   7054 C  CA  . GLU B 1 393 ? 42.195  2.777   -37.079 1.00 31.90 ? 394 GLU B CA  1 
ATOM   7055 C  C   . GLU B 1 393 ? 41.537  1.447   -36.678 1.00 31.46 ? 394 GLU B C   1 
ATOM   7056 O  O   . GLU B 1 393 ? 41.091  1.284   -35.538 1.00 31.12 ? 394 GLU B O   1 
ATOM   7057 C  CB  . GLU B 1 393 ? 41.140  3.885   -37.143 1.00 32.35 ? 394 GLU B CB  1 
ATOM   7058 C  CG  . GLU B 1 393 ? 41.677  5.307   -36.896 1.00 34.61 ? 394 GLU B CG  1 
ATOM   7059 C  CD  . GLU B 1 393 ? 40.580  6.377   -36.950 1.00 38.11 ? 394 GLU B CD  1 
ATOM   7060 O  OE1 . GLU B 1 393 ? 39.427  6.043   -37.306 1.00 39.11 ? 394 GLU B OE1 1 
ATOM   7061 O  OE2 . GLU B 1 393 ? 40.869  7.556   -36.634 1.00 40.27 ? 394 GLU B OE2 1 
ATOM   7062 N  N   . ASN B 1 394 ? 41.473  0.498   -37.610 1.00 30.84 ? 395 ASN B N   1 
ATOM   7063 C  CA  . ASN B 1 394 ? 40.864  -0.794  -37.317 1.00 29.97 ? 395 ASN B CA  1 
ATOM   7064 C  C   . ASN B 1 394 ? 41.857  -1.729  -36.627 1.00 29.05 ? 395 ASN B C   1 
ATOM   7065 O  O   . ASN B 1 394 ? 43.007  -1.858  -37.062 1.00 29.03 ? 395 ASN B O   1 
ATOM   7066 C  CB  . ASN B 1 394 ? 40.310  -1.427  -38.602 1.00 30.33 ? 395 ASN B CB  1 
ATOM   7067 C  CG  . ASN B 1 394 ? 39.433  -2.648  -38.336 1.00 31.21 ? 395 ASN B CG  1 
ATOM   7068 O  OD1 . ASN B 1 394 ? 38.696  -2.709  -37.346 1.00 32.30 ? 395 ASN B OD1 1 
ATOM   7069 N  ND2 . ASN B 1 394 ? 39.499  -3.618  -39.234 1.00 32.22 ? 395 ASN B ND2 1 
ATOM   7070 N  N   . PHE B 1 395 ? 41.416  -2.367  -35.546 1.00 27.71 ? 396 PHE B N   1 
ATOM   7071 C  CA  . PHE B 1 395 ? 42.226  -3.378  -34.874 1.00 26.84 ? 396 PHE B CA  1 
ATOM   7072 C  C   . PHE B 1 395 ? 42.065  -4.704  -35.614 1.00 26.59 ? 396 PHE B C   1 
ATOM   7073 O  O   . PHE B 1 395 ? 41.012  -5.343  -35.540 1.00 26.28 ? 396 PHE B O   1 
ATOM   7074 C  CB  . PHE B 1 395 ? 41.851  -3.498  -33.389 1.00 26.17 ? 396 PHE B CB  1 
ATOM   7075 C  CG  . PHE B 1 395 ? 42.699  -4.482  -32.621 1.00 25.44 ? 396 PHE B CG  1 
ATOM   7076 C  CD1 . PHE B 1 395 ? 43.983  -4.142  -32.206 1.00 24.00 ? 396 PHE B CD1 1 
ATOM   7077 C  CD2 . PHE B 1 395 ? 42.209  -5.748  -32.303 1.00 23.68 ? 396 PHE B CD2 1 
ATOM   7078 C  CE1 . PHE B 1 395 ? 44.764  -5.039  -31.500 1.00 23.20 ? 396 PHE B CE1 1 
ATOM   7079 C  CE2 . PHE B 1 395 ? 42.985  -6.652  -31.591 1.00 23.74 ? 396 PHE B CE2 1 
ATOM   7080 C  CZ  . PHE B 1 395 ? 44.263  -6.301  -31.190 1.00 23.83 ? 396 PHE B CZ  1 
ATOM   7081 N  N   . ASP B 1 396 ? 43.110  -5.095  -36.343 1.00 26.52 ? 397 ASP B N   1 
ATOM   7082 C  CA  . ASP B 1 396 ? 43.039  -6.238  -37.254 1.00 26.64 ? 397 ASP B CA  1 
ATOM   7083 C  C   . ASP B 1 396 ? 44.313  -7.087  -37.262 1.00 26.14 ? 397 ASP B C   1 
ATOM   7084 O  O   . ASP B 1 396 ? 45.199  -6.861  -38.087 1.00 26.08 ? 397 ASP B O   1 
ATOM   7085 C  CB  . ASP B 1 396 ? 42.725  -5.761  -38.675 1.00 27.13 ? 397 ASP B CB  1 
ATOM   7086 C  CG  . ASP B 1 396 ? 42.136  -6.861  -39.539 1.00 29.15 ? 397 ASP B CG  1 
ATOM   7087 O  OD1 . ASP B 1 396 ? 40.907  -7.081  -39.462 1.00 33.63 ? 397 ASP B OD1 1 
ATOM   7088 O  OD2 . ASP B 1 396 ? 42.884  -7.516  -40.286 1.00 29.12 ? 397 ASP B OD2 1 
ATOM   7089 N  N   . PRO B 1 397 ? 44.400  -8.079  -36.355 1.00 25.71 ? 398 PRO B N   1 
ATOM   7090 C  CA  . PRO B 1 397 ? 45.563  -8.972  -36.268 1.00 25.61 ? 398 PRO B CA  1 
ATOM   7091 C  C   . PRO B 1 397 ? 45.939  -9.752  -37.546 1.00 25.56 ? 398 PRO B C   1 
ATOM   7092 O  O   . PRO B 1 397 ? 47.125  -10.016 -37.745 1.00 25.24 ? 398 PRO B O   1 
ATOM   7093 C  CB  . PRO B 1 397 ? 45.174  -9.943  -35.145 1.00 25.21 ? 398 PRO B CB  1 
ATOM   7094 C  CG  . PRO B 1 397 ? 44.228  -9.170  -34.309 1.00 25.63 ? 398 PRO B CG  1 
ATOM   7095 C  CD  . PRO B 1 397 ? 43.432  -8.345  -35.274 1.00 25.53 ? 398 PRO B CD  1 
ATOM   7096 N  N   . THR B 1 398 ? 44.956  -10.123 -38.378 1.00 25.59 ? 399 THR B N   1 
ATOM   7097 C  CA  . THR B 1 398 ? 45.213  -10.903 -39.621 1.00 26.10 ? 399 THR B CA  1 
ATOM   7098 C  C   . THR B 1 398 ? 46.103  -10.150 -40.611 1.00 26.30 ? 399 THR B C   1 
ATOM   7099 O  O   . THR B 1 398 ? 46.784  -10.759 -41.435 1.00 26.27 ? 399 THR B O   1 
ATOM   7100 C  CB  . THR B 1 398 ? 43.914  -11.311 -40.381 1.00 25.84 ? 399 THR B CB  1 
ATOM   7101 O  OG1 . THR B 1 398 ? 43.235  -10.135 -40.852 1.00 26.11 ? 399 THR B OG1 1 
ATOM   7102 C  CG2 . THR B 1 398 ? 42.974  -12.128 -39.492 1.00 26.16 ? 399 THR B CG2 1 
ATOM   7103 N  N   . ARG B 1 399 ? 46.058  -8.822  -40.529 1.00 26.48 ? 400 ARG B N   1 
ATOM   7104 C  CA  . ARG B 1 399 ? 46.993  -7.928  -41.212 1.00 27.08 ? 400 ARG B CA  1 
ATOM   7105 C  C   . ARG B 1 399 ? 48.430  -8.474  -41.206 1.00 27.44 ? 400 ARG B C   1 
ATOM   7106 O  O   . ARG B 1 399 ? 49.142  -8.366  -42.205 1.00 27.53 ? 400 ARG B O   1 
ATOM   7107 C  CB  . ARG B 1 399 ? 46.916  -6.556  -40.527 1.00 27.08 ? 400 ARG B CB  1 
ATOM   7108 C  CG  . ARG B 1 399 ? 47.906  -5.520  -40.947 1.00 26.86 ? 400 ARG B CG  1 
ATOM   7109 C  CD  . ARG B 1 399 ? 47.932  -4.326  -39.971 1.00 25.91 ? 400 ARG B CD  1 
ATOM   7110 N  NE  . ARG B 1 399 ? 46.617  -3.791  -39.580 1.00 24.76 ? 400 ARG B NE  1 
ATOM   7111 C  CZ  . ARG B 1 399 ? 45.831  -3.024  -40.338 1.00 25.80 ? 400 ARG B CZ  1 
ATOM   7112 N  NH1 . ARG B 1 399 ? 46.178  -2.697  -41.579 1.00 24.85 ? 400 ARG B NH1 1 
ATOM   7113 N  NH2 . ARG B 1 399 ? 44.674  -2.587  -39.856 1.00 25.65 ? 400 ARG B NH2 1 
ATOM   7114 N  N   . TRP B 1 400 ? 48.832  -9.076  -40.084 1.00 27.87 ? 401 TRP B N   1 
ATOM   7115 C  CA  . TRP B 1 400 ? 50.190  -9.608  -39.891 1.00 28.47 ? 401 TRP B CA  1 
ATOM   7116 C  C   . TRP B 1 400 ? 50.393  -11.048 -40.393 1.00 29.84 ? 401 TRP B C   1 
ATOM   7117 O  O   . TRP B 1 400 ? 51.498  -11.585 -40.328 1.00 29.61 ? 401 TRP B O   1 
ATOM   7118 C  CB  . TRP B 1 400 ? 50.590  -9.491  -38.416 1.00 27.72 ? 401 TRP B CB  1 
ATOM   7119 C  CG  . TRP B 1 400 ? 50.541  -8.080  -37.949 1.00 25.89 ? 401 TRP B CG  1 
ATOM   7120 C  CD1 . TRP B 1 400 ? 49.521  -7.470  -37.272 1.00 23.26 ? 401 TRP B CD1 1 
ATOM   7121 C  CD2 . TRP B 1 400 ? 51.535  -7.078  -38.174 1.00 23.62 ? 401 TRP B CD2 1 
ATOM   7122 N  NE1 . TRP B 1 400 ? 49.832  -6.150  -37.049 1.00 23.29 ? 401 TRP B NE1 1 
ATOM   7123 C  CE2 . TRP B 1 400 ? 51.063  -5.883  -37.592 1.00 22.90 ? 401 TRP B CE2 1 
ATOM   7124 C  CE3 . TRP B 1 400 ? 52.787  -7.077  -38.803 1.00 23.17 ? 401 TRP B CE3 1 
ATOM   7125 C  CZ2 . TRP B 1 400 ? 51.801  -4.693  -37.618 1.00 22.28 ? 401 TRP B CZ2 1 
ATOM   7126 C  CZ3 . TRP B 1 400 ? 53.520  -5.893  -38.827 1.00 22.91 ? 401 TRP B CZ3 1 
ATOM   7127 C  CH2 . TRP B 1 400 ? 53.021  -4.720  -38.235 1.00 21.35 ? 401 TRP B CH2 1 
ATOM   7128 N  N   . LEU B 1 401 ? 49.323  -11.659 -40.893 1.00 31.92 ? 402 LEU B N   1 
ATOM   7129 C  CA  . LEU B 1 401 ? 49.388  -13.006 -41.449 1.00 34.15 ? 402 LEU B CA  1 
ATOM   7130 C  C   . LEU B 1 401 ? 49.269  -13.006 -42.975 1.00 35.99 ? 402 LEU B C   1 
ATOM   7131 O  O   . LEU B 1 401 ? 49.285  -14.068 -43.601 1.00 36.51 ? 402 LEU B O   1 
ATOM   7132 C  CB  . LEU B 1 401 ? 48.307  -13.893 -40.816 1.00 33.82 ? 402 LEU B CB  1 
ATOM   7133 C  CG  . LEU B 1 401 ? 48.365  -14.065 -39.292 1.00 33.70 ? 402 LEU B CG  1 
ATOM   7134 C  CD1 . LEU B 1 401 ? 47.217  -14.939 -38.797 1.00 33.80 ? 402 LEU B CD1 1 
ATOM   7135 C  CD2 . LEU B 1 401 ? 49.704  -14.626 -38.836 1.00 32.99 ? 402 LEU B CD2 1 
ATOM   7136 N  N   . SER B 1 402 ? 49.146  -11.813 -43.559 1.00 37.98 ? 403 SER B N   1 
ATOM   7137 C  CA  . SER B 1 402 ? 49.017  -11.635 -45.007 1.00 40.30 ? 403 SER B CA  1 
ATOM   7138 C  C   . SER B 1 402 ? 50.211  -12.238 -45.752 1.00 41.82 ? 403 SER B C   1 
ATOM   7139 O  O   . SER B 1 402 ? 51.367  -11.992 -45.392 1.00 42.06 ? 403 SER B O   1 
ATOM   7140 C  CB  . SER B 1 402 ? 48.873  -10.144 -45.346 1.00 40.22 ? 403 SER B CB  1 
ATOM   7141 O  OG  . SER B 1 402 ? 48.738  -9.928  -46.742 1.00 40.81 ? 403 SER B OG  1 
ATOM   7142 N  N   . LYS B 1 403 ? 49.920  -13.035 -46.781 1.00 43.78 ? 404 LYS B N   1 
ATOM   7143 C  CA  . LYS B 1 403 ? 50.959  -13.734 -47.558 1.00 45.67 ? 404 LYS B CA  1 
ATOM   7144 C  C   . LYS B 1 403 ? 51.606  -12.826 -48.612 1.00 46.33 ? 404 LYS B C   1 
ATOM   7145 O  O   . LYS B 1 403 ? 52.621  -13.187 -49.217 1.00 46.74 ? 404 LYS B O   1 
ATOM   7146 C  CB  . LYS B 1 403 ? 50.396  -15.007 -48.216 1.00 45.91 ? 404 LYS B CB  1 
ATOM   7147 C  CG  . LYS B 1 403 ? 49.575  -15.919 -47.285 1.00 47.72 ? 404 LYS B CG  1 
ATOM   7148 C  CD  . LYS B 1 403 ? 50.442  -16.615 -46.226 1.00 50.11 ? 404 LYS B CD  1 
ATOM   7149 C  CE  . LYS B 1 403 ? 49.584  -17.233 -45.127 1.00 50.90 ? 404 LYS B CE  1 
ATOM   7150 N  NZ  . LYS B 1 403 ? 50.408  -17.972 -44.129 1.00 52.00 ? 404 LYS B NZ  1 
ATOM   7151 N  N   . ASP B 1 404 ? 51.006  -11.655 -48.821 1.00 47.05 ? 405 ASP B N   1 
ATOM   7152 C  CA  . ASP B 1 404 ? 51.529  -10.618 -49.714 1.00 47.62 ? 405 ASP B CA  1 
ATOM   7153 C  C   . ASP B 1 404 ? 53.000  -10.295 -49.400 1.00 47.83 ? 405 ASP B C   1 
ATOM   7154 O  O   . ASP B 1 404 ? 53.829  -10.177 -50.316 1.00 48.14 ? 405 ASP B O   1 
ATOM   7155 C  CB  . ASP B 1 404 ? 50.648  -9.363  -49.590 1.00 47.75 ? 405 ASP B CB  1 
ATOM   7156 C  CG  . ASP B 1 404 ? 50.956  -8.301  -50.639 1.00 48.79 ? 405 ASP B CG  1 
ATOM   7157 O  OD1 . ASP B 1 404 ? 50.009  -7.592  -51.052 1.00 49.91 ? 405 ASP B OD1 1 
ATOM   7158 O  OD2 . ASP B 1 404 ? 52.129  -8.151  -51.045 1.00 49.31 ? 405 ASP B OD2 1 
ATOM   7159 N  N   . LYS B 1 405 ? 53.308  -10.169 -48.107 1.00 47.59 ? 406 LYS B N   1 
ATOM   7160 C  CA  . LYS B 1 405 ? 54.668  -9.891  -47.600 1.00 47.34 ? 406 LYS B CA  1 
ATOM   7161 C  C   . LYS B 1 405 ? 55.241  -8.544  -48.067 1.00 46.69 ? 406 LYS B C   1 
ATOM   7162 O  O   . LYS B 1 405 ? 56.432  -8.275  -47.911 1.00 46.94 ? 406 LYS B O   1 
ATOM   7163 C  CB  . LYS B 1 405 ? 55.643  -11.049 -47.887 1.00 47.60 ? 406 LYS B CB  1 
ATOM   7164 C  CG  . LYS B 1 405 ? 55.177  -12.445 -47.428 1.00 48.52 ? 406 LYS B CG  1 
ATOM   7165 C  CD  . LYS B 1 405 ? 55.229  -12.642 -45.914 1.00 50.23 ? 406 LYS B CD  1 
ATOM   7166 C  CE  . LYS B 1 405 ? 54.768  -14.048 -45.539 1.00 51.40 ? 406 LYS B CE  1 
ATOM   7167 N  NZ  . LYS B 1 405 ? 54.531  -14.225 -44.075 1.00 51.96 ? 406 LYS B NZ  1 
ATOM   7168 N  N   . ASN B 1 406 ? 54.376  -7.706  -48.632 1.00 45.84 ? 407 ASN B N   1 
ATOM   7169 C  CA  . ASN B 1 406 ? 54.690  -6.308  -48.921 1.00 44.82 ? 407 ASN B CA  1 
ATOM   7170 C  C   . ASN B 1 406 ? 53.957  -5.442  -47.912 1.00 43.69 ? 407 ASN B C   1 
ATOM   7171 O  O   . ASN B 1 406 ? 54.305  -4.281  -47.682 1.00 43.75 ? 407 ASN B O   1 
ATOM   7172 C  CB  . ASN B 1 406 ? 54.215  -5.943  -50.324 1.00 45.14 ? 407 ASN B CB  1 
ATOM   7173 C  CG  . ASN B 1 406 ? 55.118  -4.944  -51.002 1.00 46.28 ? 407 ASN B CG  1 
ATOM   7174 O  OD1 . ASN B 1 406 ? 56.223  -5.287  -51.431 1.00 47.72 ? 407 ASN B OD1 1 
ATOM   7175 N  ND2 . ASN B 1 406 ? 54.653  -3.701  -51.120 1.00 46.93 ? 407 ASN B ND2 1 
ATOM   7176 N  N   . ILE B 1 407 ? 52.927  -6.039  -47.322 1.00 42.09 ? 408 ILE B N   1 
ATOM   7177 C  CA  . ILE B 1 407 ? 52.052  -5.395  -46.358 1.00 40.44 ? 408 ILE B CA  1 
ATOM   7178 C  C   . ILE B 1 407 ? 52.725  -5.252  -44.983 1.00 39.18 ? 408 ILE B C   1 
ATOM   7179 O  O   . ILE B 1 407 ? 52.405  -4.333  -44.229 1.00 38.88 ? 408 ILE B O   1 
ATOM   7180 C  CB  . ILE B 1 407 ? 50.676  -6.147  -46.302 1.00 40.69 ? 408 ILE B CB  1 
ATOM   7181 C  CG1 . ILE B 1 407 ? 49.741  -5.594  -47.388 1.00 40.82 ? 408 ILE B CG1 1 
ATOM   7182 C  CG2 . ILE B 1 407 ? 50.022  -6.075  -44.917 1.00 40.18 ? 408 ILE B CG2 1 
ATOM   7183 C  CD1 . ILE B 1 407 ? 48.509  -6.438  -47.662 1.00 41.22 ? 408 ILE B CD1 1 
ATOM   7184 N  N   . THR B 1 408 ? 53.673  -6.138  -44.683 1.00 37.51 ? 409 THR B N   1 
ATOM   7185 C  CA  . THR B 1 408 ? 54.344  -6.142  -43.379 1.00 36.19 ? 409 THR B CA  1 
ATOM   7186 C  C   . THR B 1 408 ? 55.804  -5.667  -43.423 1.00 35.12 ? 409 THR B C   1 
ATOM   7187 O  O   . THR B 1 408 ? 56.483  -5.646  -42.392 1.00 34.90 ? 409 THR B O   1 
ATOM   7188 C  CB  . THR B 1 408 ? 54.300  -7.539  -42.713 1.00 36.26 ? 409 THR B CB  1 
ATOM   7189 O  OG1 . THR B 1 408 ? 54.931  -8.498  -43.571 1.00 36.63 ? 409 THR B OG1 1 
ATOM   7190 C  CG2 . THR B 1 408 ? 52.869  -7.965  -42.433 1.00 36.14 ? 409 THR B CG2 1 
ATOM   7191 N  N   . TYR B 1 409 ? 56.277  -5.282  -44.608 1.00 33.65 ? 410 TYR B N   1 
ATOM   7192 C  CA  . TYR B 1 409 ? 57.670  -4.862  -44.793 1.00 32.28 ? 410 TYR B CA  1 
ATOM   7193 C  C   . TYR B 1 409 ? 58.060  -3.670  -43.896 1.00 30.90 ? 410 TYR B C   1 
ATOM   7194 O  O   . TYR B 1 409 ? 57.497  -2.578  -44.020 1.00 30.32 ? 410 TYR B O   1 
ATOM   7195 C  CB  . TYR B 1 409 ? 57.940  -4.542  -46.270 1.00 32.51 ? 410 TYR B CB  1 
ATOM   7196 C  CG  . TYR B 1 409 ? 59.405  -4.367  -46.583 1.00 33.46 ? 410 TYR B CG  1 
ATOM   7197 C  CD1 . TYR B 1 409 ? 60.285  -5.447  -46.501 1.00 34.67 ? 410 TYR B CD1 1 
ATOM   7198 C  CD2 . TYR B 1 409 ? 59.918  -3.119  -46.947 1.00 33.93 ? 410 TYR B CD2 1 
ATOM   7199 C  CE1 . TYR B 1 409 ? 61.640  -5.294  -46.780 1.00 35.82 ? 410 TYR B CE1 1 
ATOM   7200 C  CE2 . TYR B 1 409 ? 61.271  -2.956  -47.235 1.00 34.80 ? 410 TYR B CE2 1 
ATOM   7201 C  CZ  . TYR B 1 409 ? 62.122  -4.046  -47.144 1.00 35.61 ? 410 TYR B CZ  1 
ATOM   7202 O  OH  . TYR B 1 409 ? 63.456  -3.901  -47.415 1.00 37.04 ? 410 TYR B OH  1 
ATOM   7203 N  N   . PHE B 1 410 ? 59.022  -3.909  -43.001 1.00 29.29 ? 411 PHE B N   1 
ATOM   7204 C  CA  . PHE B 1 410 ? 59.479  -2.930  -41.997 1.00 28.11 ? 411 PHE B CA  1 
ATOM   7205 C  C   . PHE B 1 410 ? 58.347  -2.184  -41.268 1.00 27.44 ? 411 PHE B C   1 
ATOM   7206 O  O   . PHE B 1 410 ? 58.392  -0.960  -41.117 1.00 26.83 ? 411 PHE B O   1 
ATOM   7207 C  CB  . PHE B 1 410 ? 60.511  -1.958  -42.609 1.00 28.03 ? 411 PHE B CB  1 
ATOM   7208 C  CG  . PHE B 1 410 ? 61.910  -2.514  -42.645 1.00 27.18 ? 411 PHE B CG  1 
ATOM   7209 C  CD1 . PHE B 1 410 ? 62.315  -3.349  -43.685 1.00 26.79 ? 411 PHE B CD1 1 
ATOM   7210 C  CD2 . PHE B 1 410 ? 62.810  -2.233  -41.621 1.00 26.58 ? 411 PHE B CD2 1 
ATOM   7211 C  CE1 . PHE B 1 410 ? 63.605  -3.879  -43.713 1.00 26.47 ? 411 PHE B CE1 1 
ATOM   7212 C  CE2 . PHE B 1 410 ? 64.095  -2.763  -41.633 1.00 26.58 ? 411 PHE B CE2 1 
ATOM   7213 C  CZ  . PHE B 1 410 ? 64.496  -3.585  -42.689 1.00 26.77 ? 411 PHE B CZ  1 
ATOM   7214 N  N   . ARG B 1 411 ? 57.338  -2.935  -40.827 1.00 27.04 ? 412 ARG B N   1 
ATOM   7215 C  CA  . ARG B 1 411 ? 56.190  -2.367  -40.110 1.00 27.15 ? 412 ARG B CA  1 
ATOM   7216 C  C   . ARG B 1 411 ? 56.158  -2.786  -38.636 1.00 26.27 ? 412 ARG B C   1 
ATOM   7217 O  O   . ARG B 1 411 ? 55.526  -2.122  -37.820 1.00 26.52 ? 412 ARG B O   1 
ATOM   7218 C  CB  . ARG B 1 411 ? 54.859  -2.761  -40.772 1.00 27.61 ? 412 ARG B CB  1 
ATOM   7219 C  CG  . ARG B 1 411 ? 54.860  -2.778  -42.293 1.00 29.19 ? 412 ARG B CG  1 
ATOM   7220 C  CD  . ARG B 1 411 ? 54.246  -1.564  -42.958 1.00 31.25 ? 412 ARG B CD  1 
ATOM   7221 N  NE  . ARG B 1 411 ? 54.778  -1.425  -44.321 1.00 33.17 ? 412 ARG B NE  1 
ATOM   7222 C  CZ  . ARG B 1 411 ? 54.104  -0.943  -45.353 1.00 33.44 ? 412 ARG B CZ  1 
ATOM   7223 N  NH1 . ARG B 1 411 ? 52.848  -0.561  -45.222 1.00 34.81 ? 412 ARG B NH1 1 
ATOM   7224 N  NH2 . ARG B 1 411 ? 54.687  -0.854  -46.530 1.00 36.28 ? 412 ARG B NH2 1 
ATOM   7225 N  N   . ASN B 1 412 ? 56.827  -3.890  -38.306 1.00 25.24 ? 413 ASN B N   1 
ATOM   7226 C  CA  . ASN B 1 412 ? 56.818  -4.440  -36.944 1.00 24.31 ? 413 ASN B CA  1 
ATOM   7227 C  C   . ASN B 1 412 ? 57.946  -3.830  -36.115 1.00 23.25 ? 413 ASN B C   1 
ATOM   7228 O  O   . ASN B 1 412 ? 58.945  -4.488  -35.822 1.00 23.21 ? 413 ASN B O   1 
ATOM   7229 C  CB  . ASN B 1 412 ? 56.925  -5.982  -36.978 1.00 24.52 ? 413 ASN B CB  1 
ATOM   7230 C  CG  . ASN B 1 412 ? 56.805  -6.626  -35.590 1.00 25.45 ? 413 ASN B CG  1 
ATOM   7231 O  OD1 . ASN B 1 412 ? 56.194  -6.070  -34.677 1.00 27.14 ? 413 ASN B OD1 1 
ATOM   7232 N  ND2 . ASN B 1 412 ? 57.386  -7.808  -35.439 1.00 26.21 ? 413 ASN B ND2 1 
ATOM   7233 N  N   . LEU B 1 413 ? 57.778  -2.575  -35.720 1.00 21.70 ? 414 LEU B N   1 
ATOM   7234 C  CA  . LEU B 1 413 ? 58.899  -1.823  -35.165 1.00 20.86 ? 414 LEU B CA  1 
ATOM   7235 C  C   . LEU B 1 413 ? 58.807  -1.465  -33.670 1.00 20.35 ? 414 LEU B C   1 
ATOM   7236 O  O   . LEU B 1 413 ? 59.694  -0.797  -33.137 1.00 20.16 ? 414 LEU B O   1 
ATOM   7237 C  CB  . LEU B 1 413 ? 59.130  -0.565  -35.994 1.00 20.61 ? 414 LEU B CB  1 
ATOM   7238 C  CG  . LEU B 1 413 ? 59.445  -0.746  -37.481 1.00 20.54 ? 414 LEU B CG  1 
ATOM   7239 C  CD1 . LEU B 1 413 ? 59.186  0.567   -38.206 1.00 20.83 ? 414 LEU B CD1 1 
ATOM   7240 C  CD2 . LEU B 1 413 ? 60.872  -1.205  -37.674 1.00 19.35 ? 414 LEU B CD2 1 
ATOM   7241 N  N   . GLY B 1 414 ? 57.751  -1.924  -33.009 1.00 19.43 ? 415 GLY B N   1 
ATOM   7242 C  CA  . GLY B 1 414 ? 57.515  -1.633  -31.595 1.00 19.38 ? 415 GLY B CA  1 
ATOM   7243 C  C   . GLY B 1 414 ? 58.661  -1.911  -30.627 1.00 19.03 ? 415 GLY B C   1 
ATOM   7244 O  O   . GLY B 1 414 ? 58.767  -1.237  -29.607 1.00 18.96 ? 415 GLY B O   1 
ATOM   7245 N  N   . PHE B 1 415 ? 59.501  -2.900  -30.941 1.00 18.52 ? 416 PHE B N   1 
ATOM   7246 C  CA  . PHE B 1 415 ? 60.676  -3.236  -30.122 1.00 18.44 ? 416 PHE B CA  1 
ATOM   7247 C  C   . PHE B 1 415 ? 61.988  -2.804  -30.783 1.00 18.40 ? 416 PHE B C   1 
ATOM   7248 O  O   . PHE B 1 415 ? 63.073  -3.244  -30.384 1.00 18.26 ? 416 PHE B O   1 
ATOM   7249 C  CB  . PHE B 1 415 ? 60.738  -4.741  -29.847 1.00 17.97 ? 416 PHE B CB  1 
ATOM   7250 C  CG  . PHE B 1 415 ? 59.617  -5.257  -28.993 1.00 17.56 ? 416 PHE B CG  1 
ATOM   7251 C  CD1 . PHE B 1 415 ? 58.517  -5.886  -29.574 1.00 17.20 ? 416 PHE B CD1 1 
ATOM   7252 C  CD2 . PHE B 1 415 ? 59.678  -5.153  -27.610 1.00 16.70 ? 416 PHE B CD2 1 
ATOM   7253 C  CE1 . PHE B 1 415 ? 57.484  -6.377  -28.792 1.00 16.84 ? 416 PHE B CE1 1 
ATOM   7254 C  CE2 . PHE B 1 415 ? 58.647  -5.645  -26.812 1.00 17.03 ? 416 PHE B CE2 1 
ATOM   7255 C  CZ  . PHE B 1 415 ? 57.551  -6.259  -27.403 1.00 17.16 ? 416 PHE B CZ  1 
ATOM   7256 N  N   . GLY B 1 416 ? 61.884  -1.956  -31.800 1.00 18.38 ? 417 GLY B N   1 
ATOM   7257 C  CA  . GLY B 1 416 ? 63.045  -1.543  -32.568 1.00 18.76 ? 417 GLY B CA  1 
ATOM   7258 C  C   . GLY B 1 416 ? 63.554  -2.616  -33.509 1.00 19.18 ? 417 GLY B C   1 
ATOM   7259 O  O   . GLY B 1 416 ? 62.793  -3.474  -33.963 1.00 18.77 ? 417 GLY B O   1 
ATOM   7260 N  N   . TRP B 1 417 ? 64.852  -2.570  -33.795 1.00 19.60 ? 418 TRP B N   1 
ATOM   7261 C  CA  . TRP B 1 417 ? 65.431  -3.380  -34.863 1.00 20.32 ? 418 TRP B CA  1 
ATOM   7262 C  C   . TRP B 1 417 ? 66.910  -3.636  -34.604 1.00 19.70 ? 418 TRP B C   1 
ATOM   7263 O  O   . TRP B 1 417 ? 67.592  -2.805  -33.997 1.00 19.41 ? 418 TRP B O   1 
ATOM   7264 C  CB  . TRP B 1 417 ? 65.266  -2.655  -36.204 1.00 21.02 ? 418 TRP B CB  1 
ATOM   7265 C  CG  . TRP B 1 417 ? 65.658  -3.482  -37.410 1.00 24.95 ? 418 TRP B CG  1 
ATOM   7266 C  CD1 . TRP B 1 417 ? 64.851  -4.331  -38.116 1.00 26.87 ? 418 TRP B CD1 1 
ATOM   7267 C  CD2 . TRP B 1 417 ? 66.953  -3.543  -38.042 1.00 27.71 ? 418 TRP B CD2 1 
ATOM   7268 N  NE1 . TRP B 1 417 ? 65.561  -4.922  -39.137 1.00 28.33 ? 418 TRP B NE1 1 
ATOM   7269 C  CE2 . TRP B 1 417 ? 66.850  -4.456  -39.118 1.00 28.29 ? 418 TRP B CE2 1 
ATOM   7270 C  CE3 . TRP B 1 417 ? 68.188  -2.923  -37.797 1.00 29.34 ? 418 TRP B CE3 1 
ATOM   7271 C  CZ2 . TRP B 1 417 ? 67.932  -4.760  -39.961 1.00 29.67 ? 418 TRP B CZ2 1 
ATOM   7272 C  CZ3 . TRP B 1 417 ? 69.270  -3.229  -38.632 1.00 30.67 ? 418 TRP B CZ3 1 
ATOM   7273 C  CH2 . TRP B 1 417 ? 69.129  -4.139  -39.704 1.00 30.46 ? 418 TRP B CH2 1 
ATOM   7274 N  N   . GLY B 1 418 ? 67.390  -4.794  -35.058 1.00 19.13 ? 419 GLY B N   1 
ATOM   7275 C  CA  . GLY B 1 418 ? 68.820  -5.082  -35.125 1.00 18.13 ? 419 GLY B CA  1 
ATOM   7276 C  C   . GLY B 1 418 ? 69.425  -5.461  -33.799 1.00 18.13 ? 419 GLY B C   1 
ATOM   7277 O  O   . GLY B 1 418 ? 68.715  -5.893  -32.877 1.00 17.84 ? 419 GLY B O   1 
ATOM   7278 N  N   . VAL B 1 419 ? 70.744  -5.294  -33.707 1.00 17.83 ? 420 VAL B N   1 
ATOM   7279 C  CA  . VAL B 1 419 ? 71.535  -5.721  -32.542 1.00 17.25 ? 420 VAL B CA  1 
ATOM   7280 C  C   . VAL B 1 419 ? 71.246  -4.924  -31.279 1.00 16.62 ? 420 VAL B C   1 
ATOM   7281 O  O   . VAL B 1 419 ? 71.462  -5.417  -30.172 1.00 16.40 ? 420 VAL B O   1 
ATOM   7282 C  CB  . VAL B 1 419 ? 73.074  -5.685  -32.823 1.00 17.85 ? 420 VAL B CB  1 
ATOM   7283 C  CG1 . VAL B 1 419 ? 73.458  -6.781  -33.802 1.00 18.99 ? 420 VAL B CG1 1 
ATOM   7284 C  CG2 . VAL B 1 419 ? 73.521  -4.317  -33.349 1.00 17.34 ? 420 VAL B CG2 1 
ATOM   7285 N  N   . ARG B 1 420 ? 70.765  -3.692  -31.440 1.00 16.12 ? 421 ARG B N   1 
ATOM   7286 C  CA  . ARG B 1 420 ? 70.430  -2.857  -30.279 1.00 15.28 ? 421 ARG B CA  1 
ATOM   7287 C  C   . ARG B 1 420 ? 68.906  -2.666  -30.097 1.00 14.94 ? 421 ARG B C   1 
ATOM   7288 O  O   . ARG B 1 420 ? 68.455  -1.708  -29.460 1.00 14.99 ? 421 ARG B O   1 
ATOM   7289 C  CB  . ARG B 1 420 ? 71.197  -1.523  -30.308 1.00 15.09 ? 421 ARG B CB  1 
ATOM   7290 C  CG  . ARG B 1 420 ? 71.109  -0.738  -28.983 1.00 15.59 ? 421 ARG B CG  1 
ATOM   7291 C  CD  . ARG B 1 420 ? 72.277  0.199   -28.772 1.00 15.80 ? 421 ARG B CD  1 
ATOM   7292 N  NE  . ARG B 1 420 ? 72.320  0.692   -27.401 1.00 15.81 ? 421 ARG B NE  1 
ATOM   7293 C  CZ  . ARG B 1 420 ? 73.175  1.607   -26.951 1.00 16.81 ? 421 ARG B CZ  1 
ATOM   7294 N  NH1 . ARG B 1 420 ? 74.073  2.163   -27.761 1.00 15.45 ? 421 ARG B NH1 1 
ATOM   7295 N  NH2 . ARG B 1 420 ? 73.116  1.980   -25.685 1.00 16.37 ? 421 ARG B NH2 1 
ATOM   7296 N  N   . GLN B 1 421 ? 68.122  -3.599  -30.641 1.00 14.22 ? 422 GLN B N   1 
ATOM   7297 C  CA  . GLN B 1 421 ? 66.682  -3.658  -30.376 1.00 14.10 ? 422 GLN B CA  1 
ATOM   7298 C  C   . GLN B 1 421 ? 66.411  -3.861  -28.880 1.00 13.82 ? 422 GLN B C   1 
ATOM   7299 O  O   . GLN B 1 421 ? 67.333  -4.099  -28.108 1.00 13.70 ? 422 GLN B O   1 
ATOM   7300 C  CB  . GLN B 1 421 ? 66.035  -4.793  -31.172 1.00 13.96 ? 422 GLN B CB  1 
ATOM   7301 C  CG  . GLN B 1 421 ? 66.427  -6.165  -30.690 1.00 16.30 ? 422 GLN B CG  1 
ATOM   7302 C  CD  . GLN B 1 421 ? 65.846  -7.268  -31.544 1.00 20.92 ? 422 GLN B CD  1 
ATOM   7303 O  OE1 . GLN B 1 421 ? 66.519  -7.802  -32.419 1.00 22.98 ? 422 GLN B OE1 1 
ATOM   7304 N  NE2 . GLN B 1 421 ? 64.581  -7.605  -31.304 1.00 21.65 ? 422 GLN B NE2 1 
ATOM   7305 N  N   . CYS B 1 422 ? 65.146  -3.788  -28.479 1.00 13.94 ? 423 CYS B N   1 
ATOM   7306 C  CA  . CYS B 1 422 ? 64.768  -3.988  -27.073 1.00 14.03 ? 423 CYS B CA  1 
ATOM   7307 C  C   . CYS B 1 422 ? 65.444  -5.214  -26.455 1.00 14.14 ? 423 CYS B C   1 
ATOM   7308 O  O   . CYS B 1 422 ? 65.334  -6.323  -26.981 1.00 14.12 ? 423 CYS B O   1 
ATOM   7309 C  CB  . CYS B 1 422 ? 63.250  -4.124  -26.933 1.00 13.52 ? 423 CYS B CB  1 
ATOM   7310 S  SG  . CYS B 1 422 ? 62.716  -4.388  -25.217 1.00 14.64 ? 423 CYS B SG  1 
ATOM   7311 N  N   . LEU B 1 423 ? 66.135  -5.013  -25.336 1.00 14.49 ? 424 LEU B N   1 
ATOM   7312 C  CA  . LEU B 1 423 ? 66.774  -6.130  -24.632 1.00 15.00 ? 424 LEU B CA  1 
ATOM   7313 C  C   . LEU B 1 423 ? 65.734  -7.061  -23.996 1.00 15.15 ? 424 LEU B C   1 
ATOM   7314 O  O   . LEU B 1 423 ? 65.935  -8.279  -23.924 1.00 15.25 ? 424 LEU B O   1 
ATOM   7315 C  CB  . LEU B 1 423 ? 67.767  -5.619  -23.580 1.00 14.86 ? 424 LEU B CB  1 
ATOM   7316 C  CG  . LEU B 1 423 ? 68.459  -6.622  -22.642 1.00 16.10 ? 424 LEU B CG  1 
ATOM   7317 C  CD1 . LEU B 1 423 ? 69.453  -7.483  -23.418 1.00 16.68 ? 424 LEU B CD1 1 
ATOM   7318 C  CD2 . LEU B 1 423 ? 69.159  -5.881  -21.485 1.00 16.34 ? 424 LEU B CD2 1 
ATOM   7319 N  N   . GLY B 1 424 ? 64.624  -6.484  -23.542 1.00 14.67 ? 425 GLY B N   1 
ATOM   7320 C  CA  . GLY B 1 424 ? 63.588  -7.266  -22.890 1.00 14.68 ? 425 GLY B CA  1 
ATOM   7321 C  C   . GLY B 1 424 ? 62.562  -7.855  -23.842 1.00 14.67 ? 425 GLY B C   1 
ATOM   7322 O  O   . GLY B 1 424 ? 61.529  -8.329  -23.399 1.00 14.32 ? 425 GLY B O   1 
ATOM   7323 N  N   . ARG B 1 425 ? 62.850  -7.843  -25.142 1.00 14.82 ? 426 ARG B N   1 
ATOM   7324 C  CA  . ARG B 1 425 ? 61.848  -8.223  -26.149 1.00 15.64 ? 426 ARG B CA  1 
ATOM   7325 C  C   . ARG B 1 425 ? 61.253  -9.629  -25.934 1.00 15.74 ? 426 ARG B C   1 
ATOM   7326 O  O   . ARG B 1 425 ? 60.044  -9.806  -26.023 1.00 16.08 ? 426 ARG B O   1 
ATOM   7327 C  CB  . ARG B 1 425 ? 62.391  -8.070  -27.581 1.00 15.72 ? 426 ARG B CB  1 
ATOM   7328 C  CG  . ARG B 1 425 ? 61.315  -8.293  -28.646 1.00 16.38 ? 426 ARG B CG  1 
ATOM   7329 C  CD  . ARG B 1 425 ? 61.891  -8.435  -30.042 1.00 18.93 ? 426 ARG B CD  1 
ATOM   7330 N  NE  . ARG B 1 425 ? 60.820  -8.390  -31.041 1.00 21.39 ? 426 ARG B NE  1 
ATOM   7331 C  CZ  . ARG B 1 425 ? 60.936  -7.877  -32.258 1.00 22.73 ? 426 ARG B CZ  1 
ATOM   7332 N  NH1 . ARG B 1 425 ? 62.083  -7.343  -32.665 1.00 24.34 ? 426 ARG B NH1 1 
ATOM   7333 N  NH2 . ARG B 1 425 ? 59.892  -7.884  -33.070 1.00 24.26 ? 426 ARG B NH2 1 
ATOM   7334 N  N   . ARG B 1 426 ? 62.096  -10.608 -25.622 1.00 16.08 ? 427 ARG B N   1 
ATOM   7335 C  CA  . ARG B 1 426 ? 61.633  -11.982 -25.436 1.00 16.58 ? 427 ARG B CA  1 
ATOM   7336 C  C   . ARG B 1 426 ? 60.854  -12.130 -24.137 1.00 16.45 ? 427 ARG B C   1 
ATOM   7337 O  O   . ARG B 1 426 ? 59.815  -12.777 -24.112 1.00 16.31 ? 427 ARG B O   1 
ATOM   7338 C  CB  . ARG B 1 426 ? 62.806  -12.961 -25.479 1.00 17.06 ? 427 ARG B CB  1 
ATOM   7339 C  CG  . ARG B 1 426 ? 63.674  -12.828 -26.724 1.00 18.85 ? 427 ARG B CG  1 
ATOM   7340 C  CD  . ARG B 1 426 ? 63.112  -13.627 -27.867 1.00 24.69 ? 427 ARG B CD  1 
ATOM   7341 N  NE  . ARG B 1 426 ? 62.208  -12.874 -28.735 1.00 29.42 ? 427 ARG B NE  1 
ATOM   7342 C  CZ  . ARG B 1 426 ? 62.530  -12.408 -29.943 1.00 30.90 ? 427 ARG B CZ  1 
ATOM   7343 N  NH1 . ARG B 1 426 ? 63.755  -12.592 -30.426 1.00 32.54 ? 427 ARG B NH1 1 
ATOM   7344 N  NH2 . ARG B 1 426 ? 61.625  -11.753 -30.669 1.00 31.17 ? 427 ARG B NH2 1 
ATOM   7345 N  N   . ILE B 1 427 ? 61.357  -11.516 -23.069 1.00 15.92 ? 428 ILE B N   1 
ATOM   7346 C  CA  . ILE B 1 427 ? 60.650  -11.493 -21.798 1.00 15.82 ? 428 ILE B CA  1 
ATOM   7347 C  C   . ILE B 1 427 ? 59.257  -10.871 -21.980 1.00 15.75 ? 428 ILE B C   1 
ATOM   7348 O  O   . ILE B 1 427 ? 58.252  -11.476 -21.603 1.00 15.35 ? 428 ILE B O   1 
ATOM   7349 C  CB  . ILE B 1 427 ? 61.476  -10.759 -20.713 1.00 15.64 ? 428 ILE B CB  1 
ATOM   7350 C  CG1 . ILE B 1 427 ? 62.698  -11.607 -20.319 1.00 16.18 ? 428 ILE B CG1 1 
ATOM   7351 C  CG2 . ILE B 1 427 ? 60.615  -10.438 -19.484 1.00 15.94 ? 428 ILE B CG2 1 
ATOM   7352 C  CD1 . ILE B 1 427 ? 63.833  -10.801 -19.694 1.00 15.36 ? 428 ILE B CD1 1 
ATOM   7353 N  N   . ALA B 1 428 ? 59.214  -9.680  -22.582 1.00 15.48 ? 429 ALA B N   1 
ATOM   7354 C  CA  . ALA B 1 428 ? 57.967  -8.965  -22.822 1.00 15.75 ? 429 ALA B CA  1 
ATOM   7355 C  C   . ALA B 1 428 ? 56.982  -9.755  -23.687 1.00 15.81 ? 429 ALA B C   1 
ATOM   7356 O  O   . ALA B 1 428 ? 55.816  -9.881  -23.327 1.00 15.85 ? 429 ALA B O   1 
ATOM   7357 C  CB  . ALA B 1 428 ? 58.242  -7.580  -23.437 1.00 15.62 ? 429 ALA B CB  1 
ATOM   7358 N  N   . GLU B 1 429 ? 57.449  -10.282 -24.819 1.00 15.95 ? 430 GLU B N   1 
ATOM   7359 C  CA  . GLU B 1 429 ? 56.585  -11.063 -25.712 1.00 16.80 ? 430 GLU B CA  1 
ATOM   7360 C  C   . GLU B 1 429 ? 56.014  -12.296 -25.018 1.00 16.92 ? 430 GLU B C   1 
ATOM   7361 O  O   . GLU B 1 429 ? 54.810  -12.537 -25.078 1.00 17.37 ? 430 GLU B O   1 
ATOM   7362 C  CB  . GLU B 1 429 ? 57.315  -11.473 -26.990 1.00 16.50 ? 430 GLU B CB  1 
ATOM   7363 C  CG  . GLU B 1 429 ? 57.537  -10.318 -27.931 1.00 18.59 ? 430 GLU B CG  1 
ATOM   7364 C  CD  . GLU B 1 429 ? 58.431  -10.660 -29.117 1.00 20.18 ? 430 GLU B CD  1 
ATOM   7365 O  OE1 . GLU B 1 429 ? 59.204  -11.648 -29.045 1.00 20.29 ? 430 GLU B OE1 1 
ATOM   7366 O  OE2 . GLU B 1 429 ? 58.358  -9.909  -30.114 1.00 19.95 ? 430 GLU B OE2 1 
ATOM   7367 N  N   . LEU B 1 430 ? 56.879  -13.056 -24.357 1.00 16.82 ? 431 LEU B N   1 
ATOM   7368 C  CA  . LEU B 1 430 ? 56.459  -14.241 -23.618 1.00 17.34 ? 431 LEU B CA  1 
ATOM   7369 C  C   . LEU B 1 430 ? 55.485  -13.902 -22.489 1.00 17.22 ? 431 LEU B C   1 
ATOM   7370 O  O   . LEU B 1 430 ? 54.469  -14.576 -22.332 1.00 16.84 ? 431 LEU B O   1 
ATOM   7371 C  CB  . LEU B 1 430 ? 57.677  -15.005 -23.071 1.00 17.28 ? 431 LEU B CB  1 
ATOM   7372 C  CG  . LEU B 1 430 ? 58.568  -15.725 -24.100 1.00 18.45 ? 431 LEU B CG  1 
ATOM   7373 C  CD1 . LEU B 1 430 ? 59.867  -16.239 -23.465 1.00 18.56 ? 431 LEU B CD1 1 
ATOM   7374 C  CD2 . LEU B 1 430 ? 57.803  -16.881 -24.752 1.00 18.96 ? 431 LEU B CD2 1 
ATOM   7375 N  N   . GLU B 1 431 ? 55.788  -12.841 -21.736 1.00 17.15 ? 432 GLU B N   1 
ATOM   7376 C  CA  . GLU B 1 431 ? 54.957  -12.421 -20.601 1.00 17.53 ? 432 GLU B CA  1 
