data_3NA0
# 
_entry.id   3NA0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NA0         
RCSB  RCSB059567   
WWPDB D_1000059567 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3N9Y . unspecified 
PDB 3N9Z . unspecified 
PDB 3NA1 . unspecified 
# 
_pdbx_database_status.entry_id                        3NA0 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Strushkevich, N.V.'                   1  
'MacKenzie, F.'                        2  
'Tempel, W.'                           3  
'Botchkarev, A.'                       4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Bountra, C.'                          7  
'Weigelt, J.U.'                        8  
'Park, H.'                             9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                10139 
_citation.page_last                 10143 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21636783 
_citation.pdbx_database_id_DOI      10.1073/pnas.1019441108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Strushkevich, N.' 1 
primary 'Mackenzie, F.'    2 
primary 'Cherkesova, T.'   3 
primary 'Grabovec, I.'     4 
primary 'Usanov, S.'       5 
primary 'Park, H.W.'       6 
# 
_cell.length_a           82.806 
_cell.length_b           114.724 
_cell.length_c           85.716 
_cell.angle_alpha        90.000 
_cell.angle_beta         101.780 
_cell.angle_gamma        90.000 
_cell.entry_id           3NA0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3NA0 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cholesterol side-chain cleavage enzyme, mitochondrial' 54911.035 2   1.14.15.6 ? 'UNP residues 44-514' ? 
2 polymer     man 'Adrenodoxin, mitochondrial'                            7516.367  2   ?         ? 'UNP residues 88-155' ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                       616.487   2   ?         ? ?                     ? 
4 non-polymer syn '(3alpha,8alpha,22R)-cholest-5-ene-3,20,22-triol'       418.652   2   ?         ? ?                     ? 
5 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                            175.820   2   ?         ? ?                     ? 
6 water       nat water                                                   18.015    291 ?         ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cytochrome P450 11A1, CYPXIA1, Cytochrome P450(scc), Cholesterol desmolase' 
2 'Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin'                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLI
PPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLF
RFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQN
FYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQA
QGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSK
DKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF
;
;SPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLI
PPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLF
RFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQN
FYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQA
QGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSK
DKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF
;
A,B ? 
2 'polypeptide(L)' no no SLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQIC 
SLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQIC C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   PRO n 
1 3   ARG n 
1 4   PRO n 
1 5   PHE n 
1 6   ASN n 
1 7   GLU n 
1 8   ILE n 
1 9   PRO n 
1 10  SER n 
1 11  PRO n 
1 12  GLY n 
1 13  ASP n 
1 14  ASN n 
1 15  GLY n 
1 16  TRP n 
1 17  LEU n 
1 18  ASN n 
1 19  LEU n 
1 20  TYR n 
1 21  HIS n 
1 22  PHE n 
1 23  TRP n 
1 24  ARG n 
1 25  GLU n 
1 26  THR n 
1 27  GLY n 
1 28  THR n 
1 29  HIS n 
1 30  LYS n 
1 31  VAL n 
1 32  HIS n 
1 33  LEU n 
1 34  HIS n 
1 35  HIS n 
1 36  VAL n 
1 37  GLN n 
1 38  ASN n 
1 39  PHE n 
1 40  GLN n 
1 41  LYS n 
1 42  TYR n 
1 43  GLY n 
1 44  PRO n 
1 45  ILE n 
1 46  TYR n 
1 47  ARG n 
1 48  GLU n 
1 49  LYS n 
1 50  LEU n 
1 51  GLY n 
1 52  ASN n 
1 53  VAL n 
1 54  GLU n 
1 55  SER n 
1 56  VAL n 
1 57  TYR n 
1 58  VAL n 
1 59  ILE n 
1 60  ASP n 
1 61  PRO n 
1 62  GLU n 
1 63  ASP n 
1 64  VAL n 
1 65  ALA n 
1 66  LEU n 
1 67  LEU n 
1 68  PHE n 
1 69  LYS n 
1 70  SER n 
1 71  GLU n 
1 72  GLY n 
1 73  PRO n 
1 74  ASN n 
1 75  PRO n 
1 76  GLU n 
1 77  ARG n 
1 78  PHE n 
1 79  LEU n 
1 80  ILE n 
1 81  PRO n 
1 82  PRO n 
1 83  TRP n 
1 84  VAL n 
1 85  ALA n 
1 86  TYR n 
1 87  HIS n 
1 88  GLN n 
1 89  TYR n 
1 90  TYR n 
1 91  GLN n 
1 92  ARG n 
1 93  PRO n 
1 94  ILE n 
1 95  GLY n 
1 96  VAL n 
1 97  LEU n 
1 98  LEU n 
1 99  LYS n 
1 100 LYS n 
1 101 SER n 
1 102 ALA n 
1 103 ALA n 
1 104 TRP n 
1 105 LYS n 
1 106 LYS n 
1 107 ASP n 
1 108 ARG n 
1 109 VAL n 
1 110 ALA n 
1 111 LEU n 
1 112 ASN n 
1 113 GLN n 
1 114 GLU n 
1 115 VAL n 
1 116 MET n 
1 117 ALA n 
1 118 PRO n 
1 119 GLU n 
1 120 ALA n 
1 121 THR n 
1 122 LYS n 
1 123 ASN n 
1 124 PHE n 
1 125 LEU n 
1 126 PRO n 
1 127 LEU n 
1 128 LEU n 
1 129 ASP n 
1 130 ALA n 
1 131 VAL n 
1 132 SER n 
1 133 ARG n 
1 134 ASP n 
1 135 PHE n 
1 136 VAL n 
1 137 SER n 
1 138 VAL n 
1 139 LEU n 
1 140 HIS n 
1 141 ARG n 
1 142 ARG n 
1 143 ILE n 
1 144 LYS n 
1 145 LYS n 
1 146 ALA n 
1 147 GLY n 
1 148 SER n 
1 149 GLY n 
1 150 ASN n 
1 151 TYR n 
1 152 SER n 
1 153 GLY n 
1 154 ASP n 
1 155 ILE n 
1 156 SER n 
1 157 ASP n 
1 158 ASP n 
1 159 LEU n 
1 160 PHE n 
1 161 ARG n 
1 162 PHE n 
1 163 ALA n 
1 164 PHE n 
1 165 GLU n 
1 166 SER n 
1 167 ILE n 
1 168 THR n 
1 169 ASN n 
1 170 VAL n 
1 171 ILE n 
1 172 PHE n 
1 173 GLY n 
1 174 GLU n 
1 175 ARG n 
1 176 GLN n 
1 177 GLY n 
1 178 MET n 
1 179 LEU n 
1 180 GLU n 
1 181 GLU n 
1 182 VAL n 
1 183 VAL n 
1 184 ASN n 
1 185 PRO n 
1 186 GLU n 
1 187 ALA n 
1 188 GLN n 
1 189 ARG n 
1 190 PHE n 
1 191 ILE n 
1 192 ASP n 
1 193 ALA n 
1 194 ILE n 
1 195 TYR n 
1 196 GLN n 
1 197 MET n 
1 198 PHE n 
1 199 HIS n 
1 200 THR n 
1 201 SER n 
1 202 VAL n 
1 203 PRO n 
1 204 MET n 
1 205 LEU n 
1 206 ASN n 
1 207 LEU n 
1 208 PRO n 
1 209 PRO n 
1 210 ASP n 
1 211 LEU n 
1 212 PHE n 
1 213 ARG n 
1 214 LEU n 
1 215 PHE n 
1 216 ARG n 
1 217 THR n 
1 218 LYS n 
1 219 THR n 
1 220 TRP n 
1 221 LYS n 
1 222 ASP n 
1 223 HIS n 
1 224 VAL n 
1 225 ALA n 
1 226 ALA n 
1 227 TRP n 
1 228 ASP n 
1 229 VAL n 
1 230 ILE n 
1 231 PHE n 
1 232 SER n 
1 233 LYS n 
1 234 ALA n 
1 235 ASP n 
1 236 ILE n 
1 237 TYR n 
1 238 THR n 
1 239 GLN n 
1 240 ASN n 
1 241 PHE n 
1 242 TYR n 
1 243 TRP n 
1 244 GLU n 
1 245 LEU n 
1 246 ARG n 
1 247 GLN n 
1 248 LYS n 
1 249 GLY n 
1 250 SER n 
1 251 VAL n 
1 252 HIS n 
1 253 HIS n 
1 254 ASP n 
1 255 TYR n 
1 256 ARG n 
1 257 GLY n 
1 258 ILE n 
1 259 LEU n 
1 260 TYR n 
1 261 ARG n 
1 262 LEU n 
1 263 LEU n 
1 264 GLY n 
1 265 ASP n 
1 266 SER n 
1 267 LYS n 
1 268 MET n 
1 269 SER n 
1 270 PHE n 
1 271 GLU n 
1 272 ASP n 
1 273 ILE n 
1 274 LYS n 
1 275 ALA n 
1 276 ASN n 
1 277 VAL n 
1 278 THR n 
1 279 GLU n 
1 280 MET n 
1 281 LEU n 
1 282 ALA n 
1 283 GLY n 
1 284 GLY n 
1 285 VAL n 
1 286 ASP n 
1 287 THR n 
1 288 THR n 
1 289 SER n 
1 290 MET n 
1 291 THR n 
1 292 LEU n 
1 293 GLN n 
1 294 TRP n 
1 295 HIS n 
1 296 LEU n 
1 297 TYR n 
1 298 GLU n 
1 299 MET n 
1 300 ALA n 
1 301 ARG n 
1 302 ASN n 
1 303 LEU n 
1 304 LYS n 
1 305 VAL n 
1 306 GLN n 
1 307 ASP n 
1 308 MET n 
1 309 LEU n 
1 310 ARG n 
1 311 ALA n 
1 312 GLU n 
1 313 VAL n 
1 314 LEU n 
1 315 ALA n 
1 316 ALA n 
1 317 ARG n 
1 318 HIS n 
1 319 GLN n 
1 320 ALA n 
1 321 GLN n 
1 322 GLY n 
1 323 ASP n 
1 324 MET n 
1 325 ALA n 
1 326 THR n 
1 327 MET n 
1 328 LEU n 
1 329 GLN n 
1 330 LEU n 
1 331 VAL n 
1 332 PRO n 
1 333 LEU n 
1 334 LEU n 
1 335 LYS n 
1 336 ALA n 
1 337 SER n 
1 338 ILE n 
1 339 LYS n 
1 340 GLU n 
1 341 THR n 
1 342 LEU n 
1 343 ARG n 
1 344 LEU n 
1 345 HIS n 
1 346 PRO n 
1 347 ILE n 
1 348 SER n 
1 349 VAL n 
1 350 THR n 
1 351 LEU n 
1 352 GLN n 
1 353 ARG n 
1 354 TYR n 
1 355 LEU n 
1 356 VAL n 
1 357 ASN n 
1 358 ASP n 
1 359 LEU n 
1 360 VAL n 
1 361 LEU n 
1 362 ARG n 
1 363 ASP n 
1 364 TYR n 
1 365 MET n 
1 366 ILE n 
1 367 PRO n 
1 368 ALA n 
1 369 LYS n 
1 370 THR n 
1 371 LEU n 
1 372 VAL n 
1 373 GLN n 
1 374 VAL n 
1 375 ALA n 
1 376 ILE n 
1 377 TYR n 
1 378 ALA n 
1 379 LEU n 
1 380 GLY n 
1 381 ARG n 
1 382 GLU n 
1 383 PRO n 
1 384 THR n 
1 385 PHE n 
1 386 PHE n 
1 387 PHE n 
1 388 ASP n 
1 389 PRO n 
1 390 GLU n 
1 391 ASN n 
1 392 PHE n 
1 393 ASP n 
1 394 PRO n 
1 395 THR n 
1 396 ARG n 
1 397 TRP n 
1 398 LEU n 
1 399 SER n 
1 400 LYS n 
1 401 ASP n 
1 402 LYS n 
1 403 ASN n 
1 404 ILE n 
1 405 THR n 
1 406 TYR n 
1 407 PHE n 
1 408 ARG n 
1 409 ASN n 
1 410 LEU n 
1 411 GLY n 
1 412 PHE n 
1 413 GLY n 
1 414 TRP n 
1 415 GLY n 
1 416 VAL n 
1 417 ARG n 
1 418 GLN n 
1 419 CYS n 
1 420 LEU n 
1 421 GLY n 
1 422 ARG n 
1 423 ARG n 
1 424 ILE n 
1 425 ALA n 
1 426 GLU n 
1 427 LEU n 
1 428 GLU n 
1 429 MET n 
1 430 THR n 
1 431 ILE n 
1 432 PHE n 
1 433 LEU n 
1 434 ILE n 
1 435 ASN n 
1 436 MET n 
1 437 LEU n 
1 438 GLU n 
1 439 ASN n 
1 440 PHE n 
1 441 ARG n 
1 442 VAL n 
1 443 GLU n 
1 444 ILE n 
1 445 GLN n 
1 446 HIS n 
1 447 LEU n 
1 448 SER n 
1 449 ASP n 
1 450 VAL n 
1 451 GLY n 
1 452 THR n 
1 453 THR n 
1 454 PHE n 
1 455 ASN n 
1 456 LEU n 
1 457 ILE n 
1 458 LEU n 
1 459 MET n 
1 460 PRO n 
1 461 GLU n 
1 462 LYS n 
1 463 PRO n 
1 464 ILE n 
1 465 SER n 
1 466 PHE n 
1 467 THR n 
1 468 PHE n 
1 469 TRP n 
1 470 PRO n 
1 471 PHE n 
2 1   SER n 
2 2   LEU n 
2 3   LEU n 
2 4   ASP n 
2 5   VAL n 
2 6   VAL n 
2 7   VAL n 
2 8   GLU n 
2 9   ASN n 
2 10  ASN n 
2 11  LEU n 
2 12  ASP n 
2 13  ILE n 
2 14  ASP n 
2 15  GLY n 
2 16  PHE n 
2 17  GLY n 
2 18  ALA n 
2 19  CYS n 
2 20  GLU n 
2 21  GLY n 
2 22  THR n 
2 23  LEU n 
2 24  ALA n 
2 25  CYS n 
2 26  SER n 
2 27  THR n 
2 28  CYS n 
2 29  HIS n 
2 30  LEU n 
2 31  ILE n 
2 32  PHE n 
2 33  GLU n 
2 34  ASP n 
2 35  HIS n 
2 36  ILE n 
2 37  TYR n 
2 38  GLU n 
2 39  LYS n 
2 40  LEU n 
2 41  ASP n 
2 42  ALA n 
2 43  ILE n 
2 44  THR n 
2 45  ASP n 
2 46  GLU n 
2 47  GLU n 
2 48  ASN n 
2 49  ASP n 
2 50  MET n 
2 51  LEU n 
2 52  ASP n 
2 53  LEU n 
2 54  ALA n 
2 55  TYR n 
2 56  GLY n 
2 57  LEU n 
2 58  THR n 
2 59  ASP n 
2 60  ARG n 
2 61  SER n 
2 62  ARG n 
2 63  LEU n 
2 64  GLY n 
2 65  CYS n 
2 66  GLN n 
2 67  ILE n 
2 68  CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CYP11A, CYP11A1'        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
2 1 sample ? ? ? human ? 'adrenodoxin, ADX, FDX1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CP11A_HUMAN P05108 1 
;SPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLI
PPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLF
RFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQN
FYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQA
QGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSK
DKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPF
;
44 ? 
2 UNP ADX_HUMAN   P10109 2 SLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQIC 88 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NA0 A 1 ? 471 ? P05108 44 ? 514 ? 44 514 
2 1 3NA0 B 1 ? 471 ? P05108 44 ? 514 ? 44 514 
3 2 3NA0 C 1 ? 68  ? P10109 88 ? 155 ? 28 95  
4 2 3NA0 D 1 ? 68  ? P10109 88 ? 155 ? 28 95  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DC non-polymer         . '(3alpha,8alpha,22R)-cholest-5-ene-3,20,22-triol' ?    'C27 H46 O3'       418.652 
ALA 'L-peptide linking' y ALANINE                                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                          ?    'C3 H7 N O2 S'     121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                      ?    'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                 HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3NA0 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Ca acetate, pH 7.5, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2009-11-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     3NA0 
_reflns.d_resolution_high            2.500 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   53587 
_reflns.pdbx_Rmerge_I_obs            0.105 
_reflns.pdbx_netI_over_sigmaI        7.700 
_reflns.pdbx_chi_squared             0.926 
_reflns.pdbx_redundancy              4.400 
_reflns.percent_possible_obs         98.400 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.50 2.54  ? ? ? 0.365 ? ? 0.787 3.60 ? 2439 89.80  1  1 
2.54 2.59  ? ? ? 0.356 ? ? 0.849 3.70 ? 2509 91.70  2  1 
2.59 2.64  ? ? ? 0.338 ? ? 0.836 3.80 ? 2534 94.80  3  1 
2.64 2.69  ? ? ? 0.323 ? ? 0.948 3.90 ? 2637 96.90  4  1 
2.69 2.75  ? ? ? 0.306 ? ? 0.821 4.10 ? 2654 97.40  5  1 
2.75 2.82  ? ? ? 0.264 ? ? 0.804 4.20 ? 2642 99.10  6  1 
2.82 2.89  ? ? ? 0.240 ? ? 0.840 4.30 ? 2724 99.40  7  1 
2.89 2.96  ? ? ? 0.226 ? ? 0.830 4.40 ? 2712 99.80  8  1 
2.96 3.05  ? ? ? 0.206 ? ? 0.832 4.50 ? 2712 100.00 9  1 
3.05 3.15  ? ? ? 0.180 ? ? 0.859 4.60 ? 2700 100.00 10 1 
3.15 3.26  ? ? ? 0.152 ? ? 0.851 4.70 ? 2720 100.00 11 1 
3.26 3.39  ? ? ? 0.128 ? ? 0.864 4.70 ? 2700 100.00 12 1 
3.39 3.55  ? ? ? 0.108 ? ? 0.904 4.70 ? 2739 99.90  13 1 
3.55 3.73  ? ? ? 0.088 ? ? 0.958 4.70 ? 2723 99.90  14 1 
3.73 3.97  ? ? ? 0.079 ? ? 1.028 4.70 ? 2719 100.00 15 1 
3.97 4.27  ? ? ? 0.068 ? ? 1.111 4.70 ? 2722 99.90  16 1 
4.27 4.70  ? ? ? 0.057 ? ? 1.080 4.70 ? 2713 100.00 17 1 
4.70 5.38  ? ? ? 0.053 ? ? 0.969 4.70 ? 2737 100.00 18 1 
5.38 6.78  ? ? ? 0.062 ? ? 0.989 4.70 ? 2754 100.00 19 1 
6.78 50.00 ? ? ? 0.043 ? ? 1.187 4.60 ? 2797 100.00 20 1 
# 
_refine.entry_id                                 3NA0 
_refine.ls_d_res_high                            2.500 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.160 
_refine.ls_number_reflns_obs                     53564 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.245 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2718 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               29.281 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.630 
_refine.aniso_B[2][2]                            -1.680 
_refine.aniso_B[3][3]                            0.590 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.130 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.892 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.258 
_refine.overall_SU_ML                            0.173 
_refine.overall_SU_B                             7.702 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                88.26 
_refine.B_iso_min                                3.65 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8138 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         154 
_refine_hist.number_atoms_solvent             291 
_refine_hist.number_atoms_total               8583 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       8528  0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    11602 1.261  1.989  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 988   5.681  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 414   36.104 23.478 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 1418  16.232 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 60    17.673 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         1242  0.087  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   6486  0.005  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            4970  0.539  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           8044  1.055  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            3558  1.498  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           3554  2.537  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.496 
_refine_ls_shell.d_res_low                        2.561 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               86.900 
_refine_ls_shell.number_reflns_R_work             3315 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.257 
_refine_ls_shell.R_factor_R_free                  0.336 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             181 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3496 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3NA0 
_struct.title                     'Crystal structure of human CYP11A1 in complex with 20,22-dihydroxycholesterol' 
_struct.pdbx_descriptor           
'Cholesterol side-chain cleavage enzyme, mitochondrial (E.C.1.14.15.6), Adrenodoxin, mitochondrial' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NA0 
_struct_keywords.text            
;cytochrome P450, 20, 22-dihydroxycholesterol, side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
;
_struct_keywords.pdbx_keywords   'Oxidoreductase, Electron transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 4   ? ILE A 8   ? PRO A 47  ILE A 51  5 ? 5  
HELX_P HELX_P2  2  ASN A 14  ? THR A 26  ? ASN A 57  THR A 69  1 ? 13 
HELX_P HELX_P3  3  GLY A 27  ? HIS A 29  ? GLY A 70  HIS A 72  5 ? 3  
HELX_P HELX_P4  4  LYS A 30  ? GLY A 43  ? LYS A 73  GLY A 86  1 ? 14 
HELX_P HELX_P5  5  ASP A 60  ? SER A 70  ? ASP A 103 SER A 113 1 ? 11 
HELX_P HELX_P6  6  ILE A 80  ? TYR A 90  ? ILE A 123 TYR A 133 1 ? 11 
HELX_P HELX_P7  7  GLY A 95  ? LYS A 99  ? GLY A 138 LYS A 142 5 ? 5  
HELX_P HELX_P8  8  LYS A 100 ? MET A 116 ? LYS A 143 MET A 159 1 ? 17 
HELX_P HELX_P9  9  ALA A 117 ? LYS A 122 ? ALA A 160 LYS A 165 1 ? 6  
HELX_P HELX_P10 10 ASN A 123 ? GLY A 147 ? ASN A 166 GLY A 190 1 ? 25 
HELX_P HELX_P11 11 ILE A 155 ? GLY A 173 ? ILE A 198 GLY A 216 1 ? 19 
HELX_P HELX_P12 12 ASN A 184 ? THR A 200 ? ASN A 227 THR A 243 1 ? 17 
HELX_P HELX_P13 13 SER A 201 ? LEU A 205 ? SER A 244 LEU A 248 5 ? 5  
HELX_P HELX_P14 14 PRO A 208 ? ARG A 216 ? PRO A 251 ARG A 259 1 ? 9  
HELX_P HELX_P15 15 ARG A 216 ? GLY A 249 ? ARG A 259 GLY A 292 1 ? 34 
HELX_P HELX_P16 16 GLY A 257 ? ASP A 265 ? GLY A 300 ASP A 308 1 ? 9  
HELX_P HELX_P17 17 SER A 269 ? ASN A 302 ? SER A 312 ASN A 345 1 ? 34 
HELX_P HELX_P18 18 ASN A 302 ? ALA A 320 ? ASN A 345 ALA A 363 1 ? 19 
HELX_P HELX_P19 19 ASP A 323 ? LEU A 328 ? ASP A 366 LEU A 371 1 ? 6  
HELX_P HELX_P20 20 VAL A 331 ? HIS A 345 ? VAL A 374 HIS A 388 1 ? 15 
HELX_P HELX_P21 21 ALA A 375 ? GLU A 382 ? ALA A 418 GLU A 425 1 ? 8  
HELX_P HELX_P22 22 ASP A 393 ? LEU A 398 ? ASP A 436 LEU A 441 5 ? 6  
HELX_P HELX_P23 23 TRP A 414 ? GLN A 418 ? TRP A 457 GLN A 461 5 ? 5  
HELX_P HELX_P24 24 GLY A 421 ? ASN A 439 ? GLY A 464 ASN A 482 1 ? 19 
HELX_P HELX_P25 25 PRO B 4   ? ILE B 8   ? PRO B 47  ILE B 51  5 ? 5  
HELX_P HELX_P26 26 ASN B 14  ? THR B 26  ? ASN B 57  THR B 69  1 ? 13 
HELX_P HELX_P27 27 GLY B 27  ? HIS B 29  ? GLY B 70  HIS B 72  5 ? 3  
HELX_P HELX_P28 28 LYS B 30  ? GLY B 43  ? LYS B 73  GLY B 86  1 ? 14 
HELX_P HELX_P29 29 ASP B 60  ? SER B 70  ? ASP B 103 SER B 113 1 ? 11 
HELX_P HELX_P30 30 ILE B 80  ? TYR B 90  ? ILE B 123 TYR B 133 1 ? 11 
HELX_P HELX_P31 31 GLY B 95  ? LYS B 99  ? GLY B 138 LYS B 142 5 ? 5  
HELX_P HELX_P32 32 LYS B 100 ? MET B 116 ? LYS B 143 MET B 159 1 ? 17 
HELX_P HELX_P33 33 ALA B 117 ? LYS B 122 ? ALA B 160 LYS B 165 1 ? 6  
HELX_P HELX_P34 34 ASN B 123 ? GLY B 147 ? ASN B 166 GLY B 190 1 ? 25 
HELX_P HELX_P35 35 ILE B 155 ? GLY B 173 ? ILE B 198 GLY B 216 1 ? 19 
HELX_P HELX_P36 36 ASN B 184 ? THR B 200 ? ASN B 227 THR B 243 1 ? 17 
HELX_P HELX_P37 37 SER B 201 ? LEU B 205 ? SER B 244 LEU B 248 5 ? 5  
HELX_P HELX_P38 38 PRO B 208 ? ARG B 216 ? PRO B 251 ARG B 259 1 ? 9  
HELX_P HELX_P39 39 ARG B 216 ? LYS B 248 ? ARG B 259 LYS B 291 1 ? 33 
HELX_P HELX_P40 40 GLY B 257 ? SER B 266 ? GLY B 300 SER B 309 1 ? 10 
HELX_P HELX_P41 41 SER B 269 ? ASN B 302 ? SER B 312 ASN B 345 1 ? 34 
HELX_P HELX_P42 42 ASN B 302 ? ALA B 320 ? ASN B 345 ALA B 363 1 ? 19 
HELX_P HELX_P43 43 ASP B 323 ? LEU B 328 ? ASP B 366 LEU B 371 1 ? 6  
HELX_P HELX_P44 44 VAL B 331 ? HIS B 345 ? VAL B 374 HIS B 388 1 ? 15 
HELX_P HELX_P45 45 ALA B 375 ? GLU B 382 ? ALA B 418 GLU B 425 1 ? 8  
HELX_P HELX_P46 46 ASP B 393 ? LEU B 398 ? ASP B 436 LEU B 441 5 ? 6  
HELX_P HELX_P47 47 TRP B 414 ? GLN B 418 ? TRP B 457 GLN B 461 5 ? 5  
HELX_P HELX_P48 48 GLY B 421 ? ASN B 439 ? GLY B 464 ASN B 482 1 ? 19 
HELX_P HELX_P49 49 THR C 44  ? ASP C 52  ? THR C 71  ASP C 79  1 ? 9  
HELX_P HELX_P50 50 THR D 44  ? ASP D 52  ? THR D 71  ASP D 79  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C CYS 19  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 46  C FES 150 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc2  metalc ? ? D CYS 19  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 46  D FES 150 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc3  metalc ? ? C CYS 65  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 92  C FES 150 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc4  metalc ? ? A CYS 419 SG ? ? ? 1_555 E HEM . FE  ? ? A CYS 462 A HEM 601 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc5  metalc ? ? D CYS 65  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 92  D FES 150 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc6  metalc ? ? B CYS 419 SG ? ? ? 1_555 G HEM . FE  ? ? B CYS 462 B HEM 601 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc7  metalc ? ? D CYS 28  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 55  D FES 150 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc8  metalc ? ? C CYS 25  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 52  C FES 150 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc9  metalc ? ? C CYS 28  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 55  C FES 150 1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc10 metalc ? ? D CYS 25  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 52  D FES 150 1_555 ? ? ? ? ? ? ? 2.682 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 45  ? LEU A 50  ? ILE A 88  LEU A 93  
A 2 VAL A 53  ? VAL A 58  ? VAL A 96  VAL A 101 
A 3 LEU A 371 ? VAL A 374 ? LEU A 414 VAL A 417 
A 4 LEU A 351 ? TYR A 354 ? LEU A 394 TYR A 397 
B 1 TYR A 151 ? GLY A 153 ? TYR A 194 GLY A 196 
B 2 PHE A 466 ? PRO A 470 ? PHE A 509 PRO A 513 
B 3 PHE A 440 ? GLU A 443 ? PHE A 483 GLU A 486 
C 1 LEU A 359 ? LEU A 361 ? LEU A 402 LEU A 404 
C 2 TYR A 364 ? ILE A 366 ? TYR A 407 ILE A 409 
D 1 THR A 452 ? PHE A 454 ? THR A 495 PHE A 497 
D 2 LEU A 458 ? PRO A 460 ? LEU A 501 PRO A 503 
E 1 ILE B 45  ? LEU B 50  ? ILE B 88  LEU B 93  
E 2 VAL B 53  ? VAL B 58  ? VAL B 96  VAL B 101 
E 3 LEU B 371 ? VAL B 374 ? LEU B 414 VAL B 417 
E 4 LEU B 351 ? TYR B 354 ? LEU B 394 TYR B 397 
F 1 TYR B 151 ? ASP B 154 ? TYR B 194 ASP B 197 
F 2 SER B 465 ? PRO B 470 ? SER B 508 PRO B 513 
F 3 PHE B 440 ? ILE B 444 ? PHE B 483 ILE B 487 
G 1 LEU B 359 ? LEU B 361 ? LEU B 402 LEU B 404 
G 2 TYR B 364 ? ILE B 366 ? TYR B 407 ILE B 409 
H 1 THR B 452 ? PHE B 454 ? THR B 495 PHE B 497 
H 2 LEU B 458 ? PRO B 460 ? LEU B 501 PRO B 503 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 46  ? N TYR A 89  O TYR A 57  ? O TYR A 100 
A 2 3 N VAL A 56  ? N VAL A 99  O GLN A 373 ? O GLN A 416 
A 3 4 O VAL A 372 ? O VAL A 415 N ARG A 353 ? N ARG A 396 
B 1 2 N TYR A 151 ? N TYR A 194 O PHE A 468 ? O PHE A 511 
B 2 3 O THR A 467 ? O THR A 510 N GLU A 443 ? N GLU A 486 
C 1 2 N LEU A 359 ? N LEU A 402 O ILE A 366 ? O ILE A 409 
D 1 2 N THR A 453 ? N THR A 496 O MET A 459 ? O MET A 502 
E 1 2 N TYR B 46  ? N TYR B 89  O TYR B 57  ? O TYR B 100 
E 2 3 N VAL B 56  ? N VAL B 99  O GLN B 373 ? O GLN B 416 
E 3 4 O VAL B 372 ? O VAL B 415 N ARG B 353 ? N ARG B 396 
F 1 2 N TYR B 151 ? N TYR B 194 O PHE B 468 ? O PHE B 511 
F 2 3 O THR B 467 ? O THR B 510 N GLU B 443 ? N GLU B 486 
G 1 2 N LEU B 359 ? N LEU B 402 O ILE B 366 ? O ILE B 409 
H 1 2 N THR B 453 ? N THR B 496 O MET B 459 ? O MET B 502 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE HEM A 601' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 2DC A 602' 
AC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM B 601' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 2DC B 602' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE FES C 150' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE FES D 150' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 HOH K .   ? HOH A 24  . ? 1_555 ? 
2  AC1 23 ARG A 77  ? ARG A 120 . ? 1_555 ? 
3  AC1 23 TRP A 104 ? TRP A 147 . ? 1_555 ? 
4  AC1 23 ARG A 108 ? ARG A 151 . ? 1_555 ? 
5  AC1 23 MET A 280 ? MET A 323 . ? 1_555 ? 
6  AC1 23 GLY A 283 ? GLY A 326 . ? 1_555 ? 
7  AC1 23 GLY A 284 ? GLY A 327 . ? 1_555 ? 
8  AC1 23 THR A 287 ? THR A 330 . ? 1_555 ? 
9  AC1 23 THR A 291 ? THR A 334 . ? 1_555 ? 
10 AC1 23 LEU A 342 ? LEU A 385 . ? 1_555 ? 
11 AC1 23 ILE A 347 ? ILE A 390 . ? 1_555 ? 
12 AC1 23 SER A 348 ? SER A 391 . ? 1_555 ? 
13 AC1 23 LEU A 351 ? LEU A 394 . ? 1_555 ? 
14 AC1 23 ARG A 353 ? ARG A 396 . ? 1_555 ? 
15 AC1 23 GLY A 411 ? GLY A 454 . ? 1_555 ? 
16 AC1 23 PHE A 412 ? PHE A 455 . ? 1_555 ? 
17 AC1 23 GLY A 413 ? GLY A 456 . ? 1_555 ? 
18 AC1 23 TRP A 414 ? TRP A 457 . ? 1_555 ? 
19 AC1 23 ARG A 417 ? ARG A 460 . ? 1_555 ? 
20 AC1 23 GLN A 418 ? GLN A 461 . ? 1_555 ? 
21 AC1 23 CYS A 419 ? CYS A 462 . ? 1_555 ? 
22 AC1 23 GLY A 421 ? GLY A 464 . ? 1_555 ? 
23 AC1 23 2DC F .   ? 2DC A 602 . ? 1_555 ? 
24 AC2 10 HOH K .   ? HOH A 42  . ? 1_555 ? 
25 AC2 10 LEU A 97  ? LEU A 140 . ? 1_555 ? 
26 AC2 10 MET A 197 ? MET A 240 . ? 1_555 ? 
27 AC2 10 GLY A 283 ? GLY A 326 . ? 1_555 ? 
28 AC2 10 SER A 348 ? SER A 391 . ? 1_555 ? 
29 AC2 10 GLN A 352 ? GLN A 395 . ? 1_555 ? 
30 AC2 10 LEU A 456 ? LEU A 499 . ? 1_555 ? 
31 AC2 10 ILE A 457 ? ILE A 500 . ? 1_555 ? 
32 AC2 10 HOH K .   ? HOH A 599 . ? 1_555 ? 
33 AC2 10 HEM E .   ? HEM A 601 . ? 1_555 ? 
34 AC3 22 HOH L .   ? HOH B 27  . ? 1_555 ? 
35 AC3 22 ARG B 77  ? ARG B 120 . ? 1_555 ? 
36 AC3 22 VAL B 96  ? VAL B 139 . ? 1_555 ? 
37 AC3 22 TRP B 104 ? TRP B 147 . ? 1_555 ? 
38 AC3 22 ARG B 108 ? ARG B 151 . ? 1_555 ? 
39 AC3 22 MET B 280 ? MET B 323 . ? 1_555 ? 
40 AC3 22 GLY B 283 ? GLY B 326 . ? 1_555 ? 
41 AC3 22 GLY B 284 ? GLY B 327 . ? 1_555 ? 
42 AC3 22 THR B 287 ? THR B 330 . ? 1_555 ? 
43 AC3 22 THR B 291 ? THR B 334 . ? 1_555 ? 
44 AC3 22 LEU B 342 ? LEU B 385 . ? 1_555 ? 
45 AC3 22 SER B 348 ? SER B 391 . ? 1_555 ? 
46 AC3 22 ARG B 353 ? ARG B 396 . ? 1_555 ? 
47 AC3 22 GLY B 411 ? GLY B 454 . ? 1_555 ? 
48 AC3 22 PHE B 412 ? PHE B 455 . ? 1_555 ? 
49 AC3 22 GLY B 413 ? GLY B 456 . ? 1_555 ? 
50 AC3 22 TRP B 414 ? TRP B 457 . ? 1_555 ? 
51 AC3 22 ARG B 417 ? ARG B 460 . ? 1_555 ? 
52 AC3 22 GLN B 418 ? GLN B 461 . ? 1_555 ? 
53 AC3 22 CYS B 419 ? CYS B 462 . ? 1_555 ? 
54 AC3 22 GLY B 421 ? GLY B 464 . ? 1_555 ? 
55 AC3 22 2DC H .   ? 2DC B 602 . ? 1_555 ? 
56 AC4 8  PHE B 78  ? PHE B 121 . ? 1_555 ? 
57 AC4 8  GLY B 283 ? GLY B 326 . ? 1_555 ? 
58 AC4 8  SER B 348 ? SER B 391 . ? 1_555 ? 
59 AC4 8  GLN B 352 ? GLN B 395 . ? 1_555 ? 
60 AC4 8  ILE B 457 ? ILE B 500 . ? 1_555 ? 
61 AC4 8  HOH L .   ? HOH B 536 . ? 1_555 ? 
62 AC4 8  HOH L .   ? HOH B 584 . ? 1_555 ? 
63 AC4 8  HEM G .   ? HEM B 601 . ? 1_555 ? 
64 AC5 7  GLY C 17  ? GLY C 44  . ? 1_555 ? 
65 AC5 7  CYS C 19  ? CYS C 46  . ? 1_555 ? 
66 AC5 7  GLY C 21  ? GLY C 48  . ? 1_555 ? 
67 AC5 7  CYS C 25  ? CYS C 52  . ? 1_555 ? 
68 AC5 7  CYS C 28  ? CYS C 55  . ? 1_555 ? 
69 AC5 7  LEU C 63  ? LEU C 90  . ? 1_555 ? 
70 AC5 7  CYS C 65  ? CYS C 92  . ? 1_555 ? 
71 AC6 7  GLY D 17  ? GLY D 44  . ? 1_555 ? 
72 AC6 7  CYS D 19  ? CYS D 46  . ? 1_555 ? 
73 AC6 7  GLY D 21  ? GLY D 48  . ? 1_555 ? 
74 AC6 7  ALA D 24  ? ALA D 51  . ? 1_555 ? 
75 AC6 7  CYS D 25  ? CYS D 52  . ? 1_555 ? 
76 AC6 7  CYS D 28  ? CYS D 55  . ? 1_555 ? 
77 AC6 7  CYS D 65  ? CYS D 92  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3NA0 
_atom_sites.fract_transf_matrix[1][1]   0.012076 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002518 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008717 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011917 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 2   ? -68.771 -15.338 58.432  1.00 40.52 ? 45  PRO A N   1 
ATOM   2    C  CA  . PRO A 1 2   ? -67.356 -15.057 58.788  1.00 40.21 ? 45  PRO A CA  1 
ATOM   3    C  C   . PRO A 1 2   ? -66.534 -16.349 58.969  1.00 39.93 ? 45  PRO A C   1 
ATOM   4    O  O   . PRO A 1 2   ? -66.625 -16.981 60.022  1.00 39.92 ? 45  PRO A O   1 
ATOM   5    C  CB  . PRO A 1 2   ? -67.461 -14.279 60.118  1.00 40.36 ? 45  PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 2   ? -68.973 -14.276 60.500  1.00 40.40 ? 45  PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 2   ? -69.737 -14.560 59.234  1.00 40.51 ? 45  PRO A CD  1 
ATOM   8    N  N   . ARG A 1 3   ? -65.751 -16.742 57.955  1.00 39.51 ? 46  ARG A N   1 
ATOM   9    C  CA  . ARG A 1 3   ? -65.066 -18.050 57.971  1.00 39.25 ? 46  ARG A CA  1 
ATOM   10   C  C   . ARG A 1 3   ? -63.959 -18.130 59.037  1.00 38.91 ? 46  ARG A C   1 
ATOM   11   O  O   . ARG A 1 3   ? -63.291 -17.131 59.313  1.00 38.83 ? 46  ARG A O   1 
ATOM   12   C  CB  . ARG A 1 3   ? -64.495 -18.438 56.594  1.00 39.32 ? 46  ARG A CB  1 
ATOM   13   C  CG  . ARG A 1 3   ? -65.475 -18.409 55.424  1.00 39.91 ? 46  ARG A CG  1 
ATOM   14   C  CD  . ARG A 1 3   ? -65.145 -17.239 54.488  1.00 41.89 ? 46  ARG A CD  1 
ATOM   15   N  NE  . ARG A 1 3   ? -64.695 -17.653 53.151  1.00 42.81 ? 46  ARG A NE  1 
ATOM   16   C  CZ  . ARG A 1 3   ? -64.071 -16.857 52.277  1.00 42.58 ? 46  ARG A CZ  1 
ATOM   17   N  NH1 . ARG A 1 3   ? -63.773 -15.605 52.591  1.00 42.37 ? 46  ARG A NH1 1 
ATOM   18   N  NH2 . ARG A 1 3   ? -63.726 -17.318 51.083  1.00 42.84 ? 46  ARG A NH2 1 
ATOM   19   N  N   . PRO A 1 4   ? -63.770 -19.322 59.644  1.00 38.38 ? 47  PRO A N   1 
ATOM   20   C  CA  . PRO A 1 4   ? -62.700 -19.513 60.625  1.00 37.99 ? 47  PRO A CA  1 
ATOM   21   C  C   . PRO A 1 4   ? -61.313 -19.397 59.994  1.00 37.69 ? 47  PRO A C   1 
ATOM   22   O  O   . PRO A 1 4   ? -61.174 -19.518 58.767  1.00 37.80 ? 47  PRO A O   1 
ATOM   23   C  CB  . PRO A 1 4   ? -62.921 -20.952 61.112  1.00 37.90 ? 47  PRO A CB  1 
ATOM   24   C  CG  . PRO A 1 4   ? -63.663 -21.626 60.023  1.00 37.92 ? 47  PRO A CG  1 
ATOM   25   C  CD  . PRO A 1 4   ? -64.539 -20.563 59.428  1.00 38.34 ? 47  PRO A CD  1 
ATOM   26   N  N   . PHE A 1 5   ? -60.307 -19.177 60.838  1.00 37.06 ? 48  PHE A N   1 
ATOM   27   C  CA  . PHE A 1 5   ? -58.902 -19.092 60.429  1.00 36.55 ? 48  PHE A CA  1 
ATOM   28   C  C   . PHE A 1 5   ? -58.414 -20.250 59.550  1.00 36.28 ? 48  PHE A C   1 
ATOM   29   O  O   . PHE A 1 5   ? -57.730 -20.028 58.546  1.00 36.04 ? 48  PHE A O   1 
ATOM   30   C  CB  . PHE A 1 5   ? -58.016 -18.973 61.674  1.00 36.54 ? 48  PHE A CB  1 
ATOM   31   C  CG  . PHE A 1 5   ? -56.553 -18.841 61.370  1.00 36.85 ? 48  PHE A CG  1 
ATOM   32   C  CD1 . PHE A 1 5   ? -56.026 -17.621 60.954  1.00 36.45 ? 48  PHE A CD1 1 
ATOM   33   C  CD2 . PHE A 1 5   ? -55.699 -19.938 61.508  1.00 37.01 ? 48  PHE A CD2 1 
ATOM   34   C  CE1 . PHE A 1 5   ? -54.679 -17.491 60.676  1.00 36.34 ? 48  PHE A CE1 1 
ATOM   35   C  CE2 . PHE A 1 5   ? -54.347 -19.822 61.228  1.00 37.61 ? 48  PHE A CE2 1 
ATOM   36   C  CZ  . PHE A 1 5   ? -53.834 -18.589 60.811  1.00 37.92 ? 48  PHE A CZ  1 
ATOM   37   N  N   . ASN A 1 6   ? -58.762 -21.479 59.928  1.00 36.21 ? 49  ASN A N   1 
ATOM   38   C  CA  . ASN A 1 6   ? -58.256 -22.673 59.239  1.00 36.04 ? 49  ASN A CA  1 
ATOM   39   C  C   . ASN A 1 6   ? -58.658 -22.735 57.762  1.00 35.31 ? 49  ASN A C   1 
ATOM   40   O  O   . ASN A 1 6   ? -57.999 -23.398 56.961  1.00 35.50 ? 49  ASN A O   1 
ATOM   41   C  CB  . ASN A 1 6   ? -58.631 -23.971 59.989  1.00 36.37 ? 49  ASN A CB  1 
ATOM   42   C  CG  . ASN A 1 6   ? -60.125 -24.287 59.931  1.00 38.12 ? 49  ASN A CG  1 
ATOM   43   O  OD1 . ASN A 1 6   ? -60.930 -23.667 60.622  1.00 40.57 ? 49  ASN A OD1 1 
ATOM   44   N  ND2 . ASN A 1 6   ? -60.497 -25.267 59.108  1.00 39.74 ? 49  ASN A ND2 1 
ATOM   45   N  N   . GLU A 1 7   ? -59.719 -22.019 57.400  1.00 34.35 ? 50  GLU A N   1 
ATOM   46   C  CA  . GLU A 1 7   ? -60.199 -22.021 56.014  1.00 33.58 ? 50  GLU A CA  1 
ATOM   47   C  C   . GLU A 1 7   ? -59.405 -21.147 55.043  1.00 32.42 ? 50  GLU A C   1 
ATOM   48   O  O   . GLU A 1 7   ? -59.614 -21.221 53.838  1.00 32.47 ? 50  GLU A O   1 
ATOM   49   C  CB  . GLU A 1 7   ? -61.701 -21.729 55.939  1.00 33.61 ? 50  GLU A CB  1 
ATOM   50   C  CG  . GLU A 1 7   ? -62.525 -23.002 55.897  1.00 34.95 ? 50  GLU A CG  1 
ATOM   51   C  CD  . GLU A 1 7   ? -63.992 -22.788 56.208  1.00 36.77 ? 50  GLU A CD  1 
ATOM   52   O  OE1 . GLU A 1 7   ? -64.585 -21.808 55.704  1.00 37.71 ? 50  GLU A OE1 1 
ATOM   53   O  OE2 . GLU A 1 7   ? -64.557 -23.623 56.946  1.00 37.71 ? 50  GLU A OE2 1 
ATOM   54   N  N   . ILE A 1 8   ? -58.495 -20.332 55.570  1.00 31.04 ? 51  ILE A N   1 
ATOM   55   C  CA  . ILE A 1 8   ? -57.617 -19.515 54.744  1.00 29.62 ? 51  ILE A CA  1 
ATOM   56   C  C   . ILE A 1 8   ? -56.702 -20.413 53.905  1.00 28.97 ? 51  ILE A C   1 
ATOM   57   O  O   . ILE A 1 8   ? -56.035 -21.277 54.457  1.00 29.30 ? 51  ILE A O   1 
ATOM   58   C  CB  . ILE A 1 8   ? -56.791 -18.530 55.618  1.00 29.63 ? 51  ILE A CB  1 
ATOM   59   C  CG1 . ILE A 1 8   ? -57.729 -17.620 56.415  1.00 28.19 ? 51  ILE A CG1 1 
ATOM   60   C  CG2 . ILE A 1 8   ? -55.804 -17.724 54.760  1.00 29.06 ? 51  ILE A CG2 1 
ATOM   61   C  CD1 . ILE A 1 8   ? -57.050 -16.669 57.356  1.00 27.42 ? 51  ILE A CD1 1 
ATOM   62   N  N   . PRO A 1 9   ? -56.679 -20.219 52.565  1.00 28.55 ? 52  PRO A N   1 
ATOM   63   C  CA  . PRO A 1 9   ? -55.816 -21.017 51.679  1.00 28.26 ? 52  PRO A CA  1 
ATOM   64   C  C   . PRO A 1 9   ? -54.363 -21.117 52.180  1.00 28.38 ? 52  PRO A C   1 
ATOM   65   O  O   . PRO A 1 9   ? -53.799 -20.136 52.681  1.00 28.20 ? 52  PRO A O   1 
ATOM   66   C  CB  . PRO A 1 9   ? -55.877 -20.255 50.356  1.00 27.86 ? 52  PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 9   ? -57.170 -19.587 50.379  1.00 27.75 ? 52  PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 9   ? -57.433 -19.203 51.803  1.00 28.19 ? 52  PRO A CD  1 
ATOM   69   N  N   . SER A 1 10  ? -53.779 -22.302 52.040  1.00 28.47 ? 53  SER A N   1 
ATOM   70   C  CA  . SER A 1 10  ? -52.519 -22.634 52.672  1.00 28.88 ? 53  SER A CA  1 
ATOM   71   C  C   . SER A 1 10  ? -51.873 -23.848 52.000  1.00 29.32 ? 53  SER A C   1 
ATOM   72   O  O   . SER A 1 10  ? -52.577 -24.795 51.652  1.00 29.53 ? 53  SER A O   1 
ATOM   73   C  CB  . SER A 1 10  ? -52.781 -22.943 54.141  1.00 28.72 ? 53  SER A CB  1 
ATOM   74   O  OG  . SER A 1 10  ? -51.574 -22.978 54.868  1.00 29.95 ? 53  SER A OG  1 
ATOM   75   N  N   . PRO A 1 11  ? -50.530 -23.836 51.820  1.00 29.57 ? 54  PRO A N   1 
ATOM   76   C  CA  . PRO A 1 11  ? -49.818 -25.034 51.339  1.00 29.45 ? 54  PRO A CA  1 
ATOM   77   C  C   . PRO A 1 11  ? -49.993 -26.252 52.237  1.00 29.69 ? 54  PRO A C   1 
ATOM   78   O  O   . PRO A 1 11  ? -49.809 -27.374 51.762  1.00 30.18 ? 54  PRO A O   1 
ATOM   79   C  CB  . PRO A 1 11  ? -48.346 -24.608 51.360  1.00 29.15 ? 54  PRO A CB  1 
ATOM   80   C  CG  . PRO A 1 11  ? -48.289 -23.448 52.286  1.00 29.28 ? 54  PRO A CG  1 
ATOM   81   C  CD  . PRO A 1 11  ? -49.593 -22.725 52.055  1.00 29.54 ? 54  PRO A CD  1 
ATOM   82   N  N   . GLY A 1 12  ? -50.340 -26.030 53.509  1.00 29.49 ? 55  GLY A N   1 
ATOM   83   C  CA  . GLY A 1 12  ? -50.478 -27.100 54.511  1.00 29.46 ? 55  GLY A CA  1 
ATOM   84   C  C   . GLY A 1 12  ? -50.044 -26.666 55.909  1.00 29.73 ? 55  GLY A C   1 
ATOM   85   O  O   . GLY A 1 12  ? -49.483 -25.578 56.084  1.00 30.11 ? 55  GLY A O   1 
ATOM   86   N  N   . ASP A 1 13  ? -50.280 -27.517 56.905  1.00 29.63 ? 56  ASP A N   1 
ATOM   87   C  CA  . ASP A 1 13  ? -49.996 -27.184 58.306  1.00 29.84 ? 56  ASP A CA  1 
ATOM   88   C  C   . ASP A 1 13  ? -48.597 -27.550 58.819  1.00 29.47 ? 56  ASP A C   1 
ATOM   89   O  O   . ASP A 1 13  ? -48.216 -27.168 59.928  1.00 29.67 ? 56  ASP A O   1 
ATOM   90   C  CB  . ASP A 1 13  ? -51.068 -27.771 59.217  1.00 30.48 ? 56  ASP A CB  1 
ATOM   91   C  CG  . ASP A 1 13  ? -52.342 -26.936 59.220  1.00 33.18 ? 56  ASP A CG  1 
ATOM   92   O  OD1 . ASP A 1 13  ? -52.375 -25.888 59.907  1.00 36.87 ? 56  ASP A OD1 1 
ATOM   93   O  OD2 . ASP A 1 13  ? -53.310 -27.319 58.533  1.00 35.42 ? 56  ASP A OD2 1 
ATOM   94   N  N   . ASN A 1 14  ? -47.830 -28.271 58.011  1.00 28.74 ? 57  ASN A N   1 
ATOM   95   C  CA  . ASN A 1 14  ? -46.484 -28.652 58.393  1.00 28.09 ? 57  ASN A CA  1 
ATOM   96   C  C   . ASN A 1 14  ? -45.433 -27.623 57.955  1.00 27.61 ? 57  ASN A C   1 
ATOM   97   O  O   . ASN A 1 14  ? -45.032 -27.557 56.774  1.00 27.27 ? 57  ASN A O   1 
ATOM   98   C  CB  . ASN A 1 14  ? -46.156 -30.050 57.862  1.00 28.20 ? 57  ASN A CB  1 
ATOM   99   C  CG  . ASN A 1 14  ? -44.903 -30.620 58.476  1.00 28.67 ? 57  ASN A CG  1 
ATOM   100  O  OD1 . ASN A 1 14  ? -43.843 -29.982 58.490  1.00 28.83 ? 57  ASN A OD1 1 
ATOM   101  N  ND2 . ASN A 1 14  ? -45.011 -31.836 58.983  1.00 29.48 ? 57  ASN A ND2 1 
ATOM   102  N  N   . GLY A 1 15  ? -44.986 -26.837 58.933  1.00 27.03 ? 58  GLY A N   1 
ATOM   103  C  CA  . GLY A 1 15  ? -44.034 -25.756 58.719  1.00 26.08 ? 58  GLY A CA  1 
ATOM   104  C  C   . GLY A 1 15  ? -42.686 -26.188 58.185  1.00 25.71 ? 58  GLY A C   1 
ATOM   105  O  O   . GLY A 1 15  ? -42.041 -25.430 57.457  1.00 25.70 ? 58  GLY A O   1 
ATOM   106  N  N   . TRP A 1 16  ? -42.254 -27.398 58.544  1.00 25.11 ? 59  TRP A N   1 
ATOM   107  C  CA  . TRP A 1 16  ? -40.955 -27.918 58.094  1.00 24.74 ? 59  TRP A CA  1 
ATOM   108  C  C   . TRP A 1 16  ? -41.057 -28.454 56.676  1.00 24.43 ? 59  TRP A C   1 
ATOM   109  O  O   . TRP A 1 16  ? -40.108 -28.353 55.887  1.00 24.46 ? 59  TRP A O   1 
ATOM   110  C  CB  . TRP A 1 16  ? -40.413 -28.981 59.060  1.00 24.74 ? 59  TRP A CB  1 
ATOM   111  C  CG  . TRP A 1 16  ? -40.425 -28.492 60.479  1.00 25.10 ? 59  TRP A CG  1 
ATOM   112  C  CD1 . TRP A 1 16  ? -41.292 -28.867 61.477  1.00 24.60 ? 59  TRP A CD1 1 
ATOM   113  C  CD2 . TRP A 1 16  ? -39.565 -27.497 61.047  1.00 24.58 ? 59  TRP A CD2 1 
ATOM   114  N  NE1 . TRP A 1 16  ? -41.003 -28.184 62.629  1.00 24.39 ? 59  TRP A NE1 1 
ATOM   115  C  CE2 . TRP A 1 16  ? -39.951 -27.333 62.392  1.00 24.65 ? 59  TRP A CE2 1 
ATOM   116  C  CE3 . TRP A 1 16  ? -38.507 -26.725 60.546  1.00 25.50 ? 59  TRP A CE3 1 
ATOM   117  C  CZ2 . TRP A 1 16  ? -39.319 -26.430 63.243  1.00 24.55 ? 59  TRP A CZ2 1 
ATOM   118  C  CZ3 . TRP A 1 16  ? -37.867 -25.832 61.399  1.00 24.85 ? 59  TRP A CZ3 1 
ATOM   119  C  CH2 . TRP A 1 16  ? -38.278 -25.696 62.733  1.00 24.98 ? 59  TRP A CH2 1 
ATOM   120  N  N   . LEU A 1 17  ? -42.217 -29.010 56.350  1.00 23.77 ? 60  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 17  ? -42.490 -29.436 54.984  1.00 23.44 ? 60  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 17  ? -42.641 -28.217 54.050  1.00 22.74 ? 60  LEU A C   1 
ATOM   123  O  O   . LEU A 1 17  ? -42.107 -28.198 52.937  1.00 22.29 ? 60  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 17  ? -43.735 -30.335 54.949  1.00 23.62 ? 60  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 17  ? -44.098 -31.050 53.637  1.00 24.52 ? 60  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 17  ? -42.985 -31.992 53.134  1.00 24.69 ? 60  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 17  ? -45.394 -31.807 53.823  1.00 24.30 ? 60  LEU A CD2 1 
ATOM   128  N  N   . ASN A 1 18  ? -43.360 -27.204 54.516  1.00 22.02 ? 61  ASN A N   1 
ATOM   129  C  CA  . ASN A 1 18  ? -43.481 -25.949 53.775  1.00 21.64 ? 61  ASN A CA  1 
ATOM   130  C  C   . ASN A 1 18  ? -42.120 -25.318 53.527  1.00 21.38 ? 61  ASN A C   1 
ATOM   131  O  O   . ASN A 1 18  ? -41.828 -24.821 52.432  1.00 21.03 ? 61  ASN A O   1 
ATOM   132  C  CB  . ASN A 1 18  ? -44.412 -24.977 54.514  1.00 21.37 ? 61  ASN A CB  1 
ATOM   133  C  CG  . ASN A 1 18  ? -45.831 -25.505 54.616  1.00 21.41 ? 61  ASN A CG  1 
ATOM   134  O  OD1 . ASN A 1 18  ? -46.199 -26.449 53.921  1.00 23.39 ? 61  ASN A OD1 1 
ATOM   135  N  ND2 . ASN A 1 18  ? -46.628 -24.915 55.488  1.00 20.25 ? 61  ASN A ND2 1 
ATOM   136  N  N   . LEU A 1 19  ? -41.282 -25.361 54.554  1.00 21.23 ? 62  LEU A N   1 
ATOM   137  C  CA  . LEU A 1 19  ? -39.951 -24.813 54.472  1.00 21.52 ? 62  LEU A CA  1 
ATOM   138  C  C   . LEU A 1 19  ? -39.127 -25.577 53.449  1.00 22.05 ? 62  LEU A C   1 
ATOM   139  O  O   . LEU A 1 19  ? -38.372 -24.981 52.679  1.00 22.50 ? 62  LEU A O   1 
ATOM   140  C  CB  . LEU A 1 19  ? -39.293 -24.862 55.851  1.00 21.38 ? 62  LEU A CB  1 
ATOM   141  C  CG  . LEU A 1 19  ? -37.998 -24.088 56.046  1.00 20.32 ? 62  LEU A CG  1 
ATOM   142  C  CD1 . LEU A 1 19  ? -38.146 -22.650 55.577  1.00 18.92 ? 62  LEU A CD1 1 
ATOM   143  C  CD2 . LEU A 1 19  ? -37.608 -24.154 57.507  1.00 19.34 ? 62  LEU A CD2 1 
ATOM   144  N  N   . TYR A 1 20  ? -39.287 -26.901 53.450  1.00 22.61 ? 63  TYR A N   1 
ATOM   145  C  CA  . TYR A 1 20  ? -38.621 -27.786 52.511  1.00 22.94 ? 63  TYR A CA  1 
ATOM   146  C  C   . TYR A 1 20  ? -38.992 -27.475 51.062  1.00 23.00 ? 63  TYR A C   1 
ATOM   147  O  O   . TYR A 1 20  ? -38.112 -27.296 50.221  1.00 23.29 ? 63  TYR A O   1 
ATOM   148  C  CB  . TYR A 1 20  ? -38.932 -29.252 52.846  1.00 23.22 ? 63  TYR A CB  1 
ATOM   149  C  CG  . TYR A 1 20  ? -38.409 -30.219 51.816  1.00 24.31 ? 63  TYR A CG  1 
ATOM   150  C  CD1 . TYR A 1 20  ? -37.042 -30.480 51.712  1.00 26.70 ? 63  TYR A CD1 1 
ATOM   151  C  CD2 . TYR A 1 20  ? -39.272 -30.859 50.930  1.00 26.24 ? 63  TYR A CD2 1 
ATOM   152  C  CE1 . TYR A 1 20  ? -36.543 -31.362 50.764  1.00 27.23 ? 63  TYR A CE1 1 
ATOM   153  C  CE2 . TYR A 1 20  ? -38.780 -31.742 49.969  1.00 28.30 ? 63  TYR A CE2 1 
ATOM   154  C  CZ  . TYR A 1 20  ? -37.412 -31.988 49.904  1.00 28.48 ? 63  TYR A CZ  1 
ATOM   155  O  OH  . TYR A 1 20  ? -36.906 -32.849 48.966  1.00 31.57 ? 63  TYR A OH  1 
ATOM   156  N  N   . HIS A 1 21  ? -40.289 -27.439 50.767  1.00 22.99 ? 64  HIS A N   1 
ATOM   157  C  CA  . HIS A 1 21  ? -40.757 -27.059 49.428  1.00 23.61 ? 64  HIS A CA  1 
ATOM   158  C  C   . HIS A 1 21  ? -40.326 -25.650 49.005  1.00 23.24 ? 64  HIS A C   1 
ATOM   159  O  O   . HIS A 1 21  ? -39.957 -25.434 47.851  1.00 23.71 ? 64  HIS A O   1 
ATOM   160  C  CB  . HIS A 1 21  ? -42.271 -27.233 49.307  1.00 23.53 ? 64  HIS A CB  1 
ATOM   161  C  CG  . HIS A 1 21  ? -42.708 -28.664 49.282  1.00 25.41 ? 64  HIS A CG  1 
ATOM   162  N  ND1 . HIS A 1 21  ? -43.876 -29.101 49.874  1.00 26.85 ? 64  HIS A ND1 1 
ATOM   163  C  CD2 . HIS A 1 21  ? -42.124 -29.763 48.748  1.00 26.79 ? 64  HIS A CD2 1 
ATOM   164  C  CE1 . HIS A 1 21  ? -43.998 -30.405 49.695  1.00 26.43 ? 64  HIS A CE1 1 
ATOM   165  N  NE2 . HIS A 1 21  ? -42.946 -30.831 49.019  1.00 27.14 ? 64  HIS A NE2 1 
ATOM   166  N  N   . PHE A 1 22  ? -40.356 -24.702 49.939  1.00 23.26 ? 65  PHE A N   1 
ATOM   167  C  CA  . PHE A 1 22  ? -39.850 -23.349 49.685  1.00 23.72 ? 65  PHE A CA  1 
ATOM   168  C  C   . PHE A 1 22  ? -38.382 -23.399 49.257  1.00 24.10 ? 65  PHE A C   1 
ATOM   169  O  O   . PHE A 1 22  ? -38.037 -22.821 48.231  1.00 24.18 ? 65  PHE A O   1 
ATOM   170  C  CB  . PHE A 1 22  ? -40.088 -22.447 50.908  1.00 23.79 ? 65  PHE A CB  1 
ATOM   171  C  CG  . PHE A 1 22  ? -39.381 -21.107 50.862  1.00 24.64 ? 65  PHE A CG  1 
ATOM   172  C  CD1 . PHE A 1 22  ? -39.253 -20.386 49.675  1.00 24.75 ? 65  PHE A CD1 1 
ATOM   173  C  CD2 . PHE A 1 22  ? -38.887 -20.538 52.043  1.00 25.34 ? 65  PHE A CD2 1 
ATOM   174  C  CE1 . PHE A 1 22  ? -38.598 -19.160 49.650  1.00 23.78 ? 65  PHE A CE1 1 
ATOM   175  C  CE2 . PHE A 1 22  ? -38.242 -19.294 52.027  1.00 24.68 ? 65  PHE A CE2 1 
ATOM   176  C  CZ  . PHE A 1 22  ? -38.103 -18.606 50.829  1.00 24.16 ? 65  PHE A CZ  1 
ATOM   177  N  N   . TRP A 1 23  ? -37.536 -24.128 49.992  1.00 24.36 ? 66  TRP A N   1 