ATOM   7377 C  C   . GLU B 1 431 ? 53.550  -12.015 -21.032 1.00 17.16 ? 432 GLU B C   1 
ATOM   7378 O  O   . GLU B 1 431 ? 52.567  -12.378 -20.378 1.00 16.60 ? 432 GLU B O   1 
ATOM   7379 C  CB  . GLU B 1 431 ? 55.621  -11.263 -19.850 1.00 18.02 ? 432 GLU B CB  1 
ATOM   7380 C  CG  . GLU B 1 431 ? 54.780  -10.677 -18.727 1.00 20.78 ? 432 GLU B CG  1 
ATOM   7381 C  CD  . GLU B 1 431 ? 55.387  -9.412  -18.147 1.00 25.80 ? 432 GLU B CD  1 
ATOM   7382 O  OE1 . GLU B 1 431 ? 56.636  -9.358  -18.012 1.00 27.66 ? 432 GLU B OE1 1 
ATOM   7383 O  OE2 . GLU B 1 431 ? 54.617  -8.470  -17.823 1.00 27.17 ? 432 GLU B OE2 1 
ATOM   7384 N  N   . MET B 1 432 ? 53.469  -11.252 -22.123 1.00 16.63 ? 433 MET B N   1 
ATOM   7385 C  CA  . MET B 1 432 ? 52.191  -10.800 -22.659 1.00 16.44 ? 433 MET B CA  1 
ATOM   7386 C  C   . MET B 1 432 ? 51.394  -11.938 -23.286 1.00 16.13 ? 433 MET B C   1 
ATOM   7387 O  O   . MET B 1 432 ? 50.192  -12.055 -23.061 1.00 15.97 ? 433 MET B O   1 
ATOM   7388 C  CB  . MET B 1 432 ? 52.394  -9.666  -23.663 1.00 16.02 ? 433 MET B CB  1 
ATOM   7389 C  CG  . MET B 1 432 ? 52.836  -8.370  -22.990 1.00 18.01 ? 433 MET B CG  1 
ATOM   7390 S  SD  . MET B 1 432 ? 52.991  -6.971  -24.109 1.00 20.57 ? 433 MET B SD  1 
ATOM   7391 C  CE  . MET B 1 432 ? 54.391  -7.468  -25.118 1.00 16.94 ? 433 MET B CE  1 
ATOM   7392 N  N   . THR B 1 433 ? 52.067  -12.778 -24.064 1.00 16.23 ? 434 THR B N   1 
ATOM   7393 C  CA  . THR B 1 433 ? 51.401  -13.910 -24.710 1.00 16.36 ? 434 THR B CA  1 
ATOM   7394 C  C   . THR B 1 433 ? 50.860  -14.921 -23.702 1.00 15.90 ? 434 THR B C   1 
ATOM   7395 O  O   . THR B 1 433 ? 49.760  -15.432 -23.879 1.00 16.06 ? 434 THR B O   1 
ATOM   7396 C  CB  . THR B 1 433 ? 52.320  -14.613 -25.724 1.00 16.16 ? 434 THR B CB  1 
ATOM   7397 O  OG1 . THR B 1 433 ? 52.879  -13.632 -26.601 1.00 16.97 ? 434 THR B OG1 1 
ATOM   7398 C  CG2 . THR B 1 433 ? 51.531  -15.611 -26.549 1.00 15.40 ? 434 THR B CG2 1 
ATOM   7399 N  N   . ILE B 1 434 ? 51.639  -15.205 -22.660 1.00 15.74 ? 435 ILE B N   1 
ATOM   7400 C  CA  . ILE B 1 434 ? 51.200  -16.089 -21.583 1.00 15.70 ? 435 ILE B CA  1 
ATOM   7401 C  C   . ILE B 1 434 ? 50.080  -15.455 -20.751 1.00 15.69 ? 435 ILE B C   1 
ATOM   7402 O  O   . ILE B 1 434 ? 49.153  -16.145 -20.316 1.00 15.78 ? 435 ILE B O   1 
ATOM   7403 C  CB  . ILE B 1 434 ? 52.374  -16.537 -20.680 1.00 15.75 ? 435 ILE B CB  1 
ATOM   7404 C  CG1 . ILE B 1 434 ? 53.317  -17.462 -21.466 1.00 15.22 ? 435 ILE B CG1 1 
ATOM   7405 C  CG2 . ILE B 1 434 ? 51.852  -17.269 -19.451 1.00 15.71 ? 435 ILE B CG2 1 
ATOM   7406 C  CD1 . ILE B 1 434 ? 54.722  -17.616 -20.855 1.00 17.30 ? 435 ILE B CD1 1 
ATOM   7407 N  N   . PHE B 1 435 ? 50.165  -14.142 -20.540 1.00 15.45 ? 436 PHE B N   1 
ATOM   7408 C  CA  . PHE B 1 435 ? 49.143  -13.427 -19.787 1.00 15.27 ? 436 PHE B CA  1 
ATOM   7409 C  C   . PHE B 1 435 ? 47.824  -13.541 -20.527 1.00 15.15 ? 436 PHE B C   1 
ATOM   7410 O  O   . PHE B 1 435 ? 46.805  -13.877 -19.941 1.00 14.43 ? 436 PHE B O   1 
ATOM   7411 C  CB  . PHE B 1 435 ? 49.528  -11.957 -19.604 1.00 15.25 ? 436 PHE B CB  1 
ATOM   7412 C  CG  . PHE B 1 435 ? 48.424  -11.099 -19.061 1.00 15.75 ? 436 PHE B CG  1 
ATOM   7413 C  CD1 . PHE B 1 435 ? 48.235  -10.978 -17.685 1.00 15.85 ? 436 PHE B CD1 1 
ATOM   7414 C  CD2 . PHE B 1 435 ? 47.583  -10.400 -19.918 1.00 15.29 ? 436 PHE B CD2 1 
ATOM   7415 C  CE1 . PHE B 1 435 ? 47.227  -10.181 -17.174 1.00 16.74 ? 436 PHE B CE1 1 
ATOM   7416 C  CE2 . PHE B 1 435 ? 46.560  -9.597  -19.412 1.00 17.85 ? 436 PHE B CE2 1 
ATOM   7417 C  CZ  . PHE B 1 435 ? 46.385  -9.484  -18.031 1.00 16.69 ? 436 PHE B CZ  1 
ATOM   7418 N  N   . LEU B 1 436 ? 47.867  -13.265 -21.826 1.00 15.42 ? 437 LEU B N   1 
ATOM   7419 C  CA  . LEU B 1 436 ? 46.657  -13.246 -22.649 1.00 15.90 ? 437 LEU B CA  1 
ATOM   7420 C  C   . LEU B 1 436 ? 46.032  -14.629 -22.847 1.00 15.64 ? 437 LEU B C   1 
ATOM   7421 O  O   . LEU B 1 436 ? 44.813  -14.737 -22.899 1.00 15.39 ? 437 LEU B O   1 
ATOM   7422 C  CB  . LEU B 1 436 ? 46.920  -12.564 -23.987 1.00 15.66 ? 437 LEU B CB  1 
ATOM   7423 C  CG  . LEU B 1 436 ? 47.137  -11.048 -23.862 1.00 16.45 ? 437 LEU B CG  1 
ATOM   7424 C  CD1 . LEU B 1 436 ? 47.681  -10.482 -25.164 1.00 15.73 ? 437 LEU B CD1 1 
ATOM   7425 C  CD2 . LEU B 1 436 ? 45.854  -10.327 -23.416 1.00 16.97 ? 437 LEU B CD2 1 
ATOM   7426 N  N   . ILE B 1 437 ? 46.862  -15.666 -22.959 1.00 15.53 ? 438 ILE B N   1 
ATOM   7427 C  CA  . ILE B 1 437 ? 46.369  -17.051 -22.948 1.00 15.70 ? 438 ILE B CA  1 
ATOM   7428 C  C   . ILE B 1 437 ? 45.528  -17.311 -21.692 1.00 16.32 ? 438 ILE B C   1 
ATOM   7429 O  O   . ILE B 1 437 ? 44.410  -17.818 -21.794 1.00 16.37 ? 438 ILE B O   1 
ATOM   7430 C  CB  . ILE B 1 437 ? 47.531  -18.086 -23.052 1.00 15.87 ? 438 ILE B CB  1 
ATOM   7431 C  CG1 . ILE B 1 437 ? 48.058  -18.161 -24.499 1.00 15.07 ? 438 ILE B CG1 1 
ATOM   7432 C  CG2 . ILE B 1 437 ? 47.091  -19.482 -22.567 1.00 15.04 ? 438 ILE B CG2 1 
ATOM   7433 C  CD1 . ILE B 1 437 ? 49.367  -18.909 -24.649 1.00 14.51 ? 438 ILE B CD1 1 
ATOM   7434 N  N   . ASN B 1 438 ? 46.061  -16.943 -20.522 1.00 16.43 ? 439 ASN B N   1 
ATOM   7435 C  CA  . ASN B 1 438 ? 45.389  -17.204 -19.245 1.00 17.14 ? 439 ASN B CA  1 
ATOM   7436 C  C   . ASN B 1 438 ? 44.101  -16.400 -19.099 1.00 16.96 ? 439 ASN B C   1 
ATOM   7437 O  O   . ASN B 1 438 ? 43.082  -16.925 -18.636 1.00 16.64 ? 439 ASN B O   1 
ATOM   7438 C  CB  . ASN B 1 438 ? 46.326  -16.969 -18.053 1.00 17.08 ? 439 ASN B CB  1 
ATOM   7439 C  CG  . ASN B 1 438 ? 47.288  -18.129 -17.832 1.00 18.79 ? 439 ASN B CG  1 
ATOM   7440 O  OD1 . ASN B 1 438 ? 46.889  -19.201 -17.383 1.00 22.17 ? 439 ASN B OD1 1 
ATOM   7441 N  ND2 . ASN B 1 438 ? 48.559  -17.924 -18.157 1.00 18.91 ? 439 ASN B ND2 1 
ATOM   7442 N  N   . MET B 1 439 ? 44.152  -15.139 -19.518 1.00 17.17 ? 440 MET B N   1 
ATOM   7443 C  CA  . MET B 1 439 ? 42.978  -14.270 -19.514 1.00 17.77 ? 440 MET B CA  1 
ATOM   7444 C  C   . MET B 1 439 ? 41.882  -14.742 -20.474 1.00 17.97 ? 440 MET B C   1 
ATOM   7445 O  O   . MET B 1 439 ? 40.701  -14.767 -20.103 1.00 17.75 ? 440 MET B O   1 
ATOM   7446 C  CB  . MET B 1 439 ? 43.372  -12.821 -19.811 1.00 17.83 ? 440 MET B CB  1 
ATOM   7447 C  CG  . MET B 1 439 ? 44.183  -12.178 -18.688 1.00 19.06 ? 440 MET B CG  1 
ATOM   7448 S  SD  . MET B 1 439 ? 43.233  -11.879 -17.177 1.00 21.10 ? 440 MET B SD  1 
ATOM   7449 C  CE  . MET B 1 439 ? 42.269  -10.456 -17.696 1.00 17.70 ? 440 MET B CE  1 
ATOM   7450 N  N   . LEU B 1 440 ? 42.274  -15.114 -21.697 1.00 17.97 ? 441 LEU B N   1 
ATOM   7451 C  CA  . LEU B 1 440 ? 41.314  -15.549 -22.722 1.00 18.44 ? 441 LEU B CA  1 
ATOM   7452 C  C   . LEU B 1 440 ? 40.571  -16.835 -22.351 1.00 18.53 ? 441 LEU B C   1 
ATOM   7453 O  O   . LEU B 1 440 ? 39.391  -16.966 -22.644 1.00 18.45 ? 441 LEU B O   1 
ATOM   7454 C  CB  . LEU B 1 440 ? 41.983  -15.673 -24.100 1.00 18.05 ? 441 LEU B CB  1 
ATOM   7455 C  CG  . LEU B 1 440 ? 42.182  -14.325 -24.810 1.00 19.35 ? 441 LEU B CG  1 
ATOM   7456 C  CD1 . LEU B 1 440 ? 43.160  -14.434 -25.982 1.00 18.65 ? 441 LEU B CD1 1 
ATOM   7457 C  CD2 . LEU B 1 440 ? 40.838  -13.695 -25.244 1.00 19.57 ? 441 LEU B CD2 1 
ATOM   7458 N  N   . GLU B 1 441 ? 41.268  -17.764 -21.700 1.00 19.27 ? 442 GLU B N   1 
ATOM   7459 C  CA  . GLU B 1 441 ? 40.671  -19.014 -21.204 1.00 20.18 ? 442 GLU B CA  1 
ATOM   7460 C  C   . GLU B 1 441 ? 39.692  -18.800 -20.044 1.00 20.02 ? 442 GLU B C   1 
ATOM   7461 O  O   . GLU B 1 441 ? 38.804  -19.618 -19.811 1.00 20.21 ? 442 GLU B O   1 
ATOM   7462 C  CB  . GLU B 1 441 ? 41.770  -19.996 -20.757 1.00 20.40 ? 442 GLU B CB  1 
ATOM   7463 C  CG  . GLU B 1 441 ? 42.524  -20.625 -21.912 1.00 23.24 ? 442 GLU B CG  1 
ATOM   7464 C  CD  . GLU B 1 441 ? 43.761  -21.412 -21.493 1.00 26.94 ? 442 GLU B CD  1 
ATOM   7465 O  OE1 . GLU B 1 441 ? 44.422  -21.032 -20.499 1.00 27.31 ? 442 GLU B OE1 1 
ATOM   7466 O  OE2 . GLU B 1 441 ? 44.086  -22.408 -22.186 1.00 28.47 ? 442 GLU B OE2 1 
ATOM   7467 N  N   . ASN B 1 442 ? 39.861  -17.704 -19.315 1.00 19.78 ? 443 ASN B N   1 
ATOM   7468 C  CA  . ASN B 1 442 ? 39.124  -17.509 -18.071 1.00 19.34 ? 443 ASN B CA  1 
ATOM   7469 C  C   . ASN B 1 442 ? 38.045  -16.446 -18.071 1.00 19.42 ? 443 ASN B C   1 
ATOM   7470 O  O   . ASN B 1 442 ? 37.082  -16.551 -17.305 1.00 19.84 ? 443 ASN B O   1 
ATOM   7471 C  CB  . ASN B 1 442 ? 40.105  -17.263 -16.931 1.00 19.28 ? 443 ASN B CB  1 
ATOM   7472 C  CG  . ASN B 1 442 ? 40.660  -18.550 -16.375 1.00 19.93 ? 443 ASN B CG  1 
ATOM   7473 O  OD1 . ASN B 1 442 ? 40.062  -19.156 -15.491 1.00 21.60 ? 443 ASN B OD1 1 
ATOM   7474 N  ND2 . ASN B 1 442 ? 41.796  -18.982 -16.894 1.00 18.87 ? 443 ASN B ND2 1 
ATOM   7475 N  N   . PHE B 1 443 ? 38.198  -15.424 -18.915 1.00 19.36 ? 444 PHE B N   1 
ATOM   7476 C  CA  . PHE B 1 443 ? 37.304  -14.268 -18.880 1.00 19.45 ? 444 PHE B CA  1 
ATOM   7477 C  C   . PHE B 1 443 ? 36.887  -13.750 -20.253 1.00 19.93 ? 444 PHE B C   1 
ATOM   7478 O  O   . PHE B 1 443 ? 37.619  -13.886 -21.243 1.00 19.48 ? 444 PHE B O   1 
ATOM   7479 C  CB  . PHE B 1 443 ? 37.949  -13.102 -18.108 1.00 19.19 ? 444 PHE B CB  1 
ATOM   7480 C  CG  . PHE B 1 443 ? 38.494  -13.482 -16.766 1.00 18.53 ? 444 PHE B CG  1 
ATOM   7481 C  CD1 . PHE B 1 443 ? 39.861  -13.645 -16.582 1.00 17.14 ? 444 PHE B CD1 1 
ATOM   7482 C  CD2 . PHE B 1 443 ? 37.642  -13.683 -15.686 1.00 18.29 ? 444 PHE B CD2 1 
ATOM   7483 C  CE1 . PHE B 1 443 ? 40.374  -13.999 -15.340 1.00 17.63 ? 444 PHE B CE1 1 
ATOM   7484 C  CE2 . PHE B 1 443 ? 38.147  -14.036 -14.443 1.00 18.17 ? 444 PHE B CE2 1 
ATOM   7485 C  CZ  . PHE B 1 443 ? 39.517  -14.201 -14.271 1.00 17.65 ? 444 PHE B CZ  1 
ATOM   7486 N  N   . ARG B 1 444 ? 35.695  -13.160 -20.280 1.00 20.69 ? 445 ARG B N   1 
ATOM   7487 C  CA  . ARG B 1 444 ? 35.266  -12.261 -21.343 1.00 21.81 ? 445 ARG B CA  1 
ATOM   7488 C  C   . ARG B 1 444 ? 35.445  -10.839 -20.834 1.00 21.87 ? 445 ARG B C   1 
ATOM   7489 O  O   . ARG B 1 444 ? 35.083  -10.534 -19.692 1.00 21.66 ? 445 ARG B O   1 
ATOM   7490 C  CB  . ARG B 1 444 ? 33.795  -12.505 -21.707 1.00 22.17 ? 445 ARG B CB  1 
ATOM   7491 C  CG  . ARG B 1 444 ? 33.568  -13.792 -22.479 1.00 24.89 ? 445 ARG B CG  1 
ATOM   7492 C  CD  . ARG B 1 444 ? 32.076  -14.107 -22.691 1.00 29.98 ? 445 ARG B CD  1 
ATOM   7493 N  NE  . ARG B 1 444 ? 31.934  -15.310 -23.518 1.00 34.36 ? 445 ARG B NE  1 
ATOM   7494 C  CZ  . ARG B 1 444 ? 30.785  -15.818 -23.966 1.00 36.88 ? 445 ARG B CZ  1 
ATOM   7495 N  NH1 . ARG B 1 444 ? 29.613  -15.242 -23.685 1.00 37.73 ? 445 ARG B NH1 1 
ATOM   7496 N  NH2 . ARG B 1 444 ? 30.810  -16.919 -24.705 1.00 37.18 ? 445 ARG B NH2 1 
ATOM   7497 N  N   . VAL B 1 445 ? 36.018  -9.977  -21.669 1.00 22.47 ? 446 VAL B N   1 
ATOM   7498 C  CA  . VAL B 1 445 ? 36.283  -8.590  -21.284 1.00 23.13 ? 446 VAL B CA  1 
ATOM   7499 C  C   . VAL B 1 445 ? 35.449  -7.588  -22.088 1.00 24.17 ? 446 VAL B C   1 
ATOM   7500 O  O   . VAL B 1 445 ? 35.318  -7.704  -23.314 1.00 23.84 ? 446 VAL B O   1 
ATOM   7501 C  CB  . VAL B 1 445 ? 37.814  -8.257  -21.312 1.00 22.97 ? 446 VAL B CB  1 
ATOM   7502 C  CG1 . VAL B 1 445 ? 38.394  -8.370  -22.716 1.00 23.05 ? 446 VAL B CG1 1 
ATOM   7503 C  CG2 . VAL B 1 445 ? 38.087  -6.886  -20.717 1.00 22.34 ? 446 VAL B CG2 1 
ATOM   7504 N  N   . GLU B 1 446 ? 34.871  -6.626  -21.371 1.00 25.46 ? 447 GLU B N   1 
ATOM   7505 C  CA  . GLU B 1 446 ? 34.054  -5.568  -21.959 1.00 27.62 ? 447 GLU B CA  1 
ATOM   7506 C  C   . GLU B 1 446 ? 34.406  -4.185  -21.389 1.00 28.48 ? 447 GLU B C   1 
ATOM   7507 O  O   . GLU B 1 446 ? 34.998  -4.078  -20.313 1.00 27.76 ? 447 GLU B O   1 
ATOM   7508 C  CB  . GLU B 1 446 ? 32.563  -5.863  -21.741 1.00 27.80 ? 447 GLU B CB  1 
ATOM   7509 C  CG  . GLU B 1 446 ? 32.101  -7.191  -22.354 1.00 30.29 ? 447 GLU B CG  1 
ATOM   7510 C  CD  . GLU B 1 446 ? 30.598  -7.410  -22.281 1.00 33.59 ? 447 GLU B CD  1 
ATOM   7511 O  OE1 . GLU B 1 446 ? 29.974  -7.047  -21.255 1.00 35.25 ? 447 GLU B OE1 1 
ATOM   7512 O  OE2 . GLU B 1 446 ? 30.046  -7.969  -23.256 1.00 35.41 ? 447 GLU B OE2 1 
ATOM   7513 N  N   . ILE B 1 447 ? 34.047  -3.142  -22.133 1.00 30.39 ? 448 ILE B N   1 
ATOM   7514 C  CA  . ILE B 1 447 ? 34.110  -1.749  -21.663 1.00 32.95 ? 448 ILE B CA  1 
ATOM   7515 C  C   . ILE B 1 447 ? 32.728  -1.117  -21.848 1.00 34.80 ? 448 ILE B C   1 
ATOM   7516 O  O   . ILE B 1 447 ? 32.018  -1.431  -22.803 1.00 34.81 ? 448 ILE B O   1 
ATOM   7517 C  CB  . ILE B 1 447 ? 35.220  -0.912  -22.389 1.00 32.66 ? 448 ILE B CB  1 
ATOM   7518 C  CG1 . ILE B 1 447 ? 35.007  0.606   -22.214 1.00 33.03 ? 448 ILE B CG1 1 
ATOM   7519 C  CG2 . ILE B 1 447 ? 35.239  -1.216  -23.882 1.00 33.07 ? 448 ILE B CG2 1 
ATOM   7520 C  CD1 . ILE B 1 447 ? 35.556  1.234   -20.934 1.00 31.65 ? 448 ILE B CD1 1 
ATOM   7521 N  N   . GLN B 1 448 ? 32.346  -0.238  -20.929 1.00 37.69 ? 449 GLN B N   1 
ATOM   7522 C  CA  . GLN B 1 448 ? 31.013  0.367   -20.961 1.00 40.44 ? 449 GLN B CA  1 
ATOM   7523 C  C   . GLN B 1 448 ? 30.959  1.563   -21.898 1.00 41.71 ? 449 GLN B C   1 
ATOM   7524 O  O   . GLN B 1 448 ? 30.228  1.548   -22.892 1.00 42.04 ? 449 GLN B O   1 
ATOM   7525 C  CB  . GLN B 1 448 ? 30.541  0.780   -19.555 1.00 40.63 ? 449 GLN B CB  1 
ATOM   7526 C  CG  . GLN B 1 448 ? 30.581  -0.325  -18.501 1.00 42.54 ? 449 GLN B CG  1 
ATOM   7527 C  CD  . GLN B 1 448 ? 30.057  -1.657  -19.010 1.00 45.56 ? 449 GLN B CD  1 
ATOM   7528 O  OE1 . GLN B 1 448 ? 28.896  -1.773  -19.411 1.00 47.57 ? 449 GLN B OE1 1 
ATOM   7529 N  NE2 . GLN B 1 448 ? 30.914  -2.675  -18.992 1.00 46.15 ? 449 GLN B NE2 1 
ATOM   7530 N  N   . HIS B 1 449 ? 31.743  2.589   -21.575 1.00 43.35 ? 450 HIS B N   1 
ATOM   7531 C  CA  . HIS B 1 449 ? 31.635  3.896   -22.234 1.00 44.94 ? 450 HIS B CA  1 
ATOM   7532 C  C   . HIS B 1 449 ? 31.820  3.825   -23.753 1.00 45.21 ? 450 HIS B C   1 
ATOM   7533 O  O   . HIS B 1 449 ? 31.135  4.535   -24.499 1.00 45.56 ? 450 HIS B O   1 
ATOM   7534 C  CB  . HIS B 1 449 ? 32.603  4.901   -21.592 1.00 45.35 ? 450 HIS B CB  1 
ATOM   7535 C  CG  . HIS B 1 449 ? 32.545  4.913   -20.093 1.00 47.59 ? 450 HIS B CG  1 
ATOM   7536 N  ND1 . HIS B 1 449 ? 33.586  4.469   -19.302 1.00 49.54 ? 450 HIS B ND1 1 
ATOM   7537 C  CD2 . HIS B 1 449 ? 31.560  5.288   -19.240 1.00 49.16 ? 450 HIS B CD2 1 
ATOM   7538 C  CE1 . HIS B 1 449 ? 33.250  4.584   -18.028 1.00 50.02 ? 450 HIS B CE1 1 
ATOM   7539 N  NE2 . HIS B 1 449 ? 32.026  5.078   -17.962 1.00 50.31 ? 450 HIS B NE2 1 
ATOM   7540 N  N   . LEU B 1 450 ? 32.729  2.955   -24.199 1.00 45.43 ? 451 LEU B N   1 
ATOM   7541 C  CA  . LEU B 1 450 ? 32.991  2.728   -25.630 1.00 45.29 ? 451 LEU B CA  1 
ATOM   7542 C  C   . LEU B 1 450 ? 33.524  3.971   -26.366 1.00 44.92 ? 451 LEU B C   1 
ATOM   7543 O  O   . LEU B 1 450 ? 33.684  3.963   -27.594 1.00 45.34 ? 451 LEU B O   1 
ATOM   7544 C  CB  . LEU B 1 450 ? 31.743  2.156   -26.328 1.00 45.49 ? 451 LEU B CB  1 
ATOM   7545 C  CG  . LEU B 1 450 ? 31.925  1.258   -27.558 1.00 46.09 ? 451 LEU B CG  1 
ATOM   7546 C  CD1 . LEU B 1 450 ? 32.721  -0.020  -27.216 1.00 45.69 ? 451 LEU B CD1 1 
ATOM   7547 C  CD2 . LEU B 1 450 ? 30.564  0.916   -28.174 1.00 46.09 ? 451 LEU B CD2 1 
ATOM   7548 N  N   . SER B 1 451 ? 33.811  5.032   -25.614 1.00 44.10 ? 452 SER B N   1 
ATOM   7549 C  CA  . SER B 1 451 ? 34.419  6.234   -26.185 1.00 43.14 ? 452 SER B CA  1 
ATOM   7550 C  C   . SER B 1 451 ? 35.913  5.999   -26.402 1.00 42.10 ? 452 SER B C   1 
ATOM   7551 O  O   . SER B 1 451 ? 36.541  5.223   -25.671 1.00 42.22 ? 452 SER B O   1 
ATOM   7552 C  CB  . SER B 1 451 ? 34.180  7.457   -25.288 1.00 43.39 ? 452 SER B CB  1 
ATOM   7553 O  OG  . SER B 1 451 ? 34.782  7.287   -24.014 1.00 43.86 ? 452 SER B OG  1 
ATOM   7554 N  N   . ASP B 1 452 ? 36.468  6.672   -27.408 1.00 40.50 ? 453 ASP B N   1 
ATOM   7555 C  CA  . ASP B 1 452 ? 37.857  6.478   -27.808 1.00 38.82 ? 453 ASP B CA  1 
ATOM   7556 C  C   . ASP B 1 452 ? 38.808  7.094   -26.794 1.00 36.95 ? 453 ASP B C   1 
ATOM   7557 O  O   . ASP B 1 452 ? 38.810  8.309   -26.584 1.00 36.99 ? 453 ASP B O   1 
ATOM   7558 C  CB  . ASP B 1 452 ? 38.108  7.064   -29.203 1.00 39.34 ? 453 ASP B CB  1 
ATOM   7559 C  CG  . ASP B 1 452 ? 37.016  6.700   -30.193 1.00 40.93 ? 453 ASP B CG  1 
ATOM   7560 O  OD1 . ASP B 1 452 ? 36.565  5.530   -30.190 1.00 41.77 ? 453 ASP B OD1 1 
ATOM   7561 O  OD2 . ASP B 1 452 ? 36.604  7.589   -30.975 1.00 43.26 ? 453 ASP B OD2 1 
ATOM   7562 N  N   . VAL B 1 453 ? 39.609  6.247   -26.160 1.00 34.50 ? 454 VAL B N   1 
ATOM   7563 C  CA  . VAL B 1 453 ? 40.583  6.720   -25.193 1.00 32.13 ? 454 VAL B CA  1 
ATOM   7564 C  C   . VAL B 1 453 ? 41.809  7.223   -25.953 1.00 30.66 ? 454 VAL B C   1 
ATOM   7565 O  O   . VAL B 1 453 ? 42.417  6.486   -26.736 1.00 30.27 ? 454 VAL B O   1 
ATOM   7566 C  CB  . VAL B 1 453 ? 40.940  5.623   -24.155 1.00 32.28 ? 454 VAL B CB  1 
ATOM   7567 C  CG1 . VAL B 1 453 ? 42.174  6.006   -23.343 1.00 31.44 ? 454 VAL B CG1 1 
ATOM   7568 C  CG2 . VAL B 1 453 ? 39.750  5.364   -23.232 1.00 31.69 ? 454 VAL B CG2 1 
ATOM   7569 N  N   . GLY B 1 454 ? 42.144  8.489   -25.732 1.00 28.62 ? 455 GLY B N   1 
ATOM   7570 C  CA  . GLY B 1 454 ? 43.300  9.102   -26.366 1.00 26.64 ? 455 GLY B CA  1 
ATOM   7571 C  C   . GLY B 1 454 ? 44.618  8.651   -25.766 1.00 25.13 ? 455 GLY B C   1 
ATOM   7572 O  O   . GLY B 1 454 ? 44.657  7.797   -24.881 1.00 24.70 ? 455 GLY B O   1 
ATOM   7573 N  N   . THR B 1 455 ? 45.695  9.257   -26.252 1.00 23.82 ? 456 THR B N   1 
ATOM   7574 C  CA  . THR B 1 455 ? 47.053  8.895   -25.877 1.00 22.24 ? 456 THR B CA  1 
ATOM   7575 C  C   . THR B 1 455 ? 47.793  10.121  -25.350 1.00 21.16 ? 456 THR B C   1 
ATOM   7576 O  O   . THR B 1 455 ? 47.690  11.216  -25.916 1.00 20.71 ? 456 THR B O   1 
ATOM   7577 C  CB  . THR B 1 455 ? 47.806  8.310   -27.099 1.00 22.39 ? 456 THR B CB  1 
ATOM   7578 O  OG1 . THR B 1 455 ? 47.111  7.152   -27.576 1.00 22.49 ? 456 THR B OG1 1 
ATOM   7579 C  CG2 . THR B 1 455 ? 49.222  7.917   -26.745 1.00 22.22 ? 456 THR B CG2 1 
ATOM   7580 N  N   . THR B 1 456 ? 48.541  9.933   -24.270 1.00 19.88 ? 457 THR B N   1 
ATOM   7581 C  CA  . THR B 1 456 ? 49.390  10.992  -23.750 1.00 19.57 ? 457 THR B CA  1 
ATOM   7582 C  C   . THR B 1 456 ? 50.864  10.575  -23.680 1.00 18.47 ? 457 THR B C   1 
ATOM   7583 O  O   . THR B 1 456 ? 51.188  9.406   -23.455 1.00 17.97 ? 457 THR B O   1 
ATOM   7584 C  CB  . THR B 1 456 ? 48.877  11.542  -22.385 1.00 19.64 ? 457 THR B CB  1 
ATOM   7585 O  OG1 . THR B 1 456 ? 49.553  12.765  -22.090 1.00 21.39 ? 457 THR B OG1 1 
ATOM   7586 C  CG2 . THR B 1 456 ? 49.119  10.563  -21.247 1.00 19.99 ? 457 THR B CG2 1 
ATOM   7587 N  N   . PHE B 1 457 ? 51.751  11.537  -23.897 1.00 17.31 ? 458 PHE B N   1 
ATOM   7588 C  CA  . PHE B 1 457 ? 53.177  11.260  -23.882 1.00 16.76 ? 458 PHE B CA  1 
ATOM   7589 C  C   . PHE B 1 457 ? 53.743  11.567  -22.490 1.00 16.94 ? 458 PHE B C   1 
ATOM   7590 O  O   . PHE B 1 457 ? 53.818  12.735  -22.085 1.00 16.83 ? 458 PHE B O   1 
ATOM   7591 C  CB  . PHE B 1 457 ? 53.884  12.053  -24.992 1.00 16.37 ? 458 PHE B CB  1 
ATOM   7592 C  CG  . PHE B 1 457 ? 55.389  11.995  -24.938 1.00 15.89 ? 458 PHE B CG  1 
ATOM   7593 C  CD1 . PHE B 1 457 ? 56.084  10.901  -25.461 1.00 14.89 ? 458 PHE B CD1 1 
ATOM   7594 C  CD2 . PHE B 1 457 ? 56.117  13.052  -24.396 1.00 15.33 ? 458 PHE B CD2 1 
ATOM   7595 C  CE1 . PHE B 1 457 ? 57.482  10.859  -25.431 1.00 13.74 ? 458 PHE B CE1 1 
ATOM   7596 C  CE2 . PHE B 1 457 ? 57.522  13.022  -24.368 1.00 14.72 ? 458 PHE B CE2 1 
ATOM   7597 C  CZ  . PHE B 1 457 ? 58.198  11.921  -24.877 1.00 13.97 ? 458 PHE B CZ  1 
ATOM   7598 N  N   . ASN B 1 458 ? 54.093  10.503  -21.760 1.00 17.04 ? 459 ASN B N   1 
ATOM   7599 C  CA  . ASN B 1 458 ? 54.752  10.588  -20.447 1.00 17.35 ? 459 ASN B CA  1 
ATOM   7600 C  C   . ASN B 1 458 ? 56.100  9.874   -20.519 1.00 16.96 ? 459 ASN B C   1 
ATOM   7601 O  O   . ASN B 1 458 ? 56.380  8.952   -19.754 1.00 16.40 ? 459 ASN B O   1 
ATOM   7602 C  CB  . ASN B 1 458 ? 53.869  9.963   -19.362 1.00 17.75 ? 459 ASN B CB  1 
ATOM   7603 C  CG  . ASN B 1 458 ? 52.722  10.873  -18.945 1.00 19.85 ? 459 ASN B CG  1 
ATOM   7604 O  OD1 . ASN B 1 458 ? 52.906  12.070  -18.741 1.00 22.07 ? 459 ASN B OD1 1 
ATOM   7605 N  ND2 . ASN B 1 458 ? 51.534  10.305  -18.814 1.00 21.51 ? 459 ASN B ND2 1 
ATOM   7606 N  N   . LEU B 1 459 ? 56.926  10.338  -21.453 1.00 17.23 ? 460 LEU B N   1 
ATOM   7607 C  CA  . LEU B 1 459 ? 58.139  9.652   -21.935 1.00 17.72 ? 460 LEU B CA  1 
ATOM   7608 C  C   . LEU B 1 459 ? 57.845  8.341   -22.681 1.00 18.12 ? 460 LEU B C   1 
ATOM   7609 O  O   . LEU B 1 459 ? 58.236  8.202   -23.839 1.00 18.30 ? 460 LEU B O   1 
ATOM   7610 C  CB  . LEU B 1 459 ? 59.246  9.495   -20.881 1.00 17.57 ? 460 LEU B CB  1 
ATOM   7611 C  CG  . LEU B 1 459 ? 60.539  9.407   -21.725 1.00 19.60 ? 460 LEU B CG  1 
ATOM   7612 C  CD1 . LEU B 1 459 ? 61.348  10.702  -21.731 1.00 16.48 ? 460 LEU B CD1 1 
ATOM   7613 C  CD2 . LEU B 1 459 ? 61.388  8.220   -21.359 1.00 19.10 ? 460 LEU B CD2 1 
ATOM   7614 N  N   . ILE B 1 460 ? 57.178  7.388   -22.027 1.00 18.33 ? 461 ILE B N   1 
ATOM   7615 C  CA  . ILE B 1 460 ? 56.501  6.327   -22.758 1.00 18.74 ? 461 ILE B CA  1 
ATOM   7616 C  C   . ILE B 1 460 ? 55.093  6.814   -23.104 1.00 18.88 ? 461 ILE B C   1 
ATOM   7617 O  O   . ILE B 1 460 ? 54.557  7.706   -22.432 1.00 19.15 ? 461 ILE B O   1 
ATOM   7618 C  CB  . ILE B 1 460 ? 56.434  4.984   -21.974 1.00 19.09 ? 461 ILE B CB  1 
ATOM   7619 C  CG1 . ILE B 1 460 ? 55.578  5.124   -20.710 1.00 20.07 ? 461 ILE B CG1 1 
ATOM   7620 C  CG2 . ILE B 1 460 ? 57.854  4.446   -21.690 1.00 17.94 ? 461 ILE B CG2 1 
ATOM   7621 C  CD1 . ILE B 1 460 ? 55.376  3.827   -19.945 1.00 21.97 ? 461 ILE B CD1 1 
ATOM   7622 N  N   . LEU B 1 461 ? 54.499  6.255   -24.154 1.00 18.76 ? 462 LEU B N   1 
ATOM   7623 C  CA  . LEU B 1 461 ? 53.124  6.608   -24.499 1.00 18.85 ? 462 LEU B CA  1 
ATOM   7624 C  C   . LEU B 1 461 ? 52.153  5.825   -23.624 1.00 18.88 ? 462 LEU B C   1 
ATOM   7625 O  O   . LEU B 1 461 ? 52.403  4.660   -23.287 1.00 17.66 ? 462 LEU B O   1 
ATOM   7626 C  CB  . LEU B 1 461 ? 52.839  6.417   -25.993 1.00 18.37 ? 462 LEU B CB  1 
ATOM   7627 C  CG  . LEU B 1 461 ? 53.544  7.370   -26.968 1.00 19.21 ? 462 LEU B CG  1 
ATOM   7628 C  CD1 . LEU B 1 461 ? 53.513  6.816   -28.388 1.00 17.92 ? 462 LEU B CD1 1 
ATOM   7629 C  CD2 . LEU B 1 461 ? 52.953  8.792   -26.935 1.00 18.31 ? 462 LEU B CD2 1 
ATOM   7630 N  N   . MET B 1 462 ? 51.060  6.489   -23.243 1.00 19.59 ? 463 MET B N   1 
ATOM   7631 C  CA  . MET B 1 462 ? 50.104  5.955   -22.266 1.00 20.83 ? 463 MET B CA  1 
ATOM   7632 C  C   . MET B 1 462 ? 48.685  6.425   -22.562 1.00 21.09 ? 463 MET B C   1 
ATOM   7633 O  O   . MET B 1 462 ? 48.507  7.463   -23.206 1.00 20.44 ? 463 MET B O   1 
ATOM   7634 C  CB  . MET B 1 462 ? 50.461  6.449   -20.864 1.00 21.18 ? 463 MET B CB  1 
ATOM   7635 C  CG  . MET B 1 462 ? 51.758  5.912   -20.293 1.00 23.98 ? 463 MET B CG  1 
ATOM   7636 S  SD  . MET B 1 462 ? 52.043  6.595   -18.655 1.00 29.67 ? 463 MET B SD  1 
ATOM   7637 C  CE  . MET B 1 462 ? 50.774  5.732   -17.708 1.00 28.22 ? 463 MET B CE  1 
ATOM   7638 N  N   . PRO B 1 463 ? 47.666  5.686   -22.059 1.00 21.51 ? 464 PRO B N   1 
ATOM   7639 C  CA  . PRO B 1 463 ? 46.284  6.185   -22.166 1.00 22.07 ? 464 PRO B CA  1 
ATOM   7640 C  C   . PRO B 1 463 ? 46.185  7.555   -21.522 1.00 22.50 ? 464 PRO B C   1 
ATOM   7641 O  O   . PRO B 1 463 ? 46.788  7.781   -20.467 1.00 22.30 ? 464 PRO B O   1 
ATOM   7642 C  CB  . PRO B 1 463 ? 45.462  5.179   -21.351 1.00 22.08 ? 464 PRO B CB  1 
ATOM   7643 C  CG  . PRO B 1 463 ? 46.311  3.991   -21.194 1.00 22.07 ? 464 PRO B CG  1 
ATOM   7644 C  CD  . PRO B 1 463 ? 47.744  4.390   -21.361 1.00 21.38 ? 464 PRO B CD  1 
ATOM   7645 N  N   . GLU B 1 464 ? 45.456  8.460   -22.163 1.00 23.09 ? 465 GLU B N   1 
ATOM   7646 C  CA  . GLU B 1 464 ? 45.255  9.812   -21.642 1.00 24.21 ? 465 GLU B CA  1 
ATOM   7647 C  C   . GLU B 1 464 ? 44.347  9.844   -20.405 1.00 23.78 ? 465 GLU B C   1 
ATOM   7648 O  O   . GLU B 1 464 ? 44.445  10.751  -19.593 1.00 23.70 ? 465 GLU B O   1 
ATOM   7649 C  CB  . GLU B 1 464 ? 44.706  10.743  -22.739 1.00 24.91 ? 465 GLU B CB  1 
ATOM   7650 C  CG  . GLU B 1 464 ? 44.494  12.189  -22.270 1.00 29.11 ? 465 GLU B CG  1 
ATOM   7651 C  CD  . GLU B 1 464 ? 44.173  13.175  -23.388 1.00 33.81 ? 465 GLU B CD  1 
ATOM   7652 O  OE1 . GLU B 1 464 ? 43.695  12.753  -24.471 1.00 36.13 ? 465 GLU B OE1 1 
ATOM   7653 O  OE2 . GLU B 1 464 ? 44.405  14.387  -23.170 1.00 35.88 ? 465 GLU B OE2 1 
ATOM   7654 N  N   . LYS B 1 465 ? 43.467  8.853   -20.275 1.00 23.96 ? 466 LYS B N   1 
ATOM   7655 C  CA  . LYS B 1 465 ? 42.562  8.745   -19.122 1.00 23.74 ? 466 LYS B CA  1 
ATOM   7656 C  C   . LYS B 1 465 ? 42.392  7.271   -18.709 1.00 23.27 ? 466 LYS B C   1 
ATOM   7657 O  O   . LYS B 1 465 ? 42.724  6.367   -19.489 1.00 22.92 ? 466 LYS B O   1 
ATOM   7658 C  CB  . LYS B 1 465 ? 41.210  9.402   -19.429 1.00 23.88 ? 466 LYS B CB  1 
ATOM   7659 C  CG  . LYS B 1 465 ? 40.438  8.729   -20.556 1.00 25.99 ? 466 LYS B CG  1 
ATOM   7660 C  CD  . LYS B 1 465 ? 39.166  9.482   -20.910 1.00 29.27 ? 466 LYS B CD  1 
ATOM   7661 C  CE  . LYS B 1 465 ? 38.376  8.708   -21.956 1.00 31.19 ? 466 LYS B CE  1 
ATOM   7662 N  NZ  . LYS B 1 465 ? 37.033  9.302   -22.205 1.00 33.71 ? 466 LYS B NZ  1 
ATOM   7663 N  N   . PRO B 1 466 ? 41.903  7.024   -17.475 1.00 22.70 ? 467 PRO B N   1 
ATOM   7664 C  CA  . PRO B 1 466 ? 41.705  5.652   -17.006 1.00 22.00 ? 467 PRO B CA  1 
ATOM   7665 C  C   . PRO B 1 466 ? 40.739  4.838   -17.872 1.00 21.72 ? 467 PRO B C   1 
ATOM   7666 O  O   . PRO B 1 466 ? 39.802  5.388   -18.465 1.00 21.82 ? 467 PRO B O   1 
ATOM   7667 C  CB  . PRO B 1 466 ? 41.141  5.842   -15.589 1.00 22.09 ? 467 PRO B CB  1 
ATOM   7668 C  CG  . PRO B 1 466 ? 41.700  7.150   -15.137 1.00 21.92 ? 467 PRO B CG  1 
ATOM   7669 C  CD  . PRO B 1 466 ? 41.760  8.009   -16.380 1.00 22.83 ? 467 PRO B CD  1 
ATOM   7670 N  N   . ILE B 1 467 ? 40.990  3.536   -17.951 1.00 21.23 ? 468 ILE B N   1 
ATOM   7671 C  CA  . ILE B 1 467 ? 40.127  2.608   -18.676 1.00 21.08 ? 468 ILE B CA  1 
ATOM   7672 C  C   . ILE B 1 467 ? 39.563  1.642   -17.646 1.00 21.04 ? 468 ILE B C   1 
ATOM   7673 O  O   . ILE B 1 467 ? 40.330  0.961   -16.963 1.00 20.74 ? 468 ILE B O   1 
ATOM   7674 C  CB  . ILE B 1 467 ? 40.916  1.789   -19.747 1.00 20.83 ? 468 ILE B CB  1 
ATOM   7675 C  CG1 . ILE B 1 467 ? 41.528  2.708   -20.808 1.00 20.40 ? 468 ILE B CG1 1 
ATOM   7676 C  CG2 . ILE B 1 467 ? 40.009  0.717   -20.394 1.00 21.32 ? 468 ILE B CG2 1 
ATOM   7677 C  CD1 . ILE B 1 467 ? 42.658  2.071   -21.610 1.00 19.51 ? 468 ILE B CD1 1 
ATOM   7678 N  N   . SER B 1 468 ? 38.237  1.589   -17.513 1.00 21.01 ? 469 SER B N   1 
ATOM   7679 C  CA  . SER B 1 468 ? 37.631  0.591   -16.629 1.00 21.49 ? 469 SER B CA  1 
ATOM   7680 C  C   . SER B 1 468 ? 36.985  -0.550  -17.407 1.00 21.02 ? 469 SER B C   1 
ATOM   7681 O  O   . SER B 1 468 ? 36.185  -0.331  -18.312 1.00 21.50 ? 469 SER B O   1 
ATOM   7682 C  CB  . SER B 1 468 ? 36.657  1.213   -15.613 1.00 21.50 ? 469 SER B CB  1 
ATOM   7683 O  OG  . SER B 1 468 ? 35.797  2.157   -16.222 1.00 24.11 ? 469 SER B OG  1 
ATOM   7684 N  N   . PHE B 1 469 ? 37.357  -1.771  -17.046 1.00 20.38 ? 470 PHE B N   1 
ATOM   7685 C  CA  . PHE B 1 469 ? 36.868  -2.965  -17.714 1.00 19.85 ? 470 PHE B CA  1 
ATOM   7686 C  C   . PHE B 1 469 ? 35.802  -3.648  -16.883 1.00 19.74 ? 470 PHE B C   1 
ATOM   7687 O  O   . PHE B 1 469 ? 35.767  -3.496  -15.664 1.00 20.03 ? 470 PHE B O   1 
ATOM   7688 C  CB  . PHE B 1 469 ? 38.007  -3.971  -17.884 1.00 19.70 ? 470 PHE B CB  1 
ATOM   7689 C  CG  . PHE B 1 469 ? 39.111  -3.508  -18.790 1.00 19.59 ? 470 PHE B CG  1 
ATOM   7690 C  CD1 . PHE B 1 469 ? 40.306  -3.047  -18.261 1.00 19.38 ? 470 PHE B CD1 1 
ATOM   7691 C  CD2 . PHE B 1 469 ? 38.961  -3.550  -20.168 1.00 18.38 ? 470 PHE B CD2 1 
ATOM   7692 C  CE1 . PHE B 1 469 ? 41.344  -2.634  -19.096 1.00 19.94 ? 470 PHE B CE1 1 
ATOM   7693 C  CE2 . PHE B 1 469 ? 39.988  -3.140  -21.009 1.00 19.25 ? 470 PHE B CE2 1 
ATOM   7694 C  CZ  . PHE B 1 469 ? 41.180  -2.677  -20.470 1.00 19.79 ? 470 PHE B CZ  1 
ATOM   7695 N  N   . THR B 1 470 ? 34.959  -4.427  -17.551 1.00 19.65 ? 471 THR B N   1 
ATOM   7696 C  CA  . THR B 1 470 ? 34.113  -5.401  -16.889 1.00 19.58 ? 471 THR B CA  1 
ATOM   7697 C  C   . THR B 1 470 ? 34.561  -6.795  -17.333 1.00 19.61 ? 471 THR B C   1 
ATOM   7698 O  O   . THR B 1 470 ? 34.661  -7.064  -18.530 1.00 19.89 ? 471 THR B O   1 
ATOM   7699 C  CB  . THR B 1 470 ? 32.616  -5.176  -17.211 1.00 19.57 ? 471 THR B CB  1 
ATOM   7700 O  OG1 . THR B 1 470 ? 32.217  -3.876  -16.745 1.00 19.14 ? 471 THR B OG1 1 
ATOM   7701 C  CG2 . THR B 1 470 ? 31.765  -6.237  -16.543 1.00 18.87 ? 471 THR B CG2 1 
ATOM   7702 N  N   . PHE B 1 471 ? 34.851  -7.660  -16.366 1.00 19.56 ? 472 PHE B N   1 
ATOM   7703 C  CA  . PHE B 1 471 ? 35.249  -9.043  -16.639 1.00 20.02 ? 472 PHE B CA  1 
ATOM   7704 C  C   . PHE B 1 471 ? 34.130  -10.009 -16.235 1.00 20.80 ? 472 PHE B C   1 
ATOM   7705 O  O   . PHE B 1 471 ? 33.576  -9.900  -15.131 1.00 19.81 ? 472 PHE B O   1 
ATOM   7706 C  CB  . PHE B 1 471 ? 36.533  -9.413  -15.889 1.00 19.70 ? 472 PHE B CB  1 
ATOM   7707 C  CG  . PHE B 1 471 ? 37.730  -8.566  -16.252 1.00 20.32 ? 472 PHE B CG  1 
ATOM   7708 C  CD1 . PHE B 1 471 ? 38.047  -7.435  -15.508 1.00 19.70 ? 472 PHE B CD1 1 
ATOM   7709 C  CD2 . PHE B 1 471 ? 38.547  -8.910  -17.326 1.00 20.63 ? 472 PHE B CD2 1 
ATOM   7710 C  CE1 . PHE B 1 471 ? 39.156  -6.651  -15.828 1.00 20.77 ? 472 PHE B CE1 1 
ATOM   7711 C  CE2 . PHE B 1 471 ? 39.648  -8.131  -17.657 1.00 21.55 ? 472 PHE B CE2 1 
ATOM   7712 C  CZ  . PHE B 1 471 ? 39.955  -6.996  -16.902 1.00 20.49 ? 472 PHE B CZ  1 
ATOM   7713 N  N   . TRP B 1 472 ? 33.801  -10.929 -17.145 1.00 21.65 ? 473 TRP B N   1 
ATOM   7714 C  CA  . TRP B 1 472 ? 32.863  -12.026 -16.877 1.00 23.10 ? 473 TRP B CA  1 
ATOM   7715 C  C   . TRP B 1 472 ? 33.610  -13.358 -16.983 1.00 23.73 ? 473 TRP B C   1 
ATOM   7716 O  O   . TRP B 1 472 ? 34.410  -13.531 -17.899 1.00 23.61 ? 473 TRP B O   1 
ATOM   7717 C  CB  . TRP B 1 472 ? 31.716  -12.030 -17.895 1.00 23.09 ? 473 TRP B CB  1 
ATOM   7718 C  CG  . TRP B 1 472 ? 30.966  -10.733 -18.025 1.00 24.65 ? 473 TRP B CG  1 
ATOM   7719 C  CD1 . TRP B 1 472 ? 31.339  -9.634  -18.753 1.00 25.43 ? 473 TRP B CD1 1 
ATOM   7720 C  CD2 . TRP B 1 472 ? 29.707  -10.408 -17.428 1.00 25.74 ? 473 TRP B CD2 1 
ATOM   7721 N  NE1 . TRP B 1 472 ? 30.396  -8.644  -18.638 1.00 26.41 ? 473 TRP B NE1 1 
ATOM   7722 C  CE2 . TRP B 1 472 ? 29.379  -9.093  -17.834 1.00 26.77 ? 473 TRP B CE2 1 
ATOM   7723 C  CE3 . TRP B 1 472 ? 28.821  -11.102 -16.593 1.00 26.18 ? 473 TRP B CE3 1 
ATOM   7724 C  CZ2 . TRP B 1 472 ? 28.204  -8.454  -17.430 1.00 27.52 ? 473 TRP B CZ2 1 
ATOM   7725 C  CZ3 . TRP B 1 472 ? 27.653  -10.468 -16.188 1.00 28.03 ? 473 TRP B CZ3 1 
ATOM   7726 C  CH2 . TRP B 1 472 ? 27.355  -9.153  -16.608 1.00 28.53 ? 473 TRP B CH2 1 
ATOM   7727 N  N   . PRO B 1 473 ? 33.339  -14.311 -16.066 1.00 24.83 ? 474 PRO B N   1 
ATOM   7728 C  CA  . PRO B 1 473 ? 33.946  -15.643 -16.165 1.00 25.92 ? 474 PRO B CA  1 
ATOM   7729 C  C   . PRO B 1 473 ? 33.428  -16.390 -17.391 1.00 27.24 ? 474 PRO B C   1 
ATOM   7730 O  O   . PRO B 1 473 ? 32.216  -16.510 -17.566 1.00 27.81 ? 474 PRO B O   1 
ATOM   7731 C  CB  . PRO B 1 473 ? 33.484  -16.346 -14.884 1.00 25.99 ? 474 PRO B CB  1 
ATOM   7732 C  CG  . PRO B 1 473 ? 32.934  -15.283 -14.003 1.00 25.18 ? 474 PRO B CG  1 
ATOM   7733 C  CD  . PRO B 1 473 ? 32.440  -14.206 -14.904 1.00 24.86 ? 474 PRO B CD  1 
ATOM   7734 N  N   . PHE B 1 474 ? 34.343  -16.875 -18.232 1.00 28.31 ? 475 PHE B N   1 
ATOM   7735 C  CA  . PHE B 1 474 ? 33.979  -17.537 -19.488 1.00 29.32 ? 475 PHE B CA  1 
ATOM   7736 C  C   . PHE B 1 474 ? 33.557  -18.978 -19.250 1.00 29.60 ? 475 PHE B C   1 
ATOM   7737 O  O   . PHE B 1 474 ? 34.192  -19.689 -18.472 1.00 30.40 ? 475 PHE B O   1 
ATOM   7738 C  CB  . PHE B 1 474 ? 35.137  -17.463 -20.502 1.00 29.37 ? 475 PHE B CB  1 
ATOM   7739 C  CG  . PHE B 1 474 ? 35.025  -18.454 -21.632 1.00 30.14 ? 475 PHE B CG  1 
ATOM   7740 C  CD1 . PHE B 1 474 ? 34.153  -18.228 -22.694 1.00 31.05 ? 475 PHE B CD1 1 
ATOM   7741 C  CD2 . PHE B 1 474 ? 35.803  -19.616 -21.639 1.00 31.02 ? 475 PHE B CD2 1 
ATOM   7742 C  CE1 . PHE B 1 474 ? 34.050  -19.150 -23.742 1.00 31.28 ? 475 PHE B CE1 1 
ATOM   7743 C  CE2 . PHE B 1 474 ? 35.704  -20.543 -22.679 1.00 30.15 ? 475 PHE B CE2 1 
ATOM   7744 C  CZ  . PHE B 1 474 ? 34.830  -20.309 -23.732 1.00 30.77 ? 475 PHE B CZ  1 
ATOM   7745 N  N   . GLY C 2 43  ? -2.673  11.680  26.732  1.00 61.01 ? 44  GLY C N   1 
ATOM   7746 C  CA  . GLY C 2 43  ? -1.312  12.103  26.294  1.00 60.96 ? 44  GLY C CA  1 
ATOM   7747 C  C   . GLY C 2 43  ? -0.245  11.225  26.911  1.00 60.97 ? 44  GLY C C   1 
ATOM   7748 O  O   . GLY C 2 43  ? 0.504   11.665  27.787  1.00 61.04 ? 44  GLY C O   1 
ATOM   7749 N  N   . ALA C 2 44  ? -0.174  9.981   26.439  1.00 60.90 ? 45  ALA C N   1 
ATOM   7750 C  CA  . ALA C 2 44  ? 0.687   8.958   27.039  1.00 60.70 ? 45  ALA C CA  1 
ATOM   7751 C  C   . ALA C 2 44  ? 2.195   9.226   26.904  1.00 60.61 ? 45  ALA C C   1 
ATOM   7752 O  O   . ALA C 2 44  ? 2.947   8.999   27.855  1.00 60.58 ? 45  ALA C O   1 
ATOM   7753 C  CB  . ALA C 2 44  ? 0.323   7.578   26.501  1.00 60.68 ? 45  ALA C CB  1 
ATOM   7754 N  N   . CYS C 2 45  ? 2.629   9.721   25.742  1.00 60.40 ? 46  CYS C N   1 
ATOM   7755 C  CA  . CYS C 2 45  ? 4.046   10.054  25.527  1.00 60.26 ? 46  CYS C CA  1 
ATOM   7756 C  C   . CYS C 2 45  ? 4.459   11.347  26.244  1.00 60.34 ? 46  CYS C C   1 
ATOM   7757 O  O   . CYS C 2 45  ? 5.653   11.623  26.406  1.00 60.21 ? 46  CYS C O   1 
ATOM   7758 C  CB  . CYS C 2 45  ? 4.373   10.142  24.032  1.00 60.27 ? 46  CYS C CB  1 
ATOM   7759 S  SG  . CYS C 2 45  ? 4.189   11.791  23.297  1.00 59.50 ? 46  CYS C SG  1 
ATOM   7760 N  N   . GLU C 2 46  ? 3.453   12.128  26.647  1.00 60.46 ? 47  GLU C N   1 
ATOM   7761 C  CA  . GLU C 2 46  ? 3.611   13.355  27.445  1.00 60.60 ? 47  GLU C CA  1 
ATOM   7762 C  C   . GLU C 2 46  ? 4.220   14.542  26.683  1.00 60.58 ? 47  GLU C C   1 
ATOM   7763 O  O   . GLU C 2 46  ? 5.225   15.120  27.101  1.00 60.51 ? 47  GLU C O   1 
ATOM   7764 C  CB  . GLU C 2 46  ? 4.330   13.070  28.778  1.00 60.62 ? 47  GLU C CB  1 
ATOM   7765 C  CG  . GLU C 2 46  ? 3.453   12.320  29.786  1.00 60.91 ? 47  GLU C CG  1 
ATOM   7766 C  CD  . GLU C 2 46  ? 4.241   11.578  30.859  1.00 61.16 ? 47  GLU C CD  1 
ATOM   7767 O  OE1 . GLU C 2 46  ? 5.332   12.050  31.254  1.00 60.88 ? 47  GLU C OE1 1 
ATOM   7768 O  OE2 . GLU C 2 46  ? 3.755   10.519  31.315  1.00 60.88 ? 47  GLU C OE2 1 
ATOM   7769 N  N   . GLY C 2 47  ? 3.590   14.889  25.562  1.00 60.64 ? 48  GLY C N   1 
ATOM   7770 C  CA  . GLY C 2 47  ? 3.897   16.110  24.815  1.00 60.98 ? 48  GLY C CA  1 
ATOM   7771 C  C   . GLY C 2 47  ? 5.189   16.164  24.013  1.00 61.18 ? 48  GLY C C   1 
ATOM   7772 O  O   . GLY C 2 47  ? 5.751   17.247  23.826  1.00 61.23 ? 48  GLY C O   1 
ATOM   7773 N  N   . THR C 2 48  ? 5.654   15.013  23.525  1.00 61.33 ? 49  THR C N   1 
ATOM   7774 C  CA  . THR C 2 48  ? 6.917   14.948  22.772  1.00 61.39 ? 49  THR C CA  1 
ATOM   7775 C  C   . THR C 2 48  ? 6.738   14.513  21.313  1.00 61.72 ? 49  THR C C   1 
ATOM   7776 O  O   . THR C 2 48  ? 7.716   14.158  20.648  1.00 61.77 ? 49  THR C O   1 
ATOM   7777 C  CB  . THR C 2 48  ? 7.967   14.024  23.457  1.00 61.31 ? 49  THR C CB  1 
ATOM   7778 O  OG1 . THR C 2 48  ? 7.494   12.671  23.468  1.00 61.21 ? 49  THR C OG1 1 
ATOM   7779 C  CG2 . THR C 2 48  ? 8.263   14.476  24.884  1.00 60.89 ? 49  THR C CG2 1 
ATOM   7780 N  N   . LEU C 2 49  ? 5.496   14.555  20.823  1.00 62.15 ? 50  LEU C N   1 
ATOM   7781 C  CA  . LEU C 2 49  ? 5.140   14.067  19.477  1.00 62.50 ? 50  LEU C CA  1 
ATOM   7782 C  C   . LEU C 2 49  ? 5.557   12.609  19.232  1.00 62.90 ? 50  LEU C C   1 
ATOM   7783 O  O   . LEU C 2 49  ? 6.042   12.265  18.151  1.00 62.94 ? 50  LEU C O   1 
ATOM   7784 C  CB  . LEU C 2 49  ? 5.703   14.985  18.377  1.00 62.45 ? 50  LEU C CB  1 
ATOM   7785 C  CG  . LEU C 2 49  ? 4.744   15.776  17.482  1.00 62.21 ? 50  LEU C CG  1 
ATOM   7786 C  CD1 . LEU C 2 49  ? 5.514   16.809  16.680  1.00 62.02 ? 50  LEU C CD1 1 
ATOM   7787 C  CD2 . LEU C 2 49  ? 3.962   14.852  16.547  1.00 61.96 ? 50  LEU C CD2 1 
ATOM   7788 N  N   . ALA C 2 50  ? 5.354   11.761  20.237  1.00 63.38 ? 51  ALA C N   1 
ATOM   7789 C  CA  . ALA C 2 50  ? 5.792   10.366  20.176  1.00 63.93 ? 51  ALA C CA  1 
ATOM   7790 C  C   . ALA C 2 50  ? 4.646   9.354   20.328  1.00 64.30 ? 51  ALA C C   1 
ATOM   7791 O  O   . ALA C 2 50  ? 4.888   8.163   20.542  1.00 64.42 ? 51  ALA C O   1 
ATOM   7792 C  CB  . ALA C 2 50  ? 6.890   10.111  21.210  1.00 63.88 ? 51  ALA C CB  1 
ATOM   7793 N  N   . CYS C 2 51  ? 3.408   9.837   20.221  1.00 64.74 ? 52  CYS C N   1 
ATOM   7794 C  CA  . CYS C 2 51  ? 2.211   8.981   20.166  1.00 65.12 ? 52  CYS C CA  1 
ATOM   7795 C  C   . CYS C 2 51  ? 1.085   9.710   19.419  1.00 65.56 ? 52  CYS C C   1 
ATOM   7796 O  O   . CYS C 2 51  ? 1.351   10.615  18.626  1.00 65.85 ? 52  CYS C O   1 
ATOM   7797 C  CB  . CYS C 2 51  ? 1.767   8.543   21.571  1.00 65.03 ? 52  CYS C CB  1 
ATOM   7798 S  SG  . CYS C 2 51  ? 0.932   9.804   22.571  1.00 64.49 ? 52  CYS C SG  1 
ATOM   7799 N  N   . SER C 2 52  ? -0.162  9.314   19.658  1.00 65.98 ? 53  SER C N   1 
ATOM   7800 C  CA  . SER C 2 52  ? -1.314  10.005  19.070  1.00 66.32 ? 53  SER C CA  1 
ATOM   7801 C  C   . SER C 2 52  ? -2.525  10.036  20.014  1.00 66.62 ? 53  SER C C   1 
ATOM   7802 O  O   . SER C 2 52  ? -3.656  10.282  19.583  1.00 66.67 ? 53  SER C O   1 
ATOM   7803 C  CB  . SER C 2 52  ? -1.681  9.395   17.707  1.00 66.30 ? 53  SER C CB  1 
ATOM   7804 O  OG  . SER C 2 52  ? -1.855  7.991   17.791  1.00 66.13 ? 53  SER C OG  1 
ATOM   7805 N  N   . THR C 2 53  ? -2.269  9.812   21.304  1.00 66.99 ? 54  THR C N   1 
ATOM   7806 C  CA  . THR C 2 53  ? -3.325  9.737   22.324  1.00 67.28 ? 54  THR C CA  1 
ATOM   7807 C  C   . THR C 2 53  ? -3.894  11.104  22.729  1.00 67.50 ? 54  THR C C   1 
ATOM   7808 O  O   . THR C 2 53  ? -4.867  11.176  23.484  1.00 67.51 ? 54  THR C O   1 
ATOM   7809 C  CB  . THR C 2 53  ? -2.851  8.976   23.597  1.00 67.32 ? 54  THR C CB  1 
ATOM   7810 O  OG1 . THR C 2 53  ? -1.669  9.591   24.124  1.00 67.33 ? 54  THR C OG1 1 
ATOM   7811 C  CG2 . THR C 2 53  ? -2.567  7.505   23.288  1.00 67.27 ? 54  THR C CG2 1 
ATOM   7812 N  N   . CYS C 2 54  ? -3.288  12.179  22.226  1.00 67.77 ? 55  CYS C N   1 
ATOM   7813 C  CA  . CYS C 2 54  ? -3.749  13.542  22.506  1.00 68.00 ? 55  CYS C CA  1 
ATOM   7814 C  C   . CYS C 2 54  ? -4.577  14.128  21.354  1.00 68.20 ? 55  CYS C C   1 
ATOM   7815 O  O   . CYS C 2 54  ? -4.810  15.340  21.302  1.00 68.24 ? 55  CYS C O   1 
ATOM   7816 C  CB  . CYS C 2 54  ? -2.558  14.453  22.822  1.00 68.00 ? 55  CYS C CB  1 
ATOM   7817 S  SG  . CYS C 2 54  ? -1.464  14.760  21.409  1.00 67.96 ? 55  CYS C SG  1 
ATOM   7818 N  N   . HIS C 2 55  ? -5.018  13.259  20.444  1.00 68.42 ? 56  HIS C N   1 
ATOM   7819 C  CA  . HIS C 2 55  ? -5.815  13.648  19.273  1.00 68.65 ? 56  HIS C CA  1 
ATOM   7820 C  C   . HIS C 2 55  ? -7.154  14.292  19.671  1.00 68.82 ? 56  HIS C C   1 
ATOM   7821 O  O   . HIS C 2 55  ? -8.044  13.625  20.212  1.00 68.83 ? 56  HIS C O   1 
ATOM   7822 C  CB  . HIS C 2 55  ? -6.020  12.430  18.353  1.00 68.61 ? 56  HIS C CB  1 
ATOM   7823 C  CG  . HIS C 2 55  ? -6.868  12.700  17.146  1.00 68.67 ? 56  HIS C CG  1 
ATOM   7824 N  ND1 . HIS C 2 55  ? -7.802  11.799  16.679  1.00 68.71 ? 56  HIS C ND1 1 
ATOM   7825 C  CD2 . HIS C 2 55  ? -6.922  13.764  16.308  1.00 68.76 ? 56  HIS C CD2 1 
ATOM   7826 C  CE1 . HIS C 2 55  ? -8.393  12.294  15.607  1.00 68.59 ? 56  HIS C CE1 1 
ATOM   7827 N  NE2 . HIS C 2 55  ? -7.880  13.486  15.361  1.00 68.73 ? 56  HIS C NE2 1 
ATOM   7828 N  N   . LEU C 2 56  ? -7.274  15.594  19.405  1.00 68.94 ? 57  LEU C N   1 
ATOM   7829 C  CA  . LEU C 2 56  ? -8.463  16.370  19.774  1.00 69.06 ? 57  LEU C CA  1 
ATOM   7830 C  C   . LEU C 2 56  ? -9.236  16.863  18.551  1.00 69.07 ? 57  LEU C C   1 
ATOM   7831 O  O   . LEU C 2 56  ? -8.696  17.577  17.707  1.00 69.11 ? 57  LEU C O   1 
ATOM   7832 C  CB  . LEU C 2 56  ? -8.087  17.555  20.678  1.00 68.99 ? 57  LEU C CB  1 
ATOM   7833 C  CG  . LEU C 2 56  ? -7.684  17.293  22.136  1.00 69.06 ? 57  LEU C CG  1 
ATOM   7834 C  CD1 . LEU C 2 56  ? -7.072  18.544  22.751  1.00 69.09 ? 57  LEU C CD1 1 
ATOM   7835 C  CD2 . LEU C 2 56  ? -8.862  16.804  22.981  1.00 68.81 ? 57  LEU C CD2 1 
ATOM   7836 N  N   . ASP C 2 71  ? 5.256   17.891  8.926   1.00 66.74 ? 72  ASP C N   1 
ATOM   7837 C  CA  . ASP C 2 71  ? 5.423   16.579  8.311   1.00 66.81 ? 72  ASP C CA  1 
ATOM   7838 C  C   . ASP C 2 71  ? 5.305   15.460  9.346   1.00 66.72 ? 72  ASP C C   1 
ATOM   7839 O  O   . ASP C 2 71  ? 4.685   14.429  9.081   1.00 66.62 ? 72  ASP C O   1 
ATOM   7840 C  CB  . ASP C 2 71  ? 6.777   16.476  7.602   1.00 66.91 ? 72  ASP C CB  1 
ATOM   7841 C  CG  . ASP C 2 71  ? 7.111   17.708  6.772   1.00 67.51 ? 72  ASP C CG  1 
ATOM   7842 O  OD1 . ASP C 2 71  ? 6.599   17.834  5.637   1.00 67.96 ? 72  ASP C OD1 1 
ATOM   7843 O  OD2 . ASP C 2 71  ? 7.906   18.545  7.254   1.00 68.20 ? 72  ASP C OD2 1 
ATOM   7844 N  N   . GLU C 2 72  ? 5.909   15.673  10.516  1.00 66.69 ? 73  GLU C N   1 
ATOM   7845 C  CA  . GLU C 2 72  ? 5.950   14.678  11.598  1.00 66.61 ? 73  GLU C CA  1 
ATOM   7846 C  C   . GLU C 2 72  ? 4.575   14.498  12.226  1.00 66.59 ? 73  GLU C C   1 
ATOM   7847 O  O   . GLU C 2 72  ? 4.170   13.378  12.546  1.00 66.43 ? 73  GLU C O   1 
ATOM   7848 C  CB  . GLU C 2 72  ? 6.966   15.081  12.679  1.00 66.57 ? 73  GLU C CB  1 
ATOM   7849 C  CG  . GLU C 2 72  ? 8.430   15.061  12.238  1.00 66.45 ? 73  GLU C CG  1 
ATOM   7850 C  CD  . GLU C 2 72  ? 8.758   16.134  11.208  1.00 66.53 ? 73  GLU C CD  1 
ATOM   7851 O  OE1 . GLU C 2 72  ? 8.634   17.339  11.524  1.00 66.45 ? 73  GLU C OE1 1 
ATOM   7852 O  OE2 . GLU C 2 72  ? 9.139   15.767  10.077  1.00 66.14 ? 73  GLU C OE2 1 
ATOM   7853 N  N   . GLU C 2 73  ? 3.874   15.617  12.397  1.00 66.64 ? 74  GLU C N   1 
ATOM   7854 C  CA  . GLU C 2 73  ? 2.505   15.632  12.895  1.00 66.73 ? 74  GLU C CA  1 
ATOM   7855 C  C   . GLU C 2 73  ? 1.554   14.962  11.896  1.00 66.72 ? 74  GLU C C   1 
ATOM   7856 O  O   . GLU C 2 73  ? 0.639   14.239  12.294  1.00 66.69 ? 74  GLU C O   1 
ATOM   7857 C  CB  . GLU C 2 73  ? 2.071   17.071  13.185  1.00 66.74 ? 74  GLU C CB  1 
ATOM   7858 C  CG  . GLU C 2 73  ? 0.816   17.193  14.041  1.00 67.03 ? 74  GLU C CG  1 
ATOM   7859 C  CD  . GLU C 2 73  ? 0.534   18.617  14.492  1.00 67.35 ? 74  GLU C CD  1 
ATOM   7860 O  OE1 . GLU C 2 73  ? 1.331   19.527  14.174  1.00 67.69 ? 74  GLU C OE1 1 
ATOM   7861 O  OE2 . GLU C 2 73  ? -0.493  18.826  15.171  1.00 67.57 ? 74  GLU C OE2 1 
ATOM   7862 N  N   . ASN C 2 74  ? 1.791   15.202  10.606  1.00 66.75 ? 75  ASN C N   1 
ATOM   7863 C  CA  . ASN C 2 74  ? 1.034   14.570  9.521   1.00 66.85 ? 75  ASN C CA  1 
ATOM   7864 C  C   . ASN C 2 74  ? 1.071   13.038  9.539   1.00 66.93 ? 75  ASN C C   1 
ATOM   7865 O  O   . ASN C 2 74  ? 0.079   12.387  9.202   1.00 66.94 ? 75  ASN C O   1 
ATOM   7866 C  CB  . ASN C 2 74  ? 1.525   15.076  8.156   1.00 66.88 ? 75  ASN C CB  1 
ATOM   7867 C  CG  . ASN C 2 74  ? 0.933   16.423  7.774   1.00 66.83 ? 75  ASN C CG  1 
ATOM   7868 O  OD1 . ASN C 2 74  ? -0.237  16.702  8.038   1.00 66.86 ? 75  ASN C OD1 1 
ATOM   7869 N  ND2 . ASN C 2 74  ? 1.741   17.261  7.132   1.00 66.59 ? 75  ASN C ND2 1 
ATOM   7870 N  N   . ASP C 2 75  ? 2.214   12.473  9.926   1.00 67.01 ? 76  ASP C N   1 
ATOM   7871 C  CA  . ASP C 2 75  ? 2.397   11.019  9.947   1.00 67.13 ? 76  ASP C CA  1 
ATOM   7872 C  C   . ASP C 2 75  ? 1.748   10.363  11.170  1.00 67.16 ? 76  ASP C C   1 
ATOM   7873 O  O   . ASP C 2 75  ? 1.170   9.277   11.063  1.00 67.12 ? 76  ASP C O   1 
ATOM   7874 C  CB  . ASP C 2 75  ? 3.883   10.655  9.870   1.00 67.13 ? 76  ASP C CB  1 
ATOM   7875 C  CG  . ASP C 2 75  ? 4.589   11.294  8.682   1.00 67.36 ? 76  ASP C CG  1 
ATOM   7876 O  OD1 . ASP C 2 75  ? 3.908   11.830  7.777   1.00 67.35 ? 76  ASP C OD1 1 
ATOM   7877 O  OD2 . ASP C 2 75  ? 5.838   11.259  8.656   1.00 67.86 ? 76  ASP C OD2 1 
ATOM   7878 N  N   . MET C 2 76  ? 1.847   11.025  12.323  1.00 67.25 ? 77  MET C N   1 
ATOM   7879 C  CA  . MET C 2 76  ? 1.186   10.569  13.554  1.00 67.43 ? 77  MET C CA  1 
ATOM   7880 C  C   . MET C 2 76  ? -0.339  10.607  13.428  1.00 67.52 ? 77  MET C C   1 
ATOM   7881 O  O   . MET C 2 76  ? -1.051  9.895   14.141  1.00 67.59 ? 77  MET C O   1 
ATOM   7882 C  CB  . MET C 2 76  ? 1.637   11.406  14.759  1.00 67.31 ? 77  MET C CB  1 
ATOM   7883 C  CG  . MET C 2 76  ? 3.094   11.207  15.180  1.00 67.37 ? 77  MET C CG  1 
ATOM   7884 S  SD  . MET C 2 76  ? 3.411   9.691   16.116  1.00 67.81 ? 77  MET C SD  1 
ATOM   7885 C  CE  . MET C 2 76  ? 3.554   8.467   14.816  1.00 67.06 ? 77  MET C CE  1 
ATOM   7886 N  N   . LEU C 2 77  ? -0.820  11.436  12.503  1.00 67.66 ? 78  LEU C N   1 
ATOM   7887 C  CA  . LEU C 2 77  ? -2.243  11.650  12.277  1.00 67.80 ? 78  LEU C CA  1 
ATOM   7888 C  C   . LEU C 2 77  ? -2.841  10.584  11.352  1.00 67.89 ? 78  LEU C C   1 
ATOM   7889 O  O   . LEU C 2 77  ? -4.007  10.211  11.498  1.00 67.89 ? 78  LEU C O   1 
ATOM   7890 C  CB  . LEU C 2 77  ? -2.457  13.050  11.688  1.00 67.78 ? 78  LEU C CB  1 
ATOM   7891 C  CG  . LEU C 2 77  ? -3.557  13.956  12.245  1.00 67.89 ? 78  LEU C CG  1 
ATOM   7892 C  CD1 . LEU C 2 77  ? -3.347  14.252  13.734  1.00 67.91 ? 78  LEU C CD1 1 
ATOM   7893 C  CD2 . LEU C 2 77  ? -3.611  15.253  11.442  1.00 67.88 ? 78  LEU C CD2 1 
ATOM   7894 N  N   . ASP C 2 78  ? -2.037  10.098  10.408  1.00 67.95 ? 79  ASP C N   1 
ATOM   7895 C  CA  . ASP C 2 78  ? -2.462  9.057   9.469   1.00 68.12 ? 79  ASP C CA  1 
ATOM   7896 C  C   . ASP C 2 78  ? -2.591  7.675   10.134  1.00 68.13 ? 79  ASP C C   1 
ATOM   7897 O  O   . ASP C 2 78  ? -3.152  6.743   9.546   1.00 68.10 ? 79  ASP C O   1 
ATOM   7898 C  CB  . ASP C 2 78  ? -1.503  8.991   8.266   1.00 68.20 ? 79  ASP C CB  1 
ATOM   7899 C  CG  . ASP C 2 78  ? -1.542  10.255  7.402   1.00 68.56 ? 79  ASP C CG  1 
ATOM   7900 O  OD1 . ASP C 2 78  ? -0.561  10.497  6.664   1.00 68.77 ? 79  ASP C OD1 1 
ATOM   7901 O  OD2 . ASP C 2 78  ? -2.543  11.007  7.453   1.00 68.85 ? 79  ASP C OD2 1 
ATOM   7902 N  N   . LEU C 2 79  ? -2.067  7.558   11.355  1.00 68.11 ? 80  LEU C N   1 
ATOM   7903 C  CA  . LEU C 2 79  ? -2.105  6.316   12.129  1.00 68.00 ? 80  LEU C CA  1 
ATOM   7904 C  C   . LEU C 2 79  ? -2.742  6.544   13.496  1.00 67.90 ? 80  LEU C C   1 
ATOM   7905 O  O   . LEU C 2 79  ? -3.867  7.032   13.594  1.00 67.85 ? 80  LEU C O   1 
ATOM   7906 C  CB  . LEU C 2 79  ? -0.691  5.738   12.295  1.00 68.00 ? 80  LEU C CB  1 
ATOM   7907 C  CG  . LEU C 2 79  ? -0.150  4.681   11.316  1.00 68.16 ? 80  LEU C CG  1 
ATOM   7908 C  CD1 . LEU C 2 79  ? -0.085  5.171   9.873   1.00 68.27 ? 80  LEU C CD1 1 
ATOM   7909 C  CD2 . LEU C 2 79  ? 1.226   4.208   11.759  1.00 68.27 ? 80  LEU C CD2 1 
ATOM   7910 N  N   . ARG C 2 88  ? -6.252  17.502  14.619  1.00 74.58 ? 89  ARG C N   1 
ATOM   7911 C  CA  . ARG C 2 88  ? -4.921  17.921  15.049  1.00 74.67 ? 89  ARG C CA  1 
ATOM   7912 C  C   . ARG C 2 88  ? -4.564  17.348  16.422  1.00 74.72 ? 89  ARG C C   1 
ATOM   7913 O  O   . ARG C 2 88  ? -5.448  16.993  17.205  1.00 74.82 ? 89  ARG C O   1 
ATOM   7914 C  CB  . ARG C 2 88  ? -4.803  19.455  15.065  1.00 74.65 ? 89  ARG C CB  1 
ATOM   7915 C  CG  . ARG C 2 88  ? -4.882  20.138  13.692  1.00 74.65 ? 89  ARG C CG  1 
ATOM   7916 C  CD  . ARG C 2 88  ? -3.670  19.844  12.803  1.00 74.54 ? 89  ARG C CD  1 
ATOM   7917 N  NE  . ARG C 2 88  ? -2.422  20.370  13.355  1.00 74.91 ? 89  ARG C NE  1 
ATOM   7918 C  CZ  . ARG C 2 88  ? -1.916  21.572  13.082  1.00 75.01 ? 89  ARG C CZ  1 
ATOM   7919 N  NH1 . ARG C 2 88  ? -2.545  22.401  12.256  1.00 75.14 ? 89  ARG C NH1 1 
ATOM   7920 N  NH2 . ARG C 2 88  ? -0.774  21.948  13.638  1.00 74.74 ? 89  ARG C NH2 1 
ATOM   7921 N  N   . LEU C 2 89  ? -3.263  17.266  16.701  1.00 74.71 ? 90  LEU C N   1 
ATOM   7922 C  CA  . LEU C 2 89  ? -2.757  16.718  17.960  1.00 74.62 ? 90  LEU C CA  1 
ATOM   7923 C  C   . LEU C 2 89  ? -2.722  17.772  19.062  1.00 74.53 ? 90  LEU C C   1 
ATOM   7924 O  O   . LEU C 2 89  ? -2.195  18.870  18.865  1.00 74.52 ? 90  LEU C O   1 
ATOM   7925 C  CB  . LEU C 2 89  ? -1.362  16.105  17.766  1.00 74.65 ? 90  LEU C CB  1 
ATOM   7926 C  CG  . LEU C 2 89  ? -1.243  14.805  16.960  1.00 74.65 ? 90  LEU C CG  1 
ATOM   7927 C  CD1 . LEU C 2 89  ? 0.199   14.562  16.550  1.00 74.58 ? 90  LEU C CD1 1 
ATOM   7928 C  CD2 . LEU C 2 89  ? -1.786  13.609  17.736  1.00 74.73 ? 90  LEU C CD2 1 
ATOM   7929 N  N   . GLY C 2 90  ? -3.275  17.416  20.221  1.00 74.40 ? 91  GLY C N   1 
ATOM   7930 C  CA  . GLY C 2 90  ? -3.418  18.326  21.361  1.00 74.19 ? 91  GLY C CA  1 
ATOM   7931 C  C   . GLY C 2 90  ? -2.146  18.976  21.878  1.00 74.05 ? 91  GLY C C   1 
ATOM   7932 O  O   . GLY C 2 90  ? -2.178  20.122  22.330  1.00 74.11 ? 91  GLY C O   1 
ATOM   7933 N  N   . CYS C 2 91  ? -1.029  18.250  21.823  1.00 73.86 ? 92  CYS C N   1 
ATOM   7934 C  CA  . CYS C 2 91  ? 0.259   18.788  22.266  1.00 73.59 ? 92  CYS C CA  1 
ATOM   7935 C  C   . CYS C 2 91  ? 0.966   19.517  21.127  1.00 73.51 ? 92  CYS C C   1 
ATOM   7936 O  O   . CYS C 2 91  ? 1.747   20.434  21.360  1.00 73.41 ? 92  CYS C O   1 
ATOM   7937 C  CB  . CYS C 2 91  ? 1.157   17.685  22.848  1.00 73.64 ? 92  CYS C CB  1 
ATOM   7938 S  SG  . CYS C 2 91  ? 2.088   16.676  21.640  1.00 72.86 ? 92  CYS C SG  1 
ATOM   7939 N  N   . GLY D 2 43  ? 77.177  -12.638 -38.226 1.00 64.43 ? 44  GLY D N   1 
ATOM   7940 C  CA  . GLY D 2 43  ? 76.417  -12.997 -36.994 1.00 64.36 ? 44  GLY D CA  1 
ATOM   7941 C  C   . GLY D 2 43  ? 76.693  -12.031 -35.860 1.00 64.34 ? 44  GLY D C   1 
ATOM   7942 O  O   . GLY D 2 43  ? 77.344  -12.386 -34.874 1.00 64.36 ? 44  GLY D O   1 
ATOM   7943 N  N   . ALA D 2 44  ? 76.178  -10.812 -36.002 1.00 64.33 ? 45  ALA D N   1 
ATOM   7944 C  CA  . ALA D 2 44  ? 76.497  -9.703  -35.099 1.00 64.34 ? 45  ALA D CA  1 
ATOM   7945 C  C   . ALA D 2 44  ? 76.104  -9.922  -33.632 1.00 64.36 ? 45  ALA D C   1 
ATOM   7946 O  O   . ALA D 2 44  ? 76.861  -9.559  -32.731 1.00 64.40 ? 45  ALA D O   1 
ATOM   7947 C  CB  . ALA D 2 44  ? 75.907  -8.404  -35.631 1.00 64.33 ? 45  ALA D CB  1 
ATOM   7948 N  N   . CYS D 2 45  ? 74.938  -10.525 -33.394 1.00 64.37 ? 46  CYS D N   1 
ATOM   7949 C  CA  . CYS D 2 45  ? 74.499  -10.839 -32.026 1.00 64.25 ? 46  CYS D CA  1 
ATOM   7950 C  C   . CYS D 2 45  ? 75.098  -12.150 -31.500 1.00 64.47 ? 46  CYS D C   1 
ATOM   7951 O  O   . CYS D 2 45  ? 74.878  -12.516 -30.344 1.00 64.36 ? 46  CYS D O   1 
ATOM   7952 C  CB  . CYS D 2 45  ? 72.968  -10.864 -31.925 1.00 64.20 ? 46  CYS D CB  1 
ATOM   7953 S  SG  . CYS D 2 45  ? 72.194  -12.431 -32.388 1.00 63.22 ? 46  CYS D SG  1 
ATOM   7954 N  N   . GLU D 2 46  ? 75.841  -12.848 -32.359 1.00 64.71 ? 47  GLU D N   1 
ATOM   7955 C  CA  . GLU D 2 46  ? 76.573  -14.070 -31.994 1.00 64.96 ? 47  GLU D CA  1 
ATOM   7956 C  C   . GLU D 2 46  ? 75.679  -15.240 -31.543 1.00 65.02 ? 47  GLU D C   1 
ATOM   7957 O  O   . GLU D 2 46  ? 75.916  -15.860 -30.502 1.00 64.93 ? 47  GLU D O   1 
ATOM   7958 C  CB  . GLU D 2 46  ? 77.687  -13.759 -30.978 1.00 65.00 ? 47  GLU D CB  1 
ATOM   7959 C  CG  . GLU D 2 46  ? 78.884  -13.029 -31.595 1.00 65.48 ? 47  GLU D CG  1 
ATOM   7960 C  CD  . GLU D 2 46  ? 79.574  -12.072 -30.633 1.00 65.82 ? 47  GLU D CD  1 
ATOM   7961 O  OE1 . GLU D 2 46  ? 79.935  -12.492 -29.510 1.00 65.73 ? 47  GLU D OE1 1 
ATOM   7962 O  OE2 . GLU D 2 46  ? 79.763  -10.895 -31.013 1.00 65.93 ? 47  GLU D OE2 1 
ATOM   7963 N  N   . GLY D 2 47  ? 74.648  -15.519 -32.340 1.00 65.16 ? 48  GLY D N   1 
ATOM   7964 C  CA  . GLY D 2 47  ? 73.843  -16.734 -32.200 1.00 65.52 ? 48  GLY D CA  1 
ATOM   7965 C  C   . GLY D 2 47  ? 72.818  -16.776 -31.080 1.00 65.75 ? 48  GLY D C   1 
ATOM   7966 O  O   . GLY D 2 47  ? 72.634  -17.820 -30.449 1.00 65.78 ? 48  GLY D O   1 
ATOM   7967 N  N   . THR D 2 48  ? 72.140  -15.655 -30.841 1.00 65.99 ? 49  THR D N   1 
ATOM   7968 C  CA  . THR D 2 48  ? 71.112  -15.577 -29.793 1.00 66.11 ? 49  THR D CA  1 
ATOM   7969 C  C   . THR D 2 48  ? 69.738  -15.168 -30.337 1.00 66.34 ? 49  THR D C   1 
ATOM   7970 O  O   . THR D 2 48  ? 68.815  -14.902 -29.563 1.00 66.40 ? 49  THR D O   1 
ATOM   7971 C  CB  . THR D 2 48  ? 71.519  -14.609 -28.648 1.00 66.07 ? 49  THR D CB  1 
ATOM   7972 O  OG1 . THR D 2 48  ? 71.842  -13.324 -29.193 1.00 66.02 ? 49  THR D OG1 1 
ATOM   7973 C  CG2 . THR D 2 48  ? 72.715  -15.150 -27.861 1.00 65.72 ? 49  THR D CG2 1 
ATOM   7974 N  N   . LEU D 2 49  ? 69.614  -15.133 -31.666 1.00 66.65 ? 50  LEU D N   1 
ATOM   7975 C  CA  . LEU D 2 49  ? 68.391  -14.696 -32.368 1.00 66.99 ? 50  LEU D CA  1 
ATOM   7976 C  C   . LEU D 2 49  ? 67.974  -13.260 -31.989 1.00 67.20 ? 50  LEU D C   1 
ATOM   7977 O  O   . LEU D 2 49  ? 66.812  -12.996 -31.667 1.00 67.20 ? 50  LEU D O   1 
ATOM   7978 C  CB  . LEU D 2 49  ? 67.244  -15.709 -32.168 1.00 66.95 ? 50  LEU D CB  1 
ATOM   7979 C  CG  . LEU D 2 49  ? 66.083  -15.774 -33.172 1.00 67.05 ? 50  LEU D CG  1 
ATOM   7980 C  CD1 . LEU D 2 49  ? 66.564  -16.142 -34.571 1.00 67.13 ? 50  LEU D CD1 1 
ATOM   7981 C  CD2 . LEU D 2 49  ? 65.019  -16.757 -32.701 1.00 66.89 ? 50  LEU D CD2 1 
ATOM   7982 N  N   . ALA D 2 50  ? 68.940  -12.343 -32.043 1.00 67.50 ? 51  ALA D N   1 
ATOM   7983 C  CA  . ALA D 2 50  ? 68.740  -10.950 -31.630 1.00 67.85 ? 51  ALA D CA  1 
ATOM   7984 C  C   . ALA D 2 50  ? 69.144  -9.938  -32.710 1.00 68.16 ? 51  ALA D C   1 
ATOM   7985 O  O   . ALA D 2 50  ? 69.256  -8.740  -32.437 1.00 68.20 ? 51  ALA D O   1 
ATOM   7986 C  CB  . ALA D 2 50  ? 69.483  -10.672 -30.325 1.00 67.81 ? 51  ALA D CB  1 
ATOM   7987 N  N   . CYS D 2 51  ? 69.371  -10.434 -33.926 1.00 68.50 ? 52  CYS D N   1 
ATOM   7988 C  CA  . CYS D 2 51  ? 69.598  -9.601  -35.115 1.00 68.79 ? 52  CYS D CA  1 
ATOM   7989 C  C   . CYS D 2 51  ? 69.170  -10.381 -36.364 1.00 69.23 ? 52  CYS D C   1 
ATOM   7990 O  O   . CYS D 2 51  ? 68.406  -11.346 -36.261 1.00 69.41 ? 52  CYS D O   1 
ATOM   7991 C  CB  . CYS D 2 51  ? 71.061  -9.140  -35.209 1.00 68.75 ? 52  CYS D CB  1 
ATOM   7992 S  SG  . CYS D 2 51  ? 72.289  -10.423 -35.595 1.00 67.92 ? 52  CYS D SG  1 
ATOM   7993 N  N   . SER D 2 52  ? 69.647  -9.968  -37.537 1.00 69.58 ? 53  SER D N   1 
ATOM   7994 C  CA  . SER D 2 52  ? 69.343  -10.681 -38.781 1.00 69.93 ? 53  SER D CA  1 
ATOM   7995 C  C   . SER D 2 52  ? 70.539  -10.747 -39.742 1.00 70.29 ? 53  SER D C   1 
ATOM   7996 O  O   . SER D 2 52  ? 70.373  -10.966 -40.947 1.00 70.33 ? 53  SER D O   1 
ATOM   7997 C  CB  . SER D 2 52  ? 68.107  -10.079 -39.466 1.00 69.85 ? 53  SER D CB  1 
ATOM   7998 O  OG  . SER D 2 52  ? 68.241  -8.680  -39.643 1.00 69.71 ? 53  SER D OG  1 
ATOM   7999 N  N   . THR D 2 53  ? 71.741  -10.581 -39.188 1.00 70.70 ? 54  THR D N   1 
ATOM   8000 C  CA  . THR D 2 53  ? 72.980  -10.504 -39.973 1.00 71.08 ? 54  THR D CA  1 
ATOM   8001 C  C   . THR D 2 53  ? 73.548  -11.875 -40.372 1.00 71.42 ? 54  THR D C   1 
ATOM   8002 O  O   . THR D 2 53  ? 74.587  -11.954 -41.035 1.00 71.41 ? 54  THR D O   1 
ATOM   8003 C  CB  . THR D 2 53  ? 74.070  -9.695  -39.227 1.00 71.06 ? 54  THR D CB  1 
ATOM   8004 O  OG1 . THR D 2 53  ? 74.364  -10.321 -37.973 1.00 71.08 ? 54  THR D OG1 1 
ATOM   8005 C  CG2 . THR D 2 53  ? 73.615  -8.256  -38.982 1.00 71.08 ? 54  THR D CG2 1 
ATOM   8006 N  N   . CYS D 2 54  ? 72.866  -12.945 -39.964 1.00 71.80 ? 55  CYS D N   1 
ATOM   8007 C  CA  . CYS D 2 54  ? 73.264  -14.311 -40.312 1.00 72.21 ? 55  CYS D CA  1 
ATOM   8008 C  C   . CYS D 2 54  ? 72.360  -14.904 -41.400 1.00 72.43 ? 55  CYS D C   1 
ATOM   8009 O  O   . CYS D 2 54  ? 72.301  -16.126 -41.580 1.00 72.42 ? 55  CYS D O   1 
ATOM   8010 C  CB  . CYS D 2 54  ? 73.255  -15.200 -39.066 1.00 72.21 ? 55  CYS D CB  1 
ATOM   8011 S  SG  . CYS D 2 54  ? 71.607  -15.452 -38.356 1.00 72.62 ? 55  CYS D SG  1 
ATOM   8012 N  N   . HIS D 2 55  ? 71.664  -14.024 -42.120 1.00 72.76 ? 56  HIS D N   1 
ATOM   8013 C  CA  . HIS D 2 55  ? 70.758  -14.411 -43.203 1.00 73.03 ? 56  HIS D CA  1 
ATOM   8014 C  C   . HIS D 2 55  ? 71.516  -15.083 -44.354 1.00 73.18 ? 56  HIS D C   1 
ATOM   8015 O  O   . HIS D 2 55  ? 72.331  -14.449 -45.030 1.00 73.24 ? 56  HIS D O   1 
ATOM   8016 C  CB  . HIS D 2 55  ? 69.968  -13.185 -43.688 1.00 73.01 ? 56  HIS D CB  1 
ATOM   8017 C  CG  . HIS D 2 55  ? 68.967  -13.482 -44.765 1.00 73.18 ? 56  HIS D CG  1 
ATOM   8018 N  ND1 . HIS D 2 55  ? 68.718  -12.613 -45.806 1.00 73.33 ? 56  HIS D ND1 1 
ATOM   8019 C  CD2 . HIS D 2 55  ? 68.155  -14.548 -44.963 1.00 73.34 ? 56  HIS D CD2 1 
ATOM   8020 C  CE1 . HIS D 2 55  ? 67.794  -13.129 -46.597 1.00 73.25 ? 56  HIS D CE1 1 
ATOM   8021 N  NE2 . HIS D 2 55  ? 67.437  -14.303 -46.109 1.00 73.46 ? 56  HIS D NE2 1 