ATOM   178  C  CA  . TRP A 1 23  ? -36.100 -24.170 49.669  1.00 25.18 ? 66  TRP A CA  1 
ATOM   179  C  C   . TRP A 1 23  ? -35.763 -24.857 48.356  1.00 25.53 ? 66  TRP A C   1 
ATOM   180  O  O   . TRP A 1 23  ? -34.849 -24.435 47.669  1.00 25.16 ? 66  TRP A O   1 
ATOM   181  C  CB  . TRP A 1 23  ? -35.260 -24.784 50.795  1.00 25.06 ? 66  TRP A CB  1 
ATOM   182  C  CG  . TRP A 1 23  ? -35.257 -24.004 52.051  1.00 25.29 ? 66  TRP A CG  1 
ATOM   183  C  CD1 . TRP A 1 23  ? -35.822 -22.789 52.255  1.00 24.86 ? 66  TRP A CD1 1 
ATOM   184  C  CD2 . TRP A 1 23  ? -34.623 -24.367 53.283  1.00 25.66 ? 66  TRP A CD2 1 
ATOM   185  N  NE1 . TRP A 1 23  ? -35.599 -22.372 53.539  1.00 25.51 ? 66  TRP A NE1 1 
ATOM   186  C  CE2 . TRP A 1 23  ? -34.862 -23.319 54.195  1.00 25.96 ? 66  TRP A CE2 1 
ATOM   187  C  CE3 . TRP A 1 23  ? -33.869 -25.472 53.701  1.00 26.73 ? 66  TRP A CE3 1 
ATOM   188  C  CZ2 . TRP A 1 23  ? -34.381 -23.338 55.516  1.00 27.11 ? 66  TRP A CZ2 1 
ATOM   189  C  CZ3 . TRP A 1 23  ? -33.394 -25.503 55.014  1.00 27.78 ? 66  TRP A CZ3 1 
ATOM   190  C  CH2 . TRP A 1 23  ? -33.652 -24.436 55.907  1.00 28.33 ? 66  TRP A CH2 1 
ATOM   191  N  N   . ARG A 1 24  ? -36.494 -25.913 48.016  1.00 26.83 ? 67  ARG A N   1 
ATOM   192  C  CA  . ARG A 1 24  ? -36.196 -26.700 46.808  1.00 28.19 ? 67  ARG A CA  1 
ATOM   193  C  C   . ARG A 1 24  ? -36.715 -26.046 45.515  1.00 28.07 ? 67  ARG A C   1 
ATOM   194  O  O   . ARG A 1 24  ? -36.053 -26.111 44.477  1.00 28.02 ? 67  ARG A O   1 
ATOM   195  C  CB  . ARG A 1 24  ? -36.725 -28.147 46.952  1.00 28.91 ? 67  ARG A CB  1 
ATOM   196  C  CG  . ARG A 1 24  ? -36.299 -29.129 45.836  1.00 31.80 ? 67  ARG A CG  1 
ATOM   197  C  CD  . ARG A 1 24  ? -37.186 -30.382 45.802  1.00 37.62 ? 67  ARG A CD  1 
ATOM   198  N  NE  . ARG A 1 24  ? -38.612 -30.044 45.688  1.00 41.80 ? 67  ARG A NE  1 
ATOM   199  C  CZ  . ARG A 1 24  ? -39.621 -30.811 46.115  1.00 44.31 ? 67  ARG A CZ  1 
ATOM   200  N  NH1 . ARG A 1 24  ? -39.380 -31.987 46.699  1.00 46.29 ? 67  ARG A NH1 1 
ATOM   201  N  NH2 . ARG A 1 24  ? -40.878 -30.400 45.973  1.00 43.45 ? 67  ARG A NH2 1 
ATOM   202  N  N   . GLU A 1 25  ? -37.895 -25.426 45.579  1.00 28.15 ? 68  GLU A N   1 
ATOM   203  C  CA  . GLU A 1 25  ? -38.526 -24.835 44.389  1.00 28.33 ? 68  GLU A CA  1 
ATOM   204  C  C   . GLU A 1 25  ? -38.065 -23.416 44.048  1.00 27.70 ? 68  GLU A C   1 
ATOM   205  O  O   . GLU A 1 25  ? -37.884 -23.077 42.876  1.00 27.86 ? 68  GLU A O   1 
ATOM   206  C  CB  . GLU A 1 25  ? -40.046 -24.861 44.532  1.00 28.54 ? 68  GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 25  ? -40.653 -26.185 44.089  1.00 32.34 ? 68  GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 25  ? -41.924 -26.552 44.843  1.00 35.62 ? 68  GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 25  ? -42.866 -25.718 44.910  1.00 36.11 ? 68  GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 25  ? -41.972 -27.694 45.360  1.00 37.36 ? 68  GLU A OE2 1 
ATOM   211  N  N   . THR A 1 26  ? -37.877 -22.597 45.076  1.00 27.11 ? 69  THR A N   1 
ATOM   212  C  CA  . THR A 1 26  ? -37.653 -21.174 44.906  1.00 26.56 ? 69  THR A CA  1 
ATOM   213  C  C   . THR A 1 26  ? -36.311 -20.763 45.483  1.00 26.21 ? 69  THR A C   1 
ATOM   214  O  O   . THR A 1 26  ? -35.540 -20.091 44.815  1.00 26.35 ? 69  THR A O   1 
ATOM   215  C  CB  . THR A 1 26  ? -38.789 -20.369 45.563  1.00 27.01 ? 69  THR A CB  1 
ATOM   216  O  OG1 . THR A 1 26  ? -40.050 -20.940 45.174  1.00 26.91 ? 69  THR A OG1 1 
ATOM   217  C  CG2 . THR A 1 26  ? -38.740 -18.896 45.139  1.00 26.24 ? 69  THR A CG2 1 
ATOM   218  N  N   . GLY A 1 27  ? -36.026 -21.186 46.712  1.00 25.78 ? 70  GLY A N   1 
ATOM   219  C  CA  . GLY A 1 27  ? -34.760 -20.866 47.356  1.00 24.92 ? 70  GLY A CA  1 
ATOM   220  C  C   . GLY A 1 27  ? -34.858 -19.682 48.300  1.00 24.78 ? 70  GLY A C   1 
ATOM   221  O  O   . GLY A 1 27  ? -35.690 -18.769 48.113  1.00 23.99 ? 70  GLY A O   1 
ATOM   222  N  N   . THR A 1 28  ? -33.990 -19.696 49.313  1.00 24.61 ? 71  THR A N   1 
ATOM   223  C  CA  . THR A 1 28  ? -33.994 -18.660 50.360  1.00 24.61 ? 71  THR A CA  1 
ATOM   224  C  C   . THR A 1 28  ? -33.778 -17.250 49.810  1.00 24.07 ? 71  THR A C   1 
ATOM   225  O  O   . THR A 1 28  ? -34.356 -16.298 50.321  1.00 23.81 ? 71  THR A O   1 
ATOM   226  C  CB  . THR A 1 28  ? -32.978 -18.959 51.493  1.00 24.57 ? 71  THR A CB  1 
ATOM   227  O  OG1 . THR A 1 28  ? -31.732 -19.357 50.923  1.00 24.70 ? 71  THR A OG1 1 
ATOM   228  C  CG2 . THR A 1 28  ? -33.473 -20.087 52.365  1.00 25.24 ? 71  THR A CG2 1 
ATOM   229  N  N   . HIS A 1 29  ? -32.980 -17.124 48.754  1.00 23.51 ? 72  HIS A N   1 
ATOM   230  C  CA  . HIS A 1 29  ? -32.659 -15.807 48.211  1.00 23.69 ? 72  HIS A CA  1 
ATOM   231  C  C   . HIS A 1 29  ? -33.683 -15.278 47.191  1.00 23.17 ? 72  HIS A C   1 
ATOM   232  O  O   . HIS A 1 29  ? -33.469 -14.253 46.537  1.00 23.27 ? 72  HIS A O   1 
ATOM   233  C  CB  . HIS A 1 29  ? -31.227 -15.776 47.678  1.00 23.34 ? 72  HIS A CB  1 
ATOM   234  C  CG  . HIS A 1 29  ? -30.195 -16.029 48.736  1.00 26.12 ? 72  HIS A CG  1 
ATOM   235  N  ND1 . HIS A 1 29  ? -29.832 -15.078 49.668  1.00 27.33 ? 72  HIS A ND1 1 
ATOM   236  C  CD2 . HIS A 1 29  ? -29.458 -17.131 49.020  1.00 27.85 ? 72  HIS A CD2 1 
ATOM   237  C  CE1 . HIS A 1 29  ? -28.908 -15.577 50.470  1.00 26.89 ? 72  HIS A CE1 1 
ATOM   238  N  NE2 . HIS A 1 29  ? -28.669 -16.823 50.104  1.00 27.26 ? 72  HIS A NE2 1 
ATOM   239  N  N   . LYS A 1 30  ? -34.809 -15.971 47.093  1.00 22.61 ? 73  LYS A N   1 
ATOM   240  C  CA  . LYS A 1 30  ? -35.876 -15.592 46.188  1.00 22.04 ? 73  LYS A CA  1 
ATOM   241  C  C   . LYS A 1 30  ? -37.219 -15.603 46.904  1.00 21.49 ? 73  LYS A C   1 
ATOM   242  O  O   . LYS A 1 30  ? -38.246 -15.853 46.299  1.00 21.60 ? 73  LYS A O   1 
ATOM   243  C  CB  . LYS A 1 30  ? -35.903 -16.523 44.965  1.00 22.15 ? 73  LYS A CB  1 
ATOM   244  C  CG  . LYS A 1 30  ? -34.643 -16.487 44.104  1.00 22.53 ? 73  LYS A CG  1 
ATOM   245  C  CD  . LYS A 1 30  ? -34.547 -15.212 43.259  1.00 23.63 ? 73  LYS A CD  1 
ATOM   246  C  CE  . LYS A 1 30  ? -33.163 -15.044 42.642  1.00 23.95 ? 73  LYS A CE  1 
ATOM   247  N  NZ  . LYS A 1 30  ? -33.109 -13.854 41.745  1.00 25.52 ? 73  LYS A NZ  1 
ATOM   248  N  N   . VAL A 1 31  ? -37.201 -15.316 48.197  1.00 21.33 ? 74  VAL A N   1 
ATOM   249  C  CA  . VAL A 1 31  ? -38.422 -15.203 48.997  1.00 21.30 ? 74  VAL A CA  1 
ATOM   250  C  C   . VAL A 1 31  ? -39.491 -14.276 48.350  1.00 20.90 ? 74  VAL A C   1 
ATOM   251  O  O   . VAL A 1 31  ? -40.683 -14.577 48.382  1.00 20.91 ? 74  VAL A O   1 
ATOM   252  C  CB  . VAL A 1 31  ? -38.085 -14.782 50.468  1.00 21.57 ? 74  VAL A CB  1 
ATOM   253  C  CG1 . VAL A 1 31  ? -37.672 -13.325 50.548  1.00 20.92 ? 74  VAL A CG1 1 
ATOM   254  C  CG2 . VAL A 1 31  ? -39.269 -15.054 51.406  1.00 22.54 ? 74  VAL A CG2 1 
ATOM   255  N  N   . HIS A 1 32  ? -39.058 -13.168 47.747  1.00 20.49 ? 75  HIS A N   1 
ATOM   256  C  CA  . HIS A 1 32  ? -39.979 -12.260 47.045  1.00 19.75 ? 75  HIS A CA  1 
ATOM   257  C  C   . HIS A 1 32  ? -40.759 -12.950 45.909  1.00 19.69 ? 75  HIS A C   1 
ATOM   258  O  O   . HIS A 1 32  ? -41.934 -12.641 45.698  1.00 19.46 ? 75  HIS A O   1 
ATOM   259  C  CB  . HIS A 1 32  ? -39.241 -11.024 46.522  1.00 19.39 ? 75  HIS A CB  1 
ATOM   260  C  CG  . HIS A 1 32  ? -38.036 -11.343 45.696  1.00 18.90 ? 75  HIS A CG  1 
ATOM   261  N  ND1 . HIS A 1 32  ? -37.010 -12.142 46.154  1.00 18.33 ? 75  HIS A ND1 1 
ATOM   262  C  CD2 . HIS A 1 32  ? -37.681 -10.953 44.449  1.00 18.41 ? 75  HIS A CD2 1 
ATOM   263  C  CE1 . HIS A 1 32  ? -36.074 -12.232 45.224  1.00 18.82 ? 75  HIS A CE1 1 
ATOM   264  N  NE2 . HIS A 1 32  ? -36.461 -11.528 44.175  1.00 19.21 ? 75  HIS A NE2 1 
ATOM   265  N  N   . LEU A 1 33  ? -40.114 -13.879 45.195  1.00 19.14 ? 76  LEU A N   1 
ATOM   266  C  CA  . LEU A 1 33  ? -40.805 -14.673 44.173  1.00 19.08 ? 76  LEU A CA  1 
ATOM   267  C  C   . LEU A 1 33  ? -41.784 -15.660 44.776  1.00 18.83 ? 76  LEU A C   1 
ATOM   268  O  O   . LEU A 1 33  ? -42.865 -15.883 44.235  1.00 18.85 ? 76  LEU A O   1 
ATOM   269  C  CB  . LEU A 1 33  ? -39.822 -15.404 43.259  1.00 18.85 ? 76  LEU A CB  1 
ATOM   270  C  CG  . LEU A 1 33  ? -38.895 -14.493 42.436  1.00 19.12 ? 76  LEU A CG  1 
ATOM   271  C  CD1 . LEU A 1 33  ? -38.121 -15.310 41.414  1.00 16.64 ? 76  LEU A CD1 1 
ATOM   272  C  CD2 . LEU A 1 33  ? -39.652 -13.301 41.774  1.00 18.07 ? 76  LEU A CD2 1 
ATOM   273  N  N   . HIS A 1 34  ? -41.398 -16.240 45.904  1.00 19.03 ? 77  HIS A N   1 
ATOM   274  C  CA  . HIS A 1 34  ? -42.243 -17.179 46.647  1.00 18.99 ? 77  HIS A CA  1 
ATOM   275  C  C   . HIS A 1 34  ? -43.593 -16.516 46.942  1.00 18.70 ? 77  HIS A C   1 
ATOM   276  O  O   . HIS A 1 34  ? -44.632 -17.132 46.727  1.00 18.45 ? 77  HIS A O   1 
ATOM   277  C  CB  . HIS A 1 34  ? -41.524 -17.625 47.926  1.00 18.95 ? 77  HIS A CB  1 
ATOM   278  C  CG  . HIS A 1 34  ? -42.288 -18.602 48.763  1.00 19.60 ? 77  HIS A CG  1 
ATOM   279  N  ND1 . HIS A 1 34  ? -42.444 -19.925 48.406  1.00 19.86 ? 77  HIS A ND1 1 
ATOM   280  C  CD2 . HIS A 1 34  ? -42.905 -18.458 49.963  1.00 19.98 ? 77  HIS A CD2 1 
ATOM   281  C  CE1 . HIS A 1 34  ? -43.146 -20.549 49.340  1.00 20.84 ? 77  HIS A CE1 1 
ATOM   282  N  NE2 . HIS A 1 34  ? -43.431 -19.684 50.302  1.00 18.75 ? 77  HIS A NE2 1 
ATOM   283  N  N   . HIS A 1 35  ? -43.561 -15.254 47.378  1.00 18.65 ? 78  HIS A N   1 
ATOM   284  C  CA  . HIS A 1 35  ? -44.778 -14.473 47.638  1.00 18.80 ? 78  HIS A CA  1 
ATOM   285  C  C   . HIS A 1 35  ? -45.623 -14.254 46.383  1.00 19.14 ? 78  HIS A C   1 
ATOM   286  O  O   . HIS A 1 35  ? -46.822 -14.508 46.400  1.00 19.46 ? 78  HIS A O   1 
ATOM   287  C  CB  . HIS A 1 35  ? -44.452 -13.128 48.302  1.00 18.85 ? 78  HIS A CB  1 
ATOM   288  C  CG  . HIS A 1 35  ? -43.770 -13.246 49.637  1.00 18.78 ? 78  HIS A CG  1 
ATOM   289  N  ND1 . HIS A 1 35  ? -43.006 -12.230 50.172  1.00 17.99 ? 78  HIS A ND1 1 
ATOM   290  C  CD2 . HIS A 1 35  ? -43.727 -14.259 50.536  1.00 18.55 ? 78  HIS A CD2 1 
ATOM   291  C  CE1 . HIS A 1 35  ? -42.529 -12.611 51.345  1.00 18.27 ? 78  HIS A CE1 1 
ATOM   292  N  NE2 . HIS A 1 35  ? -42.954 -13.837 51.590  1.00 17.99 ? 78  HIS A NE2 1 
ATOM   293  N  N   . VAL A 1 36  ? -44.997 -13.806 45.296  1.00 19.42 ? 79  VAL A N   1 
ATOM   294  C  CA  . VAL A 1 36  ? -45.690 -13.619 44.019  1.00 19.70 ? 79  VAL A CA  1 
ATOM   295  C  C   . VAL A 1 36  ? -46.398 -14.911 43.591  1.00 20.51 ? 79  VAL A C   1 
ATOM   296  O  O   . VAL A 1 36  ? -47.610 -14.919 43.319  1.00 20.38 ? 79  VAL A O   1 
ATOM   297  C  CB  . VAL A 1 36  ? -44.719 -13.149 42.900  1.00 19.64 ? 79  VAL A CB  1 
ATOM   298  C  CG1 . VAL A 1 36  ? -45.401 -13.142 41.533  1.00 17.83 ? 79  VAL A CG1 1 
ATOM   299  C  CG2 . VAL A 1 36  ? -44.174 -11.778 43.220  1.00 19.56 ? 79  VAL A CG2 1 
ATOM   300  N  N   . GLN A 1 37  ? -45.632 -15.997 43.547  1.00 21.34 ? 80  GLN A N   1 
ATOM   301  C  CA  . GLN A 1 37  ? -46.161 -17.303 43.161  1.00 22.21 ? 80  GLN A CA  1 
ATOM   302  C  C   . GLN A 1 37  ? -47.286 -17.738 44.098  1.00 22.24 ? 80  GLN A C   1 
ATOM   303  O  O   . GLN A 1 37  ? -48.305 -18.247 43.642  1.00 22.82 ? 80  GLN A O   1 
ATOM   304  C  CB  . GLN A 1 37  ? -45.051 -18.351 43.110  1.00 22.07 ? 80  GLN A CB  1 
ATOM   305  C  CG  . GLN A 1 37  ? -43.977 -18.077 42.054  1.00 23.71 ? 80  GLN A CG  1 
ATOM   306  C  CD  . GLN A 1 37  ? -42.736 -18.963 42.206  1.00 26.19 ? 80  GLN A CD  1 
ATOM   307  O  OE1 . GLN A 1 37  ? -42.507 -19.559 43.256  1.00 28.26 ? 80  GLN A OE1 1 
ATOM   308  N  NE2 . GLN A 1 37  ? -41.920 -19.026 41.162  1.00 28.20 ? 80  GLN A NE2 1 
ATOM   309  N  N   . ASN A 1 38  ? -47.118 -17.517 45.399  1.00 22.24 ? 81  ASN A N   1 
ATOM   310  C  CA  . ASN A 1 38  ? -48.148 -17.903 46.356  1.00 22.14 ? 81  ASN A CA  1 
ATOM   311  C  C   . ASN A 1 38  ? -49.476 -17.200 46.079  1.00 22.43 ? 81  ASN A C   1 
ATOM   312  O  O   . ASN A 1 38  ? -50.522 -17.834 46.095  1.00 22.70 ? 81  ASN A O   1 
ATOM   313  C  CB  . ASN A 1 38  ? -47.696 -17.647 47.800  1.00 22.00 ? 81  ASN A CB  1 
ATOM   314  C  CG  . ASN A 1 38  ? -46.861 -18.794 48.382  1.00 21.14 ? 81  ASN A CG  1 
ATOM   315  O  OD1 . ASN A 1 38  ? -46.984 -19.948 47.978  1.00 21.40 ? 81  ASN A OD1 1 
ATOM   316  N  ND2 . ASN A 1 38  ? -46.025 -18.470 49.354  1.00 19.06 ? 81  ASN A ND2 1 
ATOM   317  N  N   . PHE A 1 39  ? -49.432 -15.895 45.820  1.00 22.35 ? 82  PHE A N   1 
ATOM   318  C  CA  . PHE A 1 39  ? -50.649 -15.145 45.519  1.00 22.63 ? 82  PHE A CA  1 
ATOM   319  C  C   . PHE A 1 39  ? -51.326 -15.582 44.209  1.00 23.19 ? 82  PHE A C   1 
ATOM   320  O  O   . PHE A 1 39  ? -52.553 -15.613 44.124  1.00 23.10 ? 82  PHE A O   1 
ATOM   321  C  CB  . PHE A 1 39  ? -50.376 -13.645 45.501  1.00 21.99 ? 82  PHE A CB  1 
ATOM   322  C  CG  . PHE A 1 39  ? -50.190 -13.054 46.860  1.00 20.32 ? 82  PHE A CG  1 
ATOM   323  C  CD1 . PHE A 1 39  ? -48.985 -12.453 47.209  1.00 17.98 ? 82  PHE A CD1 1 
ATOM   324  C  CD2 . PHE A 1 39  ? -51.221 -13.090 47.794  1.00 18.61 ? 82  PHE A CD2 1 
ATOM   325  C  CE1 . PHE A 1 39  ? -48.814 -11.907 48.449  1.00 17.09 ? 82  PHE A CE1 1 
ATOM   326  C  CE2 . PHE A 1 39  ? -51.059 -12.541 49.048  1.00 17.56 ? 82  PHE A CE2 1 
ATOM   327  C  CZ  . PHE A 1 39  ? -49.851 -11.940 49.379  1.00 18.06 ? 82  PHE A CZ  1 
ATOM   328  N  N   . GLN A 1 40  ? -50.521 -15.916 43.207  1.00 23.96 ? 83  GLN A N   1 
ATOM   329  C  CA  . GLN A 1 40  ? -51.029 -16.469 41.960  1.00 25.39 ? 83  GLN A CA  1 
ATOM   330  C  C   . GLN A 1 40  ? -51.678 -17.834 42.172  1.00 25.94 ? 83  GLN A C   1 
ATOM   331  O  O   . GLN A 1 40  ? -52.555 -18.231 41.399  1.00 26.36 ? 83  GLN A O   1 
ATOM   332  C  CB  . GLN A 1 40  ? -49.905 -16.598 40.938  1.00 25.55 ? 83  GLN A CB  1 
ATOM   333  C  CG  . GLN A 1 40  ? -49.427 -15.275 40.361  1.00 28.65 ? 83  GLN A CG  1 
ATOM   334  C  CD  . GLN A 1 40  ? -48.135 -15.427 39.572  1.00 34.12 ? 83  GLN A CD  1 
ATOM   335  O  OE1 . GLN A 1 40  ? -47.543 -16.522 39.524  1.00 36.14 ? 83  GLN A OE1 1 
ATOM   336  N  NE2 . GLN A 1 40  ? -47.676 -14.327 38.958  1.00 34.16 ? 83  GLN A NE2 1 
ATOM   337  N  N   . LYS A 1 41  ? -51.248 -18.535 43.227  1.00 26.33 ? 84  LYS A N   1 
ATOM   338  C  CA  . LYS A 1 41  ? -51.714 -19.879 43.552  1.00 26.39 ? 84  LYS A CA  1 
ATOM   339  C  C   . LYS A 1 41  ? -52.949 -19.890 44.457  1.00 26.23 ? 84  LYS A C   1 
ATOM   340  O  O   . LYS A 1 41  ? -53.873 -20.671 44.223  1.00 25.99 ? 84  LYS A O   1 
ATOM   341  C  CB  . LYS A 1 41  ? -50.583 -20.640 44.227  1.00 27.02 ? 84  LYS A CB  1 
ATOM   342  C  CG  . LYS A 1 41  ? -50.547 -22.138 43.980  1.00 29.25 ? 84  LYS A CG  1 
ATOM   343  C  CD  . LYS A 1 41  ? -49.201 -22.718 44.425  1.00 32.61 ? 84  LYS A CD  1 
ATOM   344  C  CE  . LYS A 1 41  ? -48.049 -22.170 43.560  1.00 34.28 ? 84  LYS A CE  1 
ATOM   345  N  NZ  . LYS A 1 41  ? -46.704 -22.427 44.172  1.00 35.75 ? 84  LYS A NZ  1 
ATOM   346  N  N   . TYR A 1 42  ? -52.968 -19.023 45.475  1.00 25.96 ? 85  TYR A N   1 
ATOM   347  C  CA  . TYR A 1 42  ? -54.011 -19.044 46.516  1.00 25.91 ? 85  TYR A CA  1 
ATOM   348  C  C   . TYR A 1 42  ? -55.043 -17.894 46.469  1.00 25.25 ? 85  TYR A C   1 
ATOM   349  O  O   . TYR A 1 42  ? -56.031 -17.873 47.227  1.00 24.89 ? 85  TYR A O   1 
ATOM   350  C  CB  . TYR A 1 42  ? -53.361 -19.120 47.905  1.00 26.11 ? 85  TYR A CB  1 
ATOM   351  C  CG  . TYR A 1 42  ? -52.413 -20.298 48.080  1.00 28.39 ? 85  TYR A CG  1 
ATOM   352  C  CD1 . TYR A 1 42  ? -51.040 -20.094 48.203  1.00 30.00 ? 85  TYR A CD1 1 
ATOM   353  C  CD2 . TYR A 1 42  ? -52.890 -21.615 48.118  1.00 29.66 ? 85  TYR A CD2 1 
ATOM   354  C  CE1 . TYR A 1 42  ? -50.162 -21.155 48.354  1.00 31.16 ? 85  TYR A CE1 1 
ATOM   355  C  CE2 . TYR A 1 42  ? -52.016 -22.695 48.274  1.00 31.49 ? 85  TYR A CE2 1 
ATOM   356  C  CZ  . TYR A 1 42  ? -50.649 -22.456 48.391  1.00 32.15 ? 85  TYR A CZ  1 
ATOM   357  O  OH  . TYR A 1 42  ? -49.759 -23.503 48.533  1.00 31.81 ? 85  TYR A OH  1 
ATOM   358  N  N   . GLY A 1 43  ? -54.809 -16.936 45.586  1.00 24.67 ? 86  GLY A N   1 
ATOM   359  C  CA  . GLY A 1 43  ? -55.614 -15.731 45.576  1.00 24.14 ? 86  GLY A CA  1 
ATOM   360  C  C   . GLY A 1 43  ? -55.018 -14.695 46.504  1.00 24.03 ? 86  GLY A C   1 
ATOM   361  O  O   . GLY A 1 43  ? -53.876 -14.835 46.940  1.00 23.86 ? 86  GLY A O   1 
ATOM   362  N  N   . PRO A 1 44  ? -55.800 -13.649 46.821  1.00 24.15 ? 87  PRO A N   1 
ATOM   363  C  CA  . PRO A 1 44  ? -55.367 -12.406 47.479  1.00 23.88 ? 87  PRO A CA  1 
ATOM   364  C  C   . PRO A 1 44  ? -55.008 -12.513 48.957  1.00 23.90 ? 87  PRO A C   1 
ATOM   365  O  O   . PRO A 1 44  ? -54.469 -11.560 49.521  1.00 24.18 ? 87  PRO A O   1 
ATOM   366  C  CB  . PRO A 1 44  ? -56.593 -11.513 47.331  1.00 23.98 ? 87  PRO A CB  1 
ATOM   367  C  CG  . PRO A 1 44  ? -57.731 -12.483 47.342  1.00 23.68 ? 87  PRO A CG  1 
ATOM   368  C  CD  . PRO A 1 44  ? -57.243 -13.622 46.518  1.00 23.65 ? 87  PRO A CD  1 
ATOM   369  N  N   . ILE A 1 45  ? -55.326 -13.636 49.591  1.00 23.88 ? 88  ILE A N   1 
ATOM   370  C  CA  . ILE A 1 45  ? -54.951 -13.863 50.993  1.00 23.95 ? 88  ILE A CA  1 
ATOM   371  C  C   . ILE A 1 45  ? -54.588 -15.328 51.206  1.00 23.83 ? 88  ILE A C   1 
ATOM   372  O  O   . ILE A 1 45  ? -55.210 -16.217 50.622  1.00 23.84 ? 88  ILE A O   1 
ATOM   373  C  CB  . ILE A 1 45  ? -56.069 -13.394 51.983  1.00 24.22 ? 88  ILE A CB  1 
ATOM   374  C  CG1 . ILE A 1 45  ? -55.612 -13.510 53.442  1.00 24.66 ? 88  ILE A CG1 1 
ATOM   375  C  CG2 . ILE A 1 45  ? -57.398 -14.139 51.748  1.00 24.82 ? 88  ILE A CG2 1 
ATOM   376  C  CD1 . ILE A 1 45  ? -56.545 -12.849 54.438  1.00 25.31 ? 88  ILE A CD1 1 
ATOM   377  N  N   . TYR A 1 46  ? -53.550 -15.575 52.002  1.00 23.84 ? 89  TYR A N   1 
ATOM   378  C  CA  . TYR A 1 46  ? -53.155 -16.940 52.362  1.00 23.72 ? 89  TYR A CA  1 
ATOM   379  C  C   . TYR A 1 46  ? -52.411 -16.959 53.685  1.00 23.91 ? 89  TYR A C   1 
ATOM   380  O  O   . TYR A 1 46  ? -52.011 -15.918 54.185  1.00 23.87 ? 89  TYR A O   1 
ATOM   381  C  CB  . TYR A 1 46  ? -52.338 -17.627 51.248  1.00 23.43 ? 89  TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 46  ? -50.922 -17.122 51.070  1.00 23.26 ? 89  TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 46  ? -49.858 -17.712 51.763  1.00 23.34 ? 89  TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 46  ? -50.640 -16.057 50.208  1.00 21.80 ? 89  TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 46  ? -48.549 -17.252 51.608  1.00 22.49 ? 89  TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 46  ? -49.331 -15.590 50.040  1.00 22.48 ? 89  TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 46  ? -48.290 -16.193 50.746  1.00 23.08 ? 89  TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 46  ? -46.995 -15.747 50.593  1.00 22.56 ? 89  TYR A OH  1 
ATOM   389  N  N   . ARG A 1 47  ? -52.264 -18.152 54.255  1.00 24.69 ? 90  ARG A N   1 
ATOM   390  C  CA  . ARG A 1 47  ? -51.459 -18.364 55.462  1.00 25.25 ? 90  ARG A CA  1 
ATOM   391  C  C   . ARG A 1 47  ? -50.379 -19.390 55.159  1.00 25.43 ? 90  ARG A C   1 
ATOM   392  O  O   . ARG A 1 47  ? -50.587 -20.305 54.353  1.00 25.28 ? 90  ARG A O   1 
ATOM   393  C  CB  . ARG A 1 47  ? -52.316 -18.828 56.647  1.00 25.36 ? 90  ARG A CB  1 
ATOM   394  C  CG  . ARG A 1 47  ? -53.085 -20.093 56.405  1.00 26.57 ? 90  ARG A CG  1 
ATOM   395  C  CD  . ARG A 1 47  ? -53.949 -20.461 57.610  1.00 31.41 ? 90  ARG A CD  1 
ATOM   396  N  NE  . ARG A 1 47  ? -54.706 -21.698 57.369  1.00 34.51 ? 90  ARG A NE  1 
ATOM   397  C  CZ  . ARG A 1 47  ? -54.238 -22.928 57.586  1.00 35.44 ? 90  ARG A CZ  1 
ATOM   398  N  NH1 . ARG A 1 47  ? -53.010 -23.104 58.064  1.00 35.53 ? 90  ARG A NH1 1 
ATOM   399  N  NH2 . ARG A 1 47  ? -55.003 -23.989 57.326  1.00 36.04 ? 90  ARG A NH2 1 
ATOM   400  N  N   . GLU A 1 48  ? -49.216 -19.212 55.775  1.00 25.51 ? 91  GLU A N   1 
ATOM   401  C  CA  . GLU A 1 48  ? -48.136 -20.167 55.633  1.00 25.93 ? 91  GLU A CA  1 
ATOM   402  C  C   . GLU A 1 48  ? -47.345 -20.260 56.926  1.00 26.24 ? 91  GLU A C   1 
ATOM   403  O  O   . GLU A 1 48  ? -46.947 -19.252 57.512  1.00 25.97 ? 91  GLU A O   1 
ATOM   404  C  CB  . GLU A 1 48  ? -47.230 -19.823 54.447  1.00 26.04 ? 91  GLU A CB  1 
ATOM   405  C  CG  . GLU A 1 48  ? -46.268 -20.944 54.049  1.00 26.73 ? 91  GLU A CG  1 
ATOM   406  C  CD  . GLU A 1 48  ? -45.415 -20.619 52.826  1.00 28.49 ? 91  GLU A CD  1 
ATOM   407  O  OE1 . GLU A 1 48  ? -44.998 -19.454 52.657  1.00 28.18 ? 91  GLU A OE1 1 
ATOM   408  O  OE2 . GLU A 1 48  ? -45.132 -21.549 52.037  1.00 29.65 ? 91  GLU A OE2 1 
ATOM   409  N  N   . LYS A 1 49  ? -47.166 -21.491 57.387  1.00 26.91 ? 92  LYS A N   1 
ATOM   410  C  CA  . LYS A 1 49  ? -46.225 -21.775 58.457  1.00 27.27 ? 92  LYS A CA  1 
ATOM   411  C  C   . LYS A 1 49  ? -44.907 -22.130 57.791  1.00 26.98 ? 92  LYS A C   1 
ATOM   412  O  O   . LYS A 1 49  ? -44.856 -23.056 56.984  1.00 26.70 ? 92  LYS A O   1 
ATOM   413  C  CB  . LYS A 1 49  ? -46.712 -22.934 59.320  1.00 27.21 ? 92  LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 49  ? -46.067 -22.991 60.698  1.00 28.22 ? 92  LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 49  ? -46.577 -24.201 61.448  1.00 30.57 ? 92  LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 49  ? -46.533 -23.995 62.947  1.00 33.13 ? 92  LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 49  ? -47.233 -25.121 63.634  1.00 34.62 ? 92  LYS A NZ  1 
ATOM   418  N  N   . LEU A 1 50  ? -43.872 -21.343 58.088  1.00 27.00 ? 93  LEU A N   1 
ATOM   419  C  CA  . LEU A 1 50  ? -42.500 -21.630 57.668  1.00 26.83 ? 93  LEU A CA  1 
ATOM   420  C  C   . LEU A 1 50  ? -41.690 -21.919 58.923  1.00 27.51 ? 93  LEU A C   1 
ATOM   421  O  O   . LEU A 1 50  ? -41.574 -21.067 59.811  1.00 27.01 ? 93  LEU A O   1 
ATOM   422  C  CB  . LEU A 1 50  ? -41.900 -20.465 56.877  1.00 26.28 ? 93  LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 50  ? -42.390 -20.262 55.440  1.00 25.33 ? 93  LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 50  ? -41.722 -19.065 54.826  1.00 24.43 ? 93  LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 50  ? -42.150 -21.503 54.566  1.00 24.53 ? 93  LEU A CD2 1 
ATOM   426  N  N   . GLY A 1 51  ? -41.174 -23.145 59.017  1.00 28.62 ? 94  GLY A N   1 
ATOM   427  C  CA  . GLY A 1 51  ? -40.534 -23.616 60.247  1.00 29.49 ? 94  GLY A CA  1 
ATOM   428  C  C   . GLY A 1 51  ? -41.542 -23.532 61.376  1.00 30.25 ? 94  GLY A C   1 
ATOM   429  O  O   . GLY A 1 51  ? -42.563 -24.207 61.334  1.00 30.01 ? 94  GLY A O   1 
ATOM   430  N  N   . ASN A 1 52  ? -41.269 -22.682 62.367  1.00 31.29 ? 95  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 52  ? -42.187 -22.489 63.505  1.00 32.29 ? 95  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 52  ? -43.096 -21.267 63.414  1.00 32.14 ? 95  ASN A C   1 
ATOM   433  O  O   . ASN A 1 52  ? -44.059 -21.154 64.181  1.00 32.30 ? 95  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 52  ? -41.433 -22.467 64.844  1.00 32.70 ? 95  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 52  ? -41.241 -23.858 65.426  1.00 34.94 ? 95  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 52  ? -42.168 -24.684 65.429  1.00 37.58 ? 95  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 52  ? -40.030 -24.130 65.921  1.00 36.66 ? 95  ASN A ND2 1 
ATOM   438  N  N   . VAL A 1 53  ? -42.802 -20.364 62.481  1.00 31.83 ? 96  VAL A N   1 
ATOM   439  C  CA  . VAL A 1 53  ? -43.577 -19.126 62.355  1.00 31.34 ? 96  VAL A CA  1 
ATOM   440  C  C   . VAL A 1 53  ? -44.669 -19.181 61.280  1.00 30.58 ? 96  VAL A C   1 
ATOM   441  O  O   . VAL A 1 53  ? -44.402 -19.453 60.103  1.00 30.27 ? 96  VAL A O   1 
ATOM   442  C  CB  . VAL A 1 53  ? -42.646 -17.907 62.183  1.00 31.74 ? 96  VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 53  ? -43.439 -16.621 61.959  1.00 31.73 ? 96  VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 53  ? -41.764 -17.774 63.427  1.00 32.17 ? 96  VAL A CG2 1 
ATOM   445  N  N   . GLU A 1 54  ? -45.902 -18.934 61.719  1.00 29.83 ? 97  GLU A N   1 
ATOM   446  C  CA  . GLU A 1 54  ? -47.047 -18.794 60.824  1.00 29.49 ? 97  GLU A CA  1 
ATOM   447  C  C   . GLU A 1 54  ? -47.469 -17.334 60.625  1.00 28.75 ? 97  GLU A C   1 
ATOM   448  O  O   . GLU A 1 54  ? -47.650 -16.589 61.592  1.00 28.58 ? 97  GLU A O   1 
ATOM   449  C  CB  . GLU A 1 54  ? -48.242 -19.606 61.328  1.00 29.53 ? 97  GLU A CB  1 
ATOM   450  C  CG  . GLU A 1 54  ? -49.416 -19.604 60.364  1.00 31.21 ? 97  GLU A CG  1 
ATOM   451  C  CD  . GLU A 1 54  ? -50.466 -20.650 60.695  1.00 35.51 ? 97  GLU A CD  1 
ATOM   452  O  OE1 . GLU A 1 54  ? -50.801 -20.791 61.905  1.00 36.02 ? 97  GLU A OE1 1 
ATOM   453  O  OE2 . GLU A 1 54  ? -50.957 -21.316 59.733  1.00 36.17 ? 97  GLU A OE2 1 
ATOM   454  N  N   . SER A 1 55  ? -47.634 -16.946 59.361  1.00 27.97 ? 98  SER A N   1 
ATOM   455  C  CA  . SER A 1 55  ? -48.167 -15.637 59.014  1.00 27.39 ? 98  SER A CA  1 
ATOM   456  C  C   . SER A 1 55  ? -49.380 -15.775 58.103  1.00 26.48 ? 98  SER A C   1 
ATOM   457  O  O   . SER A 1 55  ? -49.522 -16.755 57.373  1.00 26.26 ? 98  SER A O   1 
ATOM   458  C  CB  . SER A 1 55  ? -47.107 -14.779 58.293  1.00 27.88 ? 98  SER A CB  1 
ATOM   459  O  OG  . SER A 1 55  ? -45.834 -14.826 58.922  1.00 29.17 ? 98  SER A OG  1 
ATOM   460  N  N   . VAL A 1 56  ? -50.251 -14.778 58.162  1.00 25.72 ? 99  VAL A N   1 
ATOM   461  C  CA  . VAL A 1 56  ? -51.247 -14.543 57.131  1.00 24.98 ? 99  VAL A CA  1 
ATOM   462  C  C   . VAL A 1 56  ? -50.611 -13.517 56.210  1.00 24.83 ? 99  VAL A C   1 
ATOM   463  O  O   . VAL A 1 56  ? -50.022 -12.544 56.684  1.00 24.98 ? 99  VAL A O   1 
ATOM   464  C  CB  . VAL A 1 56  ? -52.544 -13.967 57.741  1.00 25.26 ? 99  VAL A CB  1 
ATOM   465  C  CG1 . VAL A 1 56  ? -53.496 -13.453 56.657  1.00 23.85 ? 99  VAL A CG1 1 
ATOM   466  C  CG2 . VAL A 1 56  ? -53.230 -15.021 58.604  1.00 24.38 ? 99  VAL A CG2 1 
ATOM   467  N  N   . TYR A 1 57  ? -50.683 -13.751 54.905  1.00 24.35 ? 100 TYR A N   1 
ATOM   468  C  CA  . TYR A 1 57  ? -50.130 -12.810 53.930  1.00 24.25 ? 100 TYR A CA  1 
ATOM   469  C  C   . TYR A 1 57  ? -51.224 -12.121 53.139  1.00 24.09 ? 100 TYR A C   1 
ATOM   470  O  O   . TYR A 1 57  ? -52.161 -12.777 52.666  1.00 24.41 ? 100 TYR A O   1 
ATOM   471  C  CB  . TYR A 1 57  ? -49.186 -13.512 52.956  1.00 24.23 ? 100 TYR A CB  1 
ATOM   472  C  CG  . TYR A 1 57  ? -47.927 -14.038 53.590  1.00 23.74 ? 100 TYR A CG  1 
ATOM   473  C  CD1 . TYR A 1 57  ? -47.923 -15.276 54.233  1.00 24.25 ? 100 TYR A CD1 1 
ATOM   474  C  CD2 . TYR A 1 57  ? -46.745 -13.307 53.548  1.00 21.80 ? 100 TYR A CD2 1 
ATOM   475  C  CE1 . TYR A 1 57  ? -46.777 -15.777 54.805  1.00 24.56 ? 100 TYR A CE1 1 
ATOM   476  C  CE2 . TYR A 1 57  ? -45.586 -13.800 54.127  1.00 22.33 ? 100 TYR A CE2 1 
ATOM   477  C  CZ  . TYR A 1 57  ? -45.611 -15.033 54.757  1.00 22.85 ? 100 TYR A CZ  1 
ATOM   478  O  OH  . TYR A 1 57  ? -44.490 -15.552 55.335  1.00 21.14 ? 100 TYR A OH  1 
ATOM   479  N  N   . VAL A 1 58  ? -51.098 -10.801 52.999  1.00 23.91 ? 101 VAL A N   1 
ATOM   480  C  CA  . VAL A 1 58  ? -52.036 -9.998  52.198  1.00 23.24 ? 101 VAL A CA  1 
ATOM   481  C  C   . VAL A 1 58  ? -51.303 -9.151  51.158  1.00 23.18 ? 101 VAL A C   1 
ATOM   482  O  O   . VAL A 1 58  ? -50.122 -8.860  51.311  1.00 22.91 ? 101 VAL A O   1 
ATOM   483  C  CB  . VAL A 1 58  ? -52.958 -9.119  53.079  1.00 23.25 ? 101 VAL A CB  1 
ATOM   484  C  CG1 . VAL A 1 58  ? -53.862 -9.987  53.962  1.00 23.19 ? 101 VAL A CG1 1 
ATOM   485  C  CG2 . VAL A 1 58  ? -52.157 -8.137  53.927  1.00 22.61 ? 101 VAL A CG2 1 
ATOM   486  N  N   . ILE A 1 59  ? -52.027 -8.765  50.109  1.00 23.78 ? 102 ILE A N   1 
ATOM   487  C  CA  . ILE A 1 59  ? -51.495 -8.016  48.957  1.00 23.88 ? 102 ILE A CA  1 
ATOM   488  C  C   . ILE A 1 59  ? -52.352 -6.782  48.598  1.00 24.77 ? 102 ILE A C   1 
ATOM   489  O  O   . ILE A 1 59  ? -51.825 -5.783  48.093  1.00 24.79 ? 102 ILE A O   1 
ATOM   490  C  CB  . ILE A 1 59  ? -51.345 -8.935  47.710  1.00 23.65 ? 102 ILE A CB  1 
ATOM   491  C  CG1 . ILE A 1 59  ? -50.504 -8.245  46.617  1.00 23.12 ? 102 ILE A CG1 1 
ATOM   492  C  CG2 . ILE A 1 59  ? -52.731 -9.407  47.203  1.00 22.93 ? 102 ILE A CG2 1 
ATOM   493  C  CD1 . ILE A 1 59  ? -50.027 -9.156  45.494  1.00 21.11 ? 102 ILE A CD1 1 
ATOM   494  N  N   . ASP A 1 60  ? -53.660 -6.860  48.876  1.00 25.22 ? 103 ASP A N   1 
ATOM   495  C  CA  . ASP A 1 60  ? -54.635 -5.819  48.518  1.00 25.54 ? 103 ASP A CA  1 
ATOM   496  C  C   . ASP A 1 60  ? -54.586 -4.593  49.423  1.00 25.72 ? 103 ASP A C   1 
ATOM   497  O  O   . ASP A 1 60  ? -54.801 -4.711  50.633  1.00 25.36 ? 103 ASP A O   1 
ATOM   498  C  CB  . ASP A 1 60  ? -56.060 -6.394  48.537  1.00 25.83 ? 103 ASP A CB  1 
ATOM   499  C  CG  . ASP A 1 60  ? -57.094 -5.462  47.898  1.00 26.87 ? 103 ASP A CG  1 
ATOM   500  O  OD1 . ASP A 1 60  ? -57.152 -4.257  48.231  1.00 26.68 ? 103 ASP A OD1 1 
ATOM   501  O  OD2 . ASP A 1 60  ? -57.875 -5.955  47.062  1.00 29.25 ? 103 ASP A OD2 1 
ATOM   502  N  N   . PRO A 1 61  ? -54.375 -3.394  48.829  1.00 26.17 ? 104 PRO A N   1 
ATOM   503  C  CA  . PRO A 1 61  ? -54.285 -2.180  49.645  1.00 26.76 ? 104 PRO A CA  1 
ATOM   504  C  C   . PRO A 1 61  ? -55.512 -1.949  50.530  1.00 27.86 ? 104 PRO A C   1 
ATOM   505  O  O   . PRO A 1 61  ? -55.410 -1.255  51.549  1.00 28.36 ? 104 PRO A O   1 
ATOM   506  C  CB  . PRO A 1 61  ? -54.139 -1.067  48.606  1.00 26.37 ? 104 PRO A CB  1 
ATOM   507  C  CG  . PRO A 1 61  ? -53.598 -1.739  47.403  1.00 25.76 ? 104 PRO A CG  1 
ATOM   508  C  CD  . PRO A 1 61  ? -54.225 -3.094  47.393  1.00 25.56 ? 104 PRO A CD  1 
ATOM   509  N  N   . GLU A 1 62  ? -56.653 -2.534  50.161  1.00 28.86 ? 105 GLU A N   1 
ATOM   510  C  CA  . GLU A 1 62  ? -57.872 -2.436  50.974  1.00 30.12 ? 105 GLU A CA  1 
ATOM   511  C  C   . GLU A 1 62  ? -57.803 -3.263  52.280  1.00 29.90 ? 105 GLU A C   1 
ATOM   512  O  O   . GLU A 1 62  ? -58.295 -2.827  53.330  1.00 30.10 ? 105 GLU A O   1 
ATOM   513  C  CB  . GLU A 1 62  ? -59.095 -2.815  50.136  1.00 30.87 ? 105 GLU A CB  1 
ATOM   514  C  CG  . GLU A 1 62  ? -60.432 -2.408  50.749  1.00 34.83 ? 105 GLU A CG  1 
ATOM   515  C  CD  . GLU A 1 62  ? -60.563 -0.899  50.883  1.00 39.48 ? 105 GLU A CD  1 
ATOM   516  O  OE1 . GLU A 1 62  ? -60.859 -0.233  49.857  1.00 41.19 ? 105 GLU A OE1 1 
ATOM   517  O  OE2 . GLU A 1 62  ? -60.361 -0.389  52.014  1.00 40.35 ? 105 GLU A OE2 1 
ATOM   518  N  N   . ASP A 1 63  ? -57.202 -4.453  52.202  1.00 29.77 ? 106 ASP A N   1 
ATOM   519  C  CA  . ASP A 1 63  ? -56.882 -5.270  53.387  1.00 29.36 ? 106 ASP A CA  1 
ATOM   520  C  C   . ASP A 1 63  ? -55.798 -4.595  54.233  1.00 29.15 ? 106 ASP A C   1 
ATOM   521  O  O   . ASP A 1 63  ? -55.866 -4.601  55.469  1.00 28.89 ? 106 ASP A O   1 
ATOM   522  C  CB  . ASP A 1 63  ? -56.427 -6.684  52.977  1.00 29.27 ? 106 ASP A CB  1 
ATOM   523  C  CG  . ASP A 1 63  ? -57.482 -7.440  52.171  1.00 29.43 ? 106 ASP A CG  1 
ATOM   524  O  OD1 . ASP A 1 63  ? -58.683 -7.240  52.425  1.00 30.35 ? 106 ASP A OD1 1 
ATOM   525  O  OD2 . ASP A 1 63  ? -57.117 -8.243  51.281  1.00 28.92 ? 106 ASP A OD2 1 
ATOM   526  N  N   . VAL A 1 64  ? -54.810 -4.009  53.557  1.00 29.05 ? 107 VAL A N   1 
ATOM   527  C  CA  . VAL A 1 64  ? -53.743 -3.266  54.219  1.00 29.49 ? 107 VAL A CA  1 
ATOM   528  C  C   . VAL A 1 64  ? -54.335 -2.154  55.079  1.00 30.07 ? 107 VAL A C   1 
ATOM   529  O  O   . VAL A 1 64  ? -53.929 -1.978  56.226  1.00 30.20 ? 107 VAL A O   1 
ATOM   530  C  CB  . VAL A 1 64  ? -52.723 -2.658  53.201  1.00 29.44 ? 107 VAL A CB  1 
ATOM   531  C  CG1 . VAL A 1 64  ? -51.585 -1.947  53.910  1.00 28.83 ? 107 VAL A CG1 1 
ATOM   532  C  CG2 . VAL A 1 64  ? -52.153 -3.724  52.322  1.00 29.21 ? 107 VAL A CG2 1 
ATOM   533  N  N   . ALA A 1 65  ? -55.305 -1.424  54.527  1.00 30.80 ? 108 ALA A N   1 
ATOM   534  C  CA  . ALA A 1 65  ? -55.916 -0.286  55.220  1.00 31.51 ? 108 ALA A CA  1 
ATOM   535  C  C   . ALA A 1 65  ? -56.632 -0.722  56.493  1.00 32.06 ? 108 ALA A C   1 
ATOM   536  O  O   . ALA A 1 65  ? -56.545 -0.050  57.531  1.00 31.71 ? 108 ALA A O   1 
ATOM   537  C  CB  . ALA A 1 65  ? -56.867 0.462   54.296  1.00 31.56 ? 108 ALA A CB  1 
ATOM   538  N  N   . LEU A 1 66  ? -57.317 -1.862  56.406  1.00 32.67 ? 109 LEU A N   1 
ATOM   539  C  CA  . LEU A 1 66  ? -57.995 -2.446  57.558  1.00 33.32 ? 109 LEU A CA  1 
ATOM   540  C  C   . LEU A 1 66  ? -56.991 -2.888  58.613  1.00 33.74 ? 109 LEU A C   1 
ATOM   541  O  O   . LEU A 1 66  ? -57.227 -2.710  59.820  1.00 33.81 ? 109 LEU A O   1 
ATOM   542  C  CB  . LEU A 1 66  ? -58.897 -3.610  57.133  1.00 33.39 ? 109 LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 66  ? -60.114 -3.252  56.260  1.00 33.96 ? 109 LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 66  ? -60.745 -4.503  55.661  1.00 34.16 ? 109 LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 66  ? -61.172 -2.432  57.025  1.00 33.21 ? 109 LEU A CD2 1 
ATOM   546  N  N   . LEU A 1 67  ? -55.868 -3.446  58.158  1.00 34.11 ? 110 LEU A N   1 
ATOM   547  C  CA  . LEU A 1 67  ? -54.831 -3.904  59.070  1.00 34.49 ? 110 LEU A CA  1 
ATOM   548  C  C   . LEU A 1 67  ? -54.305 -2.731  59.894  1.00 35.30 ? 110 LEU A C   1 
ATOM   549  O  O   . LEU A 1 67  ? -54.344 -2.750  61.122  1.00 35.26 ? 110 LEU A O   1 
ATOM   550  C  CB  . LEU A 1 67  ? -53.693 -4.599  58.313  1.00 34.11 ? 110 LEU A CB  1 
ATOM   551  C  CG  . LEU A 1 67  ? -52.412 -4.809  59.129  1.00 33.14 ? 110 LEU A CG  1 
ATOM   552  C  CD1 . LEU A 1 67  ? -52.592 -5.907  60.146  1.00 32.53 ? 110 LEU A CD1 1 
ATOM   553  C  CD2 . LEU A 1 67  ? -51.243 -5.109  58.243  1.00 33.17 ? 110 LEU A CD2 1 
ATOM   554  N  N   . PHE A 1 68  ? -53.835 -1.702  59.206  1.00 36.58 ? 111 PHE A N   1 
ATOM   555  C  CA  . PHE A 1 68  ? -53.242 -0.555  59.871  1.00 37.99 ? 111 PHE A CA  1 
ATOM   556  C  C   . PHE A 1 68  ? -54.278 0.291   60.613  1.00 38.98 ? 111 PHE A C   1 
ATOM   557  O  O   . PHE A 1 68  ? -53.920 1.077   61.489  1.00 39.31 ? 111 PHE A O   1 
ATOM   558  C  CB  . PHE A 1 68  ? -52.420 0.278   58.878  1.00 37.78 ? 111 PHE A CB  1 
ATOM   559  C  CG  . PHE A 1 68  ? -51.072 -0.331  58.541  1.00 38.10 ? 111 PHE A CG  1 
ATOM   560  C  CD1 . PHE A 1 68  ? -50.831 -0.884  57.282  1.00 38.80 ? 111 PHE A CD1 1 
ATOM   561  C  CD2 . PHE A 1 68  ? -50.048 -0.366  59.486  1.00 37.54 ? 111 PHE A CD2 1 
ATOM   562  C  CE1 . PHE A 1 68  ? -49.588 -1.451  56.965  1.00 38.19 ? 111 PHE A CE1 1 
ATOM   563  C  CE2 . PHE A 1 68  ? -48.814 -0.928  59.180  1.00 37.67 ? 111 PHE A CE2 1 
ATOM   564  C  CZ  . PHE A 1 68  ? -48.585 -1.472  57.910  1.00 37.45 ? 111 PHE A CZ  1 
ATOM   565  N  N   . LYS A 1 69  ? -55.554 0.107   60.275  1.00 40.14 ? 112 LYS A N   1 
ATOM   566  C  CA  . LYS A 1 69  ? -56.651 0.807   60.946  1.00 41.23 ? 112 LYS A CA  1 
ATOM   567  C  C   . LYS A 1 69  ? -56.777 0.360   62.399  1.00 41.32 ? 112 LYS A C   1 
ATOM   568  O  O   . LYS A 1 69  ? -56.926 1.189   63.295  1.00 41.69 ? 112 LYS A O   1 
ATOM   569  C  CB  . LYS A 1 69  ? -57.980 0.583   60.208  1.00 41.71 ? 112 LYS A CB  1 
ATOM   570  C  CG  . LYS A 1 69  ? -58.812 1.858   59.991  1.00 43.54 ? 112 LYS A CG  1 
ATOM   571  C  CD  . LYS A 1 69  ? -58.139 2.843   58.993  1.00 45.62 ? 112 LYS A CD  1 
ATOM   572  C  CE  . LYS A 1 69  ? -58.717 4.273   59.124  1.00 46.85 ? 112 LYS A CE  1 
ATOM   573  N  NZ  . LYS A 1 69  ? -58.073 5.271   58.210  1.00 46.28 ? 112 LYS A NZ  1 
ATOM   574  N  N   . SER A 1 70  ? -56.689 -0.947  62.629  1.00 41.29 ? 113 SER A N   1 
ATOM   575  C  CA  . SER A 1 70  ? -56.860 -1.514  63.966  1.00 41.38 ? 113 SER A CA  1 
ATOM   576  C  C   . SER A 1 70  ? -55.565 -1.559  64.770  1.00 41.27 ? 113 SER A C   1 
ATOM   577  O  O   . SER A 1 70  ? -55.525 -2.131  65.860  1.00 41.27 ? 113 SER A O   1 
ATOM   578  C  CB  . SER A 1 70  ? -57.437 -2.927  63.869  1.00 41.70 ? 113 SER A CB  1 
ATOM   579  O  OG  . SER A 1 70  ? -56.550 -3.764  63.149  1.00 42.39 ? 113 SER A OG  1 
ATOM   580  N  N   . GLU A 1 71  ? -54.508 -0.959  64.237  1.00 40.86 ? 114 GLU A N   1 
ATOM   581  C  CA  . GLU A 1 71  ? -53.239 -0.922  64.935  1.00 40.33 ? 114 GLU A CA  1 
ATOM   582  C  C   . GLU A 1 71  ? -53.339 -0.267  66.321  1.00 40.00 ? 114 GLU A C   1 
ATOM   583  O  O   . GLU A 1 71  ? -54.033 0.742   66.495  1.00 39.88 ? 114 GLU A O   1 
ATOM   584  C  CB  . GLU A 1 71  ? -52.215 -0.190  64.093  1.00 40.45 ? 114 GLU A CB  1 
ATOM   585  C  CG  . GLU A 1 71  ? -50.827 -0.734  64.250  1.00 40.85 ? 114 GLU A CG  1 
ATOM   586  C  CD  . GLU A 1 71  ? -49.866 -0.062  63.321  1.00 40.97 ? 114 GLU A CD  1 
ATOM   587  O  OE1 . GLU A 1 71  ? -49.691 1.169   63.422  1.00 41.06 ? 114 GLU A OE1 1 
ATOM   588  O  OE2 . GLU A 1 71  ? -49.290 -0.769  62.481  1.00 42.09 ? 114 GLU A OE2 1 
ATOM   589  N  N   . GLY A 1 72  ? -52.640 -0.857  67.293  1.00 39.38 ? 115 GLY A N   1 
ATOM   590  C  CA  . GLY A 1 72  ? -52.622 -0.362  68.667  1.00 38.54 ? 115 GLY A CA  1 
ATOM   591  C  C   . GLY A 1 72  ? -51.630 0.767   68.891  1.00 37.90 ? 115 GLY A C   1 
ATOM   592  O  O   . GLY A 1 72  ? -50.950 1.182   67.960  1.00 38.14 ? 115 GLY A O   1 
ATOM   593  N  N   . PRO A 1 73  ? -51.547 1.279   70.131  1.00 37.29 ? 116 PRO A N   1 
ATOM   594  C  CA  . PRO A 1 73  ? -50.620 2.377   70.434  1.00 36.81 ? 116 PRO A CA  1 
ATOM   595  C  C   . PRO A 1 73  ? -49.133 2.005   70.302  1.00 36.22 ? 116 PRO A C   1 
ATOM   596  O  O   . PRO A 1 73  ? -48.323 2.873   69.976  1.00 36.15 ? 116 PRO A O   1 
ATOM   597  C  CB  . PRO A 1 73  ? -50.951 2.729   71.892  1.00 36.92 ? 116 PRO A CB  1 
ATOM   598  C  CG  . PRO A 1 73  ? -51.587 1.488   72.458  1.00 37.24 ? 116 PRO A CG  1 
ATOM   599  C  CD  . PRO A 1 73  ? -52.343 0.880   71.310  1.00 37.17 ? 116 PRO A CD  1 
ATOM   600  N  N   . ASN A 1 74  ? -48.788 0.739   70.566  1.00 35.51 ? 117 ASN A N   1 
ATOM   601  C  CA  . ASN A 1 74  ? -47.402 0.248   70.452  1.00 34.53 ? 117 ASN A CA  1 
ATOM   602  C  C   . ASN A 1 74  ? -47.273 -1.000  69.558  1.00 33.14 ? 117 ASN A C   1 
ATOM   603  O  O   . ASN A 1 74  ? -47.143 -2.116  70.066  1.00 32.56 ? 117 ASN A O   1 
ATOM   604  C  CB  . ASN A 1 74  ? -46.809 -0.050  71.837  1.00 35.30 ? 117 ASN A CB  1 
ATOM   605  C  CG  . ASN A 1 74  ? -46.950 1.115   72.807  1.00 36.58 ? 117 ASN A CG  1 
ATOM   606  O  OD1 . ASN A 1 74  ? -46.118 2.023   72.848  1.00 38.19 ? 117 ASN A OD1 1 
ATOM   607  N  ND2 . ASN A 1 74  ? -48.006 1.079   73.605  1.00 39.11 ? 117 ASN A ND2 1 
ATOM   608  N  N   . PRO A 1 75  ? -47.295 -0.813  68.222  1.00 31.91 ? 118 PRO A N   1 
ATOM   609  C  CA  . PRO A 1 75  ? -47.267 -1.938  67.273  1.00 30.95 ? 118 PRO A CA  1 
ATOM   610  C  C   . PRO A 1 75  ? -45.985 -2.779  67.300  1.00 29.89 ? 118 PRO A C   1 
ATOM   611  O  O   . PRO A 1 75  ? -44.910 -2.272  67.603  1.00 29.63 ? 118 PRO A O   1 
ATOM   612  C  CB  . PRO A 1 75  ? -47.414 -1.251  65.905  1.00 30.84 ? 118 PRO A CB  1 
ATOM   613  C  CG  . PRO A 1 75  ? -46.980 0.137   66.122  1.00 30.97 ? 118 PRO A CG  1 
ATOM   614  C  CD  . PRO A 1 75  ? -47.349 0.483   67.525  1.00 31.49 ? 118 PRO A CD  1 
ATOM   615  N  N   . GLU A 1 76  ? -46.119 -4.060  66.972  1.00 28.96 ? 119 GLU A N   1 
ATOM   616  C  CA  . GLU A 1 76  ? -44.979 -4.963  66.855  1.00 28.06 ? 119 GLU A CA  1 
ATOM   617  C  C   . GLU A 1 76  ? -44.925 -5.570  65.463  1.00 26.63 ? 119 GLU A C   1 
ATOM   618  O  O   . GLU A 1 76  ? -45.955 -5.947  64.905  1.00 26.23 ? 119 GLU A O   1 
ATOM   619  C  CB  . GLU A 1 76  ? -45.047 -6.066  67.911  1.00 28.35 ? 119 GLU A CB  1 
ATOM   620  C  CG  . GLU A 1 76  ? -44.726 -5.590  69.326  1.00 30.87 ? 119 GLU A CG  1 
ATOM   621  C  CD  . GLU A 1 76  ? -45.101 -6.632  70.376  1.00 35.23 ? 119 GLU A CD  1 
ATOM   622  O  OE1 . GLU A 1 76  ? -44.194 -7.363  70.847  1.00 36.46 ? 119 GLU A OE1 1 
ATOM   623  O  OE2 . GLU A 1 76  ? -46.307 -6.739  70.710  1.00 36.39 ? 119 GLU A OE2 1 
ATOM   624  N  N   . ARG A 1 77  ? -43.720 -5.629  64.900  1.00 25.27 ? 120 ARG A N   1 
ATOM   625  C  CA  . ARG A 1 77  ? -43.488 -6.272  63.609  1.00 23.95 ? 120 ARG A CA  1 
ATOM   626  C  C   . ARG A 1 77  ? -42.740 -7.579  63.856  1.00 23.25 ? 120 ARG A C   1 
ATOM   627  O  O   . ARG A 1 77  ? -42.462 -7.907  65.000  1.00 23.30 ? 120 ARG A O   1 
ATOM   628  C  CB  . ARG A 1 77  ? -42.698 -5.350  62.678  1.00 23.80 ? 120 ARG A CB  1 
ATOM   629  C  CG  . ARG A 1 77  ? -41.222 -5.224  63.002  1.00 22.63 ? 120 ARG A CG  1 
ATOM   630  C  CD  . ARG A 1 77  ? -40.485 -4.478  61.917  1.00 20.91 ? 120 ARG A CD  1 
ATOM   631  N  NE  . ARG A 1 77  ? -40.829 -3.051  61.873  1.00 21.61 ? 120 ARG A NE  1 
ATOM   632  C  CZ  . ARG A 1 77  ? -40.304 -2.109  62.656  1.00 20.10 ? 120 ARG A CZ  1 
ATOM   633  N  NH1 . ARG A 1 77  ? -39.407 -2.403  63.584  1.00 18.44 ? 120 ARG A NH1 1 
ATOM   634  N  NH2 . ARG A 1 77  ? -40.689 -0.854  62.513  1.00 22.08 ? 120 ARG A NH2 1 
ATOM   635  N  N   . PHE A 1 78  ? -42.413 -8.329  62.806  1.00 22.27 ? 121 PHE A N   1 
ATOM   636  C  CA  . PHE A 1 78  ? -41.635 -9.547  62.990  1.00 21.24 ? 121 PHE A CA  1 
ATOM   637  C  C   . PHE A 1 78  ? -40.219 -9.179  63.422  1.00 20.89 ? 121 PHE A C   1 
ATOM   638  O  O   . PHE A 1 78  ? -39.608 -8.276  62.857  1.00 20.60 ? 121 PHE A O   1 
ATOM   639  C  CB  . PHE A 1 78  ? -41.618 -10.390 61.715  1.00 21.30 ? 121 PHE A CB  1 
ATOM   640  C  CG  . PHE A 1 78  ? -40.884 -11.706 61.857  1.00 20.31 ? 121 PHE A CG  1 
ATOM   641  C  CD1 . PHE A 1 78  ? -41.378 -12.711 62.688  1.00 19.68 ? 121 PHE A CD1 1 
ATOM   642  C  CD2 . PHE A 1 78  ? -39.717 -11.944 61.138  1.00 20.51 ? 121 PHE A CD2 1 
ATOM   643  C  CE1 . PHE A 1 78  ? -40.711 -13.926 62.818  1.00 20.32 ? 121 PHE A CE1 1 
ATOM   644  C  CE2 . PHE A 1 78  ? -39.031 -13.162 61.259  1.00 21.03 ? 121 PHE A CE2 1 
ATOM   645  C  CZ  . PHE A 1 78  ? -39.528 -14.156 62.105  1.00 20.06 ? 121 PHE A CZ  1 
ATOM   646  N  N   . LEU A 1 79  ? -39.738 -9.854  64.461  1.00 20.47 ? 122 LEU A N   1 
ATOM   647  C  CA  . LEU A 1 79  ? -38.374 -9.705  64.952  1.00 19.83 ? 122 LEU A CA  1 
ATOM   648  C  C   . LEU A 1 79  ? -37.522 -10.790 64.325  1.00 19.67 ? 122 LEU A C   1 
ATOM   649  O  O   . LEU A 1 79  ? -37.927 -11.957 64.248  1.00 19.23 ? 122 LEU A O   1 
ATOM   650  C  CB  . LEU A 1 79  ? -38.324 -9.819  66.476  1.00 19.86 ? 122 LEU A CB  1 
ATOM   651  C  CG  . LEU A 1 79  ? -38.912 -8.667  67.311  1.00 20.62 ? 122 LEU A CG  1 
ATOM   652  C  CD1 . LEU A 1 79  ? -38.979 -9.037  68.812  1.00 18.83 ? 122 LEU A CD1 1 
ATOM   653  C  CD2 . LEU A 1 79  ? -38.115 -7.371  67.110  1.00 19.33 ? 122 LEU A CD2 1 
ATOM   654  N  N   . ILE A 1 80  ? -36.344 -10.399 63.863  1.00 19.25 ? 123 ILE A N   1 
ATOM   655  C  CA  . ILE A 1 80  ? -35.460 -11.329 63.182  1.00 19.06 ? 123 ILE A CA  1 
ATOM   656  C  C   . ILE A 1 80  ? -34.679 -12.158 64.212  1.00 18.84 ? 123 ILE A C   1 
ATOM   657  O  O   . ILE A 1 80  ? -33.877 -11.625 64.968  1.00 18.76 ? 123 ILE A O   1 
ATOM   658  C  CB  . ILE A 1 80  ? -34.583 -10.594 62.153  1.00 19.15 ? 123 ILE A CB  1 
ATOM   659  C  CG1 . ILE A 1 80  ? -35.477 -10.142 60.995  1.00 19.36 ? 123 ILE A CG1 1 
ATOM   660  C  CG2 . ILE A 1 80  ? -33.473 -11.498 61.625  1.00 19.32 ? 123 ILE A CG2 1 
ATOM   661  C  CD1 . ILE A 1 80  ? -34.946 -9.014  60.249  1.00 21.26 ? 123 ILE A CD1 1 
ATOM   662  N  N   . PRO A 1 81  ? -34.946 -13.474 64.254  1.00 18.72 ? 124 PRO A N   1 
ATOM   663  C  CA  . PRO A 1 81  ? -34.420 -14.338 65.308  1.00 18.52 ? 124 PRO A CA  1 
ATOM   664  C  C   . PRO A 1 81  ? -32.888 -14.305 65.475  1.00 18.07 ? 124 PRO A C   1 
ATOM   665  O  O   . PRO A 1 81  ? -32.412 -14.147 66.600  1.00 17.06 ? 124 PRO A O   1 