ATOM   8022 N  N   . LEU D 2 56  ? 71.246  -16.373 -44.553 1.00 73.33 ? 57  LEU D N   1 
ATOM   8023 C  CA  . LEU D 2 56  ? 71.922  -17.171 -45.579 1.00 73.42 ? 57  LEU D CA  1 
ATOM   8024 C  C   . LEU D 2 56  ? 70.946  -17.684 -46.637 1.00 73.45 ? 57  LEU D C   1 
ATOM   8025 O  O   . LEU D 2 56  ? 70.027  -18.448 -46.335 1.00 73.52 ? 57  LEU D O   1 
ATOM   8026 C  CB  . LEU D 2 56  ? 72.682  -18.345 -44.944 1.00 73.42 ? 57  LEU D CB  1 
ATOM   8027 C  CG  . LEU D 2 56  ? 73.963  -18.075 -44.146 1.00 73.41 ? 57  LEU D CG  1 
ATOM   8028 C  CD1 . LEU D 2 56  ? 74.380  -19.325 -43.381 1.00 73.30 ? 57  LEU D CD1 1 
ATOM   8029 C  CD2 . LEU D 2 56  ? 75.099  -17.591 -45.044 1.00 73.27 ? 57  LEU D CD2 1 
ATOM   8030 N  N   . ASP D 2 71  ? 58.040  -18.600 -34.968 1.00 73.26 ? 72  ASP D N   1 
ATOM   8031 C  CA  . ASP D 2 71  ? 57.380  -17.298 -35.009 1.00 73.29 ? 72  ASP D CA  1 
ATOM   8032 C  C   . ASP D 2 71  ? 58.376  -16.153 -34.825 1.00 73.20 ? 72  ASP D C   1 
ATOM   8033 O  O   . ASP D 2 71  ? 58.275  -15.128 -35.499 1.00 73.17 ? 72  ASP D O   1 
ATOM   8034 C  CB  . ASP D 2 71  ? 56.271  -17.209 -33.949 1.00 73.33 ? 72  ASP D CB  1 
ATOM   8035 C  CG  . ASP D 2 71  ? 55.205  -18.293 -34.108 1.00 73.73 ? 72  ASP D CG  1 
ATOM   8036 O  OD1 . ASP D 2 71  ? 54.536  -18.615 -33.102 1.00 73.88 ? 72  ASP D OD1 1 
ATOM   8037 O  OD2 . ASP D 2 71  ? 55.028  -18.824 -35.227 1.00 74.02 ? 72  ASP D OD2 1 
ATOM   8038 N  N   . GLU D 2 72  ? 59.331  -16.339 -33.913 1.00 73.14 ? 73  GLU D N   1 
ATOM   8039 C  CA  . GLU D 2 72  ? 60.353  -15.331 -33.605 1.00 73.09 ? 73  GLU D CA  1 
ATOM   8040 C  C   . GLU D 2 72  ? 61.319  -15.152 -34.768 1.00 73.07 ? 73  GLU D C   1 
ATOM   8041 O  O   . GLU D 2 72  ? 61.677  -14.025 -35.120 1.00 72.97 ? 73  GLU D O   1 
ATOM   8042 C  CB  . GLU D 2 72  ? 61.134  -15.704 -32.336 1.00 73.02 ? 73  GLU D CB  1 
ATOM   8043 C  CG  . GLU D 2 72  ? 60.356  -15.554 -31.029 1.00 73.06 ? 73  GLU D CG  1 
ATOM   8044 C  CD  . GLU D 2 72  ? 59.289  -16.628 -30.833 1.00 73.21 ? 73  GLU D CD  1 
ATOM   8045 O  OE1 . GLU D 2 72  ? 59.621  -17.833 -30.896 1.00 73.01 ? 73  GLU D OE1 1 
ATOM   8046 O  OE2 . GLU D 2 72  ? 58.115  -16.262 -30.612 1.00 73.04 ? 73  GLU D OE2 1 
ATOM   8047 N  N   . GLU D 2 73  ? 61.731  -16.276 -35.355 1.00 73.07 ? 74  GLU D N   1 
ATOM   8048 C  CA  . GLU D 2 73  ? 62.627  -16.285 -36.507 1.00 73.14 ? 74  GLU D CA  1 
ATOM   8049 C  C   . GLU D 2 73  ? 61.981  -15.615 -37.719 1.00 73.12 ? 74  GLU D C   1 
ATOM   8050 O  O   . GLU D 2 73  ? 62.661  -14.944 -38.495 1.00 73.16 ? 74  GLU D O   1 
ATOM   8051 C  CB  . GLU D 2 73  ? 63.049  -17.719 -36.845 1.00 73.12 ? 74  GLU D CB  1 
ATOM   8052 C  CG  . GLU D 2 73  ? 64.248  -17.818 -37.785 1.00 73.21 ? 74  GLU D CG  1 
ATOM   8053 C  CD  . GLU D 2 73  ? 64.822  -19.223 -37.884 1.00 73.45 ? 74  GLU D CD  1 
ATOM   8054 O  OE1 . GLU D 2 73  ? 64.557  -20.054 -36.986 1.00 73.61 ? 74  GLU D OE1 1 
ATOM   8055 O  OE2 . GLU D 2 73  ? 65.550  -19.495 -38.862 1.00 73.50 ? 74  GLU D OE2 1 
ATOM   8056 N  N   . ASN D 2 74  ? 60.669  -15.796 -37.862 1.00 73.15 ? 75  ASN D N   1 
ATOM   8057 C  CA  . ASN D 2 74  ? 59.897  -15.185 -38.945 1.00 73.18 ? 75  ASN D CA  1 
ATOM   8058 C  C   . ASN D 2 74  ? 59.771  -13.665 -38.848 1.00 73.15 ? 75  ASN D C   1 
ATOM   8059 O  O   . ASN D 2 74  ? 59.673  -12.984 -39.871 1.00 73.15 ? 75  ASN D O   1 
ATOM   8060 C  CB  . ASN D 2 74  ? 58.509  -15.826 -39.043 1.00 73.21 ? 75  ASN D CB  1 
ATOM   8061 C  CG  . ASN D 2 74  ? 58.516  -17.116 -39.848 1.00 73.41 ? 75  ASN D CG  1 
ATOM   8062 O  OD1 . ASN D 2 74  ? 59.303  -17.277 -40.784 1.00 73.46 ? 75  ASN D OD1 1 
ATOM   8063 N  ND2 . ASN D 2 74  ? 57.629  -18.039 -39.491 1.00 73.47 ? 75  ASN D ND2 1 
ATOM   8064 N  N   . ASP D 2 75  ? 59.770  -13.143 -37.622 1.00 73.18 ? 76  ASP D N   1 
ATOM   8065 C  CA  . ASP D 2 75  ? 59.720  -11.697 -37.389 1.00 73.20 ? 76  ASP D CA  1 
ATOM   8066 C  C   . ASP D 2 75  ? 61.069  -11.041 -37.691 1.00 73.23 ? 76  ASP D C   1 
ATOM   8067 O  O   . ASP D 2 75  ? 61.121  -9.948  -38.263 1.00 73.12 ? 76  ASP D O   1 
ATOM   8068 C  CB  . ASP D 2 75  ? 59.289  -11.387 -35.952 1.00 73.18 ? 76  ASP D CB  1 
ATOM   8069 C  CG  . ASP D 2 75  ? 57.963  -12.032 -35.580 1.00 73.22 ? 76  ASP D CG  1 
ATOM   8070 O  OD1 . ASP D 2 75  ? 57.218  -12.458 -36.491 1.00 73.04 ? 76  ASP D OD1 1 
ATOM   8071 O  OD2 . ASP D 2 75  ? 57.669  -12.117 -34.367 1.00 73.29 ? 76  ASP D OD2 1 
ATOM   8072 N  N   . MET D 2 76  ? 62.149  -11.721 -37.304 1.00 73.29 ? 77  MET D N   1 
ATOM   8073 C  CA  . MET D 2 76  ? 63.516  -11.289 -37.614 1.00 73.43 ? 77  MET D CA  1 
ATOM   8074 C  C   . MET D 2 76  ? 63.791  -11.326 -39.118 1.00 73.50 ? 77  MET D C   1 
ATOM   8075 O  O   . MET D 2 76  ? 64.642  -10.586 -39.621 1.00 73.55 ? 77  MET D O   1 
ATOM   8076 C  CB  . MET D 2 76  ? 64.541  -12.170 -36.888 1.00 73.37 ? 77  MET D CB  1 
ATOM   8077 C  CG  . MET D 2 76  ? 64.638  -11.967 -35.380 1.00 73.47 ? 77  MET D CG  1 
ATOM   8078 S  SD  . MET D 2 76  ? 65.501  -10.456 -34.888 1.00 73.96 ? 77  MET D SD  1 
ATOM   8079 C  CE  . MET D 2 76  ? 64.149  -9.285  -34.817 1.00 73.38 ? 77  MET D CE  1 
ATOM   8080 N  N   . LEU D 2 77  ? 63.052  -12.186 -39.817 1.00 73.59 ? 78  LEU D N   1 
ATOM   8081 C  CA  . LEU D 2 77  ? 63.243  -12.448 -41.243 1.00 73.66 ? 78  LEU D CA  1 
ATOM   8082 C  C   . LEU D 2 77  ? 62.526  -11.431 -42.138 1.00 73.68 ? 78  LEU D C   1 
ATOM   8083 O  O   . LEU D 2 77  ? 63.000  -11.129 -43.234 1.00 73.77 ? 78  LEU D O   1 
ATOM   8084 C  CB  . LEU D 2 77  ? 62.772  -13.871 -41.570 1.00 73.65 ? 78  LEU D CB  1 
ATOM   8085 C  CG  . LEU D 2 77  ? 63.486  -14.724 -42.623 1.00 73.70 ? 78  LEU D CG  1 
ATOM   8086 C  CD1 . LEU D 2 77  ? 64.933  -15.012 -42.233 1.00 73.64 ? 78  LEU D CD1 1 
ATOM   8087 C  CD2 . LEU D 2 77  ? 62.723  -16.032 -42.833 1.00 73.53 ? 78  LEU D CD2 1 
ATOM   8088 N  N   . ASP D 2 78  ? 61.395  -10.903 -41.669 1.00 73.76 ? 79  ASP D N   1 
ATOM   8089 C  CA  . ASP D 2 78  ? 60.597  -9.930  -42.434 1.00 73.82 ? 79  ASP D CA  1 
ATOM   8090 C  C   . ASP D 2 78  ? 61.237  -8.534  -42.489 1.00 73.82 ? 79  ASP D C   1 
ATOM   8091 O  O   . ASP D 2 78  ? 60.579  -7.547  -42.845 1.00 73.74 ? 79  ASP D O   1 
ATOM   8092 C  CB  . ASP D 2 78  ? 59.165  -9.844  -41.876 1.00 73.88 ? 79  ASP D CB  1 
ATOM   8093 C  CG  . ASP D 2 78  ? 58.300  -11.045 -42.265 1.00 74.18 ? 79  ASP D CG  1 
ATOM   8094 O  OD1 . ASP D 2 78  ? 57.529  -11.526 -41.405 1.00 74.31 ? 79  ASP D OD1 1 
ATOM   8095 O  OD2 . ASP D 2 78  ? 58.382  -11.506 -43.427 1.00 74.14 ? 79  ASP D OD2 1 
ATOM   8096 N  N   . LEU D 2 79  ? 62.523  -8.465  -42.146 1.00 73.82 ? 80  LEU D N   1 
ATOM   8097 C  CA  . LEU D 2 79  ? 63.260  -7.206  -42.090 1.00 73.78 ? 80  LEU D CA  1 
ATOM   8098 C  C   . LEU D 2 79  ? 64.548  -7.265  -42.914 1.00 73.77 ? 80  LEU D C   1 
ATOM   8099 O  O   . LEU D 2 79  ? 65.253  -8.276  -42.924 1.00 73.76 ? 80  LEU D O   1 
ATOM   8100 C  CB  . LEU D 2 79  ? 63.576  -6.838  -40.636 1.00 73.70 ? 80  LEU D CB  1 
ATOM   8101 C  CG  . LEU D 2 79  ? 62.411  -6.659  -39.653 1.00 73.80 ? 80  LEU D CG  1 
ATOM   8102 C  CD1 . LEU D 2 79  ? 62.844  -7.001  -38.232 1.00 73.83 ? 80  LEU D CD1 1 
ATOM   8103 C  CD2 . LEU D 2 79  ? 61.795  -5.261  -39.720 1.00 73.72 ? 80  LEU D CD2 1 
ATOM   8104 N  N   . ARG D 2 88  ? 66.289  -18.065 -44.706 1.00 72.35 ? 89  ARG D N   1 
ATOM   8105 C  CA  . ARG D 2 88  ? 66.422  -18.630 -43.366 1.00 72.45 ? 89  ARG D CA  1 
ATOM   8106 C  C   . ARG D 2 88  ? 67.686  -18.137 -42.661 1.00 72.53 ? 89  ARG D C   1 
ATOM   8107 O  O   . ARG D 2 88  ? 68.751  -18.030 -43.274 1.00 72.62 ? 89  ARG D O   1 
ATOM   8108 C  CB  . ARG D 2 88  ? 66.409  -20.165 -43.414 1.00 72.42 ? 89  ARG D CB  1 
ATOM   8109 C  CG  . ARG D 2 88  ? 65.054  -20.802 -43.757 1.00 72.39 ? 89  ARG D CG  1 
ATOM   8110 C  CD  . ARG D 2 88  ? 64.027  -20.656 -42.631 1.00 72.10 ? 89  ARG D CD  1 
ATOM   8111 N  NE  . ARG D 2 88  ? 64.585  -21.017 -41.328 1.00 72.26 ? 89  ARG D NE  1 
ATOM   8112 C  CZ  . ARG D 2 88  ? 64.433  -22.196 -40.731 1.00 72.07 ? 89  ARG D CZ  1 
ATOM   8113 N  NH1 . ARG D 2 88  ? 63.724  -23.162 -41.301 1.00 72.07 ? 89  ARG D NH1 1 
ATOM   8114 N  NH2 . ARG D 2 88  ? 64.992  -22.406 -39.548 1.00 71.92 ? 89  ARG D NH2 1 
ATOM   8115 N  N   . LEU D 2 89  ? 67.556  -17.844 -41.368 1.00 72.57 ? 90  LEU D N   1 
ATOM   8116 C  CA  . LEU D 2 89  ? 68.668  -17.354 -40.551 1.00 72.54 ? 90  LEU D CA  1 
ATOM   8117 C  C   . LEU D 2 89  ? 69.630  -18.474 -40.179 1.00 72.43 ? 90  LEU D C   1 
ATOM   8118 O  O   . LEU D 2 89  ? 69.207  -19.536 -39.721 1.00 72.39 ? 90  LEU D O   1 
ATOM   8119 C  CB  . LEU D 2 89  ? 68.147  -16.673 -39.279 1.00 72.58 ? 90  LEU D CB  1 
ATOM   8120 C  CG  . LEU D 2 89  ? 67.408  -15.339 -39.427 1.00 72.65 ? 90  LEU D CG  1 
ATOM   8121 C  CD1 . LEU D 2 89  ? 66.646  -15.014 -38.156 1.00 72.82 ? 90  LEU D CD1 1 
ATOM   8122 C  CD2 . LEU D 2 89  ? 68.360  -14.203 -39.792 1.00 72.72 ? 90  LEU D CD2 1 
ATOM   8123 N  N   . GLY D 2 90  ? 70.923  -18.217 -40.362 1.00 72.35 ? 91  GLY D N   1 
ATOM   8124 C  CA  . GLY D 2 90  ? 71.973  -19.198 -40.079 1.00 72.27 ? 91  GLY D CA  1 
ATOM   8125 C  C   . GLY D 2 90  ? 72.157  -19.548 -38.611 1.00 72.23 ? 91  GLY D C   1 
ATOM   8126 O  O   . GLY D 2 90  ? 73.072  -20.298 -38.259 1.00 72.19 ? 91  GLY D O   1 
ATOM   8127 N  N   . CYS D 2 91  ? 71.288  -19.004 -37.758 1.00 72.16 ? 92  CYS D N   1 
ATOM   8128 C  CA  . CYS D 2 91  ? 71.299  -19.279 -36.319 1.00 72.00 ? 92  CYS D CA  1 
ATOM   8129 C  C   . CYS D 2 91  ? 70.841  -20.694 -35.991 1.00 71.97 ? 92  CYS D C   1 
ATOM   8130 O  O   . CYS D 2 91  ? 71.487  -21.383 -35.204 1.00 71.94 ? 92  CYS D O   1 
ATOM   8131 C  CB  . CYS D 2 91  ? 70.426  -18.269 -35.566 1.00 72.06 ? 92  CYS D CB  1 
ATOM   8132 S  SG  . CYS D 2 91  ? 71.345  -16.991 -34.691 1.00 71.48 ? 92  CYS D SG  1 
HETATM 8133 C  CHA . HEM E 3 .   ? 12.534  0.128   18.256  1.00 13.40 ? 601 HEM A CHA 1 
HETATM 8134 C  CHB . HEM E 3 .   ? 12.933  0.385   13.400  1.00 13.01 ? 601 HEM A CHB 1 
HETATM 8135 C  CHC . HEM E 3 .   ? 16.757  3.276   13.887  1.00 14.58 ? 601 HEM A CHC 1 
HETATM 8136 C  CHD . HEM E 3 .   ? 16.753  2.546   18.678  1.00 14.92 ? 601 HEM A CHD 1 
HETATM 8137 C  C1A . HEM E 3 .   ? 12.293  -0.035  16.905  1.00 13.16 ? 601 HEM A C1A 1 
HETATM 8138 C  C2A . HEM E 3 .   ? 11.177  -0.752  16.319  1.00 12.64 ? 601 HEM A C2A 1 
HETATM 8139 C  C3A . HEM E 3 .   ? 11.291  -0.673  14.990  1.00 12.01 ? 601 HEM A C3A 1 
HETATM 8140 C  C4A . HEM E 3 .   ? 12.476  0.093   14.675  1.00 12.28 ? 601 HEM A C4A 1 
HETATM 8141 C  CMA . HEM E 3 .   ? 10.334  -1.298  13.954  1.00 9.65  ? 601 HEM A CMA 1 
HETATM 8142 C  CAA . HEM E 3 .   ? 10.039  -1.464  17.097  1.00 13.34 ? 601 HEM A CAA 1 
HETATM 8143 C  CBA . HEM E 3 .   ? 8.901   -0.444  17.247  1.00 14.53 ? 601 HEM A CBA 1 
HETATM 8144 C  CGA . HEM E 3 .   ? 7.626   -1.046  17.829  1.00 14.77 ? 601 HEM A CGA 1 
HETATM 8145 O  O1A . HEM E 3 .   ? 7.669   -2.105  18.514  1.00 15.95 ? 601 HEM A O1A 1 
HETATM 8146 O  O2A . HEM E 3 .   ? 6.542   -0.454  17.613  1.00 13.35 ? 601 HEM A O2A 1 
HETATM 8147 C  C1B . HEM E 3 .   ? 13.973  1.224   13.074  1.00 13.30 ? 601 HEM A C1B 1 
HETATM 8148 C  C2B . HEM E 3 .   ? 14.364  1.705   11.756  1.00 13.90 ? 601 HEM A C2B 1 
HETATM 8149 C  C3B . HEM E 3 .   ? 15.437  2.507   11.913  1.00 14.34 ? 601 HEM A C3B 1 
HETATM 8150 C  C4B . HEM E 3 .   ? 15.736  2.554   13.323  1.00 14.20 ? 601 HEM A C4B 1 
HETATM 8151 C  CMB . HEM E 3 .   ? 13.628  1.342   10.442  1.00 13.37 ? 601 HEM A CMB 1 
HETATM 8152 C  CAB . HEM E 3 .   ? 16.277  3.303   10.877  1.00 14.54 ? 601 HEM A CAB 1 
HETATM 8153 C  CBB . HEM E 3 .   ? 16.152  3.190   9.549   1.00 15.69 ? 601 HEM A CBB 1 
HETATM 8154 C  C1C . HEM E 3 .   ? 17.069  3.378   15.221  1.00 14.44 ? 601 HEM A C1C 1 
HETATM 8155 C  C2C . HEM E 3 .   ? 18.065  4.253   15.786  1.00 13.75 ? 601 HEM A C2C 1 
HETATM 8156 C  C3C . HEM E 3 .   ? 18.064  4.050   17.104  1.00 14.22 ? 601 HEM A C3C 1 
HETATM 8157 C  C4C . HEM E 3 .   ? 17.066  3.046   17.428  1.00 14.19 ? 601 HEM A C4C 1 
HETATM 8158 C  CMC . HEM E 3 .   ? 18.962  5.249   15.000  1.00 13.01 ? 601 HEM A CMC 1 
HETATM 8159 C  CAC . HEM E 3 .   ? 18.979  4.778   18.101  1.00 14.11 ? 601 HEM A CAC 1 
HETATM 8160 C  CBC . HEM E 3 .   ? 18.459  5.642   18.973  1.00 17.38 ? 601 HEM A CBC 1 
HETATM 8161 C  C1D . HEM E 3 .   ? 15.633  1.827   19.039  1.00 15.85 ? 601 HEM A C1D 1 
HETATM 8162 C  C2D . HEM E 3 .   ? 15.290  1.429   20.392  1.00 16.32 ? 601 HEM A C2D 1 
HETATM 8163 C  C3D . HEM E 3 .   ? 13.971  0.674   20.258  1.00 15.43 ? 601 HEM A C3D 1 
HETATM 8164 C  C4D . HEM E 3 .   ? 13.644  0.692   18.846  1.00 14.87 ? 601 HEM A C4D 1 
HETATM 8165 C  CMD . HEM E 3 .   ? 16.077  1.692   21.702  1.00 15.85 ? 601 HEM A CMD 1 
HETATM 8166 C  CAD . HEM E 3 .   ? 13.161  0.051   21.416  1.00 15.15 ? 601 HEM A CAD 1 
HETATM 8167 C  CBD . HEM E 3 .   ? 12.347  1.193   22.023  1.00 15.53 ? 601 HEM A CBD 1 
HETATM 8168 C  CGD . HEM E 3 .   ? 11.453  0.710   23.157  1.00 16.56 ? 601 HEM A CGD 1 
HETATM 8169 O  O1D . HEM E 3 .   ? 11.022  1.571   23.953  1.00 13.66 ? 601 HEM A O1D 1 
HETATM 8170 O  O2D . HEM E 3 .   ? 11.165  -0.514  23.269  1.00 15.95 ? 601 HEM A O2D 1 
HETATM 8171 N  NA  . HEM E 3 .   ? 13.044  0.484   15.869  1.00 13.51 ? 601 HEM A NA  1 
HETATM 8172 N  NB  . HEM E 3 .   ? 14.824  1.776   13.997  1.00 14.35 ? 601 HEM A NB  1 
HETATM 8173 N  NC  . HEM E 3 .   ? 16.469  2.678   16.250  1.00 14.56 ? 601 HEM A NC  1 
HETATM 8174 N  ND  . HEM E 3 .   ? 14.640  1.377   18.171  1.00 14.85 ? 601 HEM A ND  1 
HETATM 8175 FE FE  . HEM E 3 .   ? 14.694  1.609   16.062  1.00 15.36 ? 601 HEM A FE  1 
HETATM 8176 C  C1  . HC9 F 4 .   ? 13.022  -9.864  14.500  1.00 14.40 ? 602 HC9 A C1  1 
HETATM 8177 O  O1  . HC9 F 4 .   ? 10.650  -12.748 15.056  1.00 16.93 ? 602 HC9 A O1  1 
HETATM 8178 C  C2  . HC9 F 4 .   ? 12.100  -11.036 14.129  1.00 15.69 ? 602 HC9 A C2  1 
HETATM 8179 O  O2  . HC9 F 4 .   ? 16.375  -0.312  16.358  1.00 21.73 ? 602 HC9 A O2  1 
HETATM 8180 C  C3  . HC9 F 4 .   ? 11.419  -11.585 15.386  1.00 14.90 ? 602 HC9 A C3  1 
HETATM 8181 C  C4  . HC9 F 4 .   ? 10.529  -10.498 15.996  1.00 13.82 ? 602 HC9 A C4  1 
HETATM 8182 C  C5  . HC9 F 4 .   ? 11.358  -9.241  16.209  1.00 13.42 ? 602 HC9 A C5  1 
HETATM 8183 C  C6  . HC9 F 4 .   ? 11.289  -8.656  17.415  1.00 13.25 ? 602 HC9 A C6  1 
HETATM 8184 C  C7  . HC9 F 4 .   ? 12.188  -7.518  17.833  1.00 13.82 ? 602 HC9 A C7  1 
HETATM 8185 C  C8  . HC9 F 4 .   ? 12.569  -6.675  16.617  1.00 13.14 ? 602 HC9 A C8  1 
HETATM 8186 C  C9  . HC9 F 4 .   ? 13.222  -7.623  15.598  1.00 13.70 ? 602 HC9 A C9  1 
HETATM 8187 C  C10 . HC9 F 4 .   ? 12.229  -8.685  15.089  1.00 13.85 ? 602 HC9 A C10 1 
HETATM 8188 C  C11 . HC9 F 4 .   ? 13.948  -6.881  14.453  1.00 12.19 ? 602 HC9 A C11 1 
HETATM 8189 C  C12 . HC9 F 4 .   ? 14.913  -5.806  14.969  1.00 12.83 ? 602 HC9 A C12 1 
HETATM 8190 C  C13 . HC9 F 4 .   ? 14.184  -4.785  15.843  1.00 13.82 ? 602 HC9 A C13 1 
HETATM 8191 C  C14 . HC9 F 4 .   ? 13.551  -5.560  16.998  1.00 13.86 ? 602 HC9 A C14 1 
HETATM 8192 C  C15 . HC9 F 4 .   ? 13.122  -4.515  18.019  1.00 14.97 ? 602 HC9 A C15 1 
HETATM 8193 C  C16 . HC9 F 4 .   ? 14.230  -3.472  17.896  1.00 15.03 ? 602 HC9 A C16 1 
HETATM 8194 C  C17 . HC9 F 4 .   ? 15.080  -3.848  16.668  1.00 15.57 ? 602 HC9 A C17 1 
HETATM 8195 C  C18 . HC9 F 4 .   ? 13.181  -3.978  14.997  1.00 12.59 ? 602 HC9 A C18 1 
HETATM 8196 C  C19 . HC9 F 4 .   ? 11.319  -8.062  14.024  1.00 13.07 ? 602 HC9 A C19 1 
HETATM 8197 C  C20 . HC9 F 4 .   ? 15.656  -2.597  15.964  1.00 18.04 ? 602 HC9 A C20 1 
HETATM 8198 C  C21 . HC9 F 4 .   ? 16.577  -2.930  14.779  1.00 17.68 ? 602 HC9 A C21 1 
HETATM 8199 C  C22 . HC9 F 4 .   ? 16.332  -1.627  16.948  1.00 19.64 ? 602 HC9 A C22 1 
HETATM 8200 C  C23 . HC9 F 4 .   ? 17.734  -2.061  17.361  1.00 21.86 ? 602 HC9 A C23 1 
HETATM 8201 C  C24 . HC9 F 4 .   ? 18.076  -1.635  18.788  1.00 24.61 ? 602 HC9 A C24 1 
HETATM 8202 C  C25 . HC9 F 4 .   ? 19.005  -2.592  19.538  1.00 25.65 ? 602 HC9 A C25 1 
HETATM 8203 C  C26 . HC9 F 4 .   ? 19.541  -1.915  20.801  1.00 27.50 ? 602 HC9 A C26 1 
HETATM 8204 C  C27 . HC9 F 4 .   ? 20.185  -3.079  18.706  1.00 26.64 ? 602 HC9 A C27 1 
HETATM 8205 C  CHA . HEM G 3 .   ? 65.169  -0.758  -25.665 1.00 14.69 ? 601 HEM B CHA 1 
HETATM 8206 C  CHB . HEM G 3 .   ? 60.378  -1.077  -26.406 1.00 13.47 ? 601 HEM B CHB 1 
HETATM 8207 C  CHC . HEM G 3 .   ? 59.892  -3.942  -22.534 1.00 14.19 ? 601 HEM B CHC 1 
HETATM 8208 C  CHD . HEM G 3 .   ? 64.582  -3.231  -21.461 1.00 15.27 ? 601 HEM B CHD 1 
HETATM 8209 C  C1A . HEM G 3 .   ? 63.922  -0.601  -26.232 1.00 14.28 ? 601 HEM B C1A 1 
HETATM 8210 C  C2A . HEM G 3 .   ? 63.617  0.088   -27.473 1.00 14.49 ? 601 HEM B C2A 1 
HETATM 8211 C  C3A . HEM G 3 .   ? 62.298  -0.013  -27.667 1.00 13.43 ? 601 HEM B C3A 1 
HETATM 8212 C  C4A . HEM G 3 .   ? 61.718  -0.768  -26.569 1.00 12.76 ? 601 HEM B C4A 1 
HETATM 8213 C  CMA . HEM G 3 .   ? 61.505  0.575   -28.848 1.00 10.07 ? 601 HEM B CMA 1 
HETATM 8214 C  CAA . HEM G 3 .   ? 64.639  0.810   -28.400 1.00 14.10 ? 601 HEM B CAA 1 
HETATM 8215 C  CBA . HEM G 3 .   ? 65.266  -0.234  -29.318 1.00 14.94 ? 601 HEM B CBA 1 
HETATM 8216 C  CGA . HEM G 3 .   ? 66.005  0.390   -30.491 1.00 14.09 ? 601 HEM B CGA 1 
HETATM 8217 O  O1A . HEM G 3 .   ? 66.692  1.443   -30.359 1.00 15.35 ? 601 HEM B O1A 1 
HETATM 8218 O  O2A . HEM G 3 .   ? 65.914  -0.203  -31.582 1.00 11.82 ? 601 HEM B O2A 1 
HETATM 8219 C  C1B . HEM G 3 .   ? 59.814  -1.897  -25.452 1.00 13.43 ? 601 HEM B C1B 1 
HETATM 8220 C  C2B . HEM G 3 .   ? 58.436  -2.371  -25.406 1.00 13.10 ? 601 HEM B C2B 1 
HETATM 8221 C  C3B . HEM G 3 .   ? 58.311  -3.167  -24.332 1.00 13.49 ? 601 HEM B C3B 1 
HETATM 8222 C  C4B . HEM G 3 .   ? 59.599  -3.223  -23.671 1.00 14.10 ? 601 HEM B C4B 1 
HETATM 8223 C  CMB . HEM G 3 .   ? 57.334  -2.019  -26.443 1.00 11.18 ? 601 HEM B CMB 1 
HETATM 8224 C  CAB . HEM G 3 .   ? 57.053  -3.914  -23.814 1.00 15.08 ? 601 HEM B CAB 1 
HETATM 8225 C  CBB . HEM G 3 .   ? 56.031  -4.279  -24.600 1.00 15.20 ? 601 HEM B CBB 1 
HETATM 8226 C  C1C . HEM G 3 .   ? 61.128  -4.049  -21.924 1.00 14.95 ? 601 HEM B C1C 1 
HETATM 8227 C  C2C . HEM G 3 .   ? 61.451  -4.905  -20.803 1.00 14.30 ? 601 HEM B C2C 1 
HETATM 8228 C  C3C . HEM G 3 .   ? 62.747  -4.716  -20.510 1.00 14.17 ? 601 HEM B C3C 1 
HETATM 8229 C  C4C . HEM G 3 .   ? 63.291  -3.728  -21.431 1.00 15.17 ? 601 HEM B C4C 1 
HETATM 8230 C  CMC . HEM G 3 .   ? 60.460  -5.880  -20.102 1.00 12.45 ? 601 HEM B CMC 1 
HETATM 8231 C  CAC . HEM G 3 .   ? 63.530  -5.407  -19.374 1.00 14.64 ? 601 HEM B CAC 1 
HETATM 8232 C  CBC . HEM G 3 .   ? 64.038  -6.636  -19.511 1.00 18.96 ? 601 HEM B CBC 1 
HETATM 8233 C  C1D . HEM G 3 .   ? 65.181  -2.500  -22.472 1.00 15.48 ? 601 HEM B C1D 1 
HETATM 8234 C  C2D . HEM G 3 .   ? 66.569  -2.096  -22.487 1.00 15.74 ? 601 HEM B C2D 1 
HETATM 8235 C  C3D . HEM G 3 .   ? 66.751  -1.325  -23.794 1.00 15.83 ? 601 HEM B C3D 1 
HETATM 8236 C  C4D . HEM G 3 .   ? 65.457  -1.343  -24.448 1.00 15.27 ? 601 HEM B C4D 1 
HETATM 8237 C  CMD . HEM G 3 .   ? 67.647  -2.362  -21.417 1.00 16.09 ? 601 HEM B CMD 1 
HETATM 8238 C  CAD . HEM G 3 .   ? 68.066  -0.698  -24.299 1.00 14.94 ? 601 HEM B CAD 1 
HETATM 8239 C  CBD . HEM G 3 .   ? 68.896  -1.856  -24.855 1.00 14.01 ? 601 HEM B CBD 1 
HETATM 8240 C  CGD . HEM G 3 .   ? 70.200  -1.390  -25.462 1.00 14.66 ? 601 HEM B CGD 1 
HETATM 8241 O  O1D . HEM G 3 .   ? 71.096  -2.248  -25.627 1.00 13.60 ? 601 HEM B O1D 1 
HETATM 8242 O  O2D . HEM G 3 .   ? 70.348  -0.181  -25.800 1.00 16.05 ? 601 HEM B O2D 1 
HETATM 8243 N  NA  . HEM G 3 .   ? 62.746  -1.126  -25.732 1.00 14.16 ? 601 HEM B NA  1 
HETATM 8244 N  NB  . HEM G 3 .   ? 60.492  -2.449  -24.387 1.00 14.06 ? 601 HEM B NB  1 
HETATM 8245 N  NC  . HEM G 3 .   ? 62.280  -3.364  -22.289 1.00 14.67 ? 601 HEM B NC  1 
HETATM 8246 N  ND  . HEM G 3 .   ? 64.571  -2.046  -23.645 1.00 14.87 ? 601 HEM B ND  1 
HETATM 8247 FE FE  . HEM G 3 .   ? 62.529  -2.285  -24.042 1.00 14.87 ? 601 HEM B FE  1 
HETATM 8248 C  C1  . HC9 H 4 .   ? 61.339  9.137   -25.965 1.00 11.48 ? 602 HC9 B C1  1 
HETATM 8249 O  O1  . HC9 H 4 .   ? 62.496  12.124  -28.004 1.00 14.98 ? 602 HC9 B O1  1 
HETATM 8250 C  C2  . HC9 H 4 .   ? 61.208  10.357  -26.896 1.00 12.45 ? 602 HC9 B C2  1 
HETATM 8251 O  O2  . HC9 H 4 .   ? 62.413  -0.391  -22.347 1.00 19.06 ? 602 HC9 B O2  1 
HETATM 8252 C  C3  . HC9 H 4 .   ? 62.598  10.919  -27.226 1.00 12.65 ? 602 HC9 B C3  1 
HETATM 8253 C  C4  . HC9 H 4 .   ? 63.364  9.857   -28.015 1.00 11.31 ? 602 HC9 B C4  1 
HETATM 8254 C  C5  . HC9 H 4 .   ? 63.405  8.574   -27.203 1.00 11.13 ? 602 HC9 B C5  1 
HETATM 8255 C  C6  . HC9 H 4 .   ? 64.610  8.006   -27.005 1.00 10.99 ? 602 HC9 B C6  1 
HETATM 8256 C  C7  . HC9 H 4 .   ? 64.844  6.795   -26.134 1.00 12.02 ? 602 HC9 B C7  1 
HETATM 8257 C  C8  . HC9 H 4 .   ? 63.558  5.988   -25.942 1.00 11.49 ? 602 HC9 B C8  1 
HETATM 8258 C  C9  . HC9 H 4 .   ? 62.401  6.931   -25.556 1.00 11.57 ? 602 HC9 B C9  1 
HETATM 8259 C  C10 . HC9 H 4 .   ? 62.116  7.990   -26.636 1.00 11.58 ? 602 HC9 B C10 1 
HETATM 8260 C  C11 . HC9 H 4 .   ? 61.117  6.175   -25.141 1.00 10.52 ? 602 HC9 B C11 1 
HETATM 8261 C  C12 . HC9 H 4 .   ? 61.378  5.086   -24.101 1.00 11.09 ? 602 HC9 B C12 1 
HETATM 8262 C  C13 . HC9 H 4 .   ? 62.447  4.095   -24.575 1.00 12.84 ? 602 HC9 B C13 1 
HETATM 8263 C  C14 . HC9 H 4 .   ? 63.715  4.900   -24.873 1.00 11.65 ? 602 HC9 B C14 1 
HETATM 8264 C  C15 . HC9 H 4 .   ? 64.808  3.853   -25.042 1.00 12.71 ? 602 HC9 B C15 1 
HETATM 8265 C  C16 . HC9 H 4 .   ? 64.428  2.806   -23.995 1.00 13.24 ? 602 HC9 B C16 1 
HETATM 8266 C  C17 . HC9 H 4 .   ? 63.014  3.156   -23.500 1.00 13.54 ? 602 HC9 B C17 1 
HETATM 8267 C  C18 . HC9 H 4 .   ? 61.940  3.270   -25.780 1.00 11.05 ? 602 HC9 B C18 1 
HETATM 8268 C  C19 . HC9 H 4 .   ? 61.303  7.377   -27.787 1.00 10.22 ? 602 HC9 B C19 1 
HETATM 8269 C  C20 . HC9 H 4 .   ? 62.204  1.891   -23.156 1.00 16.50 ? 602 HC9 B C20 1 
HETATM 8270 C  C21 . HC9 H 4 .   ? 60.841  2.209   -22.517 1.00 16.16 ? 602 HC9 B C21 1 
HETATM 8271 C  C22 . HC9 H 4 .   ? 63.010  0.914   -22.280 1.00 18.54 ? 602 HC9 B C22 1 
HETATM 8272 C  C23 . HC9 H 4 .   ? 63.111  1.384   -20.829 1.00 20.74 ? 602 HC9 B C23 1 
HETATM 8273 C  C24 . HC9 H 4 .   ? 64.272  0.735   -20.080 1.00 24.28 ? 602 HC9 B C24 1 
HETATM 8274 C  C25 . HC9 H 4 .   ? 65.035  1.710   -19.186 1.00 25.39 ? 602 HC9 B C25 1 
HETATM 8275 C  C26 . HC9 H 4 .   ? 66.177  0.967   -18.502 1.00 26.31 ? 602 HC9 B C26 1 
HETATM 8276 C  C27 . HC9 H 4 .   ? 64.168  2.394   -18.132 1.00 25.93 ? 602 HC9 B C27 1 
HETATM 8277 FE FE1 . FES I 5 .   ? 2.099   11.965  22.653  1.00 59.70 ? 150 FES C FE1 1 
HETATM 8278 FE FE2 . FES I 5 .   ? 0.872   14.666  21.881  1.00 60.99 ? 150 FES C FE2 1 
HETATM 8279 S  S1  . FES I 5 .   ? 1.739   12.992  20.739  1.00 60.11 ? 150 FES C S1  1 
HETATM 8280 S  S2  . FES I 5 .   ? 1.026   13.541  23.765  1.00 61.00 ? 150 FES C S2  1 
HETATM 8281 FE FE1 . FES J 5 .   ? 71.989  -12.649 -34.537 1.00 61.32 ? 151 FES D FE1 1 
HETATM 8282 FE FE2 . FES J 5 .   ? 71.624  -15.238 -36.191 1.00 63.43 ? 151 FES D FE2 1 
HETATM 8283 S  S1  . FES J 5 .   ? 70.270  -13.649 -35.481 1.00 61.91 ? 151 FES D S1  1 
HETATM 8284 S  S2  . FES J 5 .   ? 73.364  -14.118 -35.441 1.00 62.62 ? 151 FES D S2  1 
HETATM 8285 O  O   . HOH K 6 .   ? 13.785  -7.866  10.551  1.00 11.18 ? 1   HOH A O   1 
HETATM 8286 O  O   . HOH K 6 .   ? 14.568  9.810   17.847  1.00 14.04 ? 489 HOH A O   1 
HETATM 8287 O  O   . HOH K 6 .   ? 8.195   -5.071  1.542   1.00 17.37 ? 490 HOH A O   1 
HETATM 8288 O  O   . HOH K 6 .   ? 7.417   -4.602  17.211  1.00 12.34 ? 491 HOH A O   1 
HETATM 8289 O  O   . HOH K 6 .   ? 26.416  14.986  25.036  1.00 17.49 ? 492 HOH A O   1 
HETATM 8290 O  O   . HOH K 6 .   ? 32.395  -0.120  8.388   1.00 16.98 ? 493 HOH A O   1 
HETATM 8291 O  O   . HOH K 6 .   ? 27.076  0.025   -1.702  1.00 14.50 ? 494 HOH A O   1 
HETATM 8292 O  O   . HOH K 6 .   ? 26.505  -23.082 16.438  1.00 25.37 ? 495 HOH A O   1 
HETATM 8293 O  O   . HOH K 6 .   ? 11.218  -1.395  9.384   1.00 13.86 ? 496 HOH A O   1 
HETATM 8294 O  O   . HOH K 6 .   ? 17.013  -3.473  4.931   1.00 19.68 ? 497 HOH A O   1 
HETATM 8295 O  O   . HOH K 6 .   ? 6.634   -9.874  6.966   1.00 18.73 ? 498 HOH A O   1 
HETATM 8296 O  O   . HOH K 6 .   ? 11.554  -5.186  23.320  1.00 18.00 ? 499 HOH A O   1 
HETATM 8297 O  O   . HOH K 6 .   ? 16.033  -0.880  5.082   1.00 18.41 ? 500 HOH A O   1 
HETATM 8298 O  O   . HOH K 6 .   ? 12.568  -6.782  21.412  1.00 15.10 ? 501 HOH A O   1 
HETATM 8299 O  O   . HOH K 6 .   ? 6.136   3.679   11.567  1.00 17.42 ? 502 HOH A O   1 
HETATM 8300 O  O   . HOH K 6 .   ? -6.877  -16.788 6.910   1.00 22.35 ? 503 HOH A O   1 
HETATM 8301 O  O   . HOH K 6 .   ? -5.255  -9.615  8.179   1.00 24.86 ? 504 HOH A O   1 
HETATM 8302 O  O   . HOH K 6 .   ? 1.380   -13.062 0.699   1.00 23.95 ? 505 HOH A O   1 
HETATM 8303 O  O   . HOH K 6 .   ? 14.263  -11.877 -1.129  1.00 23.77 ? 506 HOH A O   1 
HETATM 8304 O  O   . HOH K 6 .   ? 8.819   -12.323 24.506  1.00 17.47 ? 507 HOH A O   1 
HETATM 8305 O  O   . HOH K 6 .   ? 28.147  0.881   -10.528 1.00 26.07 ? 508 HOH A O   1 
HETATM 8306 O  O   . HOH K 6 .   ? 3.343   1.444   20.986  1.00 16.68 ? 515 HOH A O   1 
HETATM 8307 O  O   . HOH K 6 .   ? 21.918  -0.813  14.347  1.00 22.34 ? 516 HOH A O   1 
HETATM 8308 O  O   . HOH K 6 .   ? 34.576  -6.421  16.458  1.00 24.91 ? 517 HOH A O   1 
HETATM 8309 O  O   . HOH K 6 .   ? 14.108  -5.696  1.394   1.00 18.55 ? 518 HOH A O   1 
HETATM 8310 O  O   . HOH K 6 .   ? 17.204  -20.205 14.055  1.00 35.30 ? 519 HOH A O   1 
HETATM 8311 O  O   . HOH K 6 .   ? 8.710   -12.518 13.142  1.00 18.43 ? 520 HOH A O   1 
HETATM 8312 O  O   . HOH K 6 .   ? 9.713   -5.000  15.466  1.00 20.09 ? 521 HOH A O   1 
HETATM 8313 O  O   . HOH K 6 .   ? 0.728   -23.490 14.841  1.00 22.08 ? 522 HOH A O   1 
HETATM 8314 O  O   . HOH K 6 .   ? 2.443   -29.042 13.453  1.00 29.47 ? 523 HOH A O   1 
HETATM 8315 O  O   . HOH K 6 .   ? 14.882  -17.170 11.217  1.00 29.30 ? 524 HOH A O   1 
HETATM 8316 O  O   . HOH K 6 .   ? 22.062  23.929  18.570  1.00 37.63 ? 525 HOH A O   1 
HETATM 8317 O  O   . HOH K 6 .   ? 23.772  19.510  25.467  1.00 30.13 ? 526 HOH A O   1 
HETATM 8318 O  O   . HOH K 6 .   ? 8.220   -22.297 4.768   1.00 26.53 ? 527 HOH A O   1 
HETATM 8319 O  O   . HOH K 6 .   ? 4.912   -28.021 19.889  1.00 21.43 ? 528 HOH A O   1 
HETATM 8320 O  O   . HOH K 6 .   ? 29.832  18.459  14.426  1.00 24.57 ? 529 HOH A O   1 
HETATM 8321 O  O   . HOH K 6 .   ? 14.685  -8.194  22.357  1.00 24.92 ? 530 HOH A O   1 
HETATM 8322 O  O   . HOH K 6 .   ? 18.516  0.266   14.988  1.00 31.22 ? 531 HOH A O   1 
HETATM 8323 O  O   . HOH K 6 .   ? 5.887   13.842  2.615   1.00 20.67 ? 532 HOH A O   1 
HETATM 8324 O  O   . HOH K 6 .   ? 14.417  22.565  -8.900  1.00 26.15 ? 533 HOH A O   1 
HETATM 8325 O  O   . HOH K 6 .   ? 2.972   -10.156 0.399   1.00 21.92 ? 534 HOH A O   1 
HETATM 8326 O  O   . HOH K 6 .   ? 34.284  5.779   5.525   1.00 30.50 ? 535 HOH A O   1 
HETATM 8327 O  O   . HOH K 6 .   ? 14.514  -20.263 13.041  1.00 23.52 ? 536 HOH A O   1 
HETATM 8328 O  O   . HOH K 6 .   ? 9.550   18.467  4.034   1.00 25.83 ? 537 HOH A O   1 
HETATM 8329 O  O   . HOH K 6 .   ? 28.367  20.833  14.154  1.00 28.94 ? 538 HOH A O   1 
HETATM 8330 O  O   . HOH K 6 .   ? 10.980  -13.798 24.217  1.00 19.84 ? 539 HOH A O   1 
HETATM 8331 O  O   . HOH K 6 .   ? 14.846  -4.915  3.693   1.00 15.25 ? 540 HOH A O   1 
HETATM 8332 O  O   . HOH K 6 .   ? 9.109   -5.960  24.681  1.00 23.54 ? 541 HOH A O   1 
HETATM 8333 O  O   . HOH K 6 .   ? 31.110  11.517  15.664  1.00 18.24 ? 542 HOH A O   1 
HETATM 8334 O  O   . HOH K 6 .   ? 26.759  -3.246  -0.662  1.00 19.85 ? 543 HOH A O   1 
HETATM 8335 O  O   . HOH K 6 .   ? 22.981  6.532   12.683  1.00 16.72 ? 544 HOH A O   1 
HETATM 8336 O  O   . HOH K 6 .   ? 18.091  -19.489 4.973   1.00 39.32 ? 545 HOH A O   1 
HETATM 8337 O  O   . HOH K 6 .   ? 18.926  16.401  23.586  1.00 19.60 ? 546 HOH A O   1 
HETATM 8338 O  O   . HOH K 6 .   ? 1.409   -5.280  24.588  1.00 23.58 ? 547 HOH A O   1 
HETATM 8339 O  O   . HOH K 6 .   ? 15.454  -18.026 20.497  1.00 25.10 ? 548 HOH A O   1 
HETATM 8340 O  O   . HOH K 6 .   ? 20.490  -1.804  1.677   1.00 26.61 ? 549 HOH A O   1 
HETATM 8341 O  O   . HOH K 6 .   ? 18.375  15.540  -12.102 1.00 29.41 ? 550 HOH A O   1 
HETATM 8342 O  O   . HOH K 6 .   ? 32.387  -15.783 23.987  1.00 23.98 ? 551 HOH A O   1 
HETATM 8343 O  O   . HOH K 6 .   ? 33.403  9.843   25.405  1.00 31.54 ? 552 HOH A O   1 