ATOM   666  C  CB  . PRO A 1 81  ? -34.926 -15.728 64.893  1.00 18.47 ? 124 PRO A CB  1 
ATOM   667  C  CG  . PRO A 1 81  ? -36.185 -15.429 64.139  1.00 18.48 ? 124 PRO A CG  1 
ATOM   668  C  CD  . PRO A 1 81  ? -35.800 -14.236 63.320  1.00 18.68 ? 124 PRO A CD  1 
ATOM   669  N  N   . PRO A 1 82  ? -32.116 -14.431 64.371  1.00 18.43 ? 125 PRO A N   1 
ATOM   670  C  CA  . PRO A 1 82  ? -30.667 -14.295 64.594  1.00 18.37 ? 125 PRO A CA  1 
ATOM   671  C  C   . PRO A 1 82  ? -30.286 -12.967 65.260  1.00 18.40 ? 125 PRO A C   1 
ATOM   672  O  O   . PRO A 1 82  ? -29.446 -12.971 66.141  1.00 19.38 ? 125 PRO A O   1 
ATOM   673  C  CB  . PRO A 1 82  ? -30.063 -14.413 63.189  1.00 18.09 ? 125 PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 82  ? -31.182 -14.241 62.249  1.00 18.15 ? 125 PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 82  ? -32.431 -14.671 62.948  1.00 18.20 ? 125 PRO A CD  1 
ATOM   676  N  N   . TRP A 1 83  ? -30.914 -11.858 64.879  1.00 18.12 ? 126 TRP A N   1 
ATOM   677  C  CA  . TRP A 1 83  ? -30.606 -10.555 65.491  1.00 17.86 ? 126 TRP A CA  1 
ATOM   678  C  C   . TRP A 1 83  ? -30.923 -10.562 66.981  1.00 17.99 ? 126 TRP A C   1 
ATOM   679  O  O   . TRP A 1 83  ? -30.097 -10.142 67.802  1.00 17.65 ? 126 TRP A O   1 
ATOM   680  C  CB  . TRP A 1 83  ? -31.359 -9.409  64.790  1.00 17.40 ? 126 TRP A CB  1 
ATOM   681  C  CG  . TRP A 1 83  ? -31.020 -9.221  63.324  1.00 16.63 ? 126 TRP A CG  1 
ATOM   682  C  CD1 . TRP A 1 83  ? -30.209 -10.010 62.554  1.00 17.26 ? 126 TRP A CD1 1 
ATOM   683  C  CD2 . TRP A 1 83  ? -31.516 -8.193  62.454  1.00 16.82 ? 126 TRP A CD2 1 
ATOM   684  N  NE1 . TRP A 1 83  ? -30.162 -9.531  61.261  1.00 16.99 ? 126 TRP A NE1 1 
ATOM   685  C  CE2 . TRP A 1 83  ? -30.958 -8.421  61.172  1.00 15.73 ? 126 TRP A CE2 1 
ATOM   686  C  CE3 . TRP A 1 83  ? -32.382 -7.100  62.632  1.00 17.00 ? 126 TRP A CE3 1 
ATOM   687  C  CZ2 . TRP A 1 83  ? -31.228 -7.599  60.078  1.00 15.19 ? 126 TRP A CZ2 1 
ATOM   688  C  CZ3 . TRP A 1 83  ? -32.669 -6.288  61.527  1.00 17.94 ? 126 TRP A CZ3 1 
ATOM   689  C  CH2 . TRP A 1 83  ? -32.089 -6.546  60.266  1.00 16.19 ? 126 TRP A CH2 1 
ATOM   690  N  N   . VAL A 1 84  ? -32.119 -11.040 67.323  1.00 18.48 ? 127 VAL A N   1 
ATOM   691  C  CA  . VAL A 1 84  ? -32.570 -11.102 68.715  1.00 19.04 ? 127 VAL A CA  1 
ATOM   692  C  C   . VAL A 1 84  ? -31.633 -11.956 69.578  1.00 19.77 ? 127 VAL A C   1 
ATOM   693  O  O   . VAL A 1 84  ? -31.214 -11.519 70.664  1.00 19.88 ? 127 VAL A O   1 
ATOM   694  C  CB  . VAL A 1 84  ? -34.019 -11.606 68.818  1.00 19.03 ? 127 VAL A CB  1 
ATOM   695  C  CG1 . VAL A 1 84  ? -34.401 -11.858 70.270  1.00 19.14 ? 127 VAL A CG1 1 
ATOM   696  C  CG2 . VAL A 1 84  ? -34.977 -10.611 68.185  1.00 18.18 ? 127 VAL A CG2 1 
ATOM   697  N  N   . ALA A 1 85  ? -31.287 -13.147 69.079  1.00 20.16 ? 128 ALA A N   1 
ATOM   698  C  CA  . ALA A 1 85  ? -30.402 -14.071 69.806  1.00 20.91 ? 128 ALA A CA  1 
ATOM   699  C  C   . ALA A 1 85  ? -29.030 -13.477 70.071  1.00 21.69 ? 128 ALA A C   1 
ATOM   700  O  O   . ALA A 1 85  ? -28.498 -13.627 71.176  1.00 21.76 ? 128 ALA A O   1 
ATOM   701  C  CB  . ALA A 1 85  ? -30.263 -15.419 69.075  1.00 20.34 ? 128 ALA A CB  1 
ATOM   702  N  N   . TYR A 1 86  ? -28.458 -12.810 69.062  1.00 22.45 ? 129 TYR A N   1 
ATOM   703  C  CA  . TYR A 1 86  ? -27.162 -12.172 69.224  1.00 23.50 ? 129 TYR A CA  1 
ATOM   704  C  C   . TYR A 1 86  ? -27.192 -11.182 70.386  1.00 24.41 ? 129 TYR A C   1 
ATOM   705  O  O   . TYR A 1 86  ? -26.265 -11.125 71.187  1.00 24.53 ? 129 TYR A O   1 
ATOM   706  C  CB  . TYR A 1 86  ? -26.725 -11.442 67.954  1.00 23.13 ? 129 TYR A CB  1 
ATOM   707  C  CG  . TYR A 1 86  ? -25.488 -10.588 68.177  1.00 22.59 ? 129 TYR A CG  1 
ATOM   708  C  CD1 . TYR A 1 86  ? -24.222 -11.159 68.162  1.00 21.82 ? 129 TYR A CD1 1 
ATOM   709  C  CD2 . TYR A 1 86  ? -25.587 -9.206  68.427  1.00 22.21 ? 129 TYR A CD2 1 
ATOM   710  C  CE1 . TYR A 1 86  ? -23.080 -10.385 68.382  1.00 21.88 ? 129 TYR A CE1 1 
ATOM   711  C  CE2 . TYR A 1 86  ? -24.447 -8.419  68.649  1.00 20.17 ? 129 TYR A CE2 1 
ATOM   712  C  CZ  . TYR A 1 86  ? -23.197 -9.022  68.626  1.00 21.42 ? 129 TYR A CZ  1 
ATOM   713  O  OH  . TYR A 1 86  ? -22.049 -8.291  68.837  1.00 22.05 ? 129 TYR A OH  1 
ATOM   714  N  N   . HIS A 1 87  ? -28.264 -10.402 70.466  1.00 25.79 ? 130 HIS A N   1 
ATOM   715  C  CA  . HIS A 1 87  ? -28.345 -9.329  71.439  1.00 27.10 ? 130 HIS A CA  1 
ATOM   716  C  C   . HIS A 1 87  ? -28.522 -9.925  72.820  1.00 28.16 ? 130 HIS A C   1 
ATOM   717  O  O   . HIS A 1 87  ? -27.928 -9.447  73.774  1.00 28.03 ? 130 HIS A O   1 
ATOM   718  C  CB  . HIS A 1 87  ? -29.482 -8.350  71.113  1.00 26.64 ? 130 HIS A CB  1 
ATOM   719  C  CG  . HIS A 1 87  ? -29.151 -7.355  70.040  1.00 26.93 ? 130 HIS A CG  1 
ATOM   720  N  ND1 . HIS A 1 87  ? -29.346 -7.609  68.699  1.00 26.43 ? 130 HIS A ND1 1 
ATOM   721  C  CD2 . HIS A 1 87  ? -28.673 -6.089  70.113  1.00 26.97 ? 130 HIS A CD2 1 
ATOM   722  C  CE1 . HIS A 1 87  ? -28.985 -6.554  67.992  1.00 24.81 ? 130 HIS A CE1 1 
ATOM   723  N  NE2 . HIS A 1 87  ? -28.570 -5.619  68.827  1.00 25.77 ? 130 HIS A NE2 1 
ATOM   724  N  N   . GLN A 1 88  ? -29.335 -10.975 72.918  1.00 29.91 ? 131 GLN A N   1 
ATOM   725  C  CA  . GLN A 1 88  ? -29.596 -11.622 74.203  1.00 31.53 ? 131 GLN A CA  1 
ATOM   726  C  C   . GLN A 1 88  ? -28.375 -12.354 74.718  1.00 32.21 ? 131 GLN A C   1 
ATOM   727  O  O   . GLN A 1 88  ? -27.921 -12.098 75.840  1.00 32.81 ? 131 GLN A O   1 
ATOM   728  C  CB  . GLN A 1 88  ? -30.791 -12.575 74.125  1.00 31.85 ? 131 GLN A CB  1 
ATOM   729  C  CG  . GLN A 1 88  ? -32.134 -11.875 74.350  1.00 34.10 ? 131 GLN A CG  1 
ATOM   730  C  CD  . GLN A 1 88  ? -33.336 -12.699 73.884  1.00 37.25 ? 131 GLN A CD  1 
ATOM   731  O  OE1 . GLN A 1 88  ? -33.185 -13.843 73.422  1.00 38.06 ? 131 GLN A OE1 1 
ATOM   732  N  NE2 . GLN A 1 88  ? -34.545 -12.114 74.000  1.00 35.97 ? 131 GLN A NE2 1 
ATOM   733  N  N   . TYR A 1 89  ? -27.824 -13.236 73.889  1.00 32.81 ? 132 TYR A N   1 
ATOM   734  C  CA  . TYR A 1 89  ? -26.731 -14.096 74.317  1.00 33.45 ? 132 TYR A CA  1 
ATOM   735  C  C   . TYR A 1 89  ? -25.450 -13.335 74.628  1.00 33.66 ? 132 TYR A C   1 
ATOM   736  O  O   . TYR A 1 89  ? -24.720 -13.712 75.553  1.00 34.19 ? 132 TYR A O   1 
ATOM   737  C  CB  . TYR A 1 89  ? -26.460 -15.192 73.290  1.00 33.64 ? 132 TYR A CB  1 
ATOM   738  C  CG  . TYR A 1 89  ? -25.514 -16.263 73.785  1.00 35.83 ? 132 TYR A CG  1 
ATOM   739  C  CD1 . TYR A 1 89  ? -25.987 -17.344 74.536  1.00 37.08 ? 132 TYR A CD1 1 
ATOM   740  C  CD2 . TYR A 1 89  ? -24.138 -16.198 73.511  1.00 37.60 ? 132 TYR A CD2 1 
ATOM   741  C  CE1 . TYR A 1 89  ? -25.124 -18.341 74.995  1.00 37.71 ? 132 TYR A CE1 1 
ATOM   742  C  CE2 . TYR A 1 89  ? -23.262 -17.190 73.971  1.00 38.12 ? 132 TYR A CE2 1 
ATOM   743  C  CZ  . TYR A 1 89  ? -23.770 -18.257 74.716  1.00 38.53 ? 132 TYR A CZ  1 
ATOM   744  O  OH  . TYR A 1 89  ? -22.929 -19.250 75.172  1.00 39.01 ? 132 TYR A OH  1 
ATOM   745  N  N   . TYR A 1 90  ? -25.160 -12.282 73.864  1.00 33.45 ? 133 TYR A N   1 
ATOM   746  C  CA  . TYR A 1 90  ? -23.939 -11.520 74.096  1.00 33.19 ? 133 TYR A CA  1 
ATOM   747  C  C   . TYR A 1 90  ? -24.244 -10.263 74.887  1.00 33.22 ? 133 TYR A C   1 
ATOM   748  O  O   . TYR A 1 90  ? -23.366 -9.431  75.112  1.00 33.12 ? 133 TYR A O   1 
ATOM   749  C  CB  . TYR A 1 90  ? -23.192 -11.227 72.788  1.00 33.31 ? 133 TYR A CB  1 
ATOM   750  C  CG  . TYR A 1 90  ? -22.554 -12.461 72.189  1.00 33.51 ? 133 TYR A CG  1 
ATOM   751  C  CD1 . TYR A 1 90  ? -23.210 -13.195 71.203  1.00 33.30 ? 133 TYR A CD1 1 
ATOM   752  C  CD2 . TYR A 1 90  ? -21.310 -12.922 72.635  1.00 33.32 ? 133 TYR A CD2 1 
ATOM   753  C  CE1 . TYR A 1 90  ? -22.644 -14.351 70.666  1.00 32.69 ? 133 TYR A CE1 1 
ATOM   754  C  CE2 . TYR A 1 90  ? -20.736 -14.077 72.103  1.00 32.77 ? 133 TYR A CE2 1 
ATOM   755  C  CZ  . TYR A 1 90  ? -21.409 -14.785 71.116  1.00 32.45 ? 133 TYR A CZ  1 
ATOM   756  O  OH  . TYR A 1 90  ? -20.861 -15.923 70.570  1.00 31.62 ? 133 TYR A OH  1 
ATOM   757  N  N   . GLN A 1 91  ? -25.492 -10.155 75.330  1.00 33.30 ? 134 GLN A N   1 
ATOM   758  C  CA  . GLN A 1 91  ? -25.955 -9.028  76.152  1.00 33.90 ? 134 GLN A CA  1 
ATOM   759  C  C   . GLN A 1 91  ? -25.513 -7.657  75.617  1.00 33.45 ? 134 GLN A C   1 
ATOM   760  O  O   . GLN A 1 91  ? -24.772 -6.915  76.273  1.00 33.70 ? 134 GLN A O   1 
ATOM   761  C  CB  . GLN A 1 91  ? -25.576 -9.222  77.625  1.00 34.11 ? 134 GLN A CB  1 
ATOM   762  C  CG  . GLN A 1 91  ? -26.367 -10.334 78.321  1.00 36.93 ? 134 GLN A CG  1 
ATOM   763  C  CD  . GLN A 1 91  ? -25.807 -10.681 79.700  1.00 40.68 ? 134 GLN A CD  1 
ATOM   764  O  OE1 . GLN A 1 91  ? -24.614 -10.984 79.838  1.00 41.86 ? 134 GLN A OE1 1 
ATOM   765  N  NE2 . GLN A 1 91  ? -26.668 -10.645 80.726  1.00 40.48 ? 134 GLN A NE2 1 
ATOM   766  N  N   . ARG A 1 92  ? -25.974 -7.346  74.409  1.00 32.60 ? 135 ARG A N   1 
ATOM   767  C  CA  . ARG A 1 92  ? -25.739 -6.054  73.793  1.00 31.89 ? 135 ARG A CA  1 
ATOM   768  C  C   . ARG A 1 92  ? -26.952 -5.181  74.054  1.00 31.21 ? 135 ARG A C   1 
ATOM   769  O  O   . ARG A 1 92  ? -28.067 -5.680  74.104  1.00 31.32 ? 135 ARG A O   1 
ATOM   770  C  CB  . ARG A 1 92  ? -25.523 -6.209  72.292  1.00 32.14 ? 135 ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 92  ? -24.430 -7.193  71.905  1.00 32.95 ? 135 ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 92  ? -23.054 -6.560  71.849  1.00 34.92 ? 135 ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 92  ? -22.043 -7.595  72.020  1.00 38.62 ? 135 ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 92  ? -20.741 -7.379  72.151  1.00 40.10 ? 135 ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 92  ? -20.265 -6.138  72.119  1.00 41.57 ? 135 ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 92  ? -19.914 -8.409  72.317  1.00 39.59 ? 135 ARG A NH2 1 
ATOM   777  N  N   . PRO A 1 93  ? -26.740 -3.872  74.255  1.00 30.75 ? 136 PRO A N   1 
ATOM   778  C  CA  . PRO A 1 93  ? -27.890 -2.995  74.503  1.00 30.16 ? 136 PRO A CA  1 
ATOM   779  C  C   . PRO A 1 93  ? -28.750 -2.842  73.253  1.00 29.53 ? 136 PRO A C   1 
ATOM   780  O  O   . PRO A 1 93  ? -28.231 -2.642  72.157  1.00 29.75 ? 136 PRO A O   1 
ATOM   781  C  CB  . PRO A 1 93  ? -27.247 -1.661  74.888  1.00 30.34 ? 136 PRO A CB  1 
ATOM   782  C  CG  . PRO A 1 93  ? -25.841 -1.728  74.348  1.00 30.75 ? 136 PRO A CG  1 
ATOM   783  C  CD  . PRO A 1 93  ? -25.451 -3.171  74.407  1.00 30.62 ? 136 PRO A CD  1 
ATOM   784  N  N   . ILE A 1 94  ? -30.058 -2.953  73.428  1.00 28.53 ? 137 ILE A N   1 
ATOM   785  C  CA  . ILE A 1 94  ? -30.973 -2.934  72.310  1.00 27.58 ? 137 ILE A CA  1 
ATOM   786  C  C   . ILE A 1 94  ? -31.549 -1.543  72.114  1.00 27.26 ? 137 ILE A C   1 
ATOM   787  O  O   . ILE A 1 94  ? -31.815 -0.813  73.076  1.00 27.03 ? 137 ILE A O   1 
ATOM   788  C  CB  . ILE A 1 94  ? -32.119 -3.987  72.455  1.00 27.47 ? 137 ILE A CB  1 
ATOM   789  C  CG1 . ILE A 1 94  ? -32.952 -3.734  73.705  1.00 25.25 ? 137 ILE A CG1 1 
ATOM   790  C  CG2 . ILE A 1 94  ? -31.542 -5.412  72.465  1.00 27.91 ? 137 ILE A CG2 1 
ATOM   791  C  CD1 . ILE A 1 94  ? -34.135 -4.629  73.805  1.00 24.49 ? 137 ILE A CD1 1 
ATOM   792  N  N   . GLY A 1 95  ? -31.732 -1.183  70.852  1.00 26.35 ? 138 GLY A N   1 
ATOM   793  C  CA  . GLY A 1 95  ? -32.347 0.071   70.521  1.00 25.15 ? 138 GLY A CA  1 
ATOM   794  C  C   . GLY A 1 95  ? -33.802 -0.114  70.175  1.00 24.55 ? 138 GLY A C   1 
ATOM   795  O  O   . GLY A 1 95  ? -34.383 -1.186  70.372  1.00 24.64 ? 138 GLY A O   1 
ATOM   796  N  N   . VAL A 1 96  ? -34.364 0.952   69.627  1.00 23.83 ? 139 VAL A N   1 
ATOM   797  C  CA  . VAL A 1 96  ? -35.758 1.061   69.287  1.00 22.89 ? 139 VAL A CA  1 
ATOM   798  C  C   . VAL A 1 96  ? -36.233 -0.118  68.433  1.00 22.88 ? 139 VAL A C   1 
ATOM   799  O  O   . VAL A 1 96  ? -37.371 -0.565  68.575  1.00 23.12 ? 139 VAL A O   1 
ATOM   800  C  CB  . VAL A 1 96  ? -36.021 2.472   68.642  1.00 23.35 ? 139 VAL A CB  1 
ATOM   801  C  CG1 . VAL A 1 96  ? -35.657 2.514   67.148  1.00 22.02 ? 139 VAL A CG1 1 
ATOM   802  C  CG2 . VAL A 1 96  ? -37.441 2.954   68.905  1.00 22.45 ? 139 VAL A CG2 1 
ATOM   803  N  N   . LEU A 1 97  ? -35.353 -0.652  67.589  1.00 22.41 ? 140 LEU A N   1 
ATOM   804  C  CA  . LEU A 1 97  ? -35.719 -1.768  66.704  1.00 22.19 ? 140 LEU A CA  1 
ATOM   805  C  C   . LEU A 1 97  ? -36.140 -3.051  67.434  1.00 21.97 ? 140 LEU A C   1 
ATOM   806  O  O   . LEU A 1 97  ? -37.013 -3.769  66.963  1.00 21.54 ? 140 LEU A O   1 
ATOM   807  C  CB  . LEU A 1 97  ? -34.586 -2.070  65.705  1.00 22.08 ? 140 LEU A CB  1 
ATOM   808  C  CG  . LEU A 1 97  ? -34.710 -3.283  64.767  1.00 22.67 ? 140 LEU A CG  1 
ATOM   809  C  CD1 . LEU A 1 97  ? -35.660 -3.035  63.610  1.00 22.87 ? 140 LEU A CD1 1 
ATOM   810  C  CD2 . LEU A 1 97  ? -33.354 -3.720  64.243  1.00 23.28 ? 140 LEU A CD2 1 
ATOM   811  N  N   . LEU A 1 98  ? -35.518 -3.338  68.573  1.00 22.36 ? 141 LEU A N   1 
ATOM   812  C  CA  . LEU A 1 98  ? -35.778 -4.589  69.296  1.00 22.64 ? 141 LEU A CA  1 
ATOM   813  C  C   . LEU A 1 98  ? -36.584 -4.438  70.591  1.00 23.04 ? 141 LEU A C   1 
ATOM   814  O  O   . LEU A 1 98  ? -36.701 -5.383  71.374  1.00 23.83 ? 141 LEU A O   1 
ATOM   815  C  CB  . LEU A 1 98  ? -34.469 -5.315  69.581  1.00 22.26 ? 141 LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 98  ? -33.621 -5.712  68.369  1.00 22.59 ? 141 LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 98  ? -32.381 -6.430  68.839  1.00 21.82 ? 141 LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 98  ? -34.396 -6.584  67.400  1.00 22.90 ? 141 LEU A CD2 1 
ATOM   819  N  N   . LYS A 1 99  ? -37.142 -3.255  70.812  1.00 23.31 ? 142 LYS A N   1 
ATOM   820  C  CA  . LYS A 1 99  ? -37.968 -3.003  71.984  1.00 23.44 ? 142 LYS A CA  1 
ATOM   821  C  C   . LYS A 1 99  ? -39.442 -3.114  71.641  1.00 24.14 ? 142 LYS A C   1 
ATOM   822  O  O   . LYS A 1 99  ? -39.819 -2.995  70.477  1.00 24.55 ? 142 LYS A O   1 
ATOM   823  C  CB  . LYS A 1 99  ? -37.662 -1.613  72.557  1.00 23.49 ? 142 LYS A CB  1 
ATOM   824  C  CG  . LYS A 1 99  ? -36.225 -1.444  73.038  1.00 21.21 ? 142 LYS A CG  1 
ATOM   825  C  CD  . LYS A 1 99  ? -36.078 -0.193  73.866  1.00 18.57 ? 142 LYS A CD  1 
ATOM   826  C  CE  . LYS A 1 99  ? -34.648 -0.026  74.343  1.00 16.70 ? 142 LYS A CE  1 
ATOM   827  N  NZ  . LYS A 1 99  ? -34.472 1.181   75.183  1.00 15.17 ? 142 LYS A NZ  1 
ATOM   828  N  N   . LYS A 1 100 ? -40.276 -3.345  72.651  1.00 25.35 ? 143 LYS A N   1 
ATOM   829  C  CA  . LYS A 1 100 ? -41.736 -3.347  72.481  1.00 26.24 ? 143 LYS A CA  1 
ATOM   830  C  C   . LYS A 1 100 ? -42.403 -2.460  73.529  1.00 26.68 ? 143 LYS A C   1 
ATOM   831  O  O   . LYS A 1 100 ? -41.734 -1.933  74.416  1.00 26.62 ? 143 LYS A O   1 
ATOM   832  C  CB  . LYS A 1 100 ? -42.292 -4.769  72.559  1.00 26.42 ? 143 LYS A CB  1 
ATOM   833  C  CG  . LYS A 1 100 ? -42.073 -5.452  73.908  1.00 28.73 ? 143 LYS A CG  1 
ATOM   834  C  CD  . LYS A 1 100 ? -42.176 -6.964  73.821  1.00 32.85 ? 143 LYS A CD  1 
ATOM   835  C  CE  . LYS A 1 100 ? -42.188 -7.590  75.215  1.00 36.78 ? 143 LYS A CE  1 
ATOM   836  N  NZ  . LYS A 1 100 ? -43.583 -7.679  75.791  1.00 39.74 ? 143 LYS A NZ  1 
ATOM   837  N  N   . SER A 1 101 ? -43.723 -2.314  73.408  1.00 27.39 ? 144 SER A N   1 
ATOM   838  C  CA  . SER A 1 101 ? -44.565 -1.505  74.296  1.00 28.23 ? 144 SER A CA  1 
ATOM   839  C  C   . SER A 1 101 ? -43.909 -0.228  74.829  1.00 28.12 ? 144 SER A C   1 
ATOM   840  O  O   . SER A 1 101 ? -43.246 0.489   74.068  1.00 28.45 ? 144 SER A O   1 
ATOM   841  C  CB  . SER A 1 101 ? -45.144 -2.348  75.441  1.00 28.37 ? 144 SER A CB  1 
ATOM   842  O  OG  . SER A 1 101 ? -44.124 -2.707  76.350  1.00 30.25 ? 144 SER A OG  1 
ATOM   843  N  N   . ALA A 1 102 ? -44.099 0.040   76.125  1.00 27.72 ? 145 ALA A N   1 
ATOM   844  C  CA  . ALA A 1 102 ? -43.735 1.324   76.736  1.00 27.59 ? 145 ALA A CA  1 
ATOM   845  C  C   . ALA A 1 102 ? -42.257 1.727   76.547  1.00 27.31 ? 145 ALA A C   1 
ATOM   846  O  O   . ALA A 1 102 ? -41.965 2.906   76.323  1.00 27.29 ? 145 ALA A O   1 
ATOM   847  C  CB  . ALA A 1 102 ? -44.130 1.351   78.224  1.00 27.20 ? 145 ALA A CB  1 
ATOM   848  N  N   . ALA A 1 103 ? -41.342 0.757   76.634  1.00 26.78 ? 146 ALA A N   1 
ATOM   849  C  CA  . ALA A 1 103 ? -39.917 1.018   76.422  1.00 26.78 ? 146 ALA A CA  1 
ATOM   850  C  C   . ALA A 1 103 ? -39.605 1.434   74.964  1.00 26.94 ? 146 ALA A C   1 
ATOM   851  O  O   . ALA A 1 103 ? -38.668 2.201   74.719  1.00 26.51 ? 146 ALA A O   1 
ATOM   852  C  CB  . ALA A 1 103 ? -39.083 -0.188  76.835  1.00 26.37 ? 146 ALA A CB  1 
ATOM   853  N  N   . TRP A 1 104 ? -40.390 0.931   74.009  1.00 26.78 ? 147 TRP A N   1 
ATOM   854  C  CA  . TRP A 1 104 ? -40.205 1.314   72.624  1.00 27.03 ? 147 TRP A CA  1 
ATOM   855  C  C   . TRP A 1 104 ? -40.658 2.753   72.431  1.00 27.63 ? 147 TRP A C   1 
ATOM   856  O  O   . TRP A 1 104 ? -39.953 3.547   71.801  1.00 27.28 ? 147 TRP A O   1 
ATOM   857  C  CB  . TRP A 1 104 ? -40.962 0.393   71.652  1.00 26.73 ? 147 TRP A CB  1 
ATOM   858  C  CG  . TRP A 1 104 ? -41.050 1.008   70.281  1.00 25.70 ? 147 TRP A CG  1 
ATOM   859  C  CD1 . TRP A 1 104 ? -40.078 1.003   69.321  1.00 25.36 ? 147 TRP A CD1 1 
ATOM   860  C  CD2 . TRP A 1 104 ? -42.142 1.766   69.742  1.00 24.55 ? 147 TRP A CD2 1 
ATOM   861  N  NE1 . TRP A 1 104 ? -40.500 1.694   68.214  1.00 25.44 ? 147 TRP A NE1 1 
ATOM   862  C  CE2 . TRP A 1 104 ? -41.762 2.179   68.445  1.00 24.94 ? 147 TRP A CE2 1 
ATOM   863  C  CE3 . TRP A 1 104 ? -43.406 2.125   70.220  1.00 24.47 ? 147 TRP A CE3 1 
ATOM   864  C  CZ2 . TRP A 1 104 ? -42.606 2.930   67.615  1.00 23.70 ? 147 TRP A CZ2 1 
ATOM   865  C  CZ3 . TRP A 1 104 ? -44.244 2.883   69.396  1.00 24.48 ? 147 TRP A CZ3 1 
ATOM   866  C  CH2 . TRP A 1 104 ? -43.833 3.277   68.107  1.00 24.08 ? 147 TRP A CH2 1 
ATOM   867  N  N   . LYS A 1 105 ? -41.838 3.068   72.971  1.00 28.12 ? 148 LYS A N   1 
ATOM   868  C  CA  . LYS A 1 105 ? -42.458 4.382   72.826  1.00 28.95 ? 148 LYS A CA  1 
ATOM   869  C  C   . LYS A 1 105 ? -41.519 5.465   73.337  1.00 29.11 ? 148 LYS A C   1 
ATOM   870  O  O   . LYS A 1 105 ? -41.329 6.501   72.684  1.00 28.93 ? 148 LYS A O   1 
ATOM   871  C  CB  . LYS A 1 105 ? -43.794 4.431   73.582  1.00 29.21 ? 148 LYS A CB  1 
ATOM   872  C  CG  . LYS A 1 105 ? -44.560 5.763   73.491  1.00 31.18 ? 148 LYS A CG  1 
ATOM   873  C  CD  . LYS A 1 105 ? -45.124 6.010   72.081  1.00 33.91 ? 148 LYS A CD  1 
ATOM   874  C  CE  . LYS A 1 105 ? -46.399 6.869   72.101  1.00 34.39 ? 148 LYS A CE  1 
ATOM   875  N  NZ  . LYS A 1 105 ? -47.271 6.581   70.906  1.00 34.38 ? 148 LYS A NZ  1 
ATOM   876  N  N   . LYS A 1 106 ? -40.919 5.197   74.494  1.00 29.14 ? 149 LYS A N   1 
ATOM   877  C  CA  . LYS A 1 106 ? -40.039 6.144   75.159  1.00 29.43 ? 149 LYS A CA  1 
ATOM   878  C  C   . LYS A 1 106 ? -38.824 6.512   74.291  1.00 29.23 ? 149 LYS A C   1 
ATOM   879  O  O   . LYS A 1 106 ? -38.493 7.694   74.159  1.00 29.41 ? 149 LYS A O   1 
ATOM   880  C  CB  . LYS A 1 106 ? -39.604 5.580   76.510  1.00 29.71 ? 149 LYS A CB  1 
ATOM   881  C  CG  . LYS A 1 106 ? -38.926 6.588   77.405  1.00 31.41 ? 149 LYS A CG  1 
ATOM   882  C  CD  . LYS A 1 106 ? -38.151 5.905   78.524  1.00 33.33 ? 149 LYS A CD  1 
ATOM   883  C  CE  . LYS A 1 106 ? -37.696 6.924   79.541  1.00 34.73 ? 149 LYS A CE  1 
ATOM   884  N  NZ  . LYS A 1 106 ? -36.661 6.311   80.406  1.00 37.61 ? 149 LYS A NZ  1 
ATOM   885  N  N   . ASP A 1 107 ? -38.164 5.506   73.709  1.00 28.63 ? 150 ASP A N   1 
ATOM   886  C  CA  . ASP A 1 107 ? -37.085 5.745   72.746  1.00 28.18 ? 150 ASP A CA  1 
ATOM   887  C  C   . ASP A 1 107 ? -37.605 6.448   71.487  1.00 27.78 ? 150 ASP A C   1 
ATOM   888  O  O   . ASP A 1 107 ? -37.016 7.427   71.028  1.00 27.87 ? 150 ASP A O   1 
ATOM   889  C  CB  . ASP A 1 107 ? -36.402 4.436   72.344  1.00 28.20 ? 150 ASP A CB  1 
ATOM   890  C  CG  . ASP A 1 107 ? -35.303 4.012   73.311  1.00 29.90 ? 150 ASP A CG  1 
ATOM   891  O  OD1 . ASP A 1 107 ? -35.301 4.469   74.484  1.00 31.05 ? 150 ASP A OD1 1 
ATOM   892  O  OD2 . ASP A 1 107 ? -34.439 3.199   72.890  1.00 30.22 ? 150 ASP A OD2 1 
ATOM   893  N  N   . ARG A 1 108 ? -38.704 5.941   70.933  1.00 27.13 ? 151 ARG A N   1 
ATOM   894  C  CA  . ARG A 1 108 ? -39.228 6.452   69.675  1.00 26.75 ? 151 ARG A CA  1 
ATOM   895  C  C   . ARG A 1 108 ? -39.545 7.945   69.776  1.00 27.04 ? 151 ARG A C   1 
ATOM   896  O  O   . ARG A 1 108 ? -39.096 8.736   68.940  1.00 27.16 ? 151 ARG A O   1 
ATOM   897  C  CB  . ARG A 1 108 ? -40.441 5.636   69.197  1.00 25.94 ? 151 ARG A CB  1 
ATOM   898  C  CG  . ARG A 1 108 ? -40.874 5.922   67.766  1.00 24.82 ? 151 ARG A CG  1 
ATOM   899  C  CD  . ARG A 1 108 ? -39.739 5.821   66.745  1.00 22.79 ? 151 ARG A CD  1 
ATOM   900  N  NE  . ARG A 1 108 ? -40.166 6.364   65.450  1.00 22.90 ? 151 ARG A NE  1 
ATOM   901  C  CZ  . ARG A 1 108 ? -40.344 5.655   64.331  1.00 22.14 ? 151 ARG A CZ  1 
ATOM   902  N  NH1 . ARG A 1 108 ? -40.108 4.341   64.300  1.00 22.20 ? 151 ARG A NH1 1 
ATOM   903  N  NH2 . ARG A 1 108 ? -40.750 6.264   63.226  1.00 19.63 ? 151 ARG A NH2 1 
ATOM   904  N  N   . VAL A 1 109 ? -40.293 8.318   70.815  1.00 27.12 ? 152 VAL A N   1 
ATOM   905  C  CA  . VAL A 1 109 ? -40.656 9.716   71.069  1.00 26.89 ? 152 VAL A CA  1 
ATOM   906  C  C   . VAL A 1 109 ? -39.411 10.602  71.203  1.00 26.93 ? 152 VAL A C   1 
ATOM   907  O  O   . VAL A 1 109 ? -39.334 11.647  70.562  1.00 27.20 ? 152 VAL A O   1 
ATOM   908  C  CB  . VAL A 1 109 ? -41.620 9.855   72.296  1.00 26.74 ? 152 VAL A CB  1 
ATOM   909  C  CG1 . VAL A 1 109 ? -41.710 11.301  72.787  1.00 26.39 ? 152 VAL A CG1 1 
ATOM   910  C  CG2 . VAL A 1 109 ? -42.997 9.333   71.927  1.00 25.82 ? 152 VAL A CG2 1 
ATOM   911  N  N   . ALA A 1 110 ? -38.440 10.171  72.006  1.00 26.65 ? 153 ALA A N   1 
ATOM   912  C  CA  . ALA A 1 110 ? -37.154 10.875  72.119  1.00 26.92 ? 153 ALA A CA  1 
ATOM   913  C  C   . ALA A 1 110 ? -36.490 11.085  70.756  1.00 27.36 ? 153 ALA A C   1 
ATOM   914  O  O   . ALA A 1 110 ? -36.096 12.210  70.404  1.00 27.53 ? 153 ALA A O   1 
ATOM   915  C  CB  . ALA A 1 110 ? -36.212 10.122  73.038  1.00 26.52 ? 153 ALA A CB  1 
ATOM   916  N  N   . LEU A 1 111 ? -36.389 9.995   69.994  1.00 27.28 ? 154 LEU A N   1 
ATOM   917  C  CA  . LEU A 1 111 ? -35.666 9.991   68.737  1.00 27.17 ? 154 LEU A CA  1 
ATOM   918  C  C   . LEU A 1 111 ? -36.396 10.774  67.653  1.00 27.25 ? 154 LEU A C   1 
ATOM   919  O  O   . LEU A 1 111 ? -35.756 11.445  66.832  1.00 26.68 ? 154 LEU A O   1 
ATOM   920  C  CB  . LEU A 1 111 ? -35.399 8.557   68.287  1.00 27.09 ? 154 LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 111 ? -34.382 7.777   69.115  1.00 26.69 ? 154 LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 111 ? -34.551 6.273   68.882  1.00 26.13 ? 154 LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 111 ? -32.956 8.232   68.807  1.00 25.75 ? 154 LEU A CD2 1 
ATOM   924  N  N   . ASN A 1 112 ? -37.727 10.693  67.672  1.00 27.29 ? 155 ASN A N   1 
ATOM   925  C  CA  . ASN A 1 112 ? -38.575 11.437  66.745  1.00 27.50 ? 155 ASN A CA  1 
ATOM   926  C  C   . ASN A 1 112 ? -38.364 12.950  66.787  1.00 28.06 ? 155 ASN A C   1 
ATOM   927  O  O   . ASN A 1 112 ? -38.406 13.609  65.745  1.00 28.39 ? 155 ASN A O   1 
ATOM   928  C  CB  . ASN A 1 112 ? -40.050 11.107  66.962  1.00 27.19 ? 155 ASN A CB  1 
ATOM   929  C  CG  . ASN A 1 112 ? -40.481 9.832   66.248  1.00 27.35 ? 155 ASN A CG  1 
ATOM   930  O  OD1 . ASN A 1 112 ? -39.689 9.174   65.577  1.00 26.47 ? 155 ASN A OD1 1 
ATOM   931  N  ND2 . ASN A 1 112 ? -41.749 9.485   66.391  1.00 27.83 ? 155 ASN A ND2 1 
ATOM   932  N  N   . GLN A 1 113 ? -38.121 13.498  67.975  1.00 28.57 ? 156 GLN A N   1 
ATOM   933  C  CA  . GLN A 1 113 ? -37.864 14.931  68.111  1.00 29.25 ? 156 GLN A CA  1 
ATOM   934  C  C   . GLN A 1 113 ? -36.578 15.336  67.367  1.00 28.68 ? 156 GLN A C   1 
ATOM   935  O  O   . GLN A 1 113 ? -36.462 16.461  66.890  1.00 28.54 ? 156 GLN A O   1 
ATOM   936  C  CB  . GLN A 1 113 ? -37.803 15.367  69.588  1.00 29.58 ? 156 GLN A CB  1 
ATOM   937  C  CG  . GLN A 1 113 ? -38.953 14.870  70.490  1.00 32.96 ? 156 GLN A CG  1 
ATOM   938  C  CD  . GLN A 1 113 ? -40.174 15.812  70.561  1.00 38.31 ? 156 GLN A CD  1 
ATOM   939  O  OE1 . GLN A 1 113 ? -40.435 16.605  69.640  1.00 40.84 ? 156 GLN A OE1 1 
ATOM   940  N  NE2 . GLN A 1 113 ? -40.936 15.711  71.658  1.00 37.78 ? 156 GLN A NE2 1 
ATOM   941  N  N   . GLU A 1 114 ? -35.636 14.408  67.235  1.00 28.51 ? 157 GLU A N   1 
ATOM   942  C  CA  . GLU A 1 114 ? -34.337 14.728  66.647  1.00 28.56 ? 157 GLU A CA  1 
ATOM   943  C  C   . GLU A 1 114 ? -34.116 14.230  65.217  1.00 28.49 ? 157 GLU A C   1 
ATOM   944  O  O   . GLU A 1 114 ? -33.181 14.662  64.536  1.00 28.58 ? 157 GLU A O   1 
ATOM   945  C  CB  . GLU A 1 114 ? -33.206 14.251  67.566  1.00 28.76 ? 157 GLU A CB  1 
ATOM   946  C  CG  . GLU A 1 114 ? -33.110 15.016  68.900  1.00 29.92 ? 157 GLU A CG  1 
ATOM   947  C  CD  . GLU A 1 114 ? -33.206 16.544  68.735  1.00 32.05 ? 157 GLU A CD  1 
ATOM   948  O  OE1 . GLU A 1 114 ? -32.759 17.077  67.699  1.00 33.02 ? 157 GLU A OE1 1 
ATOM   949  O  OE2 . GLU A 1 114 ? -33.728 17.220  69.647  1.00 33.45 ? 157 GLU A OE2 1 
ATOM   950  N  N   . VAL A 1 115 ? -34.993 13.355  64.746  1.00 28.30 ? 158 VAL A N   1 
ATOM   951  C  CA  . VAL A 1 115 ? -34.717 12.596  63.530  1.00 28.47 ? 158 VAL A CA  1 
ATOM   952  C  C   . VAL A 1 115 ? -35.879 12.649  62.516  1.00 28.55 ? 158 VAL A C   1 
ATOM   953  O  O   . VAL A 1 115 ? -35.663 12.549  61.306  1.00 27.82 ? 158 VAL A O   1 
ATOM   954  C  CB  . VAL A 1 115 ? -34.297 11.142  63.907  1.00 28.63 ? 158 VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 115 ? -34.177 10.252  62.700  1.00 29.93 ? 158 VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 115 ? -32.978 11.165  64.667  1.00 27.83 ? 158 VAL A CG2 1 
ATOM   957  N  N   . MET A 1 116 ? -37.101 12.841  63.015  1.00 28.91 ? 159 MET A N   1 
ATOM   958  C  CA  . MET A 1 116 ? -38.285 12.879  62.157  1.00 29.27 ? 159 MET A CA  1 
ATOM   959  C  C   . MET A 1 116 ? -38.914 14.277  62.094  1.00 29.09 ? 159 MET A C   1 
ATOM   960  O  O   . MET A 1 116 ? -39.612 14.593  61.133  1.00 29.43 ? 159 MET A O   1 
ATOM   961  C  CB  . MET A 1 116 ? -39.337 11.854  62.626  1.00 29.44 ? 159 MET A CB  1 
ATOM   962  C  CG  . MET A 1 116 ? -39.018 10.380  62.366  1.00 31.01 ? 159 MET A CG  1 
ATOM   963  S  SD  . MET A 1 116 ? -39.219 9.854   60.633  1.00 35.27 ? 159 MET A SD  1 
ATOM   964  C  CE  . MET A 1 116 ? -40.967 9.503   60.518  1.00 33.56 ? 159 MET A CE  1 
ATOM   965  N  N   . ALA A 1 117 ? -38.676 15.098  63.114  1.00 28.83 ? 160 ALA A N   1 
ATOM   966  C  CA  . ALA A 1 117 ? -39.335 16.412  63.251  1.00 29.00 ? 160 ALA A CA  1 
ATOM   967  C  C   . ALA A 1 117 ? -38.823 17.471  62.263  1.00 29.41 ? 160 ALA A C   1 
ATOM   968  O  O   . ALA A 1 117 ? -37.609 17.680  62.152  1.00 29.35 ? 160 ALA A O   1 
ATOM   969  C  CB  . ALA A 1 117 ? -39.202 16.923  64.684  1.00 28.31 ? 160 ALA A CB  1 
ATOM   970  N  N   . PRO A 1 118 ? -39.745 18.163  61.558  1.00 29.92 ? 161 PRO A N   1 
ATOM   971  C  CA  . PRO A 1 118 ? -39.333 19.224  60.613  1.00 30.36 ? 161 PRO A CA  1 
ATOM   972  C  C   . PRO A 1 118 ? -38.340 20.226  61.216  1.00 30.92 ? 161 PRO A C   1 
ATOM   973  O  O   . PRO A 1 118 ? -37.377 20.599  60.548  1.00 31.15 ? 161 PRO A O   1 
ATOM   974  C  CB  . PRO A 1 118 ? -40.654 19.906  60.247  1.00 30.30 ? 161 PRO A CB  1 
ATOM   975  C  CG  . PRO A 1 118 ? -41.696 18.816  60.421  1.00 30.45 ? 161 PRO A CG  1 
ATOM   976  C  CD  . PRO A 1 118 ? -41.208 17.953  61.561  1.00 29.76 ? 161 PRO A CD  1 
ATOM   977  N  N   . GLU A 1 119 ? -38.552 20.635  62.469  1.00 31.47 ? 162 GLU A N   1 
ATOM   978  C  CA  . GLU A 1 119 ? -37.644 21.580  63.142  1.00 32.31 ? 162 GLU A CA  1 
ATOM   979  C  C   . GLU A 1 119 ? -36.210 21.069  63.200  1.00 32.00 ? 162 GLU A C   1 
ATOM   980  O  O   . GLU A 1 119 ? -35.274 21.834  62.989  1.00 32.01 ? 162 GLU A O   1 
ATOM   981  C  CB  . GLU A 1 119 ? -38.118 21.918  64.562  1.00 32.87 ? 162 GLU A CB  1 
ATOM   982  C  CG  . GLU A 1 119 ? -39.349 22.836  64.640  1.00 36.53 ? 162 GLU A CG  1 
ATOM   983  C  CD  . GLU A 1 119 ? -40.630 22.177  64.106  1.00 40.42 ? 162 GLU A CD  1 
ATOM   984  O  OE1 . GLU A 1 119 ? -40.864 20.975  64.407  1.00 42.47 ? 162 GLU A OE1 1 
ATOM   985  O  OE2 . GLU A 1 119 ? -41.391 22.859  63.372  1.00 41.16 ? 162 GLU A OE2 1 
ATOM   986  N  N   . ALA A 1 120 ? -36.049 19.779  63.498  1.00 31.62 ? 163 ALA A N   1 
ATOM   987  C  CA  . ALA A 1 120 ? -34.734 19.130  63.512  1.00 30.92 ? 163 ALA A CA  1 
ATOM   988  C  C   . ALA A 1 120 ? -34.191 18.824  62.100  1.00 30.50 ? 163 ALA A C   1 
ATOM   989  O  O   . ALA A 1 120 ? -33.058 19.188  61.774  1.00 31.02 ? 163 ALA A O   1 
ATOM   990  C  CB  . ALA A 1 120 ? -34.786 17.869  64.351  1.00 30.79 ? 163 ALA A CB  1 
ATOM   991  N  N   . THR A 1 121 ? -35.010 18.186  61.266  1.00 29.66 ? 164 THR A N   1 
ATOM   992  C  CA  . THR A 1 121 ? -34.587 17.707  59.949  1.00 29.06 ? 164 THR A CA  1 
ATOM   993  C  C   . THR A 1 121 ? -34.129 18.805  58.969  1.00 28.95 ? 164 THR A C   1 
ATOM   994  O  O   . THR A 1 121 ? -33.373 18.517  58.032  1.00 28.30 ? 164 THR A O   1 
ATOM   995  C  CB  . THR A 1 121 ? -35.682 16.824  59.262  1.00 29.24 ? 164 THR A CB  1 
ATOM   996  O  OG1 . THR A 1 121 ? -36.844 17.613  58.974  1.00 28.79 ? 164 THR A OG1 1 
ATOM   997  C  CG2 . THR A 1 121 ? -36.079 15.634  60.135  1.00 28.91 ? 164 THR A CG2 1 
ATOM   998  N  N   . LYS A 1 122 ? -34.580 20.047  59.179  1.00 28.69 ? 165 LYS A N   1 
ATOM   999  C  CA  . LYS A 1 122 ? -34.167 21.169  58.320  1.00 28.71 ? 165 LYS A CA  1 
ATOM   1000 C  C   . LYS A 1 122 ? -32.662 21.393  58.431  1.00 28.19 ? 165 LYS A C   1 
ATOM   1001 O  O   . LYS A 1 122 ? -32.034 21.855  57.486  1.00 27.84 ? 165 LYS A O   1 
ATOM   1002 C  CB  . LYS A 1 122 ? -34.934 22.458  58.651  1.00 29.08 ? 165 LYS A CB  1 
ATOM   1003 C  CG  . LYS A 1 122 ? -34.525 23.118  59.973  1.00 30.63 ? 165 LYS A CG  1 
ATOM   1004 C  CD  . LYS A 1 122 ? -35.467 24.238  60.419  1.00 33.25 ? 165 LYS A CD  1 
ATOM   1005 C  CE  . LYS A 1 122 ? -35.095 24.709  61.835  1.00 34.89 ? 165 LYS A CE  1 
ATOM   1006 N  NZ  . LYS A 1 122 ? -35.234 26.181  62.022  1.00 35.84 ? 165 LYS A NZ  1 
ATOM   1007 N  N   . ASN A 1 123 ? -32.099 21.041  59.588  1.00 27.98 ? 166 ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 123 ? -30.657 21.130  59.829  1.00 27.95 ? 166 ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 123 ? -29.826 20.141  59.026  1.00 27.54 ? 166 ASN A C   1 
ATOM   1010 O  O   . ASN A 1 123 ? -28.632 20.363  58.814  1.00 27.15 ? 166 ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 123 ? -30.360 20.933  61.305  1.00 28.03 ? 166 ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 123 ? -30.869 22.071  62.150  1.00 29.62 ? 166 ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 123 ? -30.570 23.235  61.883  1.00 31.89 ? 166 ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 123 ? -31.640 21.746  63.181  1.00 29.77 ? 166 ASN A ND2 1 
ATOM   1015 N  N   . PHE A 1 124 ? -30.463 19.050  58.593  1.00 27.13 ? 167 PHE A N   1 
ATOM   1016 C  CA  . PHE A 1 124 ? -29.774 18.004  57.842  1.00 26.91 ? 167 PHE A CA  1 
ATOM   1017 C  C   . PHE A 1 124 ? -29.339 18.495  56.468  1.00 27.01 ? 167 PHE A C   1 
ATOM   1018 O  O   . PHE A 1 124 ? -28.330 18.023  55.930  1.00 27.14 ? 167 PHE A O   1 
ATOM   1019 C  CB  . PHE A 1 124 ? -30.644 16.741  57.692  1.00 26.72 ? 167 PHE A CB  1 
ATOM   1020 C  CG  . PHE A 1 124 ? -31.003 16.056  59.004  1.00 26.00 ? 167 PHE A CG  1 
ATOM   1021 C  CD1 . PHE A 1 124 ? -30.342 16.368  60.198  1.00 24.68 ? 167 PHE A CD1 1 
ATOM   1022 C  CD2 . PHE A 1 124 ? -31.994 15.076  59.029  1.00 24.87 ? 167 PHE A CD2 1 
ATOM   1023 C  CE1 . PHE A 1 124 ? -30.672 15.724  61.389  1.00 24.71 ? 167 PHE A CE1 1 
ATOM   1024 C  CE2 . PHE A 1 124 ? -32.334 14.416  60.227  1.00 23.99 ? 167 PHE A CE2 1 
ATOM   1025 C  CZ  . PHE A 1 124 ? -31.673 14.744  61.407  1.00 24.06 ? 167 PHE A CZ  1 
ATOM   1026 N  N   . LEU A 1 125 ? -30.086 19.452  55.911  1.00 26.83 ? 168 LEU A N   1 
ATOM   1027 C  CA  . LEU A 1 125 ? -29.898 19.859  54.506  1.00 26.64 ? 168 LEU A CA  1 
ATOM   1028 C  C   . LEU A 1 125 ? -28.437 20.132  54.092  1.00 26.45 ? 168 LEU A C   1 
ATOM   1029 O  O   . LEU A 1 125 ? -27.934 19.478  53.180  1.00 26.85 ? 168 LEU A O   1 
ATOM   1030 C  CB  . LEU A 1 125 ? -30.865 20.973  54.082  1.00 26.30 ? 168 LEU A CB  1 
ATOM   1031 C  CG  . LEU A 1 125 ? -32.353 20.698  54.329  1.00 26.04 ? 168 LEU A CG  1 
ATOM   1032 C  CD1 . LEU A 1 125 ? -33.164 21.606  53.459  1.00 26.19 ? 168 LEU A CD1 1 
ATOM   1033 C  CD2 . LEU A 1 125 ? -32.737 19.270  54.055  1.00 25.47 ? 168 LEU A CD2 1 
ATOM   1034 N  N   . PRO A 1 126 ? -27.747 21.073  54.772  1.00 25.93 ? 169 PRO A N   1 
ATOM   1035 C  CA  . PRO A 1 126 ? -26.363 21.351  54.363  1.00 25.53 ? 169 PRO A CA  1 
ATOM   1036 C  C   . PRO A 1 126 ? -25.385 20.200  54.654  1.00 25.21 ? 169 PRO A C   1 
ATOM   1037 O  O   . PRO A 1 126 ? -24.377 20.050  53.949  1.00 25.90 ? 169 PRO A O   1 
ATOM   1038 C  CB  . PRO A 1 126 ? -25.994 22.595  55.179  1.00 25.50 ? 169 PRO A CB  1 
ATOM   1039 C  CG  . PRO A 1 126 ? -26.946 22.616  56.310  1.00 25.63 ? 169 PRO A CG  1 
ATOM   1040 C  CD  . PRO A 1 126 ? -28.195 21.953  55.870  1.00 25.58 ? 169 PRO A CD  1 
ATOM   1041 N  N   . LEU A 1 127 ? -25.678 19.400  55.675  1.00 24.27 ? 170 LEU A N   1 
ATOM   1042 C  CA  . LEU A 1 127 ? -24.843 18.248  56.013  1.00 23.20 ? 170 LEU A CA  1 
ATOM   1043 C  C   . LEU A 1 127 ? -24.904 17.181  54.924  1.00 22.51 ? 170 LEU A C   1 
ATOM   1044 O  O   . LEU A 1 127 ? -23.876 16.576  54.582  1.00 22.64 ? 170 LEU A O   1 
ATOM   1045 C  CB  . LEU A 1 127 ? -25.235 17.656  57.377  1.00 22.97 ? 170 LEU A CB  1 
ATOM   1046 C  CG  . LEU A 1 127 ? -24.979 18.517  58.619  1.00 23.28 ? 170 LEU A CG  1 
ATOM   1047 C  CD1 . LEU A 1 127 ? -25.575 17.871  59.889  1.00 22.34 ? 170 LEU A CD1 1 
ATOM   1048 C  CD2 . LEU A 1 127 ? -23.481 18.776  58.794  1.00 23.50 ? 170 LEU A CD2 1 
ATOM   1049 N  N   . LEU A 1 128 ? -26.097 16.957  54.377  1.00 21.16 ? 171 LEU A N   1 
ATOM   1050 C  CA  . LEU A 1 128 ? -26.265 15.933  53.357  1.00 20.63 ? 171 LEU A CA  1 
ATOM   1051 C  C   . LEU A 1 128 ? -25.777 16.454  52.015  1.00 20.67 ? 171 LEU A C   1 
ATOM   1052 O  O   . LEU A 1 128 ? -25.092 15.737  51.279  1.00 20.82 ? 171 LEU A O   1 
ATOM   1053 C  CB  . LEU A 1 128 ? -27.714 15.443  53.273  1.00 20.00 ? 171 LEU A CB  1 
ATOM   1054 C  CG  . LEU A 1 128 ? -28.221 14.679  54.499  1.00 19.07 ? 171 LEU A CG  1 
ATOM   1055 C  CD1 . LEU A 1 128 ? -29.732 14.724  54.554  1.00 15.84 ? 171 LEU A CD1 1 
ATOM   1056 C  CD2 . LEU A 1 128 ? -27.689 13.235  54.527  1.00 17.27 ? 171 LEU A CD2 1 
ATOM   1057 N  N   . ASP A 1 129 ? -26.104 17.709  51.721  1.00 20.32 ? 172 ASP A N   1 
ATOM   1058 C  CA  . ASP A 1 129 ? -25.629 18.373  50.509  1.00 20.53 ? 172 ASP A CA  1 
ATOM   1059 C  C   . ASP A 1 129 ? -24.104 18.369  50.367  1.00 20.19 ? 172 ASP A C   1 
ATOM   1060 O  O   . ASP A 1 129 ? -23.586 18.122  49.282  1.00 20.04 ? 172 ASP A O   1 
ATOM   1061 C  CB  . ASP A 1 129 ? -26.156 19.801  50.441  1.00 20.96 ? 172 ASP A CB  1 
ATOM   1062 C  CG  . ASP A 1 129 ? -26.237 20.312  49.036  1.00 22.79 ? 172 ASP A CG  1 
ATOM   1063 O  OD1 . ASP A 1 129 ? -26.219 21.545  48.866  1.00 26.28 ? 172 ASP A OD1 1 
ATOM   1064 O  OD2 . ASP A 1 129 ? -26.317 19.486  48.098  1.00 25.05 ? 172 ASP A OD2 1 
ATOM   1065 N  N   . ALA A 1 130 ? -23.391 18.624  51.462  1.00 19.89 ? 173 ALA A N   1 
ATOM   1066 C  CA  . ALA A 1 130 ? -21.929 18.564  51.447  1.00 20.16 ? 173 ALA A CA  1 
ATOM   1067 C  C   . ALA A 1 130 ? -21.401 17.190  50.983  1.00 20.28 ? 173 ALA A C   1 
ATOM   1068 O  O   . ALA A 1 130 ? -20.432 17.123  50.217  1.00 20.50 ? 173 ALA A O   1 
ATOM   1069 C  CB  . ALA A 1 130 ? -21.354 18.943  52.827  1.00 20.02 ? 173 ALA A CB  1 
ATOM   1070 N  N   . VAL A 1 131 ? -22.036 16.108  51.444  1.00 19.93 ? 174 VAL A N   1 
ATOM   1071 C  CA  . VAL A 1 131 ? -21.639 14.753  51.041  1.00 19.68 ? 174 VAL A CA  1 
ATOM   1072 C  C   . VAL A 1 131 ? -21.961 14.504  49.557  1.00 19.97 ? 174 VAL A C   1 
ATOM   1073 O  O   . VAL A 1 131 ? -21.091 14.079  48.795  1.00 18.63 ? 174 VAL A O   1 
ATOM   1074 C  CB  . VAL A 1 131 ? -22.274 13.667  51.938  1.00 19.21 ? 174 VAL A CB  1 
ATOM   1075 C  CG1 . VAL A 1 131 ? -21.819 12.296  51.523  1.00 17.59 ? 174 VAL A CG1 1 
ATOM   1076 C  CG2 . VAL A 1 131 ? -21.927 13.917  53.395  1.00 19.17 ? 174 VAL A CG2 1 
ATOM   1077 N  N   . SER A 1 132 ? -23.202 14.804  49.162  1.00 20.83 ? 175 SER A N   1 
ATOM   1078 C  CA  . SER A 1 132 ? -23.636 14.691  47.763  1.00 21.91 ? 175 SER A CA  1 
ATOM   1079 C  C   . SER A 1 132 ? -22.741 15.488  46.792  1.00 22.50 ? 175 SER A C   1 
ATOM   1080 O  O   . SER A 1 132 ? -22.353 14.984  45.739  1.00 22.28 ? 175 SER A O   1 
ATOM   1081 C  CB  . SER A 1 132 ? -25.085 15.135  47.619  1.00 21.81 ? 175 SER A CB  1 
ATOM   1082 O  OG  . SER A 1 132 ? -25.952 14.202  48.218  1.00 21.93 ? 175 SER A OG  1 
ATOM   1083 N  N   . ARG A 1 133 ? -22.393 16.715  47.171  1.00 23.05 ? 176 ARG A N   1 
ATOM   1084 C  CA  . ARG A 1 133 ? -21.522 17.552  46.348  1.00 23.78 ? 176 ARG A CA  1 
ATOM   1085 C  C   . ARG A 1 133 ? -20.142 16.938  46.146  1.00 23.55 ? 176 ARG A C   1 
ATOM   1086 O  O   . ARG A 1 133 ? -19.577 17.036  45.056  1.00 23.79 ? 176 ARG A O   1 
ATOM   1087 C  CB  . ARG A 1 133 ? -21.436 18.973  46.917  1.00 23.96 ? 176 ARG A CB  1 
ATOM   1088 C  CG  . ARG A 1 133 ? -22.736 19.744  46.738  1.00 26.21 ? 176 ARG A CG  1 
ATOM   1089 C  CD  . ARG A 1 133 ? -22.705 21.084  47.435  1.00 31.86 ? 176 ARG A CD  1 
ATOM   1090 N  NE  . ARG A 1 133 ? -21.705 21.961  46.828  1.00 35.81 ? 176 ARG A NE  1 
ATOM   1091 C  CZ  . ARG A 1 133 ? -21.958 22.904  45.923  1.00 38.18 ? 176 ARG A CZ  1 
ATOM   1092 N  NH1 . ARG A 1 133 ? -23.199 23.132  45.496  1.00 38.58 ? 176 ARG A NH1 1 
ATOM   1093 N  NH2 . ARG A 1 133 ? -20.953 23.630  45.445  1.00 40.18 ? 176 ARG A NH2 1 
ATOM   1094 N  N   . ASP A 1 134 ? -19.614 16.312  47.198  1.00 23.41 ? 177 ASP A N   1 
ATOM   1095 C  CA  . ASP A 1 134 ? -18.360 15.550  47.127  1.00 23.30 ? 177 ASP A CA  1 
ATOM   1096 C  C   . ASP A 1 134 ? -18.467 14.275  46.288  1.00 22.76 ? 177 ASP A C   1 
ATOM   1097 O  O   . ASP A 1 134 ? -17.500 13.878  45.641  1.00 23.08 ? 177 ASP A O   1 
ATOM   1098 C  CB  . ASP A 1 134 ? -17.845 15.201  48.537  1.00 23.39 ? 177 ASP A CB  1 
ATOM   1099 C  CG  . ASP A 1 134 ? -17.331 16.414  49.292  1.00 25.39 ? 177 ASP A CG  1 
ATOM   1100 O  OD1 . ASP A 1 134 ? -17.112 17.479  48.659  1.00 25.85 ? 177 ASP A OD1 1 
ATOM   1101 O  OD2 . ASP A 1 134 ? -17.154 16.307  50.526  1.00 27.10 ? 177 ASP A OD2 1 
ATOM   1102 N  N   . PHE A 1 135 ? -19.628 13.623  46.312  1.00 22.20 ? 178 PHE A N   1 
ATOM   1103 C  CA  . PHE A 1 135 ? -19.827 12.431  45.499  1.00 21.72 ? 178 PHE A CA  1 
ATOM   1104 C  C   . PHE A 1 135 ? -19.715 12.804  44.033  1.00 21.74 ? 178 PHE A C   1 
ATOM   1105 O  O   . PHE A 1 135 ? -19.014 12.133  43.272  1.00 21.88 ? 178 PHE A O   1 
ATOM   1106 C  CB  . PHE A 1 135 ? -21.162 11.738  45.780  1.00 21.12 ? 178 PHE A CB  1 
ATOM   1107 C  CG  . PHE A 1 135 ? -21.273 10.390  45.137  1.00 20.62 ? 178 PHE A CG  1 
ATOM   1108 C  CD1 . PHE A 1 135 ? -20.795 9.264   45.779  1.00 19.21 ? 178 PHE A CD1 1 
ATOM   1109 C  CD2 . PHE A 1 135 ? -21.833 10.249  43.866  1.00 21.47 ? 178 PHE A CD2 1 
ATOM   1110 C  CE1 . PHE A 1 135 ? -20.880 8.023   45.189  1.00 19.13 ? 178 PHE A CE1 1 
ATOM   1111 C  CE2 . PHE A 1 135 ? -21.921 9.004   43.259  1.00 20.02 ? 178 PHE A CE2 1 
ATOM   1112 C  CZ  . PHE A 1 135 ? -21.439 7.883   43.928  1.00 19.84 ? 178 PHE A CZ  1 
ATOM   1113 N  N   . VAL A 1 136 ? -20.391 13.887  43.656  1.00 21.67 ? 179 VAL A N   1 
ATOM   1114 C  CA  . VAL A 1 136 ? -20.269 14.475  42.321  1.00 21.82 ? 179 VAL A CA  1 
ATOM   1115 C  C   . VAL A 1 136 ? -18.788 14.765  41.959  1.00 22.31 ? 179 VAL A C   1 
ATOM   1116 O  O   . VAL A 1 136 ? -18.334 14.424  40.862  1.00 22.30 ? 179 VAL A O   1 
ATOM   1117 C  CB  . VAL A 1 136 ? -21.177 15.731  42.204  1.00 21.96 ? 179 VAL A CB  1 
ATOM   1118 C  CG1 . VAL A 1 136 ? -20.741 16.655  41.059  1.00 21.63 ? 179 VAL A CG1 1 
ATOM   1119 C  CG2 . VAL A 1 136 ? -22.641 15.313  42.061  1.00 20.73 ? 179 VAL A CG2 1 
ATOM   1120 N  N   . SER A 1 137 ? -18.031 15.348  42.888  1.00 22.60 ? 180 SER A N   1 
ATOM   1121 C  CA  . SER A 1 137 ? -16.601 15.573  42.664  1.00 23.29 ? 180 SER A CA  1 
ATOM   1122 C  C   . SER A 1 137 ? -15.817 14.308  42.361  1.00 23.40 ? 180 SER A C   1 
ATOM   1123 O  O   . SER A 1 137 ? -14.989 14.313  41.451  1.00 23.95 ? 180 SER A O   1 
ATOM   1124 C  CB  . SER A 1 137 ? -15.967 16.300  43.839  1.00 23.11 ? 180 SER A CB  1 
ATOM   1125 O  OG  . SER A 1 137 ? -16.502 17.603  43.918  1.00 25.48 ? 180 SER A OG  1 
ATOM   1126 N  N   . VAL A 1 138 ? -16.062 13.241  43.130  1.00 23.43 ? 181 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 138 ? -15.435 11.934  42.897  1.00 23.25 ? 181 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 138 ? -15.608 11.512  41.440  1.00 23.26 ? 181 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 138 ? -14.635 11.150  40.769  1.00 23.30 ? 181 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 138 ? -16.017 10.830  43.832  1.00 23.44 ? 181 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 138 ? -15.645 9.426   43.358  1.00 22.08 ? 181 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 138 ? -15.551 11.041  45.263  1.00 24.10 ? 181 VAL A CG2 1 
ATOM   1133 N  N   . LEU A 1 139 ? -16.848 11.571  40.962  1.00 23.21 ? 182 LEU A N   1 
ATOM   1134 C  CA  . LEU A 1 139 ? -17.168 11.157  39.602  1.00 23.59 ? 182 LEU A CA  1 
ATOM   1135 C  C   . LEU A 1 139 ? -16.512 12.043  38.547  1.00 23.74 ? 182 LEU A C   1 
ATOM   1136 O  O   . LEU A 1 139 ? -15.985 11.521  37.566  1.00 23.46 ? 182 LEU A O   1 
ATOM   1137 C  CB  . LEU A 1 139 ? -18.675 11.068  39.387  1.00 23.29 ? 182 LEU A CB  1 
ATOM   1138 C  CG  . LEU A 1 139 ? -19.423 9.926   40.065  1.00 23.77 ? 182 LEU A CG  1 
ATOM   1139 C  CD1 . LEU A 1 139 ? -20.880 10.021  39.673  1.00 23.69 ? 182 LEU A CD1 1 
ATOM   1140 C  CD2 . LEU A 1 139 ? -18.847 8.542   39.700  1.00 24.13 ? 182 LEU A CD2 1 
ATOM   1141 N  N   . HIS A 1 140 ? -16.536 13.364  38.758  1.00 24.00 ? 183 HIS A N   1 
ATOM   1142 C  CA  . HIS A 1 140 ? -15.811 14.301  37.889  1.00 24.62 ? 183 HIS A CA  1 
ATOM   1143 C  C   . HIS A 1 140 ? -14.325 13.936  37.825  1.00 24.96 ? 183 HIS A C   1 
ATOM   1144 O  O   . HIS A 1 140 ? -13.730 13.999  36.755  1.00 25.35 ? 183 HIS A O   1 
ATOM   1145 C  CB  . HIS A 1 140 ? -15.981 15.773  38.336  1.00 24.50 ? 183 HIS A CB  1 
ATOM   1146 C  CG  . HIS A 1 140 ? -17.267 16.409  37.893  1.00 24.91 ? 183 HIS A CG  1 
ATOM   1147 N  ND1 . HIS A 1 140 ? -17.640 16.501  36.567  1.00 25.36 ? 183 HIS A ND1 1 
ATOM   1148 C  CD2 . HIS A 1 140 ? -18.264 16.993  38.603  1.00 25.29 ? 183 HIS A CD2 1 
ATOM   1149 C  CE1 . HIS A 1 140 ? -18.815 17.102  36.480  1.00 25.29 ? 183 HIS A CE1 1 
ATOM   1150 N  NE2 . HIS A 1 140 ? -19.215 17.414  37.701  1.00 25.17 ? 183 HIS A NE2 1 