HETATM 8344 O  O   . HOH K 6 .   ? 10.004  10.219  6.024   1.00 23.21 ? 553 HOH A O   1 
HETATM 8345 O  O   . HOH K 6 .   ? 1.093   -16.523 21.706  1.00 24.41 ? 554 HOH A O   1 
HETATM 8346 O  O   . HOH K 6 .   ? 17.764  2.716   -13.816 1.00 24.97 ? 555 HOH A O   1 
HETATM 8347 O  O   . HOH K 6 .   ? 21.417  3.208   -12.808 1.00 21.67 ? 556 HOH A O   1 
HETATM 8348 O  O   . HOH K 6 .   ? 31.793  -12.541 17.541  1.00 17.85 ? 557 HOH A O   1 
HETATM 8349 O  O   . HOH K 6 .   ? 19.879  -10.860 -4.797  1.00 34.95 ? 558 HOH A O   1 
HETATM 8350 O  O   . HOH K 6 .   ? 6.068   -2.554  4.304   1.00 29.86 ? 559 HOH A O   1 
HETATM 8351 O  O   . HOH K 6 .   ? 15.132  13.337  30.540  1.00 21.46 ? 560 HOH A O   1 
HETATM 8352 O  O   . HOH K 6 .   ? 5.221   -17.723 10.012  1.00 30.07 ? 561 HOH A O   1 
HETATM 8353 O  O   . HOH K 6 .   ? 19.642  25.259  -4.855  1.00 28.37 ? 562 HOH A O   1 
HETATM 8354 O  O   . HOH K 6 .   ? 23.427  21.746  17.918  1.00 25.41 ? 563 HOH A O   1 
HETATM 8355 O  O   . HOH K 6 .   ? 31.717  18.844  8.337   1.00 34.01 ? 564 HOH A O   1 
HETATM 8356 O  O   . HOH K 6 .   ? 0.038   -9.063  27.903  1.00 34.78 ? 565 HOH A O   1 
HETATM 8357 O  O   . HOH K 6 .   ? 30.591  17.754  17.054  1.00 17.71 ? 566 HOH A O   1 
HETATM 8358 O  O   . HOH K 6 .   ? 4.605   -3.648  29.944  1.00 42.76 ? 567 HOH A O   1 
HETATM 8359 O  O   . HOH K 6 .   ? 22.288  -1.674  28.023  1.00 28.40 ? 568 HOH A O   1 
HETATM 8360 O  O   . HOH K 6 .   ? 39.094  6.612   -6.147  1.00 24.10 ? 569 HOH A O   1 
HETATM 8361 O  O   . HOH K 6 .   ? 28.084  -2.859  11.169  1.00 33.15 ? 570 HOH A O   1 
HETATM 8362 O  O   . HOH K 6 .   ? 20.869  -3.478  26.579  1.00 31.66 ? 571 HOH A O   1 
HETATM 8363 O  O   . HOH K 6 .   ? 13.311  2.487   34.439  1.00 26.30 ? 572 HOH A O   1 
HETATM 8364 O  O   . HOH K 6 .   ? 28.008  -24.956 17.620  1.00 30.18 ? 573 HOH A O   1 
HETATM 8365 O  O   . HOH K 6 .   ? 34.733  11.761  10.487  1.00 23.85 ? 574 HOH A O   1 
HETATM 8366 O  O   . HOH K 6 .   ? 31.300  -7.776  11.560  1.00 35.26 ? 575 HOH A O   1 
HETATM 8367 O  O   . HOH K 6 .   ? -14.277 -9.377  13.326  1.00 34.28 ? 576 HOH A O   1 
HETATM 8368 O  O   . HOH K 6 .   ? 24.560  20.769  3.595   1.00 27.56 ? 577 HOH A O   1 
HETATM 8369 O  O   . HOH K 6 .   ? 30.640  18.486  1.573   1.00 38.11 ? 578 HOH A O   1 
HETATM 8370 O  O   . HOH K 6 .   ? 6.796   3.212   5.136   1.00 20.69 ? 579 HOH A O   1 
HETATM 8371 O  O   . HOH K 6 .   ? 40.303  4.927   -12.416 1.00 18.03 ? 580 HOH A O   1 
HETATM 8372 O  O   . HOH K 6 .   ? 22.619  -4.348  -8.480  1.00 37.86 ? 581 HOH A O   1 
HETATM 8373 O  O   . HOH K 6 .   ? 0.500   6.499   6.881   1.00 52.48 ? 582 HOH A O   1 
HETATM 8374 O  O   . HOH K 6 .   ? 13.317  -16.865 19.023  1.00 35.06 ? 583 HOH A O   1 
HETATM 8375 O  O   . HOH K 6 .   ? 19.061  -22.356 13.146  1.00 25.74 ? 584 HOH A O   1 
HETATM 8376 O  O   . HOH K 6 .   ? 24.353  12.720  9.938   1.00 19.68 ? 585 HOH A O   1 
HETATM 8377 O  O   . HOH K 6 .   ? 6.419   -24.177 9.069   1.00 23.97 ? 586 HOH A O   1 
HETATM 8378 O  O   . HOH K 6 .   ? 38.489  0.683   9.190   1.00 41.71 ? 587 HOH A O   1 
HETATM 8379 O  O   . HOH K 6 .   ? 11.674  -3.912  33.576  1.00 21.48 ? 588 HOH A O   1 
HETATM 8380 O  O   . HOH K 6 .   ? 36.132  4.399   -9.594  1.00 22.14 ? 589 HOH A O   1 
HETATM 8381 O  O   . HOH K 6 .   ? 2.365   -20.353 -0.442  1.00 28.52 ? 590 HOH A O   1 
HETATM 8382 O  O   . HOH K 6 .   ? 4.079   5.415   13.699  1.00 24.71 ? 591 HOH A O   1 
HETATM 8383 O  O   . HOH K 6 .   ? 4.259   -28.362 9.989   1.00 30.45 ? 592 HOH A O   1 
HETATM 8384 O  O   . HOH K 6 .   ? 11.370  -18.019 20.301  1.00 32.78 ? 593 HOH A O   1 
HETATM 8385 O  O   . HOH K 6 .   ? -6.131  -22.388 1.924   1.00 48.29 ? 594 HOH A O   1 
HETATM 8386 O  O   . HOH K 6 .   ? 9.058   -13.975 16.815  1.00 25.05 ? 595 HOH A O   1 
HETATM 8387 O  O   . HOH K 6 .   ? -0.730  -3.255  24.592  1.00 35.83 ? 596 HOH A O   1 
HETATM 8388 O  O   . HOH K 6 .   ? 11.469  13.279  11.982  1.00 28.26 ? 597 HOH A O   1 
HETATM 8389 O  O   . HOH K 6 .   ? 31.567  -5.729  -2.757  1.00 22.90 ? 598 HOH A O   1 
HETATM 8390 O  O   . HOH K 6 .   ? 5.565   -17.754 15.695  1.00 33.68 ? 599 HOH A O   1 
HETATM 8391 O  O   . HOH K 6 .   ? 16.372  17.076  -11.571 1.00 33.93 ? 600 HOH A O   1 
HETATM 8392 O  O   . HOH K 6 .   ? 6.112   -15.634 23.321  1.00 34.28 ? 603 HOH A O   1 
HETATM 8393 O  O   . HOH K 6 .   ? 27.153  3.330   27.969  1.00 38.94 ? 604 HOH A O   1 
HETATM 8394 O  O   . HOH K 6 .   ? 31.052  -13.401 15.305  1.00 24.25 ? 605 HOH A O   1 
HETATM 8395 O  O   . HOH K 6 .   ? 25.318  9.031   -16.841 1.00 41.34 ? 606 HOH A O   1 
HETATM 8396 O  O   . HOH K 6 .   ? -7.297  -20.964 5.094   1.00 28.31 ? 607 HOH A O   1 
HETATM 8397 O  O   . HOH K 6 .   ? 4.285   11.721  3.126   1.00 30.92 ? 608 HOH A O   1 
HETATM 8398 O  O   . HOH K 6 .   ? 25.948  -4.173  -8.153  1.00 34.28 ? 609 HOH A O   1 
HETATM 8399 O  O   . HOH K 6 .   ? 11.024  9.502   33.700  1.00 34.03 ? 610 HOH A O   1 
HETATM 8400 O  O   . HOH K 6 .   ? -2.929  -17.505 23.237  1.00 35.03 ? 611 HOH A O   1 
HETATM 8401 O  O   . HOH K 6 .   ? -0.158  -1.920  28.925  1.00 37.22 ? 612 HOH A O   1 
HETATM 8402 O  O   . HOH K 6 .   ? 9.026   -5.879  27.229  1.00 23.97 ? 613 HOH A O   1 
HETATM 8403 O  O   . HOH K 6 .   ? 31.882  18.230  12.839  1.00 33.44 ? 614 HOH A O   1 
HETATM 8404 O  O   . HOH K 6 .   ? 1.472   -6.827  27.351  1.00 38.69 ? 615 HOH A O   1 
HETATM 8405 O  O   . HOH K 6 .   ? 31.623  -6.089  28.229  1.00 35.61 ? 616 HOH A O   1 
HETATM 8406 O  O   . HOH K 6 .   ? 32.272  -1.076  1.324   1.00 27.17 ? 617 HOH A O   1 
HETATM 8407 O  O   . HOH K 6 .   ? 12.551  21.943  10.580  1.00 30.93 ? 618 HOH A O   1 
HETATM 8408 O  O   . HOH K 6 .   ? 24.085  -14.908 36.267  1.00 39.91 ? 619 HOH A O   1 
HETATM 8409 O  O   . HOH K 6 .   ? 6.741   7.392   23.472  1.00 33.10 ? 620 HOH A O   1 
HETATM 8410 O  O   . HOH K 6 .   ? 5.194   -20.863 3.997   1.00 46.73 ? 621 HOH A O   1 
HETATM 8411 O  O   . HOH K 6 .   ? 2.113   4.498   31.382  1.00 45.66 ? 622 HOH A O   1 
HETATM 8412 O  O   . HOH K 6 .   ? 15.370  -22.538 28.387  1.00 27.63 ? 623 HOH A O   1 
HETATM 8413 O  O   . HOH K 6 .   ? 12.498  18.530  24.975  1.00 37.03 ? 624 HOH A O   1 
HETATM 8414 O  O   . HOH K 6 .   ? -9.567  -22.271 20.887  1.00 40.56 ? 625 HOH A O   1 
HETATM 8415 O  O   . HOH K 6 .   ? 27.647  -18.473 28.151  1.00 28.25 ? 626 HOH A O   1 
HETATM 8416 O  O   . HOH K 6 .   ? 6.536   -26.562 21.363  1.00 36.09 ? 627 HOH A O   1 
HETATM 8417 O  O   . HOH K 6 .   ? 25.528  -4.231  2.718   1.00 38.26 ? 628 HOH A O   1 
HETATM 8418 O  O   . HOH K 6 .   ? 36.755  16.210  -0.862  1.00 47.68 ? 629 HOH A O   1 
HETATM 8419 O  O   . HOH K 6 .   ? 6.871   4.788   35.162  1.00 33.16 ? 630 HOH A O   1 
HETATM 8420 O  O   . HOH K 6 .   ? 8.197   -2.122  36.212  1.00 31.75 ? 631 HOH A O   1 
HETATM 8421 O  O   . HOH K 6 .   ? -10.333 -1.169  11.135  1.00 44.02 ? 632 HOH A O   1 
HETATM 8422 O  O   . HOH K 6 .   ? 32.371  13.731  -14.179 1.00 27.46 ? 633 HOH A O   1 
HETATM 8423 O  O   . HOH K 6 .   ? 28.582  -3.981  31.492  1.00 40.60 ? 634 HOH A O   1 
HETATM 8424 O  O   . HOH K 6 .   ? 28.731  -5.400  0.887   1.00 45.10 ? 635 HOH A O   1 
HETATM 8425 O  O   . HOH K 6 .   ? 34.521  -9.866  22.978  1.00 31.19 ? 636 HOH A O   1 
HETATM 8426 O  O   . HOH K 6 .   ? 32.162  15.685  28.428  1.00 33.10 ? 637 HOH A O   1 
HETATM 8427 O  O   . HOH K 6 .   ? 1.993   4.973   27.970  1.00 37.96 ? 638 HOH A O   1 
HETATM 8428 O  O   . HOH K 6 .   ? 41.046  12.753  6.225   1.00 36.95 ? 639 HOH A O   1 
HETATM 8429 O  O   . HOH K 6 .   ? 16.462  -15.911 27.010  1.00 31.38 ? 640 HOH A O   1 
HETATM 8430 O  O   . HOH K 6 .   ? 12.825  -18.529 24.877  1.00 37.19 ? 641 HOH A O   1 
HETATM 8431 O  O   . HOH K 6 .   ? -1.910  1.911   -0.729  1.00 37.78 ? 642 HOH A O   1 
HETATM 8432 O  O   . HOH K 6 .   ? 38.001  15.549  1.817   1.00 46.56 ? 643 HOH A O   1 
HETATM 8433 O  O   . HOH K 6 .   ? 33.779  -12.758 25.283  1.00 35.96 ? 644 HOH A O   1 
HETATM 8434 O  O   . HOH K 6 .   ? 0.301   3.691   22.034  1.00 44.51 ? 645 HOH A O   1 
HETATM 8435 O  O   . HOH K 6 .   ? 9.723   8.329   7.985   1.00 26.19 ? 646 HOH A O   1 
HETATM 8436 O  O   . HOH K 6 .   ? 8.791   -0.787  6.481   1.00 39.53 ? 647 HOH A O   1 
HETATM 8437 O  O   . HOH K 6 .   ? 26.898  21.631  10.701  1.00 30.96 ? 648 HOH A O   1 
HETATM 8438 O  O   . HOH K 6 .   ? 15.646  4.162   -14.511 1.00 26.85 ? 649 HOH A O   1 
HETATM 8439 O  O   . HOH K 6 .   ? 24.680  0.938   33.175  1.00 56.45 ? 650 HOH A O   1 
HETATM 8440 O  O   . HOH K 6 .   ? 8.994   -11.314 -1.264  1.00 44.30 ? 651 HOH A O   1 
HETATM 8441 O  O   . HOH K 6 .   ? 17.326  27.614  11.426  1.00 53.28 ? 652 HOH A O   1 
HETATM 8442 O  O   . HOH K 6 .   ? 8.804   13.412  17.813  1.00 35.73 ? 653 HOH A O   1 
HETATM 8443 O  O   . HOH K 6 .   ? 7.244   21.964  -0.749  1.00 39.26 ? 654 HOH A O   1 
HETATM 8444 O  O   . HOH K 6 .   ? 14.936  -4.937  -5.523  1.00 45.12 ? 655 HOH A O   1 
HETATM 8445 O  O   . HOH K 6 .   ? 37.270  5.561   6.643   1.00 57.54 ? 657 HOH A O   1 
HETATM 8446 O  O   . HOH K 6 .   ? 6.835   8.391   -8.740  1.00 35.49 ? 658 HOH A O   1 
HETATM 8447 O  O   . HOH K 6 .   ? 6.499   0.527   6.444   1.00 35.45 ? 659 HOH A O   1 
HETATM 8448 O  O   . HOH K 6 .   ? -2.776  10.670  2.459   1.00 49.89 ? 660 HOH A O   1 
HETATM 8449 O  O   . HOH K 6 .   ? 6.116   -1.952  28.787  1.00 32.35 ? 661 HOH A O   1 
HETATM 8450 O  O   . HOH K 6 .   ? -10.640 -18.465 21.605  1.00 44.58 ? 662 HOH A O   1 
HETATM 8451 O  O   . HOH K 6 .   ? 11.251  22.083  -2.930  1.00 34.16 ? 663 HOH A O   1 
HETATM 8452 O  O   . HOH K 6 .   ? 8.036   -15.482 12.378  1.00 26.92 ? 664 HOH A O   1 
HETATM 8453 O  O   . HOH K 6 .   ? 36.728  -4.900  23.600  1.00 45.21 ? 665 HOH A O   1 
HETATM 8454 O  O   . HOH K 6 .   ? 22.793  13.453  8.014   1.00 34.15 ? 666 HOH A O   1 
HETATM 8455 O  O   . HOH K 6 .   ? 8.534   12.682  28.051  1.00 50.45 ? 667 HOH A O   1 
HETATM 8456 O  O   . HOH K 6 .   ? 33.479  3.636   -13.025 1.00 31.81 ? 668 HOH A O   1 
HETATM 8457 O  O   . HOH K 6 .   ? -4.010  7.912   6.299   1.00 43.24 ? 669 HOH A O   1 
HETATM 8458 O  O   . HOH K 6 .   ? 38.458  8.685   2.883   1.00 51.05 ? 670 HOH A O   1 
HETATM 8459 O  O   . HOH K 6 .   ? 34.540  -24.513 14.800  1.00 48.48 ? 671 HOH A O   1 
HETATM 8460 O  O   . HOH K 6 .   ? -10.875 -7.960  11.688  1.00 35.31 ? 672 HOH A O   1 
HETATM 8461 O  O   . HOH K 6 .   ? 21.810  25.265  7.111   1.00 43.58 ? 673 HOH A O   1 
HETATM 8462 O  O   . HOH K 6 .   ? 21.454  10.365  -13.201 1.00 46.30 ? 674 HOH A O   1 
HETATM 8463 O  O   . HOH K 6 .   ? 31.572  21.083  32.005  1.00 39.42 ? 675 HOH A O   1 
HETATM 8464 O  O   . HOH K 6 .   ? 23.795  -12.608 -7.861  1.00 39.45 ? 676 HOH A O   1 
HETATM 8465 O  O   . HOH K 6 .   ? -4.134  -1.907  -5.231  1.00 38.40 ? 677 HOH A O   1 
HETATM 8466 O  O   . HOH K 6 .   ? -0.771  -18.558 22.163  1.00 30.35 ? 678 HOH A O   1 
HETATM 8467 O  O   . HOH K 6 .   ? 35.851  14.044  4.938   1.00 36.27 ? 679 HOH A O   1 
HETATM 8468 O  O   . HOH K 6 .   ? 11.338  12.193  32.916  1.00 33.64 ? 680 HOH A O   1 
HETATM 8469 O  O   . HOH K 6 .   ? -5.666  -24.717 8.831   1.00 40.85 ? 681 HOH A O   1 
HETATM 8470 O  O   . HOH K 6 .   ? 12.634  14.558  8.686   1.00 48.60 ? 682 HOH A O   1 
HETATM 8471 O  O   . HOH K 6 .   ? 25.528  -0.049  30.134  1.00 48.65 ? 683 HOH A O   1 
HETATM 8472 O  O   . HOH K 6 .   ? 21.321  -22.279 30.100  1.00 48.75 ? 684 HOH A O   1 
HETATM 8473 O  O   . HOH K 6 .   ? 33.546  17.769  17.525  1.00 46.69 ? 685 HOH A O   1 
HETATM 8474 O  O   . HOH K 6 .   ? 18.982  11.803  -11.547 1.00 35.86 ? 686 HOH A O   1 
HETATM 8475 O  O   . HOH K 6 .   ? 29.633  14.458  -13.893 1.00 41.48 ? 687 HOH A O   1 
HETATM 8476 O  O   . HOH K 6 .   ? 40.090  -0.351  11.357  1.00 46.27 ? 688 HOH A O   1 
HETATM 8477 O  O   . HOH K 6 .   ? 10.260  0.893   -9.622  1.00 46.26 ? 689 HOH A O   1 
HETATM 8478 O  O   . HOH K 6 .   ? 33.868  -1.895  -4.263  1.00 31.26 ? 690 HOH A O   1 
HETATM 8479 O  O   . HOH K 6 .   ? -0.267  10.596  -5.218  1.00 49.53 ? 691 HOH A O   1 
HETATM 8480 O  O   . HOH K 6 .   ? 16.508  -23.807 2.947   1.00 46.32 ? 692 HOH A O   1 
HETATM 8481 O  O   . HOH K 6 .   ? 16.548  -4.002  -10.179 1.00 42.04 ? 693 HOH A O   1 
HETATM 8482 O  O   . HOH K 6 .   ? 26.644  4.144   -14.852 1.00 43.88 ? 694 HOH A O   1 
HETATM 8483 O  O   . HOH K 6 .   ? 33.513  -18.638 15.471  1.00 59.80 ? 695 HOH A O   1 
HETATM 8484 O  O   . HOH K 6 .   ? 28.850  -14.112 12.183  1.00 41.27 ? 696 HOH A O   1 
HETATM 8485 O  O   . HOH K 6 .   ? 35.248  2.202   1.129   1.00 33.51 ? 697 HOH A O   1 
HETATM 8486 O  O   . HOH K 6 .   ? 13.586  19.064  14.818  1.00 47.40 ? 698 HOH A O   1 
HETATM 8487 O  O   . HOH K 6 .   ? 12.981  -2.668  -5.708  1.00 32.07 ? 699 HOH A O   1 
HETATM 8488 O  O   . HOH K 6 .   ? 33.208  10.987  22.604  1.00 41.29 ? 700 HOH A O   1 
HETATM 8489 O  O   . HOH K 6 .   ? 16.499  15.633  30.127  1.00 40.08 ? 701 HOH A O   1 
HETATM 8490 O  O   . HOH K 6 .   ? 24.086  -5.299  36.260  1.00 45.13 ? 702 HOH A O   1 
HETATM 8491 O  O   . HOH K 6 .   ? 13.771  13.188  32.870  1.00 30.02 ? 703 HOH A O   1 
HETATM 8492 O  O   . HOH K 6 .   ? 32.134  -3.565  1.793   1.00 50.51 ? 704 HOH A O   1 
HETATM 8493 O  O   . HOH K 6 .   ? 11.665  13.398  -13.476 1.00 41.45 ? 705 HOH A O   1 
HETATM 8494 O  O   . HOH K 6 .   ? 2.429   7.625   -9.751  1.00 51.53 ? 706 HOH A O   1 
HETATM 8495 O  O   . HOH K 6 .   ? 23.278  23.372  5.520   1.00 31.66 ? 707 HOH A O   1 
HETATM 8496 O  O   . HOH K 6 .   ? 9.878   -16.801 13.825  1.00 25.29 ? 708 HOH A O   1 
HETATM 8497 O  O   . HOH K 6 .   ? 27.475  11.029  39.803  1.00 37.88 ? 709 HOH A O   1 
HETATM 8498 O  O   . HOH K 6 .   ? 33.511  18.222  4.545   1.00 27.30 ? 710 HOH A O   1 
HETATM 8499 O  O   . HOH K 6 .   ? 13.016  -9.073  -1.464  1.00 33.05 ? 711 HOH A O   1 
HETATM 8500 O  O   . HOH K 6 .   ? 11.870  16.027  -12.779 1.00 37.27 ? 712 HOH A O   1 
HETATM 8501 O  O   . HOH K 6 .   ? 29.806  -4.619  4.059   1.00 41.87 ? 713 HOH A O   1 
HETATM 8502 O  O   . HOH K 6 .   ? 23.109  -13.113 1.756   1.00 41.00 ? 714 HOH A O   1 
HETATM 8503 O  O   . HOH K 6 .   ? 9.701   -4.023  35.389  1.00 38.70 ? 715 HOH A O   1 
HETATM 8504 O  O   . HOH K 6 .   ? 17.054  -15.961 29.604  1.00 33.41 ? 716 HOH A O   1 
HETATM 8505 O  O   . HOH K 6 .   ? -0.686  2.698   -2.887  1.00 29.96 ? 717 HOH A O   1 
HETATM 8506 O  O   . HOH K 6 .   ? 12.589  -16.981 12.618  1.00 28.10 ? 718 HOH A O   1 
HETATM 8507 O  O   . HOH K 6 .   ? 27.310  -1.870  31.589  1.00 40.39 ? 719 HOH A O   1 
HETATM 8508 O  O   . HOH K 6 .   ? -3.629  -14.962 34.131  1.00 39.62 ? 720 HOH A O   1 
HETATM 8509 O  O   . HOH K 6 .   ? 39.408  -2.630  13.569  1.00 32.56 ? 721 HOH A O   1 
HETATM 8510 O  O   . HOH K 6 .   ? 30.634  3.004   34.712  1.00 41.60 ? 722 HOH A O   1 
HETATM 8511 O  O   . HOH K 6 .   ? 7.918   -9.052  -3.989  1.00 29.73 ? 723 HOH A O   1 
HETATM 8512 O  O   . HOH K 6 .   ? 30.273  -0.957  -11.480 1.00 37.44 ? 724 HOH A O   1 
HETATM 8513 O  O   . HOH K 6 .   ? 21.239  23.248  -3.780  1.00 37.34 ? 725 HOH A O   1 
HETATM 8514 O  O   . HOH K 6 .   ? 28.723  20.175  -12.304 1.00 52.22 ? 726 HOH A O   1 
HETATM 8515 O  O   . HOH K 6 .   ? 22.523  21.534  26.785  1.00 42.47 ? 727 HOH A O   1 
HETATM 8516 O  O   . HOH K 6 .   ? 25.009  -8.250  4.954   1.00 42.13 ? 728 HOH A O   1 
HETATM 8517 O  O   . HOH L 6 .   ? 57.351  7.201   -26.274 1.00 7.17  ? 489 HOH B O   1 
HETATM 8518 O  O   . HOH L 6 .   ? 70.467  4.383   -25.379 1.00 12.88 ? 490 HOH B O   1 
HETATM 8519 O  O   . HOH L 6 .   ? 50.031  4.439   -33.894 1.00 17.07 ? 491 HOH B O   1 
HETATM 8520 O  O   . HOH L 6 .   ? 42.310  -0.845  -16.533 1.00 15.71 ? 492 HOH B O   1 
HETATM 8521 O  O   . HOH L 6 .   ? 51.607  0.159   -25.417 1.00 17.19 ? 493 HOH B O   1 
HETATM 8522 O  O   . HOH L 6 .   ? 59.934  8.858   -45.146 1.00 17.50 ? 494 HOH B O   1 
HETATM 8523 O  O   . HOH L 6 .   ? 47.203  1.099   -21.828 1.00 18.55 ? 495 HOH B O   1 
HETATM 8524 O  O   . HOH L 6 .   ? 68.142  6.169   -24.873 1.00 14.95 ? 496 HOH B O   1 
HETATM 8525 O  O   . HOH L 6 .   ? 56.892  0.672   -29.091 1.00 11.33 ? 497 HOH B O   1 
HETATM 8526 O  O   . HOH L 6 .   ? 59.984  22.589  -12.302 1.00 22.33 ? 498 HOH B O   1 
HETATM 8527 O  O   . HOH L 6 .   ? 55.698  9.178   -34.096 1.00 16.70 ? 499 HOH B O   1 
HETATM 8528 O  O   . HOH L 6 .   ? 50.649  -0.601  -8.732  1.00 22.86 ? 500 HOH B O   1 
HETATM 8529 O  O   . HOH L 6 .   ? 29.748  -13.062 -8.305  1.00 19.95 ? 501 HOH B O   1 
HETATM 8530 O  O   . HOH L 6 .   ? 65.383  3.975   -30.761 1.00 14.86 ? 502 HOH B O   1 
HETATM 8531 O  O   . HOH L 6 .   ? 68.403  -15.654 -10.550 1.00 18.72 ? 503 HOH B O   1 
HETATM 8532 O  O   . HOH L 6 .   ? 63.122  4.358   -29.168 1.00 16.61 ? 504 HOH B O   1 
HETATM 8533 O  O   . HOH L 6 .   ? 71.082  13.177  -25.615 1.00 15.97 ? 505 HOH B O   1 
HETATM 8534 O  O   . HOH L 6 .   ? 60.275  -4.357  -33.442 1.00 21.78 ? 506 HOH B O   1 
HETATM 8535 O  O   . HOH L 6 .   ? 70.051  -2.160  -33.942 1.00 22.01 ? 507 HOH B O   1 
HETATM 8536 O  O   . HOH L 6 .   ? 29.401  -8.692  -9.556  1.00 23.78 ? 508 HOH B O   1 
HETATM 8537 O  O   . HOH L 6 .   ? 54.097  -11.055 -30.986 1.00 23.12 ? 509 HOH B O   1 
HETATM 8538 O  O   . HOH L 6 .   ? 65.692  -6.778  -36.183 1.00 33.97 ? 510 HOH B O   1 
HETATM 8539 O  O   . HOH L 6 .   ? 51.033  2.715   -24.613 1.00 22.04 ? 515 HOH B O   1 
HETATM 8540 O  O   . HOH L 6 .   ? 50.582  4.109   -26.965 1.00 16.14 ? 516 HOH B O   1 
HETATM 8541 O  O   . HOH L 6 .   ? 64.769  22.824  -37.873 1.00 20.93 ? 517 HOH B O   1 
HETATM 8542 O  O   . HOH L 6 .   ? 60.501  -0.941  -20.657 1.00 27.79 ? 518 HOH B O   1 
HETATM 8543 O  O   . HOH L 6 .   ? 64.167  -10.459 -23.643 1.00 18.62 ? 519 HOH B O   1 
HETATM 8544 O  O   . HOH L 6 .   ? 53.002  21.652  -32.979 1.00 28.49 ? 520 HOH B O   1 
HETATM 8545 O  O   . HOH L 6 .   ? 62.901  28.338  -36.431 1.00 28.57 ? 521 HOH B O   1 
HETATM 8546 O  O   . HOH L 6 .   ? 54.599  2.178   -12.228 1.00 26.57 ? 522 HOH B O   1 
HETATM 8547 O  O   . HOH L 6 .   ? 66.690  17.378  -22.168 1.00 21.01 ? 523 HOH B O   1 
HETATM 8548 O  O   . HOH L 6 .   ? 26.317  -8.286  -6.175  1.00 17.89 ? 524 HOH B O   1 
HETATM 8549 O  O   . HOH L 6 .   ? 57.332  -6.375  -40.164 1.00 37.78 ? 525 HOH B O   1 
HETATM 8550 O  O   . HOH L 6 .   ? 48.355  5.022   -28.200 1.00 21.19 ? 526 HOH B O   1 
HETATM 8551 O  O   . HOH L 6 .   ? 71.982  11.677  -27.674 1.00 15.13 ? 527 HOH B O   1 
HETATM 8552 O  O   . HOH L 6 .   ? 58.049  -12.249 -8.160  1.00 19.25 ? 528 HOH B O   1 
HETATM 8553 O  O   . HOH L 6 .   ? 57.744  16.439  -24.969 1.00 23.98 ? 529 HOH B O   1 
HETATM 8554 O  O   . HOH L 6 .   ? 43.335  2.597   -16.497 1.00 15.68 ? 530 HOH B O   1 
HETATM 8555 O  O   . HOH L 6 .   ? 53.211  1.978   -35.188 1.00 23.70 ? 531 HOH B O   1 
HETATM 8556 O  O   . HOH L 6 .   ? 58.985  16.118  -47.190 1.00 20.24 ? 532 HOH B O   1 
HETATM 8557 O  O   . HOH L 6 .   ? 50.019  -1.977  -3.030  1.00 39.25 ? 533 HOH B O   1 
HETATM 8558 O  O   . HOH L 6 .   ? 63.041  -6.153  -34.911 1.00 21.97 ? 534 HOH B O   1 
HETATM 8559 O  O   . HOH L 6 .   ? 57.364  -19.171 -9.697  1.00 23.69 ? 535 HOH B O   1 
HETATM 8560 O  O   . HOH L 6 .   ? 59.157  16.916  -34.592 1.00 26.56 ? 536 HOH B O   1 
HETATM 8561 O  O   . HOH L 6 .   ? 38.529  -23.533 -30.400 1.00 25.73 ? 537 HOH B O   1 
HETATM 8562 O  O   . HOH L 6 .   ? 42.450  -9.288  -38.408 1.00 54.91 ? 538 HOH B O   1 
HETATM 8563 O  O   . HOH L 6 .   ? 59.627  19.653  -24.835 1.00 24.04 ? 539 HOH B O   1 
HETATM 8564 O  O   . HOH L 6 .   ? 57.422  -7.283  -16.877 1.00 21.52 ? 540 HOH B O   1 
HETATM 8565 O  O   . HOH L 6 .   ? 72.329  25.941  -14.541 1.00 21.79 ? 541 HOH B O   1 
HETATM 8566 O  O   . HOH L 6 .   ? 68.460  7.273   -22.534 1.00 20.31 ? 542 HOH B O   1 
HETATM 8567 O  O   . HOH L 6 .   ? 52.252  -12.556 -5.851  1.00 22.54 ? 543 HOH B O   1 
HETATM 8568 O  O   . HOH L 6 .   ? 63.292  -24.441 -16.082 1.00 30.61 ? 544 HOH B O   1 
HETATM 8569 O  O   . HOH L 6 .   ? 68.617  27.387  -32.593 1.00 24.89 ? 545 HOH B O   1 
HETATM 8570 O  O   . HOH L 6 .   ? 52.150  -19.060 -31.847 1.00 25.67 ? 546 HOH B O   1 
HETATM 8571 O  O   . HOH L 6 .   ? 67.021  8.764   -52.757 1.00 30.51 ? 547 HOH B O   1 
HETATM 8572 O  O   . HOH L 6 .   ? 57.300  20.173  -47.873 1.00 31.46 ? 548 HOH B O   1 
HETATM 8573 O  O   . HOH L 6 .   ? 54.486  -22.456 -13.684 1.00 24.11 ? 549 HOH B O   1 
HETATM 8574 O  O   . HOH L 6 .   ? 65.626  -14.141 -29.453 1.00 41.14 ? 550 HOH B O   1 
HETATM 8575 O  O   . HOH L 6 .   ? 50.290  9.701   -39.168 1.00 28.26 ? 551 HOH B O   1 
HETATM 8576 O  O   . HOH L 6 .   ? 64.916  16.899  -32.797 1.00 25.86 ? 552 HOH B O   1 
HETATM 8577 O  O   . HOH L 6 .   ? 59.770  19.700  -22.084 1.00 35.99 ? 553 HOH B O   1 
HETATM 8578 O  O   . HOH L 6 .   ? 65.799  15.069  -4.892  1.00 25.63 ? 554 HOH B O   1 
HETATM 8579 O  O   . HOH L 6 .   ? 80.686  -9.997  -23.172 1.00 28.09 ? 555 HOH B O   1 
HETATM 8580 O  O   . HOH L 6 .   ? 74.062  4.656   -34.687 1.00 23.13 ? 556 HOH B O   1 
HETATM 8581 O  O   . HOH L 6 .   ? 46.090  11.090  -28.589 1.00 26.15 ? 557 HOH B O   1 
HETATM 8582 O  O   . HOH L 6 .   ? 72.174  5.285   -27.310 1.00 25.77 ? 558 HOH B O   1 
HETATM 8583 O  O   . HOH L 6 .   ? 55.738  -8.988  -30.862 1.00 25.19 ? 559 HOH B O   1 
HETATM 8584 O  O   . HOH L 6 .   ? 33.564  -1.573  -18.090 1.00 32.11 ? 560 HOH B O   1 
HETATM 8585 O  O   . HOH L 6 .   ? 58.451  21.702  -20.488 1.00 24.55 ? 561 HOH B O   1 
HETATM 8586 O  O   . HOH L 6 .   ? 59.849  11.772  -7.035  1.00 19.95 ? 562 HOH B O   1 
HETATM 8587 O  O   . HOH L 6 .   ? 71.579  2.852   -15.860 1.00 28.90 ? 563 HOH B O   1 
HETATM 8588 O  O   . HOH L 6 .   ? 54.171  7.013   -9.037  1.00 31.11 ? 564 HOH B O   1 
HETATM 8589 O  O   . HOH L 6 .   ? 59.055  27.728  -35.663 1.00 25.73 ? 565 HOH B O   1 
HETATM 8590 O  O   . HOH L 6 .   ? 48.266  -21.491 -17.787 1.00 22.99 ? 566 HOH B O   1 
HETATM 8591 O  O   . HOH L 6 .   ? 66.997  -10.529 -3.634  1.00 27.26 ? 567 HOH B O   1 
HETATM 8592 O  O   . HOH L 6 .   ? 34.445  -16.472 -27.471 1.00 25.48 ? 568 HOH B O   1 
HETATM 8593 O  O   . HOH L 6 .   ? 51.878  -14.661 -36.014 1.00 27.31 ? 569 HOH B O   1 
HETATM 8594 O  O   . HOH L 6 .   ? 76.832  1.409   -29.417 1.00 32.85 ? 570 HOH B O   1 
HETATM 8595 O  O   . HOH L 6 .   ? 34.680  -16.259 -10.761 1.00 23.98 ? 571 HOH B O   1 
HETATM 8596 O  O   . HOH L 6 .   ? 53.873  -3.751  -34.426 1.00 21.82 ? 572 HOH B O   1 
HETATM 8597 O  O   . HOH L 6 .   ? 59.053  0.118   -17.515 1.00 33.03 ? 573 HOH B O   1 
HETATM 8598 O  O   . HOH L 6 .   ? 55.193  -19.039 -8.197  1.00 25.81 ? 574 HOH B O   1 
HETATM 8599 O  O   . HOH L 6 .   ? 65.610  18.547  -27.908 1.00 35.75 ? 575 HOH B O   1 
HETATM 8600 O  O   . HOH L 6 .   ? 61.173  12.008  -30.617 1.00 18.90 ? 576 HOH B O   1 
HETATM 8601 O  O   . HOH L 6 .   ? 58.295  5.772   -4.831  1.00 27.28 ? 577 HOH B O   1 
HETATM 8602 O  O   . HOH L 6 .   ? 66.766  11.833  -3.180  1.00 30.51 ? 578 HOH B O   1 
HETATM 8603 O  O   . HOH L 6 .   ? 73.695  23.275  -13.967 1.00 47.80 ? 579 HOH B O   1 
HETATM 8604 O  O   . HOH L 6 .   ? 71.553  15.611  -35.751 1.00 20.42 ? 580 HOH B O   1 
HETATM 8605 O  O   . HOH L 6 .   ? 32.778  -4.926  -30.805 1.00 30.88 ? 581 HOH B O   1 
HETATM 8606 O  O   . HOH L 6 .   ? 76.778  -1.458  -9.857  1.00 44.69 ? 582 HOH B O   1 
HETATM 8607 O  O   . HOH L 6 .   ? 50.744  18.915  -23.383 1.00 34.70 ? 583 HOH B O   1 
HETATM 8608 O  O   . HOH L 6 .   ? 50.252  -2.735  -44.137 1.00 29.96 ? 584 HOH B O   1 
HETATM 8609 O  O   . HOH L 6 .   ? 35.434  -17.802 -29.419 1.00 25.18 ? 585 HOH B O   1 
HETATM 8610 O  O   . HOH L 6 .   ? 71.107  -11.878 2.493   1.00 59.80 ? 586 HOH B O   1 
HETATM 8611 O  O   . HOH L 6 .   ? 50.842  12.362  -40.957 1.00 26.70 ? 587 HOH B O   1 
HETATM 8612 O  O   . HOH L 6 .   ? 73.810  16.927  -39.436 1.00 29.22 ? 588 HOH B O   1 
HETATM 8613 O  O   . HOH L 6 .   ? 59.896  -7.185  -3.653  1.00 37.25 ? 589 HOH B O   1 
HETATM 8614 O  O   . HOH L 6 .   ? 72.352  0.996   -13.779 1.00 25.44 ? 590 HOH B O   1 
HETATM 8615 O  O   . HOH L 6 .   ? 80.097  3.366   -22.799 1.00 19.74 ? 591 HOH B O   1 
HETATM 8616 O  O   . HOH L 6 .   ? 79.818  -12.408 -23.187 1.00 33.83 ? 592 HOH B O   1 
HETATM 8617 O  O   . HOH L 6 .   ? 44.657  6.666   -38.826 1.00 38.77 ? 593 HOH B O   1 
HETATM 8618 O  O   . HOH L 6 .   ? 71.393  17.836  -23.713 1.00 26.50 ? 594 HOH B O   1 
HETATM 8619 O  O   . HOH L 6 .   ? 74.306  21.869  -20.389 1.00 37.84 ? 595 HOH B O   1 
HETATM 8620 O  O   . HOH L 6 .   ? 60.941  24.546  -10.654 1.00 31.57 ? 596 HOH B O   1 
HETATM 8621 O  O   . HOH L 6 .   ? 42.264  -11.596 -3.548  1.00 40.59 ? 597 HOH B O   1 
HETATM 8622 O  O   . HOH L 6 .   ? 38.214  7.319   -17.609 1.00 26.12 ? 598 HOH B O   1 
HETATM 8623 O  O   . HOH L 6 .   ? 49.223  19.542  -39.938 1.00 39.89 ? 599 HOH B O   1 
HETATM 8624 O  O   . HOH L 6 .   ? 35.816  -7.199  -33.963 1.00 58.38 ? 600 HOH B O   1 
HETATM 8625 O  O   . HOH L 6 .   ? 74.638  2.523   -36.893 1.00 37.56 ? 603 HOH B O   1 
HETATM 8626 O  O   . HOH L 6 .   ? 32.876  -4.032  -24.661 1.00 21.56 ? 604 HOH B O   1 
HETATM 8627 O  O   . HOH L 6 .   ? 43.901  1.198   -48.490 1.00 58.28 ? 605 HOH B O   1 
HETATM 8628 O  O   . HOH L 6 .   ? 80.798  -3.237  -20.853 1.00 26.33 ? 606 HOH B O   1 
HETATM 8629 O  O   . HOH L 6 .   ? 44.480  -19.567 -12.645 1.00 43.94 ? 607 HOH B O   1 
HETATM 8630 O  O   . HOH L 6 .   ? 64.503  13.463  -29.461 1.00 27.31 ? 608 HOH B O   1 
HETATM 8631 O  O   . HOH L 6 .   ? 71.725  14.871  -30.554 1.00 30.90 ? 609 HOH B O   1 
HETATM 8632 O  O   . HOH L 6 .   ? 35.175  -7.035  -5.879  1.00 28.94 ? 610 HOH B O   1 
HETATM 8633 O  O   . HOH L 6 .   ? 40.781  3.826   -40.316 1.00 30.96 ? 611 HOH B O   1 
HETATM 8634 O  O   . HOH L 6 .   ? 52.630  -14.058 -18.077 1.00 18.70 ? 612 HOH B O   1 
HETATM 8635 O  O   . HOH L 6 .   ? 41.137  -25.869 -24.532 1.00 27.67 ? 613 HOH B O   1 
HETATM 8636 O  O   . HOH L 6 .   ? 69.392  -20.082 -13.238 1.00 32.25 ? 614 HOH B O   1 
HETATM 8637 O  O   . HOH L 6 .   ? 57.425  -21.422 -11.325 1.00 31.26 ? 615 HOH B O   1 
HETATM 8638 O  O   . HOH L 6 .   ? 25.991  -13.439 -4.674  1.00 41.63 ? 616 HOH B O   1 
HETATM 8639 O  O   . HOH L 6 .   ? 46.690  3.530   -16.979 1.00 28.48 ? 617 HOH B O   1 
HETATM 8640 O  O   . HOH L 6 .   ? 52.875  20.524  -36.854 1.00 40.44 ? 618 HOH B O   1 
HETATM 8641 O  O   . HOH L 6 .   ? 71.837  -4.227  -36.306 1.00 42.86 ? 619 HOH B O   1 
HETATM 8642 O  O   . HOH L 6 .   ? 44.380  4.744   -13.903 1.00 29.85 ? 620 HOH B O   1 
HETATM 8643 O  O   . HOH L 6 .   ? 45.360  -22.797 -32.245 1.00 33.39 ? 621 HOH B O   1 
HETATM 8644 O  O   . HOH L 6 .   ? 47.335  -6.650  -7.866  1.00 33.70 ? 622 HOH B O   1 
HETATM 8645 O  O   . HOH L 6 .   ? 74.856  -0.726  -3.953  1.00 52.26 ? 623 HOH B O   1 
HETATM 8646 O  O   . HOH L 6 .   ? 72.744  15.288  -19.658 1.00 29.78 ? 624 HOH B O   1 
HETATM 8647 O  O   . HOH L 6 .   ? 44.135  0.522   -10.708 1.00 30.03 ? 625 HOH B O   1 
HETATM 8648 O  O   . HOH L 6 .   ? 72.215  -19.301 -23.804 1.00 31.76 ? 626 HOH B O   1 
HETATM 8649 O  O   . HOH L 6 .   ? 70.892  -26.678 -4.263  1.00 39.82 ? 627 HOH B O   1 
HETATM 8650 O  O   . HOH L 6 .   ? 63.748  0.264   -49.190 1.00 43.42 ? 628 HOH B O   1 
HETATM 8651 O  O   . HOH L 6 .   ? 40.650  -17.003 -7.129  1.00 39.58 ? 629 HOH B O   1 
HETATM 8652 O  O   . HOH L 6 .   ? 70.201  -16.638 -4.081  1.00 42.29 ? 630 HOH B O   1 
HETATM 8653 O  O   . HOH L 6 .   ? 54.084  21.633  -23.051 1.00 49.62 ? 631 HOH B O   1 
HETATM 8654 O  O   . HOH L 6 .   ? 35.348  -16.149 -33.882 1.00 41.37 ? 632 HOH B O   1 
HETATM 8655 O  O   . HOH L 6 .   ? 64.521  7.397   -49.940 1.00 29.76 ? 633 HOH B O   1 
HETATM 8656 O  O   . HOH L 6 .   ? 39.163  -6.671  -37.142 1.00 37.94 ? 634 HOH B O   1 
HETATM 8657 O  O   . HOH L 6 .   ? 50.930  -19.552 -9.604  1.00 30.70 ? 635 HOH B O   1 
HETATM 8658 O  O   . HOH L 6 .   ? 54.319  -12.876 -28.990 1.00 36.34 ? 636 HOH B O   1 
HETATM 8659 O  O   . HOH L 6 .   ? 74.800  5.167   -26.703 1.00 22.58 ? 637 HOH B O   1 
HETATM 8660 O  O   . HOH L 6 .   ? 47.613  14.656  -22.510 1.00 37.78 ? 638 HOH B O   1 
HETATM 8661 O  O   . HOH L 6 .   ? 54.737  21.585  -47.620 1.00 46.46 ? 639 HOH B O   1 
HETATM 8662 O  O   . HOH L 6 .   ? 71.188  -4.027  -9.106  1.00 34.28 ? 640 HOH B O   1 
HETATM 8663 O  O   . HOH L 6 .   ? 68.802  -16.950 -17.970 1.00 24.80 ? 641 HOH B O   1 
HETATM 8664 O  O   . HOH L 6 .   ? 54.799  0.203   -32.551 1.00 32.89 ? 642 HOH B O   1 
HETATM 8665 O  O   . HOH L 6 .   ? 73.029  20.305  -25.692 1.00 45.86 ? 643 HOH B O   1 
HETATM 8666 O  O   . HOH L 6 .   ? 60.050  9.217   -6.246  1.00 30.05 ? 644 HOH B O   1 
HETATM 8667 O  O   . HOH L 6 .   ? 76.379  15.749  -38.699 1.00 31.31 ? 645 HOH B O   1 
HETATM 8668 O  O   . HOH L 6 .   ? 74.063  3.253   -6.983  1.00 47.77 ? 646 HOH B O   1 
HETATM 8669 O  O   . HOH L 6 .   ? 45.665  -20.473 -35.666 1.00 43.97 ? 647 HOH B O   1 
HETATM 8670 O  O   . HOH L 6 .   ? 64.147  9.189   -3.263  1.00 24.04 ? 648 HOH B O   1 
HETATM 8671 O  O   . HOH L 6 .   ? 70.046  5.687   -4.520  1.00 40.13 ? 649 HOH B O   1 
HETATM 8672 O  O   . HOH L 6 .   ? 46.948  3.708   -12.379 1.00 29.45 ? 650 HOH B O   1 
HETATM 8673 O  O   . HOH L 6 .   ? 40.324  -18.596 -34.109 1.00 26.41 ? 651 HOH B O   1 
HETATM 8674 O  O   . HOH L 6 .   ? 40.175  -9.055  -37.582 1.00 38.43 ? 652 HOH B O   1 
HETATM 8675 O  O   . HOH L 6 .   ? 73.921  17.832  -47.396 1.00 41.40 ? 653 HOH B O   1 
HETATM 8676 O  O   . HOH L 6 .   ? 79.266  -13.766 -20.728 1.00 37.65 ? 654 HOH B O   1 
HETATM 8677 O  O   . HOH L 6 .   ? 68.657  22.163  -10.216 1.00 46.59 ? 655 HOH B O   1 
HETATM 8678 O  O   . HOH L 6 .   ? 77.180  -5.620  -33.487 1.00 40.44 ? 656 HOH B O   1 
HETATM 8679 O  O   . HOH L 6 .   ? 67.429  17.169  -26.480 1.00 28.20 ? 657 HOH B O   1 
HETATM 8680 O  O   . HOH L 6 .   ? 53.443  -30.495 -20.314 1.00 43.47 ? 658 HOH B O   1 
HETATM 8681 O  O   . HOH L 6 .   ? 52.073  -25.880 -19.305 1.00 36.02 ? 659 HOH B O   1 
HETATM 8682 O  O   . HOH L 6 .   ? 38.666  0.843   -10.162 1.00 25.57 ? 660 HOH B O   1 
HETATM 8683 O  O   . HOH L 6 .   ? 57.644  23.495  -33.736 1.00 27.62 ? 661 HOH B O   1 
HETATM 8684 O  O   . HOH L 6 .   ? 64.317  23.631  -46.386 1.00 37.72 ? 662 HOH B O   1 
HETATM 8685 O  O   . HOH L 6 .   ? 62.900  26.320  -11.933 1.00 31.21 ? 663 HOH B O   1 
HETATM 8686 O  O   . HOH L 6 .   ? 29.199  -11.851 -21.029 1.00 43.72 ? 665 HOH B O   1 
HETATM 8687 O  O   . HOH L 6 .   ? 34.755  -12.625 -26.559 1.00 31.63 ? 666 HOH B O   1 
HETATM 8688 O  O   . HOH L 6 .   ? 59.730  -18.398 -8.256  1.00 26.20 ? 667 HOH B O   1 
HETATM 8689 O  O   . HOH L 6 .   ? 72.882  -9.389  2.738   1.00 44.05 ? 668 HOH B O   1 
HETATM 8690 O  O   . HOH L 6 .   ? 47.257  0.987   -47.568 1.00 37.91 ? 669 HOH B O   1 
HETATM 8691 O  O   . HOH L 6 .   ? 75.477  -13.262 -27.073 1.00 39.41 ? 670 HOH B O   1 
HETATM 8692 O  O   . HOH L 6 .   ? 33.262  -7.054  -33.056 1.00 43.63 ? 671 HOH B O   1 
HETATM 8693 O  O   . HOH L 6 .   ? 76.495  -13.979 -20.215 1.00 35.68 ? 672 HOH B O   1 
HETATM 8694 O  O   . HOH L 6 .   ? 71.448  18.519  -33.127 1.00 35.46 ? 673 HOH B O   1 
HETATM 8695 O  O   . HOH L 6 .   ? 47.795  -3.251  -43.488 1.00 30.87 ? 674 HOH B O   1 
HETATM 8696 O  O   . HOH L 6 .   ? 75.064  15.263  -18.427 1.00 33.90 ? 675 HOH B O   1 
HETATM 8697 O  O   . HOH L 6 .   ? 50.088  -24.103 -18.453 1.00 30.21 ? 676 HOH B O   1 
HETATM 8698 O  O   . HOH L 6 .   ? 46.519  -13.102 -0.597  1.00 43.95 ? 677 HOH B O   1 
HETATM 8699 O  O   . HOH L 6 .   ? 62.245  -22.506 -14.984 1.00 27.09 ? 678 HOH B O   1 
HETATM 8700 O  O   . HOH L 6 .   ? 44.736  -11.703 -4.287  1.00 40.83 ? 679 HOH B O   1 
HETATM 8701 O  O   . HOH L 6 .   ? 65.828  21.208  -2.072  1.00 52.60 ? 680 HOH B O   1 
HETATM 8702 O  O   . HOH L 6 .   ? 79.781  14.701  -10.175 1.00 40.67 ? 681 HOH B O   1 
HETATM 8703 O  O   . HOH L 6 .   ? 28.718  -5.592  -6.637  1.00 31.31 ? 682 HOH B O   1 
HETATM 8704 O  O   . HOH L 6 .   ? 57.867  -7.718  -1.976  1.00 40.90 ? 683 HOH B O   1 
HETATM 8705 O  O   . HOH L 6 .   ? 54.081  -13.418 -16.058 1.00 21.01 ? 684 HOH B O   1 
HETATM 8706 O  O   . HOH L 6 .   ? 52.579  -12.412 -37.323 1.00 32.74 ? 685 HOH B O   1 
HETATM 8707 O  O   . HOH L 6 .   ? 41.330  10.418  -23.967 1.00 50.41 ? 686 HOH B O   1 
HETATM 8708 O  O   . HOH L 6 .   ? 57.558  -22.544 -27.511 1.00 31.37 ? 687 HOH B O   1 
HETATM 8709 O  O   . HOH L 6 .   ? 47.149  15.131  -35.121 1.00 41.28 ? 689 HOH B O   1 
HETATM 8710 O  O   . HOH L 6 .   ? 30.606  -16.804 -20.909 1.00 49.32 ? 690 HOH B O   1 
HETATM 8711 O  O   . HOH L 6 .   ? 32.584  -4.987  -9.636  1.00 33.44 ? 691 HOH B O   1 
HETATM 8712 O  O   . HOH L 6 .   ? 54.783  16.093  -16.705 1.00 38.48 ? 692 HOH B O   1 
HETATM 8713 O  O   . HOH L 6 .   ? 32.708  -3.499  -28.434 1.00 31.81 ? 693 HOH B O   1 
HETATM 8714 O  O   . HOH L 6 .   ? 29.701  -4.302  -13.071 1.00 44.05 ? 694 HOH B O   1 
HETATM 8715 O  O   . HOH L 6 .   ? 70.692  1.043   -1.145  1.00 44.22 ? 695 HOH B O   1 
HETATM 8716 O  O   . HOH L 6 .   ? 56.189  19.188  -19.817 1.00 37.59 ? 696 HOH B O   1 
HETATM 8717 O  O   . HOH L 6 .   ? 54.150  1.984   -0.755  1.00 36.48 ? 697 HOH B O   1 
HETATM 8718 O  O   . HOH L 6 .   ? 59.111  -18.219 -5.220  1.00 33.60 ? 698 HOH B O   1 
HETATM 8719 O  O   . HOH L 6 .   ? 53.327  29.251  -36.272 1.00 45.72 ? 699 HOH B O   1 
HETATM 8720 O  O   . HOH L 6 .   ? 64.280  4.483   -1.094  1.00 39.07 ? 700 HOH B O   1 
HETATM 8721 O  O   . HOH L 6 .   ? 69.799  5.359   -0.663  1.00 44.82 ? 701 HOH B O   1 
HETATM 8722 O  O   . HOH L 6 .   ? 46.889  16.287  -37.863 1.00 35.23 ? 702 HOH B O   1 
HETATM 8723 O  O   . HOH L 6 .   ? 51.644  -0.821  -0.147  1.00 37.23 ? 703 HOH B O   1 
HETATM 8724 O  O   . HOH L 6 .   ? 64.402  -11.769 -4.521  1.00 38.96 ? 704 HOH B O   1 
HETATM 8725 O  O   . HOH L 6 .   ? 54.084  -23.598 -15.971 1.00 35.72 ? 705 HOH B O   1 
HETATM 8726 O  O   . HOH L 6 .   ? 36.354  -13.379 -2.908  1.00 32.39 ? 706 HOH B O   1 
HETATM 8727 O  O   . HOH L 6 .   ? 64.276  -25.935 -14.109 1.00 30.77 ? 707 HOH B O   1 
HETATM 8728 O  O   . HOH L 6 .   ? 71.696  -7.987  -29.930 1.00 39.32 ? 708 HOH B O   1 
HETATM 8729 O  O   . HOH L 6 .   ? 43.740  -9.972  3.886   1.00 49.32 ? 709 HOH B O   1 
HETATM 8730 O  O   . HOH L 6 .   ? 36.523  3.412   -18.725 1.00 29.04 ? 710 HOH B O   1 
HETATM 8731 O  O   . HOH L 6 .   ? 57.759  12.691  -8.313  1.00 26.15 ? 711 HOH B O   1 
HETATM 8732 O  O   . HOH L 6 .   ? 56.015  -15.358 -27.468 1.00 37.47 ? 712 HOH B O   1 
HETATM 8733 O  O   . HOH L 6 .   ? 74.642  24.909  -21.934 1.00 39.95 ? 713 HOH B O   1 
HETATM 8734 O  O   . HOH L 6 .   ? 60.546  14.710  -31.504 1.00 26.56 ? 714 HOH B O   1 
HETATM 8735 O  O   . HOH L 6 .   ? 46.553  10.480  -33.566 1.00 41.24 ? 715 HOH B O   1 
HETATM 8736 O  O   . HOH L 6 .   ? 55.323  -23.517 -18.356 1.00 45.90 ? 716 HOH B O   1 
HETATM 8737 O  O   . HOH L 6 .   ? 50.618  -2.662  1.536   1.00 39.25 ? 717 HOH B O   1 
HETATM 8738 O  O   . HOH L 6 .   ? 76.289  5.988   -33.951 1.00 42.31 ? 718 HOH B O   1 
HETATM 8739 O  O   . HOH L 6 .   ? 52.288  5.074   -9.745  1.00 47.74 ? 719 HOH B O   1 
HETATM 8740 O  O   . HOH L 6 .   ? 57.762  21.718  -14.968 1.00 45.95 ? 720 HOH B O   1 
HETATM 8741 O  O   . HOH L 6 .   ? 36.679  3.133   -29.115 1.00 41.76 ? 721 HOH B O   1 
HETATM 8742 O  O   . HOH L 6 .   ? 73.071  6.668   -49.349 1.00 33.76 ? 722 HOH B O   1 
HETATM 8743 O  O   . HOH L 6 .   ? 70.317  12.624  -4.362  1.00 39.93 ? 723 HOH B O   1 
HETATM 8744 O  O   . HOH L 6 .   ? 61.296  -19.595 -25.493 1.00 42.28 ? 724 HOH B O   1 
HETATM 8745 O  O   . HOH L 6 .   ? 64.221  -25.986 -6.366  1.00 40.88 ? 725 HOH B O   1 
HETATM 8746 O  O   . HOH L 6 .   ? 33.299  -0.002  -15.944 1.00 35.36 ? 726 HOH B O   1 
HETATM 8747 O  O   . HOH L 6 .   ? 55.567  -26.081 -20.781 1.00 30.39 ? 727 HOH B O   1 
HETATM 8748 O  O   . HOH L 6 .   ? 36.769  4.892   -16.769 1.00 36.27 ? 728 HOH B O   1 
HETATM 8749 O  O   . HOH L 6 .   ? 82.595  -11.552 -5.746  1.00 31.90 ? 729 HOH B O   1 
HETATM 8750 O  O   . HOH L 6 .   ? 28.679  -14.440 -14.618 1.00 29.82 ? 730 HOH B O   1 
HETATM 8751 O  O   . HOH L 6 .   ? 59.828  16.230  -26.875 1.00 25.55 ? 731 HOH B O   1 
HETATM 8752 O  O   . HOH L 6 .   ? 74.457  1.118   -8.187  1.00 37.74 ? 732 HOH B O   1 
HETATM 8753 O  O   . HOH L 6 .   ? 56.198  2.419   -48.954 1.00 36.93 ? 733 HOH B O   1 
HETATM 8754 O  O   . HOH L 6 .   ? 66.512  -18.156 -7.212  1.00 32.87 ? 734 HOH B O   1 
HETATM 8755 O  O   . HOH L 6 .   ? 51.162  3.232   -4.624  1.00 35.94 ? 735 HOH B O   1 
HETATM 8756 O  O   . HOH L 6 .   ? 84.166  -6.916  -8.746  1.00 47.91 ? 736 HOH B O   1 
HETATM 8757 O  O   . HOH L 6 .   ? 84.254  -14.532 -16.406 1.00 38.28 ? 737 HOH B O   1 
HETATM 8758 O  O   . HOH L 6 .   ? 73.951  -24.492 -10.806 1.00 46.79 ? 738 HOH B O   1 
HETATM 8759 O  O   . HOH L 6 .   ? 71.184  -22.058 -14.068 1.00 42.81 ? 739 HOH B O   1 
HETATM 8760 O  O   . HOH L 6 .   ? 29.781  -4.898  -20.143 1.00 41.46 ? 740 HOH B O   1 
HETATM 8761 O  O   . HOH L 6 .   ? 59.595  -14.276 -28.007 1.00 39.15 ? 741 HOH B O   1 
HETATM 8762 O  O   . HOH L 6 .   ? 83.534  -8.728  -10.465 1.00 39.13 ? 742 HOH B O   1 
HETATM 8763 O  O   . HOH L 6 .   ? 72.442  17.660  -37.498 1.00 27.07 ? 743 HOH B O   1 
HETATM 8764 O  O   . HOH L 6 .   ? 41.861  -23.898 -22.730 1.00 41.19 ? 744 HOH B O   1 
HETATM 8765 O  O   . HOH L 6 .   ? 46.556  12.671  -19.589 1.00 39.87 ? 745 HOH B O   1 
HETATM 8766 O  O   . HOH L 6 .   ? 83.915  1.421   -24.934 1.00 31.41 ? 746 HOH B O   1 
HETATM 8767 O  O   . HOH L 6 .   ? 29.985  -15.147 -17.048 1.00 36.38 ? 747 HOH B O   1 
HETATM 8768 O  O   . HOH L 6 .   ? 28.080  -9.532  -21.540 1.00 51.02 ? 748 HOH B O   1 
HETATM 8769 O  O   . HOH M 6 .   ? 5.348   10.791  12.731  1.00 27.13 ? 280 HOH C O   1 
HETATM 8770 O  O   . HOH N 6 .   ? 57.273  -14.029 -31.566 1.00 41.57 ? 327 HOH D O   1 
HETATM 8771 O  O   . HOH N 6 .   ? 61.749  -11.419 -33.747 1.00 39.02 ? 358 HOH D O   1 
HETATM 8772 O  O   . HOH N 6 .   ? 59.769  -20.445 -31.434 1.00 48.42 ? 361 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   ?   ?   ?   A . n 
A 1 2   THR 2   3   ?   ?   ?   A . n 
A 1 3   ARG 3   4   ?   ?   ?   A . n 
A 1 4   SER 4   5   ?   ?   ?   A . n 
A 1 5   PRO 5   6   6   PRO PRO A . n 
A 1 6   ARG 6   7   7   ARG ARG A . n 
A 1 7   PRO 7   8   8   PRO PRO A . n 
A 1 8   PHE 8   9   9   PHE PHE A . n 
A 1 9   ASN 9   10  10  ASN ASN A . n 
A 1 10  GLU 10  11  11  GLU GLU A . n 
A 1 11  ILE 11  12  12  ILE ILE A . n 
A 1 12  PRO 12  13  13  PRO PRO A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  GLY 15  16  16  GLY GLY A . n 
A 1 16  ASP 16  17  17  ASP ASP A . n 
A 1 17  ASN 17  18  18  ASN ASN A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  TRP 19  20  20  TRP TRP A . n 
A 1 20  LEU 20  21  21  LEU LEU A . n 
A 1 21  ASN 21  22  22  ASN ASN A . n 
A 1 22  LEU 22  23  23  LEU LEU A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  HIS 24  25  25  HIS HIS A . n 
A 1 25  PHE 25  26  26  PHE PHE A . n 
A 1 26  TRP 26  27  27  TRP TRP A . n 
A 1 27  ARG 27  28  28  ARG ARG A . n 
A 1 28  GLU 28  29  29  GLU GLU A . n 
A 1 29  THR 29  30  30  THR THR A . n 
A 1 30  GLY 30  31  31  GLY GLY A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  HIS 32  33  33  HIS HIS A . n 
A 1 33  LYS 33  34  34  LYS LYS A . n 
A 1 34  VAL 34  35  35  VAL VAL A . n 
A 1 35  HIS 35  36  36  HIS HIS A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  HIS 37  38  38  HIS HIS A . n 
A 1 38  HIS 38  39  39  HIS HIS A . n 
A 1 39  VAL 39  40  40  VAL VAL A . n 
A 1 40  GLN 40  41  41  GLN GLN A . n 
A 1 41  ASN 41  42  42  ASN ASN A . n 
A 1 42  PHE 42  43  43  PHE PHE A . n 
A 1 43  GLN 43  44  44  GLN GLN A . n 
A 1 44  LYS 44  45  45  LYS LYS A . n 
A 1 45  TYR 45  46  46  TYR TYR A . n 
A 1 46  GLY 46  47  47  GLY GLY A . n 
A 1 47  PRO 47  48  48  PRO PRO A . n 
A 1 48  ILE 48  49  49  ILE ILE A . n 
A 1 49  TYR 49  50  50  TYR TYR A . n 
A 1 50  ARG 50  51  51  ARG ARG A . n 
A 1 51  GLU 51  52  52  GLU GLU A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  LEU 53  54  54  LEU LEU A . n 
A 1 54  GLY 54  55  55  GLY GLY A . n 
A 1 55  ASN 55  56  56  ASN ASN A . n 
A 1 56  VAL 56  57  57  VAL VAL A . n 
A 1 57  GLU 57  58  58  GLU GLU A . n 
A 1 58  SER 58  59  59  SER SER A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  TYR 60  61  61  TYR TYR A . n 
A 1 61  VAL 61  62  62  VAL VAL A . n 
A 1 62  ILE 62  63  63  ILE ILE A . n 
A 1 63  ASP 63  64  64  ASP ASP A . n 
A 1 64  PRO 64  65  65  PRO PRO A . n 
A 1 65  GLU 65  66  66  GLU GLU A . n 
A 1 66  ASP 66  67  67  ASP ASP A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  ALA 68  69  69  ALA ALA A . n 
A 1 69  LEU 69  70  70  LEU LEU A . n 
A 1 70  LEU 70  71  71  LEU LEU A . n 
A 1 71  PHE 71  72  72  PHE PHE A . n 
A 1 72  LYS 72  73  73  LYS LYS A . n 
A 1 73  SER 73  74  74  SER SER A . n 
A 1 74  GLU 74  75  75  GLU GLU A . n 
A 1 75  GLY 75  76  76  GLY GLY A . n 
A 1 76  PRO 76  77  77  PRO PRO A . n 
A 1 77  ASN 77  78  78  ASN ASN A . n 
A 1 78  PRO 78  79  79  PRO PRO A . n 
A 1 79  GLU 79  80  80  GLU GLU A . n 
A 1 80  ARG 80  81  81  ARG ARG A . n 
A 1 81  PHE 81  82  82  PHE PHE A . n 
A 1 82  LEU 82  83  83  LEU LEU A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  PRO 84  85  85  PRO PRO A . n 
A 1 85  PRO 85  86  86  PRO PRO A . n 
A 1 86  TRP 86  87  87  TRP TRP A . n 
A 1 87  VAL 87  88  88  VAL VAL A . n 
A 1 88  ALA 88  89  89  ALA ALA A . n 
A 1 89  TYR 89  90  90  TYR TYR A . n 
A 1 90  HIS 90  91  91  HIS HIS A . n 
A 1 91  GLN 91  92  92  GLN GLN A . n 
A 1 92  TYR 92  93  93  TYR TYR A . n 
A 1 93  TYR 93  94  94  TYR TYR A . n 
A 1 94  GLN 94  95  95  GLN GLN A . n 
A 1 95  ARG 95  96  96  ARG ARG A . n 
A 1 96  PRO 96  97  97  PRO PRO A . n 
A 1 97  ILE 97  98  98  ILE ILE A . n 
A 1 98  GLY 98  99  99  GLY GLY A . n 
A 1 99  VAL 99  100 100 VAL VAL A . n 
A 1 100 LEU 100 101 101 LEU LEU A . n 
A 1 101 LEU 101 102 102 LEU LEU A . n 
A 1 102 LYS 102 103 103 LYS LYS A . n 
A 1 103 LYS 103 104 104 LYS LYS A . n 
A 1 104 SER 104 105 105 SER SER A . n 
A 1 105 ALA 105 106 106 ALA ALA A . n 
A 1 106 ALA 106 107 107 ALA ALA A . n 
A 1 107 TRP 107 108 108 TRP TRP A . n 
A 1 108 LYS 108 109 109 LYS LYS A . n 
A 1 109 LYS 109 110 110 LYS LYS A . n 
A 1 110 ASP 110 111 111 ASP ASP A . n 
A 1 111 ARG 111 112 112 ARG ARG A . n 
A 1 112 VAL 112 113 113 VAL VAL A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 ASN 115 116 116 ASN ASN A . n 
A 1 116 GLN 116 117 117 GLN GLN A . n 
A 1 117 GLU 117 118 118 GLU GLU A . n 
A 1 118 VAL 118 119 119 VAL VAL A . n 
A 1 119 MET 119 120 120 MET MET A . n 
A 1 120 ALA 120 121 121 ALA ALA A . n 
A 1 121 PRO 121 122 122 PRO PRO A . n 
A 1 122 GLU 122 123 123 GLU GLU A . n 
A 1 123 ALA 123 124 124 ALA ALA A . n 
A 1 124 THR 124 125 125 THR THR A . n 
A 1 125 LYS 125 126 126 LYS LYS A . n 
A 1 126 ASN 126 127 127 ASN ASN A . n 
A 1 127 PHE 127 128 128 PHE PHE A . n 
A 1 128 LEU 128 129 129 LEU LEU A . n 
A 1 129 PRO 129 130 130 PRO PRO A . n 
A 1 130 LEU 130 131 131 LEU LEU A . n 
A 1 131 LEU 131 132 132 LEU LEU A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 ALA 133 134 134 ALA ALA A . n 
A 1 134 VAL 134 135 135 VAL VAL A . n 
A 1 135 SER 135 136 136 SER SER A . n 
A 1 136 ARG 136 137 137 ARG ARG A . n 
A 1 137 ASP 137 138 138 ASP ASP A . n 
A 1 138 PHE 138 139 139 PHE PHE A . n 
A 1 139 VAL 139 140 140 VAL VAL A . n 
A 1 140 SER 140 141 141 SER SER A . n 
A 1 141 VAL 141 142 142 VAL VAL A . n 
A 1 142 LEU 142 143 143 LEU LEU A . n 
A 1 143 HIS 143 144 144 HIS HIS A . n 
A 1 144 ARG 144 145 145 ARG ARG A . n 
A 1 145 ARG 145 146 146 ARG ARG A . n 
A 1 146 ILE 146 147 147 ILE ILE A . n 
A 1 147 LYS 147 148 148 LYS LYS A . n 
A 1 148 LYS 148 149 149 LYS LYS A . n 
A 1 149 ALA 149 150 150 ALA ALA A . n 
A 1 150 GLY 150 151 151 GLY GLY A . n 
A 1 151 SER 151 152 152 SER SER A . n 
A 1 152 GLY 152 153 153 GLY GLY A . n 
A 1 153 ASN 153 154 154 ASN ASN A . n 
A 1 154 TYR 154 155 155 TYR TYR A . n 
A 1 155 SER 155 156 156 SER SER A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 ASP 157 158 158 ASP ASP A . n 
A 1 158 ILE 158 159 159 ILE ILE A . n 
A 1 159 SER 159 160 160 SER SER A . n 
A 1 160 ASP 160 161 161 ASP ASP A . n 
A 1 161 ASP 161 162 162 ASP ASP A . n 
A 1 162 LEU 162 163 163 LEU LEU A . n 
A 1 163 PHE 163 164 164 PHE PHE A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 PHE 165 166 166 PHE PHE A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PHE 167 168 168 PHE PHE A . n 
A 1 168 GLU 168 169 169 GLU GLU A . n 
A 1 169 SER 169 170 170 SER SER A . n 
A 1 170 ILE 170 171 171 ILE ILE A . n 
A 1 171 THR 171 172 172 THR THR A . n 
A 1 172 ASN 172 173 173 ASN ASN A . n 
A 1 173 VAL 173 174 174 VAL VAL A . n 
A 1 174 ILE 174 175 175 ILE ILE A . n 
A 1 175 PHE 175 176 176 PHE PHE A . n 
A 1 176 GLY 176 177 177 GLY GLY A . n 
A 1 177 GLU 177 178 178 GLU GLU A . n 
A 1 178 ARG 178 179 179 ARG ARG A . n 
A 1 179 GLN 179 180 180 GLN GLN A . n 
A 1 180 GLY 180 181 181 GLY GLY A . n 
A 1 181 MET 181 182 182 MET MET A . n 
A 1 182 LEU 182 183 183 LEU LEU A . n 
A 1 183 GLU 183 184 184 GLU GLU A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 VAL 185 186 186 VAL VAL A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ASN 187 188 188 ASN ASN A . n 
A 1 188 PRO 188 189 189 PRO PRO A . n 
A 1 189 GLU 189 190 190 GLU GLU A . n 
A 1 190 ALA 190 191 191 ALA ALA A . n 
A 1 191 GLN 191 192 192 GLN GLN A . n 
A 1 192 ARG 192 193 193 ARG ARG A . n 
A 1 193 PHE 193 194 194 PHE PHE A . n 
A 1 194 ILE 194 195 195 ILE ILE A . n 
A 1 195 ASP 195 196 196 ASP ASP A . n 
A 1 196 ALA 196 197 197 ALA ALA A . n 
A 1 197 ILE 197 198 198 ILE ILE A . n 
A 1 198 TYR 198 199 199 TYR TYR A . n 
A 1 199 GLN 199 200 200 GLN GLN A . n 
A 1 200 MET 200 201 201 MET MET A . n 
A 1 201 PHE 201 202 202 PHE PHE A . n 
A 1 202 HIS 202 203 203 HIS HIS A . n 
A 1 203 THR 203 204 204 THR THR A . n 
A 1 204 SER 204 205 205 SER SER A . n 
A 1 205 VAL 205 206 206 VAL VAL A . n 
A 1 206 PRO 206 207 207 PRO PRO A . n 
A 1 207 MET 207 208 208 MET MET A . n 
A 1 208 LEU 208 209 209 LEU LEU A . n 
A 1 209 ASN 209 210 210 ASN ASN A . n 
A 1 210 LEU 210 211 211 LEU LEU A . n 
A 1 211 PRO 211 212 212 PRO PRO A . n 
A 1 212 PRO 212 213 213 PRO PRO A . n 
A 1 213 ASP 213 214 214 ASP ASP A . n 
A 1 214 LEU 214 215 215 LEU LEU A . n 
A 1 215 PHE 215 216 216 PHE PHE A . n 
A 1 216 ARG 216 217 217 ARG ARG A . n 
A 1 217 LEU 217 218 218 LEU LEU A . n 
A 1 218 PHE 218 219 219 PHE PHE A . n 
A 1 219 ARG 219 220 220 ARG ARG A . n 
A 1 220 THR 220 221 221 THR THR A . n 
A 1 221 LYS 221 222 222 LYS LYS A . n 
A 1 222 THR 222 223 223 THR THR A . n 
A 1 223 TRP 223 224 224 TRP TRP A . n 
A 1 224 LYS 224 225 225 LYS LYS A . n 
A 1 225 ASP 225 226 226 ASP ASP A . n 
A 1 226 HIS 226 227 227 HIS HIS A . n 
A 1 227 VAL 227 228 228 VAL VAL A . n 
A 1 228 ALA 228 229 229 ALA ALA A . n 
A 1 229 ALA 229 230 230 ALA ALA A . n 
A 1 230 TRP 230 231 231 TRP TRP A . n 
A 1 231 ASP 231 232 232 ASP ASP A . n 
A 1 232 VAL 232 233 233 VAL VAL A . n 
A 1 233 ILE 233 234 234 ILE ILE A . n 
A 1 234 PHE 234 235 235 PHE PHE A . n 
A 1 235 SER 235 236 236 SER SER A . n 
A 1 236 LYS 236 237 237 LYS LYS A . n 
A 1 237 ALA 237 238 238 ALA ALA A . n 
A 1 238 ASP 238 239 239 ASP ASP A . n 
A 1 239 ILE 239 240 240 ILE ILE A . n 
A 1 240 TYR 240 241 241 TYR TYR A . n 
A 1 241 THR 241 242 242 THR THR A . n 
A 1 242 GLN 242 243 243 GLN GLN A . n 
A 1 243 ASN 243 244 244 ASN ASN A . n 
A 1 244 PHE 244 245 245 PHE PHE A . n 
A 1 245 TYR 245 246 246 TYR TYR A . n 
A 1 246 TRP 246 247 247 TRP TRP A . n 
A 1 247 GLU 247 248 248 GLU GLU A . n 
A 1 248 LEU 248 249 249 LEU LEU A . n 
A 1 249 ARG 249 250 250 ARG ARG A . n 
A 1 250 GLN 250 251 251 GLN GLN A . n 
A 1 251 LYS 251 252 252 LYS LYS A . n 
A 1 252 GLY 252 253 253 GLY GLY A . n 
A 1 253 SER 253 254 254 SER SER A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 HIS 255 256 256 HIS HIS A . n 
A 1 256 HIS 256 257 257 HIS HIS A . n 
A 1 257 ASP 257 258 258 ASP ASP A . n 
A 1 258 TYR 258 259 259 TYR TYR A . n 
A 1 259 ARG 259 260 260 ARG ARG A . n 
A 1 260 GLY 260 261 261 GLY GLY A . n 
A 1 261 ILE 261 262 262 ILE ILE A . n 
A 1 262 LEU 262 263 263 LEU LEU A . n 
A 1 263 TYR 263 264 264 TYR TYR A . n 
A 1 264 ARG 264 265 265 ARG ARG A . n 
A 1 265 LEU 265 266 266 LEU LEU A . n 
A 1 266 LEU 266 267 267 LEU LEU A . n 
A 1 267 GLY 267 268 268 GLY GLY A . n 
A 1 268 ASP 268 269 269 ASP ASP A . n 
A 1 269 SER 269 270 270 SER SER A . n 
A 1 270 LYS 270 271 271 LYS LYS A . n 
A 1 271 MET 271 272 272 MET MET A . n 
A 1 272 SER 272 273 273 SER SER A . n 
A 1 273 PHE 273 274 274 PHE PHE A . n 
A 1 274 GLU 274 275 275 GLU GLU A . n 
A 1 275 ASP 275 276 276 ASP ASP A . n 
A 1 276 ILE 276 277 277 ILE ILE A . n 
A 1 277 LYS 277 278 278 LYS LYS A . n 
A 1 278 ALA 278 279 279 ALA ALA A . n 
A 1 279 ASN 279 280 280 ASN ASN A . n 
A 1 280 VAL 280 281 281 VAL VAL A . n 
A 1 281 THR 281 282 282 THR THR A . n 
A 1 282 GLU 282 283 283 GLU GLU A . n 
A 1 283 MET 283 284 284 MET MET A . n 
A 1 284 LEU 284 285 285 LEU LEU A . n 
A 1 285 ALA 285 286 286 ALA ALA A . n 
A 1 286 GLY 286 287 287 GLY GLY A . n 
A 1 287 GLY 287 288 288 GLY GLY A . n 
A 1 288 VAL 288 289 289 VAL VAL A . n 
A 1 289 ASP 289 290 290 ASP ASP A . n 
A 1 290 THR 290 291 291 THR THR A . n 
A 1 291 THR 291 292 292 THR THR A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 MET 293 294 294 MET MET A . n 
A 1 294 THR 294 295 295 THR THR A . n 
A 1 295 LEU 295 296 296 LEU LEU A . n 
A 1 296 GLN 296 297 297 GLN GLN A . n 
A 1 297 TRP 297 298 298 TRP TRP A . n 
A 1 298 HIS 298 299 299 HIS HIS A . n 
A 1 299 LEU 299 300 300 LEU LEU A . n 
A 1 300 TYR 300 301 301 TYR TYR A . n 
A 1 301 GLU 301 302 302 GLU GLU A . n 
A 1 302 MET 302 303 303 MET MET A . n 
A 1 303 ALA 303 304 304 ALA ALA A . n 
A 1 304 ARG 304 305 305 ARG ARG A . n 
A 1 305 ASN 305 306 306 ASN ASN A . n 
A 1 306 LEU 306 307 307 LEU LEU A . n 
A 1 307 LYS 307 308 308 LYS LYS A . n 
A 1 308 VAL 308 309 309 VAL VAL A . n 
A 1 309 GLN 309 310 310 GLN GLN A . n 
A 1 310 ASP 310 311 311 ASP ASP A . n 
A 1 311 MET 311 312 312 MET MET A . n 
A 1 312 LEU 312 313 313 LEU LEU A . n 
A 1 313 ARG 313 314 314 ARG ARG A . n 
A 1 314 ALA 314 315 315 ALA ALA A . n 
A 1 315 GLU 315 316 316 GLU GLU A . n 
A 1 316 VAL 316 317 317 VAL VAL A . n 
A 1 317 LEU 317 318 318 LEU LEU A . n 
A 1 318 ALA 318 319 319 ALA ALA A . n 
A 1 319 ALA 319 320 320 ALA ALA A . n 
A 1 320 ARG 320 321 321 ARG ARG A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLN 322 323 323 GLN GLN A . n 
A 1 323 ALA 323 324 324 ALA ALA A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 GLY 325 326 326 GLY GLY A . n 
A 1 326 ASP 326 327 327 ASP ASP A . n 
A 1 327 MET 327 328 328 MET MET A . n 
A 1 328 ALA 328 329 329 ALA ALA A . n 
A 1 329 THR 329 330 330 THR THR A . n 
A 1 330 MET 330 331 331 MET MET A . n 
A 1 331 LEU 331 332 332 LEU LEU A . n 
A 1 332 GLN 332 333 333 GLN GLN A . n 
A 1 333 LEU 333 334 334 LEU LEU A . n 
A 1 334 VAL 334 335 335 VAL VAL A . n 
A 1 335 PRO 335 336 336 PRO PRO A . n 
A 1 336 LEU 336 337 337 LEU LEU A . n 
A 1 337 LEU 337 338 338 LEU LEU A . n 
A 1 338 LYS 338 339 339 LYS LYS A . n 
A 1 339 ALA 339 340 340 ALA ALA A . n 
A 1 340 SER 340 341 341 SER SER A . n 
A 1 341 ILE 341 342 342 ILE ILE A . n 
A 1 342 LYS 342 343 343 LYS LYS A . n 
A 1 343 GLU 343 344 344 GLU GLU A . n 
A 1 344 THR 344 345 345 THR THR A . n 
A 1 345 LEU 345 346 346 LEU LEU A . n 
A 1 346 ARG 346 347 347 ARG ARG A . n 
A 1 347 LEU 347 348 348 LEU LEU A . n 
A 1 348 HIS 348 349 349 HIS HIS A . n 
A 1 349 PRO 349 350 350 PRO PRO A . n 
A 1 350 ILE 350 351 351 ILE ILE A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 VAL 352 353 353 VAL VAL A . n 
A 1 353 THR 353 354 354 THR THR A . n 
A 1 354 LEU 354 355 355 LEU LEU A . n 
A 1 355 GLN 355 356 356 GLN GLN A . n 
A 1 356 ARG 356 357 357 ARG ARG A . n 
A 1 357 TYR 357 358 358 TYR TYR A . n 
A 1 358 LEU 358 359 359 LEU LEU A . n 
A 1 359 VAL 359 360 360 VAL VAL A . n 
A 1 360 ASN 360 361 361 ASN ASN A . n 
A 1 361 ASP 361 362 362 ASP ASP A . n 
A 1 362 LEU 362 363 363 LEU LEU A . n 
A 1 363 VAL 363 364 364 VAL VAL A . n 
A 1 364 LEU 364 365 365 LEU LEU A . n 
A 1 365 ARG 365 366 366 ARG ARG A . n 
A 1 366 ASP 366 367 367 ASP ASP A . n 
A 1 367 TYR 367 368 368 TYR TYR A . n 
A 1 368 MET 368 369 369 MET MET A . n 
A 1 369 ILE 369 370 370 ILE ILE A . n 
A 1 370 PRO 370 371 371 PRO PRO A . n 
A 1 371 ALA 371 372 372 ALA ALA A . n 
A 1 372 LYS 372 373 373 LYS LYS A . n 
A 1 373 THR 373 374 374 THR THR A . n 
A 1 374 LEU 374 375 375 LEU LEU A . n 
A 1 375 VAL 375 376 376 VAL VAL A . n 
A 1 376 GLN 376 377 377 GLN GLN A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 ALA 378 379 379 ALA ALA A . n 
A 1 379 ILE 379 380 380 ILE ILE A . n 
A 1 380 TYR 380 381 381 TYR TYR A . n 
A 1 381 ALA 381 382 382 ALA ALA A . n 
A 1 382 LEU 382 383 383 LEU LEU A . n 
A 1 383 GLY 383 384 384 GLY GLY A . n 
A 1 384 ARG 384 385 385 ARG ARG A . n 
A 1 385 GLU 385 386 386 GLU GLU A . n 
A 1 386 PRO 386 387 387 PRO PRO A . n 
A 1 387 THR 387 388 388 THR THR A . n 
A 1 388 PHE 388 389 389 PHE PHE A . n 
A 1 389 PHE 389 390 390 PHE PHE A . n 
A 1 390 PHE 390 391 391 PHE PHE A . n 
A 1 391 ASP 391 392 392 ASP ASP A . n 
A 1 392 PRO 392 393 393 PRO PRO A . n 
A 1 393 GLU 393 394 394 GLU GLU A . n 
A 1 394 ASN 394 395 395 ASN ASN A . n 
A 1 395 PHE 395 396 396 PHE PHE A . n 
A 1 396 ASP 396 397 397 ASP ASP A . n 
A 1 397 PRO 397 398 398 PRO PRO A . n 
A 1 398 THR 398 399 399 THR THR A . n 
A 1 399 ARG 399 400 400 ARG ARG A . n 
A 1 400 TRP 400 401 401 TRP TRP A . n 
A 1 401 LEU 401 402 402 LEU LEU A . n 
A 1 402 SER 402 403 403 SER SER A . n 
A 1 403 LYS 403 404 404 LYS LYS A . n 
A 1 404 ASP 404 405 405 ASP ASP A . n 
A 1 405 LYS 405 406 406 LYS LYS A . n 
A 1 406 ASN 406 407 407 ASN ASN A . n 
A 1 407 ILE 407 408 408 ILE ILE A . n 
A 1 408 THR 408 409 409 THR THR A . n 
A 1 409 TYR 409 410 410 TYR TYR A . n 
A 1 410 PHE 410 411 411 PHE PHE A . n 
A 1 411 ARG 411 412 412 ARG ARG A . n 
A 1 412 ASN 412 413 413 ASN ASN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 GLY 414 415 415 GLY GLY A . n 
A 1 415 PHE 415 416 416 PHE PHE A . n 
A 1 416 GLY 416 417 417 GLY GLY A . n 
A 1 417 TRP 417 418 418 TRP TRP A . n 
A 1 418 GLY 418 419 419 GLY GLY A . n 
A 1 419 VAL 419 420 420 VAL VAL A . n 
A 1 420 ARG 420 421 421 ARG ARG A . n 
A 1 421 GLN 421 422 422 GLN GLN A . n 
A 1 422 CYS 422 423 423 CYS CYS A . n 
A 1 423 LEU 423 424 424 LEU LEU A . n 
A 1 424 GLY 424 425 425 GLY GLY A . n 
A 1 425 ARG 425 426 426 ARG ARG A . n 
A 1 426 ARG 426 427 427 ARG ARG A . n 
A 1 427 ILE 427 428 428 ILE ILE A . n 
A 1 428 ALA 428 429 429 ALA ALA A . n 
A 1 429 GLU 429 430 430 GLU GLU A . n 
A 1 430 LEU 430 431 431 LEU LEU A . n 
A 1 431 GLU 431 432 432 GLU GLU A . n 
A 1 432 MET 432 433 433 MET MET A . n 
A 1 433 THR 433 434 434 THR THR A . n 
A 1 434 ILE 434 435 435 ILE ILE A . n 
A 1 435 PHE 435 436 436 PHE PHE A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 ILE 437 438 438 ILE ILE A . n 
A 1 438 ASN 438 439 439 ASN ASN A . n 
A 1 439 MET 439 440 440 MET MET A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 GLU 441 442 442 GLU GLU A . n 
A 1 442 ASN 442 443 443 ASN ASN A . n 
A 1 443 PHE 443 444 444 PHE PHE A . n 
A 1 444 ARG 444 445 445 ARG ARG A . n 
A 1 445 VAL 445 446 446 VAL VAL A . n 
A 1 446 GLU 446 447 447 GLU GLU A . n 
A 1 447 ILE 447 448 448 ILE ILE A . n 
A 1 448 GLN 448 449 449 GLN GLN A . n 
A 1 449 HIS 449 450 450 HIS HIS A . n 
A 1 450 LEU 450 451 451 LEU LEU A . n 
A 1 451 SER 451 452 452 SER SER A . n 
A 1 452 ASP 452 453 453 ASP ASP A . n 
A 1 453 VAL 453 454 454 VAL VAL A . n 
A 1 454 GLY 454 455 455 GLY GLY A . n 
A 1 455 THR 455 456 456 THR THR A . n 
A 1 456 THR 456 457 457 THR THR A . n 
A 1 457 PHE 457 458 458 PHE PHE A . n 
A 1 458 ASN 458 459 459 ASN ASN A . n 
A 1 459 LEU 459 460 460 LEU LEU A . n 
A 1 460 ILE 460 461 461 ILE ILE A . n 
A 1 461 LEU 461 462 462 LEU LEU A . n 
A 1 462 MET 462 463 463 MET MET A . n 
A 1 463 PRO 463 464 464 PRO PRO A . n 
A 1 464 GLU 464 465 465 GLU GLU A . n 
A 1 465 LYS 465 466 466 LYS LYS A . n 
A 1 466 PRO 466 467 467 PRO PRO A . n 
A 1 467 ILE 467 468 468 ILE ILE A . n 
A 1 468 SER 468 469 469 SER SER A . n 
A 1 469 PHE 469 470 470 PHE PHE A . n 
A 1 470 THR 470 471 471 THR THR A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 TRP 472 473 473 TRP TRP A . n 
A 1 473 PRO 473 474 474 PRO PRO A . n 
A 1 474 PHE 474 475 475 PHE PHE A . n 
A 1 475 ASN 475 476 ?   ?   ?   A . n 
A 1 476 GLN 476 477 ?   ?   ?   A . n 
A 1 477 GLU 477 478 ?   ?   ?   A . n 
A 1 478 ALA 478 479 ?   ?   ?   A . n 
A 1 479 THR 479 480 ?   ?   ?   A . n 
A 1 480 GLN 480 481 ?   ?   ?   A . n 
A 1 481 GLN 481 482 ?   ?   ?   A . n 
A 1 482 HIS 482 483 ?   ?   ?   A . n 
A 1 483 HIS 483 484 ?   ?   ?   A . n 
A 1 484 HIS 484 485 ?   ?   ?   A . n 
A 1 485 HIS 485 486 ?   ?   ?   A . n 
A 1 486 HIS 486 487 ?   ?   ?   A . n 
A 1 487 HIS 487 488 ?   ?   ?   A . n 
B 1 1   SER 1   2   ?   ?   ?   B . n 
B 1 2   THR 2   3   ?   ?   ?   B . n 
B 1 3   ARG 3   4   ?   ?   ?   B . n 
B 1 4   SER 4   5   ?   ?   ?   B . n 
B 1 5   PRO 5   6   6   PRO PRO B . n 
B 1 6   ARG 6   7   7   ARG ARG B . n 
B 1 7   PRO 7   8   8   PRO PRO B . n 