ATOM   1151 N  N   . ARG A 1 141 ? -13.733 13.545  38.955  1.00 25.46 ? 184 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 141 ? -12.312 13.141  38.990  1.00 26.57 ? 184 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 141 ? -12.089 11.887  38.154  1.00 25.98 ? 184 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 141 ? -11.129 11.800  37.386  1.00 25.89 ? 184 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 141 ? -11.811 12.887  40.428  1.00 27.41 ? 184 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 141 ? -11.708 14.132  41.321  1.00 30.88 ? 184 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 141 ? -10.987 13.824  42.654  1.00 36.21 ? 184 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 141 ? -11.731 14.296  43.837  1.00 38.71 ? 184 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 141 ? -12.137 13.515  44.847  1.00 40.28 ? 184 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 141 ? -11.873 12.203  44.856  1.00 39.55 ? 184 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 141 ? -12.808 14.053  45.865  1.00 41.06 ? 184 ARG A NH2 1 
ATOM   1162 N  N   . ARG A 1 142 ? -12.993 10.926  38.311  1.00 25.25 ? 185 ARG A N   1 
ATOM   1163 C  CA  . ARG A 1 142 ? -12.928 9.676   37.572  1.00 24.95 ? 185 ARG A CA  1 
ATOM   1164 C  C   . ARG A 1 142 ? -13.089 9.868   36.058  1.00 24.89 ? 185 ARG A C   1 
ATOM   1165 O  O   . ARG A 1 142 ? -12.494 9.131   35.285  1.00 24.23 ? 185 ARG A O   1 
ATOM   1166 C  CB  . ARG A 1 142 ? -13.945 8.664   38.127  1.00 24.48 ? 185 ARG A CB  1 
ATOM   1167 C  CG  . ARG A 1 142 ? -13.497 8.080   39.428  1.00 23.21 ? 185 ARG A CG  1 
ATOM   1168 C  CD  . ARG A 1 142 ? -14.348 6.933   39.892  1.00 23.63 ? 185 ARG A CD  1 
ATOM   1169 N  NE  . ARG A 1 142 ? -13.985 6.573   41.260  1.00 23.46 ? 185 ARG A NE  1 
ATOM   1170 C  CZ  . ARG A 1 142 ? -14.758 5.884   42.089  1.00 23.95 ? 185 ARG A CZ  1 
ATOM   1171 N  NH1 . ARG A 1 142 ? -15.950 5.447   41.704  1.00 24.60 ? 185 ARG A NH1 1 
ATOM   1172 N  NH2 . ARG A 1 142 ? -14.337 5.630   43.314  1.00 24.86 ? 185 ARG A NH2 1 
ATOM   1173 N  N   . ILE A 1 143 ? -13.880 10.865  35.658  1.00 25.46 ? 186 ILE A N   1 
ATOM   1174 C  CA  . ILE A 1 143 ? -14.085 11.204  34.254  1.00 26.00 ? 186 ILE A CA  1 
ATOM   1175 C  C   . ILE A 1 143 ? -12.791 11.785  33.685  1.00 26.95 ? 186 ILE A C   1 
ATOM   1176 O  O   . ILE A 1 143 ? -12.300 11.324  32.648  1.00 27.11 ? 186 ILE A O   1 
ATOM   1177 C  CB  . ILE A 1 143 ? -15.245 12.198  34.080  1.00 25.86 ? 186 ILE A CB  1 
ATOM   1178 C  CG1 . ILE A 1 143 ? -16.579 11.516  34.416  1.00 25.90 ? 186 ILE A CG1 1 
ATOM   1179 C  CG2 . ILE A 1 143 ? -15.258 12.754  32.665  1.00 25.41 ? 186 ILE A CG2 1 
ATOM   1180 C  CD1 . ILE A 1 143 ? -17.781 12.437  34.493  1.00 24.41 ? 186 ILE A CD1 1 
ATOM   1181 N  N   . LYS A 1 144 ? -12.229 12.769  34.389  1.00 27.68 ? 187 LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 144 ? -10.938 13.371  34.030  1.00 28.60 ? 187 LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 144 ? -9.832  12.313  33.870  1.00 28.42 ? 187 LYS A C   1 
ATOM   1184 O  O   . LYS A 1 144 ? -9.114  12.303  32.858  1.00 28.02 ? 187 LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 144 ? -10.538 14.425  35.078  1.00 29.15 ? 187 LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 144 ? -9.277  15.231  34.768  1.00 31.50 ? 187 LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 144 ? -8.991  16.246  35.882  1.00 36.10 ? 187 LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 144 ? -7.871  17.224  35.493  1.00 38.64 ? 187 LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 144 ? -8.270  18.054  34.301  1.00 41.11 ? 187 LYS A NZ  1 
ATOM   1190 N  N   . LYS A 1 145 ? -9.721  11.429  34.867  1.00 28.33 ? 188 LYS A N   1 
ATOM   1191 C  CA  . LYS A 1 145 ? -8.726  10.363  34.896  1.00 28.43 ? 188 LYS A CA  1 
ATOM   1192 C  C   . LYS A 1 145 ? -8.898  9.358   33.750  1.00 28.23 ? 188 LYS A C   1 
ATOM   1193 O  O   . LYS A 1 145 ? -7.900  8.829   33.223  1.00 28.31 ? 188 LYS A O   1 
ATOM   1194 C  CB  . LYS A 1 145 ? -8.775  9.645   36.244  1.00 28.99 ? 188 LYS A CB  1 
ATOM   1195 C  CG  . LYS A 1 145 ? -7.822  8.453   36.375  1.00 31.25 ? 188 LYS A CG  1 
ATOM   1196 C  CD  . LYS A 1 145 ? -8.107  7.615   37.637  1.00 34.75 ? 188 LYS A CD  1 
ATOM   1197 C  CE  . LYS A 1 145 ? -7.410  6.228   37.583  1.00 36.92 ? 188 LYS A CE  1 
ATOM   1198 N  NZ  . LYS A 1 145 ? -5.918  6.323   37.366  1.00 37.50 ? 188 LYS A NZ  1 
ATOM   1199 N  N   . ALA A 1 146 ? -10.154 9.105   33.369  1.00 27.40 ? 189 ALA A N   1 
ATOM   1200 C  CA  . ALA A 1 146 ? -10.474 8.145   32.315  1.00 26.66 ? 189 ALA A CA  1 
ATOM   1201 C  C   . ALA A 1 146 ? -10.000 8.625   30.947  1.00 26.39 ? 189 ALA A C   1 
ATOM   1202 O  O   . ALA A 1 146 ? -9.652  7.814   30.091  1.00 26.02 ? 189 ALA A O   1 
ATOM   1203 C  CB  . ALA A 1 146 ? -11.960 7.863   32.287  1.00 26.35 ? 189 ALA A CB  1 
ATOM   1204 N  N   . GLY A 1 147 ? -10.014 9.942   30.747  1.00 26.07 ? 190 GLY A N   1 
ATOM   1205 C  CA  . GLY A 1 147 ? -9.480  10.563  29.537  1.00 25.78 ? 190 GLY A CA  1 
ATOM   1206 C  C   . GLY A 1 147 ? -10.375 10.480  28.315  1.00 26.02 ? 190 GLY A C   1 
ATOM   1207 O  O   . GLY A 1 147 ? -9.931  10.768  27.200  1.00 26.11 ? 190 GLY A O   1 
ATOM   1208 N  N   . SER A 1 148 ? -11.640 10.124  28.526  1.00 25.86 ? 191 SER A N   1 
ATOM   1209 C  CA  . SER A 1 148 ? -12.581 9.880   27.436  1.00 25.80 ? 191 SER A CA  1 
ATOM   1210 C  C   . SER A 1 148 ? -13.856 10.736  27.497  1.00 26.14 ? 191 SER A C   1 
ATOM   1211 O  O   . SER A 1 148 ? -14.742 10.559  26.673  1.00 26.24 ? 191 SER A O   1 
ATOM   1212 C  CB  . SER A 1 148 ? -12.969 8.406   27.442  1.00 25.66 ? 191 SER A CB  1 
ATOM   1213 O  OG  . SER A 1 148 ? -13.508 8.055   28.701  1.00 25.33 ? 191 SER A OG  1 
ATOM   1214 N  N   . GLY A 1 149 ? -13.949 11.645  28.473  1.00 26.34 ? 192 GLY A N   1 
ATOM   1215 C  CA  . GLY A 1 149 ? -15.106 12.545  28.629  1.00 26.53 ? 192 GLY A CA  1 
ATOM   1216 C  C   . GLY A 1 149 ? -16.329 11.819  29.164  1.00 26.51 ? 192 GLY A C   1 
ATOM   1217 O  O   . GLY A 1 149 ? -17.468 12.121  28.799  1.00 26.65 ? 192 GLY A O   1 
ATOM   1218 N  N   . ASN A 1 150 ? -16.081 10.915  30.101  1.00 26.36 ? 193 ASN A N   1 
ATOM   1219 C  CA  . ASN A 1 150 ? -16.868 9.724   30.248  1.00 25.55 ? 193 ASN A CA  1 
ATOM   1220 C  C   . ASN A 1 150 ? -16.368 8.932   31.458  1.00 24.80 ? 193 ASN A C   1 
ATOM   1221 O  O   . ASN A 1 150 ? -15.164 8.860   31.689  1.00 24.39 ? 193 ASN A O   1 
ATOM   1222 C  CB  . ASN A 1 150 ? -16.549 8.927   28.994  1.00 26.51 ? 193 ASN A CB  1 
ATOM   1223 C  CG  . ASN A 1 150 ? -17.481 7.824   28.759  1.00 26.87 ? 193 ASN A CG  1 
ATOM   1224 O  OD1 . ASN A 1 150 ? -18.404 7.966   27.973  1.00 29.31 ? 193 ASN A OD1 1 
ATOM   1225 N  ND2 . ASN A 1 150 ? -17.256 6.700   29.422  1.00 27.27 ? 193 ASN A ND2 1 
ATOM   1226 N  N   . TYR A 1 151 ? -17.272 8.324   32.222  1.00 24.03 ? 194 TYR A N   1 
ATOM   1227 C  CA  . TYR A 1 151 ? -16.861 7.314   33.204  1.00 23.10 ? 194 TYR A CA  1 
ATOM   1228 C  C   . TYR A 1 151 ? -17.808 6.114   33.252  1.00 22.69 ? 194 TYR A C   1 
ATOM   1229 O  O   . TYR A 1 151 ? -19.019 6.279   33.393  1.00 23.19 ? 194 TYR A O   1 
ATOM   1230 C  CB  . TYR A 1 151 ? -16.666 7.915   34.612  1.00 23.06 ? 194 TYR A CB  1 
ATOM   1231 C  CG  . TYR A 1 151 ? -16.361 6.861   35.661  1.00 22.31 ? 194 TYR A CG  1 
ATOM   1232 C  CD1 . TYR A 1 151 ? -15.170 6.125   35.611  1.00 21.90 ? 194 TYR A CD1 1 
ATOM   1233 C  CD2 . TYR A 1 151 ? -17.264 6.583   36.685  1.00 20.81 ? 194 TYR A CD2 1 
ATOM   1234 C  CE1 . TYR A 1 151 ? -14.887 5.148   36.554  1.00 21.22 ? 194 TYR A CE1 1 
ATOM   1235 C  CE2 . TYR A 1 151 ? -16.994 5.610   37.639  1.00 20.97 ? 194 TYR A CE2 1 
ATOM   1236 C  CZ  . TYR A 1 151 ? -15.805 4.886   37.564  1.00 23.06 ? 194 TYR A CZ  1 
ATOM   1237 O  OH  . TYR A 1 151 ? -15.518 3.908   38.504  1.00 24.34 ? 194 TYR A OH  1 
ATOM   1238 N  N   . SER A 1 152 ? -17.256 4.910   33.139  1.00 21.73 ? 195 SER A N   1 
ATOM   1239 C  CA  . SER A 1 152 ? -18.050 3.694   33.317  1.00 21.23 ? 195 SER A CA  1 
ATOM   1240 C  C   . SER A 1 152 ? -17.523 2.904   34.483  1.00 20.91 ? 195 SER A C   1 
ATOM   1241 O  O   . SER A 1 152 ? -16.308 2.846   34.716  1.00 20.93 ? 195 SER A O   1 
ATOM   1242 C  CB  . SER A 1 152 ? -18.020 2.805   32.084  1.00 20.69 ? 195 SER A CB  1 
ATOM   1243 O  OG  . SER A 1 152 ? -18.403 3.542   30.960  1.00 21.72 ? 195 SER A OG  1 
ATOM   1244 N  N   . GLY A 1 153 ? -18.440 2.271   35.197  1.00 20.42 ? 196 GLY A N   1 
ATOM   1245 C  CA  . GLY A 1 153 ? -18.082 1.548   36.394  1.00 19.94 ? 196 GLY A CA  1 
ATOM   1246 C  C   . GLY A 1 153 ? -19.260 1.110   37.228  1.00 19.71 ? 196 GLY A C   1 
ATOM   1247 O  O   . GLY A 1 153 ? -20.374 1.633   37.109  1.00 19.75 ? 196 GLY A O   1 
ATOM   1248 N  N   . ASP A 1 154 ? -18.991 0.107   38.051  1.00 19.35 ? 197 ASP A N   1 
ATOM   1249 C  CA  . ASP A 1 154 ? -19.889 -0.357  39.071  1.00 19.03 ? 197 ASP A CA  1 
ATOM   1250 C  C   . ASP A 1 154 ? -19.573 0.538   40.263  1.00 18.72 ? 197 ASP A C   1 
ATOM   1251 O  O   . ASP A 1 154 ? -18.448 0.529   40.756  1.00 18.65 ? 197 ASP A O   1 
ATOM   1252 C  CB  . ASP A 1 154 ? -19.540 -1.809  39.362  1.00 19.24 ? 197 ASP A CB  1 
ATOM   1253 C  CG  . ASP A 1 154 ? -20.319 -2.398  40.509  1.00 20.68 ? 197 ASP A CG  1 
ATOM   1254 O  OD1 . ASP A 1 154 ? -21.062 -1.690  41.213  1.00 21.50 ? 197 ASP A OD1 1 
ATOM   1255 O  OD2 . ASP A 1 154 ? -20.170 -3.618  40.710  1.00 25.04 ? 197 ASP A OD2 1 
ATOM   1256 N  N   . ILE A 1 155 ? -20.560 1.311   40.719  1.00 18.25 ? 198 ILE A N   1 
ATOM   1257 C  CA  . ILE A 1 155 ? -20.356 2.250   41.830  1.00 17.39 ? 198 ILE A CA  1 
ATOM   1258 C  C   . ILE A 1 155 ? -21.036 1.834   43.139  1.00 16.88 ? 198 ILE A C   1 
ATOM   1259 O  O   . ILE A 1 155 ? -21.250 2.670   44.032  1.00 16.57 ? 198 ILE A O   1 
ATOM   1260 C  CB  . ILE A 1 155 ? -20.779 3.699   41.456  1.00 17.18 ? 198 ILE A CB  1 
ATOM   1261 C  CG1 . ILE A 1 155 ? -22.219 3.722   40.958  1.00 17.12 ? 198 ILE A CG1 1 
ATOM   1262 C  CG2 . ILE A 1 155 ? -19.831 4.275   40.422  1.00 16.58 ? 198 ILE A CG2 1 
ATOM   1263 C  CD1 . ILE A 1 155 ? -22.923 5.029   41.188  1.00 17.90 ? 198 ILE A CD1 1 
ATOM   1264 N  N   . SER A 1 156 ? -21.360 0.549   43.260  1.00 16.13 ? 199 SER A N   1 
ATOM   1265 C  CA  . SER A 1 156 ? -21.968 0.022   44.492  1.00 16.09 ? 199 SER A CA  1 
ATOM   1266 C  C   . SER A 1 156 ? -21.155 0.354   45.766  1.00 16.14 ? 199 SER A C   1 
ATOM   1267 O  O   . SER A 1 156 ? -21.699 0.920   46.722  1.00 15.32 ? 199 SER A O   1 
ATOM   1268 C  CB  . SER A 1 156 ? -22.199 -1.488  44.382  1.00 15.59 ? 199 SER A CB  1 
ATOM   1269 O  OG  . SER A 1 156 ? -21.090 -2.120  43.754  1.00 15.17 ? 199 SER A OG  1 
ATOM   1270 N  N   . ASP A 1 157 ? -19.865 0.000   45.763  1.00 16.57 ? 200 ASP A N   1 
ATOM   1271 C  CA  . ASP A 1 157 ? -18.964 0.283   46.890  1.00 17.49 ? 200 ASP A CA  1 
ATOM   1272 C  C   . ASP A 1 157 ? -18.936 1.773   47.207  1.00 17.20 ? 200 ASP A C   1 
ATOM   1273 O  O   . ASP A 1 157 ? -18.921 2.147   48.371  1.00 16.92 ? 200 ASP A O   1 
ATOM   1274 C  CB  . ASP A 1 157 ? -17.526 -0.192  46.606  1.00 18.23 ? 200 ASP A CB  1 
ATOM   1275 C  CG  . ASP A 1 157 ? -17.400 -1.713  46.526  1.00 20.04 ? 200 ASP A CG  1 
ATOM   1276 O  OD1 . ASP A 1 157 ? -18.335 -2.435  46.952  1.00 21.62 ? 200 ASP A OD1 1 
ATOM   1277 O  OD2 . ASP A 1 157 ? -16.340 -2.187  46.041  1.00 22.18 ? 200 ASP A OD2 1 
ATOM   1278 N  N   . ASP A 1 158 ? -18.923 2.606   46.165  1.00 17.20 ? 201 ASP A N   1 
ATOM   1279 C  CA  . ASP A 1 158 ? -18.999 4.056   46.328  1.00 17.75 ? 201 ASP A CA  1 
ATOM   1280 C  C   . ASP A 1 158 ? -20.331 4.506   46.913  1.00 17.44 ? 201 ASP A C   1 
ATOM   1281 O  O   . ASP A 1 158 ? -20.377 5.427   47.722  1.00 17.69 ? 201 ASP A O   1 
ATOM   1282 C  CB  . ASP A 1 158 ? -18.745 4.758   45.006  1.00 18.02 ? 201 ASP A CB  1 
ATOM   1283 C  CG  . ASP A 1 158 ? -17.503 4.253   44.327  1.00 19.72 ? 201 ASP A CG  1 
ATOM   1284 O  OD1 . ASP A 1 158 ? -16.397 4.425   44.893  1.00 20.91 ? 201 ASP A OD1 1 
ATOM   1285 O  OD2 . ASP A 1 158 ? -17.638 3.677   43.227  1.00 22.44 ? 201 ASP A OD2 1 
ATOM   1286 N  N   . LEU A 1 159 ? -21.412 3.847   46.523  1.00 17.20 ? 202 LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 159 ? -22.704 4.190   47.076  1.00 17.00 ? 202 LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 159 ? -22.774 3.803   48.549  1.00 17.16 ? 202 LEU A C   1 
ATOM   1289 O  O   . LEU A 1 159 ? -23.336 4.570   49.346  1.00 17.64 ? 202 LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 159 ? -23.853 3.605   46.246  1.00 16.92 ? 202 LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 159 ? -24.011 4.234   44.843  1.00 16.55 ? 202 LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 159 ? -25.007 3.487   43.993  1.00 14.57 ? 202 LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 159 ? -24.414 5.703   44.945  1.00 16.98 ? 202 LEU A CD2 1 
ATOM   1294 N  N   . PHE A 1 160 ? -22.181 2.658   48.925  1.00 16.52 ? 203 PHE A N   1 
ATOM   1295 C  CA  . PHE A 1 160 ? -22.073 2.280   50.363  1.00 15.80 ? 203 PHE A CA  1 
ATOM   1296 C  C   . PHE A 1 160 ? -21.263 3.313   51.162  1.00 16.16 ? 203 PHE A C   1 
ATOM   1297 O  O   . PHE A 1 160 ? -21.664 3.701   52.276  1.00 16.35 ? 203 PHE A O   1 
ATOM   1298 C  CB  . PHE A 1 160 ? -21.455 0.887   50.579  1.00 15.40 ? 203 PHE A CB  1 
ATOM   1299 C  CG  . PHE A 1 160 ? -22.286 -0.250  50.067  1.00 14.00 ? 203 PHE A CG  1 
ATOM   1300 C  CD1 . PHE A 1 160 ? -21.804 -1.064  49.040  1.00 13.76 ? 203 PHE A CD1 1 
ATOM   1301 C  CD2 . PHE A 1 160 ? -23.527 -0.530  50.613  1.00 13.51 ? 203 PHE A CD2 1 
ATOM   1302 C  CE1 . PHE A 1 160 ? -22.559 -2.126  48.546  1.00 12.90 ? 203 PHE A CE1 1 
ATOM   1303 C  CE2 . PHE A 1 160 ? -24.290 -1.598  50.139  1.00 13.71 ? 203 PHE A CE2 1 
ATOM   1304 C  CZ  . PHE A 1 160 ? -23.804 -2.396  49.103  1.00 13.29 ? 203 PHE A CZ  1 
ATOM   1305 N  N   . ARG A 1 161 ? -20.138 3.765   50.600  1.00 15.98 ? 204 ARG A N   1 
ATOM   1306 C  CA  . ARG A 1 161 ? -19.321 4.785   51.263  1.00 16.59 ? 204 ARG A CA  1 
ATOM   1307 C  C   . ARG A 1 161 ? -20.073 6.123   51.347  1.00 17.22 ? 204 ARG A C   1 
ATOM   1308 O  O   . ARG A 1 161 ? -20.001 6.827   52.368  1.00 17.89 ? 204 ARG A O   1 
ATOM   1309 C  CB  . ARG A 1 161 ? -17.946 4.942   50.596  1.00 16.38 ? 204 ARG A CB  1 
ATOM   1310 C  CG  . ARG A 1 161 ? -16.962 3.841   50.956  1.00 15.37 ? 204 ARG A CG  1 
ATOM   1311 C  CD  . ARG A 1 161 ? -15.556 4.103   50.414  1.00 17.19 ? 204 ARG A CD  1 
ATOM   1312 N  NE  . ARG A 1 161 ? -15.511 3.989   48.954  1.00 18.28 ? 204 ARG A NE  1 
ATOM   1313 C  CZ  . ARG A 1 161 ? -15.287 2.856   48.287  1.00 18.08 ? 204 ARG A CZ  1 
ATOM   1314 N  NH1 . ARG A 1 161 ? -15.045 1.718   48.932  1.00 16.39 ? 204 ARG A NH1 1 
ATOM   1315 N  NH2 . ARG A 1 161 ? -15.299 2.865   46.967  1.00 17.05 ? 204 ARG A NH2 1 
ATOM   1316 N  N   . PHE A 1 162 ? -20.813 6.457   50.286  1.00 17.28 ? 205 PHE A N   1 
ATOM   1317 C  CA  . PHE A 1 162 ? -21.654 7.646   50.292  1.00 16.83 ? 205 PHE A CA  1 
ATOM   1318 C  C   . PHE A 1 162 ? -22.687 7.580   51.417  1.00 17.14 ? 205 PHE A C   1 
ATOM   1319 O  O   . PHE A 1 162 ? -22.824 8.514   52.220  1.00 17.68 ? 205 PHE A O   1 
ATOM   1320 C  CB  . PHE A 1 162 ? -22.358 7.845   48.949  1.00 16.63 ? 205 PHE A CB  1 
ATOM   1321 C  CG  . PHE A 1 162 ? -23.504 8.814   49.025  1.00 16.53 ? 205 PHE A CG  1 
ATOM   1322 C  CD1 . PHE A 1 162 ? -23.271 10.189  49.024  1.00 15.97 ? 205 PHE A CD1 1 
ATOM   1323 C  CD2 . PHE A 1 162 ? -24.813 8.358   49.157  1.00 14.99 ? 205 PHE A CD2 1 
ATOM   1324 C  CE1 . PHE A 1 162 ? -24.345 11.091  49.128  1.00 16.80 ? 205 PHE A CE1 1 
ATOM   1325 C  CE2 . PHE A 1 162 ? -25.876 9.256   49.277  1.00 15.65 ? 205 PHE A CE2 1 
ATOM   1326 C  CZ  . PHE A 1 162 ? -25.647 10.617  49.260  1.00 14.15 ? 205 PHE A CZ  1 
ATOM   1327 N  N   . ALA A 1 163 ? -23.420 6.475   51.472  1.00 17.11 ? 206 ALA A N   1 
ATOM   1328 C  CA  . ALA A 1 163 ? -24.458 6.320   52.469  1.00 16.87 ? 206 ALA A CA  1 
ATOM   1329 C  C   . ALA A 1 163 ? -23.867 6.415   53.881  1.00 17.08 ? 206 ALA A C   1 
ATOM   1330 O  O   . ALA A 1 163 ? -24.498 6.966   54.787  1.00 16.79 ? 206 ALA A O   1 
ATOM   1331 C  CB  . ALA A 1 163 ? -25.196 5.007   52.262  1.00 16.69 ? 206 ALA A CB  1 
ATOM   1332 N  N   . PHE A 1 164 ? -22.645 5.900   54.048  1.00 17.26 ? 207 PHE A N   1 
ATOM   1333 C  CA  . PHE A 1 164 ? -21.945 5.962   55.325  1.00 17.21 ? 207 PHE A CA  1 
ATOM   1334 C  C   . PHE A 1 164 ? -21.514 7.379   55.730  1.00 17.52 ? 207 PHE A C   1 
ATOM   1335 O  O   . PHE A 1 164 ? -21.748 7.770   56.877  1.00 17.08 ? 207 PHE A O   1 
ATOM   1336 C  CB  . PHE A 1 164 ? -20.749 5.011   55.336  1.00 17.63 ? 207 PHE A CB  1 
ATOM   1337 C  CG  . PHE A 1 164 ? -20.017 4.970   56.651  1.00 17.27 ? 207 PHE A CG  1 
ATOM   1338 C  CD1 . PHE A 1 164 ? -20.477 4.179   57.687  1.00 17.88 ? 207 PHE A CD1 1 
ATOM   1339 C  CD2 . PHE A 1 164 ? -18.872 5.730   56.846  1.00 17.12 ? 207 PHE A CD2 1 
ATOM   1340 C  CE1 . PHE A 1 164 ? -19.802 4.136   58.893  1.00 19.24 ? 207 PHE A CE1 1 
ATOM   1341 C  CE2 . PHE A 1 164 ? -18.189 5.688   58.041  1.00 17.81 ? 207 PHE A CE2 1 
ATOM   1342 C  CZ  . PHE A 1 164 ? -18.649 4.897   59.071  1.00 18.18 ? 207 PHE A CZ  1 
ATOM   1343 N  N   . GLU A 1 165 ? -20.896 8.140   54.813  1.00 17.78 ? 208 GLU A N   1 
ATOM   1344 C  CA  . GLU A 1 165 ? -20.615 9.568   55.056  1.00 18.32 ? 208 GLU A CA  1 
ATOM   1345 C  C   . GLU A 1 165 ? -21.875 10.311  55.448  1.00 17.96 ? 208 GLU A C   1 
ATOM   1346 O  O   . GLU A 1 165 ? -21.839 11.155  56.332  1.00 18.22 ? 208 GLU A O   1 
ATOM   1347 C  CB  . GLU A 1 165 ? -20.092 10.284  53.817  1.00 18.50 ? 208 GLU A CB  1 
ATOM   1348 C  CG  . GLU A 1 165 ? -18.651 10.168  53.545  1.00 21.46 ? 208 GLU A CG  1 
ATOM   1349 C  CD  . GLU A 1 165 ? -17.775 10.710  54.646  1.00 22.69 ? 208 GLU A CD  1 
ATOM   1350 O  OE1 . GLU A 1 165 ? -17.651 11.939  54.812  1.00 24.48 ? 208 GLU A OE1 1 
ATOM   1351 O  OE2 . GLU A 1 165 ? -17.160 9.876   55.318  1.00 23.37 ? 208 GLU A OE2 1 
ATOM   1352 N  N   . SER A 1 166 ? -22.974 10.021  54.754  1.00 17.46 ? 209 SER A N   1 
ATOM   1353 C  CA  . SER A 1 166 ? -24.231 10.740  54.959  1.00 16.94 ? 209 SER A CA  1 
ATOM   1354 C  C   . SER A 1 166 ? -24.816 10.510  56.361  1.00 16.94 ? 209 SER A C   1 
ATOM   1355 O  O   . SER A 1 166 ? -25.056 11.473  57.094  1.00 16.97 ? 209 SER A O   1 
ATOM   1356 C  CB  . SER A 1 166 ? -25.237 10.389  53.855  1.00 16.63 ? 209 SER A CB  1 
ATOM   1357 O  OG  . SER A 1 166 ? -24.668 10.624  52.574  1.00 15.50 ? 209 SER A OG  1 
ATOM   1358 N  N   . ILE A 1 167 ? -25.016 9.245   56.742  1.00 16.40 ? 210 ILE A N   1 
ATOM   1359 C  CA  . ILE A 1 167 ? -25.538 8.933   58.068  1.00 15.96 ? 210 ILE A CA  1 
ATOM   1360 C  C   . ILE A 1 167 ? -24.591 9.372   59.196  1.00 16.53 ? 210 ILE A C   1 
ATOM   1361 O  O   . ILE A 1 167 ? -25.054 9.810   60.236  1.00 16.81 ? 210 ILE A O   1 
ATOM   1362 C  CB  . ILE A 1 167 ? -25.908 7.428   58.232  1.00 15.99 ? 210 ILE A CB  1 
ATOM   1363 C  CG1 . ILE A 1 167 ? -26.726 7.194   59.510  1.00 15.26 ? 210 ILE A CG1 1 
ATOM   1364 C  CG2 . ILE A 1 167 ? -24.667 6.531   58.225  1.00 14.20 ? 210 ILE A CG2 1 
ATOM   1365 C  CD1 . ILE A 1 167 ? -28.128 7.828   59.496  1.00 15.25 ? 210 ILE A CD1 1 
ATOM   1366 N  N   . THR A 1 168 ? -23.277 9.269   58.986  1.00 16.93 ? 211 THR A N   1 
ATOM   1367 C  CA  . THR A 1 168 ? -22.316 9.691   60.000  1.00 17.32 ? 211 THR A CA  1 
ATOM   1368 C  C   . THR A 1 168 ? -22.315 11.209  60.147  1.00 17.55 ? 211 THR A C   1 
ATOM   1369 O  O   . THR A 1 168 ? -22.201 11.723  61.258  1.00 17.54 ? 211 THR A O   1 
ATOM   1370 C  CB  . THR A 1 168 ? -20.862 9.191   59.734  1.00 17.25 ? 211 THR A CB  1 
ATOM   1371 O  OG1 . THR A 1 168 ? -20.466 9.510   58.394  1.00 17.54 ? 211 THR A OG1 1 
ATOM   1372 C  CG2 . THR A 1 168 ? -20.734 7.695   59.970  1.00 16.41 ? 211 THR A CG2 1 
ATOM   1373 N  N   . ASN A 1 169 ? -22.466 11.917  59.033  1.00 17.84 ? 212 ASN A N   1 
ATOM   1374 C  CA  . ASN A 1 169 ? -22.463 13.377  59.056  1.00 18.48 ? 212 ASN A CA  1 
ATOM   1375 C  C   . ASN A 1 169 ? -23.650 13.984  59.823  1.00 18.69 ? 212 ASN A C   1 
ATOM   1376 O  O   . ASN A 1 169 ? -23.463 14.922  60.593  1.00 18.32 ? 212 ASN A O   1 
ATOM   1377 C  CB  . ASN A 1 169 ? -22.369 13.958  57.640  1.00 18.36 ? 212 ASN A CB  1 
ATOM   1378 C  CG  . ASN A 1 169 ? -21.638 15.309  57.590  1.00 19.62 ? 212 ASN A CG  1 
ATOM   1379 O  OD1 . ASN A 1 169 ? -20.790 15.620  58.438  1.00 19.48 ? 212 ASN A OD1 1 
ATOM   1380 N  ND2 . ASN A 1 169 ? -21.955 16.107  56.569  1.00 21.53 ? 212 ASN A ND2 1 
ATOM   1381 N  N   . VAL A 1 170 ? -24.856 13.452  59.637  1.00 18.97 ? 213 VAL A N   1 
ATOM   1382 C  CA  . VAL A 1 170 ? -26.018 14.007  60.361  1.00 19.41 ? 213 VAL A CA  1 
ATOM   1383 C  C   . VAL A 1 170 ? -26.051 13.572  61.841  1.00 20.16 ? 213 VAL A C   1 
ATOM   1384 O  O   . VAL A 1 170 ? -26.600 14.288  62.692  1.00 20.54 ? 213 VAL A O   1 
ATOM   1385 C  CB  . VAL A 1 170 ? -27.386 13.733  59.654  1.00 19.06 ? 213 VAL A CB  1 
ATOM   1386 C  CG1 . VAL A 1 170 ? -27.404 14.337  58.262  1.00 18.57 ? 213 VAL A CG1 1 
ATOM   1387 C  CG2 . VAL A 1 170 ? -27.679 12.246  59.582  1.00 18.93 ? 213 VAL A CG2 1 
ATOM   1388 N  N   . ILE A 1 171 ? -25.456 12.411  62.138  1.00 20.57 ? 214 ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 171 ? -25.343 11.919  63.513  1.00 20.85 ? 214 ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 171 ? -24.206 12.629  64.256  1.00 21.19 ? 214 ILE A C   1 
ATOM   1391 O  O   . ILE A 1 171 ? -24.395 13.115  65.370  1.00 21.79 ? 214 ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 171 ? -25.129 10.369  63.580  1.00 20.69 ? 214 ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 171 ? -26.410 9.617   63.206  1.00 20.49 ? 214 ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 171 ? -24.684 9.945   64.969  1.00 20.33 ? 214 ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 171 ? -26.219 8.117   63.108  1.00 20.37 ? 214 ILE A CD1 1 
ATOM   1396 N  N   . PHE A 1 172 ? -23.031 12.695  63.644  1.00 21.21 ? 215 PHE A N   1 
ATOM   1397 C  CA  . PHE A 1 172 ? -21.859 13.197  64.350  1.00 21.80 ? 215 PHE A CA  1 
ATOM   1398 C  C   . PHE A 1 172 ? -21.486 14.640  64.020  1.00 22.03 ? 215 PHE A C   1 
ATOM   1399 O  O   . PHE A 1 172 ? -20.677 15.236  64.713  1.00 21.97 ? 215 PHE A O   1 
ATOM   1400 C  CB  . PHE A 1 172 ? -20.656 12.263  64.119  1.00 21.69 ? 215 PHE A CB  1 
ATOM   1401 C  CG  . PHE A 1 172 ? -20.845 10.879  64.682  1.00 22.55 ? 215 PHE A CG  1 
ATOM   1402 C  CD1 . PHE A 1 172 ? -20.865 9.770   63.846  1.00 23.41 ? 215 PHE A CD1 1 
ATOM   1403 C  CD2 . PHE A 1 172 ? -21.008 10.684  66.050  1.00 23.48 ? 215 PHE A CD2 1 
ATOM   1404 C  CE1 . PHE A 1 172 ? -21.042 8.490   64.361  1.00 24.14 ? 215 PHE A CE1 1 
ATOM   1405 C  CE2 . PHE A 1 172 ? -21.181 9.408   66.578  1.00 24.59 ? 215 PHE A CE2 1 
ATOM   1406 C  CZ  . PHE A 1 172 ? -21.201 8.306   65.729  1.00 24.92 ? 215 PHE A CZ  1 
ATOM   1407 N  N   . GLY A 1 173 ? -22.064 15.194  62.956  1.00 22.58 ? 216 GLY A N   1 
ATOM   1408 C  CA  . GLY A 1 173 ? -21.628 16.482  62.431  1.00 23.05 ? 216 GLY A CA  1 
ATOM   1409 C  C   . GLY A 1 173 ? -20.168 16.514  62.022  1.00 23.93 ? 216 GLY A C   1 
ATOM   1410 O  O   . GLY A 1 173 ? -19.566 17.578  62.018  1.00 24.38 ? 216 GLY A O   1 
ATOM   1411 N  N   . GLU A 1 174 ? -19.590 15.359  61.692  1.00 24.49 ? 217 GLU A N   1 
ATOM   1412 C  CA  . GLU A 1 174 ? -18.193 15.286  61.270  1.00 25.58 ? 217 GLU A CA  1 
ATOM   1413 C  C   . GLU A 1 174 ? -18.009 14.403  60.049  1.00 25.47 ? 217 GLU A C   1 
ATOM   1414 O  O   . GLU A 1 174 ? -18.583 13.312  59.954  1.00 25.92 ? 217 GLU A O   1 
ATOM   1415 C  CB  . GLU A 1 174 ? -17.302 14.732  62.372  1.00 25.85 ? 217 GLU A CB  1 
ATOM   1416 C  CG  . GLU A 1 174 ? -17.226 15.580  63.616  1.00 30.79 ? 217 GLU A CG  1 
ATOM   1417 C  CD  . GLU A 1 174 ? -16.485 14.883  64.754  1.00 36.17 ? 217 GLU A CD  1 
ATOM   1418 O  OE1 . GLU A 1 174 ? -16.376 13.625  64.734  1.00 38.47 ? 217 GLU A OE1 1 
ATOM   1419 O  OE2 . GLU A 1 174 ? -16.010 15.603  65.666  1.00 37.99 ? 217 GLU A OE2 1 
ATOM   1420 N  N   . ARG A 1 175 ? -17.170 14.866  59.132  1.00 24.93 ? 218 ARG A N   1 
ATOM   1421 C  CA  . ARG A 1 175 ? -16.841 14.102  57.943  1.00 24.24 ? 218 ARG A CA  1 
ATOM   1422 C  C   . ARG A 1 175 ? -15.915 12.958  58.309  1.00 24.34 ? 218 ARG A C   1 
ATOM   1423 O  O   . ARG A 1 175 ? -15.016 13.141  59.129  1.00 24.52 ? 218 ARG A O   1 
ATOM   1424 C  CB  . ARG A 1 175 ? -16.243 15.022  56.876  1.00 23.22 ? 218 ARG A CB  1 
ATOM   1425 C  CG  . ARG A 1 175 ? -17.275 16.048  56.354  1.00 22.02 ? 218 ARG A CG  1 
ATOM   1426 C  CD  . ARG A 1 175 ? -18.531 15.406  55.692  1.00 18.26 ? 218 ARG A CD  1 
ATOM   1427 N  NE  . ARG A 1 175 ? -18.150 14.603  54.536  1.00 15.50 ? 218 ARG A NE  1 
ATOM   1428 C  CZ  . ARG A 1 175 ? -18.041 15.059  53.289  1.00 15.02 ? 218 ARG A CZ  1 
ATOM   1429 N  NH1 . ARG A 1 175 ? -18.329 16.331  52.996  1.00 14.85 ? 218 ARG A NH1 1 
ATOM   1430 N  NH2 . ARG A 1 175 ? -17.639 14.238  52.327  1.00 13.05 ? 218 ARG A NH2 1 
ATOM   1431 N  N   . GLN A 1 176 ? -16.165 11.775  57.736  1.00 24.30 ? 219 GLN A N   1 
ATOM   1432 C  CA  . GLN A 1 176 ? -15.312 10.595  57.958  1.00 24.22 ? 219 GLN A CA  1 
ATOM   1433 C  C   . GLN A 1 176 ? -14.304 10.403  56.828  1.00 24.16 ? 219 GLN A C   1 
ATOM   1434 O  O   . GLN A 1 176 ? -13.450 9.519   56.891  1.00 23.92 ? 219 GLN A O   1 
ATOM   1435 C  CB  . GLN A 1 176 ? -16.160 9.333   58.107  1.00 24.53 ? 219 GLN A CB  1 
ATOM   1436 C  CG  . GLN A 1 176 ? -17.318 9.481   59.067  1.00 25.26 ? 219 GLN A CG  1 
ATOM   1437 C  CD  . GLN A 1 176 ? -16.854 9.640   60.496  1.00 27.72 ? 219 GLN A CD  1 
ATOM   1438 O  OE1 . GLN A 1 176 ? -16.168 8.764   61.038  1.00 28.99 ? 219 GLN A OE1 1 
ATOM   1439 N  NE2 . GLN A 1 176 ? -17.227 10.759  61.122  1.00 27.33 ? 219 GLN A NE2 1 
ATOM   1440 N  N   . GLY A 1 177 ? -14.416 11.229  55.789  1.00 24.21 ? 220 GLY A N   1 
ATOM   1441 C  CA  . GLY A 1 177 ? -13.505 11.177  54.646  1.00 24.53 ? 220 GLY A CA  1 
ATOM   1442 C  C   . GLY A 1 177 ? -13.586 9.900   53.827  1.00 24.77 ? 220 GLY A C   1 
ATOM   1443 O  O   . GLY A 1 177 ? -12.583 9.460   53.285  1.00 24.79 ? 220 GLY A O   1 
ATOM   1444 N  N   . MET A 1 178 ? -14.779 9.313   53.723  1.00 25.10 ? 221 MET A N   1 
ATOM   1445 C  CA  . MET A 1 178 ? -14.956 8.075   52.963  1.00 25.16 ? 221 MET A CA  1 
ATOM   1446 C  C   . MET A 1 178 ? -15.106 8.309   51.454  1.00 25.31 ? 221 MET A C   1 
ATOM   1447 O  O   . MET A 1 178 ? -15.111 7.361   50.673  1.00 25.36 ? 221 MET A O   1 
ATOM   1448 C  CB  . MET A 1 178 ? -16.116 7.238   53.518  1.00 25.05 ? 221 MET A CB  1 
ATOM   1449 C  CG  . MET A 1 178 ? -15.902 6.699   54.923  1.00 25.12 ? 221 MET A CG  1 
ATOM   1450 S  SD  . MET A 1 178 ? -14.291 5.910   55.199  1.00 28.53 ? 221 MET A SD  1 
ATOM   1451 C  CE  . MET A 1 178 ? -14.630 4.251   54.577  1.00 26.11 ? 221 MET A CE  1 
ATOM   1452 N  N   . LEU A 1 179 ? -15.208 9.570   51.046  1.00 25.79 ? 222 LEU A N   1 
ATOM   1453 C  CA  . LEU A 1 179 ? -15.224 9.925   49.625  1.00 26.33 ? 222 LEU A CA  1 
ATOM   1454 C  C   . LEU A 1 179 ? -13.866 10.436  49.101  1.00 27.46 ? 222 LEU A C   1 
ATOM   1455 O  O   . LEU A 1 179 ? -13.760 10.840  47.940  1.00 27.29 ? 222 LEU A O   1 
ATOM   1456 C  CB  . LEU A 1 179 ? -16.359 10.915  49.326  1.00 25.63 ? 222 LEU A CB  1 
ATOM   1457 C  CG  . LEU A 1 179 ? -17.785 10.403  49.583  1.00 24.73 ? 222 LEU A CG  1 
ATOM   1458 C  CD1 . LEU A 1 179 ? -18.803 11.410  49.063  1.00 22.91 ? 222 LEU A CD1 1 
ATOM   1459 C  CD2 . LEU A 1 179 ? -18.035 9.031   48.958  1.00 21.95 ? 222 LEU A CD2 1 
ATOM   1460 N  N   . GLU A 1 180 ? -12.838 10.418  49.955  1.00 28.96 ? 223 GLU A N   1 
ATOM   1461 C  CA  . GLU A 1 180 ? -11.476 10.789  49.547  1.00 30.75 ? 223 GLU A CA  1 
ATOM   1462 C  C   . GLU A 1 180 ? -10.806 9.643   48.787  1.00 31.80 ? 223 GLU A C   1 
ATOM   1463 O  O   . GLU A 1 180 ? -11.275 8.504   48.840  1.00 31.81 ? 223 GLU A O   1 
ATOM   1464 C  CB  . GLU A 1 180 ? -10.609 11.159  50.756  1.00 30.79 ? 223 GLU A CB  1 
ATOM   1465 C  CG  . GLU A 1 180 ? -11.258 12.065  51.789  1.00 32.38 ? 223 GLU A CG  1 
ATOM   1466 C  CD  . GLU A 1 180 ? -11.369 13.525  51.367  1.00 35.39 ? 223 GLU A CD  1 
ATOM   1467 O  OE1 . GLU A 1 180 ? -11.303 13.839  50.154  1.00 35.96 ? 223 GLU A OE1 1 
ATOM   1468 O  OE2 . GLU A 1 180 ? -11.540 14.374  52.273  1.00 37.77 ? 223 GLU A OE2 1 
ATOM   1469 N  N   . GLU A 1 181 ? -9.705  9.943   48.096  1.00 33.20 ? 224 GLU A N   1 
ATOM   1470 C  CA  . GLU A 1 181 ? -8.954  8.920   47.359  1.00 34.50 ? 224 GLU A CA  1 
ATOM   1471 C  C   . GLU A 1 181 ? -8.371  7.870   48.292  1.00 34.64 ? 224 GLU A C   1 
ATOM   1472 O  O   . GLU A 1 181 ? -8.380  6.690   47.967  1.00 35.21 ? 224 GLU A O   1 
ATOM   1473 C  CB  . GLU A 1 181 ? -7.855  9.536   46.487  1.00 34.52 ? 224 GLU A CB  1 
ATOM   1474 C  CG  . GLU A 1 181 ? -8.411  10.307  45.305  1.00 37.98 ? 224 GLU A CG  1 
ATOM   1475 C  CD  . GLU A 1 181 ? -7.447  10.407  44.119  1.00 42.52 ? 224 GLU A CD  1 
ATOM   1476 O  OE1 . GLU A 1 181 ? -7.038  9.351   43.576  1.00 43.75 ? 224 GLU A OE1 1 
ATOM   1477 O  OE2 . GLU A 1 181 ? -7.120  11.552  43.712  1.00 43.88 ? 224 GLU A OE2 1 
ATOM   1478 N  N   . VAL A 1 182 ? -7.874  8.306   49.447  1.00 34.89 ? 225 VAL A N   1 
ATOM   1479 C  CA  . VAL A 1 182 ? -7.328  7.400   50.457  1.00 34.96 ? 225 VAL A CA  1 
ATOM   1480 C  C   . VAL A 1 182 ? -8.306  7.341   51.632  1.00 34.97 ? 225 VAL A C   1 
ATOM   1481 O  O   . VAL A 1 182 ? -8.677  8.369   52.197  1.00 35.25 ? 225 VAL A O   1 
ATOM   1482 C  CB  . VAL A 1 182 ? -5.900  7.828   50.899  1.00 35.15 ? 225 VAL A CB  1 
ATOM   1483 C  CG1 . VAL A 1 182 ? -5.512  7.193   52.233  1.00 34.68 ? 225 VAL A CG1 1 
ATOM   1484 C  CG2 . VAL A 1 182 ? -4.879  7.478   49.801  1.00 35.24 ? 225 VAL A CG2 1 
ATOM   1485 N  N   . VAL A 1 183 ? -8.716  6.130   51.987  1.00 34.54 ? 226 VAL A N   1 
ATOM   1486 C  CA  . VAL A 1 183 ? -9.898  5.922   52.810  1.00 34.07 ? 226 VAL A CA  1 
ATOM   1487 C  C   . VAL A 1 183 ? -9.517  5.280   54.140  1.00 33.49 ? 226 VAL A C   1 
ATOM   1488 O  O   . VAL A 1 183 ? -8.595  4.481   54.192  1.00 33.71 ? 226 VAL A O   1 
ATOM   1489 C  CB  . VAL A 1 183 ? -10.937 5.059   52.003  1.00 34.46 ? 226 VAL A CB  1 
ATOM   1490 C  CG1 . VAL A 1 183 ? -11.724 4.086   52.886  1.00 34.91 ? 226 VAL A CG1 1 
ATOM   1491 C  CG2 . VAL A 1 183 ? -11.866 5.957   51.148  1.00 33.91 ? 226 VAL A CG2 1 
ATOM   1492 N  N   . ASN A 1 184 ? -10.215 5.650   55.212  1.00 32.78 ? 227 ASN A N   1 
ATOM   1493 C  CA  . ASN A 1 184 ? -10.073 4.978   56.499  1.00 32.03 ? 227 ASN A CA  1 
ATOM   1494 C  C   . ASN A 1 184 ? -10.418 3.476   56.394  1.00 31.41 ? 227 ASN A C   1 
ATOM   1495 O  O   . ASN A 1 184 ? -11.579 3.120   56.193  1.00 31.02 ? 227 ASN A O   1 
ATOM   1496 C  CB  . ASN A 1 184 ? -10.962 5.652   57.544  1.00 31.94 ? 227 ASN A CB  1 
ATOM   1497 C  CG  . ASN A 1 184 ? -10.648 5.200   58.965  1.00 33.62 ? 227 ASN A CG  1 
ATOM   1498 O  OD1 . ASN A 1 184 ? -9.977  4.187   59.185  1.00 35.27 ? 227 ASN A OD1 1 
ATOM   1499 N  ND2 . ASN A 1 184 ? -11.125 5.962   59.942  1.00 35.43 ? 227 ASN A ND2 1 
ATOM   1500 N  N   . PRO A 1 185 ? -9.406  2.590   56.529  1.00 30.87 ? 228 PRO A N   1 
ATOM   1501 C  CA  . PRO A 1 185 ? -9.693  1.152   56.391  1.00 30.17 ? 228 PRO A CA  1 
ATOM   1502 C  C   . PRO A 1 185 ? -10.572 0.586   57.523  1.00 29.56 ? 228 PRO A C   1 
ATOM   1503 O  O   . PRO A 1 185 ? -11.298 -0.393  57.303  1.00 29.42 ? 228 PRO A O   1 
ATOM   1504 C  CB  . PRO A 1 185 ? -8.300  0.510   56.390  1.00 30.14 ? 228 PRO A CB  1 
ATOM   1505 C  CG  . PRO A 1 185 ? -7.439  1.479   57.155  1.00 30.60 ? 228 PRO A CG  1 
ATOM   1506 C  CD  . PRO A 1 185 ? -7.987  2.850   56.855  1.00 30.46 ? 228 PRO A CD  1 
ATOM   1507 N  N   . GLU A 1 186 ? -10.524 1.197   58.707  1.00 28.93 ? 229 GLU A N   1 
ATOM   1508 C  CA  . GLU A 1 186 ? -11.397 0.769   59.807  1.00 28.77 ? 229 GLU A CA  1 
ATOM   1509 C  C   . GLU A 1 186 ? -12.860 1.117   59.550  1.00 27.84 ? 229 GLU A C   1 
ATOM   1510 O  O   . GLU A 1 186 ? -13.754 0.332   59.875  1.00 27.71 ? 229 GLU A O   1 
ATOM   1511 C  CB  . GLU A 1 186 ? -10.950 1.316   61.177  1.00 29.04 ? 229 GLU A CB  1 
ATOM   1512 C  CG  . GLU A 1 186 ? -9.744  0.599   61.817  1.00 32.16 ? 229 GLU A CG  1 
ATOM   1513 C  CD  . GLU A 1 186 ? -9.716  -0.922  61.581  1.00 35.86 ? 229 GLU A CD  1 
ATOM   1514 O  OE1 . GLU A 1 186 ? -10.663 -1.632  61.997  1.00 36.39 ? 229 GLU A OE1 1 
ATOM   1515 O  OE2 . GLU A 1 186 ? -8.729  -1.405  60.975  1.00 37.95 ? 229 GLU A OE2 1 
ATOM   1516 N  N   . ALA A 1 187 ? -13.107 2.295   58.979  1.00 27.02 ? 230 ALA A N   1 
ATOM   1517 C  CA  . ALA A 1 187 ? -14.468 2.675   58.606  1.00 25.82 ? 230 ALA A CA  1 
ATOM   1518 C  C   . ALA A 1 187 ? -14.996 1.749   57.490  1.00 25.41 ? 230 ALA A C   1 
ATOM   1519 O  O   . ALA A 1 187 ? -16.157 1.321   57.525  1.00 25.07 ? 230 ALA A O   1 
ATOM   1520 C  CB  . ALA A 1 187 ? -14.529 4.121   58.211  1.00 25.55 ? 230 ALA A CB  1 
ATOM   1521 N  N   . GLN A 1 188 ? -14.135 1.405   56.535  1.00 24.61 ? 231 GLN A N   1 
ATOM   1522 C  CA  . GLN A 1 188 ? -14.498 0.418   55.520  1.00 24.60 ? 231 GLN A CA  1 
ATOM   1523 C  C   . GLN A 1 188 ? -14.898 -0.938  56.132  1.00 24.69 ? 231 GLN A C   1 
ATOM   1524 O  O   . GLN A 1 188 ? -15.832 -1.599  55.653  1.00 24.49 ? 231 GLN A O   1 
ATOM   1525 C  CB  . GLN A 1 188 ? -13.364 0.210   54.505  1.00 24.11 ? 231 GLN A CB  1 
ATOM   1526 C  CG  . GLN A 1 188 ? -13.802 -0.586  53.275  1.00 22.81 ? 231 GLN A CG  1 
ATOM   1527 C  CD  . GLN A 1 188 ? -14.781 0.191   52.406  1.00 22.48 ? 231 GLN A CD  1 
ATOM   1528 O  OE1 . GLN A 1 188 ? -14.435 1.229   51.836  1.00 22.18 ? 231 GLN A OE1 1 
ATOM   1529 N  NE2 . GLN A 1 188 ? -16.008 -0.309  52.300  1.00 21.98 ? 231 GLN A NE2 1 
ATOM   1530 N  N   . ARG A 1 189 ? -14.171 -1.343  57.173  1.00 24.39 ? 232 ARG A N   1 
ATOM   1531 C  CA  . ARG A 1 189 ? -14.383 -2.632  57.816  1.00 24.31 ? 232 ARG A CA  1 
ATOM   1532 C  C   . ARG A 1 189 ? -15.781 -2.647  58.443  1.00 23.44 ? 232 ARG A C   1 
ATOM   1533 O  O   . ARG A 1 189 ? -16.472 -3.672  58.400  1.00 22.99 ? 232 ARG A O   1 
ATOM   1534 C  CB  . ARG A 1 189 ? -13.296 -2.873  58.866  1.00 24.89 ? 232 ARG A CB  1 
ATOM   1535 C  CG  . ARG A 1 189 ? -12.603 -4.224  58.751  1.00 27.68 ? 232 ARG A CG  1 
ATOM   1536 C  CD  . ARG A 1 189 ? -11.444 -4.387  59.755  1.00 31.47 ? 232 ARG A CD  1 
ATOM   1537 N  NE  . ARG A 1 189 ? -11.857 -4.214  61.158  1.00 32.99 ? 232 ARG A NE  1 
ATOM   1538 C  CZ  . ARG A 1 189 ? -12.485 -5.133  61.891  1.00 33.77 ? 232 ARG A CZ  1 
ATOM   1539 N  NH1 . ARG A 1 189 ? -12.803 -6.320  61.373  1.00 33.78 ? 232 ARG A NH1 1 
ATOM   1540 N  NH2 . ARG A 1 189 ? -12.803 -4.856  63.153  1.00 33.96 ? 232 ARG A NH2 1 
ATOM   1541 N  N   . PHE A 1 190 ? -16.185 -1.495  58.992  1.00 22.02 ? 233 PHE A N   1 
ATOM   1542 C  CA  . PHE A 1 190 ? -17.545 -1.267  59.460  1.00 21.41 ? 233 PHE A CA  1 
ATOM   1543 C  C   . PHE A 1 190 ? -18.607 -1.384  58.338  1.00 20.71 ? 233 PHE A C   1 
ATOM   1544 O  O   . PHE A 1 190 ? -19.602 -2.095  58.487  1.00 20.60 ? 233 PHE A O   1 
ATOM   1545 C  CB  . PHE A 1 190 ? -17.640 0.102   60.157  1.00 21.78 ? 233 PHE A CB  1 
ATOM   1546 C  CG  . PHE A 1 190 ? -18.983 0.376   60.797  1.00 22.44 ? 233 PHE A CG  1 
ATOM   1547 C  CD1 . PHE A 1 190 ? -19.272 -0.085  62.067  1.00 23.46 ? 233 PHE A CD1 1 
ATOM   1548 C  CD2 . PHE A 1 190 ? -19.960 1.092   60.121  1.00 24.72 ? 233 PHE A CD2 1 
ATOM   1549 C  CE1 . PHE A 1 190 ? -20.506 0.172   62.662  1.00 24.11 ? 233 PHE A CE1 1 
ATOM   1550 C  CE2 . PHE A 1 190 ? -21.199 1.346   60.707  1.00 25.33 ? 233 PHE A CE2 1 
ATOM   1551 C  CZ  . PHE A 1 190 ? -21.466 0.885   61.989  1.00 24.39 ? 233 PHE A CZ  1 
ATOM   1552 N  N   . ILE A 1 191 ? -18.394 -0.682  57.228  1.00 19.78 ? 234 ILE A N   1 
ATOM   1553 C  CA  . ILE A 1 191 ? -19.320 -0.715  56.106  1.00 19.24 ? 234 ILE A CA  1 
ATOM   1554 C  C   . ILE A 1 191 ? -19.551 -2.157  55.639  1.00 19.54 ? 234 ILE A C   1 
ATOM   1555 O  O   . ILE A 1 191 ? -20.692 -2.553  55.414  1.00 19.60 ? 234 ILE A O   1 
ATOM   1556 C  CB  . ILE A 1 191 ? -18.826 0.151   54.918  1.00 19.05 ? 234 ILE A CB  1 
ATOM   1557 C  CG1 . ILE A 1 191 ? -18.892 1.637   55.263  1.00 18.48 ? 234 ILE A CG1 1 
ATOM   1558 C  CG2 . ILE A 1 191 ? -19.643 -0.141  53.647  1.00 18.77 ? 234 ILE A CG2 1 
ATOM   1559 C  CD1 . ILE A 1 191 ? -18.066 2.512   54.342  1.00 17.63 ? 234 ILE A CD1 1 
ATOM   1560 N  N   . ASP A 1 192 ? -18.468 -2.924  55.499  1.00 19.42 ? 235 ASP A N   1 
ATOM   1561 C  CA  . ASP A 1 192 ? -18.524 -4.321  55.059  1.00 19.74 ? 235 ASP A CA  1 
ATOM   1562 C  C   . ASP A 1 192 ? -19.210 -5.236  56.062  1.00 19.17 ? 235 ASP A C   1 
ATOM   1563 O  O   . ASP A 1 192 ? -19.894 -6.182  55.676  1.00 19.37 ? 235 ASP A O   1 
ATOM   1564 C  CB  . ASP A 1 192 ? -17.116 -4.864  54.784  1.00 19.84 ? 235 ASP A CB  1 
ATOM   1565 C  CG  . ASP A 1 192 ? -16.364 -4.055  53.745  1.00 22.00 ? 235 ASP A CG  1 
ATOM   1566 O  OD1 . ASP A 1 192 ? -16.962 -3.195  53.047  1.00 23.19 ? 235 ASP A OD1 1 
ATOM   1567 O  OD2 . ASP A 1 192 ? -15.145 -4.286  53.621  1.00 26.50 ? 235 ASP A OD2 1 
ATOM   1568 N  N   . ALA A 1 193 ? -19.014 -4.964  57.346  1.00 18.89 ? 236 ALA A N   1 
ATOM   1569 C  CA  . ALA A 1 193 ? -19.638 -5.767  58.384  1.00 18.73 ? 236 ALA A CA  1 
ATOM   1570 C  C   . ALA A 1 193 ? -21.141 -5.653  58.245  1.00 18.91 ? 236 ALA A C   1 
ATOM   1571 O  O   . ALA A 1 193 ? -21.864 -6.637  58.462  1.00 19.37 ? 236 ALA A O   1 
ATOM   1572 C  CB  . ALA A 1 193 ? -19.194 -5.323  59.758  1.00 18.34 ? 236 ALA A CB  1 
ATOM   1573 N  N   . ILE A 1 194 ? -21.607 -4.460  57.868  1.00 18.36 ? 237 ILE A N   1 
ATOM   1574 C  CA  . ILE A 1 194 ? -23.034 -4.225  57.725  1.00 18.55 ? 237 ILE A CA  1 
ATOM   1575 C  C   . ILE A 1 194 ? -23.655 -5.144  56.673  1.00 19.20 ? 237 ILE A C   1 
ATOM   1576 O  O   . ILE A 1 194 ? -24.675 -5.785  56.942  1.00 19.10 ? 237 ILE A O   1 
ATOM   1577 C  CB  . ILE A 1 194 ? -23.368 -2.737  57.470  1.00 18.37 ? 237 ILE A CB  1 
ATOM   1578 C  CG1 . ILE A 1 194 ? -23.294 -1.968  58.790  1.00 17.65 ? 237 ILE A CG1 1 
ATOM   1579 C  CG2 . ILE A 1 194 ? -24.757 -2.599  56.890  1.00 17.45 ? 237 ILE A CG2 1 
ATOM   1580 C  CD1 . ILE A 1 194 ? -22.918 -0.545  58.625  1.00 17.84 ? 237 ILE A CD1 1 
ATOM   1581 N  N   . TYR A 1 195 ? -23.033 -5.224  55.498  1.00 19.60 ? 238 TYR A N   1 
ATOM   1582 C  CA  . TYR A 1 195 ? -23.516 -6.110  54.459  1.00 20.71 ? 238 TYR A CA  1 
ATOM   1583 C  C   . TYR A 1 195 ? -23.432 -7.584  54.904  1.00 20.80 ? 238 TYR A C   1 
ATOM   1584 O  O   . TYR A 1 195 ? -24.316 -8.380  54.593  1.00 20.61 ? 238 TYR A O   1 
ATOM   1585 C  CB  . TYR A 1 195 ? -22.762 -5.858  53.140  1.00 21.27 ? 238 TYR A CB  1 
ATOM   1586 C  CG  . TYR A 1 195 ? -23.060 -6.878  52.086  1.00 23.17 ? 238 TYR A CG  1 
ATOM   1587 C  CD1 . TYR A 1 195 ? -24.255 -6.835  51.367  1.00 26.63 ? 238 TYR A CD1 1 
ATOM   1588 C  CD2 . TYR A 1 195 ? -22.169 -7.915  51.831  1.00 24.78 ? 238 TYR A CD2 1 
ATOM   1589 C  CE1 . TYR A 1 195 ? -24.545 -7.799  50.403  1.00 28.50 ? 238 TYR A CE1 1 
ATOM   1590 C  CE2 . TYR A 1 195 ? -22.442 -8.880  50.871  1.00 27.03 ? 238 TYR A CE2 1 
ATOM   1591 C  CZ  . TYR A 1 195 ? -23.633 -8.816  50.158  1.00 29.20 ? 238 TYR A CZ  1 
ATOM   1592 O  OH  . TYR A 1 195 ? -23.916 -9.781  49.208  1.00 32.20 ? 238 TYR A OH  1 
ATOM   1593 N  N   . GLN A 1 196 ? -22.377 -7.925  55.649  1.00 21.02 ? 239 GLN A N   1 
ATOM   1594 C  CA  . GLN A 1 196 ? -22.182 -9.283  56.157  1.00 21.50 ? 239 GLN A CA  1 
ATOM   1595 C  C   . GLN A 1 196 ? -23.262 -9.669  57.153  1.00 20.75 ? 239 GLN A C   1 
ATOM   1596 O  O   . GLN A 1 196 ? -23.801 -10.781 57.100  1.00 21.02 ? 239 GLN A O   1 
ATOM   1597 C  CB  . GLN A 1 196 ? -20.797 -9.441  56.786  1.00 21.80 ? 239 GLN A CB  1 
ATOM   1598 C  CG  . GLN A 1 196 ? -19.738 -9.839  55.796  1.00 25.90 ? 239 GLN A CG  1 
ATOM   1599 C  CD  . GLN A 1 196 ? -20.036 -11.207 55.168  1.00 31.49 ? 239 GLN A CD  1 
ATOM   1600 O  OE1 . GLN A 1 196 ? -20.101 -12.231 55.875  1.00 32.93 ? 239 GLN A OE1 1 
ATOM   1601 N  NE2 . GLN A 1 196 ? -20.221 -11.229 53.839  1.00 30.94 ? 239 GLN A NE2 1 
ATOM   1602 N  N   . MET A 1 197 ? -23.570 -8.747  58.057  1.00 19.60 ? 240 MET A N   1 
ATOM   1603 C  CA  . MET A 1 197 ? -24.680 -8.918  58.977  1.00 19.24 ? 240 MET A CA  1 
ATOM   1604 C  C   . MET A 1 197 ? -25.980 -9.322  58.243  1.00 18.65 ? 240 MET A C   1 
ATOM   1605 O  O   . MET A 1 197 ? -26.648 -10.271 58.655  1.00 18.53 ? 240 MET A O   1 
ATOM   1606 C  CB  . MET A 1 197 ? -24.876 -7.645  59.799  1.00 18.97 ? 240 MET A CB  1 
ATOM   1607 C  CG  . MET A 1 197 ? -25.776 -7.805  60.996  1.00 20.03 ? 240 MET A CG  1 
ATOM   1608 S  SD  . MET A 1 197 ? -27.541 -7.775  60.606  1.00 21.61 ? 240 MET A SD  1 
ATOM   1609 C  CE  . MET A 1 197 ? -27.786 -6.021  60.387  1.00 21.09 ? 240 MET A CE  1 
ATOM   1610 N  N   . PHE A 1 198 ? -26.307 -8.639  57.142  1.00 17.56 ? 241 PHE A N   1 
ATOM   1611 C  CA  . PHE A 1 198 ? -27.545 -8.919  56.417  1.00 16.95 ? 241 PHE A CA  1 
ATOM   1612 C  C   . PHE A 1 198 ? -27.460 -10.230 55.663  1.00 17.20 ? 241 PHE A C   1 
ATOM   1613 O  O   . PHE A 1 198 ? -28.339 -11.084 55.792  1.00 16.86 ? 241 PHE A O   1 
ATOM   1614 C  CB  . PHE A 1 198 ? -27.903 -7.791  55.442  1.00 16.17 ? 241 PHE A CB  1 
ATOM   1615 C  CG  . PHE A 1 198 ? -28.412 -6.558  56.108  1.00 14.28 ? 241 PHE A CG  1 
ATOM   1616 C  CD1 . PHE A 1 198 ? -27.787 -5.333  55.895  1.00 12.21 ? 241 PHE A CD1 1 
ATOM   1617 C  CD2 . PHE A 1 198 ? -29.521 -6.611  56.956  1.00 13.40 ? 241 PHE A CD2 1 
ATOM   1618 C  CE1 . PHE A 1 198 ? -28.266 -4.170  56.513  1.00 12.47 ? 241 PHE A CE1 1 
ATOM   1619 C  CE2 . PHE A 1 198 ? -30.007 -5.447  57.578  1.00 12.44 ? 241 PHE A CE2 1 
ATOM   1620 C  CZ  . PHE A 1 198 ? -29.372 -4.227  57.358  1.00 10.05 ? 241 PHE A CZ  1 
ATOM   1621 N  N   . HIS A 1 199 ? -26.404 -10.364 54.863  1.00 17.52 ? 242 HIS A N   1 
ATOM   1622 C  CA  . HIS A 1 199 ? -26.165 -11.571 54.089  1.00 17.91 ? 242 HIS A CA  1 
ATOM   1623 C  C   . HIS A 1 199 ? -26.209 -12.816 54.992  1.00 17.60 ? 242 HIS A C   1 
ATOM   1624 O  O   . HIS A 1 199 ? -26.935 -13.764 54.693  1.00 17.78 ? 242 HIS A O   1 
ATOM   1625 C  CB  . HIS A 1 199 ? -24.840 -11.473 53.317  1.00 17.95 ? 242 HIS A CB  1 
ATOM   1626 C  CG  . HIS A 1 199 ? -24.567 -12.648 52.428  1.00 20.17 ? 242 HIS A CG  1 
ATOM   1627 N  ND1 . HIS A 1 199 ? -25.357 -12.963 51.339  1.00 23.05 ? 242 HIS A ND1 1 
ATOM   1628 C  CD2 . HIS A 1 199 ? -23.587 -13.581 52.459  1.00 21.45 ? 242 HIS A CD2 1 
ATOM   1629 C  CE1 . HIS A 1 199 ? -24.884 -14.044 50.745  1.00 20.78 ? 242 HIS A CE1 1 
ATOM   1630 N  NE2 . HIS A 1 199 ? -23.809 -14.438 51.404  1.00 22.24 ? 242 HIS A NE2 1 
ATOM   1631 N  N   . THR A 1 200 ? -25.473 -12.803 56.104  1.00 17.34 ? 243 THR A N   1 
ATOM   1632 C  CA  . THR A 1 200 ? -25.435 -13.987 56.980  1.00 17.20 ? 243 THR A CA  1 
ATOM   1633 C  C   . THR A 1 200 ? -26.739 -14.192 57.754  1.00 17.58 ? 243 THR A C   1 
ATOM   1634 O  O   . THR A 1 200 ? -26.909 -15.204 58.408  1.00 18.47 ? 243 THR A O   1 
ATOM   1635 C  CB  . THR A 1 200 ? -24.256 -13.988 57.987  1.00 16.64 ? 243 THR A CB  1 
ATOM   1636 O  OG1 . THR A 1 200 ? -24.372 -12.868 58.874  1.00 17.62 ? 243 THR A OG1 1 
ATOM   1637 C  CG2 . THR A 1 200 ? -22.920 -13.966 57.295  1.00 14.98 ? 243 THR A CG2 1 
ATOM   1638 N  N   . SER A 1 201 ? -27.660 -13.243 57.689  1.00 17.92 ? 244 SER A N   1 
ATOM   1639 C  CA  . SER A 1 201 ? -28.940 -13.420 58.355  1.00 18.35 ? 244 SER A CA  1 
ATOM   1640 C  C   . SER A 1 201 ? -29.779 -14.509 57.677  1.00 18.74 ? 244 SER A C   1 
ATOM   1641 O  O   . SER A 1 201 ? -30.538 -15.212 58.336  1.00 18.91 ? 244 SER A O   1 