B 1 8   PHE 8   9   9   PHE PHE B . n 
B 1 9   ASN 9   10  10  ASN ASN B . n 
B 1 10  GLU 10  11  11  GLU GLU B . n 
B 1 11  ILE 11  12  12  ILE ILE B . n 
B 1 12  PRO 12  13  13  PRO PRO B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  GLY 15  16  16  GLY GLY B . n 
B 1 16  ASP 16  17  17  ASP ASP B . n 
B 1 17  ASN 17  18  18  ASN ASN B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  TRP 19  20  20  TRP TRP B . n 
B 1 20  LEU 20  21  21  LEU LEU B . n 
B 1 21  ASN 21  22  22  ASN ASN B . n 
B 1 22  LEU 22  23  23  LEU LEU B . n 
B 1 23  TYR 23  24  24  TYR TYR B . n 
B 1 24  HIS 24  25  25  HIS HIS B . n 
B 1 25  PHE 25  26  26  PHE PHE B . n 
B 1 26  TRP 26  27  27  TRP TRP B . n 
B 1 27  ARG 27  28  28  ARG ARG B . n 
B 1 28  GLU 28  29  29  GLU GLU B . n 
B 1 29  THR 29  30  30  THR THR B . n 
B 1 30  GLY 30  31  31  GLY GLY B . n 
B 1 31  THR 31  32  32  THR THR B . n 
B 1 32  HIS 32  33  33  HIS HIS B . n 
B 1 33  LYS 33  34  34  LYS LYS B . n 
B 1 34  VAL 34  35  35  VAL VAL B . n 
B 1 35  HIS 35  36  36  HIS HIS B . n 
B 1 36  LEU 36  37  37  LEU LEU B . n 
B 1 37  HIS 37  38  38  HIS HIS B . n 
B 1 38  HIS 38  39  39  HIS HIS B . n 
B 1 39  VAL 39  40  40  VAL VAL B . n 
B 1 40  GLN 40  41  41  GLN GLN B . n 
B 1 41  ASN 41  42  42  ASN ASN B . n 
B 1 42  PHE 42  43  43  PHE PHE B . n 
B 1 43  GLN 43  44  44  GLN GLN B . n 
B 1 44  LYS 44  45  45  LYS LYS B . n 
B 1 45  TYR 45  46  46  TYR TYR B . n 
B 1 46  GLY 46  47  47  GLY GLY B . n 
B 1 47  PRO 47  48  48  PRO PRO B . n 
B 1 48  ILE 48  49  49  ILE ILE B . n 
B 1 49  TYR 49  50  50  TYR TYR B . n 
B 1 50  ARG 50  51  51  ARG ARG B . n 
B 1 51  GLU 51  52  52  GLU GLU B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  LEU 53  54  54  LEU LEU B . n 
B 1 54  GLY 54  55  55  GLY GLY B . n 
B 1 55  ASN 55  56  56  ASN ASN B . n 
B 1 56  VAL 56  57  57  VAL VAL B . n 
B 1 57  GLU 57  58  58  GLU GLU B . n 
B 1 58  SER 58  59  59  SER SER B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  TYR 60  61  61  TYR TYR B . n 
B 1 61  VAL 61  62  62  VAL VAL B . n 
B 1 62  ILE 62  63  63  ILE ILE B . n 
B 1 63  ASP 63  64  64  ASP ASP B . n 
B 1 64  PRO 64  65  65  PRO PRO B . n 
B 1 65  GLU 65  66  66  GLU GLU B . n 
B 1 66  ASP 66  67  67  ASP ASP B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  ALA 68  69  69  ALA ALA B . n 
B 1 69  LEU 69  70  70  LEU LEU B . n 
B 1 70  LEU 70  71  71  LEU LEU B . n 
B 1 71  PHE 71  72  72  PHE PHE B . n 
B 1 72  LYS 72  73  73  LYS LYS B . n 
B 1 73  SER 73  74  74  SER SER B . n 
B 1 74  GLU 74  75  75  GLU GLU B . n 
B 1 75  GLY 75  76  76  GLY GLY B . n 
B 1 76  PRO 76  77  77  PRO PRO B . n 
B 1 77  ASN 77  78  78  ASN ASN B . n 
B 1 78  PRO 78  79  79  PRO PRO B . n 
B 1 79  GLU 79  80  80  GLU GLU B . n 
B 1 80  ARG 80  81  81  ARG ARG B . n 
B 1 81  PHE 81  82  82  PHE PHE B . n 
B 1 82  LEU 82  83  83  LEU LEU B . n 
B 1 83  ILE 83  84  84  ILE ILE B . n 
B 1 84  PRO 84  85  85  PRO PRO B . n 
B 1 85  PRO 85  86  86  PRO PRO B . n 
B 1 86  TRP 86  87  87  TRP TRP B . n 
B 1 87  VAL 87  88  88  VAL VAL B . n 
B 1 88  ALA 88  89  89  ALA ALA B . n 
B 1 89  TYR 89  90  90  TYR TYR B . n 
B 1 90  HIS 90  91  91  HIS HIS B . n 
B 1 91  GLN 91  92  92  GLN GLN B . n 
B 1 92  TYR 92  93  93  TYR TYR B . n 
B 1 93  TYR 93  94  94  TYR TYR B . n 
B 1 94  GLN 94  95  95  GLN GLN B . n 
B 1 95  ARG 95  96  96  ARG ARG B . n 
B 1 96  PRO 96  97  97  PRO PRO B . n 
B 1 97  ILE 97  98  98  ILE ILE B . n 
B 1 98  GLY 98  99  99  GLY GLY B . n 
B 1 99  VAL 99  100 100 VAL VAL B . n 
B 1 100 LEU 100 101 101 LEU LEU B . n 
B 1 101 LEU 101 102 102 LEU LEU B . n 
B 1 102 LYS 102 103 103 LYS LYS B . n 
B 1 103 LYS 103 104 104 LYS LYS B . n 
B 1 104 SER 104 105 105 SER SER B . n 
B 1 105 ALA 105 106 106 ALA ALA B . n 
B 1 106 ALA 106 107 107 ALA ALA B . n 
B 1 107 TRP 107 108 108 TRP TRP B . n 
B 1 108 LYS 108 109 109 LYS LYS B . n 
B 1 109 LYS 109 110 110 LYS LYS B . n 
B 1 110 ASP 110 111 111 ASP ASP B . n 
B 1 111 ARG 111 112 112 ARG ARG B . n 
B 1 112 VAL 112 113 113 VAL VAL B . n 
B 1 113 ALA 113 114 114 ALA ALA B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 ASN 115 116 116 ASN ASN B . n 
B 1 116 GLN 116 117 117 GLN GLN B . n 
B 1 117 GLU 117 118 118 GLU GLU B . n 
B 1 118 VAL 118 119 119 VAL VAL B . n 
B 1 119 MET 119 120 120 MET MET B . n 
B 1 120 ALA 120 121 121 ALA ALA B . n 
B 1 121 PRO 121 122 122 PRO PRO B . n 
B 1 122 GLU 122 123 123 GLU GLU B . n 
B 1 123 ALA 123 124 124 ALA ALA B . n 
B 1 124 THR 124 125 125 THR THR B . n 
B 1 125 LYS 125 126 126 LYS LYS B . n 
B 1 126 ASN 126 127 127 ASN ASN B . n 
B 1 127 PHE 127 128 128 PHE PHE B . n 
B 1 128 LEU 128 129 129 LEU LEU B . n 
B 1 129 PRO 129 130 130 PRO PRO B . n 
B 1 130 LEU 130 131 131 LEU LEU B . n 
B 1 131 LEU 131 132 132 LEU LEU B . n 
B 1 132 ASP 132 133 133 ASP ASP B . n 
B 1 133 ALA 133 134 134 ALA ALA B . n 
B 1 134 VAL 134 135 135 VAL VAL B . n 
B 1 135 SER 135 136 136 SER SER B . n 
B 1 136 ARG 136 137 137 ARG ARG B . n 
B 1 137 ASP 137 138 138 ASP ASP B . n 
B 1 138 PHE 138 139 139 PHE PHE B . n 
B 1 139 VAL 139 140 140 VAL VAL B . n 
B 1 140 SER 140 141 141 SER SER B . n 
B 1 141 VAL 141 142 142 VAL VAL B . n 
B 1 142 LEU 142 143 143 LEU LEU B . n 
B 1 143 HIS 143 144 144 HIS HIS B . n 
B 1 144 ARG 144 145 145 ARG ARG B . n 
B 1 145 ARG 145 146 146 ARG ARG B . n 
B 1 146 ILE 146 147 147 ILE ILE B . n 
B 1 147 LYS 147 148 148 LYS LYS B . n 
B 1 148 LYS 148 149 149 LYS LYS B . n 
B 1 149 ALA 149 150 150 ALA ALA B . n 
B 1 150 GLY 150 151 151 GLY GLY B . n 
B 1 151 SER 151 152 152 SER SER B . n 
B 1 152 GLY 152 153 153 GLY GLY B . n 
B 1 153 ASN 153 154 154 ASN ASN B . n 
B 1 154 TYR 154 155 155 TYR TYR B . n 
B 1 155 SER 155 156 156 SER SER B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 ASP 157 158 158 ASP ASP B . n 
B 1 158 ILE 158 159 159 ILE ILE B . n 
B 1 159 SER 159 160 160 SER SER B . n 
B 1 160 ASP 160 161 161 ASP ASP B . n 
B 1 161 ASP 161 162 162 ASP ASP B . n 
B 1 162 LEU 162 163 163 LEU LEU B . n 
B 1 163 PHE 163 164 164 PHE PHE B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 PHE 165 166 166 PHE PHE B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PHE 167 168 168 PHE PHE B . n 
B 1 168 GLU 168 169 169 GLU GLU B . n 
B 1 169 SER 169 170 170 SER SER B . n 
B 1 170 ILE 170 171 171 ILE ILE B . n 
B 1 171 THR 171 172 172 THR THR B . n 
B 1 172 ASN 172 173 173 ASN ASN B . n 
B 1 173 VAL 173 174 174 VAL VAL B . n 
B 1 174 ILE 174 175 175 ILE ILE B . n 
B 1 175 PHE 175 176 176 PHE PHE B . n 
B 1 176 GLY 176 177 177 GLY GLY B . n 
B 1 177 GLU 177 178 178 GLU GLU B . n 
B 1 178 ARG 178 179 179 ARG ARG B . n 
B 1 179 GLN 179 180 180 GLN GLN B . n 
B 1 180 GLY 180 181 181 GLY GLY B . n 
B 1 181 MET 181 182 182 MET MET B . n 
B 1 182 LEU 182 183 183 LEU LEU B . n 
B 1 183 GLU 183 184 184 GLU GLU B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 VAL 185 186 186 VAL VAL B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ASN 187 188 188 ASN ASN B . n 
B 1 188 PRO 188 189 189 PRO PRO B . n 
B 1 189 GLU 189 190 190 GLU GLU B . n 
B 1 190 ALA 190 191 191 ALA ALA B . n 
B 1 191 GLN 191 192 192 GLN GLN B . n 
B 1 192 ARG 192 193 193 ARG ARG B . n 
B 1 193 PHE 193 194 194 PHE PHE B . n 
B 1 194 ILE 194 195 195 ILE ILE B . n 
B 1 195 ASP 195 196 196 ASP ASP B . n 
B 1 196 ALA 196 197 197 ALA ALA B . n 
B 1 197 ILE 197 198 198 ILE ILE B . n 
B 1 198 TYR 198 199 199 TYR TYR B . n 
B 1 199 GLN 199 200 200 GLN GLN B . n 
B 1 200 MET 200 201 201 MET MET B . n 
B 1 201 PHE 201 202 202 PHE PHE B . n 
B 1 202 HIS 202 203 203 HIS HIS B . n 
B 1 203 THR 203 204 204 THR THR B . n 
B 1 204 SER 204 205 205 SER SER B . n 
B 1 205 VAL 205 206 206 VAL VAL B . n 
B 1 206 PRO 206 207 207 PRO PRO B . n 
B 1 207 MET 207 208 208 MET MET B . n 
B 1 208 LEU 208 209 209 LEU LEU B . n 
B 1 209 ASN 209 210 210 ASN ASN B . n 
B 1 210 LEU 210 211 211 LEU LEU B . n 
B 1 211 PRO 211 212 212 PRO PRO B . n 
B 1 212 PRO 212 213 213 PRO PRO B . n 
B 1 213 ASP 213 214 214 ASP ASP B . n 
B 1 214 LEU 214 215 215 LEU LEU B . n 
B 1 215 PHE 215 216 216 PHE PHE B . n 
B 1 216 ARG 216 217 217 ARG ARG B . n 
B 1 217 LEU 217 218 218 LEU LEU B . n 
B 1 218 PHE 218 219 219 PHE PHE B . n 
B 1 219 ARG 219 220 220 ARG ARG B . n 
B 1 220 THR 220 221 221 THR THR B . n 
B 1 221 LYS 221 222 222 LYS LYS B . n 
B 1 222 THR 222 223 223 THR THR B . n 
B 1 223 TRP 223 224 224 TRP TRP B . n 
B 1 224 LYS 224 225 225 LYS LYS B . n 
B 1 225 ASP 225 226 226 ASP ASP B . n 
B 1 226 HIS 226 227 227 HIS HIS B . n 
B 1 227 VAL 227 228 228 VAL VAL B . n 
B 1 228 ALA 228 229 229 ALA ALA B . n 
B 1 229 ALA 229 230 230 ALA ALA B . n 
B 1 230 TRP 230 231 231 TRP TRP B . n 
B 1 231 ASP 231 232 232 ASP ASP B . n 
B 1 232 VAL 232 233 233 VAL VAL B . n 
B 1 233 ILE 233 234 234 ILE ILE B . n 
B 1 234 PHE 234 235 235 PHE PHE B . n 
B 1 235 SER 235 236 236 SER SER B . n 
B 1 236 LYS 236 237 237 LYS LYS B . n 
B 1 237 ALA 237 238 238 ALA ALA B . n 
B 1 238 ASP 238 239 239 ASP ASP B . n 
B 1 239 ILE 239 240 240 ILE ILE B . n 
B 1 240 TYR 240 241 241 TYR TYR B . n 
B 1 241 THR 241 242 242 THR THR B . n 
B 1 242 GLN 242 243 243 GLN GLN B . n 
B 1 243 ASN 243 244 244 ASN ASN B . n 
B 1 244 PHE 244 245 245 PHE PHE B . n 
B 1 245 TYR 245 246 246 TYR TYR B . n 
B 1 246 TRP 246 247 247 TRP TRP B . n 
B 1 247 GLU 247 248 248 GLU GLU B . n 
B 1 248 LEU 248 249 249 LEU LEU B . n 
B 1 249 ARG 249 250 250 ARG ARG B . n 
B 1 250 GLN 250 251 251 GLN GLN B . n 
B 1 251 LYS 251 252 252 LYS LYS B . n 
B 1 252 GLY 252 253 253 GLY GLY B . n 
B 1 253 SER 253 254 254 SER SER B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 HIS 255 256 256 HIS HIS B . n 
B 1 256 HIS 256 257 257 HIS HIS B . n 
B 1 257 ASP 257 258 258 ASP ASP B . n 
B 1 258 TYR 258 259 259 TYR TYR B . n 
B 1 259 ARG 259 260 260 ARG ARG B . n 
B 1 260 GLY 260 261 261 GLY GLY B . n 
B 1 261 ILE 261 262 262 ILE ILE B . n 
B 1 262 LEU 262 263 263 LEU LEU B . n 
B 1 263 TYR 263 264 264 TYR TYR B . n 
B 1 264 ARG 264 265 265 ARG ARG B . n 
B 1 265 LEU 265 266 266 LEU LEU B . n 
B 1 266 LEU 266 267 267 LEU LEU B . n 
B 1 267 GLY 267 268 268 GLY GLY B . n 
B 1 268 ASP 268 269 269 ASP ASP B . n 
B 1 269 SER 269 270 270 SER SER B . n 
B 1 270 LYS 270 271 271 LYS LYS B . n 
B 1 271 MET 271 272 272 MET MET B . n 
B 1 272 SER 272 273 273 SER SER B . n 
B 1 273 PHE 273 274 274 PHE PHE B . n 
B 1 274 GLU 274 275 275 GLU GLU B . n 
B 1 275 ASP 275 276 276 ASP ASP B . n 
B 1 276 ILE 276 277 277 ILE ILE B . n 
B 1 277 LYS 277 278 278 LYS LYS B . n 
B 1 278 ALA 278 279 279 ALA ALA B . n 
B 1 279 ASN 279 280 280 ASN ASN B . n 
B 1 280 VAL 280 281 281 VAL VAL B . n 
B 1 281 THR 281 282 282 THR THR B . n 
B 1 282 GLU 282 283 283 GLU GLU B . n 
B 1 283 MET 283 284 284 MET MET B . n 
B 1 284 LEU 284 285 285 LEU LEU B . n 
B 1 285 ALA 285 286 286 ALA ALA B . n 
B 1 286 GLY 286 287 287 GLY GLY B . n 
B 1 287 GLY 287 288 288 GLY GLY B . n 
B 1 288 VAL 288 289 289 VAL VAL B . n 
B 1 289 ASP 289 290 290 ASP ASP B . n 
B 1 290 THR 290 291 291 THR THR B . n 
B 1 291 THR 291 292 292 THR THR B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 MET 293 294 294 MET MET B . n 
B 1 294 THR 294 295 295 THR THR B . n 
B 1 295 LEU 295 296 296 LEU LEU B . n 
B 1 296 GLN 296 297 297 GLN GLN B . n 
B 1 297 TRP 297 298 298 TRP TRP B . n 
B 1 298 HIS 298 299 299 HIS HIS B . n 
B 1 299 LEU 299 300 300 LEU LEU B . n 
B 1 300 TYR 300 301 301 TYR TYR B . n 
B 1 301 GLU 301 302 302 GLU GLU B . n 
B 1 302 MET 302 303 303 MET MET B . n 
B 1 303 ALA 303 304 304 ALA ALA B . n 
B 1 304 ARG 304 305 305 ARG ARG B . n 
B 1 305 ASN 305 306 306 ASN ASN B . n 
B 1 306 LEU 306 307 307 LEU LEU B . n 
B 1 307 LYS 307 308 308 LYS LYS B . n 
B 1 308 VAL 308 309 309 VAL VAL B . n 
B 1 309 GLN 309 310 310 GLN GLN B . n 
B 1 310 ASP 310 311 311 ASP ASP B . n 
B 1 311 MET 311 312 312 MET MET B . n 
B 1 312 LEU 312 313 313 LEU LEU B . n 
B 1 313 ARG 313 314 314 ARG ARG B . n 
B 1 314 ALA 314 315 315 ALA ALA B . n 
B 1 315 GLU 315 316 316 GLU GLU B . n 
B 1 316 VAL 316 317 317 VAL VAL B . n 
B 1 317 LEU 317 318 318 LEU LEU B . n 
B 1 318 ALA 318 319 319 ALA ALA B . n 
B 1 319 ALA 319 320 320 ALA ALA B . n 
B 1 320 ARG 320 321 321 ARG ARG B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLN 322 323 323 GLN GLN B . n 
B 1 323 ALA 323 324 324 ALA ALA B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 GLY 325 326 326 GLY GLY B . n 
B 1 326 ASP 326 327 327 ASP ASP B . n 
B 1 327 MET 327 328 328 MET MET B . n 
B 1 328 ALA 328 329 329 ALA ALA B . n 
B 1 329 THR 329 330 330 THR THR B . n 
B 1 330 MET 330 331 331 MET MET B . n 
B 1 331 LEU 331 332 332 LEU LEU B . n 
B 1 332 GLN 332 333 333 GLN GLN B . n 
B 1 333 LEU 333 334 334 LEU LEU B . n 
B 1 334 VAL 334 335 335 VAL VAL B . n 
B 1 335 PRO 335 336 336 PRO PRO B . n 
B 1 336 LEU 336 337 337 LEU LEU B . n 
B 1 337 LEU 337 338 338 LEU LEU B . n 
B 1 338 LYS 338 339 339 LYS LYS B . n 
B 1 339 ALA 339 340 340 ALA ALA B . n 
B 1 340 SER 340 341 341 SER SER B . n 
B 1 341 ILE 341 342 342 ILE ILE B . n 
B 1 342 LYS 342 343 343 LYS LYS B . n 
B 1 343 GLU 343 344 344 GLU GLU B . n 
B 1 344 THR 344 345 345 THR THR B . n 
B 1 345 LEU 345 346 346 LEU LEU B . n 
B 1 346 ARG 346 347 347 ARG ARG B . n 
B 1 347 LEU 347 348 348 LEU LEU B . n 
B 1 348 HIS 348 349 349 HIS HIS B . n 
B 1 349 PRO 349 350 350 PRO PRO B . n 
B 1 350 ILE 350 351 351 ILE ILE B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 VAL 352 353 353 VAL VAL B . n 
B 1 353 THR 353 354 354 THR THR B . n 
B 1 354 LEU 354 355 355 LEU LEU B . n 
B 1 355 GLN 355 356 356 GLN GLN B . n 
B 1 356 ARG 356 357 357 ARG ARG B . n 
B 1 357 TYR 357 358 358 TYR TYR B . n 
B 1 358 LEU 358 359 359 LEU LEU B . n 
B 1 359 VAL 359 360 360 VAL VAL B . n 
B 1 360 ASN 360 361 361 ASN ASN B . n 
B 1 361 ASP 361 362 362 ASP ASP B . n 
B 1 362 LEU 362 363 363 LEU LEU B . n 
B 1 363 VAL 363 364 364 VAL VAL B . n 
B 1 364 LEU 364 365 365 LEU LEU B . n 
B 1 365 ARG 365 366 366 ARG ARG B . n 
B 1 366 ASP 366 367 367 ASP ASP B . n 
B 1 367 TYR 367 368 368 TYR TYR B . n 
B 1 368 MET 368 369 369 MET MET B . n 
B 1 369 ILE 369 370 370 ILE ILE B . n 
B 1 370 PRO 370 371 371 PRO PRO B . n 
B 1 371 ALA 371 372 372 ALA ALA B . n 
B 1 372 LYS 372 373 373 LYS LYS B . n 
B 1 373 THR 373 374 374 THR THR B . n 
B 1 374 LEU 374 375 375 LEU LEU B . n 
B 1 375 VAL 375 376 376 VAL VAL B . n 
B 1 376 GLN 376 377 377 GLN GLN B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 ALA 378 379 379 ALA ALA B . n 
B 1 379 ILE 379 380 380 ILE ILE B . n 
B 1 380 TYR 380 381 381 TYR TYR B . n 
B 1 381 ALA 381 382 382 ALA ALA B . n 
B 1 382 LEU 382 383 383 LEU LEU B . n 
B 1 383 GLY 383 384 384 GLY GLY B . n 
B 1 384 ARG 384 385 385 ARG ARG B . n 
B 1 385 GLU 385 386 386 GLU GLU B . n 
B 1 386 PRO 386 387 387 PRO PRO B . n 
B 1 387 THR 387 388 388 THR THR B . n 
B 1 388 PHE 388 389 389 PHE PHE B . n 
B 1 389 PHE 389 390 390 PHE PHE B . n 
B 1 390 PHE 390 391 391 PHE PHE B . n 
B 1 391 ASP 391 392 392 ASP ASP B . n 
B 1 392 PRO 392 393 393 PRO PRO B . n 
B 1 393 GLU 393 394 394 GLU GLU B . n 
B 1 394 ASN 394 395 395 ASN ASN B . n 
B 1 395 PHE 395 396 396 PHE PHE B . n 
B 1 396 ASP 396 397 397 ASP ASP B . n 
B 1 397 PRO 397 398 398 PRO PRO B . n 
B 1 398 THR 398 399 399 THR THR B . n 
B 1 399 ARG 399 400 400 ARG ARG B . n 
B 1 400 TRP 400 401 401 TRP TRP B . n 
B 1 401 LEU 401 402 402 LEU LEU B . n 
B 1 402 SER 402 403 403 SER SER B . n 
B 1 403 LYS 403 404 404 LYS LYS B . n 
B 1 404 ASP 404 405 405 ASP ASP B . n 
B 1 405 LYS 405 406 406 LYS LYS B . n 
B 1 406 ASN 406 407 407 ASN ASN B . n 
B 1 407 ILE 407 408 408 ILE ILE B . n 
B 1 408 THR 408 409 409 THR THR B . n 
B 1 409 TYR 409 410 410 TYR TYR B . n 
B 1 410 PHE 410 411 411 PHE PHE B . n 
B 1 411 ARG 411 412 412 ARG ARG B . n 
B 1 412 ASN 412 413 413 ASN ASN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 GLY 414 415 415 GLY GLY B . n 
B 1 415 PHE 415 416 416 PHE PHE B . n 
B 1 416 GLY 416 417 417 GLY GLY B . n 
B 1 417 TRP 417 418 418 TRP TRP B . n 
B 1 418 GLY 418 419 419 GLY GLY B . n 
B 1 419 VAL 419 420 420 VAL VAL B . n 
B 1 420 ARG 420 421 421 ARG ARG B . n 
B 1 421 GLN 421 422 422 GLN GLN B . n 
B 1 422 CYS 422 423 423 CYS CYS B . n 
B 1 423 LEU 423 424 424 LEU LEU B . n 
B 1 424 GLY 424 425 425 GLY GLY B . n 
B 1 425 ARG 425 426 426 ARG ARG B . n 
B 1 426 ARG 426 427 427 ARG ARG B . n 
B 1 427 ILE 427 428 428 ILE ILE B . n 
B 1 428 ALA 428 429 429 ALA ALA B . n 
B 1 429 GLU 429 430 430 GLU GLU B . n 
B 1 430 LEU 430 431 431 LEU LEU B . n 
B 1 431 GLU 431 432 432 GLU GLU B . n 
B 1 432 MET 432 433 433 MET MET B . n 
B 1 433 THR 433 434 434 THR THR B . n 
B 1 434 ILE 434 435 435 ILE ILE B . n 
B 1 435 PHE 435 436 436 PHE PHE B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 ILE 437 438 438 ILE ILE B . n 
B 1 438 ASN 438 439 439 ASN ASN B . n 
B 1 439 MET 439 440 440 MET MET B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 GLU 441 442 442 GLU GLU B . n 
B 1 442 ASN 442 443 443 ASN ASN B . n 
B 1 443 PHE 443 444 444 PHE PHE B . n 
B 1 444 ARG 444 445 445 ARG ARG B . n 
B 1 445 VAL 445 446 446 VAL VAL B . n 
B 1 446 GLU 446 447 447 GLU GLU B . n 
B 1 447 ILE 447 448 448 ILE ILE B . n 
B 1 448 GLN 448 449 449 GLN GLN B . n 
B 1 449 HIS 449 450 450 HIS HIS B . n 
B 1 450 LEU 450 451 451 LEU LEU B . n 
B 1 451 SER 451 452 452 SER SER B . n 
B 1 452 ASP 452 453 453 ASP ASP B . n 
B 1 453 VAL 453 454 454 VAL VAL B . n 
B 1 454 GLY 454 455 455 GLY GLY B . n 
B 1 455 THR 455 456 456 THR THR B . n 
B 1 456 THR 456 457 457 THR THR B . n 
B 1 457 PHE 457 458 458 PHE PHE B . n 
B 1 458 ASN 458 459 459 ASN ASN B . n 
B 1 459 LEU 459 460 460 LEU LEU B . n 
B 1 460 ILE 460 461 461 ILE ILE B . n 
B 1 461 LEU 461 462 462 LEU LEU B . n 
B 1 462 MET 462 463 463 MET MET B . n 
B 1 463 PRO 463 464 464 PRO PRO B . n 
B 1 464 GLU 464 465 465 GLU GLU B . n 
B 1 465 LYS 465 466 466 LYS LYS B . n 
B 1 466 PRO 466 467 467 PRO PRO B . n 
B 1 467 ILE 467 468 468 ILE ILE B . n 
B 1 468 SER 468 469 469 SER SER B . n 
B 1 469 PHE 469 470 470 PHE PHE B . n 
B 1 470 THR 470 471 471 THR THR B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 TRP 472 473 473 TRP TRP B . n 
B 1 473 PRO 473 474 474 PRO PRO B . n 
B 1 474 PHE 474 475 475 PHE PHE B . n 
B 1 475 ASN 475 476 ?   ?   ?   B . n 
B 1 476 GLN 476 477 ?   ?   ?   B . n 
B 1 477 GLU 477 478 ?   ?   ?   B . n 
B 1 478 ALA 478 479 ?   ?   ?   B . n 
B 1 479 THR 479 480 ?   ?   ?   B . n 
B 1 480 GLN 480 481 ?   ?   ?   B . n 
B 1 481 GLN 481 482 ?   ?   ?   B . n 
B 1 482 HIS 482 483 ?   ?   ?   B . n 
B 1 483 HIS 483 484 ?   ?   ?   B . n 
B 1 484 HIS 484 485 ?   ?   ?   B . n 
B 1 485 HIS 485 486 ?   ?   ?   B . n 
B 1 486 HIS 486 487 ?   ?   ?   B . n 
B 1 487 HIS 487 488 ?   ?   ?   B . n 
C 2 1   SER 1   2   ?   ?   ?   C . n 
C 2 2   SER 2   3   ?   ?   ?   C . n 
C 2 3   GLU 3   4   ?   ?   ?   C . n 
C 2 4   ASP 4   5   ?   ?   ?   C . n 
C 2 5   LYS 5   6   ?   ?   ?   C . n 
C 2 6   ILE 6   7   ?   ?   ?   C . n 
C 2 7   THR 7   8   ?   ?   ?   C . n 
C 2 8   VAL 8   9   ?   ?   ?   C . n 
C 2 9   HIS 9   10  ?   ?   ?   C . n 
C 2 10  PHE 10  11  ?   ?   ?   C . n 
C 2 11  ILE 11  12  ?   ?   ?   C . n 
C 2 12  ASN 12  13  ?   ?   ?   C . n 
C 2 13  ARG 13  14  ?   ?   ?   C . n 
C 2 14  ASP 14  15  ?   ?   ?   C . n 
C 2 15  GLY 15  16  ?   ?   ?   C . n 
C 2 16  GLU 16  17  ?   ?   ?   C . n 
C 2 17  THR 17  18  ?   ?   ?   C . n 
C 2 18  LEU 18  19  ?   ?   ?   C . n 
C 2 19  THR 19  20  ?   ?   ?   C . n 
C 2 20  THR 20  21  ?   ?   ?   C . n 
C 2 21  LYS 21  22  ?   ?   ?   C . n 
C 2 22  GLY 22  23  ?   ?   ?   C . n 
C 2 23  LYS 23  24  ?   ?   ?   C . n 
C 2 24  VAL 24  25  ?   ?   ?   C . n 
C 2 25  GLY 25  26  ?   ?   ?   C . n 
C 2 26  ASP 26  27  ?   ?   ?   C . n 
C 2 27  SER 27  28  ?   ?   ?   C . n 
C 2 28  LEU 28  29  ?   ?   ?   C . n 
C 2 29  LEU 29  30  ?   ?   ?   C . n 
C 2 30  ASP 30  31  ?   ?   ?   C . n 
C 2 31  VAL 31  32  ?   ?   ?   C . n 
C 2 32  VAL 32  33  ?   ?   ?   C . n 
C 2 33  VAL 33  34  ?   ?   ?   C . n 
C 2 34  GLU 34  35  ?   ?   ?   C . n 
C 2 35  ASN 35  36  ?   ?   ?   C . n 
C 2 36  ASN 36  37  ?   ?   ?   C . n 
C 2 37  LEU 37  38  ?   ?   ?   C . n 
C 2 38  ASP 38  39  ?   ?   ?   C . n 
C 2 39  ILE 39  40  ?   ?   ?   C . n 
C 2 40  ASP 40  41  ?   ?   ?   C . n 
C 2 41  GLY 41  42  ?   ?   ?   C . n 
C 2 42  PHE 42  43  ?   ?   ?   C . n 
C 2 43  GLY 43  44  44  GLY GLY C . n 
C 2 44  ALA 44  45  45  ALA ALA C . n 
C 2 45  CYS 45  46  46  CYS CYS C . n 
C 2 46  GLU 46  47  47  GLU GLU C . n 
C 2 47  GLY 47  48  48  GLY GLY C . n 
C 2 48  THR 48  49  49  THR THR C . n 
C 2 49  LEU 49  50  50  LEU LEU C . n 
C 2 50  ALA 50  51  51  ALA ALA C . n 
C 2 51  CYS 51  52  52  CYS CYS C . n 
C 2 52  SER 52  53  53  SER SER C . n 
C 2 53  THR 53  54  54  THR THR C . n 
C 2 54  CYS 54  55  55  CYS CYS C . n 
C 2 55  HIS 55  56  56  HIS HIS C . n 
C 2 56  LEU 56  57  57  LEU LEU C . n 
C 2 57  ILE 57  58  ?   ?   ?   C . n 
C 2 58  PHE 58  59  ?   ?   ?   C . n 
C 2 59  GLU 59  60  ?   ?   ?   C . n 
C 2 60  ASP 60  61  ?   ?   ?   C . n 
C 2 61  HIS 61  62  ?   ?   ?   C . n 
C 2 62  ILE 62  63  ?   ?   ?   C . n 
C 2 63  TYR 63  64  ?   ?   ?   C . n 
C 2 64  GLU 64  65  ?   ?   ?   C . n 
C 2 65  LYS 65  66  ?   ?   ?   C . n 
C 2 66  LEU 66  67  ?   ?   ?   C . n 
C 2 67  ASP 67  68  ?   ?   ?   C . n 
C 2 68  ALA 68  69  ?   ?   ?   C . n 
C 2 69  ILE 69  70  ?   ?   ?   C . n 
C 2 70  THR 70  71  ?   ?   ?   C . n 
C 2 71  ASP 71  72  72  ASP ASP C . n 
C 2 72  GLU 72  73  73  GLU GLU C . n 
C 2 73  GLU 73  74  74  GLU GLU C . n 
C 2 74  ASN 74  75  75  ASN ASN C . n 
C 2 75  ASP 75  76  76  ASP ASP C . n 
C 2 76  MET 76  77  77  MET MET C . n 
C 2 77  LEU 77  78  78  LEU LEU C . n 
C 2 78  ASP 78  79  79  ASP ASP C . n 
C 2 79  LEU 79  80  80  LEU LEU C . n 
C 2 80  ALA 80  81  ?   ?   ?   C . n 
C 2 81  TYR 81  82  ?   ?   ?   C . n 
C 2 82  GLY 82  83  ?   ?   ?   C . n 
C 2 83  LEU 83  84  ?   ?   ?   C . n 
C 2 84  THR 84  85  ?   ?   ?   C . n 
C 2 85  ASP 85  86  ?   ?   ?   C . n 
C 2 86  ARG 86  87  ?   ?   ?   C . n 
C 2 87  SER 87  88  ?   ?   ?   C . n 
C 2 88  ARG 88  89  89  ARG ARG C . n 
C 2 89  LEU 89  90  90  LEU LEU C . n 
C 2 90  GLY 90  91  91  GLY GLY C . n 
C 2 91  CYS 91  92  92  CYS CYS C . n 
C 2 92  GLN 92  93  ?   ?   ?   C . n 
C 2 93  ILE 93  94  ?   ?   ?   C . n 
C 2 94  CYS 94  95  ?   ?   ?   C . n 
C 2 95  LEU 95  96  ?   ?   ?   C . n 
C 2 96  THR 96  97  ?   ?   ?   C . n 
C 2 97  LYS 97  98  ?   ?   ?   C . n 
C 2 98  SER 98  99  ?   ?   ?   C . n 
C 2 99  MET 99  100 ?   ?   ?   C . n 
C 2 100 ASP 100 101 ?   ?   ?   C . n 
C 2 101 ASN 101 102 ?   ?   ?   C . n 
C 2 102 MET 102 103 ?   ?   ?   C . n 
C 2 103 THR 103 104 ?   ?   ?   C . n 
C 2 104 VAL 104 105 ?   ?   ?   C . n 
C 2 105 ARG 105 106 ?   ?   ?   C . n 
C 2 106 VAL 106 107 ?   ?   ?   C . n 
C 2 107 PRO 107 108 ?   ?   ?   C . n 
C 2 108 GLU 108 109 ?   ?   ?   C . n 
C 2 109 THR 109 110 ?   ?   ?   C . n 
C 2 110 VAL 110 111 ?   ?   ?   C . n 
C 2 111 ALA 111 112 ?   ?   ?   C . n 
C 2 112 ASP 112 113 ?   ?   ?   C . n 
C 2 113 ALA 113 114 ?   ?   ?   C . n 
C 2 114 ARG 114 115 ?   ?   ?   C . n 
C 2 115 GLN 115 116 ?   ?   ?   C . n 
C 2 116 SER 116 117 ?   ?   ?   C . n 
C 2 117 ILE 117 118 ?   ?   ?   C . n 
C 2 118 ASP 118 119 ?   ?   ?   C . n 
C 2 119 VAL 119 120 ?   ?   ?   C . n 
C 2 120 GLY 120 121 ?   ?   ?   C . n 
C 2 121 LYS 121 122 ?   ?   ?   C . n 
C 2 122 THR 122 123 ?   ?   ?   C . n 
C 2 123 SER 123 124 ?   ?   ?   C . n 
D 2 1   SER 1   2   ?   ?   ?   D . n 
D 2 2   SER 2   3   ?   ?   ?   D . n 
D 2 3   GLU 3   4   ?   ?   ?   D . n 
D 2 4   ASP 4   5   ?   ?   ?   D . n 
D 2 5   LYS 5   6   ?   ?   ?   D . n 
D 2 6   ILE 6   7   ?   ?   ?   D . n 
D 2 7   THR 7   8   ?   ?   ?   D . n 
D 2 8   VAL 8   9   ?   ?   ?   D . n 
D 2 9   HIS 9   10  ?   ?   ?   D . n 
D 2 10  PHE 10  11  ?   ?   ?   D . n 
D 2 11  ILE 11  12  ?   ?   ?   D . n 
D 2 12  ASN 12  13  ?   ?   ?   D . n 
D 2 13  ARG 13  14  ?   ?   ?   D . n 
D 2 14  ASP 14  15  ?   ?   ?   D . n 
D 2 15  GLY 15  16  ?   ?   ?   D . n 
D 2 16  GLU 16  17  ?   ?   ?   D . n 
D 2 17  THR 17  18  ?   ?   ?   D . n 
D 2 18  LEU 18  19  ?   ?   ?   D . n 
D 2 19  THR 19  20  ?   ?   ?   D . n 
D 2 20  THR 20  21  ?   ?   ?   D . n 
D 2 21  LYS 21  22  ?   ?   ?   D . n 
D 2 22  GLY 22  23  ?   ?   ?   D . n 
D 2 23  LYS 23  24  ?   ?   ?   D . n 
D 2 24  VAL 24  25  ?   ?   ?   D . n 
D 2 25  GLY 25  26  ?   ?   ?   D . n 
D 2 26  ASP 26  27  ?   ?   ?   D . n 
D 2 27  SER 27  28  ?   ?   ?   D . n 
D 2 28  LEU 28  29  ?   ?   ?   D . n 
D 2 29  LEU 29  30  ?   ?   ?   D . n 
D 2 30  ASP 30  31  ?   ?   ?   D . n 
D 2 31  VAL 31  32  ?   ?   ?   D . n 
D 2 32  VAL 32  33  ?   ?   ?   D . n 
D 2 33  VAL 33  34  ?   ?   ?   D . n 
D 2 34  GLU 34  35  ?   ?   ?   D . n 
D 2 35  ASN 35  36  ?   ?   ?   D . n 
D 2 36  ASN 36  37  ?   ?   ?   D . n 
D 2 37  LEU 37  38  ?   ?   ?   D . n 
D 2 38  ASP 38  39  ?   ?   ?   D . n 
D 2 39  ILE 39  40  ?   ?   ?   D . n 
D 2 40  ASP 40  41  ?   ?   ?   D . n 
D 2 41  GLY 41  42  ?   ?   ?   D . n 
D 2 42  PHE 42  43  ?   ?   ?   D . n 
D 2 43  GLY 43  44  44  GLY GLY D . n 
D 2 44  ALA 44  45  45  ALA ALA D . n 
D 2 45  CYS 45  46  46  CYS CYS D . n 
D 2 46  GLU 46  47  47  GLU GLU D . n 
D 2 47  GLY 47  48  48  GLY GLY D . n 
D 2 48  THR 48  49  49  THR THR D . n 
D 2 49  LEU 49  50  50  LEU LEU D . n 
D 2 50  ALA 50  51  51  ALA ALA D . n 
D 2 51  CYS 51  52  52  CYS CYS D . n 
D 2 52  SER 52  53  53  SER SER D . n 
D 2 53  THR 53  54  54  THR THR D . n 
D 2 54  CYS 54  55  55  CYS CYS D . n 
D 2 55  HIS 55  56  56  HIS HIS D . n 
D 2 56  LEU 56  57  57  LEU LEU D . n 
D 2 57  ILE 57  58  ?   ?   ?   D . n 
D 2 58  PHE 58  59  ?   ?   ?   D . n 
D 2 59  GLU 59  60  ?   ?   ?   D . n 
D 2 60  ASP 60  61  ?   ?   ?   D . n 
D 2 61  HIS 61  62  ?   ?   ?   D . n 
D 2 62  ILE 62  63  ?   ?   ?   D . n 
D 2 63  TYR 63  64  ?   ?   ?   D . n 
D 2 64  GLU 64  65  ?   ?   ?   D . n 
D 2 65  LYS 65  66  ?   ?   ?   D . n 
D 2 66  LEU 66  67  ?   ?   ?   D . n 
D 2 67  ASP 67  68  ?   ?   ?   D . n 
D 2 68  ALA 68  69  ?   ?   ?   D . n 
D 2 69  ILE 69  70  ?   ?   ?   D . n 
D 2 70  THR 70  71  ?   ?   ?   D . n 
D 2 71  ASP 71  72  72  ASP ASP D . n 
D 2 72  GLU 72  73  73  GLU GLU D . n 
D 2 73  GLU 73  74  74  GLU GLU D . n 
D 2 74  ASN 74  75  75  ASN ASN D . n 
D 2 75  ASP 75  76  76  ASP ASP D . n 
D 2 76  MET 76  77  77  MET MET D . n 
D 2 77  LEU 77  78  78  LEU LEU D . n 
D 2 78  ASP 78  79  79  ASP ASP D . n 
D 2 79  LEU 79  80  80  LEU LEU D . n 
D 2 80  ALA 80  81  ?   ?   ?   D . n 
D 2 81  TYR 81  82  ?   ?   ?   D . n 
D 2 82  GLY 82  83  ?   ?   ?   D . n 
D 2 83  LEU 83  84  ?   ?   ?   D . n 
D 2 84  THR 84  85  ?   ?   ?   D . n 
D 2 85  ASP 85  86  ?   ?   ?   D . n 
D 2 86  ARG 86  87  ?   ?   ?   D . n 
D 2 87  SER 87  88  ?   ?   ?   D . n 
D 2 88  ARG 88  89  89  ARG ARG D . n 
D 2 89  LEU 89  90  90  LEU LEU D . n 
D 2 90  GLY 90  91  91  GLY GLY D . n 
D 2 91  CYS 91  92  92  CYS CYS D . n 
D 2 92  GLN 92  93  ?   ?   ?   D . n 
D 2 93  ILE 93  94  ?   ?   ?   D . n 
D 2 94  CYS 94  95  ?   ?   ?   D . n 
D 2 95  LEU 95  96  ?   ?   ?   D . n 
D 2 96  THR 96  97  ?   ?   ?   D . n 
D 2 97  LYS 97  98  ?   ?   ?   D . n 
D 2 98  SER 98  99  ?   ?   ?   D . n 
D 2 99  MET 99  100 ?   ?   ?   D . n 
D 2 100 ASP 100 101 ?   ?   ?   D . n 
D 2 101 ASN 101 102 ?   ?   ?   D . n 
D 2 102 MET 102 103 ?   ?   ?   D . n 
D 2 103 THR 103 104 ?   ?   ?   D . n 
D 2 104 VAL 104 105 ?   ?   ?   D . n 
D 2 105 ARG 105 106 ?   ?   ?   D . n 
D 2 106 VAL 106 107 ?   ?   ?   D . n 
D 2 107 PRO 107 108 ?   ?   ?   D . n 
D 2 108 GLU 108 109 ?   ?   ?   D . n 
D 2 109 THR 109 110 ?   ?   ?   D . n 
D 2 110 VAL 110 111 ?   ?   ?   D . n 
D 2 111 ALA 111 112 ?   ?   ?   D . n 
D 2 112 ASP 112 113 ?   ?   ?   D . n 
D 2 113 ALA 113 114 ?   ?   ?   D . n 
D 2 114 ARG 114 115 ?   ?   ?   D . n 
D 2 115 GLN 115 116 ?   ?   ?   D . n 
D 2 116 SER 116 117 ?   ?   ?   D . n 
D 2 117 ILE 117 118 ?   ?   ?   D . n 
D 2 118 ASP 118 119 ?   ?   ?   D . n 
D 2 119 VAL 119 120 ?   ?   ?   D . n 
D 2 120 GLY 120 121 ?   ?   ?   D . n 
D 2 121 LYS 121 122 ?   ?   ?   D . n 
D 2 122 THR 122 123 ?   ?   ?   D . n 
D 2 123 SER 123 124 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HEM 1   601 601 HEM HEM A . 
F 4 HC9 1   602 602 HC9 HC9 A . 
G 3 HEM 1   601 601 HEM HEM B . 
H 4 HC9 1   602 602 HC9 HC9 B . 
I 5 FES 1   150 150 FES FES C . 
J 5 FES 1   151 151 FES FES D . 
K 6 HOH 1   1   1   HOH HOH A . 
K 6 HOH 2   489 8   HOH HOH A . 
K 6 HOH 3   490 10  HOH HOH A . 
K 6 HOH 4   491 11  HOH HOH A . 
K 6 HOH 5   492 12  HOH HOH A . 