ATOM   1642 C  CB  . SER A 1 201 ? -29.728 -12.107 58.380  1.00 18.20 ? 244 SER A CB  1 
ATOM   1643 O  OG  . SER A 1 201 ? -29.128 -11.120 59.206  1.00 18.60 ? 244 SER A OG  1 
ATOM   1644 N  N   . VAL A 1 202 ? -29.628 -14.644 56.360  1.00 19.08 ? 245 VAL A N   1 
ATOM   1645 C  CA  . VAL A 1 202 ? -30.580 -15.390 55.534  1.00 19.21 ? 245 VAL A CA  1 
ATOM   1646 C  C   . VAL A 1 202 ? -30.651 -16.907 55.830  1.00 19.52 ? 245 VAL A C   1 
ATOM   1647 O  O   . VAL A 1 202 ? -31.750 -17.442 56.012  1.00 19.04 ? 245 VAL A O   1 
ATOM   1648 C  CB  . VAL A 1 202 ? -30.385 -15.065 54.022  1.00 19.43 ? 245 VAL A CB  1 
ATOM   1649 C  CG1 . VAL A 1 202 ? -31.291 -15.922 53.141  1.00 19.35 ? 245 VAL A CG1 1 
ATOM   1650 C  CG2 . VAL A 1 202 ? -30.669 -13.594 53.767  1.00 18.97 ? 245 VAL A CG2 1 
ATOM   1651 N  N   . PRO A 1 203 ? -29.496 -17.600 55.905  1.00 20.10 ? 246 PRO A N   1 
ATOM   1652 C  CA  . PRO A 1 203 ? -29.620 -19.030 56.220  1.00 20.66 ? 246 PRO A CA  1 
ATOM   1653 C  C   . PRO A 1 203 ? -30.273 -19.347 57.581  1.00 21.58 ? 246 PRO A C   1 
ATOM   1654 O  O   . PRO A 1 203 ? -30.662 -20.484 57.815  1.00 21.10 ? 246 PRO A O   1 
ATOM   1655 C  CB  . PRO A 1 203 ? -28.166 -19.531 56.175  1.00 20.44 ? 246 PRO A CB  1 
ATOM   1656 C  CG  . PRO A 1 203 ? -27.451 -18.554 55.267  1.00 19.66 ? 246 PRO A CG  1 
ATOM   1657 C  CD  . PRO A 1 203 ? -28.093 -17.228 55.607  1.00 20.03 ? 246 PRO A CD  1 
ATOM   1658 N  N   . MET A 1 204 ? -30.431 -18.356 58.452  1.00 22.56 ? 247 MET A N   1 
ATOM   1659 C  CA  . MET A 1 204 ? -30.999 -18.631 59.762  1.00 24.08 ? 247 MET A CA  1 
ATOM   1660 C  C   . MET A 1 204 ? -32.454 -18.164 59.924  1.00 25.03 ? 247 MET A C   1 
ATOM   1661 O  O   . MET A 1 204 ? -33.033 -18.289 61.015  1.00 25.31 ? 247 MET A O   1 
ATOM   1662 C  CB  . MET A 1 204 ? -30.106 -18.038 60.863  1.00 24.22 ? 247 MET A CB  1 
ATOM   1663 C  CG  . MET A 1 204 ? -28.645 -18.491 60.796  1.00 25.12 ? 247 MET A CG  1 
ATOM   1664 S  SD  . MET A 1 204 ? -27.565 -17.573 61.914  1.00 27.77 ? 247 MET A SD  1 
ATOM   1665 C  CE  . MET A 1 204 ? -27.605 -18.669 63.276  1.00 29.98 ? 247 MET A CE  1 
ATOM   1666 N  N   . LEU A 1 205 ? -33.059 -17.669 58.840  1.00 25.82 ? 248 LEU A N   1 
ATOM   1667 C  CA  . LEU A 1 205 ? -34.293 -16.860 58.927  1.00 26.38 ? 248 LEU A CA  1 
ATOM   1668 C  C   . LEU A 1 205 ? -35.578 -17.521 59.468  1.00 26.57 ? 248 LEU A C   1 
ATOM   1669 O  O   . LEU A 1 205 ? -36.376 -16.868 60.171  1.00 27.57 ? 248 LEU A O   1 
ATOM   1670 C  CB  . LEU A 1 205 ? -34.583 -16.198 57.582  1.00 26.83 ? 248 LEU A CB  1 
ATOM   1671 C  CG  . LEU A 1 205 ? -35.608 -15.063 57.646  1.00 28.57 ? 248 LEU A CG  1 
ATOM   1672 C  CD1 . LEU A 1 205 ? -35.036 -13.874 58.412  1.00 28.51 ? 248 LEU A CD1 1 
ATOM   1673 C  CD2 . LEU A 1 205 ? -36.111 -14.669 56.248  1.00 30.00 ? 248 LEU A CD2 1 
ATOM   1674 N  N   . ASN A 1 206 ? -35.794 -18.790 59.147  1.00 25.79 ? 249 ASN A N   1 
ATOM   1675 C  CA  . ASN A 1 206 ? -37.039 -19.451 59.507  1.00 25.35 ? 249 ASN A CA  1 
ATOM   1676 C  C   . ASN A 1 206 ? -36.860 -20.507 60.613  1.00 25.38 ? 249 ASN A C   1 
ATOM   1677 O  O   . ASN A 1 206 ? -37.733 -21.363 60.839  1.00 25.46 ? 249 ASN A O   1 
ATOM   1678 C  CB  . ASN A 1 206 ? -37.673 -20.062 58.250  1.00 25.42 ? 249 ASN A CB  1 
ATOM   1679 C  CG  . ASN A 1 206 ? -38.021 -19.010 57.193  1.00 24.95 ? 249 ASN A CG  1 
ATOM   1680 O  OD1 . ASN A 1 206 ? -39.085 -18.395 57.242  1.00 24.97 ? 249 ASN A OD1 1 
ATOM   1681 N  ND2 . ASN A 1 206 ? -37.129 -18.814 56.232  1.00 22.71 ? 249 ASN A ND2 1 
ATOM   1682 N  N   . LEU A 1 207 ? -35.731 -20.426 61.309  1.00 24.82 ? 250 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 207 ? -35.359 -21.412 62.316  1.00 24.53 ? 250 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 207 ? -35.372 -20.793 63.697  1.00 24.21 ? 250 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 207 ? -35.051 -19.622 63.845  1.00 24.01 ? 250 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 207 ? -33.962 -21.974 62.021  1.00 24.19 ? 250 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 207 ? -33.716 -22.556 60.621  1.00 25.20 ? 250 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 207 ? -32.255 -22.948 60.418  1.00 23.79 ? 250 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 207 ? -34.654 -23.729 60.340  1.00 25.13 ? 250 LEU A CD2 1 
ATOM   1690 N  N   . PRO A 1 208 ? -35.745 -21.576 64.723  1.00 24.32 ? 251 PRO A N   1 
ATOM   1691 C  CA  . PRO A 1 208 ? -35.591 -21.079 66.102  1.00 24.23 ? 251 PRO A CA  1 
ATOM   1692 C  C   . PRO A 1 208 ? -34.104 -21.087 66.480  1.00 23.89 ? 251 PRO A C   1 
ATOM   1693 O  O   . PRO A 1 208 ? -33.337 -21.818 65.852  1.00 23.50 ? 251 PRO A O   1 
ATOM   1694 C  CB  . PRO A 1 208 ? -36.401 -22.074 66.935  1.00 24.27 ? 251 PRO A CB  1 
ATOM   1695 C  CG  . PRO A 1 208 ? -36.397 -23.332 66.128  1.00 24.88 ? 251 PRO A CG  1 
ATOM   1696 C  CD  . PRO A 1 208 ? -36.364 -22.911 64.674  1.00 24.21 ? 251 PRO A CD  1 
ATOM   1697 N  N   . PRO A 1 209 ? -33.686 -20.246 67.452  1.00 23.92 ? 252 PRO A N   1 
ATOM   1698 C  CA  . PRO A 1 209 ? -32.257 -20.171 67.751  1.00 24.44 ? 252 PRO A CA  1 
ATOM   1699 C  C   . PRO A 1 209 ? -31.639 -21.533 68.059  1.00 24.99 ? 252 PRO A C   1 
ATOM   1700 O  O   . PRO A 1 209 ? -30.487 -21.757 67.701  1.00 25.30 ? 252 PRO A O   1 
ATOM   1701 C  CB  . PRO A 1 209 ? -32.175 -19.225 68.969  1.00 24.47 ? 252 PRO A CB  1 
ATOM   1702 C  CG  . PRO A 1 209 ? -33.596 -19.002 69.423  1.00 23.82 ? 252 PRO A CG  1 
ATOM   1703 C  CD  . PRO A 1 209 ? -34.460 -19.257 68.227  1.00 24.04 ? 252 PRO A CD  1 
ATOM   1704 N  N   . ASP A 1 210 ? -32.408 -22.433 68.673  1.00 25.30 ? 253 ASP A N   1 
ATOM   1705 C  CA  . ASP A 1 210 ? -31.951 -23.793 68.976  1.00 26.28 ? 253 ASP A CA  1 
ATOM   1706 C  C   . ASP A 1 210 ? -31.393 -24.552 67.794  1.00 26.69 ? 253 ASP A C   1 
ATOM   1707 O  O   . ASP A 1 210 ? -30.524 -25.401 67.961  1.00 26.84 ? 253 ASP A O   1 
ATOM   1708 C  CB  . ASP A 1 210 ? -33.067 -24.636 69.598  1.00 26.07 ? 253 ASP A CB  1 
ATOM   1709 C  CG  . ASP A 1 210 ? -33.196 -24.424 71.090  1.00 27.01 ? 253 ASP A CG  1 
ATOM   1710 O  OD1 . ASP A 1 210 ? -32.214 -23.951 71.722  1.00 26.98 ? 253 ASP A OD1 1 
ATOM   1711 O  OD2 . ASP A 1 210 ? -34.289 -24.724 71.630  1.00 28.60 ? 253 ASP A OD2 1 
ATOM   1712 N  N   . LEU A 1 211 ? -31.905 -24.263 66.607  1.00 27.50 ? 254 LEU A N   1 
ATOM   1713 C  CA  . LEU A 1 211 ? -31.432 -24.925 65.397  1.00 28.22 ? 254 LEU A CA  1 
ATOM   1714 C  C   . LEU A 1 211 ? -30.272 -24.206 64.667  1.00 28.77 ? 254 LEU A C   1 
ATOM   1715 O  O   . LEU A 1 211 ? -29.592 -24.834 63.859  1.00 28.72 ? 254 LEU A O   1 
ATOM   1716 C  CB  . LEU A 1 211 ? -32.604 -25.241 64.464  1.00 27.94 ? 254 LEU A CB  1 
ATOM   1717 C  CG  . LEU A 1 211 ? -33.781 -26.005 65.096  1.00 28.29 ? 254 LEU A CG  1 
ATOM   1718 C  CD1 . LEU A 1 211 ? -34.849 -26.251 64.072  1.00 28.17 ? 254 LEU A CD1 1 
ATOM   1719 C  CD2 . LEU A 1 211 ? -33.372 -27.343 65.727  1.00 28.60 ? 254 LEU A CD2 1 
ATOM   1720 N  N   . PHE A 1 212 ? -30.032 -22.923 64.983  1.00 29.37 ? 255 PHE A N   1 
ATOM   1721 C  CA  . PHE A 1 212 ? -28.927 -22.140 64.389  1.00 29.65 ? 255 PHE A CA  1 
ATOM   1722 C  C   . PHE A 1 212 ? -27.615 -22.844 64.598  1.00 30.43 ? 255 PHE A C   1 
ATOM   1723 O  O   . PHE A 1 212 ? -26.965 -23.287 63.650  1.00 30.81 ? 255 PHE A O   1 
ATOM   1724 C  CB  . PHE A 1 212 ? -28.694 -20.789 65.089  1.00 29.45 ? 255 PHE A CB  1 
ATOM   1725 C  CG  . PHE A 1 212 ? -29.816 -19.810 65.004  1.00 27.44 ? 255 PHE A CG  1 
ATOM   1726 C  CD1 . PHE A 1 212 ? -29.749 -18.645 65.762  1.00 25.93 ? 255 PHE A CD1 1 
ATOM   1727 C  CD2 . PHE A 1 212 ? -30.924 -20.032 64.205  1.00 26.10 ? 255 PHE A CD2 1 
ATOM   1728 C  CE1 . PHE A 1 212 ? -30.762 -17.716 65.729  1.00 26.13 ? 255 PHE A CE1 1 
ATOM   1729 C  CE2 . PHE A 1 212 ? -31.947 -19.109 64.170  1.00 26.20 ? 255 PHE A CE2 1 
ATOM   1730 C  CZ  . PHE A 1 212 ? -31.866 -17.942 64.929  1.00 26.79 ? 255 PHE A CZ  1 
ATOM   1731 N  N   . ARG A 1 213 ? -27.217 -22.908 65.869  1.00 31.03 ? 256 ARG A N   1 
ATOM   1732 C  CA  . ARG A 1 213 ? -25.896 -23.400 66.251  1.00 31.55 ? 256 ARG A CA  1 
ATOM   1733 C  C   . ARG A 1 213 ? -25.716 -24.834 65.813  1.00 31.13 ? 256 ARG A C   1 
ATOM   1734 O  O   . ARG A 1 213 ? -24.582 -25.308 65.639  1.00 31.83 ? 256 ARG A O   1 
ATOM   1735 C  CB  . ARG A 1 213 ? -25.659 -23.255 67.764  1.00 32.39 ? 256 ARG A CB  1 
ATOM   1736 C  CG  . ARG A 1 213 ? -26.931 -23.231 68.631  1.00 34.19 ? 256 ARG A CG  1 
ATOM   1737 C  CD  . ARG A 1 213 ? -26.618 -23.645 70.079  1.00 37.75 ? 256 ARG A CD  1 
ATOM   1738 N  NE  . ARG A 1 213 ? -27.640 -23.181 71.020  1.00 40.00 ? 256 ARG A NE  1 
ATOM   1739 C  CZ  . ARG A 1 213 ? -28.784 -23.817 71.273  1.00 41.65 ? 256 ARG A CZ  1 
ATOM   1740 N  NH1 . ARG A 1 213 ? -29.077 -24.969 70.661  1.00 42.24 ? 256 ARG A NH1 1 
ATOM   1741 N  NH2 . ARG A 1 213 ? -29.641 -23.296 72.140  1.00 41.22 ? 256 ARG A NH2 1 
ATOM   1742 N  N   . LEU A 1 214 ? -26.841 -25.509 65.599  1.00 29.90 ? 257 LEU A N   1 
ATOM   1743 C  CA  . LEU A 1 214 ? -26.830 -26.912 65.263  1.00 28.82 ? 257 LEU A CA  1 
ATOM   1744 C  C   . LEU A 1 214 ? -26.655 -27.149 63.761  1.00 28.29 ? 257 LEU A C   1 
ATOM   1745 O  O   . LEU A 1 214 ? -25.897 -28.027 63.358  1.00 28.31 ? 257 LEU A O   1 
ATOM   1746 C  CB  . LEU A 1 214 ? -28.099 -27.574 65.811  1.00 28.77 ? 257 LEU A CB  1 
ATOM   1747 C  CG  . LEU A 1 214 ? -28.051 -29.026 66.280  1.00 27.51 ? 257 LEU A CG  1 
ATOM   1748 C  CD1 . LEU A 1 214 ? -26.868 -29.294 67.185  1.00 26.22 ? 257 LEU A CD1 1 
ATOM   1749 C  CD2 . LEU A 1 214 ? -29.338 -29.348 66.991  1.00 26.60 ? 257 LEU A CD2 1 
ATOM   1750 N  N   . PHE A 1 215 ? -27.335 -26.361 62.930  1.00 27.39 ? 258 PHE A N   1 
ATOM   1751 C  CA  . PHE A 1 215 ? -27.278 -26.578 61.484  1.00 26.45 ? 258 PHE A CA  1 
ATOM   1752 C  C   . PHE A 1 215 ? -26.692 -25.429 60.659  1.00 26.17 ? 258 PHE A C   1 
ATOM   1753 O  O   . PHE A 1 215 ? -26.504 -25.555 59.451  1.00 26.03 ? 258 PHE A O   1 
ATOM   1754 C  CB  . PHE A 1 215 ? -28.653 -26.969 60.967  1.00 26.15 ? 258 PHE A CB  1 
ATOM   1755 C  CG  . PHE A 1 215 ? -29.190 -28.225 61.581  1.00 26.43 ? 258 PHE A CG  1 
ATOM   1756 C  CD1 . PHE A 1 215 ? -30.336 -28.192 62.382  1.00 27.30 ? 258 PHE A CD1 1 
ATOM   1757 C  CD2 . PHE A 1 215 ? -28.549 -29.446 61.374  1.00 25.73 ? 258 PHE A CD2 1 
ATOM   1758 C  CE1 . PHE A 1 215 ? -30.846 -29.357 62.957  1.00 26.65 ? 258 PHE A CE1 1 
ATOM   1759 C  CE2 . PHE A 1 215 ? -29.047 -30.613 61.950  1.00 26.00 ? 258 PHE A CE2 1 
ATOM   1760 C  CZ  . PHE A 1 215 ? -30.204 -30.566 62.743  1.00 25.82 ? 258 PHE A CZ  1 
ATOM   1761 N  N   . ARG A 1 216 ? -26.401 -24.313 61.317  1.00 25.79 ? 259 ARG A N   1 
ATOM   1762 C  CA  . ARG A 1 216 ? -25.888 -23.126 60.646  1.00 25.61 ? 259 ARG A CA  1 
ATOM   1763 C  C   . ARG A 1 216 ? -24.766 -22.545 61.479  1.00 25.89 ? 259 ARG A C   1 
ATOM   1764 O  O   . ARG A 1 216 ? -24.588 -21.331 61.534  1.00 25.91 ? 259 ARG A O   1 
ATOM   1765 C  CB  . ARG A 1 216 ? -27.001 -22.075 60.490  1.00 25.35 ? 259 ARG A CB  1 
ATOM   1766 C  CG  . ARG A 1 216 ? -28.181 -22.502 59.634  1.00 23.90 ? 259 ARG A CG  1 
ATOM   1767 C  CD  . ARG A 1 216 ? -27.807 -22.556 58.167  1.00 22.87 ? 259 ARG A CD  1 
ATOM   1768 N  NE  . ARG A 1 216 ? -28.948 -22.945 57.336  1.00 23.00 ? 259 ARG A NE  1 
ATOM   1769 C  CZ  . ARG A 1 216 ? -29.160 -24.171 56.871  1.00 22.62 ? 259 ARG A CZ  1 
ATOM   1770 N  NH1 . ARG A 1 216 ? -28.312 -25.160 57.136  1.00 20.93 ? 259 ARG A NH1 1 
ATOM   1771 N  NH2 . ARG A 1 216 ? -30.226 -24.409 56.130  1.00 24.01 ? 259 ARG A NH2 1 
ATOM   1772 N  N   . THR A 1 217 ? -24.020 -23.429 62.135  1.00 26.39 ? 260 THR A N   1 
ATOM   1773 C  CA  . THR A 1 217 ? -22.926 -23.056 63.043  1.00 26.63 ? 260 THR A CA  1 
ATOM   1774 C  C   . THR A 1 217 ? -21.970 -22.054 62.406  1.00 26.49 ? 260 THR A C   1 
ATOM   1775 O  O   . THR A 1 217 ? -21.642 -21.031 63.020  1.00 26.64 ? 260 THR A O   1 
ATOM   1776 C  CB  . THR A 1 217 ? -22.118 -24.306 63.503  1.00 26.70 ? 260 THR A CB  1 
ATOM   1777 O  OG1 . THR A 1 217 ? -23.019 -25.387 63.756  1.00 27.60 ? 260 THR A OG1 1 
ATOM   1778 C  CG2 . THR A 1 217 ? -21.324 -24.010 64.763  1.00 26.82 ? 260 THR A CG2 1 
ATOM   1779 N  N   . LYS A 1 218 ? -21.522 -22.359 61.188  1.00 26.27 ? 261 LYS A N   1 
ATOM   1780 C  CA  . LYS A 1 218 ? -20.582 -21.501 60.473  1.00 26.70 ? 261 LYS A CA  1 
ATOM   1781 C  C   . LYS A 1 218 ? -21.196 -20.129 60.150  1.00 26.55 ? 261 LYS A C   1 
ATOM   1782 O  O   . LYS A 1 218 ? -20.526 -19.091 60.285  1.00 26.56 ? 261 LYS A O   1 
ATOM   1783 C  CB  . LYS A 1 218 ? -20.102 -22.179 59.189  1.00 26.97 ? 261 LYS A CB  1 
ATOM   1784 C  CG  . LYS A 1 218 ? -18.994 -21.417 58.485  1.00 28.29 ? 261 LYS A CG  1 
ATOM   1785 C  CD  . LYS A 1 218 ? -19.148 -21.437 56.962  1.00 30.51 ? 261 LYS A CD  1 
ATOM   1786 C  CE  . LYS A 1 218 ? -18.720 -20.084 56.342  1.00 30.64 ? 261 LYS A CE  1 
ATOM   1787 N  NZ  . LYS A 1 218 ? -17.332 -19.661 56.724  1.00 29.39 ? 261 LYS A NZ  1 
ATOM   1788 N  N   . THR A 1 219 ? -22.468 -20.129 59.731  1.00 25.93 ? 262 THR A N   1 
ATOM   1789 C  CA  . THR A 1 219 ? -23.175 -18.887 59.406  1.00 25.07 ? 262 THR A CA  1 
ATOM   1790 C  C   . THR A 1 219 ? -23.388 -18.022 60.656  1.00 24.90 ? 262 THR A C   1 
ATOM   1791 O  O   . THR A 1 219 ? -23.194 -16.797 60.625  1.00 24.49 ? 262 THR A O   1 
ATOM   1792 C  CB  . THR A 1 219 ? -24.482 -19.175 58.645  1.00 25.17 ? 262 THR A CB  1 
ATOM   1793 O  OG1 . THR A 1 219 ? -24.171 -19.350 57.252  1.00 24.91 ? 262 THR A OG1 1 
ATOM   1794 C  CG2 . THR A 1 219 ? -25.494 -18.032 58.801  1.00 24.23 ? 262 THR A CG2 1 
ATOM   1795 N  N   . TRP A 1 220 ? -23.758 -18.680 61.750  1.00 24.39 ? 263 TRP A N   1 
ATOM   1796 C  CA  . TRP A 1 220 ? -23.940 -18.027 63.022  1.00 24.48 ? 263 TRP A CA  1 
ATOM   1797 C  C   . TRP A 1 220 ? -22.630 -17.411 63.508  1.00 25.12 ? 263 TRP A C   1 
ATOM   1798 O  O   . TRP A 1 220 ? -22.607 -16.260 63.970  1.00 25.08 ? 263 TRP A O   1 
ATOM   1799 C  CB  . TRP A 1 220 ? -24.495 -19.015 64.035  1.00 24.12 ? 263 TRP A CB  1 
ATOM   1800 C  CG  . TRP A 1 220 ? -24.535 -18.507 65.441  1.00 23.77 ? 263 TRP A CG  1 
ATOM   1801 C  CD1 . TRP A 1 220 ? -23.764 -18.937 66.470  1.00 23.26 ? 263 TRP A CD1 1 
ATOM   1802 C  CD2 . TRP A 1 220 ? -25.378 -17.475 65.975  1.00 22.27 ? 263 TRP A CD2 1 
ATOM   1803 N  NE1 . TRP A 1 220 ? -24.072 -18.252 67.615  1.00 23.33 ? 263 TRP A NE1 1 
ATOM   1804 C  CE2 . TRP A 1 220 ? -25.053 -17.342 67.343  1.00 23.39 ? 263 TRP A CE2 1 
ATOM   1805 C  CE3 . TRP A 1 220 ? -26.369 -16.651 65.437  1.00 20.86 ? 263 TRP A CE3 1 
ATOM   1806 C  CZ2 . TRP A 1 220 ? -25.691 -16.422 68.188  1.00 23.58 ? 263 TRP A CZ2 1 
ATOM   1807 C  CZ3 . TRP A 1 220 ? -27.010 -15.735 66.274  1.00 21.84 ? 263 TRP A CZ3 1 
ATOM   1808 C  CH2 . TRP A 1 220 ? -26.668 -15.627 67.634  1.00 23.09 ? 263 TRP A CH2 1 
ATOM   1809 N  N   . LYS A 1 221 ? -21.541 -18.169 63.380  1.00 25.46 ? 264 LYS A N   1 
ATOM   1810 C  CA  . LYS A 1 221 ? -20.234 -17.685 63.772  1.00 25.60 ? 264 LYS A CA  1 
ATOM   1811 C  C   . LYS A 1 221 ? -19.937 -16.382 63.030  1.00 25.01 ? 264 LYS A C   1 
ATOM   1812 O  O   . LYS A 1 221 ? -19.580 -15.376 63.654  1.00 25.46 ? 264 LYS A O   1 
ATOM   1813 C  CB  . LYS A 1 221 ? -19.159 -18.734 63.473  1.00 26.46 ? 264 LYS A CB  1 
ATOM   1814 C  CG  . LYS A 1 221 ? -17.877 -18.548 64.270  1.00 29.27 ? 264 LYS A CG  1 
ATOM   1815 C  CD  . LYS A 1 221 ? -16.634 -19.111 63.574  1.00 32.77 ? 264 LYS A CD  1 
ATOM   1816 C  CE  . LYS A 1 221 ? -15.377 -18.409 64.116  1.00 34.42 ? 264 LYS A CE  1 
ATOM   1817 N  NZ  . LYS A 1 221 ? -14.159 -19.265 64.063  1.00 36.42 ? 264 LYS A NZ  1 
ATOM   1818 N  N   . ASP A 1 222 ? -20.102 -16.407 61.706  1.00 23.86 ? 265 ASP A N   1 
ATOM   1819 C  CA  . ASP A 1 222 ? -19.828 -15.263 60.838  1.00 22.71 ? 265 ASP A CA  1 
ATOM   1820 C  C   . ASP A 1 222 ? -20.774 -14.090 61.103  1.00 21.79 ? 265 ASP A C   1 
ATOM   1821 O  O   . ASP A 1 222 ? -20.390 -12.922 61.027  1.00 21.83 ? 265 ASP A O   1 
ATOM   1822 C  CB  . ASP A 1 222 ? -19.934 -15.691 59.369  1.00 23.19 ? 265 ASP A CB  1 
ATOM   1823 C  CG  . ASP A 1 222 ? -18.751 -16.545 58.903  1.00 24.55 ? 265 ASP A CG  1 
ATOM   1824 O  OD1 . ASP A 1 222 ? -17.771 -16.713 59.651  1.00 28.23 ? 265 ASP A OD1 1 
ATOM   1825 O  OD2 . ASP A 1 222 ? -18.784 -17.052 57.767  1.00 25.78 ? 265 ASP A OD2 1 
ATOM   1826 N  N   . HIS A 1 223 ? -22.019 -14.409 61.403  1.00 20.45 ? 266 HIS A N   1 
ATOM   1827 C  CA  . HIS A 1 223 ? -23.006 -13.409 61.751  1.00 19.52 ? 266 HIS A CA  1 
ATOM   1828 C  C   . HIS A 1 223 ? -22.651 -12.656 63.039  1.00 19.41 ? 266 HIS A C   1 
ATOM   1829 O  O   . HIS A 1 223 ? -22.779 -11.424 63.097  1.00 19.47 ? 266 HIS A O   1 
ATOM   1830 C  CB  . HIS A 1 223 ? -24.357 -14.086 61.902  1.00 19.05 ? 266 HIS A CB  1 
ATOM   1831 C  CG  . HIS A 1 223 ? -25.484 -13.138 62.116  1.00 16.99 ? 266 HIS A CG  1 
ATOM   1832 N  ND1 . HIS A 1 223 ? -25.999 -12.363 61.102  1.00 13.56 ? 266 HIS A ND1 1 
ATOM   1833 C  CD2 . HIS A 1 223 ? -26.218 -12.861 63.220  1.00 15.74 ? 266 HIS A CD2 1 
ATOM   1834 C  CE1 . HIS A 1 223 ? -26.996 -11.639 61.576  1.00 14.85 ? 266 HIS A CE1 1 
ATOM   1835 N  NE2 . HIS A 1 223 ? -27.151 -11.923 62.858  1.00 15.37 ? 266 HIS A NE2 1 
ATOM   1836 N  N   . VAL A 1 224 ? -22.233 -13.407 64.063  1.00 19.02 ? 267 VAL A N   1 
ATOM   1837 C  CA  . VAL A 1 224 ? -21.763 -12.863 65.341  1.00 18.17 ? 267 VAL A CA  1 
ATOM   1838 C  C   . VAL A 1 224 ? -20.534 -11.966 65.154  1.00 17.86 ? 267 VAL A C   1 
ATOM   1839 O  O   . VAL A 1 224 ? -20.448 -10.901 65.769  1.00 18.12 ? 267 VAL A O   1 
ATOM   1840 C  CB  . VAL A 1 224 ? -21.474 -13.998 66.372  1.00 18.73 ? 267 VAL A CB  1 
ATOM   1841 C  CG1 . VAL A 1 224 ? -20.699 -13.481 67.612  1.00 17.58 ? 267 VAL A CG1 1 
ATOM   1842 C  CG2 . VAL A 1 224 ? -22.780 -14.661 66.811  1.00 18.65 ? 267 VAL A CG2 1 
ATOM   1843 N  N   . ALA A 1 225 ? -19.589 -12.380 64.312  1.00 16.86 ? 268 ALA A N   1 
ATOM   1844 C  CA  . ALA A 1 225 ? -18.407 -11.556 64.052  1.00 16.27 ? 268 ALA A CA  1 
ATOM   1845 C  C   . ALA A 1 225 ? -18.796 -10.215 63.428  1.00 16.36 ? 268 ALA A C   1 
ATOM   1846 O  O   . ALA A 1 225 ? -18.218 -9.184  63.777  1.00 16.36 ? 268 ALA A O   1 
ATOM   1847 C  CB  . ALA A 1 225 ? -17.407 -12.282 63.167  1.00 15.79 ? 268 ALA A CB  1 
ATOM   1848 N  N   . ALA A 1 226 ? -19.783 -10.239 62.523  1.00 15.93 ? 269 ALA A N   1 
ATOM   1849 C  CA  . ALA A 1 226 ? -20.250 -9.037  61.834  1.00 15.88 ? 269 ALA A CA  1 
ATOM   1850 C  C   . ALA A 1 226 ? -20.893 -8.020  62.800  1.00 15.90 ? 269 ALA A C   1 
ATOM   1851 O  O   . ALA A 1 226 ? -20.482 -6.860  62.843  1.00 16.38 ? 269 ALA A O   1 
ATOM   1852 C  CB  . ALA A 1 226 ? -21.187 -9.395  60.661  1.00 15.15 ? 269 ALA A CB  1 
ATOM   1853 N  N   . TRP A 1 227 ? -21.861 -8.454  63.592  1.00 15.81 ? 270 TRP A N   1 
ATOM   1854 C  CA  . TRP A 1 227 ? -22.392 -7.607  64.662  1.00 16.58 ? 270 TRP A CA  1 
ATOM   1855 C  C   . TRP A 1 227 ? -21.295 -7.073  65.642  1.00 17.70 ? 270 TRP A C   1 
ATOM   1856 O  O   . TRP A 1 227 ? -21.387 -5.921  66.095  1.00 17.65 ? 270 TRP A O   1 
ATOM   1857 C  CB  . TRP A 1 227 ? -23.456 -8.349  65.461  1.00 15.86 ? 270 TRP A CB  1 
ATOM   1858 C  CG  . TRP A 1 227 ? -24.853 -8.383  64.896  1.00 14.24 ? 270 TRP A CG  1 
ATOM   1859 C  CD1 . TRP A 1 227 ? -25.509 -9.481  64.428  1.00 13.26 ? 270 TRP A CD1 1 
ATOM   1860 C  CD2 . TRP A 1 227 ? -25.773 -7.288  64.783  1.00 13.12 ? 270 TRP A CD2 1 
ATOM   1861 N  NE1 . TRP A 1 227 ? -26.767 -9.144  64.019  1.00 13.80 ? 270 TRP A NE1 1 
ATOM   1862 C  CE2 . TRP A 1 227 ? -26.966 -7.805  64.234  1.00 13.34 ? 270 TRP A CE2 1 
ATOM   1863 C  CE3 . TRP A 1 227 ? -25.703 -5.915  65.086  1.00 12.92 ? 270 TRP A CE3 1 
ATOM   1864 C  CZ2 . TRP A 1 227 ? -28.088 -7.004  63.977  1.00 11.60 ? 270 TRP A CZ2 1 
ATOM   1865 C  CZ3 . TRP A 1 227 ? -26.820 -5.116  64.842  1.00 12.30 ? 270 TRP A CZ3 1 
ATOM   1866 C  CH2 . TRP A 1 227 ? -27.999 -5.667  64.290  1.00 12.52 ? 270 TRP A CH2 1 
ATOM   1867 N  N   . ASP A 1 228 ? -20.275 -7.891  65.953  1.00 18.18 ? 271 ASP A N   1 
ATOM   1868 C  CA  . ASP A 1 228 ? -19.157 -7.453  66.821  1.00 19.20 ? 271 ASP A CA  1 
ATOM   1869 C  C   . ASP A 1 228 ? -18.435 -6.229  66.257  1.00 19.32 ? 271 ASP A C   1 
ATOM   1870 O  O   . ASP A 1 228 ? -18.145 -5.283  66.993  1.00 19.31 ? 271 ASP A O   1 
ATOM   1871 C  CB  . ASP A 1 228 ? -18.150 -8.586  67.128  1.00 19.08 ? 271 ASP A CB  1 
ATOM   1872 C  CG  . ASP A 1 228 ? -18.637 -9.537  68.235  1.00 20.76 ? 271 ASP A CG  1 
ATOM   1873 O  OD1 . ASP A 1 228 ? -19.546 -9.173  69.021  1.00 22.62 ? 271 ASP A OD1 1 
ATOM   1874 O  OD2 . ASP A 1 228 ? -18.111 -10.671 68.318  1.00 23.85 ? 271 ASP A OD2 1 
ATOM   1875 N  N   . VAL A 1 229 ? -18.162 -6.239  64.958  1.00 19.52 ? 272 VAL A N   1 
ATOM   1876 C  CA  . VAL A 1 229 ? -17.610 -5.057  64.311  1.00 20.21 ? 272 VAL A CA  1 
ATOM   1877 C  C   . VAL A 1 229 ? -18.582 -3.880  64.451  1.00 21.17 ? 272 VAL A C   1 
ATOM   1878 O  O   . VAL A 1 229 ? -18.186 -2.794  64.897  1.00 21.62 ? 272 VAL A O   1 
ATOM   1879 C  CB  . VAL A 1 229 ? -17.304 -5.288  62.824  1.00 20.37 ? 272 VAL A CB  1 
ATOM   1880 C  CG1 . VAL A 1 229 ? -16.806 -3.999  62.195  1.00 19.65 ? 272 VAL A CG1 1 
ATOM   1881 C  CG2 . VAL A 1 229 ? -16.291 -6.435  62.633  1.00 18.90 ? 272 VAL A CG2 1 
ATOM   1882 N  N   . ILE A 1 230 ? -19.853 -4.106  64.109  1.00 21.58 ? 273 ILE A N   1 
ATOM   1883 C  CA  . ILE A 1 230 ? -20.854 -3.041  64.177  1.00 21.93 ? 273 ILE A CA  1 
ATOM   1884 C  C   . ILE A 1 230 ? -20.817 -2.364  65.545  1.00 22.55 ? 273 ILE A C   1 
ATOM   1885 O  O   . ILE A 1 230 ? -20.638 -1.148  65.630  1.00 22.43 ? 273 ILE A O   1 
ATOM   1886 C  CB  . ILE A 1 230 ? -22.291 -3.541  63.786  1.00 21.85 ? 273 ILE A CB  1 
ATOM   1887 C  CG1 . ILE A 1 230 ? -22.360 -3.802  62.273  1.00 21.40 ? 273 ILE A CG1 1 
ATOM   1888 C  CG2 . ILE A 1 230 ? -23.382 -2.540  64.232  1.00 20.67 ? 273 ILE A CG2 1 
ATOM   1889 C  CD1 . ILE A 1 230 ? -23.510 -4.659  61.829  1.00 18.20 ? 273 ILE A CD1 1 
ATOM   1890 N  N   . PHE A 1 231 ? -20.929 -3.176  66.600  1.00 23.41 ? 274 PHE A N   1 
ATOM   1891 C  CA  . PHE A 1 231 ? -20.993 -2.704  67.978  1.00 23.91 ? 274 PHE A CA  1 
ATOM   1892 C  C   . PHE A 1 231 ? -19.687 -2.110  68.482  1.00 24.68 ? 274 PHE A C   1 
ATOM   1893 O  O   . PHE A 1 231 ? -19.704 -1.087  69.158  1.00 24.98 ? 274 PHE A O   1 
ATOM   1894 C  CB  . PHE A 1 231 ? -21.466 -3.821  68.915  1.00 23.94 ? 274 PHE A CB  1 
ATOM   1895 C  CG  . PHE A 1 231 ? -22.962 -3.888  69.061  1.00 23.81 ? 274 PHE A CG  1 
ATOM   1896 C  CD1 . PHE A 1 231 ? -23.701 -4.860  68.382  1.00 23.40 ? 274 PHE A CD1 1 
ATOM   1897 C  CD2 . PHE A 1 231 ? -23.641 -2.963  69.863  1.00 22.36 ? 274 PHE A CD2 1 
ATOM   1898 C  CE1 . PHE A 1 231 ? -25.104 -4.916  68.506  1.00 22.08 ? 274 PHE A CE1 1 
ATOM   1899 C  CE2 . PHE A 1 231 ? -25.030 -3.008  69.985  1.00 22.70 ? 274 PHE A CE2 1 
ATOM   1900 C  CZ  . PHE A 1 231 ? -25.761 -3.992  69.308  1.00 21.86 ? 274 PHE A CZ  1 
ATOM   1901 N  N   . SER A 1 232 ? -18.559 -2.728  68.150  1.00 25.33 ? 275 SER A N   1 
ATOM   1902 C  CA  . SER A 1 232 ? -17.271 -2.184  68.562  1.00 26.32 ? 275 SER A CA  1 
ATOM   1903 C  C   . SER A 1 232 ? -17.094 -0.750  68.104  1.00 26.52 ? 275 SER A C   1 
ATOM   1904 O  O   . SER A 1 232 ? -16.842 0.143   68.920  1.00 27.08 ? 275 SER A O   1 
ATOM   1905 C  CB  . SER A 1 232 ? -16.126 -3.029  68.027  1.00 26.04 ? 275 SER A CB  1 
ATOM   1906 O  OG  . SER A 1 232 ? -16.136 -4.261  68.696  1.00 28.51 ? 275 SER A OG  1 
ATOM   1907 N  N   . LYS A 1 233 ? -17.251 -0.543  66.803  1.00 26.56 ? 276 LYS A N   1 
ATOM   1908 C  CA  . LYS A 1 233 ? -16.993 0.748   66.190  1.00 26.85 ? 276 LYS A CA  1 
ATOM   1909 C  C   . LYS A 1 233 ? -18.058 1.799   66.501  1.00 26.85 ? 276 LYS A C   1 
ATOM   1910 O  O   . LYS A 1 233 ? -17.720 2.968   66.681  1.00 26.46 ? 276 LYS A O   1 
ATOM   1911 C  CB  . LYS A 1 233 ? -16.754 0.577   64.696  1.00 26.65 ? 276 LYS A CB  1 
ATOM   1912 C  CG  . LYS A 1 233 ? -15.594 -0.373  64.482  1.00 28.00 ? 276 LYS A CG  1 
ATOM   1913 C  CD  . LYS A 1 233 ? -15.299 -0.683  63.040  1.00 28.85 ? 276 LYS A CD  1 
ATOM   1914 C  CE  . LYS A 1 233 ? -13.932 -1.355  62.935  1.00 29.06 ? 276 LYS A CE  1 
ATOM   1915 N  NZ  . LYS A 1 233 ? -12.885 -0.601  63.682  1.00 29.38 ? 276 LYS A NZ  1 
ATOM   1916 N  N   . ALA A 1 234 ? -19.326 1.393   66.597  1.00 26.84 ? 277 ALA A N   1 
ATOM   1917 C  CA  . ALA A 1 234 ? -20.353 2.339   67.039  1.00 27.05 ? 277 ALA A CA  1 
ATOM   1918 C  C   . ALA A 1 234 ? -20.004 2.849   68.440  1.00 27.26 ? 277 ALA A C   1 
ATOM   1919 O  O   . ALA A 1 234 ? -20.025 4.051   68.679  1.00 26.56 ? 277 ALA A O   1 
ATOM   1920 C  CB  . ALA A 1 234 ? -21.750 1.725   66.999  1.00 26.62 ? 277 ALA A CB  1 
ATOM   1921 N  N   . ASP A 1 235 ? -19.642 1.931   69.343  1.00 27.97 ? 278 ASP A N   1 
ATOM   1922 C  CA  . ASP A 1 235 ? -19.234 2.294   70.705  1.00 28.79 ? 278 ASP A CA  1 
ATOM   1923 C  C   . ASP A 1 235 ? -18.044 3.263   70.709  1.00 28.20 ? 278 ASP A C   1 
ATOM   1924 O  O   . ASP A 1 235 ? -18.122 4.324   71.318  1.00 27.73 ? 278 ASP A O   1 
ATOM   1925 C  CB  . ASP A 1 235 ? -18.920 1.050   71.547  1.00 29.53 ? 278 ASP A CB  1 
ATOM   1926 C  CG  . ASP A 1 235 ? -20.152 0.140   71.775  1.00 33.29 ? 278 ASP A CG  1 
ATOM   1927 O  OD1 . ASP A 1 235 ? -21.224 0.329   71.125  1.00 35.46 ? 278 ASP A OD1 1 
ATOM   1928 O  OD2 . ASP A 1 235 ? -20.025 -0.801  72.599  1.00 36.25 ? 278 ASP A OD2 1 
ATOM   1929 N  N   . ILE A 1 236 ? -16.963 2.902   70.020  1.00 27.85 ? 279 ILE A N   1 
ATOM   1930 C  CA  . ILE A 1 236 ? -15.803 3.792   69.859  1.00 27.83 ? 279 ILE A CA  1 
ATOM   1931 C  C   . ILE A 1 236 ? -16.198 5.203   69.372  1.00 27.90 ? 279 ILE A C   1 
ATOM   1932 O  O   . ILE A 1 236 ? -15.824 6.196   70.006  1.00 27.96 ? 279 ILE A O   1 
ATOM   1933 C  CB  . ILE A 1 236 ? -14.710 3.163   68.954  1.00 27.86 ? 279 ILE A CB  1 
ATOM   1934 C  CG1 . ILE A 1 236 ? -14.109 1.924   69.637  1.00 28.57 ? 279 ILE A CG1 1 
ATOM   1935 C  CG2 . ILE A 1 236 ? -13.613 4.182   68.629  1.00 27.54 ? 279 ILE A CG2 1 
ATOM   1936 C  CD1 . ILE A 1 236 ? -13.208 1.055   68.735  1.00 29.52 ? 279 ILE A CD1 1 
ATOM   1937 N  N   . TYR A 1 237 ? -16.975 5.284   68.286  1.00 27.80 ? 280 TYR A N   1 
ATOM   1938 C  CA  . TYR A 1 237 ? -17.476 6.571   67.765  1.00 27.80 ? 280 TYR A CA  1 
ATOM   1939 C  C   . TYR A 1 237 ? -18.219 7.396   68.801  1.00 27.37 ? 280 TYR A C   1 
ATOM   1940 O  O   . TYR A 1 237 ? -17.878 8.547   69.018  1.00 27.34 ? 280 TYR A O   1 
ATOM   1941 C  CB  . TYR A 1 237 ? -18.399 6.396   66.550  1.00 27.82 ? 280 TYR A CB  1 
ATOM   1942 C  CG  . TYR A 1 237 ? -17.740 5.910   65.289  1.00 28.85 ? 280 TYR A CG  1 
ATOM   1943 C  CD1 . TYR A 1 237 ? -18.431 5.079   64.414  1.00 29.38 ? 280 TYR A CD1 1 
ATOM   1944 C  CD2 . TYR A 1 237 ? -16.427 6.270   64.965  1.00 30.92 ? 280 TYR A CD2 1 
ATOM   1945 C  CE1 . TYR A 1 237 ? -17.842 4.602   63.246  1.00 31.20 ? 280 TYR A CE1 1 
ATOM   1946 C  CE2 . TYR A 1 237 ? -15.818 5.795   63.780  1.00 32.58 ? 280 TYR A CE2 1 
ATOM   1947 C  CZ  . TYR A 1 237 ? -16.544 4.960   62.930  1.00 32.62 ? 280 TYR A CZ  1 
ATOM   1948 O  OH  . TYR A 1 237 ? -15.992 4.476   61.767  1.00 34.04 ? 280 TYR A OH  1 
ATOM   1949 N  N   . THR A 1 238 ? -19.247 6.807   69.406  1.00 27.32 ? 281 THR A N   1 
ATOM   1950 C  CA  . THR A 1 238 ? -20.072 7.470   70.414  1.00 27.54 ? 281 THR A CA  1 
ATOM   1951 C  C   . THR A 1 238 ? -19.232 7.893   71.618  1.00 28.01 ? 281 THR A C   1 
ATOM   1952 O  O   . THR A 1 238 ? -19.373 9.004   72.109  1.00 28.01 ? 281 THR A O   1 
ATOM   1953 C  CB  . THR A 1 238 ? -21.219 6.546   70.882  1.00 27.34 ? 281 THR A CB  1 
ATOM   1954 O  OG1 . THR A 1 238 ? -21.870 5.992   69.738  1.00 28.44 ? 281 THR A OG1 1 
ATOM   1955 C  CG2 . THR A 1 238 ? -22.263 7.297   71.725  1.00 26.58 ? 281 THR A CG2 1 
ATOM   1956 N  N   . GLN A 1 239 ? -18.346 7.010   72.069  1.00 28.49 ? 282 GLN A N   1 
ATOM   1957 C  CA  . GLN A 1 239 ? -17.547 7.264   73.253  1.00 29.40 ? 282 GLN A CA  1 
ATOM   1958 C  C   . GLN A 1 239 ? -16.545 8.402   73.026  1.00 29.30 ? 282 GLN A C   1 
ATOM   1959 O  O   . GLN A 1 239 ? -16.472 9.322   73.840  1.00 29.20 ? 282 GLN A O   1 
ATOM   1960 C  CB  . GLN A 1 239 ? -16.852 5.982   73.714  1.00 29.77 ? 282 GLN A CB  1 
ATOM   1961 C  CG  . GLN A 1 239 ? -15.985 6.134   74.962  1.00 33.36 ? 282 GLN A CG  1 
ATOM   1962 C  CD  . GLN A 1 239 ? -15.204 4.866   75.279  1.00 37.93 ? 282 GLN A CD  1 
ATOM   1963 O  OE1 . GLN A 1 239 ? -15.738 3.746   75.171  1.00 39.52 ? 282 GLN A OE1 1 
ATOM   1964 N  NE2 . GLN A 1 239 ? -13.933 5.031   75.668  1.00 37.89 ? 282 GLN A NE2 1 
ATOM   1965 N  N   . ASN A 1 240 ? -15.786 8.335   71.929  1.00 29.11 ? 283 ASN A N   1 
ATOM   1966 C  CA  . ASN A 1 240 ? -14.935 9.443   71.509  1.00 29.10 ? 283 ASN A CA  1 
ATOM   1967 C  C   . ASN A 1 240 ? -15.706 10.767  71.395  1.00 29.10 ? 283 ASN A C   1 
ATOM   1968 O  O   . ASN A 1 240 ? -15.243 11.805  71.871  1.00 29.03 ? 283 ASN A O   1 
ATOM   1969 C  CB  . ASN A 1 240 ? -14.226 9.124   70.195  1.00 28.96 ? 283 ASN A CB  1 
ATOM   1970 C  CG  . ASN A 1 240 ? -13.222 8.001   70.334  1.00 30.35 ? 283 ASN A CG  1 
ATOM   1971 O  OD1 . ASN A 1 240 ? -12.749 7.703   71.431  1.00 32.93 ? 283 ASN A OD1 1 
ATOM   1972 N  ND2 . ASN A 1 240 ? -12.884 7.371   69.220  1.00 31.47 ? 283 ASN A ND2 1 
ATOM   1973 N  N   . PHE A 1 241 ? -16.894 10.725  70.800  1.00 28.55 ? 284 PHE A N   1 
ATOM   1974 C  CA  . PHE A 1 241 ? -17.704 11.927  70.675  1.00 28.25 ? 284 PHE A CA  1 
ATOM   1975 C  C   . PHE A 1 241 ? -18.044 12.517  72.041  1.00 28.25 ? 284 PHE A C   1 
ATOM   1976 O  O   . PHE A 1 241 ? -18.063 13.744  72.229  1.00 28.00 ? 284 PHE A O   1 
ATOM   1977 C  CB  . PHE A 1 241 ? -18.987 11.625  69.905  1.00 27.77 ? 284 PHE A CB  1 
ATOM   1978 C  CG  . PHE A 1 241 ? -19.793 12.842  69.580  1.00 27.36 ? 284 PHE A CG  1 
ATOM   1979 C  CD1 . PHE A 1 241 ? -19.598 13.515  68.383  1.00 26.72 ? 284 PHE A CD1 1 
ATOM   1980 C  CD2 . PHE A 1 241 ? -20.744 13.323  70.475  1.00 26.77 ? 284 PHE A CD2 1 
ATOM   1981 C  CE1 . PHE A 1 241 ? -20.335 14.636  68.084  1.00 25.57 ? 284 PHE A CE1 1 
ATOM   1982 C  CE2 . PHE A 1 241 ? -21.488 14.455  70.182  1.00 25.34 ? 284 PHE A CE2 1 
ATOM   1983 C  CZ  . PHE A 1 241 ? -21.285 15.108  68.989  1.00 25.44 ? 284 PHE A CZ  1 
ATOM   1984 N  N   . TYR A 1 242 ? -18.326 11.627  72.985  1.00 28.37 ? 285 TYR A N   1 
ATOM   1985 C  CA  . TYR A 1 242 ? -18.825 12.012  74.300  1.00 28.77 ? 285 TYR A CA  1 
ATOM   1986 C  C   . TYR A 1 242 ? -17.743 12.746  75.070  1.00 29.06 ? 285 TYR A C   1 
ATOM   1987 O  O   . TYR A 1 242 ? -18.008 13.771  75.705  1.00 28.59 ? 285 TYR A O   1 
ATOM   1988 C  CB  . TYR A 1 242 ? -19.279 10.760  75.038  1.00 28.65 ? 285 TYR A CB  1 
ATOM   1989 C  CG  . TYR A 1 242 ? -19.632 10.884  76.502  1.00 28.26 ? 285 TYR A CG  1 
ATOM   1990 C  CD1 . TYR A 1 242 ? -20.971 10.995  76.915  1.00 28.39 ? 285 TYR A CD1 1 
ATOM   1991 C  CD2 . TYR A 1 242 ? -18.640 10.812  77.483  1.00 27.81 ? 285 TYR A CD2 1 
ATOM   1992 C  CE1 . TYR A 1 242 ? -21.309 11.055  78.272  1.00 28.18 ? 285 TYR A CE1 1 
ATOM   1993 C  CE2 . TYR A 1 242 ? -18.964 10.871  78.839  1.00 28.90 ? 285 TYR A CE2 1 
ATOM   1994 C  CZ  . TYR A 1 242 ? -20.297 10.987  79.225  1.00 29.41 ? 285 TYR A CZ  1 
ATOM   1995 O  OH  . TYR A 1 242 ? -20.592 11.051  80.566  1.00 31.23 ? 285 TYR A OH  1 
ATOM   1996 N  N   . TRP A 1 243 ? -16.525 12.219  74.981  1.00 29.54 ? 286 TRP A N   1 
ATOM   1997 C  CA  . TRP A 1 243 ? -15.390 12.803  75.662  1.00 30.35 ? 286 TRP A CA  1 
ATOM   1998 C  C   . TRP A 1 243 ? -14.888 14.083  75.026  1.00 30.98 ? 286 TRP A C   1 
ATOM   1999 O  O   . TRP A 1 243 ? -14.589 15.025  75.747  1.00 30.92 ? 286 TRP A O   1 
ATOM   2000 C  CB  . TRP A 1 243 ? -14.284 11.770  75.886  1.00 29.96 ? 286 TRP A CB  1 
ATOM   2001 C  CG  . TRP A 1 243 ? -14.627 10.911  77.061  1.00 30.25 ? 286 TRP A CG  1 
ATOM   2002 C  CD1 . TRP A 1 243 ? -14.945 9.578   77.050  1.00 29.77 ? 286 TRP A CD1 1 
ATOM   2003 C  CD2 . TRP A 1 243 ? -14.768 11.344  78.422  1.00 30.02 ? 286 TRP A CD2 1 
ATOM   2004 N  NE1 . TRP A 1 243 ? -15.238 9.153   78.321  1.00 29.14 ? 286 TRP A NE1 1 
ATOM   2005 C  CE2 . TRP A 1 243 ? -15.135 10.214  79.183  1.00 29.50 ? 286 TRP A CE2 1 
ATOM   2006 C  CE3 . TRP A 1 243 ? -14.599 12.576  79.076  1.00 29.58 ? 286 TRP A CE3 1 
ATOM   2007 C  CZ2 . TRP A 1 243 ? -15.337 10.278  80.568  1.00 29.65 ? 286 TRP A CZ2 1 
ATOM   2008 C  CZ3 . TRP A 1 243 ? -14.796 12.638  80.449  1.00 29.18 ? 286 TRP A CZ3 1 
ATOM   2009 C  CH2 . TRP A 1 243 ? -15.163 11.496  81.181  1.00 29.01 ? 286 TRP A CH2 1 
ATOM   2010 N  N   . GLU A 1 244 ? -14.837 14.125  73.693  1.00 32.20 ? 287 GLU A N   1 
ATOM   2011 C  CA  . GLU A 1 244 ? -14.420 15.318  72.941  1.00 33.32 ? 287 GLU A CA  1 
ATOM   2012 C  C   . GLU A 1 244 ? -15.378 16.489  73.169  1.00 33.92 ? 287 GLU A C   1 
ATOM   2013 O  O   . GLU A 1 244 ? -14.982 17.647  73.076  1.00 33.98 ? 287 GLU A O   1 
ATOM   2014 C  CB  . GLU A 1 244 ? -14.321 15.022  71.448  1.00 33.25 ? 287 GLU A CB  1 
ATOM   2015 C  CG  . GLU A 1 244 ? -13.162 14.110  71.021  1.00 34.87 ? 287 GLU A CG  1 
ATOM   2016 C  CD  . GLU A 1 244 ? -13.371 13.521  69.620  1.00 37.15 ? 287 GLU A CD  1 
ATOM   2017 O  OE1 . GLU A 1 244 ? -14.256 14.020  68.882  1.00 38.20 ? 287 GLU A OE1 1 
ATOM   2018 O  OE2 . GLU A 1 244 ? -12.667 12.551  69.256  1.00 38.34 ? 287 GLU A OE2 1 
ATOM   2019 N  N   . LEU A 1 245 ? -16.632 16.173  73.474  1.00 34.83 ? 288 LEU A N   1 
ATOM   2020 C  CA  . LEU A 1 245 ? -17.633 17.169  73.841  1.00 36.06 ? 288 LEU A CA  1 
ATOM   2021 C  C   . LEU A 1 245 ? -17.261 17.856  75.151  1.00 36.97 ? 288 LEU A C   1 
ATOM   2022 O  O   . LEU A 1 245 ? -17.478 19.049  75.324  1.00 36.95 ? 288 LEU A O   1 
ATOM   2023 C  CB  . LEU A 1 245 ? -19.006 16.502  73.986  1.00 36.00 ? 288 LEU A CB  1 
ATOM   2024 C  CG  . LEU A 1 245 ? -20.229 17.412  74.044  1.00 36.09 ? 288 LEU A CG  1 
ATOM   2025 C  CD1 . LEU A 1 245 ? -20.443 18.007  72.661  1.00 37.13 ? 288 LEU A CD1 1 
ATOM   2026 C  CD2 . LEU A 1 245 ? -21.469 16.652  74.514  1.00 35.08 ? 288 LEU A CD2 1 
ATOM   2027 N  N   . ARG A 1 246 ? -16.703 17.082  76.073  1.00 38.20 ? 289 ARG A N   1 
ATOM   2028 C  CA  . ARG A 1 246 ? -16.289 17.590  77.364  1.00 39.38 ? 289 ARG A CA  1 
ATOM   2029 C  C   . ARG A 1 246 ? -14.952 18.309  77.271  1.00 40.44 ? 289 ARG A C   1 
ATOM   2030 O  O   . ARG A 1 246 ? -14.650 19.163  78.106  1.00 40.56 ? 289 ARG A O   1 
ATOM   2031 C  CB  . ARG A 1 246 ? -16.244 16.446  78.377  1.00 39.37 ? 289 ARG A CB  1 
ATOM   2032 C  CG  . ARG A 1 246 ? -17.576 16.217  79.041  1.00 39.44 ? 289 ARG A CG  1 
ATOM   2033 C  CD  . ARG A 1 246 ? -17.961 14.771  79.103  1.00 41.31 ? 289 ARG A CD  1 
ATOM   2034 N  NE  . ARG A 1 246 ? -19.380 14.646  78.757  1.00 44.92 ? 289 ARG A NE  1 
ATOM   2035 C  CZ  . ARG A 1 246 ? -20.374 14.489  79.632  1.00 45.73 ? 289 ARG A CZ  1 
ATOM   2036 N  NH1 . ARG A 1 246 ? -20.113 14.402  80.938  1.00 46.24 ? 289 ARG A NH1 1 
ATOM   2037 N  NH2 . ARG A 1 246 ? -21.629 14.402  79.196  1.00 44.06 ? 289 ARG A NH2 1 
ATOM   2038 N  N   . GLN A 1 247 ? -14.173 17.972  76.243  1.00 41.92 ? 290 GLN A N   1 
ATOM   2039 C  CA  . GLN A 1 247 ? -12.871 18.582  75.993  1.00 43.78 ? 290 GLN A CA  1 
ATOM   2040 C  C   . GLN A 1 247 ? -12.959 19.955  75.311  1.00 45.25 ? 290 GLN A C   1 
ATOM   2041 O  O   . GLN A 1 247 ? -12.061 20.776  75.481  1.00 45.48 ? 290 GLN A O   1 
ATOM   2042 C  CB  . GLN A 1 247 ? -11.997 17.666  75.141  1.00 43.65 ? 290 GLN A CB  1 
ATOM   2043 C  CG  . GLN A 1 247 ? -11.588 16.353  75.779  1.00 44.12 ? 290 GLN A CG  1 
ATOM   2044 C  CD  . GLN A 1 247 ? -10.853 15.430  74.795  1.00 45.32 ? 290 GLN A CD  1 
ATOM   2045 O  OE1 . GLN A 1 247 ? -10.069 15.896  73.965  1.00 45.36 ? 290 GLN A OE1 1 
ATOM   2046 N  NE2 . GLN A 1 247 ? -11.108 14.119  74.887  1.00 44.74 ? 290 GLN A NE2 1 
ATOM   2047 N  N   . LYS A 1 248 ? -14.017 20.185  74.529  1.00 47.05 ? 291 LYS A N   1 
ATOM   2048 C  CA  . LYS A 1 248 ? -14.236 21.457  73.818  1.00 48.96 ? 291 LYS A CA  1 
ATOM   2049 C  C   . LYS A 1 248 ? -15.377 22.271  74.438  1.00 50.29 ? 291 LYS A C   1 
ATOM   2050 O  O   . LYS A 1 248 ? -15.596 23.431  74.068  1.00 50.41 ? 291 LYS A O   1 
ATOM   2051 C  CB  . LYS A 1 248 ? -14.543 21.205  72.336  1.00 48.95 ? 291 LYS A CB  1 
ATOM   2052 C  CG  . LYS A 1 248 ? -13.392 20.606  71.531  1.00 50.09 ? 291 LYS A CG  1 
ATOM   2053 C  CD  . LYS A 1 248 ? -13.916 19.799  70.339  1.00 51.82 ? 291 LYS A CD  1 
ATOM   2054 C  CE  . LYS A 1 248 ? -12.817 18.936  69.710  1.00 53.05 ? 291 LYS A CE  1 
ATOM   2055 N  NZ  . LYS A 1 248 ? -13.326 17.595  69.270  1.00 53.46 ? 291 LYS A NZ  1 
ATOM   2056 N  N   . GLY A 1 249 ? -16.080 21.638  75.380  1.00 51.94 ? 292 GLY A N   1 
ATOM   2057 C  CA  . GLY A 1 249 ? -17.297 22.138  76.042  1.00 54.07 ? 292 GLY A CA  1 
ATOM   2058 C  C   . GLY A 1 249 ? -17.779 23.560  75.815  1.00 55.70 ? 292 GLY A C   1 
ATOM   2059 O  O   . GLY A 1 249 ? -17.591 24.429  76.677  1.00 56.04 ? 292 GLY A O   1 
ATOM   2060 N  N   . SER A 1 250 ? -18.414 23.797  74.666  1.00 56.99 ? 293 SER A N   1 
ATOM   2061 C  CA  . SER A 1 250 ? -19.023 25.101  74.366  1.00 58.17 ? 293 SER A CA  1 
ATOM   2062 C  C   . SER A 1 250 ? -20.490 24.936  73.965  1.00 58.55 ? 293 SER A C   1 
ATOM   2063 O  O   . SER A 1 250 ? -20.825 24.028  73.194  1.00 58.90 ? 293 SER A O   1 
ATOM   2064 C  CB  . SER A 1 250 ? -18.250 25.827  73.252  1.00 58.36 ? 293 SER A CB  1 
ATOM   2065 O  OG  . SER A 1 250 ? -16.866 25.928  73.566  1.00 59.12 ? 293 SER A OG  1 
ATOM   2066 N  N   . VAL A 1 251 ? -21.361 25.800  74.490  1.00 58.71 ? 294 VAL A N   1 
ATOM   2067 C  CA  . VAL A 1 251 ? -22.763 25.815  74.056  1.00 58.83 ? 294 VAL A CA  1 
ATOM   2068 C  C   . VAL A 1 251 ? -22.829 26.462  72.661  1.00 58.70 ? 294 VAL A C   1 
ATOM   2069 O  O   . VAL A 1 251 ? -23.195 27.638  72.509  1.00 59.10 ? 294 VAL A O   1 
ATOM   2070 C  CB  . VAL A 1 251 ? -23.733 26.480  75.109  1.00 59.01 ? 294 VAL A CB  1 
ATOM   2071 C  CG1 . VAL A 1 251 ? -25.178 26.596  74.566  1.00 58.59 ? 294 VAL A CG1 1 
ATOM   2072 C  CG2 . VAL A 1 251 ? -23.732 25.683  76.416  1.00 58.88 ? 294 VAL A CG2 1 
ATOM   2073 N  N   . HIS A 1 252 ? -22.435 25.676  71.656  1.00 58.08 ? 295 HIS A N   1 
ATOM   2074 C  CA  . HIS A 1 252 ? -22.475 26.075  70.252  1.00 57.22 ? 295 HIS A CA  1 
ATOM   2075 C  C   . HIS A 1 252 ? -23.878 26.481  69.845  1.00 56.29 ? 295 HIS A C   1 
ATOM   2076 O  O   . HIS A 1 252 ? -24.853 25.855  70.258  1.00 56.04 ? 295 HIS A O   1 
ATOM   2077 C  CB  . HIS A 1 252 ? -22.020 24.919  69.363  1.00 57.41 ? 295 HIS A CB  1 
ATOM   2078 C  CG  . HIS A 1 252 ? -20.544 24.667  69.400  1.00 58.66 ? 295 HIS A CG  1 
ATOM   2079 N  ND1 . HIS A 1 252 ? -19.711 24.973  68.344  1.00 59.29 ? 295 HIS A ND1 1 
ATOM   2080 C  CD2 . HIS A 1 252 ? -19.754 24.135  70.364  1.00 58.95 ? 295 HIS A CD2 1 
ATOM   2081 C  CE1 . HIS A 1 252 ? -18.470 24.647  68.660  1.00 59.57 ? 295 HIS A CE1 1 
ATOM   2082 N  NE2 . HIS A 1 252 ? -18.468 24.139  69.880  1.00 59.26 ? 295 HIS A NE2 1 
ATOM   2083 N  N   . HIS A 1 253 ? -23.962 27.537  69.039  1.00 55.38 ? 296 HIS A N   1 
ATOM   2084 C  CA  . HIS A 1 253 ? -25.229 28.016  68.491  1.00 54.44 ? 296 HIS A CA  1 
ATOM   2085 C  C   . HIS A 1 253 ? -25.491 27.421  67.095  1.00 53.43 ? 296 HIS A C   1 
ATOM   2086 O  O   . HIS A 1 253 ? -26.639 27.301  66.672  1.00 53.41 ? 296 HIS A O   1 
ATOM   2087 C  CB  . HIS A 1 253 ? -25.261 29.551  68.450  1.00 54.74 ? 296 HIS A CB  1 
ATOM   2088 C  CG  . HIS A 1 253 ? -25.013 30.207  69.780  1.00 55.68 ? 296 HIS A CG  1 
ATOM   2089 N  ND1 . HIS A 1 253 ? -25.965 30.966  70.426  1.00 56.63 ? 296 HIS A ND1 1 
ATOM   2090 C  CD2 . HIS A 1 253 ? -23.914 30.231  70.575  1.00 56.90 ? 296 HIS A CD2 1 
ATOM   2091 C  CE1 . HIS A 1 253 ? -25.469 31.421  71.563  1.00 57.39 ? 296 HIS A CE1 1 
ATOM   2092 N  NE2 . HIS A 1 253 ? -24.226 30.990  71.678  1.00 57.30 ? 296 HIS A NE2 1 
ATOM   2093 N  N   . ASP A 1 254 ? -24.422 27.055  66.387  1.00 52.16 ? 297 ASP A N   1 
ATOM   2094 C  CA  . ASP A 1 254 ? -24.532 26.323  65.118  1.00 50.75 ? 297 ASP A CA  1 
ATOM   2095 C  C   . ASP A 1 254 ? -25.009 24.896  65.376  1.00 49.64 ? 297 ASP A C   1 
ATOM   2096 O  O   . ASP A 1 254 ? -24.767 24.344  66.454  1.00 49.73 ? 297 ASP A O   1 
ATOM   2097 C  CB  . ASP A 1 254 ? -23.183 26.296  64.385  1.00 50.87 ? 297 ASP A CB  1 
ATOM   2098 C  CG  . ASP A 1 254 ? -22.085 25.581  65.175  1.00 51.17 ? 297 ASP A CG  1 
ATOM   2099 O  OD1 . ASP A 1 254 ? -22.051 25.709  66.419  1.00 51.78 ? 297 ASP A OD1 1 
ATOM   2100 O  OD2 . ASP A 1 254 ? -21.242 24.900  64.549  1.00 51.21 ? 297 ASP A OD2 1 
ATOM   2101 N  N   . TYR A 1 255 ? -25.684 24.302  64.394  1.00 48.07 ? 298 TYR A N   1 
ATOM   2102 C  CA  . TYR A 1 255 ? -26.131 22.912  64.512  1.00 46.45 ? 298 TYR A CA  1 
ATOM   2103 C  C   . TYR A 1 255 ? -24.969 21.920  64.397  1.00 45.25 ? 298 TYR A C   1 
ATOM   2104 O  O   . TYR A 1 255 ? -24.088 22.073  63.547  1.00 45.18 ? 298 TYR A O   1 
ATOM   2105 C  CB  . TYR A 1 255 ? -27.203 22.595  63.481  1.00 46.49 ? 298 TYR A CB  1 
ATOM   2106 C  CG  . TYR A 1 255 ? -27.724 21.185  63.591  1.00 46.96 ? 298 TYR A CG  1 
ATOM   2107 C  CD1 . TYR A 1 255 ? -28.681 20.843  64.562  1.00 46.68 ? 298 TYR A CD1 1 
ATOM   2108 C  CD2 . TYR A 1 255 ? -27.253 20.182  62.736  1.00 46.31 ? 298 TYR A CD2 1 
ATOM   2109 C  CE1 . TYR A 1 255 ? -29.161 19.545  64.666  1.00 46.03 ? 298 TYR A CE1 1 
ATOM   2110 C  CE2 . TYR A 1 255 ? -27.733 18.884  62.831  1.00 46.22 ? 298 TYR A CE2 1 
ATOM   2111 C  CZ  . TYR A 1 255 ? -28.682 18.571  63.797  1.00 45.90 ? 298 TYR A CZ  1 
ATOM   2112 O  OH  . TYR A 1 255 ? -29.149 17.284  63.882  1.00 45.39 ? 298 TYR A OH  1 
ATOM   2113 N  N   . ARG A 1 256 ? -24.985 20.898  65.249  1.00 43.63 ? 299 ARG A N   1 
ATOM   2114 C  CA  . ARG A 1 256 ? -23.835 20.012  65.405  1.00 42.17 ? 299 ARG A CA  1 
ATOM   2115 C  C   . ARG A 1 256 ? -24.116 18.537  65.147  1.00 40.69 ? 299 ARG A C   1 
ATOM   2116 O  O   . ARG A 1 256 ? -23.186 17.725  65.160  1.00 40.38 ? 299 ARG A O   1 
ATOM   2117 C  CB  . ARG A 1 256 ? -23.287 20.119  66.819  1.00 42.64 ? 299 ARG A CB  1 
ATOM   2118 C  CG  . ARG A 1 256 ? -23.332 21.488  67.420  1.00 44.20 ? 299 ARG A CG  1 
ATOM   2119 C  CD  . ARG A 1 256 ? -22.039 21.723  68.128  1.00 47.11 ? 299 ARG A CD  1 
ATOM   2120 N  NE  . ARG A 1 256 ? -20.948 21.888  67.175  1.00 49.21 ? 299 ARG A NE  1 
ATOM   2121 C  CZ  . ARG A 1 256 ? -19.668 21.691  67.467  1.00 50.82 ? 299 ARG A CZ  1 
ATOM   2122 N  NH1 . ARG A 1 256 ? -19.310 21.302  68.689  1.00 51.36 ? 299 ARG A NH1 1 
ATOM   2123 N  NH2 . ARG A 1 256 ? -18.748 21.876  66.529  1.00 51.43 ? 299 ARG A NH2 1 
ATOM   2124 N  N   . GLY A 1 257 ? -25.386 18.182  64.962  1.00 38.83 ? 300 GLY A N   1 
ATOM   2125 C  CA  . GLY A 1 257 ? -25.755 16.789  64.704  1.00 36.71 ? 300 GLY A CA  1 
ATOM   2126 C  C   . GLY A 1 257 ? -26.710 16.177  65.713  1.00 34.89 ? 300 GLY A C   1 
ATOM   2127 O  O   . GLY A 1 257 ? -26.927 16.727  66.794  1.00 34.84 ? 300 GLY A O   1 
ATOM   2128 N  N   . ILE A 1 258 ? -27.280 15.032  65.340  1.00 33.03 ? 301 ILE A N   1 
ATOM   2129 C  CA  . ILE A 1 258 ? -28.228 14.301  66.181  1.00 31.23 ? 301 ILE A CA  1 
ATOM   2130 C  C   . ILE A 1 258 ? -27.657 13.954  67.575  1.00 30.81 ? 301 ILE A C   1 
ATOM   2131 O  O   . ILE A 1 258 ? -28.323 14.180  68.592  1.00 30.25 ? 301 ILE A O   1 
ATOM   2132 C  CB  . ILE A 1 258 ? -28.718 13.010  65.480  1.00 30.76 ? 301 ILE A CB  1 