K 6 HOH 6   493 13  HOH HOH A . 
K 6 HOH 7   494 15  HOH HOH A . 
K 6 HOH 8   495 18  HOH HOH A . 
K 6 HOH 9   496 19  HOH HOH A . 
K 6 HOH 10  497 20  HOH HOH A . 
K 6 HOH 11  498 24  HOH HOH A . 
K 6 HOH 12  499 25  HOH HOH A . 
K 6 HOH 13  500 26  HOH HOH A . 
K 6 HOH 14  501 29  HOH HOH A . 
K 6 HOH 15  502 30  HOH HOH A . 
K 6 HOH 16  503 31  HOH HOH A . 
K 6 HOH 17  504 33  HOH HOH A . 
K 6 HOH 18  505 34  HOH HOH A . 
K 6 HOH 19  506 37  HOH HOH A . 
K 6 HOH 20  507 38  HOH HOH A . 
K 6 HOH 21  508 43  HOH HOH A . 
K 6 HOH 22  515 515 HOH HOH A . 
K 6 HOH 23  516 516 HOH HOH A . 
K 6 HOH 24  517 517 HOH HOH A . 
K 6 HOH 25  518 518 HOH HOH A . 
K 6 HOH 26  519 519 HOH HOH A . 
K 6 HOH 27  520 520 HOH HOH A . 
K 6 HOH 28  521 521 HOH HOH A . 
K 6 HOH 29  522 522 HOH HOH A . 
K 6 HOH 30  523 523 HOH HOH A . 
K 6 HOH 31  524 524 HOH HOH A . 
K 6 HOH 32  525 525 HOH HOH A . 
K 6 HOH 33  526 526 HOH HOH A . 
K 6 HOH 34  527 527 HOH HOH A . 
K 6 HOH 35  528 528 HOH HOH A . 
K 6 HOH 36  529 529 HOH HOH A . 
K 6 HOH 37  530 530 HOH HOH A . 
K 6 HOH 38  531 531 HOH HOH A . 
K 6 HOH 39  532 532 HOH HOH A . 
K 6 HOH 40  533 533 HOH HOH A . 
K 6 HOH 41  534 534 HOH HOH A . 
K 6 HOH 42  535 535 HOH HOH A . 
K 6 HOH 43  536 536 HOH HOH A . 
K 6 HOH 44  537 537 HOH HOH A . 
K 6 HOH 45  538 538 HOH HOH A . 
K 6 HOH 46  539 539 HOH HOH A . 
K 6 HOH 47  540 540 HOH HOH A . 
K 6 HOH 48  541 541 HOH HOH A . 
K 6 HOH 49  542 542 HOH HOH A . 
K 6 HOH 50  543 543 HOH HOH A . 
K 6 HOH 51  544 544 HOH HOH A . 
K 6 HOH 52  545 545 HOH HOH A . 
K 6 HOH 53  546 546 HOH HOH A . 
K 6 HOH 54  547 547 HOH HOH A . 
K 6 HOH 55  548 548 HOH HOH A . 
K 6 HOH 56  549 549 HOH HOH A . 
K 6 HOH 57  550 550 HOH HOH A . 
K 6 HOH 58  551 551 HOH HOH A . 
K 6 HOH 59  552 552 HOH HOH A . 
K 6 HOH 60  553 553 HOH HOH A . 
K 6 HOH 61  554 554 HOH HOH A . 
K 6 HOH 62  555 555 HOH HOH A . 
K 6 HOH 63  556 556 HOH HOH A . 
K 6 HOH 64  557 557 HOH HOH A . 
K 6 HOH 65  558 558 HOH HOH A . 
K 6 HOH 66  559 559 HOH HOH A . 
K 6 HOH 67  560 560 HOH HOH A . 
K 6 HOH 68  561 561 HOH HOH A . 
K 6 HOH 69  562 562 HOH HOH A . 
K 6 HOH 70  563 563 HOH HOH A . 
K 6 HOH 71  564 564 HOH HOH A . 
K 6 HOH 72  565 565 HOH HOH A . 
K 6 HOH 73  566 566 HOH HOH A . 
K 6 HOH 74  567 567 HOH HOH A . 
K 6 HOH 75  568 568 HOH HOH A . 
K 6 HOH 76  569 569 HOH HOH A . 
K 6 HOH 77  570 570 HOH HOH A . 
K 6 HOH 78  571 571 HOH HOH A . 
K 6 HOH 79  572 572 HOH HOH A . 
K 6 HOH 80  573 573 HOH HOH A . 
K 6 HOH 81  574 574 HOH HOH A . 
K 6 HOH 82  575 575 HOH HOH A . 
K 6 HOH 83  576 576 HOH HOH A . 
K 6 HOH 84  577 577 HOH HOH A . 
K 6 HOH 85  578 578 HOH HOH A . 
K 6 HOH 86  579 579 HOH HOH A . 
K 6 HOH 87  580 580 HOH HOH A . 
K 6 HOH 88  581 581 HOH HOH A . 
K 6 HOH 89  582 582 HOH HOH A . 
K 6 HOH 90  583 583 HOH HOH A . 
K 6 HOH 91  584 584 HOH HOH A . 
K 6 HOH 92  585 585 HOH HOH A . 
K 6 HOH 93  586 586 HOH HOH A . 
K 6 HOH 94  587 587 HOH HOH A . 
K 6 HOH 95  588 588 HOH HOH A . 
K 6 HOH 96  589 589 HOH HOH A . 
K 6 HOH 97  590 590 HOH HOH A . 
K 6 HOH 98  591 591 HOH HOH A . 
K 6 HOH 99  592 592 HOH HOH A . 
K 6 HOH 100 593 593 HOH HOH A . 
K 6 HOH 101 594 594 HOH HOH A . 
K 6 HOH 102 595 595 HOH HOH A . 
K 6 HOH 103 596 596 HOH HOH A . 
K 6 HOH 104 597 597 HOH HOH A . 
K 6 HOH 105 598 598 HOH HOH A . 
K 6 HOH 106 599 599 HOH HOH A . 
K 6 HOH 107 600 600 HOH HOH A . 
K 6 HOH 108 603 603 HOH HOH A . 
K 6 HOH 109 604 604 HOH HOH A . 
K 6 HOH 110 605 605 HOH HOH A . 
K 6 HOH 111 606 606 HOH HOH A . 
K 6 HOH 112 607 607 HOH HOH A . 
K 6 HOH 113 608 608 HOH HOH A . 
K 6 HOH 114 609 609 HOH HOH A . 
K 6 HOH 115 610 610 HOH HOH A . 
K 6 HOH 116 611 611 HOH HOH A . 
K 6 HOH 117 612 612 HOH HOH A . 
K 6 HOH 118 613 613 HOH HOH A . 
K 6 HOH 119 614 614 HOH HOH A . 
K 6 HOH 120 615 615 HOH HOH A . 
K 6 HOH 121 616 616 HOH HOH A . 
K 6 HOH 122 617 617 HOH HOH A . 
K 6 HOH 123 618 618 HOH HOH A . 
K 6 HOH 124 619 619 HOH HOH A . 
K 6 HOH 125 620 620 HOH HOH A . 
K 6 HOH 126 621 621 HOH HOH A . 
K 6 HOH 127 622 622 HOH HOH A . 
K 6 HOH 128 623 623 HOH HOH A . 
K 6 HOH 129 624 624 HOH HOH A . 
K 6 HOH 130 625 625 HOH HOH A . 
K 6 HOH 131 626 626 HOH HOH A . 
K 6 HOH 132 627 627 HOH HOH A . 
K 6 HOH 133 628 628 HOH HOH A . 
K 6 HOH 134 629 629 HOH HOH A . 
K 6 HOH 135 630 630 HOH HOH A . 
K 6 HOH 136 631 631 HOH HOH A . 
K 6 HOH 137 632 632 HOH HOH A . 
K 6 HOH 138 633 633 HOH HOH A . 
K 6 HOH 139 634 634 HOH HOH A . 
K 6 HOH 140 635 635 HOH HOH A . 
K 6 HOH 141 636 636 HOH HOH A . 
K 6 HOH 142 637 637 HOH HOH A . 
K 6 HOH 143 638 638 HOH HOH A . 
K 6 HOH 144 639 639 HOH HOH A . 
K 6 HOH 145 640 640 HOH HOH A . 
K 6 HOH 146 641 641 HOH HOH A . 
K 6 HOH 147 642 642 HOH HOH A . 
K 6 HOH 148 643 643 HOH HOH A . 
K 6 HOH 149 644 644 HOH HOH A . 
K 6 HOH 150 645 645 HOH HOH A . 
K 6 HOH 151 646 646 HOH HOH A . 
K 6 HOH 152 647 647 HOH HOH A . 
K 6 HOH 153 648 648 HOH HOH A . 
K 6 HOH 154 649 649 HOH HOH A . 
K 6 HOH 155 650 650 HOH HOH A . 
K 6 HOH 156 651 651 HOH HOH A . 
K 6 HOH 157 652 652 HOH HOH A . 
K 6 HOH 158 653 653 HOH HOH A . 
K 6 HOH 159 654 654 HOH HOH A . 
K 6 HOH 160 655 655 HOH HOH A . 
K 6 HOH 161 657 657 HOH HOH A . 
K 6 HOH 162 658 658 HOH HOH A . 
K 6 HOH 163 659 659 HOH HOH A . 
K 6 HOH 164 660 660 HOH HOH A . 
K 6 HOH 165 661 661 HOH HOH A . 
K 6 HOH 166 662 662 HOH HOH A . 
K 6 HOH 167 663 663 HOH HOH A . 
K 6 HOH 168 664 664 HOH HOH A . 
K 6 HOH 169 665 665 HOH HOH A . 
K 6 HOH 170 666 666 HOH HOH A . 
K 6 HOH 171 667 667 HOH HOH A . 
K 6 HOH 172 668 668 HOH HOH A . 
K 6 HOH 173 669 669 HOH HOH A . 
K 6 HOH 174 670 670 HOH HOH A . 
K 6 HOH 175 671 671 HOH HOH A . 
K 6 HOH 176 672 672 HOH HOH A . 
K 6 HOH 177 673 673 HOH HOH A . 
K 6 HOH 178 674 674 HOH HOH A . 
K 6 HOH 179 675 675 HOH HOH A . 
K 6 HOH 180 676 676 HOH HOH A . 
K 6 HOH 181 677 677 HOH HOH A . 
K 6 HOH 182 678 678 HOH HOH A . 
K 6 HOH 183 679 679 HOH HOH A . 
K 6 HOH 184 680 680 HOH HOH A . 
K 6 HOH 185 681 681 HOH HOH A . 
K 6 HOH 186 682 682 HOH HOH A . 
K 6 HOH 187 683 683 HOH HOH A . 
K 6 HOH 188 684 684 HOH HOH A . 
K 6 HOH 189 685 685 HOH HOH A . 
K 6 HOH 190 686 686 HOH HOH A . 
K 6 HOH 191 687 687 HOH HOH A . 
K 6 HOH 192 688 688 HOH HOH A . 
K 6 HOH 193 689 689 HOH HOH A . 
K 6 HOH 194 690 690 HOH HOH A . 
K 6 HOH 195 691 691 HOH HOH A . 
K 6 HOH 196 692 692 HOH HOH A . 
K 6 HOH 197 693 693 HOH HOH A . 
K 6 HOH 198 694 694 HOH HOH A . 
K 6 HOH 199 695 695 HOH HOH A . 
K 6 HOH 200 696 696 HOH HOH A . 
K 6 HOH 201 697 697 HOH HOH A . 
K 6 HOH 202 698 698 HOH HOH A . 
K 6 HOH 203 699 699 HOH HOH A . 
K 6 HOH 204 700 700 HOH HOH A . 
K 6 HOH 205 701 701 HOH HOH A . 
K 6 HOH 206 702 702 HOH HOH A . 
K 6 HOH 207 703 703 HOH HOH A . 
K 6 HOH 208 704 704 HOH HOH A . 
K 6 HOH 209 705 705 HOH HOH A . 
K 6 HOH 210 706 706 HOH HOH A . 
K 6 HOH 211 707 707 HOH HOH A . 
K 6 HOH 212 708 708 HOH HOH A . 
K 6 HOH 213 709 709 HOH HOH A . 
K 6 HOH 214 710 710 HOH HOH A . 
K 6 HOH 215 711 711 HOH HOH A . 
K 6 HOH 216 712 712 HOH HOH A . 
K 6 HOH 217 713 713 HOH HOH A . 
K 6 HOH 218 714 714 HOH HOH A . 
K 6 HOH 219 715 715 HOH HOH A . 
K 6 HOH 220 716 716 HOH HOH A . 
K 6 HOH 221 717 717 HOH HOH A . 
K 6 HOH 222 718 718 HOH HOH A . 
K 6 HOH 223 719 719 HOH HOH A . 
K 6 HOH 224 720 720 HOH HOH A . 
K 6 HOH 225 721 721 HOH HOH A . 
K 6 HOH 226 722 722 HOH HOH A . 
K 6 HOH 227 723 723 HOH HOH A . 
K 6 HOH 228 724 724 HOH HOH A . 
K 6 HOH 229 725 725 HOH HOH A . 
K 6 HOH 230 726 726 HOH HOH A . 
K 6 HOH 231 727 727 HOH HOH A . 
K 6 HOH 232 728 728 HOH HOH A . 
L 6 HOH 1   489 2   HOH HOH B . 
L 6 HOH 2   490 3   HOH HOH B . 
L 6 HOH 3   491 4   HOH HOH B . 
L 6 HOH 4   492 5   HOH HOH B . 
L 6 HOH 5   493 6   HOH HOH B . 
L 6 HOH 6   494 7   HOH HOH B . 
L 6 HOH 7   495 9   HOH HOH B . 
L 6 HOH 8   496 14  HOH HOH B . 
L 6 HOH 9   497 16  HOH HOH B . 
L 6 HOH 10  498 17  HOH HOH B . 
L 6 HOH 11  499 21  HOH HOH B . 
L 6 HOH 12  500 22  HOH HOH B . 
L 6 HOH 13  501 23  HOH HOH B . 
L 6 HOH 14  502 27  HOH HOH B . 
L 6 HOH 15  503 28  HOH HOH B . 
L 6 HOH 16  504 32  HOH HOH B . 
L 6 HOH 17  505 35  HOH HOH B . 
L 6 HOH 18  506 36  HOH HOH B . 
L 6 HOH 19  507 39  HOH HOH B . 
L 6 HOH 20  508 40  HOH HOH B . 
L 6 HOH 21  509 41  HOH HOH B . 
L 6 HOH 22  510 42  HOH HOH B . 
L 6 HOH 23  515 515 HOH HOH B . 
L 6 HOH 24  516 516 HOH HOH B . 
L 6 HOH 25  517 517 HOH HOH B . 
L 6 HOH 26  518 518 HOH HOH B . 
L 6 HOH 27  519 519 HOH HOH B . 
L 6 HOH 28  520 520 HOH HOH B . 
L 6 HOH 29  521 521 HOH HOH B . 
L 6 HOH 30  522 522 HOH HOH B . 
L 6 HOH 31  523 523 HOH HOH B . 
L 6 HOH 32  524 524 HOH HOH B . 
L 6 HOH 33  525 525 HOH HOH B . 
L 6 HOH 34  526 526 HOH HOH B . 
L 6 HOH 35  527 527 HOH HOH B . 
L 6 HOH 36  528 528 HOH HOH B . 
L 6 HOH 37  529 529 HOH HOH B . 
L 6 HOH 38  530 530 HOH HOH B . 
L 6 HOH 39  531 531 HOH HOH B . 
L 6 HOH 40  532 532 HOH HOH B . 
L 6 HOH 41  533 533 HOH HOH B . 
L 6 HOH 42  534 534 HOH HOH B . 
L 6 HOH 43  535 535 HOH HOH B . 
L 6 HOH 44  536 536 HOH HOH B . 
L 6 HOH 45  537 537 HOH HOH B . 
L 6 HOH 46  538 538 HOH HOH B . 
L 6 HOH 47  539 539 HOH HOH B . 
L 6 HOH 48  540 540 HOH HOH B . 
L 6 HOH 49  541 541 HOH HOH B . 
L 6 HOH 50  542 542 HOH HOH B . 
L 6 HOH 51  543 543 HOH HOH B . 
L 6 HOH 52  544 544 HOH HOH B . 
L 6 HOH 53  545 545 HOH HOH B . 
L 6 HOH 54  546 546 HOH HOH B . 
L 6 HOH 55  547 547 HOH HOH B . 
L 6 HOH 56  548 548 HOH HOH B . 
L 6 HOH 57  549 549 HOH HOH B . 
L 6 HOH 58  550 550 HOH HOH B . 
L 6 HOH 59  551 551 HOH HOH B . 
L 6 HOH 60  552 552 HOH HOH B . 
L 6 HOH 61  553 553 HOH HOH B . 
L 6 HOH 62  554 554 HOH HOH B . 
L 6 HOH 63  555 555 HOH HOH B . 
L 6 HOH 64  556 556 HOH HOH B . 
L 6 HOH 65  557 557 HOH HOH B . 
L 6 HOH 66  558 558 HOH HOH B . 
L 6 HOH 67  559 559 HOH HOH B . 
L 6 HOH 68  560 560 HOH HOH B . 
L 6 HOH 69  561 561 HOH HOH B . 
L 6 HOH 70  562 562 HOH HOH B . 
L 6 HOH 71  563 563 HOH HOH B . 
L 6 HOH 72  564 564 HOH HOH B . 
L 6 HOH 73  565 565 HOH HOH B . 
L 6 HOH 74  566 566 HOH HOH B . 
L 6 HOH 75  567 567 HOH HOH B . 
L 6 HOH 76  568 568 HOH HOH B . 
L 6 HOH 77  569 569 HOH HOH B . 
L 6 HOH 78  570 570 HOH HOH B . 
L 6 HOH 79  571 571 HOH HOH B . 
L 6 HOH 80  572 572 HOH HOH B . 
L 6 HOH 81  573 573 HOH HOH B . 
L 6 HOH 82  574 574 HOH HOH B . 
L 6 HOH 83  575 575 HOH HOH B . 
L 6 HOH 84  576 576 HOH HOH B . 
L 6 HOH 85  577 577 HOH HOH B . 
L 6 HOH 86  578 578 HOH HOH B . 
L 6 HOH 87  579 579 HOH HOH B . 
L 6 HOH 88  580 580 HOH HOH B . 
L 6 HOH 89  581 581 HOH HOH B . 
L 6 HOH 90  582 582 HOH HOH B . 
L 6 HOH 91  583 583 HOH HOH B . 
L 6 HOH 92  584 584 HOH HOH B . 
L 6 HOH 93  585 585 HOH HOH B . 
L 6 HOH 94  586 586 HOH HOH B . 
L 6 HOH 95  587 587 HOH HOH B . 
L 6 HOH 96  588 588 HOH HOH B . 
L 6 HOH 97  589 589 HOH HOH B . 
L 6 HOH 98  590 590 HOH HOH B . 
L 6 HOH 99  591 591 HOH HOH B . 
L 6 HOH 100 592 592 HOH HOH B . 
L 6 HOH 101 593 593 HOH HOH B . 
L 6 HOH 102 594 594 HOH HOH B . 
L 6 HOH 103 595 595 HOH HOH B . 
L 6 HOH 104 596 596 HOH HOH B . 
L 6 HOH 105 597 597 HOH HOH B . 
L 6 HOH 106 598 598 HOH HOH B . 
L 6 HOH 107 599 599 HOH HOH B . 
L 6 HOH 108 600 600 HOH HOH B . 
L 6 HOH 109 603 603 HOH HOH B . 
L 6 HOH 110 604 604 HOH HOH B . 
L 6 HOH 111 605 605 HOH HOH B . 
L 6 HOH 112 606 606 HOH HOH B . 
L 6 HOH 113 607 607 HOH HOH B . 
L 6 HOH 114 608 608 HOH HOH B . 
L 6 HOH 115 609 609 HOH HOH B . 
L 6 HOH 116 610 610 HOH HOH B . 
L 6 HOH 117 611 611 HOH HOH B . 
L 6 HOH 118 612 612 HOH HOH B . 
L 6 HOH 119 613 613 HOH HOH B . 
L 6 HOH 120 614 614 HOH HOH B . 
L 6 HOH 121 615 615 HOH HOH B . 
L 6 HOH 122 616 616 HOH HOH B . 
L 6 HOH 123 617 617 HOH HOH B . 
L 6 HOH 124 618 618 HOH HOH B . 
L 6 HOH 125 619 619 HOH HOH B . 
L 6 HOH 126 620 620 HOH HOH B . 
L 6 HOH 127 621 621 HOH HOH B . 
L 6 HOH 128 622 622 HOH HOH B . 
L 6 HOH 129 623 623 HOH HOH B . 
L 6 HOH 130 624 624 HOH HOH B . 
L 6 HOH 131 625 625 HOH HOH B . 
L 6 HOH 132 626 626 HOH HOH B . 
L 6 HOH 133 627 627 HOH HOH B . 
L 6 HOH 134 628 628 HOH HOH B . 
L 6 HOH 135 629 629 HOH HOH B . 
L 6 HOH 136 630 630 HOH HOH B . 
L 6 HOH 137 631 631 HOH HOH B . 
L 6 HOH 138 632 632 HOH HOH B . 
L 6 HOH 139 633 633 HOH HOH B . 
L 6 HOH 140 634 634 HOH HOH B . 
L 6 HOH 141 635 635 HOH HOH B . 
L 6 HOH 142 636 636 HOH HOH B . 
L 6 HOH 143 637 637 HOH HOH B . 
L 6 HOH 144 638 638 HOH HOH B . 
L 6 HOH 145 639 639 HOH HOH B . 
L 6 HOH 146 640 640 HOH HOH B . 
L 6 HOH 147 641 641 HOH HOH B . 
L 6 HOH 148 642 642 HOH HOH B . 
L 6 HOH 149 643 643 HOH HOH B . 
L 6 HOH 150 644 644 HOH HOH B . 
L 6 HOH 151 645 645 HOH HOH B . 
L 6 HOH 152 646 646 HOH HOH B . 
L 6 HOH 153 647 647 HOH HOH B . 
L 6 HOH 154 648 648 HOH HOH B . 
L 6 HOH 155 649 649 HOH HOH B . 
L 6 HOH 156 650 650 HOH HOH B . 
L 6 HOH 157 651 651 HOH HOH B . 
L 6 HOH 158 652 652 HOH HOH B . 
L 6 HOH 159 653 653 HOH HOH B . 
L 6 HOH 160 654 654 HOH HOH B . 
L 6 HOH 161 655 655 HOH HOH B . 
L 6 HOH 162 656 656 HOH HOH B . 
L 6 HOH 163 657 657 HOH HOH B . 
L 6 HOH 164 658 658 HOH HOH B . 
L 6 HOH 165 659 659 HOH HOH B . 
L 6 HOH 166 660 660 HOH HOH B . 
L 6 HOH 167 661 661 HOH HOH B . 
L 6 HOH 168 662 662 HOH HOH B . 
L 6 HOH 169 663 663 HOH HOH B . 
L 6 HOH 170 665 665 HOH HOH B . 
L 6 HOH 171 666 666 HOH HOH B . 
L 6 HOH 172 667 667 HOH HOH B . 
L 6 HOH 173 668 668 HOH HOH B . 
L 6 HOH 174 669 669 HOH HOH B . 
L 6 HOH 175 670 670 HOH HOH B . 
L 6 HOH 176 671 671 HOH HOH B . 
L 6 HOH 177 672 672 HOH HOH B . 
L 6 HOH 178 673 673 HOH HOH B . 
L 6 HOH 179 674 674 HOH HOH B . 
L 6 HOH 180 675 675 HOH HOH B . 
L 6 HOH 181 676 676 HOH HOH B . 
L 6 HOH 182 677 677 HOH HOH B . 
L 6 HOH 183 678 678 HOH HOH B . 
L 6 HOH 184 679 679 HOH HOH B . 
L 6 HOH 185 680 680 HOH HOH B . 
L 6 HOH 186 681 681 HOH HOH B . 
L 6 HOH 187 682 682 HOH HOH B . 
L 6 HOH 188 683 683 HOH HOH B . 
L 6 HOH 189 684 684 HOH HOH B . 
L 6 HOH 190 685 685 HOH HOH B . 
L 6 HOH 191 686 686 HOH HOH B . 
L 6 HOH 192 687 687 HOH HOH B . 
L 6 HOH 193 689 689 HOH HOH B . 
L 6 HOH 194 690 690 HOH HOH B . 
L 6 HOH 195 691 691 HOH HOH B . 
L 6 HOH 196 692 692 HOH HOH B . 
L 6 HOH 197 693 693 HOH HOH B . 
L 6 HOH 198 694 694 HOH HOH B . 
L 6 HOH 199 695 695 HOH HOH B . 
L 6 HOH 200 696 696 HOH HOH B . 
L 6 HOH 201 697 697 HOH HOH B . 
L 6 HOH 202 698 698 HOH HOH B . 
L 6 HOH 203 699 699 HOH HOH B . 
L 6 HOH 204 700 700 HOH HOH B . 
L 6 HOH 205 701 701 HOH HOH B . 
L 6 HOH 206 702 702 HOH HOH B . 
L 6 HOH 207 703 703 HOH HOH B . 
L 6 HOH 208 704 704 HOH HOH B . 
L 6 HOH 209 705 705 HOH HOH B . 
L 6 HOH 210 706 706 HOH HOH B . 
L 6 HOH 211 707 707 HOH HOH B . 
L 6 HOH 212 708 708 HOH HOH B . 
L 6 HOH 213 709 709 HOH HOH B . 
L 6 HOH 214 710 710 HOH HOH B . 
L 6 HOH 215 711 711 HOH HOH B . 
L 6 HOH 216 712 712 HOH HOH B . 
L 6 HOH 217 713 713 HOH HOH B . 
L 6 HOH 218 714 714 HOH HOH B . 
L 6 HOH 219 715 715 HOH HOH B . 
L 6 HOH 220 716 716 HOH HOH B . 
L 6 HOH 221 717 717 HOH HOH B . 
L 6 HOH 222 718 718 HOH HOH B . 
L 6 HOH 223 719 719 HOH HOH B . 
L 6 HOH 224 720 720 HOH HOH B . 
L 6 HOH 225 721 721 HOH HOH B . 
L 6 HOH 226 722 722 HOH HOH B . 
L 6 HOH 227 723 723 HOH HOH B . 
L 6 HOH 228 724 724 HOH HOH B . 
L 6 HOH 229 725 725 HOH HOH B . 
L 6 HOH 230 726 726 HOH HOH B . 
L 6 HOH 231 727 727 HOH HOH B . 
L 6 HOH 232 728 728 HOH HOH B . 
L 6 HOH 233 729 729 HOH HOH B . 
L 6 HOH 234 730 730 HOH HOH B . 
L 6 HOH 235 731 731 HOH HOH B . 
L 6 HOH 236 732 732 HOH HOH B . 
L 6 HOH 237 733 733 HOH HOH B . 
L 6 HOH 238 734 734 HOH HOH B . 
L 6 HOH 239 735 735 HOH HOH B . 
L 6 HOH 240 736 736 HOH HOH B . 
L 6 HOH 241 737 737 HOH HOH B . 
L 6 HOH 242 738 738 HOH HOH B . 
L 6 HOH 243 739 739 HOH HOH B . 
L 6 HOH 244 740 740 HOH HOH B . 
L 6 HOH 245 741 741 HOH HOH B . 
L 6 HOH 246 742 742 HOH HOH B . 
L 6 HOH 247 743 743 HOH HOH B . 
L 6 HOH 248 744 744 HOH HOH B . 
L 6 HOH 249 745 745 HOH HOH B . 
L 6 HOH 250 746 746 HOH HOH B . 
L 6 HOH 251 747 747 HOH HOH B . 
L 6 HOH 252 748 748 HOH HOH B . 
M 6 HOH 1   280 280 HOH HOH C . 
N 6 HOH 1   327 327 HOH HOH D . 
N 6 HOH 2   358 358 HOH HOH D . 
N 6 HOH 3   361 361 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,I,K,M 
2 1 B,D,G,H,J,L,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? D CYS 45  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S1 ? J FES .  ? D FES 151 ? 1_555 123.0 ? 
2  SG ? D CYS 45  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 114.5 ? 
3  S1 ? J FES .   ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 90.5  ? 
4  SG ? D CYS 45  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 51 ? D CYS 52  ? 1_555 108.7 ? 
5  S1 ? J FES .   ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 51 ? D CYS 52  ? 1_555 108.6 ? 
6  S2 ? J FES .   ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 51 ? D CYS 52  ? 1_555 110.3 ? 
7  SG ? D CYS 54  ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S1 ? J FES .  ? D FES 151 ? 1_555 112.7 ? 
8  SG ? D CYS 54  ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 113.3 ? 
9  S1 ? J FES .   ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 90.5  ? 
10 SG ? D CYS 54  ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 91 ? D CYS 92  ? 1_555 124.6 ? 
11 S1 ? J FES .   ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 91 ? D CYS 92  ? 1_555 105.2 ? 
12 S2 ? J FES .   ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 91 ? D CYS 92  ? 1_555 105.0 ? 
13 SG ? C CYS 45  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .  ? C FES 150 ? 1_555 116.6 ? 
14 SG ? C CYS 45  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 111.8 ? 
15 S1 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 91.5  ? 
16 SG ? C CYS 45  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51 ? C CYS 52  ? 1_555 113.1 ? 
17 S1 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51 ? C CYS 52  ? 1_555 107.7 ? 
18 S2 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51 ? C CYS 52  ? 1_555 114.4 ? 
19 SG ? C CYS 91  ? C CYS 92  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .  ? C FES 150 ? 1_555 113.0 ? 
20 SG ? C CYS 91  ? C CYS 92  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 119.1 ? 
21 S1 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 91.6  ? 
22 SG ? C CYS 91  ? C CYS 92  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 54 ? C CYS 55  ? 1_555 116.8 ? 
23 S1 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 54 ? C CYS 55  ? 1_555 108.2 ? 
24 S2 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 54 ? C CYS 55  ? 1_555 105.0 ? 
25 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NA ? E HEM .  ? A HEM 601 ? 1_555 95.3  ? 
26 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .  ? A HEM 601 ? 1_555 84.8  ? 
27 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .  ? A HEM 601 ? 1_555 90.1  ? 
28 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 87.9  ? 
29 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 176.8 ? 
30 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 89.7  ? 
31 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 97.7  ? 
32 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 90.8  ? 
33 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 177.3 ? 
34 NC ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 89.3  ? 
35 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 O2 ? F HC9 .  ? A HC9 602 ? 1_555 167.0 ? 
36 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 O2 ? F HC9 .  ? A HC9 602 ? 1_555 97.5  ? 
37 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 O2 ? F HC9 .  ? A HC9 602 ? 1_555 97.7  ? 
38 NC ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 O2 ? F HC9 .  ? A HC9 602 ? 1_555 79.4  ? 
39 ND ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 O2 ? F HC9 .  ? A HC9 602 ? 1_555 79.7  ? 
40 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NA ? G HEM .  ? B HEM 601 ? 1_555 94.7  ? 
41 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .  ? B HEM 601 ? 1_555 85.8  ? 
42 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .  ? B HEM 601 ? 1_555 90.7  ? 
43 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 88.1  ? 
44 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 177.1 ? 
45 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 88.9  ? 
46 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 96.7  ? 
47 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 89.3  ? 
48 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 177.6 ? 
49 NC ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 90.9  ? 
50 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 O2 ? H HC9 .  ? B HC9 602 ? 1_555 167.3 ? 
51 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 O2 ? H HC9 .  ? B HC9 602 ? 1_555 97.6  ? 
52 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 O2 ? H HC9 .  ? B HC9 602 ? 1_555 97.2  ? 
53 NC ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 O2 ? H HC9 .  ? B HC9 602 ? 1_555 79.6  ? 
54 ND ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 O2 ? H HC9 .  ? B HC9 602 ? 1_555 80.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.5.0102 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.100    'May. 21, 2010' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 105 ? ? 41.84   -134.08 
2  1 ASP A 269 ? ? -159.35 85.24   
3  1 LYS A 373 ? ? 78.89   -3.35   
4  1 ASP A 392 ? ? 39.79   69.70   
5  1 ASP A 405 ? ? -66.74  84.84   
6  1 ASN A 407 ? ? -147.06 -37.50  
7  1 GLN A 422 ? ? -58.77  173.90  
8  1 ASN A 459 ? ? -117.62 57.33   
9  1 LEU A 460 ? ? 68.69   -60.78  
10 1 ILE B 63  ? ? -130.40 -35.51  
11 1 SER B 105 ? ? 58.89   -145.45 
12 1 ASP B 269 ? ? -155.81 79.08   
13 1 VAL B 335 ? ? -119.44 56.71   
14 1 LYS B 373 ? ? 75.38   -1.77   
15 1 ARG B 400 ? ? -38.87  -39.04  
16 1 LEU B 460 ? ? 65.90   -58.40  
17 1 GLU C 47  ? ? 71.69   55.02   
18 1 CYS C 52  ? ? -153.84 -157.64 
19 1 SER C 53  ? ? -144.84 18.76   
20 1 SER D 53  ? ? -141.31 21.54   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A SER 2   ? A SER 1   
2   1 Y 1 A THR 3   ? A THR 2   
3   1 Y 1 A ARG 4   ? A ARG 3   
4   1 Y 1 A SER 5   ? A SER 4   
5   1 Y 1 A ASN 476 ? A ASN 475 
6   1 Y 1 A GLN 477 ? A GLN 476 
7   1 Y 1 A GLU 478 ? A GLU 477 
8   1 Y 1 A ALA 479 ? A ALA 478 
9   1 Y 1 A THR 480 ? A THR 479 
10  1 Y 1 A GLN 481 ? A GLN 480 
11  1 Y 1 A GLN 482 ? A GLN 481 
12  1 Y 1 A HIS 483 ? A HIS 482 
13  1 Y 1 A HIS 484 ? A HIS 483 
14  1 Y 1 A HIS 485 ? A HIS 484 
15  1 Y 1 A HIS 486 ? A HIS 485 
16  1 Y 1 A HIS 487 ? A HIS 486 
17  1 Y 1 A HIS 488 ? A HIS 487 
18  1 Y 1 B SER 2   ? B SER 1   
19  1 Y 1 B THR 3   ? B THR 2   
20  1 Y 1 B ARG 4   ? B ARG 3   
21  1 Y 1 B SER 5   ? B SER 4   
22  1 Y 1 B ASN 476 ? B ASN 475 
23  1 Y 1 B GLN 477 ? B GLN 476 
24  1 Y 1 B GLU 478 ? B GLU 477 
25  1 Y 1 B ALA 479 ? B ALA 478 
26  1 Y 1 B THR 480 ? B THR 479 
27  1 Y 1 B GLN 481 ? B GLN 480 
28  1 Y 1 B GLN 482 ? B GLN 481 
29  1 Y 1 B HIS 483 ? B HIS 482 
30  1 Y 1 B HIS 484 ? B HIS 483 
31  1 Y 1 B HIS 485 ? B HIS 484 
32  1 Y 1 B HIS 486 ? B HIS 485 
33  1 Y 1 B HIS 487 ? B HIS 486 
34  1 Y 1 B HIS 488 ? B HIS 487 
35  1 Y 1 C SER 2   ? C SER 1   
36  1 Y 1 C SER 3   ? C SER 2   
37  1 Y 1 C GLU 4   ? C GLU 3   
38  1 Y 1 C ASP 5   ? C ASP 4   
39  1 Y 1 C LYS 6   ? C LYS 5   
40  1 Y 1 C ILE 7   ? C ILE 6   
41  1 Y 1 C THR 8   ? C THR 7   
42  1 Y 1 C VAL 9   ? C VAL 8   
43  1 Y 1 C HIS 10  ? C HIS 9   
44  1 Y 1 C PHE 11  ? C PHE 10  
45  1 Y 1 C ILE 12  ? C ILE 11  
46  1 Y 1 C ASN 13  ? C ASN 12  
47  1 Y 1 C ARG 14  ? C ARG 13  
48  1 Y 1 C ASP 15  ? C ASP 14  
49  1 Y 1 C GLY 16  ? C GLY 15  
50  1 Y 1 C GLU 17  ? C GLU 16  
51  1 Y 1 C THR 18  ? C THR 17  
52  1 Y 1 C LEU 19  ? C LEU 18  
53  1 Y 1 C THR 20  ? C THR 19  
54  1 Y 1 C THR 21  ? C THR 20  
55  1 Y 1 C LYS 22  ? C LYS 21  
56  1 Y 1 C GLY 23  ? C GLY 22  
57  1 Y 1 C LYS 24  ? C LYS 23  
58  1 Y 1 C VAL 25  ? C VAL 24  
59  1 Y 1 C GLY 26  ? C GLY 25  
60  1 Y 1 C ASP 27  ? C ASP 26  
61  1 Y 1 C SER 28  ? C SER 27  
62  1 Y 1 C LEU 29  ? C LEU 28  
63  1 Y 1 C LEU 30  ? C LEU 29  
64  1 Y 1 C ASP 31  ? C ASP 30  
65  1 Y 1 C VAL 32  ? C VAL 31  
66  1 Y 1 C VAL 33  ? C VAL 32  
67  1 Y 1 C VAL 34  ? C VAL 33  
68  1 Y 1 C GLU 35  ? C GLU 34  
69  1 Y 1 C ASN 36  ? C ASN 35  
70  1 Y 1 C ASN 37  ? C ASN 36  
71  1 Y 1 C LEU 38  ? C LEU 37  
72  1 Y 1 C ASP 39  ? C ASP 38  
73  1 Y 1 C ILE 40  ? C ILE 39  
74  1 Y 1 C ASP 41  ? C ASP 40  
75  1 Y 1 C GLY 42  ? C GLY 41  
76  1 Y 1 C PHE 43  ? C PHE 42  
77  1 Y 1 C ILE 58  ? C ILE 57  
78  1 Y 1 C PHE 59  ? C PHE 58  
79  1 Y 1 C GLU 60  ? C GLU 59  
80  1 Y 1 C ASP 61  ? C ASP 60  
81  1 Y 1 C HIS 62  ? C HIS 61  
82  1 Y 1 C ILE 63  ? C ILE 62  
83  1 Y 1 C TYR 64  ? C TYR 63  
84  1 Y 1 C GLU 65  ? C GLU 64  
85  1 Y 1 C LYS 66  ? C LYS 65  
86  1 Y 1 C LEU 67  ? C LEU 66  
87  1 Y 1 C ASP 68  ? C ASP 67  
88  1 Y 1 C ALA 69  ? C ALA 68  
89  1 Y 1 C ILE 70  ? C ILE 69  
90  1 Y 1 C THR 71  ? C THR 70  
91  1 Y 1 C ALA 81  ? C ALA 80  
92  1 Y 1 C TYR 82  ? C TYR 81  
93  1 Y 1 C GLY 83  ? C GLY 82  
94  1 Y 1 C LEU 84  ? C LEU 83  
95  1 Y 1 C THR 85  ? C THR 84  
96  1 Y 1 C ASP 86  ? C ASP 85  
97  1 Y 1 C ARG 87  ? C ARG 86  
98  1 Y 1 C SER 88  ? C SER 87  
99  1 Y 1 C GLN 93  ? C GLN 92  
100 1 Y 1 C ILE 94  ? C ILE 93  
101 1 Y 1 C CYS 95  ? C CYS 94  
102 1 Y 1 C LEU 96  ? C LEU 95  
103 1 Y 1 C THR 97  ? C THR 96  
104 1 Y 1 C LYS 98  ? C LYS 97  
105 1 Y 1 C SER 99  ? C SER 98  
106 1 Y 1 C MET 100 ? C MET 99  
107 1 Y 1 C ASP 101 ? C ASP 100 
108 1 Y 1 C ASN 102 ? C ASN 101 
109 1 Y 1 C MET 103 ? C MET 102 
110 1 Y 1 C THR 104 ? C THR 103 
111 1 Y 1 C VAL 105 ? C VAL 104 
112 1 Y 1 C ARG 106 ? C ARG 105 
113 1 Y 1 C VAL 107 ? C VAL 106 
114 1 Y 1 C PRO 108 ? C PRO 107 
115 1 Y 1 C GLU 109 ? C GLU 108 
116 1 Y 1 C THR 110 ? C THR 109 
117 1 Y 1 C VAL 111 ? C VAL 110 
118 1 Y 1 C ALA 112 ? C ALA 111 
119 1 Y 1 C ASP 113 ? C ASP 112 
120 1 Y 1 C ALA 114 ? C ALA 113 
121 1 Y 1 C ARG 115 ? C ARG 114 
122 1 Y 1 C GLN 116 ? C GLN 115 
123 1 Y 1 C SER 117 ? C SER 116 
124 1 Y 1 C ILE 118 ? C ILE 117 
125 1 Y 1 C ASP 119 ? C ASP 118 
126 1 Y 1 C VAL 120 ? C VAL 119 
127 1 Y 1 C GLY 121 ? C GLY 120 
128 1 Y 1 C LYS 122 ? C LYS 121 
129 1 Y 1 C THR 123 ? C THR 122 
130 1 Y 1 C SER 124 ? C SER 123 
131 1 Y 1 D SER 2   ? D SER 1   
132 1 Y 1 D SER 3   ? D SER 2   
133 1 Y 1 D GLU 4   ? D GLU 3   
134 1 Y 1 D ASP 5   ? D ASP 4   
135 1 Y 1 D LYS 6   ? D LYS 5   
136 1 Y 1 D ILE 7   ? D ILE 6   
137 1 Y 1 D THR 8   ? D THR 7   
138 1 Y 1 D VAL 9   ? D VAL 8   
139 1 Y 1 D HIS 10  ? D HIS 9   
140 1 Y 1 D PHE 11  ? D PHE 10  
141 1 Y 1 D ILE 12  ? D ILE 11  
142 1 Y 1 D ASN 13  ? D ASN 12  
143 1 Y 1 D ARG 14  ? D ARG 13  
144 1 Y 1 D ASP 15  ? D ASP 14  
145 1 Y 1 D GLY 16  ? D GLY 15  
146 1 Y 1 D GLU 17  ? D GLU 16  
147 1 Y 1 D THR 18  ? D THR 17  
148 1 Y 1 D LEU 19  ? D LEU 18  
149 1 Y 1 D THR 20  ? D THR 19  
150 1 Y 1 D THR 21  ? D THR 20  
151 1 Y 1 D LYS 22  ? D LYS 21  
152 1 Y 1 D GLY 23  ? D GLY 22  
153 1 Y 1 D LYS 24  ? D LYS 23  
154 1 Y 1 D VAL 25  ? D VAL 24  
155 1 Y 1 D GLY 26  ? D GLY 25  
156 1 Y 1 D ASP 27  ? D ASP 26  
157 1 Y 1 D SER 28  ? D SER 27  
158 1 Y 1 D LEU 29  ? D LEU 28  
159 1 Y 1 D LEU 30  ? D LEU 29  
160 1 Y 1 D ASP 31  ? D ASP 30  
161 1 Y 1 D VAL 32  ? D VAL 31  
162 1 Y 1 D VAL 33  ? D VAL 32  
163 1 Y 1 D VAL 34  ? D VAL 33  
164 1 Y 1 D GLU 35  ? D GLU 34  
165 1 Y 1 D ASN 36  ? D ASN 35  
166 1 Y 1 D ASN 37  ? D ASN 36  
167 1 Y 1 D LEU 38  ? D LEU 37  
168 1 Y 1 D ASP 39  ? D ASP 38  
169 1 Y 1 D ILE 40  ? D ILE 39  
170 1 Y 1 D ASP 41  ? D ASP 40  
171 1 Y 1 D GLY 42  ? D GLY 41  
172 1 Y 1 D PHE 43  ? D PHE 42  
173 1 Y 1 D ILE 58  ? D ILE 57  
174 1 Y 1 D PHE 59  ? D PHE 58  
175 1 Y 1 D GLU 60  ? D GLU 59  
176 1 Y 1 D ASP 61  ? D ASP 60  
177 1 Y 1 D HIS 62  ? D HIS 61  
178 1 Y 1 D ILE 63  ? D ILE 62  
179 1 Y 1 D TYR 64  ? D TYR 63  
180 1 Y 1 D GLU 65  ? D GLU 64  
181 1 Y 1 D LYS 66  ? D LYS 65  
182 1 Y 1 D LEU 67  ? D LEU 66  
183 1 Y 1 D ASP 68  ? D ASP 67  
184 1 Y 1 D ALA 69  ? D ALA 68  
185 1 Y 1 D ILE 70  ? D ILE 69  
186 1 Y 1 D THR 71  ? D THR 70  
187 1 Y 1 D ALA 81  ? D ALA 80  
188 1 Y 1 D TYR 82  ? D TYR 81  
189 1 Y 1 D GLY 83  ? D GLY 82  
190 1 Y 1 D LEU 84  ? D LEU 83  
191 1 Y 1 D THR 85  ? D THR 84  
192 1 Y 1 D ASP 86  ? D ASP 85  
193 1 Y 1 D ARG 87  ? D ARG 86  
194 1 Y 1 D SER 88  ? D SER 87  
195 1 Y 1 D GLN 93  ? D GLN 92  
196 1 Y 1 D ILE 94  ? D ILE 93  
197 1 Y 1 D CYS 95  ? D CYS 94  
198 1 Y 1 D LEU 96  ? D LEU 95  
199 1 Y 1 D THR 97  ? D THR 96  
200 1 Y 1 D LYS 98  ? D LYS 97  
201 1 Y 1 D SER 99  ? D SER 98  
202 1 Y 1 D MET 100 ? D MET 99  
203 1 Y 1 D ASP 101 ? D ASP 100 
204 1 Y 1 D ASN 102 ? D ASN 101 
205 1 Y 1 D MET 103 ? D MET 102 
206 1 Y 1 D THR 104 ? D THR 103 
207 1 Y 1 D VAL 105 ? D VAL 104 
208 1 Y 1 D ARG 106 ? D ARG 105 
209 1 Y 1 D VAL 107 ? D VAL 106 
210 1 Y 1 D PRO 108 ? D PRO 107 
211 1 Y 1 D GLU 109 ? D GLU 108 
212 1 Y 1 D THR 110 ? D THR 109 
213 1 Y 1 D VAL 111 ? D VAL 110 
214 1 Y 1 D ALA 112 ? D ALA 111 
215 1 Y 1 D ASP 113 ? D ASP 112 
216 1 Y 1 D ALA 114 ? D ALA 113 
217 1 Y 1 D ARG 115 ? D ARG 114 
218 1 Y 1 D GLN 116 ? D GLN 115 
219 1 Y 1 D SER 117 ? D SER 116 
220 1 Y 1 D ILE 118 ? D ILE 117 
221 1 Y 1 D ASP 119 ? D ASP 118 
222 1 Y 1 D VAL 120 ? D VAL 119 
223 1 Y 1 D GLY 121 ? D GLY 120 
224 1 Y 1 D LYS 122 ? D LYS 121 
225 1 Y 1 D THR 123 ? D THR 122 
226 1 Y 1 D SER 124 ? D SER 123 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE'             HEM 
4 '(3alpha,8alpha,22R)-cholest-5-ene-3,22-diol' HC9 
5 'FE2/S2 (INORGANIC) CLUSTER'                  FES 
6 water                                         HOH 
#