ATOM   2133 C  CG1 . ILE A 1 258 ? -29.450 13.337  64.175  1.00 30.12 ? 301 ILE A CG1 1 
ATOM   2134 C  CG2 . ILE A 1 258 ? -29.612 12.208  66.396  1.00 29.33 ? 301 ILE A CG2 1 
ATOM   2135 C  CD1 . ILE A 1 258 ? -29.380 12.224  63.130  1.00 27.83 ? 301 ILE A CD1 1 
ATOM   2136 N  N   . LEU A 1 259 ? -26.432 13.424  67.613  1.00 30.13 ? 302 LEU A N   1 
ATOM   2137 C  CA  . LEU A 1 259 ? -25.852 12.920  68.859  1.00 30.06 ? 302 LEU A CA  1 
ATOM   2138 C  C   . LEU A 1 259 ? -25.680 14.015  69.909  1.00 30.29 ? 302 LEU A C   1 
ATOM   2139 O  O   . LEU A 1 259 ? -26.076 13.853  71.078  1.00 29.92 ? 302 LEU A O   1 
ATOM   2140 C  CB  . LEU A 1 259 ? -24.524 12.188  68.607  1.00 29.56 ? 302 LEU A CB  1 
ATOM   2141 C  CG  . LEU A 1 259 ? -23.902 11.491  69.832  1.00 28.88 ? 302 LEU A CG  1 
ATOM   2142 C  CD1 . LEU A 1 259 ? -24.923 10.634  70.572  1.00 27.72 ? 302 LEU A CD1 1 
ATOM   2143 C  CD2 . LEU A 1 259 ? -22.676 10.666  69.463  1.00 28.21 ? 302 LEU A CD2 1 
ATOM   2144 N  N   . TYR A 1 260 ? -25.092 15.123  69.467  1.00 30.54 ? 303 TYR A N   1 
ATOM   2145 C  CA  . TYR A 1 260 ? -24.929 16.320  70.277  1.00 30.93 ? 303 TYR A CA  1 
ATOM   2146 C  C   . TYR A 1 260 ? -26.260 16.742  70.896  1.00 30.83 ? 303 TYR A C   1 
ATOM   2147 O  O   . TYR A 1 260 ? -26.310 17.081  72.079  1.00 31.12 ? 303 TYR A O   1 
ATOM   2148 C  CB  . TYR A 1 260 ? -24.329 17.452  69.423  1.00 31.20 ? 303 TYR A CB  1 
ATOM   2149 C  CG  . TYR A 1 260 ? -24.128 18.769  70.141  1.00 31.65 ? 303 TYR A CG  1 
ATOM   2150 C  CD1 . TYR A 1 260 ? -22.864 19.156  70.577  1.00 33.09 ? 303 TYR A CD1 1 
ATOM   2151 C  CD2 . TYR A 1 260 ? -25.204 19.641  70.371  1.00 31.92 ? 303 TYR A CD2 1 
ATOM   2152 C  CE1 . TYR A 1 260 ? -22.676 20.384  71.240  1.00 34.14 ? 303 TYR A CE1 1 
ATOM   2153 C  CE2 . TYR A 1 260 ? -25.029 20.855  71.033  1.00 31.79 ? 303 TYR A CE2 1 
ATOM   2154 C  CZ  . TYR A 1 260 ? -23.767 21.223  71.460  1.00 33.04 ? 303 TYR A CZ  1 
ATOM   2155 O  OH  . TYR A 1 260 ? -23.583 22.427  72.101  1.00 34.48 ? 303 TYR A OH  1 
ATOM   2156 N  N   . ARG A 1 261 ? -27.330 16.720  70.106  1.00 30.78 ? 304 ARG A N   1 
ATOM   2157 C  CA  . ARG A 1 261 ? -28.640 17.132  70.598  1.00 31.08 ? 304 ARG A CA  1 
ATOM   2158 C  C   . ARG A 1 261 ? -29.197 16.169  71.639  1.00 31.37 ? 304 ARG A C   1 
ATOM   2159 O  O   . ARG A 1 261 ? -29.759 16.590  72.644  1.00 31.58 ? 304 ARG A O   1 
ATOM   2160 C  CB  . ARG A 1 261 ? -29.630 17.295  69.455  1.00 30.96 ? 304 ARG A CB  1 
ATOM   2161 C  CG  . ARG A 1 261 ? -29.443 18.556  68.680  1.00 32.23 ? 304 ARG A CG  1 
ATOM   2162 C  CD  . ARG A 1 261 ? -30.744 19.330  68.685  1.00 35.34 ? 304 ARG A CD  1 
ATOM   2163 N  NE  . ARG A 1 261 ? -30.675 20.570  67.915  1.00 36.83 ? 304 ARG A NE  1 
ATOM   2164 C  CZ  . ARG A 1 261 ? -31.710 21.100  67.270  1.00 37.71 ? 304 ARG A CZ  1 
ATOM   2165 N  NH1 . ARG A 1 261 ? -32.891 20.488  67.288  1.00 38.78 ? 304 ARG A NH1 1 
ATOM   2166 N  NH2 . ARG A 1 261 ? -31.564 22.230  66.589  1.00 37.42 ? 304 ARG A NH2 1 
ATOM   2167 N  N   . LEU A 1 262 ? -29.037 14.876  71.400  1.00 31.80 ? 305 LEU A N   1 
ATOM   2168 C  CA  . LEU A 1 262 ? -29.542 13.883  72.328  1.00 32.48 ? 305 LEU A CA  1 
ATOM   2169 C  C   . LEU A 1 262 ? -28.757 13.904  73.650  1.00 32.81 ? 305 LEU A C   1 
ATOM   2170 O  O   . LEU A 1 262 ? -29.353 13.925  74.725  1.00 32.84 ? 305 LEU A O   1 
ATOM   2171 C  CB  . LEU A 1 262 ? -29.537 12.482  71.697  1.00 32.17 ? 305 LEU A CB  1 
ATOM   2172 C  CG  . LEU A 1 262 ? -30.521 12.157  70.565  1.00 31.86 ? 305 LEU A CG  1 
ATOM   2173 C  CD1 . LEU A 1 262 ? -30.136 10.821  69.931  1.00 31.11 ? 305 LEU A CD1 1 
ATOM   2174 C  CD2 . LEU A 1 262 ? -31.974 12.125  71.055  1.00 31.80 ? 305 LEU A CD2 1 
ATOM   2175 N  N   . LEU A 1 263 ? -27.428 13.917  73.558  1.00 33.24 ? 306 LEU A N   1 
ATOM   2176 C  CA  . LEU A 1 263 ? -26.568 13.931  74.738  1.00 33.72 ? 306 LEU A CA  1 
ATOM   2177 C  C   . LEU A 1 263 ? -26.759 15.195  75.572  1.00 34.61 ? 306 LEU A C   1 
ATOM   2178 O  O   . LEU A 1 263 ? -26.558 15.172  76.778  1.00 34.92 ? 306 LEU A O   1 
ATOM   2179 C  CB  . LEU A 1 263 ? -25.102 13.832  74.330  1.00 33.32 ? 306 LEU A CB  1 
ATOM   2180 C  CG  . LEU A 1 263 ? -24.524 12.532  73.773  1.00 32.45 ? 306 LEU A CG  1 
ATOM   2181 C  CD1 . LEU A 1 263 ? -23.077 12.767  73.373  1.00 31.28 ? 306 LEU A CD1 1 
ATOM   2182 C  CD2 . LEU A 1 263 ? -24.624 11.400  74.773  1.00 31.61 ? 306 LEU A CD2 1 
ATOM   2183 N  N   . GLY A 1 264 ? -27.151 16.287  74.921  1.00 35.53 ? 307 GLY A N   1 
ATOM   2184 C  CA  . GLY A 1 264 ? -27.256 17.585  75.561  1.00 36.60 ? 307 GLY A CA  1 
ATOM   2185 C  C   . GLY A 1 264 ? -28.640 17.925  76.072  1.00 37.62 ? 307 GLY A C   1 
ATOM   2186 O  O   . GLY A 1 264 ? -28.779 18.721  76.989  1.00 37.50 ? 307 GLY A O   1 
ATOM   2187 N  N   . ASP A 1 265 ? -29.673 17.337  75.483  1.00 38.86 ? 308 ASP A N   1 
ATOM   2188 C  CA  . ASP A 1 265 ? -31.041 17.666  75.888  1.00 40.32 ? 308 ASP A CA  1 
ATOM   2189 C  C   . ASP A 1 265 ? -32.088 16.631  75.474  1.00 40.42 ? 308 ASP A C   1 
ATOM   2190 O  O   . ASP A 1 265 ? -32.947 16.919  74.637  1.00 40.49 ? 308 ASP A O   1 
ATOM   2191 C  CB  . ASP A 1 265 ? -31.446 19.062  75.367  1.00 40.93 ? 308 ASP A CB  1 
ATOM   2192 C  CG  . ASP A 1 265 ? -32.682 19.634  76.088  1.00 42.67 ? 308 ASP A CG  1 
ATOM   2193 O  OD1 . ASP A 1 265 ? -33.254 18.946  76.976  1.00 43.61 ? 308 ASP A OD1 1 
ATOM   2194 O  OD2 . ASP A 1 265 ? -33.076 20.780  75.761  1.00 44.27 ? 308 ASP A OD2 1 
ATOM   2195 N  N   . SER A 1 266 ? -32.028 15.444  76.074  1.00 40.69 ? 309 SER A N   1 
ATOM   2196 C  CA  . SER A 1 266 ? -33.048 14.426  75.844  1.00 41.00 ? 309 SER A CA  1 
ATOM   2197 C  C   . SER A 1 266 ? -33.246 13.541  77.061  1.00 41.11 ? 309 SER A C   1 
ATOM   2198 O  O   . SER A 1 266 ? -32.355 13.399  77.896  1.00 40.97 ? 309 SER A O   1 
ATOM   2199 C  CB  . SER A 1 266 ? -32.719 13.563  74.615  1.00 41.17 ? 309 SER A CB  1 
ATOM   2200 O  OG  . SER A 1 266 ? -31.813 12.530  74.942  1.00 40.70 ? 309 SER A OG  1 
ATOM   2201 N  N   . LYS A 1 267 ? -34.417 12.919  77.126  1.00 41.21 ? 310 LYS A N   1 
ATOM   2202 C  CA  . LYS A 1 267 ? -34.782 12.068  78.245  1.00 41.27 ? 310 LYS A CA  1 
ATOM   2203 C  C   . LYS A 1 267 ? -34.070 10.714  78.242  1.00 40.76 ? 310 LYS A C   1 
ATOM   2204 O  O   . LYS A 1 267 ? -34.198 9.945   79.194  1.00 40.93 ? 310 LYS A O   1 
ATOM   2205 C  CB  . LYS A 1 267 ? -36.298 11.874  78.270  1.00 41.61 ? 310 LYS A CB  1 
ATOM   2206 C  CG  . LYS A 1 267 ? -37.067 13.177  78.403  1.00 43.10 ? 310 LYS A CG  1 
ATOM   2207 C  CD  . LYS A 1 267 ? -38.560 12.966  78.257  1.00 44.89 ? 310 LYS A CD  1 
ATOM   2208 C  CE  . LYS A 1 267 ? -39.288 14.256  78.564  1.00 46.63 ? 310 LYS A CE  1 
ATOM   2209 N  NZ  . LYS A 1 267 ? -40.687 13.989  78.996  1.00 49.08 ? 310 LYS A NZ  1 
ATOM   2210 N  N   . MET A 1 268 ? -33.324 10.421  77.181  1.00 40.13 ? 311 MET A N   1 
ATOM   2211 C  CA  . MET A 1 268 ? -32.641 9.134   77.065  1.00 39.34 ? 311 MET A CA  1 
ATOM   2212 C  C   . MET A 1 268 ? -31.370 9.054   77.911  1.00 38.39 ? 311 MET A C   1 
ATOM   2213 O  O   . MET A 1 268 ? -30.602 10.016  78.019  1.00 38.31 ? 311 MET A O   1 
ATOM   2214 C  CB  . MET A 1 268 ? -32.300 8.818   75.608  1.00 39.52 ? 311 MET A CB  1 
ATOM   2215 C  CG  . MET A 1 268 ? -33.483 8.436   74.746  1.00 40.69 ? 311 MET A CG  1 
ATOM   2216 S  SD  . MET A 1 268 ? -33.009 8.107   73.030  1.00 43.04 ? 311 MET A SD  1 
ATOM   2217 C  CE  . MET A 1 268 ? -32.430 6.443   73.162  1.00 40.67 ? 311 MET A CE  1 
ATOM   2218 N  N   . SER A 1 269 ? -31.164 7.888   78.507  1.00 37.08 ? 312 SER A N   1 
ATOM   2219 C  CA  . SER A 1 269 ? -29.903 7.555   79.132  1.00 36.14 ? 312 SER A CA  1 
ATOM   2220 C  C   . SER A 1 269 ? -28.841 7.428   78.048  1.00 35.15 ? 312 SER A C   1 
ATOM   2221 O  O   . SER A 1 269 ? -29.170 7.241   76.871  1.00 35.08 ? 312 SER A O   1 
ATOM   2222 C  CB  . SER A 1 269 ? -30.031 6.235   79.888  1.00 36.26 ? 312 SER A CB  1 
ATOM   2223 O  OG  . SER A 1 269 ? -30.528 5.223   79.028  1.00 36.83 ? 312 SER A OG  1 
ATOM   2224 N  N   . PHE A 1 270 ? -27.574 7.529   78.447  1.00 33.61 ? 313 PHE A N   1 
ATOM   2225 C  CA  . PHE A 1 270 ? -26.459 7.370   77.523  1.00 31.93 ? 313 PHE A CA  1 
ATOM   2226 C  C   . PHE A 1 270 ? -26.470 6.004   76.850  1.00 31.65 ? 313 PHE A C   1 
ATOM   2227 O  O   . PHE A 1 270 ? -26.257 5.909   75.644  1.00 31.60 ? 313 PHE A O   1 
ATOM   2228 C  CB  . PHE A 1 270 ? -25.124 7.590   78.233  1.00 31.30 ? 313 PHE A CB  1 
ATOM   2229 C  CG  . PHE A 1 270 ? -23.933 7.286   77.375  1.00 29.18 ? 313 PHE A CG  1 
ATOM   2230 C  CD1 . PHE A 1 270 ? -23.454 8.228   76.472  1.00 25.54 ? 313 PHE A CD1 1 
ATOM   2231 C  CD2 . PHE A 1 270 ? -23.291 6.046   77.465  1.00 27.45 ? 313 PHE A CD2 1 
ATOM   2232 C  CE1 . PHE A 1 270 ? -22.359 7.949   75.678  1.00 24.43 ? 313 PHE A CE1 1 
ATOM   2233 C  CE2 . PHE A 1 270 ? -22.191 5.752   76.667  1.00 25.58 ? 313 PHE A CE2 1 
ATOM   2234 C  CZ  . PHE A 1 270 ? -21.724 6.706   75.772  1.00 25.24 ? 313 PHE A CZ  1 
ATOM   2235 N  N   . GLU A 1 271 ? -26.710 4.955   77.631  1.00 31.30 ? 314 GLU A N   1 
ATOM   2236 C  CA  . GLU A 1 271 ? -26.748 3.594   77.092  1.00 31.18 ? 314 GLU A CA  1 
ATOM   2237 C  C   . GLU A 1 271 ? -27.878 3.405   76.060  1.00 30.60 ? 314 GLU A C   1 
ATOM   2238 O  O   . GLU A 1 271 ? -27.673 2.761   75.020  1.00 30.76 ? 314 GLU A O   1 
ATOM   2239 C  CB  . GLU A 1 271 ? -26.733 2.494   78.191  1.00 31.06 ? 314 GLU A CB  1 
ATOM   2240 C  CG  . GLU A 1 271 ? -27.183 2.903   79.616  1.00 32.16 ? 314 GLU A CG  1 
ATOM   2241 C  CD  . GLU A 1 271 ? -26.141 3.743   80.399  1.00 32.92 ? 314 GLU A CD  1 
ATOM   2242 O  OE1 . GLU A 1 271 ? -24.942 3.344   80.498  1.00 32.59 ? 314 GLU A OE1 1 
ATOM   2243 O  OE2 . GLU A 1 271 ? -26.535 4.814   80.921  1.00 32.50 ? 314 GLU A OE2 1 
ATOM   2244 N  N   . ASP A 1 272 ? -29.046 3.983   76.328  1.00 29.79 ? 315 ASP A N   1 
ATOM   2245 C  CA  . ASP A 1 272 ? -30.122 4.012   75.339  1.00 29.29 ? 315 ASP A CA  1 
ATOM   2246 C  C   . ASP A 1 272 ? -29.703 4.757   74.073  1.00 28.86 ? 315 ASP A C   1 
ATOM   2247 O  O   . ASP A 1 272 ? -29.922 4.282   72.951  1.00 28.79 ? 315 ASP A O   1 
ATOM   2248 C  CB  . ASP A 1 272 ? -31.370 4.666   75.924  1.00 29.69 ? 315 ASP A CB  1 
ATOM   2249 C  CG  . ASP A 1 272 ? -32.196 3.713   76.751  1.00 30.65 ? 315 ASP A CG  1 
ATOM   2250 O  OD1 . ASP A 1 272 ? -32.226 2.507   76.429  1.00 31.88 ? 315 ASP A OD1 1 
ATOM   2251 O  OD2 . ASP A 1 272 ? -32.830 4.178   77.715  1.00 32.08 ? 315 ASP A OD2 1 
ATOM   2252 N  N   . ILE A 1 273 ? -29.100 5.928   74.262  1.00 28.17 ? 316 ILE A N   1 
ATOM   2253 C  CA  . ILE A 1 273 ? -28.650 6.745   73.159  1.00 27.47 ? 316 ILE A CA  1 
ATOM   2254 C  C   . ILE A 1 273 ? -27.657 5.965   72.295  1.00 27.37 ? 316 ILE A C   1 
ATOM   2255 O  O   . ILE A 1 273 ? -27.868 5.844   71.088  1.00 27.68 ? 316 ILE A O   1 
ATOM   2256 C  CB  . ILE A 1 273 ? -28.074 8.085   73.657  1.00 27.43 ? 316 ILE A CB  1 
ATOM   2257 C  CG1 . ILE A 1 273 ? -29.225 9.039   73.993  1.00 27.98 ? 316 ILE A CG1 1 
ATOM   2258 C  CG2 . ILE A 1 273 ? -27.129 8.710   72.620  1.00 26.73 ? 316 ILE A CG2 1 
ATOM   2259 C  CD1 . ILE A 1 273 ? -28.837 10.225  74.905  1.00 26.86 ? 316 ILE A CD1 1 
ATOM   2260 N  N   . LYS A 1 274 ? -26.602 5.425   72.906  1.00 26.77 ? 317 LYS A N   1 
ATOM   2261 C  CA  . LYS A 1 274 ? -25.608 4.642   72.177  1.00 26.58 ? 317 LYS A CA  1 
ATOM   2262 C  C   . LYS A 1 274 ? -26.206 3.417   71.462  1.00 26.00 ? 317 LYS A C   1 
ATOM   2263 O  O   . LYS A 1 274 ? -25.819 3.099   70.338  1.00 26.24 ? 317 LYS A O   1 
ATOM   2264 C  CB  . LYS A 1 274 ? -24.486 4.193   73.105  1.00 27.09 ? 317 LYS A CB  1 
ATOM   2265 C  CG  . LYS A 1 274 ? -23.223 3.759   72.368  1.00 28.71 ? 317 LYS A CG  1 
ATOM   2266 C  CD  . LYS A 1 274 ? -22.735 2.397   72.838  1.00 32.50 ? 317 LYS A CD  1 
ATOM   2267 C  CE  . LYS A 1 274 ? -21.931 2.453   74.122  1.00 33.09 ? 317 LYS A CE  1 
ATOM   2268 N  NZ  . LYS A 1 274 ? -22.818 2.766   75.264  1.00 36.10 ? 317 LYS A NZ  1 
ATOM   2269 N  N   . ALA A 1 275 ? -27.145 2.728   72.099  1.00 25.06 ? 318 ALA A N   1 
ATOM   2270 C  CA  . ALA A 1 275 ? -27.811 1.615   71.421  1.00 24.47 ? 318 ALA A CA  1 
ATOM   2271 C  C   . ALA A 1 275 ? -28.456 2.084   70.104  1.00 23.66 ? 318 ALA A C   1 
ATOM   2272 O  O   . ALA A 1 275 ? -28.275 1.459   69.056  1.00 23.71 ? 318 ALA A O   1 
ATOM   2273 C  CB  . ALA A 1 275 ? -28.829 0.951   72.325  1.00 24.43 ? 318 ALA A CB  1 
ATOM   2274 N  N   . ASN A 1 276 ? -29.172 3.201   70.159  1.00 22.39 ? 319 ASN A N   1 
ATOM   2275 C  CA  . ASN A 1 276 ? -29.842 3.728   68.981  1.00 21.25 ? 319 ASN A CA  1 
ATOM   2276 C  C   . ASN A 1 276 ? -28.926 4.352   67.938  1.00 21.14 ? 319 ASN A C   1 
ATOM   2277 O  O   . ASN A 1 276 ? -29.221 4.293   66.739  1.00 21.38 ? 319 ASN A O   1 
ATOM   2278 C  CB  . ASN A 1 276 ? -30.996 4.630   69.385  1.00 20.73 ? 319 ASN A CB  1 
ATOM   2279 C  CG  . ASN A 1 276 ? -32.163 3.833   69.936  1.00 20.50 ? 319 ASN A CG  1 
ATOM   2280 O  OD1 . ASN A 1 276 ? -32.729 2.978   69.242  1.00 19.62 ? 319 ASN A OD1 1 
ATOM   2281 N  ND2 . ASN A 1 276 ? -32.518 4.085   71.187  1.00 18.36 ? 319 ASN A ND2 1 
ATOM   2282 N  N   . VAL A 1 277 ? -27.807 4.925   68.380  1.00 20.59 ? 320 VAL A N   1 
ATOM   2283 C  CA  . VAL A 1 277 ? -26.788 5.386   67.448  1.00 20.08 ? 320 VAL A CA  1 
ATOM   2284 C  C   . VAL A 1 277 ? -26.259 4.205   66.648  1.00 20.31 ? 320 VAL A C   1 
ATOM   2285 O  O   . VAL A 1 277 ? -26.091 4.311   65.428  1.00 20.83 ? 320 VAL A O   1 
ATOM   2286 C  CB  . VAL A 1 277 ? -25.648 6.157   68.145  1.00 20.08 ? 320 VAL A CB  1 
ATOM   2287 C  CG1 . VAL A 1 277 ? -24.446 6.285   67.243  1.00 19.68 ? 320 VAL A CG1 1 
ATOM   2288 C  CG2 . VAL A 1 277 ? -26.128 7.554   68.564  1.00 20.02 ? 320 VAL A CG2 1 
ATOM   2289 N  N   . THR A 1 278 ? -26.028 3.077   67.321  1.00 20.13 ? 321 THR A N   1 
ATOM   2290 C  CA  . THR A 1 278 ? -25.581 1.859   66.661  1.00 20.36 ? 321 THR A CA  1 
ATOM   2291 C  C   . THR A 1 278 ? -26.549 1.423   65.547  1.00 20.38 ? 321 THR A C   1 
ATOM   2292 O  O   . THR A 1 278 ? -26.124 1.147   64.411  1.00 20.35 ? 321 THR A O   1 
ATOM   2293 C  CB  . THR A 1 278 ? -25.333 0.729   67.693  1.00 20.77 ? 321 THR A CB  1 
ATOM   2294 O  OG1 . THR A 1 278 ? -24.302 1.140   68.604  1.00 23.72 ? 321 THR A OG1 1 
ATOM   2295 C  CG2 . THR A 1 278 ? -24.892 -0.570  67.023  1.00 19.05 ? 321 THR A CG2 1 
ATOM   2296 N  N   . GLU A 1 279 ? -27.841 1.406   65.859  1.00 20.25 ? 322 GLU A N   1 
ATOM   2297 C  CA  . GLU A 1 279 ? -28.858 0.968   64.909  1.00 20.81 ? 322 GLU A CA  1 
ATOM   2298 C  C   . GLU A 1 279 ? -29.050 1.918   63.730  1.00 20.83 ? 322 GLU A C   1 
ATOM   2299 O  O   . GLU A 1 279 ? -29.183 1.473   62.593  1.00 20.93 ? 322 GLU A O   1 
ATOM   2300 C  CB  . GLU A 1 279 ? -30.197 0.701   65.612  1.00 20.82 ? 322 GLU A CB  1 
ATOM   2301 C  CG  . GLU A 1 279 ? -30.144 -0.494  66.536  1.00 21.61 ? 322 GLU A CG  1 
ATOM   2302 C  CD  . GLU A 1 279 ? -31.463 -0.773  67.222  1.00 23.37 ? 322 GLU A CD  1 
ATOM   2303 O  OE1 . GLU A 1 279 ? -32.399 0.051   67.092  1.00 25.06 ? 322 GLU A OE1 1 
ATOM   2304 O  OE2 . GLU A 1 279 ? -31.566 -1.827  67.890  1.00 22.84 ? 322 GLU A OE2 1 
ATOM   2305 N  N   . MET A 1 280 ? -29.061 3.218   64.003  1.00 21.00 ? 323 MET A N   1 
ATOM   2306 C  CA  . MET A 1 280 ? -29.202 4.214   62.949  1.00 21.26 ? 323 MET A CA  1 
ATOM   2307 C  C   . MET A 1 280 ? -28.028 4.162   61.980  1.00 21.06 ? 323 MET A C   1 
ATOM   2308 O  O   . MET A 1 280 ? -28.223 4.262   60.776  1.00 20.93 ? 323 MET A O   1 
ATOM   2309 C  CB  . MET A 1 280 ? -29.367 5.613   63.545  1.00 21.36 ? 323 MET A CB  1 
ATOM   2310 C  CG  . MET A 1 280 ? -30.752 5.827   64.189  1.00 22.76 ? 323 MET A CG  1 
ATOM   2311 S  SD  . MET A 1 280 ? -30.850 7.429   65.020  1.00 26.91 ? 323 MET A SD  1 
ATOM   2312 C  CE  . MET A 1 280 ? -30.795 8.529   63.618  1.00 26.62 ? 323 MET A CE  1 
ATOM   2313 N  N   . LEU A 1 281 ? -26.816 3.977   62.509  1.00 21.14 ? 324 LEU A N   1 
ATOM   2314 C  CA  . LEU A 1 281 ? -25.620 3.833   61.670  1.00 20.80 ? 324 LEU A CA  1 
ATOM   2315 C  C   . LEU A 1 281 ? -25.748 2.611   60.783  1.00 20.39 ? 324 LEU A C   1 
ATOM   2316 O  O   . LEU A 1 281 ? -25.538 2.699   59.571  1.00 20.42 ? 324 LEU A O   1 
ATOM   2317 C  CB  . LEU A 1 281 ? -24.347 3.702   62.503  1.00 20.65 ? 324 LEU A CB  1 
ATOM   2318 C  CG  . LEU A 1 281 ? -23.842 4.911   63.283  1.00 21.41 ? 324 LEU A CG  1 
ATOM   2319 C  CD1 . LEU A 1 281 ? -22.876 4.429   64.366  1.00 21.67 ? 324 LEU A CD1 1 
ATOM   2320 C  CD2 . LEU A 1 281 ? -23.192 5.948   62.365  1.00 21.05 ? 324 LEU A CD2 1 
ATOM   2321 N  N   . ALA A 1 282 ? -26.104 1.480   61.387  1.00 19.58 ? 325 ALA A N   1 
ATOM   2322 C  CA  . ALA A 1 282 ? -26.126 0.231   60.654  1.00 19.34 ? 325 ALA A CA  1 
ATOM   2323 C  C   . ALA A 1 282 ? -27.291 0.215   59.676  1.00 19.28 ? 325 ALA A C   1 
ATOM   2324 O  O   . ALA A 1 282 ? -27.188 -0.362  58.582  1.00 19.41 ? 325 ALA A O   1 
ATOM   2325 C  CB  . ALA A 1 282 ? -26.183 -0.953  61.603  1.00 19.46 ? 325 ALA A CB  1 
ATOM   2326 N  N   . GLY A 1 283 ? -28.388 0.864   60.067  1.00 18.63 ? 326 GLY A N   1 
ATOM   2327 C  CA  . GLY A 1 283 ? -29.574 0.943   59.229  1.00 18.31 ? 326 GLY A CA  1 
ATOM   2328 C  C   . GLY A 1 283 ? -29.389 1.799   57.986  1.00 18.34 ? 326 GLY A C   1 
ATOM   2329 O  O   . GLY A 1 283 ? -30.115 1.640   57.003  1.00 18.15 ? 326 GLY A O   1 
ATOM   2330 N  N   . GLY A 1 284 ? -28.408 2.694   58.023  1.00 17.82 ? 327 GLY A N   1 
ATOM   2331 C  CA  . GLY A 1 284 ? -28.320 3.741   57.029  1.00 18.22 ? 327 GLY A CA  1 
ATOM   2332 C  C   . GLY A 1 284 ? -27.413 3.487   55.847  1.00 18.48 ? 327 GLY A C   1 
ATOM   2333 O  O   . GLY A 1 284 ? -27.432 4.246   54.884  1.00 18.48 ? 327 GLY A O   1 
ATOM   2334 N  N   . VAL A 1 285 ? -26.610 2.431   55.923  1.00 18.34 ? 328 VAL A N   1 
ATOM   2335 C  CA  . VAL A 1 285 ? -25.567 2.190   54.937  1.00 18.39 ? 328 VAL A CA  1 
ATOM   2336 C  C   . VAL A 1 285 ? -26.100 1.444   53.707  1.00 18.56 ? 328 VAL A C   1 
ATOM   2337 O  O   . VAL A 1 285 ? -25.838 1.841   52.570  1.00 18.22 ? 328 VAL A O   1 
ATOM   2338 C  CB  . VAL A 1 285 ? -24.370 1.407   55.561  1.00 18.34 ? 328 VAL A CB  1 
ATOM   2339 C  CG1 . VAL A 1 285 ? -23.361 1.023   54.505  1.00 16.86 ? 328 VAL A CG1 1 
ATOM   2340 C  CG2 . VAL A 1 285 ? -23.713 2.232   56.643  1.00 18.73 ? 328 VAL A CG2 1 
ATOM   2341 N  N   . ASP A 1 286 ? -26.818 0.347   53.939  1.00 18.44 ? 329 ASP A N   1 
ATOM   2342 C  CA  . ASP A 1 286 ? -27.240 -0.527  52.829  1.00 18.39 ? 329 ASP A CA  1 
ATOM   2343 C  C   . ASP A 1 286 ? -28.600 -0.163  52.229  1.00 17.62 ? 329 ASP A C   1 
ATOM   2344 O  O   . ASP A 1 286 ? -28.963 -0.654  51.170  1.00 17.57 ? 329 ASP A O   1 
ATOM   2345 C  CB  . ASP A 1 286 ? -27.229 -1.992  53.267  1.00 18.10 ? 329 ASP A CB  1 
ATOM   2346 C  CG  . ASP A 1 286 ? -25.830 -2.531  53.426  1.00 19.63 ? 329 ASP A CG  1 
ATOM   2347 O  OD1 . ASP A 1 286 ? -24.871 -1.729  53.344  1.00 20.34 ? 329 ASP A OD1 1 
ATOM   2348 O  OD2 . ASP A 1 286 ? -25.686 -3.759  53.625  1.00 20.87 ? 329 ASP A OD2 1 
ATOM   2349 N  N   . THR A 1 287 ? -29.333 0.702   52.915  1.00 17.17 ? 330 THR A N   1 
ATOM   2350 C  CA  . THR A 1 287 ? -30.687 1.048   52.518  1.00 16.86 ? 330 THR A CA  1 
ATOM   2351 C  C   . THR A 1 287 ? -30.694 2.119   51.432  1.00 16.33 ? 330 THR A C   1 
ATOM   2352 O  O   . THR A 1 287 ? -31.091 1.837   50.303  1.00 16.28 ? 330 THR A O   1 
ATOM   2353 C  CB  . THR A 1 287 ? -31.529 1.476   53.730  1.00 16.85 ? 330 THR A CB  1 
ATOM   2354 O  OG1 . THR A 1 287 ? -30.847 2.524   54.438  1.00 17.33 ? 330 THR A OG1 1 
ATOM   2355 C  CG2 . THR A 1 287 ? -31.759 0.283   54.645  1.00 16.01 ? 330 THR A CG2 1 
ATOM   2356 N  N   . THR A 1 288 ? -30.232 3.324   51.757  1.00 15.98 ? 331 THR A N   1 
ATOM   2357 C  CA  . THR A 1 288 ? -30.267 4.434   50.798  1.00 15.79 ? 331 THR A CA  1 
ATOM   2358 C  C   . THR A 1 288 ? -29.388 4.173   49.562  1.00 15.95 ? 331 THR A C   1 
ATOM   2359 O  O   . THR A 1 288 ? -29.761 4.525   48.434  1.00 15.87 ? 331 THR A O   1 
ATOM   2360 C  CB  . THR A 1 288 ? -29.851 5.765   51.439  1.00 15.59 ? 331 THR A CB  1 
ATOM   2361 O  OG1 . THR A 1 288 ? -28.545 5.631   51.998  1.00 16.84 ? 331 THR A OG1 1 
ATOM   2362 C  CG2 . THR A 1 288 ? -30.802 6.162   52.520  1.00 14.21 ? 331 THR A CG2 1 
ATOM   2363 N  N   . SER A 1 289 ? -28.247 3.530   49.785  1.00 15.96 ? 332 SER A N   1 
ATOM   2364 C  CA  . SER A 1 289 ? -27.307 3.202   48.726  1.00 16.38 ? 332 SER A CA  1 
ATOM   2365 C  C   . SER A 1 289 ? -27.889 2.287   47.635  1.00 17.14 ? 332 SER A C   1 
ATOM   2366 O  O   . SER A 1 289 ? -27.739 2.564   46.432  1.00 17.07 ? 332 SER A O   1 
ATOM   2367 C  CB  . SER A 1 289 ? -26.064 2.548   49.329  1.00 16.14 ? 332 SER A CB  1 
ATOM   2368 O  OG  . SER A 1 289 ? -26.427 1.397   50.062  1.00 15.87 ? 332 SER A OG  1 
ATOM   2369 N  N   . MET A 1 290 ? -28.541 1.198   48.047  1.00 17.52 ? 333 MET A N   1 
ATOM   2370 C  CA  . MET A 1 290 ? -29.128 0.270   47.084  1.00 17.81 ? 333 MET A CA  1 
ATOM   2371 C  C   . MET A 1 290 ? -30.312 0.886   46.364  1.00 17.51 ? 333 MET A C   1 
ATOM   2372 O  O   . MET A 1 290 ? -30.530 0.627   45.180  1.00 17.54 ? 333 MET A O   1 
ATOM   2373 C  CB  . MET A 1 290 ? -29.514 -1.056  47.751  1.00 18.40 ? 333 MET A CB  1 
ATOM   2374 C  CG  . MET A 1 290 ? -28.305 -1.897  48.190  1.00 19.93 ? 333 MET A CG  1 
ATOM   2375 S  SD  . MET A 1 290 ? -27.181 -2.300  46.826  1.00 22.37 ? 333 MET A SD  1 
ATOM   2376 C  CE  . MET A 1 290 ? -26.022 -0.917  46.817  1.00 21.16 ? 333 MET A CE  1 
ATOM   2377 N  N   . THR A 1 291 ? -31.066 1.712   47.083  1.00 17.40 ? 334 THR A N   1 
ATOM   2378 C  CA  . THR A 1 291 ? -32.229 2.385   46.522  1.00 17.08 ? 334 THR A CA  1 
ATOM   2379 C  C   . THR A 1 291 ? -31.774 3.388   45.456  1.00 17.38 ? 334 THR A C   1 
ATOM   2380 O  O   . THR A 1 291 ? -32.339 3.432   44.362  1.00 17.08 ? 334 THR A O   1 
ATOM   2381 C  CB  . THR A 1 291 ? -33.061 3.060   47.616  1.00 17.03 ? 334 THR A CB  1 
ATOM   2382 O  OG1 . THR A 1 291 ? -33.481 2.069   48.572  1.00 17.34 ? 334 THR A OG1 1 
ATOM   2383 C  CG2 . THR A 1 291 ? -34.286 3.722   47.030  1.00 17.24 ? 334 THR A CG2 1 
ATOM   2384 N  N   . LEU A 1 292 ? -30.720 4.150   45.756  1.00 17.16 ? 335 LEU A N   1 
ATOM   2385 C  CA  . LEU A 1 292 ? -30.170 5.079   44.789  1.00 16.88 ? 335 LEU A CA  1 
ATOM   2386 C  C   . LEU A 1 292 ? -29.657 4.346   43.566  1.00 17.20 ? 335 LEU A C   1 
ATOM   2387 O  O   . LEU A 1 292 ? -29.870 4.788   42.421  1.00 17.26 ? 335 LEU A O   1 
ATOM   2388 C  CB  . LEU A 1 292 ? -29.051 5.919   45.412  1.00 17.00 ? 335 LEU A CB  1 
ATOM   2389 C  CG  . LEU A 1 292 ? -29.523 7.007   46.366  1.00 16.77 ? 335 LEU A CG  1 
ATOM   2390 C  CD1 . LEU A 1 292 ? -28.348 7.646   47.096  1.00 14.56 ? 335 LEU A CD1 1 
ATOM   2391 C  CD2 . LEU A 1 292 ? -30.366 8.025   45.588  1.00 16.44 ? 335 LEU A CD2 1 
ATOM   2392 N  N   . GLN A 1 293 ? -28.974 3.228   43.795  1.00 17.37 ? 336 GLN A N   1 
ATOM   2393 C  CA  . GLN A 1 293 ? -28.516 2.421   42.683  1.00 17.67 ? 336 GLN A CA  1 
ATOM   2394 C  C   . GLN A 1 293 ? -29.694 2.033   41.795  1.00 17.57 ? 336 GLN A C   1 
ATOM   2395 O  O   . GLN A 1 293 ? -29.587 2.126   40.564  1.00 17.84 ? 336 GLN A O   1 
ATOM   2396 C  CB  . GLN A 1 293 ? -27.748 1.175   43.132  1.00 17.94 ? 336 GLN A CB  1 
ATOM   2397 C  CG  . GLN A 1 293 ? -27.007 0.507   41.953  1.00 19.29 ? 336 GLN A CG  1 
ATOM   2398 C  CD  . GLN A 1 293 ? -26.062 -0.596  42.373  1.00 20.53 ? 336 GLN A CD  1 
ATOM   2399 O  OE1 . GLN A 1 293 ? -24.912 -0.654  41.920  1.00 19.14 ? 336 GLN A OE1 1 
ATOM   2400 N  NE2 . GLN A 1 293 ? -26.539 -1.479  43.248  1.00 20.87 ? 336 GLN A NE2 1 
ATOM   2401 N  N   . TRP A 1 294 ? -30.811 1.616   42.403  1.00 17.12 ? 337 TRP A N   1 
ATOM   2402 C  CA  . TRP A 1 294 ? -31.995 1.234   41.611  1.00 16.99 ? 337 TRP A CA  1 
ATOM   2403 C  C   . TRP A 1 294 ? -32.555 2.422   40.835  1.00 16.98 ? 337 TRP A C   1 
ATOM   2404 O  O   . TRP A 1 294 ? -32.937 2.293   39.671  1.00 16.74 ? 337 TRP A O   1 
ATOM   2405 C  CB  . TRP A 1 294 ? -33.088 0.639   42.483  1.00 16.68 ? 337 TRP A CB  1 
ATOM   2406 C  CG  . TRP A 1 294 ? -32.913 -0.806  42.830  1.00 17.20 ? 337 TRP A CG  1 
ATOM   2407 C  CD1 . TRP A 1 294 ? -32.807 -1.337  44.081  1.00 15.82 ? 337 TRP A CD1 1 
ATOM   2408 C  CD2 . TRP A 1 294 ? -32.848 -1.910  41.918  1.00 18.03 ? 337 TRP A CD2 1 
ATOM   2409 N  NE1 . TRP A 1 294 ? -32.685 -2.698  44.011  1.00 15.59 ? 337 TRP A NE1 1 
ATOM   2410 C  CE2 . TRP A 1 294 ? -32.695 -3.081  42.695  1.00 17.78 ? 337 TRP A CE2 1 
ATOM   2411 C  CE3 . TRP A 1 294 ? -32.900 -2.026  40.517  1.00 17.67 ? 337 TRP A CE3 1 
ATOM   2412 C  CZ2 . TRP A 1 294 ? -32.604 -4.363  42.119  1.00 17.73 ? 337 TRP A CZ2 1 
ATOM   2413 C  CZ3 . TRP A 1 294 ? -32.796 -3.301  39.944  1.00 17.23 ? 337 TRP A CZ3 1 
ATOM   2414 C  CH2 . TRP A 1 294 ? -32.642 -4.448  40.748  1.00 16.96 ? 337 TRP A CH2 1 
ATOM   2415 N  N   . HIS A 1 295 ? -32.587 3.577   41.494  1.00 16.98 ? 338 HIS A N   1 
ATOM   2416 C  CA  . HIS A 1 295 ? -33.059 4.795   40.882  1.00 17.55 ? 338 HIS A CA  1 
ATOM   2417 C  C   . HIS A 1 295 ? -32.224 5.117   39.641  1.00 17.76 ? 338 HIS A C   1 
ATOM   2418 O  O   . HIS A 1 295 ? -32.770 5.399   38.567  1.00 17.40 ? 338 HIS A O   1 
ATOM   2419 C  CB  . HIS A 1 295 ? -33.036 5.969   41.872  1.00 17.34 ? 338 HIS A CB  1 
ATOM   2420 C  CG  . HIS A 1 295 ? -33.724 7.184   41.347  1.00 18.37 ? 338 HIS A CG  1 
ATOM   2421 N  ND1 . HIS A 1 295 ? -34.991 7.557   41.750  1.00 18.25 ? 338 HIS A ND1 1 
ATOM   2422 C  CD2 . HIS A 1 295 ? -33.358 8.067   40.385  1.00 18.21 ? 338 HIS A CD2 1 
ATOM   2423 C  CE1 . HIS A 1 295 ? -35.359 8.641   41.088  1.00 18.06 ? 338 HIS A CE1 1 
ATOM   2424 N  NE2 . HIS A 1 295 ? -34.386 8.972   40.255  1.00 19.24 ? 338 HIS A NE2 1 
ATOM   2425 N  N   . LEU A 1 296 ? -30.901 5.053   39.788  1.00 17.83 ? 339 LEU A N   1 
ATOM   2426 C  CA  . LEU A 1 296 ? -30.014 5.389   38.678  1.00 17.97 ? 339 LEU A CA  1 
ATOM   2427 C  C   . LEU A 1 296 ? -30.221 4.406   37.542  1.00 18.22 ? 339 LEU A C   1 
ATOM   2428 O  O   . LEU A 1 296 ? -30.234 4.801   36.373  1.00 18.17 ? 339 LEU A O   1 
ATOM   2429 C  CB  . LEU A 1 296 ? -28.551 5.398   39.118  1.00 17.40 ? 339 LEU A CB  1 
ATOM   2430 C  CG  . LEU A 1 296 ? -28.122 6.529   40.046  1.00 18.29 ? 339 LEU A CG  1 
ATOM   2431 C  CD1 . LEU A 1 296 ? -26.820 6.147   40.782  1.00 16.46 ? 339 LEU A CD1 1 
ATOM   2432 C  CD2 . LEU A 1 296 ? -28.011 7.879   39.295  1.00 16.66 ? 339 LEU A CD2 1 
ATOM   2433 N  N   . TYR A 1 297 ? -30.366 3.130   37.909  1.00 18.32 ? 340 TYR A N   1 
ATOM   2434 C  CA  . TYR A 1 297 ? -30.734 2.072   36.980  1.00 18.65 ? 340 TYR A CA  1 
ATOM   2435 C  C   . TYR A 1 297 ? -32.048 2.392   36.254  1.00 19.08 ? 340 TYR A C   1 
ATOM   2436 O  O   . TYR A 1 297 ? -32.098 2.310   35.039  1.00 19.24 ? 340 TYR A O   1 
ATOM   2437 C  CB  . TYR A 1 297 ? -30.818 0.727   37.715  1.00 18.08 ? 340 TYR A CB  1 
ATOM   2438 C  CG  . TYR A 1 297 ? -31.401 -0.419  36.910  1.00 16.68 ? 340 TYR A CG  1 
ATOM   2439 C  CD1 . TYR A 1 297 ? -30.609 -1.161  36.029  1.00 17.76 ? 340 TYR A CD1 1 
ATOM   2440 C  CD2 . TYR A 1 297 ? -32.727 -0.787  37.058  1.00 16.08 ? 340 TYR A CD2 1 
ATOM   2441 C  CE1 . TYR A 1 297 ? -31.140 -2.226  35.306  1.00 17.49 ? 340 TYR A CE1 1 
ATOM   2442 C  CE2 . TYR A 1 297 ? -33.268 -1.856  36.348  1.00 15.81 ? 340 TYR A CE2 1 
ATOM   2443 C  CZ  . TYR A 1 297 ? -32.478 -2.559  35.471  1.00 16.89 ? 340 TYR A CZ  1 
ATOM   2444 O  OH  . TYR A 1 297 ? -33.025 -3.603  34.770  1.00 18.33 ? 340 TYR A OH  1 
ATOM   2445 N  N   . GLU A 1 298 ? -33.092 2.766   36.993  1.00 19.78 ? 341 GLU A N   1 
ATOM   2446 C  CA  . GLU A 1 298 ? -34.378 3.142   36.375  1.00 21.08 ? 341 GLU A CA  1 
ATOM   2447 C  C   . GLU A 1 298 ? -34.320 4.379   35.480  1.00 21.57 ? 341 GLU A C   1 
ATOM   2448 O  O   . GLU A 1 298 ? -35.081 4.477   34.524  1.00 21.95 ? 341 GLU A O   1 
ATOM   2449 C  CB  . GLU A 1 298 ? -35.489 3.315   37.407  1.00 20.67 ? 341 GLU A CB  1 
ATOM   2450 C  CG  . GLU A 1 298 ? -35.862 2.024   38.141  1.00 23.04 ? 341 GLU A CG  1 
ATOM   2451 C  CD  . GLU A 1 298 ? -36.406 0.940   37.219  1.00 23.98 ? 341 GLU A CD  1 
ATOM   2452 O  OE1 . GLU A 1 298 ? -36.565 -0.207  37.683  1.00 25.01 ? 341 GLU A OE1 1 
ATOM   2453 O  OE2 . GLU A 1 298 ? -36.677 1.238   36.038  1.00 24.55 ? 341 GLU A OE2 1 
ATOM   2454 N  N   . MET A 1 299 ? -33.431 5.316   35.792  1.00 22.10 ? 342 MET A N   1 
ATOM   2455 C  CA  . MET A 1 299 ? -33.243 6.492   34.943  1.00 22.81 ? 342 MET A CA  1 
ATOM   2456 C  C   . MET A 1 299 ? -32.499 6.115   33.682  1.00 23.25 ? 342 MET A C   1 
ATOM   2457 O  O   . MET A 1 299 ? -32.699 6.731   32.639  1.00 23.29 ? 342 MET A O   1 
ATOM   2458 C  CB  . MET A 1 299 ? -32.498 7.616   35.672  1.00 22.44 ? 342 MET A CB  1 
ATOM   2459 C  CG  . MET A 1 299 ? -33.353 8.319   36.708  1.00 23.22 ? 342 MET A CG  1 
ATOM   2460 S  SD  . MET A 1 299 ? -32.782 9.973   37.129  1.00 24.50 ? 342 MET A SD  1 
ATOM   2461 C  CE  . MET A 1 299 ? -31.337 9.622   38.130  1.00 24.84 ? 342 MET A CE  1 
ATOM   2462 N  N   . ALA A 1 300 ? -31.639 5.104   33.781  1.00 23.66 ? 343 ALA A N   1 
ATOM   2463 C  CA  . ALA A 1 300 ? -30.884 4.654   32.615  1.00 24.33 ? 343 ALA A CA  1 
ATOM   2464 C  C   . ALA A 1 300 ? -31.762 3.820   31.678  1.00 24.86 ? 343 ALA A C   1 
ATOM   2465 O  O   . ALA A 1 300 ? -31.525 3.803   30.463  1.00 24.51 ? 343 ALA A O   1 
ATOM   2466 C  CB  . ALA A 1 300 ? -29.641 3.881   33.032  1.00 23.57 ? 343 ALA A CB  1 
ATOM   2467 N  N   . ARG A 1 301 ? -32.760 3.142   32.261  1.00 25.47 ? 344 ARG A N   1 
ATOM   2468 C  CA  . ARG A 1 301 ? -33.703 2.284   31.528  1.00 26.77 ? 344 ARG A CA  1 
ATOM   2469 C  C   . ARG A 1 301 ? -34.762 3.095   30.782  1.00 26.66 ? 344 ARG A C   1 
ATOM   2470 O  O   . ARG A 1 301 ? -35.322 2.628   29.798  1.00 26.71 ? 344 ARG A O   1 
ATOM   2471 C  CB  . ARG A 1 301 ? -34.420 1.314   32.486  1.00 27.28 ? 344 ARG A CB  1 
ATOM   2472 C  CG  . ARG A 1 301 ? -34.098 -0.186  32.305  1.00 28.85 ? 344 ARG A CG  1 
ATOM   2473 C  CD  . ARG A 1 301 ? -35.012 -1.089  33.190  1.00 31.42 ? 344 ARG A CD  1 
ATOM   2474 N  NE  . ARG A 1 301 ? -36.344 -1.363  32.627  1.00 33.37 ? 344 ARG A NE  1 
ATOM   2475 C  CZ  . ARG A 1 301 ? -37.518 -1.004  33.171  1.00 34.61 ? 344 ARG A CZ  1 
ATOM   2476 N  NH1 . ARG A 1 301 ? -37.578 -0.340  34.319  1.00 34.20 ? 344 ARG A NH1 1 
ATOM   2477 N  NH2 . ARG A 1 301 ? -38.656 -1.316  32.555  1.00 34.19 ? 344 ARG A NH2 1 
ATOM   2478 N  N   . ASN A 1 302 ? -35.023 4.302   31.279  1.00 26.82 ? 345 ASN A N   1 
ATOM   2479 C  CA  . ASN A 1 302 ? -36.079 5.178   30.795  1.00 26.86 ? 345 ASN A CA  1 
ATOM   2480 C  C   . ASN A 1 302 ? -35.514 6.562   30.604  1.00 26.55 ? 345 ASN A C   1 
ATOM   2481 O  O   . ASN A 1 302 ? -35.648 7.414   31.484  1.00 26.31 ? 345 ASN A O   1 
ATOM   2482 C  CB  . ASN A 1 302 ? -37.219 5.239   31.809  1.00 26.94 ? 345 ASN A CB  1 
ATOM   2483 C  CG  . ASN A 1 302 ? -37.847 3.893   32.044  1.00 29.38 ? 345 ASN A CG  1 
ATOM   2484 O  OD1 . ASN A 1 302 ? -38.668 3.449   31.245  1.00 32.25 ? 345 ASN A OD1 1 
ATOM   2485 N  ND2 . ASN A 1 302 ? -37.444 3.208   33.130  1.00 30.70 ? 345 ASN A ND2 1 
ATOM   2486 N  N   . LEU A 1 303 ? -34.886 6.792   29.454  1.00 26.30 ? 346 LEU A N   1 
ATOM   2487 C  CA  . LEU A 1 303 ? -34.217 8.075   29.213  1.00 26.50 ? 346 LEU A CA  1 
ATOM   2488 C  C   . LEU A 1 303 ? -35.149 9.309   29.145  1.00 26.37 ? 346 LEU A C   1 
ATOM   2489 O  O   . LEU A 1 303 ? -34.726 10.413  29.501  1.00 26.71 ? 346 LEU A O   1 
ATOM   2490 C  CB  . LEU A 1 303 ? -33.263 7.984   28.007  1.00 26.32 ? 346 LEU A CB  1 
ATOM   2491 C  CG  . LEU A 1 303 ? -32.078 7.015   28.224  1.00 26.50 ? 346 LEU A CG  1 
ATOM   2492 C  CD1 . LEU A 1 303 ? -31.353 6.681   26.922  1.00 25.51 ? 346 LEU A CD1 1 
ATOM   2493 C  CD2 . LEU A 1 303 ? -31.068 7.521   29.292  1.00 24.87 ? 346 LEU A CD2 1 
ATOM   2494 N  N   . LYS A 1 304 ? -36.405 9.117   28.724  1.00 26.33 ? 347 LYS A N   1 
ATOM   2495 C  CA  . LYS A 1 304 ? -37.399 10.204  28.649  1.00 26.33 ? 347 LYS A CA  1 
ATOM   2496 C  C   . LYS A 1 304 ? -37.711 10.713  30.034  1.00 25.52 ? 347 LYS A C   1 
ATOM   2497 O  O   . LYS A 1 304 ? -37.736 11.932  30.281  1.00 25.29 ? 347 LYS A O   1 
ATOM   2498 C  CB  . LYS A 1 304 ? -38.699 9.746   27.971  1.00 26.83 ? 347 LYS A CB  1 
ATOM   2499 C  CG  . LYS A 1 304 ? -38.847 10.085  26.478  1.00 29.85 ? 347 LYS A CG  1 
ATOM   2500 C  CD  . LYS A 1 304 ? -37.740 9.477   25.607  1.00 34.84 ? 347 LYS A CD  1 
ATOM   2501 C  CE  . LYS A 1 304 ? -38.231 9.176   24.181  1.00 37.70 ? 347 LYS A CE  1 
ATOM   2502 N  NZ  . LYS A 1 304 ? -39.071 7.931   24.132  1.00 39.65 ? 347 LYS A NZ  1 
ATOM   2503 N  N   . VAL A 1 305 ? -37.934 9.752   30.928  1.00 24.91 ? 348 VAL A N   1 
ATOM   2504 C  CA  . VAL A 1 305 ? -38.169 10.007  32.337  1.00 24.24 ? 348 VAL A CA  1 
ATOM   2505 C  C   . VAL A 1 305 ? -36.955 10.695  32.953  1.00 24.05 ? 348 VAL A C   1 
ATOM   2506 O  O   . VAL A 1 305 ? -37.115 11.666  33.710  1.00 24.56 ? 348 VAL A O   1 
ATOM   2507 C  CB  . VAL A 1 305 ? -38.537 8.711   33.103  1.00 24.46 ? 348 VAL A CB  1 
ATOM   2508 C  CG1 . VAL A 1 305 ? -38.713 8.986   34.597  1.00 24.10 ? 348 VAL A CG1 1 
ATOM   2509 C  CG2 . VAL A 1 305 ? -39.818 8.091   32.527  1.00 24.02 ? 348 VAL A CG2 1 
ATOM   2510 N  N   . GLN A 1 306 ? -35.752 10.232  32.620  1.00 23.27 ? 349 GLN A N   1 
ATOM   2511 C  CA  . GLN A 1 306 ? -34.560 10.932  33.069  1.00 23.37 ? 349 GLN A CA  1 
ATOM   2512 C  C   . GLN A 1 306 ? -34.534 12.395  32.590  1.00 24.03 ? 349 GLN A C   1 
ATOM   2513 O  O   . GLN A 1 306 ? -34.277 13.305  33.391  1.00 24.38 ? 349 GLN A O   1 
ATOM   2514 C  CB  . GLN A 1 306 ? -33.272 10.200  32.683  1.00 22.99 ? 349 GLN A CB  1 
ATOM   2515 C  CG  . GLN A 1 306 ? -32.029 10.863  33.272  1.00 21.06 ? 349 GLN A CG  1 
ATOM   2516 C  CD  . GLN A 1 306 ? -30.744 10.172  32.890  1.00 19.72 ? 349 GLN A CD  1 
ATOM   2517 O  OE1 . GLN A 1 306 ? -30.742 9.022   32.451  1.00 20.72 ? 349 GLN A OE1 1 
ATOM   2518 N  NE2 . GLN A 1 306 ? -29.634 10.866  33.067  1.00 17.29 ? 349 GLN A NE2 1 
ATOM   2519 N  N   . ASP A 1 307 ? -34.816 12.626  31.306  1.00 24.51 ? 350 ASP A N   1 
ATOM   2520 C  CA  . ASP A 1 307 ? -34.883 14.005  30.773  1.00 24.95 ? 350 ASP A CA  1 
ATOM   2521 C  C   . ASP A 1 307 ? -35.868 14.895  31.560  1.00 24.93 ? 350 ASP A C   1 
ATOM   2522 O  O   . ASP A 1 307 ? -35.546 16.038  31.893  1.00 24.54 ? 350 ASP A O   1 
ATOM   2523 C  CB  . ASP A 1 307 ? -35.237 14.017  29.275  1.00 24.97 ? 350 ASP A CB  1 
ATOM   2524 C  CG  . ASP A 1 307 ? -34.075 13.580  28.369  1.00 25.74 ? 350 ASP A CG  1 
ATOM   2525 O  OD1 . ASP A 1 307 ? -32.908 13.928  28.650  1.00 25.63 ? 350 ASP A OD1 1 
ATOM   2526 O  OD2 . ASP A 1 307 ? -34.341 12.900  27.345  1.00 26.25 ? 350 ASP A OD2 1 
ATOM   2527 N  N   . MET A 1 308 ? -37.059 14.366  31.852  1.00 25.45 ? 351 MET A N   1 
ATOM   2528 C  CA  . MET A 1 308 ? -38.094 15.116  32.588  1.00 25.97 ? 351 MET A CA  1 
ATOM   2529 C  C   . MET A 1 308 ? -37.613 15.504  33.979  1.00 25.38 ? 351 MET A C   1 
ATOM   2530 O  O   . MET A 1 308 ? -37.842 16.629  34.422  1.00 25.43 ? 351 MET A O   1 
ATOM   2531 C  CB  . MET A 1 308 ? -39.381 14.301  32.733  1.00 26.55 ? 351 MET A CB  1 
ATOM   2532 C  CG  . MET A 1 308 ? -40.350 14.352  31.559  1.00 29.83 ? 351 MET A CG  1 
ATOM   2533 S  SD  . MET A 1 308 ? -41.617 13.031  31.676  1.00 38.47 ? 351 MET A SD  1 
ATOM   2534 C  CE  . MET A 1 308 ? -42.467 13.423  33.216  1.00 34.21 ? 351 MET A CE  1 
ATOM   2535 N  N   . LEU A 1 309 ? -36.941 14.569  34.657  1.00 24.66 ? 352 LEU A N   1 
ATOM   2536 C  CA  . LEU A 1 309 ? -36.462 14.792  36.013  1.00 23.85 ? 352 LEU A CA  1 
ATOM   2537 C  C   . LEU A 1 309 ? -35.359 15.844  36.061  1.00 23.79 ? 352 LEU A C   1 
ATOM   2538 O  O   . LEU A 1 309 ? -35.375 16.719  36.942  1.00 23.30 ? 352 LEU A O   1 
ATOM   2539 C  CB  . LEU A 1 309 ? -36.012 13.474  36.664  1.00 23.80 ? 352 LEU A CB  1 
ATOM   2540 C  CG  . LEU A 1 309 ? -37.146 12.489  37.017  1.00 23.41 ? 352 LEU A CG  1 
ATOM   2541 C  CD1 . LEU A 1 309 ? -36.596 11.122  37.413  1.00 23.26 ? 352 LEU A CD1 1 
ATOM   2542 C  CD2 . LEU A 1 309 ? -38.075 13.025  38.090  1.00 21.01 ? 352 LEU A CD2 1 
ATOM   2543 N  N   . ARG A 1 310 ? -34.421 15.769  35.112  1.00 23.56 ? 353 ARG A N   1 
ATOM   2544 C  CA  . ARG A 1 310 ? -33.405 16.811  34.963  1.00 24.02 ? 353 ARG A CA  1 
ATOM   2545 C  C   . ARG A 1 310 ? -34.039 18.207  34.795  1.00 24.60 ? 353 ARG A C   1 
ATOM   2546 O  O   . ARG A 1 310 ? -33.682 19.145  35.516  1.00 24.81 ? 353 ARG A O   1 
ATOM   2547 C  CB  . ARG A 1 310 ? -32.460 16.499  33.798  1.00 23.55 ? 353 ARG A CB  1 
ATOM   2548 C  CG  . ARG A 1 310 ? -31.312 17.498  33.640  1.00 22.30 ? 353 ARG A CG  1 
ATOM   2549 C  CD  . ARG A 1 310 ? -30.177 16.925  32.791  1.00 21.41 ? 353 ARG A CD  1 
ATOM   2550 N  NE  . ARG A 1 310 ? -29.582 15.778  33.469  1.00 22.59 ? 353 ARG A NE  1 
ATOM   2551 C  CZ  . ARG A 1 310 ? -29.669 14.506  33.077  1.00 23.40 ? 353 ARG A CZ  1 
ATOM   2552 N  NH1 . ARG A 1 310 ? -30.301 14.150  31.953  1.00 22.70 ? 353 ARG A NH1 1 
ATOM   2553 N  NH2 . ARG A 1 310 ? -29.098 13.575  33.825  1.00 24.30 ? 353 ARG A NH2 1 
ATOM   2554 N  N   . ALA A 1 311 ? -34.983 18.324  33.859  1.00 25.14 ? 354 ALA A N   1 
ATOM   2555 C  CA  . ALA A 1 311 ? -35.656 19.595  33.561  1.00 25.93 ? 354 ALA A CA  1 
ATOM   2556 C  C   . ALA A 1 311 ? -36.339 20.153  34.809  1.00 26.65 ? 354 ALA A C   1 
ATOM   2557 O  O   . ALA A 1 311 ? -36.278 21.364  35.074  1.00 26.68 ? 354 ALA A O   1 
ATOM   2558 C  CB  . ALA A 1 311 ? -36.660 19.428  32.411  1.00 25.32 ? 354 ALA A CB  1 
ATOM   2559 N  N   . GLU A 1 312 ? -36.952 19.268  35.595  1.00 27.34 ? 355 GLU A N   1 
ATOM   2560 C  CA  . GLU A 1 312 ? -37.584 19.698  36.840  1.00 28.34 ? 355 GLU A CA  1 
ATOM   2561 C  C   . GLU A 1 312 ? -36.565 20.293  37.809  1.00 28.35 ? 355 GLU A C   1 
ATOM   2562 O  O   . GLU A 1 312 ? -36.817 21.334  38.413  1.00 28.53 ? 355 GLU A O   1 
ATOM   2563 C  CB  . GLU A 1 312 ? -38.370 18.569  37.513  1.00 28.30 ? 355 GLU A CB  1 
ATOM   2564 C  CG  . GLU A 1 312 ? -39.294 19.096  38.610  1.00 30.65 ? 355 GLU A CG  1 
ATOM   2565 C  CD  . GLU A 1 312 ? -39.982 18.005  39.421  1.00 34.00 ? 355 GLU A CD  1 
ATOM   2566 O  OE1 . GLU A 1 312 ? -39.280 17.135  39.975  1.00 36.12 ? 355 GLU A OE1 1 
ATOM   2567 O  OE2 . GLU A 1 312 ? -41.227 18.033  39.530  1.00 35.06 ? 355 GLU A OE2 1 
ATOM   2568 N  N   . VAL A 1 313 ? -35.412 19.640  37.930  1.00 28.46 ? 356 VAL A N   1 
ATOM   2569 C  CA  . VAL A 1 313 ? -34.374 20.045  38.883  1.00 28.36 ? 356 VAL A CA  1 
ATOM   2570 C  C   . VAL A 1 313 ? -33.654 21.324  38.456  1.00 28.70 ? 356 VAL A C   1 
ATOM   2571 O  O   . VAL A 1 313 ? -33.375 22.176  39.300  1.00 28.47 ? 356 VAL A O   1 
ATOM   2572 C  CB  . VAL A 1 313 ? -33.367 18.899  39.126  1.00 28.27 ? 356 VAL A CB  1 
ATOM   2573 C  CG1 . VAL A 1 313 ? -32.039 19.425  39.654  1.00 27.93 ? 356 VAL A CG1 1 
ATOM   2574 C  CG2 . VAL A 1 313 ? -33.964 17.880  40.072  1.00 27.23 ? 356 VAL A CG2 1 
ATOM   2575 N  N   . LEU A 1 314 ? -33.361 21.457  37.159  1.00 29.06 ? 357 LEU A N   1 
ATOM   2576 C  CA  . LEU A 1 314 ? -32.819 22.708  36.612  1.00 29.64 ? 357 LEU A CA  1 
ATOM   2577 C  C   . LEU A 1 314 ? -33.776 23.876  36.839  1.00 30.04 ? 357 LEU A C   1 
ATOM   2578 O  O   . LEU A 1 314 ? -33.347 24.958  37.255  1.00 30.23 ? 357 LEU A O   1 
ATOM   2579 C  CB  . LEU A 1 314 ? -32.456 22.573  35.128  1.00 29.63 ? 357 LEU A CB  1 
ATOM   2580 C  CG  . LEU A 1 314 ? -31.296 21.621  34.762  1.00 30.88 ? 357 LEU A CG  1 
ATOM   2581 C  CD1 . LEU A 1 314 ? -31.186 21.472  33.259  1.00 31.54 ? 357 LEU A CD1 1 
ATOM   2582 C  CD2 . LEU A 1 314 ? -29.940 22.045  35.341  1.00 29.67 ? 357 LEU A CD2 1 
ATOM   2583 N  N   . ALA A 1 315 ? -35.070 23.651  36.597  1.00 30.43 ? 358 ALA A N   1 
ATOM   2584 C  CA  . ALA A 1 315 ? -36.082 24.679  36.840  1.00 30.78 ? 358 ALA A CA  1 
ATOM   2585 C  C   . ALA A 1 315 ? -36.101 25.036  38.305  1.00 31.19 ? 358 ALA A C   1 
ATOM   2586 O  O   . ALA A 1 315 ? -36.163 26.218  38.661  1.00 31.65 ? 358 ALA A O   1 
ATOM   2587 C  CB  . ALA A 1 315 ? -37.468 24.218  36.389  1.00 30.60 ? 358 ALA A CB  1 
ATOM   2588 N  N   . ALA A 1 316 ? -36.018 24.008  39.150  1.00 31.58 ? 359 ALA A N   1 
ATOM   2589 C  CA  . ALA A 1 316 ? -36.125 24.181  40.592  1.00 32.13 ? 359 ALA A CA  1 
ATOM   2590 C  C   . ALA A 1 316 ? -34.917 24.902  41.178  1.00 32.69 ? 359 ALA A C   1 
ATOM   2591 O  O   . ALA A 1 316 ? -35.058 25.683  42.113  1.00 32.91 ? 359 ALA A O   1 
ATOM   2592 C  CB  . ALA A 1 316 ? -36.341 22.843  41.280  1.00 31.89 ? 359 ALA A CB  1 
ATOM   2593 N  N   . ARG A 1 317 ? -33.734 24.648  40.629  1.00 33.53 ? 360 ARG A N   1 
ATOM   2594 C  CA  . ARG A 1 317 ? -32.540 25.335  41.096  1.00 34.36 ? 360 ARG A CA  1 
ATOM   2595 C  C   . ARG A 1 317 ? -32.600 26.820  40.723  1.00 35.06 ? 360 ARG A C   1 
ATOM   2596 O  O   . ARG A 1 317 ? -32.207 27.677  41.522  1.00 35.19 ? 360 ARG A O   1 
ATOM   2597 C  CB  . ARG A 1 317 ? -31.258 24.674  40.567  1.00 33.97 ? 360 ARG A CB  1 
ATOM   2598 C  CG  . ARG A 1 317 ? -29.969 25.296  41.114  1.00 33.64 ? 360 ARG A CG  1 
ATOM   2599 C  CD  . ARG A 1 317 ? -29.750 24.987  42.598  1.00 34.43 ? 360 ARG A CD  1 
ATOM   2600 N  NE  . ARG A 1 317 ? -29.108 23.684  42.766  1.00 35.18 ? 360 ARG A NE  1 
ATOM   2601 C  CZ  . ARG A 1 317 ? -28.590 23.220  43.899  1.00 35.21 ? 360 ARG A CZ  1 
ATOM   2602 N  NH1 . ARG A 1 317 ? -28.642 23.940  45.009  1.00 35.09 ? 360 ARG A NH1 1 
ATOM   2603 N  NH2 . ARG A 1 317 ? -28.017 22.022  43.917  1.00 35.30 ? 360 ARG A NH2 1 
ATOM   2604 N  N   . HIS A 1 318 ? -33.094 27.115  39.520  1.00 35.76 ? 361 HIS A N   1 
ATOM   2605 C  CA  . HIS A 1 318 ? -33.259 28.496  39.078  1.00 36.48 ? 361 HIS A CA  1 
ATOM   2606 C  C   . HIS A 1 318 ? -34.323 29.220  39.906  1.00 36.41 ? 361 HIS A C   1 
ATOM   2607 O  O   . HIS A 1 318 ? -34.043 30.250  40.520  1.00 35.99 ? 361 HIS A O   1 
ATOM   2608 C  CB  . HIS A 1 318 ? -33.574 28.568  37.579  1.00 36.93 ? 361 HIS A CB  1 
ATOM   2609 C  CG  . HIS A 1 318 ? -33.991 29.936  37.118  1.00 38.58 ? 361 HIS A CG  1 
ATOM   2610 N  ND1 . HIS A 1 318 ? -33.124 31.009  37.084  1.00 40.06 ? 361 HIS A ND1 1 
ATOM   2611 C  CD2 . HIS A 1 318 ? -35.187 30.406  36.685  1.00 39.46 ? 361 HIS A CD2 1 
ATOM   2612 C  CE1 . HIS A 1 318 ? -33.766 32.079  36.649  1.00 40.08 ? 361 HIS A CE1 1 
ATOM   2613 N  NE2 . HIS A 1 318 ? -35.019 31.739  36.398  1.00 40.76 ? 361 HIS A NE2 1 
ATOM   2614 N  N   . GLN A 1 319 ? -35.530 28.660  39.938  1.00 36.87 ? 362 GLN A N   1 
ATOM   2615 C  CA  . GLN A 1 319 ? -36.646 29.237  40.694  1.00 37.48 ? 362 GLN A CA  1 
ATOM   2616 C  C   . GLN A 1 319 ? -36.309 29.493  42.169  1.00 37.59 ? 362 GLN A C   1 
ATOM   2617 O  O   . GLN A 1 319 ? -36.780 30.458  42.758  1.00 37.75 ? 362 GLN A O   1 
ATOM   2618 C  CB  . GLN A 1 319 ? -37.878 28.335  40.580  1.00 37.62 ? 362 GLN A CB  1 
ATOM   2619 C  CG  . GLN A 1 319 ? -39.206 29.013  40.898  1.00 39.90 ? 362 GLN A CG  1 
ATOM   2620 C  CD  . GLN A 1 319 ? -39.568 30.106  39.884  1.00 42.91 ? 362 GLN A CD  1 
ATOM   2621 O  OE1 . GLN A 1 319 ? -39.718 29.839  38.681  1.00 43.78 ? 362 GLN A OE1 1 
ATOM   2622 N  NE2 . GLN A 1 319 ? -39.708 31.342  40.371  1.00 41.83 ? 362 GLN A NE2 1 
ATOM   2623 N  N   . ALA A 1 320 ? -35.488 28.628  42.761  1.00 38.01 ? 363 ALA A N   1 
ATOM   2624 C  CA  . ALA A 1 320 ? -35.139 28.735  44.175  1.00 38.14 ? 363 ALA A CA  1 
ATOM   2625 C  C   . ALA A 1 320 ? -33.925 29.626  44.381  1.00 38.49 ? 363 ALA A C   1 
ATOM   2626 O  O   . ALA A 1 320 ? -33.433 29.764  45.511  1.00 38.66 ? 363 ALA A O   1 
ATOM   2627 C  CB  . ALA A 1 320 ? -34.876 27.360  44.748  1.00 38.12 ? 363 ALA A CB  1 
ATOM   2628 N  N   . GLN A 1 321 ? -33.447 30.228  43.290  1.00 38.58 ? 364 GLN A N   1 
ATOM   2629 C  CA  . GLN A 1 321 ? -32.198 30.985  43.296  1.00 38.85 ? 364 GLN A CA  1 
ATOM   2630 C  C   . GLN A 1 321 ? -31.180 30.298  44.182  1.00 38.26 ? 364 GLN A C   1 
ATOM   2631 O  O   . GLN A 1 321 ? -30.713 30.896  45.143  1.00 38.34 ? 364 GLN A O   1 
ATOM   2632 C  CB  . GLN A 1 321 ? -32.419 32.414  43.800  1.00 39.12 ? 364 GLN A CB  1 
ATOM   2633 C  CG  . GLN A 1 321 ? -33.141 33.347  42.830  1.00 41.55 ? 364 GLN A CG  1 
ATOM   2634 C  CD  . GLN A 1 321 ? -33.405 34.717  43.449  1.00 44.17 ? 364 GLN A CD  1 
ATOM   2635 O  OE1 . GLN A 1 321 ? -32.804 35.722  43.052  1.00 44.57 ? 364 GLN A OE1 1 
ATOM   2636 N  NE2 . GLN A 1 321 ? -34.292 34.755  44.445  1.00 44.11 ? 364 GLN A NE2 1 
ATOM   2637 N  N   . GLY A 1 322 ? -30.888 29.031  43.890  1.00 37.90 ? 365 GLY A N   1 
ATOM   2638 C  CA  . GLY A 1 322 ? -29.818 28.289  44.558  1.00 37.33 ? 365 GLY A CA  1 
ATOM   2639 C  C   . GLY A 1 322 ? -30.078 27.660  45.927  1.00 37.13 ? 365 GLY A C   1 
ATOM   2640 O  O   . GLY A 1 322 ? -29.365 26.736  46.301  1.00 37.29 ? 365 GLY A O   1 
ATOM   2641 N  N   . ASP A 1 323 ? -31.067 28.151  46.683  1.00 36.69 ? 366 ASP A N   1 
ATOM   2642 C  CA  . ASP A 1 323 ? -31.341 27.641  48.049  1.00 36.31 ? 366 ASP A CA  1 
ATOM   2643 C  C   . ASP A 1 323 ? -31.905 26.199  48.063  1.00 35.51 ? 366 ASP A C   1 
ATOM   2644 O  O   . ASP A 1 323 ? -32.932 25.926  47.442  1.00 35.24 ? 366 ASP A O   1 
ATOM   2645 C  CB  . ASP A 1 323 ? -32.267 28.612  48.814  1.00 36.45 ? 366 ASP A CB  1 
ATOM   2646 C  CG  . ASP A 1 323 ? -32.729 28.060  50.173  1.00 37.80 ? 366 ASP A CG  1 
ATOM   2647 O  OD1 . ASP A 1 323 ? -31.880 27.842  51.061  1.00 39.69 ? 366 ASP A OD1 1 
ATOM   2648 O  OD2 . ASP A 1 323 ? -33.948 27.859  50.367  1.00 37.95 ? 366 ASP A OD2 1 
ATOM   2649 N  N   . MET A 1 324 ? -31.228 25.288  48.773  1.00 34.85 ? 367 MET A N   1 
ATOM   2650 C  CA  . MET A 1 324 ? -31.642 23.872  48.823  1.00 33.69 ? 367 MET A CA  1 
ATOM   2651 C  C   . MET A 1 324 ? -32.991 23.659  49.496  1.00 33.28 ? 367 MET A C   1 
ATOM   2652 O  O   . MET A 1 324 ? -33.817 22.910  48.981  1.00 33.45 ? 367 MET A O   1 
ATOM   2653 C  CB  . MET A 1 324 ? -30.584 22.977  49.478  1.00 33.54 ? 367 MET A CB  1 
ATOM   2654 C  CG  . MET A 1 324 ? -30.936 21.459  49.479  1.00 32.51 ? 367 MET A CG  1 
ATOM   2655 S  SD  . MET A 1 324 ? -31.188 20.723  47.825  1.00 31.01 ? 367 MET A SD  1 
ATOM   2656 C  CE  . MET A 1 324 ? -29.508 20.753  47.190  1.00 30.50 ? 367 MET A CE  1 
ATOM   2657 N  N   . ALA A 1 325 ? -33.216 24.317  50.628  1.00 32.86 ? 368 ALA A N   1 
ATOM   2658 C  CA  . ALA A 1 325 ? -34.488 24.209  51.347  1.00 32.84 ? 368 ALA A CA  1 
ATOM   2659 C  C   . ALA A 1 325 ? -35.683 24.498  50.432  1.00 32.79 ? 368 ALA A C   1 
ATOM   2660 O  O   . ALA A 1 325 ? -36.665 23.749  50.419  1.00 32.47 ? 368 ALA A O   1 
ATOM   2661 C  CB  . ALA A 1 325 ? -34.494 25.129  52.568  1.00 32.77 ? 368 ALA A CB  1 
ATOM   2662 N  N   . THR A 1 326 ? -35.558 25.572  49.647  1.00 32.80 ? 369 THR A N   1 
ATOM   2663 C  CA  . THR A 1 326 ? -36.562 25.980  48.662  1.00 32.75 ? 369 THR A CA  1 
ATOM   2664 C  C   . THR A 1 326 ? -36.722 24.992  47.497  1.00 32.15 ? 369 THR A C   1 
ATOM   2665 O  O   . THR A 1 326 ? -37.840 24.652  47.135  1.00 32.22 ? 369 THR A O   1 
ATOM   2666 C  CB  . THR A 1 326 ? -36.269 27.418  48.137  1.00 32.93 ? 369 THR A CB  1 
ATOM   2667 O  OG1 . THR A 1 326 ? -36.137 28.304  49.258  1.00 33.78 ? 369 THR A OG1 1 
ATOM   2668 C  CG2 . THR A 1 326 ? -37.394 27.923  47.220  1.00 32.04 ? 369 THR A CG2 1 
ATOM   2669 N  N   . MET A 1 327 ? -35.610 24.551  46.923  1.00 31.90 ? 370 MET A N   1 
ATOM   2670 C  CA  . MET A 1 327 ? -35.604 23.542  45.861  1.00 32.20 ? 370 MET A CA  1 
ATOM   2671 C  C   . MET A 1 327 ? -36.472 22.335  46.188  1.00 31.84 ? 370 MET A C   1 
ATOM   2672 O  O   . MET A 1 327 ? -37.247 21.881  45.354  1.00 31.52 ? 370 MET A O   1 
ATOM   2673 C  CB  . MET A 1 327 ? -34.186 23.021  45.630  1.00 32.55 ? 370 MET A CB  1 
ATOM   2674 C  CG  . MET A 1 327 ? -33.359 23.812  44.660  1.00 34.10 ? 370 MET A CG  1 
ATOM   2675 S  SD  . MET A 1 327 ? -32.037 22.769  44.038  1.00 38.14 ? 370 MET A SD  1 
ATOM   2676 C  CE  . MET A 1 327 ? -32.929 21.777  42.836  1.00 35.86 ? 370 MET A CE  1 
ATOM   2677 N  N   . LEU A 1 328 ? -36.320 21.825  47.410  1.00 31.59 ? 371 LEU A N   1 
ATOM   2678 C  CA  . LEU A 1 328 ? -36.955 20.588  47.846  1.00 31.26 ? 371 LEU A CA  1 
ATOM   2679 C  C   . LEU A 1 328 ? -38.472 20.673  47.866  1.00 31.63 ? 371 LEU A C   1 
ATOM   2680 O  O   . LEU A 1 328 ? -39.151 19.651  47.990  1.00 31.87 ? 371 LEU A O   1 
ATOM   2681 C  CB  . LEU A 1 328 ? -36.441 20.187  49.230  1.00 30.90 ? 371 LEU A CB  1 
ATOM   2682 C  CG  . LEU A 1 328 ? -34.984 19.719  49.299  1.00 30.78 ? 371 LEU A CG  1 
ATOM   2683 C  CD1 . LEU A 1 328 ? -34.519 19.665  50.733  1.00 28.91 ? 371 LEU A CD1 1 
ATOM   2684 C  CD2 . LEU A 1 328 ? -34.780 18.372  48.594  1.00 29.61 ? 371 LEU A CD2 1 
ATOM   2685 N  N   . GLN A 1 329 ? -39.004 21.891  47.760  1.00 31.69 ? 372 GLN A N   1 
ATOM   2686 C  CA  . GLN A 1 329 ? -40.446 22.088  47.689  1.00 31.45 ? 372 GLN A CA  1 
ATOM   2687 C  C   . GLN A 1 329 ? -40.877 22.266  46.239  1.00 30.62 ? 372 GLN A C   1 
ATOM   2688 O  O   . GLN A 1 329 ? -42.051 22.496  45.960  1.00 30.94 ? 372 GLN A O   1 
ATOM   2689 C  CB  . GLN A 1 329 ? -40.884 23.275  48.557  1.00 31.93 ? 372 GLN A CB  1 
ATOM   2690 C  CG  . GLN A 1 329 ? -40.756 23.040  50.072  1.00 34.54 ? 372 GLN A CG  1 
ATOM   2691 C  CD  . GLN A 1 329 ? -41.626 21.882  50.583  1.00 39.38 ? 372 GLN A CD  1 
ATOM   2692 O  OE1 . GLN A 1 329 ? -41.116 20.798  50.895  1.00 41.08 ? 372 GLN A OE1 1 
ATOM   2693 N  NE2 . GLN A 1 329 ? -42.944 22.109  50.670  1.00 40.88 ? 372 GLN A NE2 1 
ATOM   2694 N  N   . LEU A 1 330 ? -39.926 22.123  45.320  1.00 29.50 ? 373 LEU A N   1 
ATOM   2695 C  CA  . LEU A 1 330 ? -40.154 22.411  43.912  1.00 28.71 ? 373 LEU A CA  1 
ATOM   2696 C  C   . LEU A 1 330 ? -39.824 21.244  42.984  1.00 28.48 ? 373 LEU A C   1 
ATOM   2697 O  O   . LEU A 1 330 ? -39.727 21.425  41.768  1.00 28.15 ? 373 LEU A O   1 
ATOM   2698 C  CB  . LEU A 1 330 ? -39.340 23.645  43.505  1.00 28.85 ? 373 LEU A CB  1 
ATOM   2699 C  CG  . LEU A 1 330 ? -39.800 25.000  44.051  1.00 28.48 ? 373 LEU A CG  1 
ATOM   2700 C  CD1 . LEU A 1 330 ? -38.704 26.034  43.912  1.00 27.95 ? 373 LEU A CD1 1 
ATOM   2701 C  CD2 . LEU A 1 330 ? -41.044 25.439  43.317  1.00 27.34 ? 373 LEU A CD2 1 
ATOM   2702 N  N   . VAL A 1 331 ? -39.658 20.049  43.548  1.00 28.12 ? 374 VAL A N   1 
ATOM   2703 C  CA  . VAL A 1 331 ? -39.335 18.862  42.749  1.00 27.78 ? 374 VAL A CA  1 
ATOM   2704 C  C   . VAL A 1 331 ? -40.339 17.709  42.944  1.00 27.96 ? 374 VAL A C   1 
ATOM   2705 O  O   . VAL A 1 331 ? -39.937 16.593  43.312  1.00 28.56 ? 374 VAL A O   1 
ATOM   2706 C  CB  . VAL A 1 331 ? -37.861 18.368  42.975  1.00 27.81 ? 374 VAL A CB  1 
ATOM   2707 C  CG1 . VAL A 1 331 ? -36.872 19.246  42.222  1.00 27.13 ? 374 VAL A CG1 1 
ATOM   2708 C  CG2 . VAL A 1 331 ? -37.501 18.272  44.467  1.00 27.26 ? 374 VAL A CG2 1 
ATOM   2709 N  N   . PRO A 1 332 ? -41.653 17.963  42.698  1.00 27.54 ? 375 PRO A N   1 
ATOM   2710 C  CA  . PRO A 1 332 ? -42.648 16.912  42.973  1.00 26.59 ? 375 PRO A CA  1 
ATOM   2711 C  C   . PRO A 1 332 ? -42.462 15.632  42.145  1.00 26.05 ? 375 PRO A C   1 
ATOM   2712 O  O   . PRO A 1 332 ? -42.762 14.542  42.639  1.00 25.62 ? 375 PRO A O   1 
ATOM   2713 C  CB  . PRO A 1 332 ? -43.988 17.594  42.639  1.00 26.46 ? 375 PRO A CB  1 
ATOM   2714 C  CG  . PRO A 1 332 ? -43.630 18.743  41.742  1.00 26.72 ? 375 PRO A CG  1 
ATOM   2715 C  CD  . PRO A 1 332 ? -42.304 19.212  42.245  1.00 27.36 ? 375 PRO A CD  1 
ATOM   2716 N  N   . LEU A 1 333 ? -41.994 15.766  40.902  1.00 25.36 ? 376 LEU A N   1 
ATOM   2717 C  CA  . LEU A 1 333 ? -41.695 14.593  40.075  1.00 24.86 ? 376 LEU A CA  1 
ATOM   2718 C  C   . LEU A 1 333 ? -40.480 13.795  40.590  1.00 24.33 ? 376 LEU A C   1 
ATOM   2719 O  O   . LEU A 1 333 ? -40.463 12.569  40.493  1.00 24.30 ? 376 LEU A O   1 
ATOM   2720 C  CB  . LEU A 1 333 ? -41.514 14.971  38.601  1.00 24.61 ? 376 LEU A CB  1 
ATOM   2721 C  CG  . LEU A 1 333 ? -41.716 13.836  37.583  1.00 25.41 ? 376 LEU A CG  1 
ATOM   2722 C  CD1 . LEU A 1 333 ? -43.194 13.394  37.451  1.00 25.85 ? 376 LEU A CD1 1 
ATOM   2723 C  CD2 . LEU A 1 333 ? -41.139 14.180  36.206  1.00 24.22 ? 376 LEU A CD2 1 
ATOM   2724 N  N   . LEU A 1 334 ? -39.477 14.482  41.140  1.00 23.48 ? 377 LEU A N   1 
ATOM   2725 C  CA  . LEU A 1 334 ? -38.336 13.793  41.727  1.00 23.06 ? 377 LEU A CA  1 
ATOM   2726 C  C   . LEU A 1 334 ? -38.761 12.947  42.928  1.00 23.12 ? 377 LEU A C   1 
ATOM   2727 O  O   . LEU A 1 334 ? -38.388 11.768  43.027  1.00 22.81 ? 377 LEU A O   1 
ATOM   2728 C  CB  . LEU A 1 334 ? -37.230 14.767  42.137  1.00 23.18 ? 377 LEU A CB  1 
ATOM   2729 C  CG  . LEU A 1 334 ? -35.858 14.145  42.447  1.00 21.93 ? 377 LEU A CG  1 
ATOM   2730 C  CD1 . LEU A 1 334 ? -35.342 13.281  41.274  1.00 20.32 ? 377 LEU A CD1 1 
ATOM   2731 C  CD2 . LEU A 1 334 ? -34.864 15.226  42.809  1.00 19.50 ? 377 LEU A CD2 1 
ATOM   2732 N  N   . LYS A 1 335 ? -39.555 13.543  43.818  1.00 22.68 ? 378 LYS A N   1 
ATOM   2733 C  CA  . LYS A 1 335 ? -40.039 12.844  44.996  1.00 22.74 ? 378 LYS A CA  1 
ATOM   2734 C  C   . LYS A 1 335 ? -40.912 11.641  44.636  1.00 22.66 ? 378 LYS A C   1 
ATOM   2735 O  O   . LYS A 1 335 ? -40.811 10.576  45.262  1.00 23.12 ? 378 LYS A O   1 
ATOM   2736 C  CB  . LYS A 1 335 ? -40.787 13.794  45.918  1.00 22.93 ? 378 LYS A CB  1 
ATOM   2737 C  CG  . LYS A 1 335 ? -39.907 14.811  46.609  1.00 23.23 ? 378 LYS A CG  1 
ATOM   2738 C  CD  . LYS A 1 335 ? -40.726 15.485  47.674  1.00 24.96 ? 378 LYS A CD  1 
ATOM   2739 C  CE  . LYS A 1 335 ? -40.132 16.783  48.127  1.00 25.68 ? 378 LYS A CE  1 
ATOM   2740 N  NZ  . LYS A 1 335 ? -39.216 16.587  49.258  1.00 28.51 ? 378 LYS A NZ  1 
ATOM   2741 N  N   . ALA A 1 336 ? -41.746 11.808  43.618  1.00 21.96 ? 379 ALA A N   1 
ATOM   2742 C  CA  . ALA A 1 336 ? -42.566 10.723  43.101  1.00 21.32 ? 379 ALA A CA  1 
ATOM   2743 C  C   . ALA A 1 336 ? -41.712 9.612   42.502  1.00 20.79 ? 379 ALA A C   1 
ATOM   2744 O  O   . ALA A 1 336 ? -42.110 8.461   42.499  1.00 20.97 ? 379 ALA A O   1 
ATOM   2745 C  CB  . ALA A 1 336 ? -43.572 11.253  42.055  1.00 20.66 ? 379 ALA A CB  1 
ATOM   2746 N  N   . SER A 1 337 ? -40.547 9.957   41.977  1.00 20.64 ? 380 SER A N   1 
ATOM   2747 C  CA  . SER A 1 337 ? -39.721 8.963   41.309  1.00 20.54 ? 380 SER A CA  1 
ATOM   2748 C  C   . SER A 1 337 ? -39.045 8.067   42.360  1.00 20.49 ? 380 SER A C   1 
ATOM   2749 O  O   . SER A 1 337 ? -38.740 6.898   42.104  1.00 20.14 ? 380 SER A O   1 
ATOM   2750 C  CB  . SER A 1 337 ? -38.691 9.642   40.406  1.00 20.49 ? 380 SER A CB  1 
ATOM   2751 O  OG  . SER A 1 337 ? -37.770 10.397  41.169  1.00 20.33 ? 380 SER A OG  1 
ATOM   2752 N  N   . ILE A 1 338 ? -38.833 8.631   43.548  1.00 20.24 ? 381 ILE A N   1 
ATOM   2753 C  CA  . ILE A 1 338 ? -38.307 7.885   44.675  1.00 20.13 ? 381 ILE A CA  1 
ATOM   2754 C  C   . ILE A 1 338 ? -39.372 6.905   45.182  1.00 20.11 ? 381 ILE A C   1 
ATOM   2755 O  O   . ILE A 1 338 ? -39.067 5.742   45.473  1.00 19.74 ? 381 ILE A O   1 
ATOM   2756 C  CB  . ILE A 1 338 ? -37.784 8.820   45.772  1.00 19.84 ? 381 ILE A CB  1 
ATOM   2757 C  CG1 . ILE A 1 338 ? -36.534 9.539   45.253  1.00 20.84 ? 381 ILE A CG1 1 
ATOM   2758 C  CG2 . ILE A 1 338 ? -37.456 8.037   47.037  1.00 19.33 ? 381 ILE A CG2 1 
ATOM   2759 C  CD1 . ILE A 1 338 ? -36.108 10.758  46.062  1.00 20.73 ? 381 ILE A CD1 1 
ATOM   2760 N  N   . LYS A 1 339 ? -40.613 7.383   45.261  1.00 20.03 ? 382 LYS A N   1 
ATOM   2761 C  CA  . LYS A 1 339 ? -41.770 6.536   45.528  1.00 20.14 ? 382 LYS A CA  1 
ATOM   2762 C  C   . LYS A 1 339 ? -41.918 5.438   44.465  1.00 20.22 ? 382 LYS A C   1 
ATOM   2763 O  O   . LYS A 1 339 ? -42.149 4.270   44.783  1.00 20.68 ? 382 LYS A O   1 
ATOM   2764 C  CB  . LYS A 1 339 ? -43.028 7.384   45.562  1.00 20.17 ? 382 LYS A CB  1 
ATOM   2765 C  CG  . LYS A 1 339 ? -43.249 8.118   46.852  1.00 19.81 ? 382 LYS A CG  1 
ATOM   2766 C  CD  . LYS A 1 339 ? -44.482 8.981   46.734  1.00 20.45 ? 382 LYS A CD  1 
ATOM   2767 C  CE  . LYS A 1 339 ? -44.365 10.204  47.620  1.00 20.92 ? 382 LYS A CE  1 
ATOM   2768 N  NZ  . LYS A 1 339 ? -45.682 10.860  47.761  1.00 20.89 ? 382 LYS A NZ  1 
ATOM   2769 N  N   . GLU A 1 340 ? -41.768 5.812   43.200  1.00 19.72 ? 383 GLU A N   1 
ATOM   2770 C  CA  . GLU A 1 340 ? -41.788 4.836   42.136  1.00 19.31 ? 383 GLU A CA  1 
ATOM   2771 C  C   . GLU A 1 340 ? -40.617 3.827   42.230  1.00 19.45 ? 383 GLU A C   1 
ATOM   2772 O  O   . GLU A 1 340 ? -40.796 2.659   41.891  1.00 19.60 ? 383 GLU A O   1 
ATOM   2773 C  CB  . GLU A 1 340 ? -41.826 5.537   40.786  1.00 18.95 ? 383 GLU A CB  1 
ATOM   2774 C  CG  . GLU A 1 340 ? -41.929 4.593   39.579  1.00 18.98 ? 383 GLU A CG  1 
ATOM   2775 C  CD  . GLU A 1 340 ? -43.316 4.040   39.342  1.00 16.63 ? 383 GLU A CD  1 
ATOM   2776 O  OE1 . GLU A 1 340 ? -44.147 4.066   40.273  1.00 16.81 ? 383 GLU A OE1 1 
ATOM   2777 O  OE2 . GLU A 1 340 ? -43.569 3.567   38.213  1.00 16.09 ? 383 GLU A OE2 1 
ATOM   2778 N  N   . THR A 1 341 ? -39.444 4.256   42.704  1.00 19.23 ? 384 THR A N   1 
ATOM   2779 C  CA  . THR A 1 341 ? -38.303 3.337   42.834  1.00 19.48 ? 384 THR A CA  1 
ATOM   2780 C  C   . THR A 1 341 ? -38.533 2.290   43.933  1.00 19.84 ? 384 THR A C   1 
ATOM   2781 O  O   . THR A 1 341 ? -38.238 1.097   43.735  1.00 20.00 ? 384 THR A O   1 
ATOM   2782 C  CB  . THR A 1 341 ? -36.955 4.063   43.049  1.00 19.44 ? 384 THR A CB  1 
ATOM   2783 O  OG1 . THR A 1 341 ? -36.640 4.842   41.891  1.00 19.77 ? 384 THR A OG1 1 
ATOM   2784 C  CG2 . THR A 1 341 ? -35.835 3.064   43.244  1.00 18.71 ? 384 THR A CG2 1 
ATOM   2785 N  N   . LEU A 1 342 ? -39.101 2.735   45.056  1.00 19.66 ? 385 LEU A N   1 
ATOM   2786 C  CA  . LEU A 1 342 ? -39.384 1.877   46.204  1.00 19.56 ? 385 LEU A CA  1 
ATOM   2787 C  C   . LEU A 1 342 ? -40.569 0.926   46.010  1.00 20.29 ? 385 LEU A C   1 
ATOM   2788 O  O   . LEU A 1 342 ? -40.741 -0.034  46.769  1.00 20.50 ? 385 LEU A O   1 
ATOM   2789 C  CB  . LEU A 1 342 ? -39.597 2.726   47.448  1.00 19.03 ? 385 LEU A CB  1 
ATOM   2790 C  CG  . LEU A 1 342 ? -38.323 3.281   48.069  1.00 18.30 ? 385 LEU A CG  1 
ATOM   2791 C  CD1 . LEU A 1 342 ? -38.695 4.304   49.099  1.00 17.47 ? 385 LEU A CD1 1 
ATOM   2792 C  CD2 . LEU A 1 342 ? -37.502 2.146   48.696  1.00 17.40 ? 385 LEU A CD2 1 
ATOM   2793 N  N   . ARG A 1 343 ? -41.389 1.196   45.002  1.00 20.79 ? 386 ARG A N   1 
ATOM   2794 C  CA  . ARG A 1 343 ? -42.508 0.323   44.675  1.00 20.83 ? 386 ARG A CA  1 
ATOM   2795 C  C   . ARG A 1 343 ? -41.989 -0.889  43.894  1.00 20.81 ? 386 ARG A C   1 
ATOM   2796 O  O   . ARG A 1 343 ? -42.349 -2.036  44.178  1.00 20.71 ? 386 ARG A O   1 
ATOM   2797 C  CB  . ARG A 1 343 ? -43.541 1.108   43.874  1.00 21.13 ? 386 ARG A CB  1 
ATOM   2798 C  CG  . ARG A 1 343 ? -44.570 0.274   43.151  1.00 20.83 ? 386 ARG A CG  1 
ATOM   2799 C  CD  . ARG A 1 343 ? -45.227 1.080   42.035  1.00 21.00 ? 386 ARG A CD  1 
ATOM   2800 N  NE  . ARG A 1 343 ? -45.332 0.226   40.869  1.00 22.95 ? 386 ARG A NE  1 
ATOM   2801 C  CZ  . ARG A 1 343 ? -44.633 0.390   39.760  1.00 23.23 ? 386 ARG A CZ  1 
ATOM   2802 N  NH1 . ARG A 1 343 ? -43.811 1.401   39.636  1.00 24.02 ? 386 ARG A NH1 1 
ATOM   2803 N  NH2 . ARG A 1 343 ? -44.763 -0.459  38.775  1.00 23.74 ? 386 ARG A NH2 1 
ATOM   2804 N  N   . LEU A 1 344 ? -41.132 -0.625  42.917  1.00 20.54 ? 387 LEU A N   1 
ATOM   2805 C  CA  . LEU A 1 344 ? -40.540 -1.676  42.117  1.00 20.27 ? 387 LEU A CA  1 
ATOM   2806 C  C   . LEU A 1 344 ? -39.425 -2.377  42.875  1.00 20.43 ? 387 LEU A C   1 
ATOM   2807 O  O   . LEU A 1 344 ? -39.168 -3.560  42.669  1.00 21.01 ? 387 LEU A O   1 
ATOM   2808 C  CB  . LEU A 1 344 ? -39.957 -1.085  40.833  1.00 20.13 ? 387 LEU A CB  1 
ATOM   2809 C  CG  . LEU A 1 344 ? -40.845 -0.978  39.599  1.00 20.45 ? 387 LEU A CG  1 
ATOM   2810 C  CD1 . LEU A 1 344 ? -40.116 -0.195  38.515  1.00 19.95 ? 387 LEU A CD1 1 
ATOM   2811 C  CD2 . LEU A 1 344 ? -41.261 -2.370  39.079  1.00 17.50 ? 387 LEU A CD2 1 
ATOM   2812 N  N   . HIS A 1 345 ? -38.739 -1.634  43.734  1.00 20.35 ? 388 HIS A N   1 
ATOM   2813 C  CA  . HIS A 1 345 ? -37.566 -2.152  44.416  1.00 20.08 ? 388 HIS A CA  1 
ATOM   2814 C  C   . HIS A 1 345 ? -37.645 -1.838  45.910  1.00 19.90 ? 388 HIS A C   1 
ATOM   2815 O  O   . HIS A 1 345 ? -36.887 -1.007  46.431  1.00 19.60 ? 388 HIS A O   1 
ATOM   2816 C  CB  . HIS A 1 345 ? -36.294 -1.591  43.783  1.00 19.80 ? 388 HIS A CB  1 
ATOM   2817 C  CG  . HIS A 1 345 ? -36.214 -1.807  42.304  1.00 20.69 ? 388 HIS A CG  1 
ATOM   2818 N  ND1 . HIS A 1 345 ? -36.219 -3.063  41.734  1.00 20.30 ? 388 HIS A ND1 1 
ATOM   2819 C  CD2 . HIS A 1 345 ? -36.144 -0.925  41.275  1.00 20.65 ? 388 HIS A CD2 1 
ATOM   2820 C  CE1 . HIS A 1 345 ? -36.142 -2.947  40.418  1.00 20.80 ? 388 HIS A CE1 1 
ATOM   2821 N  NE2 . HIS A 1 345 ? -36.098 -1.659  40.113  1.00 20.91 ? 388 HIS A NE2 1 
ATOM   2822 N  N   . PRO A 1 346 ? -38.586 -2.490  46.606  1.00 19.59 ? 389 PRO A N   1 
ATOM   2823 C  CA  . PRO A 1 346 ? -38.617 -2.280  48.043  1.00 19.58 ? 389 PRO A CA  1 
ATOM   2824 C  C   . PRO A 1 346 ? -37.314 -2.761  48.674  1.00 19.77 ? 389 PRO A C   1 
ATOM   2825 O  O   . PRO A 1 346 ? -36.649 -3.662  48.131  1.00 19.72 ? 389 PRO A O   1 
ATOM   2826 C  CB  . PRO A 1 346 ? -39.783 -3.160  48.499  1.00 19.11 ? 389 PRO A CB  1 
ATOM   2827 C  CG  . PRO A 1 346 ? -39.953 -4.152  47.436  1.00 18.30 ? 389 PRO A CG  1 
ATOM   2828 C  CD  . PRO A 1 346 ? -39.588 -3.480  46.176  1.00 19.38 ? 389 PRO A CD  1 
ATOM   2829 N  N   . ILE A 1 347 ? -36.947 -2.133  49.787  1.00 19.27 ? 390 ILE A N   1 
ATOM   2830 C  CA  . ILE A 1 347 ? -35.869 -2.616  50.628  1.00 18.76 ? 390 ILE A CA  1 
ATOM   2831 C  C   . ILE A 1 347 ? -36.442 -3.773  51.451  1.00 18.77 ? 390 ILE A C   1 
ATOM   2832 O  O   . ILE A 1 347 ? -35.793 -4.804  51.622  1.00 19.14 ? 390 ILE A O   1 
ATOM   2833 C  CB  . ILE A 1 347 ? -35.330 -1.460  51.529  1.00 18.58 ? 390 ILE A CB  1 
ATOM   2834 C  CG1 . ILE A 1 347 ? -34.294 -0.621  50.768  1.00 17.91 ? 390 ILE A CG1 1 
ATOM   2835 C  CG2 . ILE A 1 347 ? -34.803 -1.960  52.885  1.00 17.90 ? 390 ILE A CG2 1 
ATOM   2836 C  CD1 . ILE A 1 347 ? -32.976 -1.316  50.443  1.00 16.23 ? 390 ILE A CD1 1 
ATOM   2837 N  N   . SER A 1 348 ? -37.677 -3.589  51.915  1.00 18.18 ? 391 SER A N   1 
ATOM   2838 C  CA  . SER A 1 348 ? -38.372 -4.505  52.809  1.00 17.76 ? 391 SER A CA  1 
ATOM   2839 C  C   . SER A 1 348 ? -39.385 -5.378  52.015  1.00 17.79 ? 391 SER A C   1 
ATOM   2840 O  O   . SER A 1 348 ? -40.346 -4.831  51.448  1.00 17.60 ? 391 SER A O   1 
ATOM   2841 C  CB  . SER A 1 348 ? -39.120 -3.650  53.833  1.00 17.47 ? 391 SER A CB  1 
ATOM   2842 O  OG  . SER A 1 348 ? -39.432 -4.345  55.021  1.00 17.93 ? 391 SER A OG  1 
ATOM   2843 N  N   . VAL A 1 349 ? -39.183 -6.704  51.954  1.00 17.11 ? 392 VAL A N   1 
ATOM   2844 C  CA  . VAL A 1 349 ? -40.121 -7.572  51.215  1.00 17.02 ? 392 VAL A CA  1 
ATOM   2845 C  C   . VAL A 1 349 ? -41.536 -7.444  51.740  1.00 16.76 ? 392 VAL A C   1 
ATOM   2846 O  O   . VAL A 1 349 ? -42.501 -7.516  50.980  1.00 16.35 ? 392 VAL A O   1 
ATOM   2847 C  CB  . VAL A 1 349 ? -39.819 -9.100  51.293  1.00 17.33 ? 392 VAL A CB  1 
ATOM   2848 C  CG1 . VAL A 1 349 ? -39.118 -9.581  50.050  1.00 18.51 ? 392 VAL A CG1 1 
ATOM   2849 C  CG2 . VAL A 1 349 ? -39.113 -9.497  52.590  1.00 15.82 ? 392 VAL A CG2 1 
ATOM   2850 N  N   . THR A 1 350 ? -41.649 -7.308  53.056  1.00 16.42 ? 393 THR A N   1 
ATOM   2851 C  CA  . THR A 1 350 ? -42.938 -7.209  53.684  1.00 16.34 ? 393 THR A CA  1 
ATOM   2852 C  C   . THR A 1 350 ? -42.934 -6.083  54.693  1.00 16.77 ? 393 THR A C   1 
ATOM   2853 O  O   . THR A 1 350 ? -41.893 -5.531  55.033  1.00 16.35 ? 393 THR A O   1 
ATOM   2854 C  CB  . THR A 1 350 ? -43.378 -8.542  54.378  1.00 16.36 ? 393 THR A CB  1 
ATOM   2855 O  OG1 . THR A 1 350 ? -42.563 -8.802  55.533  1.00 15.54 ? 393 THR A OG1 1 
ATOM   2856 C  CG2 . THR A 1 350 ? -43.310 -9.717  53.423  1.00 15.36 ? 393 THR A CG2 1 
ATOM   2857 N  N   . LEU A 1 351 ? -44.137 -5.711  55.101  1.00 17.49 ? 394 LEU A N   1 
ATOM   2858 C  CA  . LEU A 1 351 ? -44.374 -5.095  56.391  1.00 18.01 ? 394 LEU A CA  1 
ATOM   2859 C  C   . LEU A 1 351 ? -45.076 -6.191  57.212  1.00 18.07 ? 394 LEU A C   1 
ATOM   2860 O  O   . LEU A 1 351 ? -45.717 -7.094  56.641  1.00 17.71 ? 394 LEU A O   1 
ATOM   2861 C  CB  . LEU A 1 351 ? -45.279 -3.874  56.234  1.00 17.76 ? 394 LEU A CB  1 
ATOM   2862 C  CG  . LEU A 1 351 ? -44.772 -2.769  55.309  1.00 18.88 ? 394 LEU A CG  1 
ATOM   2863 C  CD1 . LEU A 1 351 ? -45.813 -1.678  55.173  1.00 18.15 ? 394 LEU A CD1 1 
ATOM   2864 C  CD2 . LEU A 1 351 ? -43.439 -2.182  55.800  1.00 17.95 ? 394 LEU A CD2 1 
ATOM   2865 N  N   . GLN A 1 352 ? -44.952 -6.122  58.531  1.00 18.21 ? 395 GLN A N   1 
ATOM   2866 C  CA  . GLN A 1 352 ? -45.636 -7.088  59.391  1.00 18.85 ? 395 GLN A CA  1 
ATOM   2867 C  C   . GLN A 1 352 ? -46.191 -6.423  60.638  1.00 19.58 ? 395 GLN A C   1 
ATOM   2868 O  O   . GLN A 1 352 ? -45.578 -5.500  61.192  1.00 19.86 ? 395 GLN A O   1 
ATOM   2869 C  CB  . GLN A 1 352 ? -44.729 -8.260  59.800  1.00 18.28 ? 395 GLN A CB  1 
ATOM   2870 C  CG  . GLN A 1 352 ? -43.661 -8.655  58.805  1.00 17.87 ? 395 GLN A CG  1 
ATOM   2871 C  CD  . GLN A 1 352 ? -42.467 -7.728  58.865  1.00 18.70 ? 395 GLN A CD  1 
ATOM   2872 O  OE1 . GLN A 1 352 ? -42.045 -7.308  59.955  1.00 18.04 ? 395 GLN A OE1 1 
ATOM   2873 N  NE2 . GLN A 1 352 ? -41.911 -7.398  57.699  1.00 17.38 ? 395 GLN A NE2 1 
ATOM   2874 N  N   . ARG A 1 353 ? -47.354 -6.895  61.071  1.00 20.06 ? 396 ARG A N   1 
ATOM   2875 C  CA  . ARG A 1 353 ? -47.908 -6.494  62.350  1.00 21.08 ? 396 ARG A CA  1 
ATOM   2876 C  C   . ARG A 1 353 ? -48.444 -7.723  63.063  1.00 22.04 ? 396 ARG A C   1 
ATOM   2877 O  O   . ARG A 1 353 ? -48.994 -8.624  62.418  1.00 22.22 ? 396 ARG A O   1 
ATOM   2878 C  CB  . ARG A 1 353 ? -49.015 -5.445  62.176  1.00 20.65 ? 396 ARG A CB  1 
ATOM   2879 C  CG  . ARG A 1 353 ? -48.535 -4.048  61.760  1.00 20.30 ? 396 ARG A CG  1 
ATOM   2880 C  CD  . ARG A 1 353 ? -47.474 -3.506  62.712  1.00 19.76 ? 396 ARG A CD  1 
ATOM   2881 N  NE  . ARG A 1 353 ? -47.086 -2.127  62.407  1.00 20.02 ? 396 ARG A NE  1 
ATOM   2882 C  CZ  . ARG A 1 353 ? -46.012 -1.756  61.702  1.00 18.92 ? 396 ARG A CZ  1 
ATOM   2883 N  NH1 . ARG A 1 353 ? -45.181 -2.659  61.198  1.00 17.72 ? 396 ARG A NH1 1 
ATOM   2884 N  NH2 . ARG A 1 353 ? -45.767 -0.465  61.508  1.00 16.95 ? 396 ARG A NH2 1 
ATOM   2885 N  N   . TYR A 1 354 ? -48.236 -7.785  64.376  1.00 23.05 ? 397 TYR A N   1 
ATOM   2886 C  CA  . TYR A 1 354 ? -48.951 -8.747  65.207  1.00 24.72 ? 397 TYR A CA  1 
ATOM   2887 C  C   . TYR A 1 354 ? -50.263 -8.089  65.627  1.00 25.90 ? 397 TYR A C   1 
ATOM   2888 O  O   . TYR A 1 354 ? -50.267 -6.961  66.147  1.00 26.22 ? 397 TYR A O   1 
ATOM   2889 C  CB  . TYR A 1 354 ? -48.146 -9.134  66.446  1.00 24.46 ? 397 TYR A CB  1 
ATOM   2890 C  CG  . TYR A 1 354 ? -46.976 -10.060 66.197  1.00 24.44 ? 397 TYR A CG  1 
ATOM   2891 C  CD1 . TYR A 1 354 ? -45.695 -9.549  66.002  1.00 23.72 ? 397 TYR A CD1 1 
ATOM   2892 C  CD2 . TYR A 1 354 ? -47.143 -11.451 66.186  1.00 23.59 ? 397 TYR A CD2 1 
ATOM   2893 C  CE1 . TYR A 1 354 ? -44.607 -10.396 65.793  1.00 23.71 ? 397 TYR A CE1 1 
ATOM   2894 C  CE2 . TYR A 1 354 ? -46.064 -12.304 65.969  1.00 22.56 ? 397 TYR A CE2 1 
ATOM   2895 C  CZ  . TYR A 1 354 ? -44.799 -11.769 65.779  1.00 23.50 ? 397 TYR A CZ  1 
ATOM   2896 O  OH  . TYR A 1 354 ? -43.714 -12.593 65.559  1.00 23.23 ? 397 TYR A OH  1 
ATOM   2897 N  N   . LEU A 1 355 ? -51.377 -8.774  65.388  1.00 27.06 ? 398 LEU A N   1 
ATOM   2898 C  CA  . LEU A 1 355 ? -52.687 -8.224  65.739  1.00 28.23 ? 398 LEU A CA  1 
ATOM   2899 C  C   . LEU A 1 355 ? -52.841 -8.133  67.252  1.00 28.98 ? 398 LEU A C   1 
ATOM   2900 O  O   . LEU A 1 355 ? -52.319 -8.972  67.984  1.00 29.02 ? 398 LEU A O   1 
ATOM   2901 C  CB  . LEU A 1 355 ? -53.814 -9.057  65.124  1.00 28.11 ? 398 LEU A CB  1 
ATOM   2902 C  CG  . LEU A 1 355 ? -53.834 -9.186  63.597  1.00 28.13 ? 398 LEU A CG  1 
ATOM   2903 C  CD1 . LEU A 1 355 ? -54.950 -10.109 63.176  1.00 27.41 ? 398 LEU A CD1 1 
ATOM   2904 C  CD2 . LEU A 1 355 ? -53.984 -7.834  62.914  1.00 27.10 ? 398 LEU A CD2 1 
ATOM   2905 N  N   . VAL A 1 356 ? -53.520 -7.086  67.712  1.00 30.27 ? 399 VAL A N   1 
ATOM   2906 C  CA  . VAL A 1 356 ? -53.805 -6.908  69.139  1.00 31.63 ? 399 VAL A CA  1 
ATOM   2907 C  C   . VAL A 1 356 ? -55.205 -7.444  69.424  1.00 32.31 ? 399 VAL A C   1 
ATOM   2908 O  O   . VAL A 1 356 ? -55.429 -8.106  70.439  1.00 32.98 ? 399 VAL A O   1 
ATOM   2909 C  CB  . VAL A 1 356 ? -53.665 -5.434  69.598  1.00 31.67 ? 399 VAL A CB  1 
ATOM   2910 C  CG1 . VAL A 1 356 ? -53.944 -5.314  71.099  1.00 33.15 ? 399 VAL A CG1 1 
ATOM   2911 C  CG2 . VAL A 1 356 ? -52.273 -4.912  69.301  1.00 31.38 ? 399 VAL A CG2 1 
ATOM   2912 N  N   . ASN A 1 357 ? -56.122 -7.172  68.498  1.00 32.98 ? 400 ASN A N   1 
ATOM   2913 C  CA  . ASN A 1 357 ? -57.465 -7.732  68.501  1.00 33.64 ? 400 ASN A CA  1 
ATOM   2914 C  C   . ASN A 1 357 ? -57.747 -8.599  67.282  1.00 33.90 ? 400 ASN A C   1 
ATOM   2915 O  O   . ASN A 1 357 ? -57.065 -8.488  66.256  1.00 34.09 ? 400 ASN A O   1 
ATOM   2916 C  CB  . ASN A 1 357 ? -58.488 -6.607  68.527  1.00 33.87 ? 400 ASN A CB  1 
ATOM   2917 C  CG  . ASN A 1 357 ? -58.405 -5.792  69.781  1.00 35.13 ? 400 ASN A CG  1 
ATOM   2918 O  OD1 . ASN A 1 357 ? -58.359 -6.341  70.886  1.00 36.48 ? 400 ASN A OD1 1 
ATOM   2919 N  ND2 . ASN A 1 357 ? -58.378 -4.470  69.628  1.00 35.75 ? 400 ASN A ND2 1 
ATOM   2920 N  N   . ASP A 1 358 ? -58.772 -9.443  67.405  1.00 34.04 ? 401 ASP A N   1 
ATOM   2921 C  CA  . ASP A 1 358 ? -59.309 -10.222 66.293  1.00 34.05 ? 401 ASP A CA  1 
ATOM   2922 C  C   . ASP A 1 358 ? -59.648 -9.274  65.163  1.00 33.78 ? 401 ASP A C   1 
ATOM   2923 O  O   . ASP A 1 358 ? -59.896 -8.093  65.389  1.00 33.87 ? 401 ASP A O   1 
ATOM   2924 C  CB  . ASP A 1 358 ? -60.564 -11.008 66.729  1.00 34.21 ? 401 ASP A CB  1 
ATOM   2925 C  CG  . ASP A 1 358 ? -60.261 -12.084 67.783  1.00 34.81 ? 401 ASP A CG  1 
ATOM   2926 O  OD1 . ASP A 1 358 ? -59.113 -12.574 67.859  1.00 35.53 ? 401 ASP A OD1 1 
ATOM   2927 O  OD2 . ASP A 1 358 ? -61.176 -12.447 68.547  1.00 35.53 ? 401 ASP A OD2 1 
ATOM   2928 N  N   . LEU A 1 359 ? -59.643 -9.790  63.944  1.00 33.86 ? 402 LEU A N   1 
ATOM   2929 C  CA  . LEU A 1 359 ? -59.844 -8.960  62.770  1.00 33.86 ? 402 LEU A CA  1 
ATOM   2930 C  C   . LEU A 1 359 ? -60.370 -9.776  61.609  1.00 33.94 ? 402 LEU A C   1 
ATOM   2931 O  O   . LEU A 1 359 ? -59.901 -10.890 61.364  1.00 34.43 ? 402 LEU A O   1 
ATOM   2932 C  CB  . LEU A 1 359 ? -58.526 -8.293  62.366  1.00 33.70 ? 402 LEU A CB  1 
ATOM   2933 C  CG  . LEU A 1 359 ? -58.561 -7.471  61.077  1.00 34.03 ? 402 LEU A CG  1 
ATOM   2934 C  CD1 . LEU A 1 359 ? -59.259 -6.146  61.316  1.00 33.72 ? 402 LEU A CD1 1 
ATOM   2935 C  CD2 . LEU A 1 359 ? -57.157 -7.255  60.540  1.00 34.95 ? 402 LEU A CD2 1 
ATOM   2936 N  N   . VAL A 1 360 ? -61.329 -9.220  60.878  1.00 33.97 ? 403 VAL A N   1 
ATOM   2937 C  CA  . VAL A 1 360 ? -61.809 -9.883  59.674  1.00 34.21 ? 403 VAL A CA  1 
ATOM   2938 C  C   . VAL A 1 360 ? -61.168 -9.286  58.417  1.00 34.26 ? 403 VAL A C   1 
ATOM   2939 O  O   . VAL A 1 360 ? -61.180 -8.073  58.226  1.00 34.58 ? 403 VAL A O   1 
ATOM   2940 C  CB  . VAL A 1 360 ? -63.356 -9.902  59.583  1.00 34.10 ? 403 VAL A CB  1 
ATOM   2941 C  CG1 . VAL A 1 360 ? -63.805 -10.742 58.398  1.00 34.12 ? 403 VAL A CG1 1 
ATOM   2942 C  CG2 . VAL A 1 360 ? -63.941 -10.470 60.861  1.00 33.57 ? 403 VAL A CG2 1 
ATOM   2943 N  N   . LEU A 1 361 ? -60.580 -10.152 57.597  1.00 34.11 ? 404 LEU A N   1 
ATOM   2944 C  CA  . LEU A 1 361 ? -60.031 -9.776  56.302  1.00 34.14 ? 404 LEU A CA  1 
ATOM   2945 C  C   . LEU A 1 361 ? -60.514 -10.766 55.250  1.00 34.33 ? 404 LEU A C   1 
ATOM   2946 O  O   . LEU A 1 361 ? -60.358 -11.982 55.412  1.00 34.05 ? 404 LEU A O   1 
ATOM   2947 C  CB  . LEU A 1 361 ? -58.494 -9.743  56.330  1.00 33.98 ? 404 LEU A CB  1 
ATOM   2948 C  CG  . LEU A 1 361 ? -57.776 -8.661  57.145  1.00 34.06 ? 404 LEU A CG  1 
ATOM   2949 C  CD1 . LEU A 1 361 ? -56.274 -8.787  57.015  1.00 34.02 ? 404 LEU A CD1 1 
ATOM   2950 C  CD2 . LEU A 1 361 ? -58.213 -7.270  56.731  1.00 34.30 ? 404 LEU A CD2 1 
ATOM   2951 N  N   . ARG A 1 362 ? -61.107 -10.237 54.179  1.00 34.78 ? 405 ARG A N   1 
ATOM   2952 C  CA  . ARG A 1 362 ? -61.678 -11.056 53.117  1.00 35.16 ? 405 ARG A CA  1 
ATOM   2953 C  C   . ARG A 1 362 ? -62.644 -12.085 53.697  1.00 35.53 ? 405 ARG A C   1 
ATOM   2954 O  O   . ARG A 1 362 ? -62.590 -13.258 53.332  1.00 35.71 ? 405 ARG A O   1 
ATOM   2955 C  CB  . ARG A 1 362 ? -60.567 -11.787 52.353  1.00 35.19 ? 405 ARG A CB  1 
ATOM   2956 C  CG  . ARG A 1 362 ? -59.570 -10.898 51.660  1.00 35.09 ? 405 ARG A CG  1 
ATOM   2957 C  CD  . ARG A 1 362 ? -59.749 -10.986 50.172  1.00 35.23 ? 405 ARG A CD  1 
ATOM   2958 N  NE  . ARG A 1 362 ? -59.373 -9.720  49.569  1.00 36.99 ? 405 ARG A NE  1 
ATOM   2959 C  CZ  . ARG A 1 362 ? -59.606 -9.377  48.310  1.00 36.37 ? 405 ARG A CZ  1 
ATOM   2960 N  NH1 . ARG A 1 362 ? -60.219 -10.213 47.484  1.00 37.01 ? 405 ARG A NH1 1 
ATOM   2961 N  NH2 . ARG A 1 362 ? -59.215 -8.188  47.885  1.00 36.78 ? 405 ARG A NH2 1 
ATOM   2962 N  N   . ASP A 1 363 ? -63.506 -11.659 54.621  1.00 35.88 ? 406 ASP A N   1 
ATOM   2963 C  CA  . ASP A 1 363 ? -64.495 -12.566 55.244  1.00 36.45 ? 406 ASP A CA  1 
ATOM   2964 C  C   . ASP A 1 363 ? -63.864 -13.752 56.032  1.00 36.05 ? 406 ASP A C   1 
ATOM   2965 O  O   . ASP A 1 363 ? -64.544 -14.734 56.340  1.00 36.21 ? 406 ASP A O   1 
ATOM   2966 C  CB  . ASP A 1 363 ? -65.527 -13.045 54.188  1.00 36.77 ? 406 ASP A CB  1 
ATOM   2967 C  CG  . ASP A 1 363 ? -66.764 -13.723 54.803  1.00 38.86 ? 406 ASP A CG  1 
ATOM   2968 O  OD1 . ASP A 1 363 ? -67.182 -13.380 55.934  1.00 40.25 ? 406 ASP A OD1 1 
ATOM   2969 O  OD2 . ASP A 1 363 ? -67.332 -14.612 54.130  1.00 42.03 ? 406 ASP A OD2 1 
ATOM   2970 N  N   . TYR A 1 364 ? -62.573 -13.649 56.360  1.00 35.52 ? 407 TYR A N   1 
ATOM   2971 C  CA  . TYR A 1 364 ? -61.907 -14.633 57.223  1.00 34.76 ? 407 TYR A CA  1 
ATOM   2972 C  C   . TYR A 1 364 ? -61.608 -14.040 58.591  1.00 34.84 ? 407 TYR A C   1 
ATOM   2973 O  O   . TYR A 1 364 ? -61.190 -12.886 58.702  1.00 34.95 ? 407 TYR A O   1 
ATOM   2974 C  CB  . TYR A 1 364 ? -60.583 -15.108 56.621  1.00 34.49 ? 407 TYR A CB  1 
ATOM   2975 C  CG  . TYR A 1 364 ? -60.660 -15.906 55.343  1.00 32.08 ? 407 TYR A CG  1 
ATOM   2976 C  CD1 . TYR A 1 364 ? -60.400 -15.305 54.121  1.00 30.23 ? 407 TYR A CD1 1 
ATOM   2977 C  CD2 . TYR A 1 364 ? -60.952 -17.267 55.361  1.00 30.37 ? 407 TYR A CD2 1 
ATOM   2978 C  CE1 . TYR A 1 364 ? -60.459 -16.028 52.944  1.00 29.68 ? 407 TYR A CE1 1 
ATOM   2979 C  CE2 . TYR A 1 364 ? -61.001 -18.006 54.192  1.00 28.24 ? 407 TYR A CE2 1 
ATOM   2980 C  CZ  . TYR A 1 364 ? -60.753 -17.380 52.989  1.00 29.22 ? 407 TYR A CZ  1 
ATOM   2981 O  OH  . TYR A 1 364 ? -60.790 -18.095 51.817  1.00 29.81 ? 407 TYR A OH  1 
ATOM   2982 N  N   . MET A 1 365 ? -61.785 -14.850 59.625  1.00 34.69 ? 408 MET A N   1 
ATOM   2983 C  CA  . MET A 1 365 ? -61.563 -14.414 60.996  1.00 35.00 ? 408 MET A CA  1 
ATOM   2984 C  C   . MET A 1 365 ? -60.107 -14.666 61.360  1.00 34.40 ? 408 MET A C   1 
ATOM   2985 O  O   . MET A 1 365 ? -59.661 -15.811 61.365  1.00 34.21 ? 408 MET A O   1 
ATOM   2986 C  CB  . MET A 1 365 ? -62.481 -15.193 61.953  1.00 35.35 ? 408 MET A CB  1 
ATOM   2987 C  CG  . MET A 1 365 ? -63.326 -14.343 62.905  1.00 37.32 ? 408 MET A CG  1 
ATOM   2988 S  SD  . MET A 1 365 ? -62.424 -13.180 63.962  1.00 41.42 ? 408 MET A SD  1 
ATOM   2989 C  CE  . MET A 1 365 ? -61.311 -14.276 64.860  1.00 40.39 ? 408 MET A CE  1 
ATOM   2990 N  N   . ILE A 1 366 ? -59.369 -13.596 61.654  1.00 33.88 ? 409 ILE A N   1 
ATOM   2991 C  CA  . ILE A 1 366 ? -57.966 -13.717 62.054  1.00 33.33 ? 409 ILE A CA  1 
ATOM   2992 C  C   . ILE A 1 366 ? -57.794 -13.329 63.521  1.00 33.08 ? 409 ILE A C   1 
ATOM   2993 O  O   . ILE A 1 366 ? -57.999 -12.169 63.882  1.00 33.31 ? 409 ILE A O   1 
ATOM   2994 C  CB  . ILE A 1 366 ? -57.021 -12.898 61.148  1.00 33.20 ? 409 ILE A CB  1 
ATOM   2995 C  CG1 . ILE A 1 366 ? -57.240 -13.273 59.678  1.00 33.37 ? 409 ILE A CG1 1 
ATOM   2996 C  CG2 . ILE A 1 366 ? -55.566 -13.173 61.520  1.00 33.16 ? 409 ILE A CG2 1 
ATOM   2997 C  CD1 . ILE A 1 366 ? -56.875 -12.188 58.702  1.00 32.66 ? 409 ILE A CD1 1 
ATOM   2998 N  N   . PRO A 1 367 ? -57.439 -14.309 64.376  1.00 32.72 ? 410 PRO A N   1 
ATOM   2999 C  CA  . PRO A 1 367 ? -57.365 -14.067 65.822  1.00 32.48 ? 410 PRO A CA  1 
ATOM   3000 C  C   . PRO A 1 367 ? -56.209 -13.185 66.281  1.00 32.19 ? 410 PRO A C   1 
ATOM   3001 O  O   . PRO A 1 367 ? -55.159 -13.141 65.647  1.00 32.20 ? 410 PRO A O   1 
ATOM   3002 C  CB  . PRO A 1 367 ? -57.233 -15.477 66.424  1.00 32.31 ? 410 PRO A CB  1 
ATOM   3003 C  CG  . PRO A 1 367 ? -56.837 -16.361 65.313  1.00 32.37 ? 410 PRO A CG  1 
ATOM   3004 C  CD  . PRO A 1 367 ? -57.356 -15.745 64.051  1.00 32.75 ? 410 PRO A CD  1 
ATOM   3005 N  N   . ALA A 1 368 ? -56.430 -12.483 67.388  1.00 31.90 ? 411 ALA A N   1 
ATOM   3006 C  CA  . ALA A 1 368 ? -55.410 -11.654 68.026  1.00 31.49 ? 411 ALA A CA  1 
ATOM   3007 C  C   . ALA A 1 368 ? -54.117 -12.430 68.223  1.00 31.19 ? 411 ALA A C   1 
ATOM   3008 O  O   . ALA A 1 368 ? -54.136 -13.630 68.539  1.00 31.16 ? 411 ALA A O   1 
ATOM   3009 C  CB  . ALA A 1 368 ? -55.920 -11.120 69.372  1.00 31.45 ? 411 ALA A CB  1 
ATOM   3010 N  N   . LYS A 1 369 ? -53.002 -11.726 68.027  1.00 30.58 ? 412 LYS A N   1 
ATOM   3011 C  CA  . LYS A 1 369 ? -51.645 -12.270 68.171  1.00 29.63 ? 412 LYS A CA  1 
ATOM   3012 C  C   . LYS A 1 369 ? -51.123 -12.947 66.900  1.00 28.59 ? 412 LYS A C   1 
ATOM   3013 O  O   . LYS A 1 369 ? -49.962 -13.368 66.851  1.00 28.81 ? 412 LYS A O   1 
ATOM   3014 C  CB  . LYS A 1 369 ? -51.518 -13.188 69.404  1.00 30.01 ? 412 LYS A CB  1 
ATOM   3015 C  CG  . LYS A 1 369 ? -51.593 -12.439 70.743  1.00 31.39 ? 412 LYS A CG  1 
ATOM   3016 C  CD  . LYS A 1 369 ? -51.325 -13.364 71.917  1.00 33.65 ? 412 LYS A CD  1 
ATOM   3017 C  CE  . LYS A 1 369 ? -51.610 -12.661 73.238  1.00 35.25 ? 412 LYS A CE  1 
ATOM   3018 N  NZ  . LYS A 1 369 ? -52.336 -13.593 74.182  1.00 37.10 ? 412 LYS A NZ  1 
ATOM   3019 N  N   . THR A 1 370 ? -51.966 -13.049 65.874  1.00 26.96 ? 413 THR A N   1 
ATOM   3020 C  CA  . THR A 1 370 ? -51.499 -13.532 64.576  1.00 25.87 ? 413 THR A CA  1 
ATOM   3021 C  C   . THR A 1 370 ? -50.540 -12.515 63.936  1.00 24.77 ? 413 THR A C   1 
ATOM   3022 O  O   . THR A 1 370 ? -50.736 -11.304 64.036  1.00 24.67 ? 413 THR A O   1 
ATOM   3023 C  CB  . THR A 1 370 ? -52.661 -13.777 63.578  1.00 25.84 ? 413 THR A CB  1 
ATOM   3024 O  OG1 . THR A 1 370 ? -53.653 -14.611 64.175  1.00 27.02 ? 413 THR A OG1 1 
ATOM   3025 C  CG2 . THR A 1 370 ? -52.158 -14.455 62.329  1.00 26.01 ? 413 THR A CG2 1 
ATOM   3026 N  N   . LEU A 1 371 ? -49.509 -13.024 63.275  1.00 23.38 ? 414 LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 371 ? -48.661 -12.213 62.440  1.00 21.98 ? 414 LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 371 ? -49.339 -12.064 61.083  1.00 21.46 ? 414 LEU A C   1 
ATOM   3029 O  O   . LEU A 1 371 ? -49.660 -13.058 60.428  1.00 21.41 ? 414 LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 371 ? -47.304 -12.889 62.283  1.00 21.61 ? 414 LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 371 ? -46.186 -12.135 61.574  1.00 21.13 ? 414 LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 371 ? -45.963 -10.777 62.225  1.00 19.88 ? 414 LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 371 ? -44.901 -12.963 61.594  1.00 20.15 ? 414 LEU A CD2 1 
ATOM   3034 N  N   . VAL A 1 372 ? -49.572 -10.818 60.675  1.00 20.60 ? 415 VAL A N   1 
ATOM   3035 C  CA  . VAL A 1 372 ? -50.032 -10.521 59.316  1.00 19.65 ? 415 VAL A CA  1 
ATOM   3036 C  C   . VAL A 1 372 ? -48.933 -9.794  58.554  1.00 18.94 ? 415 VAL A C   1 
ATOM   3037 O  O   . VAL A 1 372 ? -48.325 -8.851  59.076  1.00 18.79 ? 415 VAL A O   1 
ATOM   3038 C  CB  . VAL A 1 372 ? -51.348 -9.696  59.300  1.00 19.95 ? 415 VAL A CB  1 
ATOM   3039 C  CG1 . VAL A 1 372 ? -51.813 -9.451  57.863  1.00 19.10 ? 415 VAL A CG1 1 
ATOM   3040 C  CG2 . VAL A 1 372 ? -52.448 -10.409 60.112  1.00 19.85 ? 415 VAL A CG2 1 
ATOM   3041 N  N   . GLN A 1 373 ? -48.675 -10.247 57.331  1.00 18.04 ? 416 GLN A N   1 
ATOM   3042 C  CA  . GLN A 1 373 ? -47.634 -9.664  56.494  1.00 17.41 ? 416 GLN A CA  1 
ATOM   3043 C  C   . GLN A 1 373 ? -48.182 -9.090  55.190  1.00 17.57 ? 416 GLN A C   1 
ATOM   3044 O  O   . GLN A 1 373 ? -48.927 -9.758  54.443  1.00 16.93 ? 416 GLN A O   1 
ATOM   3045 C  CB  . GLN A 1 373 ? -46.516 -10.670 56.216  1.00 17.15 ? 416 GLN A CB  1 
ATOM   3046 C  CG  . GLN A 1 373 ? -45.747 -11.083 57.483  1.00 17.48 ? 416 GLN A CG  1 
ATOM   3047 C  CD  . GLN A 1 373 ? -44.421 -11.789 57.212  1.00 17.56 ? 416 GLN A CD  1 
ATOM   3048 O  OE1 . GLN A 1 373 ? -43.631 -11.367 56.357  1.00 17.10 ? 416 GLN A OE1 1 
ATOM   3049 N  NE2 . GLN A 1 373 ? -44.164 -12.863 57.961  1.00 18.00 ? 416 GLN A NE2 1 
ATOM   3050 N  N   . VAL A 1 374 ? -47.817 -7.838  54.929  1.00 17.58 ? 417 VAL A N   1 
ATOM   3051 C  CA  . VAL A 1 374 ? -48.179 -7.201  53.676  1.00 18.05 ? 417 VAL A CA  1 
ATOM   3052 C  C   . VAL A 1 374 ? -47.077 -7.448  52.676  1.00 18.39 ? 417 VAL A C   1 
ATOM   3053 O  O   . VAL A 1 374 ? -45.955 -6.980  52.860  1.00 18.91 ? 417 VAL A O   1 
ATOM   3054 C  CB  . VAL A 1 374 ? -48.400 -5.685  53.850  1.00 18.21 ? 417 VAL A CB  1 
ATOM   3055 C  CG1 . VAL A 1 374 ? -48.849 -5.058  52.532  1.00 17.09 ? 417 VAL A CG1 1 
ATOM   3056 C  CG2 . VAL A 1 374 ? -49.429 -5.431  54.967  1.00 18.18 ? 417 VAL A CG2 1 
ATOM   3057 N  N   . ALA A 1 375 ? -47.388 -8.178  51.613  1.00 18.58 ? 418 ALA A N   1 
ATOM   3058 C  CA  . ALA A 1 375 ? -46.376 -8.500  50.622  1.00 18.84 ? 418 ALA A CA  1 
ATOM   3059 C  C   . ALA A 1 375 ? -46.070 -7.314  49.681  1.00 19.36 ? 418 ALA A C   1 
ATOM   3060 O  O   . ALA A 1 375 ? -46.476 -7.286  48.504  1.00 19.59 ? 418 ALA A O   1 
ATOM   3061 C  CB  . ALA A 1 375 ? -46.758 -9.752  49.856  1.00 18.54 ? 418 ALA A CB  1 
ATOM   3062 N  N   . ILE A 1 376 ? -45.322 -6.356  50.223  1.00 19.56 ? 419 ILE A N   1 
ATOM   3063 C  CA  . ILE A 1 376 ? -44.967 -5.102  49.552  1.00 19.67 ? 419 ILE A CA  1 
ATOM   3064 C  C   . ILE A 1 376 ? -44.341 -5.302  48.162  1.00 19.36 ? 419 ILE A C   1 
ATOM   3065 O  O   . ILE A 1 376 ? -44.695 -4.590  47.209  1.00 18.73 ? 419 ILE A O   1 
ATOM   3066 C  CB  . ILE A 1 376 ? -44.069 -4.225  50.498  1.00 20.28 ? 419 ILE A CB  1 
ATOM   3067 C  CG1 . ILE A 1 376 ? -44.837 -3.010  51.000  1.00 20.94 ? 419 ILE A CG1 1 
ATOM   3068 C  CG2 . ILE A 1 376 ? -42.839 -3.684  49.801  1.00 20.76 ? 419 ILE A CG2 1 
ATOM   3069 C  CD1 . ILE A 1 376 ? -46.010 -3.326  51.865  1.00 21.49 ? 419 ILE A CD1 1 
ATOM   3070 N  N   . TYR A 1 377 ? -43.425 -6.270  48.046  1.00 18.98 ? 420 TYR A N   1 
ATOM   3071 C  CA  . TYR A 1 377 ? -42.808 -6.565  46.758  1.00 18.47 ? 420 TYR A CA  1 
ATOM   3072 C  C   . TYR A 1 377 ? -43.849 -7.044  45.743  1.00 19.01 ? 420 TYR A C   1 
ATOM   3073 O  O   . TYR A 1 377 ? -43.907 -6.542  44.622  1.00 19.05 ? 420 TYR A O   1 
ATOM   3074 C  CB  . TYR A 1 377 ? -41.685 -7.607  46.877  1.00 17.96 ? 420 TYR A CB  1 
ATOM   3075 C  CG  . TYR A 1 377 ? -41.056 -7.924  45.529  1.00 15.64 ? 420 TYR A CG  1 
ATOM   3076 C  CD1 . TYR A 1 377 ? -39.967 -7.189  45.058  1.00 13.42 ? 420 TYR A CD1 1 
ATOM   3077 C  CD2 . TYR A 1 377 ? -41.569 -8.938  44.716  1.00 14.76 ? 420 TYR A CD2 1 
ATOM   3078 C  CE1 . TYR A 1 377 ? -39.388 -7.465  43.823  1.00 11.94 ? 420 TYR A CE1 1 
ATOM   3079 C  CE2 . TYR A 1 377 ? -41.009 -9.219  43.475  1.00 14.07 ? 420 TYR A CE2 1 
ATOM   3080 C  CZ  . TYR A 1 377 ? -39.919 -8.472  43.032  1.00 13.22 ? 420 TYR A CZ  1 
ATOM   3081 O  OH  . TYR A 1 377 ? -39.358 -8.740  41.805  1.00 14.03 ? 420 TYR A OH  1 
ATOM   3082 N  N   . ALA A 1 378 ? -44.646 -8.033  46.142  1.00 19.30 ? 421 ALA A N   1 
ATOM   3083 C  CA  . ALA A 1 378 ? -45.627 -8.633  45.259  1.00 20.11 ? 421 ALA A CA  1 
ATOM   3084 C  C   . ALA A 1 378 ? -46.664 -7.583  44.834  1.00 20.45 ? 421 ALA A C   1 
ATOM   3085 O  O   . ALA A 1 378 ? -47.071 -7.532  43.677  1.00 20.30 ? 421 ALA A O   1 
ATOM   3086 C  CB  . ALA A 1 378 ? -46.292 -9.847  45.928  1.00 19.86 ? 421 ALA A CB  1 
ATOM   3087 N  N   . LEU A 1 379 ? -47.051 -6.739  45.784  1.00 20.96 ? 422 LEU A N   1 
ATOM   3088 C  CA  . LEU A 1 379 ? -47.921 -5.622  45.521  1.00 21.72 ? 422 LEU A CA  1 
ATOM   3089 C  C   . LEU A 1 379 ? -47.403 -4.738  44.382  1.00 22.37 ? 422 LEU A C   1 
ATOM   3090 O  O   . LEU A 1 379 ? -48.119 -4.494  43.430  1.00 23.05 ? 422 LEU A O   1 
ATOM   3091 C  CB  . LEU A 1 379 ? -48.161 -4.821  46.800  1.00 21.41 ? 422 LEU A CB  1 
ATOM   3092 C  CG  . LEU A 1 379 ? -48.930 -3.501  46.692  1.00 21.66 ? 422 LEU A CG  1 
ATOM   3093 C  CD1 . LEU A 1 379 ? -50.155 -3.638  45.808  1.00 21.32 ? 422 LEU A CD1 1 
ATOM   3094 C  CD2 . LEU A 1 379 ? -49.320 -3.022  48.081  1.00 21.61 ? 422 LEU A CD2 1 
ATOM   3095 N  N   . GLY A 1 380 ? -46.158 -4.292  44.453  1.00 23.31 ? 423 GLY A N   1 
ATOM   3096 C  CA  . GLY A 1 380 ? -45.620 -3.358  43.456  1.00 23.93 ? 423 GLY A CA  1 
ATOM   3097 C  C   . GLY A 1 380 ? -45.493 -3.909  42.048  1.00 24.63 ? 423 GLY A C   1 
ATOM   3098 O  O   . GLY A 1 380 ? -45.309 -3.156  41.078  1.00 25.26 ? 423 GLY A O   1 
ATOM   3099 N  N   . ARG A 1 381 ? -45.569 -5.227  41.930  1.00 24.94 ? 424 ARG A N   1 
ATOM   3100 C  CA  . ARG A 1 381 ? -45.470 -5.880  40.633  1.00 24.76 ? 424 ARG A CA  1 
ATOM   3101 C  C   . ARG A 1 381 ? -46.858 -6.285  40.161  1.00 24.80 ? 424 ARG A C   1 
ATOM   3102 O  O   . ARG A 1 381 ? -47.008 -6.732  39.033  1.00 24.90 ? 424 ARG A O   1 
ATOM   3103 C  CB  . ARG A 1 381 ? -44.567 -7.132  40.700  1.00 24.64 ? 424 ARG A CB  1 
ATOM   3104 C  CG  . ARG A 1 381 ? -43.146 -6.911  41.213  1.00 23.52 ? 424 ARG A CG  1 
ATOM   3105 C  CD  . ARG A 1 381 ? -42.460 -5.851  40.421  1.00 21.64 ? 424 ARG A CD  1 
ATOM   3106 N  NE  . ARG A 1 381 ? -41.135 -5.515  40.925  1.00 20.03 ? 424 ARG A NE  1 
ATOM   3107 C  CZ  . ARG A 1 381 ? -39.996 -5.876  40.338  1.00 19.47 ? 424 ARG A CZ  1 
ATOM   3108 N  NH1 . ARG A 1 381 ? -40.013 -6.610  39.243  1.00 19.57 ? 424 ARG A NH1 1 
ATOM   3109 N  NH2 . ARG A 1 381 ? -38.832 -5.506  40.850  1.00 19.82 ? 424 ARG A NH2 1 
ATOM   3110 N  N   . GLU A 1 382 ? -47.860 -6.102  41.018  1.00 25.01 ? 425 GLU A N   1 
ATOM   3111 C  CA  . GLU A 1 382 ? -49.217 -6.596  40.769  1.00 25.74 ? 425 GLU A CA  1 
ATOM   3112 C  C   . GLU A 1 382 ? -50.047 -5.735  39.784  1.00 25.81 ? 425 GLU A C   1 
ATOM   3113 O  O   . GLU A 1 382 ? -50.447 -4.613  40.113  1.00 25.38 ? 425 GLU A O   1 
ATOM   3114 C  CB  . GLU A 1 382 ? -49.956 -6.821  42.094  1.00 25.36 ? 425 GLU A CB  1 
ATOM   3115 C  CG  . GLU A 1 382 ? -51.396 -7.323  41.961  1.00 27.90 ? 425 GLU A CG  1 
ATOM   3116 C  CD  . GLU A 1 382 ? -51.559 -8.569  41.081  1.00 29.66 ? 425 GLU A CD  1 
ATOM   3117 O  OE1 . GLU A 1 382 ? -51.064 -9.643  41.461  1.00 29.87 ? 425 GLU A OE1 1 
ATOM   3118 O  OE2 . GLU A 1 382 ? -52.210 -8.474  40.016  1.00 31.22 ? 425 GLU A OE2 1 
ATOM   3119 N  N   . PRO A 1 383 ? -50.323 -6.281  38.574  1.00 26.18 ? 426 PRO A N   1 
ATOM   3120 C  CA  . PRO A 1 383 ? -50.966 -5.479  37.532  1.00 26.59 ? 426 PRO A CA  1 
ATOM   3121 C  C   . PRO A 1 383 ? -52.400 -5.057  37.830  1.00 27.31 ? 426 PRO A C   1 
ATOM   3122 O  O   . PRO A 1 383 ? -52.927 -4.191  37.119  1.00 27.95 ? 426 PRO A O   1 
ATOM   3123 C  CB  . PRO A 1 383 ? -50.899 -6.367  36.284  1.00 26.30 ? 426 PRO A CB  1 
ATOM   3124 C  CG  . PRO A 1 383 ? -50.679 -7.744  36.795  1.00 26.72 ? 426 PRO A CG  1 
ATOM   3125 C  CD  . PRO A 1 383 ? -49.980 -7.638  38.105  1.00 25.77 ? 426 PRO A CD  1 
ATOM   3126 N  N   . THR A 1 384 ? -53.023 -5.647  38.854  1.00 27.53 ? 427 THR A N   1 
ATOM   3127 C  CA  . THR A 1 384 ? -54.367 -5.229  39.275  1.00 27.70 ? 427 THR A CA  1 
ATOM   3128 C  C   . THR A 1 384 ? -54.355 -4.076  40.273  1.00 28.10 ? 427 THR A C   1 
ATOM   3129 O  O   . THR A 1 384 ? -55.405 -3.513  40.586  1.00 28.56 ? 427 THR A O   1 
ATOM   3130 C  CB  . THR A 1 384 ? -55.199 -6.398  39.873  1.00 27.67 ? 427 THR A CB  1 
ATOM   3131 O  OG1 . THR A 1 384 ? -54.514 -6.965  40.991  1.00 27.81 ? 427 THR A OG1 1 
ATOM   3132 C  CG2 . THR A 1 384 ? -55.428 -7.488  38.842  1.00 27.03 ? 427 THR A CG2 1 
ATOM   3133 N  N   . PHE A 1 385 ? -53.180 -3.733  40.795  1.00 28.47 ? 428 PHE A N   1 
ATOM   3134 C  CA  . PHE A 1 385 ? -53.091 -2.668  41.795  1.00 28.64 ? 428 PHE A CA  1 
ATOM   3135 C  C   . PHE A 1 385 ? -52.290 -1.468  41.312  1.00 28.61 ? 428 PHE A C   1 
ATOM   3136 O  O   . PHE A 1 385 ? -52.393 -0.371  41.884  1.00 28.25 ? 428 PHE A O   1 
ATOM   3137 C  CB  . PHE A 1 385 ? -52.554 -3.206  43.114  1.00 28.67 ? 428 PHE A CB  1 
ATOM   3138 C  CG  . PHE A 1 385 ? -53.456 -4.217  43.757  1.00 30.17 ? 428 PHE A CG  1 
ATOM   3139 C  CD1 . PHE A 1 385 ? -52.947 -5.402  44.264  1.00 30.55 ? 428 PHE A CD1 1 
ATOM   3140 C  CD2 . PHE A 1 385 ? -54.832 -3.996  43.831  1.00 31.43 ? 428 PHE A CD2 1 
ATOM   3141 C  CE1 . PHE A 1 385 ? -53.787 -6.343  44.857  1.00 31.29 ? 428 PHE A CE1 1 
ATOM   3142 C  CE2 . PHE A 1 385 ? -55.676 -4.936  44.422  1.00 31.85 ? 428 PHE A CE2 1 
ATOM   3143 C  CZ  . PHE A 1 385 ? -55.149 -6.109  44.939  1.00 30.77 ? 428 PHE A CZ  1 
ATOM   3144 N  N   . PHE A 1 386 ? -51.508 -1.687  40.257  1.00 28.54 ? 429 PHE A N   1 
ATOM   3145 C  CA  . PHE A 1 386 ? -50.810 -0.618  39.572  1.00 29.36 ? 429 PHE A CA  1 
ATOM   3146 C  C   . PHE A 1 386 ? -50.953 -0.823  38.081  1.00 30.20 ? 429 PHE A C   1 
ATOM   3147 O  O   . PHE A 1 386 ? -50.693 -1.912  37.576  1.00 30.17 ? 429 PHE A O   1 
ATOM   3148 C  CB  . PHE A 1 386 ? -49.320 -0.563  39.955  1.00 28.97 ? 429 PHE A CB  1 
ATOM   3149 C  CG  . PHE A 1 386 ? -49.084 -0.242  41.396  1.00 28.03 ? 429 PHE A CG  1 
ATOM   3150 C  CD1 . PHE A 1 386 ? -48.819 -1.259  42.313  1.00 26.58 ? 429 PHE A CD1 1 
ATOM   3151 C  CD2 . PHE A 1 386 ? -49.152 1.072   41.847  1.00 27.43 ? 429 PHE A CD2 1 
ATOM   3152 C  CE1 . PHE A 1 386 ? -48.633 -0.968  43.652  1.00 26.72 ? 429 PHE A CE1 1 
ATOM   3153 C  CE2 . PHE A 1 386 ? -48.949 1.381   43.189  1.00 26.75 ? 429 PHE A CE2 1 
ATOM   3154 C  CZ  . PHE A 1 386 ? -48.684 0.354   44.094  1.00 27.26 ? 429 PHE A CZ  1 
ATOM   3155 N  N   . PHE A 1 387 ? -51.371 0.230   37.384  1.00 31.42 ? 430 PHE A N   1 
ATOM   3156 C  CA  . PHE A 1 387 ? -51.444 0.206   35.936  1.00 32.71 ? 430 PHE A CA  1 
ATOM   3157 C  C   . PHE A 1 387 ? -50.043 0.038   35.346  1.00 32.93 ? 430 PHE A C   1 
ATOM   3158 O  O   . PHE A 1 387 ? -49.113 0.765   35.720  1.00 33.30 ? 430 PHE A O   1 
ATOM   3159 C  CB  . PHE A 1 387 ? -52.090 1.492   35.413  1.00 33.18 ? 430 PHE A CB  1 
ATOM   3160 C  CG  . PHE A 1 387 ? -52.156 1.552   33.919  1.00 35.99 ? 430 PHE A CG  1 
ATOM   3161 C  CD1 . PHE A 1 387 ? -53.210 0.921   33.228  1.00 38.04 ? 430 PHE A CD1 1 
ATOM   3162 C  CD2 . PHE A 1 387 ? -51.143 2.195   33.187  1.00 37.93 ? 430 PHE A CD2 1 
ATOM   3163 C  CE1 . PHE A 1 387 ? -53.266 0.947   31.825  1.00 39.48 ? 430 PHE A CE1 1 
ATOM   3164 C  CE2 . PHE A 1 387 ? -51.183 2.228   31.775  1.00 40.18 ? 430 PHE A CE2 1 
ATOM   3165 C  CZ  . PHE A 1 387 ? -52.250 1.605   31.090  1.00 39.99 ? 430 PHE A CZ  1 
ATOM   3166 N  N   . ASP A 1 388 ? -49.905 -0.921  34.432  1.00 33.28 ? 431 ASP A N   1 
ATOM   3167 C  CA  . ASP A 1 388 ? -48.632 -1.235  33.754  1.00 33.70 ? 431 ASP A CA  1 
ATOM   3168 C  C   . ASP A 1 388 ? -47.443 -1.253  34.735  1.00 33.39 ? 431 ASP A C   1 
ATOM   3169 O  O   . ASP A 1 388 ? -46.527 -0.427  34.635  1.00 33.44 ? 431 ASP A O   1 
ATOM   3170 C  CB  . ASP A 1 388 ? -48.406 -0.276  32.570  1.00 34.23 ? 431 ASP A CB  1 
ATOM   3171 C  CG  . ASP A 1 388 ? -47.168 -0.625  31.735  1.00 36.44 ? 431 ASP A CG  1 
ATOM   3172 O  OD1 . ASP A 1 388 ? -46.651 -1.769  31.815  1.00 38.40 ? 431 ASP A OD1 1 
ATOM   3173 O  OD2 . ASP A 1 388 ? -46.701 0.272   30.989  1.00 39.66 ? 431 ASP A OD2 1 
ATOM   3174 N  N   . PRO A 1 389 ? -47.456 -2.211  35.687  1.00 33.00 ? 432 PRO A N   1 
ATOM   3175 C  CA  . PRO A 1 389 ? -46.486 -2.245  36.797  1.00 32.35 ? 432 PRO A CA  1 
ATOM   3176 C  C   . PRO A 1 389 ? -44.993 -2.366  36.422  1.00 31.94 ? 432 PRO A C   1 
ATOM   3177 O  O   . PRO A 1 389 ? -44.137 -1.937  37.195  1.00 31.52 ? 432 PRO A O   1 
ATOM   3178 C  CB  . PRO A 1 389 ? -46.947 -3.451  37.636  1.00 32.44 ? 432 PRO A CB  1 
ATOM   3179 C  CG  . PRO A 1 389 ? -47.731 -4.308  36.684  1.00 32.56 ? 432 PRO A CG  1 
ATOM   3180 C  CD  . PRO A 1 389 ? -48.400 -3.349  35.745  1.00 32.76 ? 432 PRO A CD  1 
ATOM   3181 N  N   . GLU A 1 390 ? -44.665 -2.929  35.264  1.00 31.86 ? 433 GLU A N   1 
ATOM   3182 C  CA  . GLU A 1 390 ? -43.252 -3.040  34.903  1.00 31.86 ? 433 GLU A CA  1 
ATOM   3183 C  C   . GLU A 1 390 ? -42.690 -1.716  34.343  1.00 31.57 ? 433 GLU A C   1 
ATOM   3184 O  O   . GLU A 1 390 ? -41.508 -1.617  34.007  1.00 31.56 ? 433 GLU A O   1 
ATOM   3185 C  CB  . GLU A 1 390 ? -42.989 -4.224  33.959  1.00 31.87 ? 433 GLU A CB  1 
ATOM   3186 C  CG  . GLU A 1 390 ? -43.590 -5.586  34.385  1.00 34.00 ? 433 GLU A CG  1 
ATOM   3187 C  CD  . GLU A 1 390 ? -43.319 -5.995  35.851  1.00 37.19 ? 433 GLU A CD  1 
ATOM   3188 O  OE1 . GLU A 1 390 ? -42.149 -5.907  36.309  1.00 37.67 ? 433 GLU A OE1 1 
ATOM   3189 O  OE2 . GLU A 1 390 ? -44.289 -6.433  36.541  1.00 37.70 ? 433 GLU A OE2 1 
ATOM   3190 N  N   . ASN A 1 391 ? -43.537 -0.695  34.261  1.00 31.28 ? 434 ASN A N   1 
ATOM   3191 C  CA  . ASN A 1 391 ? -43.120 0.588   33.720  1.00 30.94 ? 434 ASN A CA  1 
ATOM   3192 C  C   . ASN A 1 391 ? -42.827 1.583   34.840  1.00 30.35 ? 434 ASN A C   1 
ATOM   3193 O  O   . ASN A 1 391 ? -43.639 1.789   35.754  1.00 30.42 ? 434 ASN A O   1 
ATOM   3194 C  CB  . ASN A 1 391 ? -44.160 1.127   32.716  1.00 31.36 ? 434 ASN A CB  1 
ATOM   3195 C  CG  . ASN A 1 391 ? -43.770 2.490   32.119  1.00 32.33 ? 434 ASN A CG  1 
ATOM   3196 O  OD1 . ASN A 1 391 ? -42.916 2.588   31.230  1.00 33.67 ? 434 ASN A OD1 1 
ATOM   3197 N  ND2 . ASN A 1 391 ? -44.417 3.540   32.600  1.00 33.53 ? 434 ASN A ND2 1 
ATOM   3198 N  N   . PHE A 1 392 ? -41.639 2.173   34.774  1.00 29.49 ? 435 PHE A N   1 
ATOM   3199 C  CA  . PHE A 1 392 ? -41.214 3.185   35.722  1.00 28.60 ? 435 PHE A CA  1 
ATOM   3200 C  C   . PHE A 1 392 ? -41.895 4.504   35.325  1.00 28.43 ? 435 PHE A C   1 
ATOM   3201 O  O   . PHE A 1 392 ? -41.516 5.137   34.340  1.00 28.11 ? 435 PHE A O   1 
ATOM   3202 C  CB  . PHE A 1 392 ? -39.679 3.280   35.702  1.00 28.36 ? 435 PHE A CB  1 
ATOM   3203 C  CG  . PHE A 1 392 ? -39.094 4.211   36.740  1.00 27.67 ? 435 PHE A CG  1 
ATOM   3204 C  CD1 . PHE A 1 392 ? -39.027 3.836   38.083  1.00 26.49 ? 435 PHE A CD1 1 
ATOM   3205 C  CD2 . PHE A 1 392 ? -38.585 5.451   36.369  1.00 26.24 ? 435 PHE A CD2 1 
ATOM   3206 C  CE1 . PHE A 1 392 ? -38.482 4.681   39.043  1.00 25.69 ? 435 PHE A CE1 1 
ATOM   3207 C  CE2 . PHE A 1 392 ? -38.032 6.306   37.327  1.00 27.18 ? 435 PHE A CE2 1 
ATOM   3208 C  CZ  . PHE A 1 392 ? -37.984 5.914   38.667  1.00 27.06 ? 435 PHE A CZ  1 
ATOM   3209 N  N   . ASP A 1 393 ? -42.935 4.881   36.071  1.00 28.49 ? 436 ASP A N   1 
ATOM   3210 C  CA  . ASP A 1 393 ? -43.722 6.083   35.778  1.00 28.53 ? 436 ASP A CA  1 
ATOM   3211 C  C   . ASP A 1 393 ? -44.028 6.881   37.039  1.00 28.58 ? 436 ASP A C   1 
ATOM   3212 O  O   . ASP A 1 393 ? -45.013 6.607   37.727  1.00 28.06 ? 436 ASP A O   1 
ATOM   3213 C  CB  . ASP A 1 393 ? -45.024 5.735   35.051  1.00 28.70 ? 436 ASP A CB  1 
ATOM   3214 C  CG  . ASP A 1 393 ? -45.854 6.978   34.675  1.00 29.70 ? 436 ASP A CG  1 
ATOM   3215 O  OD1 . ASP A 1 393 ? -45.451 8.130   34.990  1.00 29.56 ? 436 ASP A OD1 1 
ATOM   3216 O  OD2 . ASP A 1 393 ? -46.928 6.794   34.058  1.00 30.60 ? 436 ASP A OD2 1 
ATOM   3217 N  N   . PRO A 1 394 ? -43.187 7.892   37.332  1.00 28.77 ? 437 PRO A N   1 
ATOM   3218 C  CA  . PRO A 1 394 ? -43.374 8.720   38.516  1.00 28.66 ? 437 PRO A CA  1 
ATOM   3219 C  C   . PRO A 1 394 ? -44.681 9.507   38.518  1.00 28.81 ? 437 PRO A C   1 
ATOM   3220 O  O   . PRO A 1 394 ? -45.207 9.788   39.590  1.00 29.20 ? 437 PRO A O   1 
ATOM   3221 C  CB  . PRO A 1 394 ? -42.171 9.669   38.466  1.00 28.97 ? 437 PRO A CB  1 
ATOM   3222 C  CG  . PRO A 1 394 ? -41.142 8.936   37.655  1.00 28.26 ? 437 PRO A CG  1 
ATOM   3223 C  CD  . PRO A 1 394 ? -41.934 8.221   36.623  1.00 28.38 ? 437 PRO A CD  1 
ATOM   3224 N  N   . THR A 1 395 ? -45.210 9.854   37.346  1.00 28.84 ? 438 THR A N   1 
ATOM   3225 C  CA  . THR A 1 395 ? -46.452 10.660  37.276  1.00 29.04 ? 438 THR A CA  1 
ATOM   3226 C  C   . THR A 1 395 ? -47.620 9.963   37.975  1.00 29.31 ? 438 THR A C   1 
ATOM   3227 O  O   . THR A 1 395 ? -48.506 10.609  38.527  1.00 29.47 ? 438 THR A O   1 
ATOM   3228 C  CB  . THR A 1 395 ? -46.864 11.043  35.821  1.00 28.97 ? 438 THR A CB  1 
ATOM   3229 O  OG1 . THR A 1 395 ? -47.379 9.894   35.132  1.00 29.26 ? 438 THR A OG1 1 
ATOM   3230 C  CG2 . THR A 1 395 ? -45.676 11.636  35.035  1.00 28.00 ? 438 THR A CG2 1 
ATOM   3231 N  N   . ARG A 1 396 ? -47.601 8.635   37.934  1.00 29.55 ? 439 ARG A N   1 
ATOM   3232 C  CA  . ARG A 1 396 ? -48.499 7.773   38.691  1.00 29.93 ? 439 ARG A CA  1 
ATOM   3233 C  C   . ARG A 1 396 ? -48.829 8.280   40.114  1.00 30.60 ? 439 ARG A C   1 
ATOM   3234 O  O   . ARG A 1 396 ? -49.960 8.143   40.567  1.00 30.87 ? 439 ARG A O   1 
ATOM   3235 C  CB  . ARG A 1 396 ? -47.864 6.391   38.723  1.00 29.53 ? 439 ARG A CB  1 
ATOM   3236 C  CG  . ARG A 1 396 ? -48.503 5.376   39.587  1.00 28.78 ? 439 ARG A CG  1 
ATOM   3237 C  CD  . ARG A 1 396 ? -47.521 4.231   39.877  1.00 26.31 ? 439 ARG A CD  1 
ATOM   3238 N  NE  . ARG A 1 396 ? -46.904 3.628   38.683  1.00 22.92 ? 439 ARG A NE  1 
ATOM   3239 C  CZ  . ARG A 1 396 ? -47.503 2.786   37.838  1.00 21.13 ? 439 ARG A CZ  1 
ATOM   3240 N  NH1 . ARG A 1 396 ? -48.775 2.422   37.997  1.00 20.51 ? 439 ARG A NH1 1 
ATOM   3241 N  NH2 . ARG A 1 396 ? -46.818 2.299   36.818  1.00 19.91 ? 439 ARG A NH2 1 
ATOM   3242 N  N   . TRP A 1 397 ? -47.855 8.880   40.797  1.00 31.54 ? 440 TRP A N   1 
ATOM   3243 C  CA  . TRP A 1 397 ? -48.021 9.358   42.180  1.00 32.55 ? 440 TRP A CA  1 
ATOM   3244 C  C   . TRP A 1 397 ? -48.573 10.780  42.260  1.00 34.30 ? 440 TRP A C   1 
ATOM   3245 O  O   . TRP A 1 397 ? -48.940 11.259  43.339  1.00 34.16 ? 440 TRP A O   1 
ATOM   3246 C  CB  . TRP A 1 397 ? -46.691 9.268   42.935  1.00 32.03 ? 440 TRP A CB  1 
ATOM   3247 C  CG  . TRP A 1 397 ? -46.185 7.866   43.012  1.00 30.59 ? 440 TRP A CG  1 
ATOM   3248 C  CD1 . TRP A 1 397 ? -45.239 7.288   42.213  1.00 28.47 ? 440 TRP A CD1 1 
ATOM   3249 C  CD2 . TRP A 1 397 ? -46.635 6.845   43.911  1.00 28.31 ? 440 TRP A CD2 1 
ATOM   3250 N  NE1 . TRP A 1 397 ? -45.072 5.972   42.562  1.00 28.20 ? 440 TRP A NE1 1 
ATOM   3251 C  CE2 . TRP A 1 397 ? -45.905 5.678   43.612  1.00 27.99 ? 440 TRP A CE2 1 
ATOM   3252 C  CE3 . TRP A 1 397 ? -47.579 6.809   44.951  1.00 28.12 ? 440 TRP A CE3 1 
ATOM   3253 C  CZ2 . TRP A 1 397 ? -46.091 4.472   44.313  1.00 27.51 ? 440 TRP A CZ2 1 
ATOM   3254 C  CZ3 . TRP A 1 397 ? -47.761 5.610   45.654  1.00 27.13 ? 440 TRP A CZ3 1 
ATOM   3255 C  CH2 . TRP A 1 397 ? -47.023 4.460   45.324  1.00 26.25 ? 440 TRP A CH2 1 
ATOM   3256 N  N   . LEU A 1 398 ? -48.623 11.447  41.107  1.00 36.37 ? 441 LEU A N   1 
ATOM   3257 C  CA  . LEU A 1 398 ? -49.150 12.801  41.011  1.00 38.51 ? 441 LEU A CA  1 
ATOM   3258 C  C   . LEU A 1 398 ? -50.642 12.829  40.674  1.00 40.41 ? 441 LEU A C   1 
ATOM   3259 O  O   . LEU A 1 398 ? -51.335 13.798  41.012  1.00 41.01 ? 441 LEU A O   1 
ATOM   3260 C  CB  . LEU A 1 398 ? -48.331 13.637  40.022  1.00 37.88 ? 441 LEU A CB  1 
ATOM   3261 C  CG  . LEU A 1 398 ? -46.872 13.902  40.438  1.00 37.80 ? 441 LEU A CG  1 
ATOM   3262 C  CD1 . LEU A 1 398 ? -46.156 14.728  39.389  1.00 36.46 ? 441 LEU A CD1 1 
ATOM   3263 C  CD2 . LEU A 1 398 ? -46.748 14.564  41.831  1.00 36.65 ? 441 LEU A CD2 1 
ATOM   3264 N  N   . SER A 1 399 ? -51.132 11.759  40.044  1.00 42.59 ? 442 SER A N   1 
ATOM   3265 C  CA  . SER A 1 399 ? -52.537 11.642  39.641  1.00 44.84 ? 442 SER A CA  1 
ATOM   3266 C  C   . SER A 1 399 ? -53.497 12.185  40.702  1.00 46.20 ? 442 SER A C   1 
ATOM   3267 O  O   . SER A 1 399 ? -53.385 11.849  41.884  1.00 46.50 ? 442 SER A O   1 
ATOM   3268 C  CB  . SER A 1 399 ? -52.878 10.183  39.317  1.00 45.04 ? 442 SER A CB  1 
ATOM   3269 O  OG  . SER A 1 399 ? -54.260 10.019  39.042  1.00 45.70 ? 442 SER A OG  1 
ATOM   3270 N  N   . LYS A 1 400 ? -54.426 13.041  40.283  1.00 48.00 ? 443 LYS A N   1 
ATOM   3271 C  CA  . LYS A 1 400 ? -55.418 13.579  41.223  1.00 49.59 ? 443 LYS A CA  1 
ATOM   3272 C  C   . LYS A 1 400 ? -56.554 12.582  41.508  1.00 50.08 ? 443 LYS A C   1 
ATOM   3273 O  O   . LYS A 1 400 ? -57.380 12.812  42.393  1.00 50.40 ? 443 LYS A O   1 
ATOM   3274 C  CB  . LYS A 1 400 ? -55.960 14.942  40.775  1.00 49.84 ? 443 LYS A CB  1 
ATOM   3275 C  CG  . LYS A 1 400 ? -56.445 15.801  41.944  1.00 51.40 ? 443 LYS A CG  1 
ATOM   3276 C  CD  . LYS A 1 400 ? -57.066 17.114  41.476  1.00 54.23 ? 443 LYS A CD  1 
ATOM   3277 C  CE  . LYS A 1 400 ? -57.964 17.719  42.558  1.00 54.76 ? 443 LYS A CE  1 
ATOM   3278 N  NZ  . LYS A 1 400 ? -58.442 19.069  42.152  1.00 55.83 ? 443 LYS A NZ  1 
ATOM   3279 N  N   . ASP A 1 401 ? -56.572 11.473  40.767  1.00 50.58 ? 444 ASP A N   1 
ATOM   3280 C  CA  . ASP A 1 401 ? -57.397 10.317  41.106  1.00 50.94 ? 444 ASP A CA  1 
ATOM   3281 C  C   . ASP A 1 401 ? -56.787 9.625   42.331  1.00 51.11 ? 444 ASP A C   1 
ATOM   3282 O  O   . ASP A 1 401 ? -56.006 8.670   42.212  1.00 51.30 ? 444 ASP A O   1 
ATOM   3283 C  CB  . ASP A 1 401 ? -57.505 9.361   39.906  1.00 51.00 ? 444 ASP A CB  1 
ATOM   3284 C  CG  . ASP A 1 401 ? -58.384 8.149   40.186  1.00 51.25 ? 444 ASP A CG  1 
ATOM   3285 O  OD1 . ASP A 1 401 ? -59.086 8.128   41.225  1.00 51.02 ? 444 ASP A OD1 1 
ATOM   3286 O  OD2 . ASP A 1 401 ? -58.366 7.211   39.357  1.00 51.61 ? 444 ASP A OD2 1 
ATOM   3287 N  N   . LYS A 1 402 ? -57.149 10.121  43.511  1.00 51.19 ? 445 LYS A N   1 
ATOM   3288 C  CA  . LYS A 1 402 ? -56.607 9.610   44.770  1.00 51.24 ? 445 LYS A CA  1 
ATOM   3289 C  C   . LYS A 1 402 ? -57.308 8.318   45.216  1.00 51.04 ? 445 LYS A C   1 
ATOM   3290 O  O   . LYS A 1 402 ? -57.571 8.090   46.398  1.00 51.29 ? 445 LYS A O   1 
ATOM   3291 C  CB  . LYS A 1 402 ? -56.632 10.700  45.848  1.00 51.49 ? 445 LYS A CB  1 
ATOM   3292 C  CG  . LYS A 1 402 ? -55.868 11.968  45.440  1.00 52.13 ? 445 LYS A CG  1 
ATOM   3293 C  CD  . LYS A 1 402 ? -55.697 12.907  46.615  1.00 53.30 ? 445 LYS A CD  1 
ATOM   3294 C  CE  . LYS A 1 402 ? -54.757 14.050  46.274  1.00 54.13 ? 445 LYS A CE  1 
ATOM   3295 N  NZ  . LYS A 1 402 ? -54.258 14.691  47.523  1.00 53.96 ? 445 LYS A NZ  1 
ATOM   3296 N  N   . ASN A 1 403 ? -57.614 7.488   44.228  1.00 50.48 ? 446 ASN A N   1 
ATOM   3297 C  CA  . ASN A 1 403 ? -58.004 6.107   44.423  1.00 49.94 ? 446 ASN A CA  1 
ATOM   3298 C  C   . ASN A 1 403 ? -56.805 5.286   43.960  1.00 48.87 ? 446 ASN A C   1 
ATOM   3299 O  O   . ASN A 1 403 ? -56.545 4.190   44.453  1.00 48.90 ? 446 ASN A O   1 
ATOM   3300 C  CB  . ASN A 1 403 ? -59.272 5.816   43.602  1.00 50.44 ? 446 ASN A CB  1 
ATOM   3301 C  CG  . ASN A 1 403 ? -59.360 4.370   43.108  1.00 52.39 ? 446 ASN A CG  1 
ATOM   3302 O  OD1 . ASN A 1 403 ? -59.362 3.424   43.901  1.00 54.94 ? 446 ASN A OD1 1 
ATOM   3303 N  ND2 . ASN A 1 403 ? -59.462 4.199   41.789  1.00 53.86 ? 446 ASN A ND2 1 
ATOM   3304 N  N   . ILE A 1 404 ? -56.048 5.867   43.036  1.00 47.49 ? 447 ILE A N   1 
ATOM   3305 C  CA  . ILE A 1 404 ? -54.894 5.216   42.431  1.00 46.16 ? 447 ILE A CA  1 
ATOM   3306 C  C   . ILE A 1 404 ? -53.686 5.070   43.383  1.00 44.92 ? 447 ILE A C   1 
ATOM   3307 O  O   . ILE A 1 404 ? -52.811 4.230   43.159  1.00 44.85 ? 447 ILE A O   1 
ATOM   3308 C  CB  . ILE A 1 404 ? -54.530 5.899   41.061  1.00 46.24 ? 447 ILE A CB  1 
ATOM   3309 C  CG1 . ILE A 1 404 ? -55.172 5.106   39.910  1.00 46.51 ? 447 ILE A CG1 1 
ATOM   3310 C  CG2 . ILE A 1 404 ? -53.005 6.071   40.883  1.00 46.31 ? 447 ILE A CG2 1 
ATOM   3311 C  CD1 . ILE A 1 404 ? -54.704 5.463   38.501  1.00 46.46 ? 447 ILE A CD1 1 
ATOM   3312 N  N   . THR A 1 405 ? -53.650 5.864   44.448  1.00 43.15 ? 448 THR A N   1 
ATOM   3313 C  CA  . THR A 1 405 ? -52.513 5.837   45.375  1.00 41.65 ? 448 THR A CA  1 
ATOM   3314 C  C   . THR A 1 405 ? -52.896 5.454   46.814  1.00 40.27 ? 448 THR A C   1 
ATOM   3315 O  O   . THR A 1 405 ? -52.083 5.574   47.736  1.00 40.14 ? 448 THR A O   1 
ATOM   3316 C  CB  . THR A 1 405 ? -51.732 7.186   45.385  1.00 41.66 ? 448 THR A CB  1 
ATOM   3317 O  OG1 . THR A 1 405 ? -52.581 8.228   45.882  1.00 42.24 ? 448 THR A OG1 1 
ATOM   3318 C  CG2 . THR A 1 405 ? -51.237 7.543   43.993  1.00 41.34 ? 448 THR A CG2 1 
ATOM   3319 N  N   . TYR A 1 406 ? -54.128 4.988   46.998  1.00 38.53 ? 449 TYR A N   1 
ATOM   3320 C  CA  . TYR A 1 406 ? -54.612 4.570   48.310  1.00 36.68 ? 449 TYR A CA  1 
ATOM   3321 C  C   . TYR A 1 406 ? -53.761 3.412   48.849  1.00 35.38 ? 449 TYR A C   1 
ATOM   3322 O  O   . TYR A 1 406 ? -53.689 2.354   48.217  1.00 35.14 ? 449 TYR A O   1 
ATOM   3323 C  CB  . TYR A 1 406 ? -56.086 4.154   48.207  1.00 36.73 ? 449 TYR A CB  1 
ATOM   3324 C  CG  . TYR A 1 406 ? -56.758 3.907   49.539  1.00 36.80 ? 449 TYR A CG  1 
ATOM   3325 C  CD1 . TYR A 1 406 ? -56.850 4.925   50.493  1.00 37.01 ? 449 TYR A CD1 1 
ATOM   3326 C  CD2 . TYR A 1 406 ? -57.310 2.661   49.845  1.00 35.89 ? 449 TYR A CD2 1 
ATOM   3327 C  CE1 . TYR A 1 406 ? -57.469 4.708   51.720  1.00 37.13 ? 449 TYR A CE1 1 
ATOM   3328 C  CE2 . TYR A 1 406 ? -57.933 2.438   51.067  1.00 35.73 ? 449 TYR A CE2 1 
ATOM   3329 C  CZ  . TYR A 1 406 ? -58.006 3.464   52.001  1.00 36.47 ? 449 TYR A CZ  1 
ATOM   3330 O  OH  . TYR A 1 406 ? -58.622 3.264   53.219  1.00 37.20 ? 449 TYR A OH  1 
ATOM   3331 N  N   . PHE A 1 407 ? -53.120 3.629   50.002  1.00 33.39 ? 450 PHE A N   1 
ATOM   3332 C  CA  . PHE A 1 407 ? -52.192 2.661   50.614  1.00 31.44 ? 450 PHE A CA  1 
ATOM   3333 C  C   . PHE A 1 407 ? -51.269 1.951   49.606  1.00 30.37 ? 450 PHE A C   1 
ATOM   3334 O  O   . PHE A 1 407 ? -51.227 0.717   49.528  1.00 30.07 ? 450 PHE A O   1 
ATOM   3335 C  CB  . PHE A 1 407 ? -52.948 1.657   51.503  1.00 31.55 ? 450 PHE A CB  1 
ATOM   3336 C  CG  . PHE A 1 407 ? -53.303 2.199   52.870  1.00 31.05 ? 450 PHE A CG  1 
ATOM   3337 C  CD1 . PHE A 1 407 ? -54.404 3.040   53.042  1.00 29.44 ? 450 PHE A CD1 1 
ATOM   3338 C  CD2 . PHE A 1 407 ? -52.529 1.875   53.982  1.00 29.88 ? 450 PHE A CD2 1 
ATOM   3339 C  CE1 . PHE A 1 407 ? -54.723 3.543   54.288  1.00 28.79 ? 450 PHE A CE1 1 
ATOM   3340 C  CE2 . PHE A 1 407 ? -52.846 2.379   55.240  1.00 28.58 ? 450 PHE A CE2 1 
ATOM   3341 C  CZ  . PHE A 1 407 ? -53.944 3.214   55.390  1.00 29.18 ? 450 PHE A CZ  1 
ATOM   3342 N  N   . ARG A 1 408 ? -50.539 2.742   48.828  1.00 28.80 ? 451 ARG A N   1 
ATOM   3343 C  CA  . ARG A 1 408 ? -49.632 2.192   47.826  1.00 27.54 ? 451 ARG A CA  1 
ATOM   3344 C  C   . ARG A 1 408 ? -48.196 2.531   48.171  1.00 26.19 ? 451 ARG A C   1 
ATOM   3345 O  O   . ARG A 1 408 ? -47.285 1.818   47.787  1.00 25.95 ? 451 ARG A O   1 
ATOM   3346 C  CB  . ARG A 1 408 ? -49.956 2.724   46.423  1.00 27.93 ? 451 ARG A CB  1 
ATOM   3347 C  CG  . ARG A 1 408 ? -51.357 2.441   45.883  1.00 27.63 ? 451 ARG A CG  1 
ATOM   3348 C  CD  . ARG A 1 408 ? -51.568 0.985   45.625  1.00 26.49 ? 451 ARG A CD  1 
ATOM   3349 N  NE  . ARG A 1 408 ? -52.597 0.705   44.622  1.00 25.78 ? 451 ARG A NE  1 
ATOM   3350 C  CZ  . ARG A 1 408 ? -53.909 0.832   44.817  1.00 25.14 ? 451 ARG A CZ  1 
ATOM   3351 N  NH1 . ARG A 1 408 ? -54.388 1.306   45.957  1.00 22.84 ? 451 ARG A NH1 1 
ATOM   3352 N  NH2 . ARG A 1 408 ? -54.747 0.495   43.848  1.00 26.00 ? 451 ARG A NH2 1 
ATOM   3353 N  N   . ASN A 1 409 ? -48.011 3.633   48.890  1.00 25.21 ? 452 ASN A N   1 
ATOM   3354 C  CA  . ASN A 1 409 ? -46.687 4.145   49.238  1.00 24.22 ? 452 ASN A CA  1 
ATOM   3355 C  C   . ASN A 1 409 ? -46.231 3.533   50.557  1.00 23.42 ? 452 ASN A C   1 
ATOM   3356 O  O   . ASN A 1 409 ? -46.319 4.153   51.605  1.00 24.01 ? 452 ASN A O   1 
ATOM   3357 C  CB  . ASN A 1 409 ? -46.730 5.679   49.302  1.00 24.34 ? 452 ASN A CB  1 
ATOM   3358 C  CG  . ASN A 1 409 ? -45.352 6.323   49.489  1.00 24.74 ? 452 ASN A CG  1 
ATOM   3359 O  OD1 . ASN A 1 409 ? -44.314 5.763   49.129  1.00 24.80 ? 452 ASN A OD1 1 
ATOM   3360 N  ND2 . ASN A 1 409 ? -45.351 7.526   50.045  1.00 25.67 ? 452 ASN A ND2 1 
ATOM   3361 N  N   . LEU A 1 410 ? -45.745 2.303   50.498  1.00 22.42 ? 453 LEU A N   1 
ATOM   3362 C  CA  . LEU A 1 410 ? -45.496 1.520   51.708  1.00 21.76 ? 453 LEU A CA  1 
ATOM   3363 C  C   . LEU A 1 410 ? -44.027 1.168   51.964  1.00 21.33 ? 453 LEU A C   1 
ATOM   3364 O  O   . LEU A 1 410 ? -43.722 0.473   52.927  1.00 21.47 ? 453 LEU A O   1 
ATOM   3365 C  CB  . LEU A 1 410 ? -46.367 0.260   51.711  1.00 21.13 ? 453 LEU A CB  1 
ATOM   3366 C  CG  . LEU A 1 410 ? -47.883 0.525   51.735  1.00 21.10 ? 453 LEU A CG  1 
ATOM   3367 C  CD1 . LEU A 1 410 ? -48.668 -0.734  51.363  1.00 21.08 ? 453 LEU A CD1 1 
ATOM   3368 C  CD2 . LEU A 1 410 ? -48.327 1.056   53.086  1.00 18.30 ? 453 LEU A CD2 1 
ATOM   3369 N  N   . GLY A 1 411 ? -43.129 1.672   51.125  1.00 20.71 ? 454 GLY A N   1 
ATOM   3370 C  CA  . GLY A 1 411 ? -41.700 1.409   51.260  1.00 20.94 ? 454 GLY A CA  1 
ATOM   3371 C  C   . GLY A 1 411 ? -41.106 1.714   52.628  1.00 21.10 ? 454 GLY A C   1 
ATOM   3372 O  O   . GLY A 1 411 ? -40.224 0.983   53.092  1.00 21.57 ? 454 GLY A O   1 
ATOM   3373 N  N   . PHE A 1 412 ? -41.572 2.785   53.272  1.00 20.51 ? 455 PHE A N   1 
ATOM   3374 C  CA  . PHE A 1 412 ? -41.108 3.131   54.612  1.00 20.67 ? 455 PHE A CA  1 
ATOM   3375 C  C   . PHE A 1 412 ? -42.069 2.690   55.726  1.00 21.09 ? 455 PHE A C   1 
ATOM   3376 O  O   . PHE A 1 412 ? -41.846 3.015   56.893  1.00 21.76 ? 455 PHE A O   1 
ATOM   3377 C  CB  . PHE A 1 412 ? -40.829 4.635   54.755  1.00 20.15 ? 455 PHE A CB  1 
ATOM   3378 C  CG  . PHE A 1 412 ? -39.738 5.155   53.854  1.00 19.19 ? 455 PHE A CG  1 
ATOM   3379 C  CD1 . PHE A 1 412 ? -40.057 5.803   52.661  1.00 17.39 ? 455 PHE A CD1 1 
ATOM   3380 C  CD2 . PHE A 1 412 ? -38.399 5.032   54.216  1.00 18.62 ? 455 PHE A CD2 1 
ATOM   3381 C  CE1 . PHE A 1 412 ? -39.065 6.295   51.831  1.00 17.76 ? 455 PHE A CE1 1 
ATOM   3382 C  CE2 . PHE A 1 412 ? -37.385 5.524   53.389  1.00 19.45 ? 455 PHE A CE2 1 
ATOM   3383 C  CZ  . PHE A 1 412 ? -37.718 6.160   52.191  1.00 19.51 ? 455 PHE A CZ  1 
ATOM   3384 N  N   . GLY A 1 413 ? -43.117 1.949   55.389  1.00 21.28 ? 456 GLY A N   1 
ATOM   3385 C  CA  . GLY A 1 413 ? -44.059 1.490   56.409  1.00 22.28 ? 456 GLY A CA  1 
ATOM   3386 C  C   . GLY A 1 413 ? -45.156 2.493   56.756  1.00 22.84 ? 456 GLY A C   1 
ATOM   3387 O  O   . GLY A 1 413 ? -45.469 3.384   55.971  1.00 22.72 ? 456 GLY A O   1 
ATOM   3388 N  N   . TRP A 1 414 ? -45.728 2.359   57.945  1.00 23.42 ? 457 TRP A N   1 
ATOM   3389 C  CA  . TRP A 1 414 ? -46.928 3.106   58.290  1.00 24.39 ? 457 TRP A CA  1 
ATOM   3390 C  C   . TRP A 1 414 ? -46.993 3.437   59.774  1.00 23.83 ? 457 TRP A C   1 
ATOM   3391 O  O   . TRP A 1 414 ? -46.508 2.666   60.613  1.00 23.90 ? 457 TRP A O   1 
ATOM   3392 C  CB  . TRP A 1 414 ? -48.167 2.292   57.907  1.00 25.17 ? 457 TRP A CB  1 
ATOM   3393 C  CG  . TRP A 1 414 ? -49.442 3.070   57.961  1.00 29.07 ? 457 TRP A CG  1 
ATOM   3394 C  CD1 . TRP A 1 414 ? -49.996 3.794   56.944  1.00 31.49 ? 457 TRP A CD1 1 
ATOM   3395 C  CD2 . TRP A 1 414 ? -50.332 3.213   59.088  1.00 32.85 ? 457 TRP A CD2 1 
ATOM   3396 N  NE1 . TRP A 1 414 ? -51.168 4.387   57.361  1.00 33.29 ? 457 TRP A NE1 1 
ATOM   3397 C  CE2 . TRP A 1 414 ? -51.404 4.049   58.669  1.00 33.69 ? 457 TRP A CE2 1 
ATOM   3398 C  CE3 . TRP A 1 414 ? -50.324 2.727   60.412  1.00 33.56 ? 457 TRP A CE3 1 
ATOM   3399 C  CZ2 . TRP A 1 414 ? -52.467 4.407   59.521  1.00 34.46 ? 457 TRP A CZ2 1 
ATOM   3400 C  CZ3 . TRP A 1 414 ? -51.378 3.083   61.263  1.00 35.36 ? 457 TRP A CZ3 1 
ATOM   3401 C  CH2 . TRP A 1 414 ? -52.438 3.920   60.808  1.00 35.88 ? 457 TRP A CH2 1 
ATOM   3402 N  N   . GLY A 1 415 ? -47.600 4.580   60.083  1.00 22.87 ? 458 GLY A N   1 
ATOM   3403 C  CA  . GLY A 1 415 ? -47.964 4.911   61.444  1.00 22.39 ? 458 GLY A CA  1 
ATOM   3404 C  C   . GLY A 1 415 ? -46.786 5.195   62.328  1.00 22.48 ? 458 GLY A C   1 
ATOM   3405 O  O   . GLY A 1 415 ? -45.715 5.551   61.838  1.00 22.67 ? 458 GLY A O   1 
ATOM   3406 N  N   . VAL A 1 416 ? -46.987 5.031   63.638  1.00 22.51 ? 459 VAL A N   1 
ATOM   3407 C  CA  . VAL A 1 416 ? -45.994 5.427   64.647  1.00 21.87 ? 459 VAL A CA  1 
ATOM   3408 C  C   . VAL A 1 416 ? -44.688 4.653   64.567  1.00 21.53 ? 459 VAL A C   1 
ATOM   3409 O  O   . VAL A 1 416 ? -43.666 5.126   65.076  1.00 21.51 ? 459 VAL A O   1 
ATOM   3410 C  CB  . VAL A 1 416 ? -46.554 5.337   66.104  1.00 22.27 ? 459 VAL A CB  1 
ATOM   3411 C  CG1 . VAL A 1 416 ? -47.595 6.417   66.341  1.00 21.89 ? 459 VAL A CG1 1 
ATOM   3412 C  CG2 . VAL A 1 416 ? -47.134 3.954   66.392  1.00 21.54 ? 459 VAL A CG2 1 
ATOM   3413 N  N   . ARG A 1 417 ? -44.719 3.475   63.938  1.00 21.07 ? 460 ARG A N   1 
ATOM   3414 C  CA  . ARG A 1 417 ? -43.530 2.612   63.860  1.00 20.72 ? 460 ARG A CA  1 
ATOM   3415 C  C   . ARG A 1 417 ? -43.022 2.379   62.422  1.00 20.91 ? 460 ARG A C   1 
ATOM   3416 O  O   . ARG A 1 417 ? -42.298 1.410   62.130  1.00 21.06 ? 460 ARG A O   1 
ATOM   3417 C  CB  . ARG A 1 417 ? -43.741 1.303   64.638  1.00 20.49 ? 460 ARG A CB  1 
ATOM   3418 C  CG  . ARG A 1 417 ? -42.444 0.587   64.943  1.00 20.04 ? 460 ARG A CG  1 
ATOM   3419 C  CD  . ARG A 1 417 ? -42.599 -0.549  65.925  1.00 18.90 ? 460 ARG A CD  1 
ATOM   3420 N  NE  . ARG A 1 417 ? -41.301 -0.936  66.490  1.00 17.01 ? 460 ARG A NE  1 
ATOM   3421 C  CZ  . ARG A 1 417 ? -41.129 -1.864  67.427  1.00 15.92 ? 460 ARG A CZ  1 
ATOM   3422 N  NH1 . ARG A 1 417 ? -42.164 -2.526  67.920  1.00 14.62 ? 460 ARG A NH1 1 
ATOM   3423 N  NH2 . ARG A 1 417 ? -39.914 -2.141  67.864  1.00 15.83 ? 460 ARG A NH2 1 
ATOM   3424 N  N   . GLN A 1 418 ? -43.388 3.294   61.532  1.00 20.79 ? 461 GLN A N   1 
ATOM   3425 C  CA  . GLN A 1 418 ? -42.729 3.419   60.238  1.00 20.97 ? 461 GLN A CA  1 
ATOM   3426 C  C   . GLN A 1 418 ? -41.220 3.611   60.429  1.00 20.87 ? 461 GLN A C   1 
ATOM   3427 O  O   . GLN A 1 418 ? -40.761 3.874   61.553  1.00 20.80 ? 461 GLN A O   1 
ATOM   3428 C  CB  . GLN A 1 418 ? -43.303 4.614   59.486  1.00 21.15 ? 461 GLN A CB  1 
ATOM   3429 C  CG  . GLN A 1 418 ? -42.869 5.958   60.040  1.00 22.84 ? 461 GLN A CG  1 
ATOM   3430 C  CD  . GLN A 1 418 ? -43.626 7.095   59.415  1.00 25.23 ? 461 GLN A CD  1 
ATOM   3431 O  OE1 . GLN A 1 418 ? -44.621 7.553   59.967  1.00 28.51 ? 461 GLN A OE1 1 
ATOM   3432 N  NE2 . GLN A 1 418 ? -43.193 7.531   58.235  1.00 25.18 ? 461 GLN A NE2 1 
ATOM   3433 N  N   . CYS A 1 419 ? -40.457 3.480   59.338  1.00 20.26 ? 462 CYS A N   1 
ATOM   3434 C  CA  . CYS A 1 419 ? -39.032 3.775   59.346  1.00 19.44 ? 462 CYS A CA  1 
ATOM   3435 C  C   . CYS A 1 419 ? -38.705 4.993   60.212  1.00 19.90 ? 462 CYS A C   1 
ATOM   3436 O  O   . CYS A 1 419 ? -39.299 6.076   60.034  1.00 19.98 ? 462 CYS A O   1 
ATOM   3437 C  CB  . CYS A 1 419 ? -38.559 4.056   57.921  1.00 19.34 ? 462 CYS A CB  1 
ATOM   3438 S  SG  . CYS A 1 419 ? -36.763 4.093   57.753  1.00 18.18 ? 462 CYS A SG  1 
ATOM   3439 N  N   . LEU A 1 420 ? -37.762 4.827   61.137  1.00 19.69 ? 463 LEU A N   1 
ATOM   3440 C  CA  . LEU A 1 420 ? -37.257 5.962   61.914  1.00 19.50 ? 463 LEU A CA  1 
ATOM   3441 C  C   . LEU A 1 420 ? -36.387 6.864   61.042  1.00 19.92 ? 463 LEU A C   1 
ATOM   3442 O  O   . LEU A 1 420 ? -36.292 8.074   61.279  1.00 20.23 ? 463 LEU A O   1 
ATOM   3443 C  CB  . LEU A 1 420 ? -36.468 5.487   63.141  1.00 19.12 ? 463 LEU A CB  1 
ATOM   3444 C  CG  . LEU A 1 420 ? -35.805 6.537   64.047  1.00 17.88 ? 463 LEU A CG  1 
ATOM   3445 C  CD1 . LEU A 1 420 ? -36.853 7.408   64.745  1.00 17.81 ? 463 LEU A CD1 1 
ATOM   3446 C  CD2 . LEU A 1 420 ? -34.896 5.877   65.081  1.00 16.06 ? 463 LEU A CD2 1 
ATOM   3447 N  N   . GLY A 1 421 ? -35.748 6.275   60.034  1.00 19.97 ? 464 GLY A N   1 
ATOM   3448 C  CA  . GLY A 1 421 ? -34.792 7.011   59.222  1.00 19.82 ? 464 GLY A CA  1 
ATOM   3449 C  C   . GLY A 1 421 ? -35.410 7.540   57.952  1.00 19.93 ? 464 GLY A C   1 
ATOM   3450 O  O   . GLY A 1 421 ? -34.693 7.854   57.012  1.00 20.07 ? 464 GLY A O   1 
ATOM   3451 N  N   . ARG A 1 422 ? -36.738 7.645   57.924  1.00 19.83 ? 465 ARG A N   1 
ATOM   3452 C  CA  . ARG A 1 422 ? -37.448 7.999   56.698  1.00 20.35 ? 465 ARG A CA  1 
ATOM   3453 C  C   . ARG A 1 422 ? -37.089 9.395   56.187  1.00 20.54 ? 465 ARG A C   1 
ATOM   3454 O  O   . ARG A 1 422 ? -36.862 9.595   54.991  1.00 20.87 ? 465 ARG A O   1 
ATOM   3455 C  CB  . ARG A 1 422 ? -38.961 7.878   56.883  1.00 20.28 ? 465 ARG A CB  1 
ATOM   3456 C  CG  . ARG A 1 422 ? -39.723 8.343   55.670  1.00 20.73 ? 465 ARG A CG  1 
ATOM   3457 C  CD  . ARG A 1 422 ? -41.218 8.269   55.868  1.00 20.17 ? 465 ARG A CD  1 
ATOM   3458 N  NE  . ARG A 1 422 ? -41.893 8.295   54.579  1.00 19.05 ? 465 ARG A NE  1 
ATOM   3459 C  CZ  . ARG A 1 422 ? -43.121 7.845   54.370  1.00 20.46 ? 465 ARG A CZ  1 
ATOM   3460 N  NH1 . ARG A 1 422 ? -43.825 7.331   55.367  1.00 22.60 ? 465 ARG A NH1 1 
ATOM   3461 N  NH2 . ARG A 1 422 ? -43.646 7.896   53.159  1.00 21.98 ? 465 ARG A NH2 1 
ATOM   3462 N  N   . ARG A 1 423 ? -37.026 10.358  57.091  1.00 20.42 ? 466 ARG A N   1 
ATOM   3463 C  CA  . ARG A 1 423 ? -36.680 11.712  56.693  1.00 20.45 ? 466 ARG A CA  1 
ATOM   3464 C  C   . ARG A 1 423 ? -35.225 11.824  56.276  1.00 19.74 ? 466 ARG A C   1 
ATOM   3465 O  O   . ARG A 1 423 ? -34.919 12.520  55.314  1.00 20.09 ? 466 ARG A O   1 
ATOM   3466 C  CB  . ARG A 1 423 ? -37.028 12.703  57.795  1.00 20.80 ? 466 ARG A CB  1 
ATOM   3467 C  CG  . ARG A 1 423 ? -38.477 12.630  58.214  1.00 22.57 ? 466 ARG A CG  1 
ATOM   3468 C  CD  . ARG A 1 423 ? -39.345 13.505  57.341  1.00 28.04 ? 466 ARG A CD  1 
ATOM   3469 N  NE  . ARG A 1 423 ? -40.051 12.785  56.280  1.00 32.06 ? 466 ARG A NE  1 
ATOM   3470 C  CZ  . ARG A 1 423 ? -41.226 12.161  56.423  1.00 34.19 ? 466 ARG A CZ  1 
ATOM   3471 N  NH1 . ARG A 1 423 ? -41.842 12.132  57.606  1.00 35.71 ? 466 ARG A NH1 1 
ATOM   3472 N  NH2 . ARG A 1 423 ? -41.790 11.556  55.377  1.00 33.46 ? 466 ARG A NH2 1 
ATOM   3473 N  N   . ILE A 1 424 ? -34.335 11.130  56.981  1.00 19.14 ? 467 ILE A N   1 
ATOM   3474 C  CA  . ILE A 1 424 ? -32.913 11.108  56.619  1.00 18.04 ? 467 ILE A CA  1 
ATOM   3475 C  C   . ILE A 1 424 ? -32.758 10.504  55.224  1.00 18.21 ? 467 ILE A C   1 
ATOM   3476 O  O   . ILE A 1 424 ? -32.017 11.024  54.379  1.00 18.02 ? 467 ILE A O   1 
ATOM   3477 C  CB  . ILE A 1 424 ? -32.063 10.335  57.678  1.00 17.95 ? 467 ILE A CB  1 
ATOM   3478 C  CG1 . ILE A 1 424 ? -32.048 11.103  59.013  1.00 17.01 ? 467 ILE A CG1 1 
ATOM   3479 C  CG2 . ILE A 1 424 ? -30.651 10.036  57.171  1.00 16.34 ? 467 ILE A CG2 1 
ATOM   3480 C  CD1 . ILE A 1 424 ? -31.262 10.447  60.119  1.00 14.68 ? 467 ILE A CD1 1 
ATOM   3481 N  N   . ALA A 1 425 ? -33.493 9.422   54.974  1.00 17.94 ? 468 ALA A N   1 
ATOM   3482 C  CA  . ALA A 1 425 ? -33.381 8.712   53.711  1.00 17.64 ? 468 ALA A CA  1 
ATOM   3483 C  C   . ALA A 1 425 ? -33.969 9.553   52.580  1.00 17.46 ? 468 ALA A C   1 
ATOM   3484 O  O   . ALA A 1 425 ? -33.313 9.746   51.561  1.00 17.91 ? 468 ALA A O   1 
ATOM   3485 C  CB  . ALA A 1 425 ? -34.056 7.330   53.794  1.00 17.39 ? 468 ALA A CB  1 
ATOM   3486 N  N   . GLU A 1 426 ? -35.187 10.063  52.768  1.00 17.39 ? 469 GLU A N   1 
ATOM   3487 C  CA  . GLU A 1 426 ? -35.854 10.895  51.752  1.00 17.65 ? 469 GLU A CA  1 
ATOM   3488 C  C   . GLU A 1 426 ? -34.978 12.082  51.396  1.00 17.89 ? 469 GLU A C   1 
ATOM   3489 O  O   . GLU A 1 426 ? -34.658 12.280  50.223  1.00 17.98 ? 469 GLU A O   1 
ATOM   3490 C  CB  . GLU A 1 426 ? -37.229 11.365  52.220  1.00 17.22 ? 469 GLU A CB  1 
ATOM   3491 C  CG  . GLU A 1 426 ? -38.310 10.318  52.033  1.00 18.47 ? 469 GLU A CG  1 
ATOM   3492 C  CD  . GLU A 1 426 ? -39.596 10.614  52.806  1.00 20.66 ? 469 GLU A CD  1 
ATOM   3493 O  OE1 . GLU A 1 426 ? -39.623 11.576  53.612  1.00 18.53 ? 469 GLU A OE1 1 
ATOM   3494 O  OE2 . GLU A 1 426 ? -40.580 9.861   52.607  1.00 21.50 ? 469 GLU A OE2 1 
ATOM   3495 N  N   . LEU A 1 427 ? -34.552 12.829  52.417  1.00 17.94 ? 470 LEU A N   1 
ATOM   3496 C  CA  . LEU A 1 427 ? -33.702 14.004  52.227  1.00 18.21 ? 470 LEU A CA  1 
ATOM   3497 C  C   . LEU A 1 427 ? -32.360 13.667  51.578  1.00 18.44 ? 470 LEU A C   1 
ATOM   3498 O  O   . LEU A 1 427 ? -31.913 14.387  50.681  1.00 18.72 ? 470 LEU A O   1 
ATOM   3499 C  CB  . LEU A 1 427 ? -33.497 14.765  53.550  1.00 18.10 ? 470 LEU A CB  1 
ATOM   3500 C  CG  . LEU A 1 427 ? -34.696 15.437  54.243  1.00 17.29 ? 470 LEU A CG  1 
ATOM   3501 C  CD1 . LEU A 1 427 ? -34.315 15.926  55.624  1.00 15.54 ? 470 LEU A CD1 1 
ATOM   3502 C  CD2 . LEU A 1 427 ? -35.235 16.589  53.409  1.00 17.62 ? 470 LEU A CD2 1 
ATOM   3503 N  N   . GLU A 1 428 ? -31.732 12.578  52.019  1.00 18.58 ? 471 GLU A N   1 
ATOM   3504 C  CA  . GLU A 1 428 ? -30.441 12.160  51.483  1.00 18.80 ? 471 GLU A CA  1 
ATOM   3505 C  C   . GLU A 1 428 ? -30.549 11.763  50.011  1.00 18.75 ? 471 GLU A C   1 
ATOM   3506 O  O   . GLU A 1 428 ? -29.701 12.149  49.210  1.00 19.22 ? 471 GLU A O   1 
ATOM   3507 C  CB  . GLU A 1 428 ? -29.868 11.000  52.299  1.00 19.14 ? 471 GLU A CB  1 
ATOM   3508 C  CG  . GLU A 1 428 ? -28.586 10.376  51.766  1.00 19.49 ? 471 GLU A CG  1 
ATOM   3509 C  CD  . GLU A 1 428 ? -28.250 9.093   52.491  1.00 23.88 ? 471 GLU A CD  1 
ATOM   3510 O  OE1 . GLU A 1 428 ? -28.717 8.927   53.644  1.00 26.16 ? 471 GLU A OE1 1 
ATOM   3511 O  OE2 . GLU A 1 428 ? -27.520 8.236   51.929  1.00 25.49 ? 471 GLU A OE2 1 
ATOM   3512 N  N   . MET A 1 429 ? -31.584 11.002  49.660  1.00 18.00 ? 472 MET A N   1 
ATOM   3513 C  CA  . MET A 1 429 ? -31.752 10.552  48.283  1.00 17.60 ? 472 MET A CA  1 
ATOM   3514 C  C   . MET A 1 429 ? -32.175 11.684  47.360  1.00 17.60 ? 472 MET A C   1 
ATOM   3515 O  O   . MET A 1 429 ? -31.698 11.778  46.233  1.00 17.39 ? 472 MET A O   1 
ATOM   3516 C  CB  . MET A 1 429 ? -32.746 9.391   48.206  1.00 17.09 ? 472 MET A CB  1 
ATOM   3517 C  CG  . MET A 1 429 ? -32.202 8.099   48.822  1.00 16.91 ? 472 MET A CG  1 
ATOM   3518 S  SD  . MET A 1 429 ? -33.335 6.699   48.691  1.00 14.90 ? 472 MET A SD  1 
ATOM   3519 C  CE  . MET A 1 429 ? -34.695 7.221   49.739  1.00 15.02 ? 472 MET A CE  1 
ATOM   3520 N  N   . THR A 1 430 ? -33.088 12.530  47.828  1.00 17.83 ? 473 THR A N   1 
ATOM   3521 C  CA  . THR A 1 430 ? -33.554 13.642  47.013  1.00 18.27 ? 473 THR A CA  1 
ATOM   3522 C  C   . THR A 1 430 ? -32.395 14.605  46.709  1.00 18.41 ? 473 THR A C   1 
ATOM   3523 O  O   . THR A 1 430 ? -32.219 15.010  45.556  1.00 18.76 ? 473 THR A O   1 
ATOM   3524 C  CB  . THR A 1 430 ? -34.769 14.361  47.634  1.00 18.26 ? 473 THR A CB  1 
ATOM   3525 O  OG1 . THR A 1 430 ? -35.728 13.383  48.046  1.00 18.10 ? 473 THR A OG1 1 
ATOM   3526 C  CG2 . THR A 1 430 ? -35.429 15.261  46.604  1.00 17.91 ? 473 THR A CG2 1 
ATOM   3527 N  N   . ILE A 1 431 ? -31.584 14.912  47.726  1.00 18.21 ? 474 ILE A N   1 
ATOM   3528 C  CA  . ILE A 1 431 ? -30.406 15.771  47.563  1.00 17.67 ? 474 ILE A CA  1 
ATOM   3529 C  C   . ILE A 1 431 ? -29.333 15.102  46.698  1.00 17.88 ? 474 ILE A C   1 
ATOM   3530 O  O   . ILE A 1 431 ? -28.658 15.758  45.872  1.00 18.16 ? 474 ILE A O   1 
ATOM   3531 C  CB  . ILE A 1 431 ? -29.826 16.238  48.934  1.00 17.64 ? 474 ILE A CB  1 
ATOM   3532 C  CG1 . ILE A 1 431 ? -30.836 17.158  49.644  1.00 17.26 ? 474 ILE A CG1 1 
ATOM   3533 C  CG2 . ILE A 1 431 ? -28.524 17.010  48.735  1.00 17.22 ? 474 ILE A CG2 1 
ATOM   3534 C  CD1 . ILE A 1 431 ? -30.572 17.414  51.120  1.00 16.95 ? 474 ILE A CD1 1 
ATOM   3535 N  N   . PHE A 1 432 ? -29.178 13.795  46.872  1.00 17.35 ? 475 PHE A N   1 
ATOM   3536 C  CA  . PHE A 1 432 ? -28.211 13.070  46.084  1.00 16.85 ? 475 PHE A CA  1 
ATOM   3537 C  C   . PHE A 1 432 ? -28.578 13.214  44.607  1.00 16.84 ? 475 PHE A C   1 
ATOM   3538 O  O   . PHE A 1 432 ? -27.727 13.498  43.771  1.00 15.95 ? 475 PHE A O   1 
ATOM   3539 C  CB  . PHE A 1 432 ? -28.159 11.598  46.501  1.00 16.62 ? 475 PHE A CB  1 
ATOM   3540 C  CG  . PHE A 1 432 ? -27.280 10.754  45.625  1.00 16.02 ? 475 PHE A CG  1 
ATOM   3541 C  CD1 . PHE A 1 432 ? -25.934 10.592  45.924  1.00 15.81 ? 475 PHE A CD1 1 
ATOM   3542 C  CD2 . PHE A 1 432 ? -27.795 10.141  44.488  1.00 14.93 ? 475 PHE A CD2 1 
ATOM   3543 C  CE1 . PHE A 1 432 ? -25.117 9.809   45.108  1.00 17.40 ? 475 PHE A CE1 1 
ATOM   3544 C  CE2 . PHE A 1 432 ? -26.988 9.380   43.664  1.00 15.23 ? 475 PHE A CE2 1 
ATOM   3545 C  CZ  . PHE A 1 432 ? -25.646 9.207   43.973  1.00 16.16 ? 475 PHE A CZ  1 
ATOM   3546 N  N   . LEU A 1 433 ? -29.859 13.021  44.310  1.00 17.39 ? 476 LEU A N   1 
ATOM   3547 C  CA  . LEU A 1 433 ? -30.343 12.966  42.924  1.00 17.80 ? 476 LEU A CA  1 
ATOM   3548 C  C   . LEU A 1 433 ? -30.407 14.338  42.262  1.00 17.92 ? 476 LEU A C   1 
ATOM   3549 O  O   . LEU A 1 433 ? -30.184 14.446  41.051  1.00 18.14 ? 476 LEU A O   1 
ATOM   3550 C  CB  . LEU A 1 433 ? -31.681 12.229  42.826  1.00 17.33 ? 476 LEU A CB  1 
ATOM   3551 C  CG  . LEU A 1 433 ? -31.535 10.716  43.083  1.00 18.46 ? 476 LEU A CG  1 
ATOM   3552 C  CD1 . LEU A 1 433 ? -32.891 10.042  43.333  1.00 17.11 ? 476 LEU A CD1 1 
ATOM   3553 C  CD2 . LEU A 1 433 ? -30.739 10.015  41.948  1.00 18.54 ? 476 LEU A CD2 1 
ATOM   3554 N  N   . ILE A 1 434 ? -30.694 15.370  43.055  1.00 17.61 ? 477 ILE A N   1 
ATOM   3555 C  CA  . ILE A 1 434 ? -30.600 16.743  42.580  1.00 17.92 ? 477 ILE A CA  1 
ATOM   3556 C  C   . ILE A 1 434 ? -29.194 16.988  42.026  1.00 18.03 ? 477 ILE A C   1 
ATOM   3557 O  O   . ILE A 1 434 ? -29.037 17.395  40.872  1.00 18.36 ? 477 ILE A O   1 
ATOM   3558 C  CB  . ILE A 1 434 ? -30.942 17.774  43.701  1.00 17.74 ? 477 ILE A CB  1 
ATOM   3559 C  CG1 . ILE A 1 434 ? -32.453 17.821  43.932  1.00 17.44 ? 477 ILE A CG1 1 
ATOM   3560 C  CG2 . ILE A 1 434 ? -30.405 19.167  43.333  1.00 17.54 ? 477 ILE A CG2 1 
ATOM   3561 C  CD1 . ILE A 1 434 ? -32.902 18.735  45.070  1.00 18.55 ? 477 ILE A CD1 1 
ATOM   3562 N  N   . ASN A 1 435 ? -28.184 16.707  42.852  1.00 18.37 ? 478 ASN A N   1 
ATOM   3563 C  CA  . ASN A 1 435 ? -26.778 16.901  42.501  1.00 18.18 ? 478 ASN A CA  1 
ATOM   3564 C  C   . ASN A 1 435 ? -26.309 16.080  41.287  1.00 18.14 ? 478 ASN A C   1 
ATOM   3565 O  O   . ASN A 1 435 ? -25.636 16.603  40.386  1.00 17.73 ? 478 ASN A O   1 
ATOM   3566 C  CB  . ASN A 1 435 ? -25.899 16.679  43.731  1.00 18.20 ? 478 ASN A CB  1 
ATOM   3567 C  CG  . ASN A 1 435 ? -25.881 17.899  44.661  1.00 19.72 ? 478 ASN A CG  1 
ATOM   3568 O  OD1 . ASN A 1 435 ? -25.352 18.952  44.297  1.00 22.59 ? 478 ASN A OD1 1 
ATOM   3569 N  ND2 . ASN A 1 435 ? -26.467 17.769  45.847  1.00 19.18 ? 478 ASN A ND2 1 
ATOM   3570 N  N   . MET A 1 436 ? -26.700 14.814  41.239  1.00 18.17 ? 479 MET A N   1 
ATOM   3571 C  CA  . MET A 1 436 ? -26.364 13.972  40.101  1.00 18.63 ? 479 MET A CA  1 
ATOM   3572 C  C   . MET A 1 436 ? -27.013 14.478  38.804  1.00 19.19 ? 479 MET A C   1 
ATOM   3573 O  O   . MET A 1 436 ? -26.339 14.594  37.770  1.00 19.15 ? 479 MET A O   1 
ATOM   3574 C  CB  . MET A 1 436 ? -26.744 12.515  40.372  1.00 18.50 ? 479 MET A CB  1 
ATOM   3575 C  CG  . MET A 1 436 ? -25.924 11.847  41.474  1.00 17.98 ? 479 MET A CG  1 
ATOM   3576 S  SD  . MET A 1 436 ? -24.218 11.527  40.991  1.00 18.98 ? 479 MET A SD  1 
ATOM   3577 C  CE  . MET A 1 436 ? -24.470 10.256  39.747  1.00 16.03 ? 479 MET A CE  1 
ATOM   3578 N  N   . LEU A 1 437 ? -28.311 14.788  38.865  1.00 19.66 ? 480 LEU A N   1 
ATOM   3579 C  CA  . LEU A 1 437 ? -29.053 15.227  37.685  1.00 20.24 ? 480 LEU A CA  1 
ATOM   3580 C  C   . LEU A 1 437 ? -28.488 16.508  37.074  1.00 21.04 ? 480 LEU A C   1 
ATOM   3581 O  O   . LEU A 1 437 ? -28.517 16.687  35.865  1.00 20.75 ? 480 LEU A O   1 
ATOM   3582 C  CB  . LEU A 1 437 ? -30.541 15.356  37.993  1.00 19.84 ? 480 LEU A CB  1 
ATOM   3583 C  CG  . LEU A 1 437 ? -31.274 14.000  37.983  1.00 20.87 ? 480 LEU A CG  1 
ATOM   3584 C  CD1 . LEU A 1 437 ? -32.702 14.093  38.555  1.00 19.87 ? 480 LEU A CD1 1 
ATOM   3585 C  CD2 . LEU A 1 437 ? -31.280 13.369  36.583  1.00 19.85 ? 480 LEU A CD2 1 
ATOM   3586 N  N   . GLU A 1 438 ? -27.954 17.381  37.920  1.00 22.27 ? 481 GLU A N   1 
ATOM   3587 C  CA  . GLU A 1 438 ? -27.351 18.632  37.472  1.00 23.40 ? 481 GLU A CA  1 
ATOM   3588 C  C   . GLU A 1 438 ? -26.011 18.402  36.791  1.00 23.46 ? 481 GLU A C   1 
ATOM   3589 O  O   . GLU A 1 438 ? -25.581 19.233  35.989  1.00 24.24 ? 481 GLU A O   1 
ATOM   3590 C  CB  . GLU A 1 438 ? -27.170 19.612  38.644  1.00 23.71 ? 481 GLU A CB  1 
ATOM   3591 C  CG  . GLU A 1 438 ? -28.452 20.279  39.110  1.00 25.53 ? 481 GLU A CG  1 
ATOM   3592 C  CD  . GLU A 1 438 ? -28.334 20.952  40.483  1.00 28.90 ? 481 GLU A CD  1 
ATOM   3593 O  OE1 . GLU A 1 438 ? -27.553 20.471  41.335  1.00 31.28 ? 481 GLU A OE1 1 
ATOM   3594 O  OE2 . GLU A 1 438 ? -29.047 21.952  40.726  1.00 29.07 ? 481 GLU A OE2 1 
ATOM   3595 N  N   . ASN A 1 439 ? -25.357 17.280  37.088  1.00 23.39 ? 482 ASN A N   1 
ATOM   3596 C  CA  . ASN A 1 439 ? -23.974 17.084  36.665  1.00 22.89 ? 482 ASN A CA  1 
ATOM   3597 C  C   . ASN A 1 439 ? -23.709 16.017  35.606  1.00 23.24 ? 482 ASN A C   1 
ATOM   3598 O  O   . ASN A 1 439 ? -22.714 16.113  34.876  1.00 23.22 ? 482 ASN A O   1 
ATOM   3599 C  CB  . ASN A 1 439 ? -23.094 16.829  37.880  1.00 22.84 ? 482 ASN A CB  1 
ATOM   3600 C  CG  . ASN A 1 439 ? -22.808 18.095  38.668  1.00 23.28 ? 482 ASN A CG  1 
ATOM   3601 O  OD1 . ASN A 1 439 ? -21.924 18.865  38.312  1.00 24.18 ? 482 ASN A OD1 1 
ATOM   3602 N  ND2 . ASN A 1 439 ? -23.539 18.299  39.760  1.00 22.86 ? 482 ASN A ND2 1 
ATOM   3603 N  N   . PHE A 1 440 ? -24.565 14.994  35.531  1.00 23.29 ? 483 PHE A N   1 
ATOM   3604 C  CA  . PHE A 1 440 ? -24.300 13.845  34.664  1.00 23.25 ? 483 PHE A CA  1 
ATOM   3605 C  C   . PHE A 1 440 ? -25.530 13.315  33.957  1.00 24.10 ? 483 PHE A C   1 
ATOM   3606 O  O   . PHE A 1 440 ? -26.638 13.400  34.468  1.00 24.02 ? 483 PHE A O   1 
ATOM   3607 C  CB  . PHE A 1 440 ? -23.680 12.685  35.458  1.00 22.73 ? 483 PHE A CB  1 
ATOM   3608 C  CG  . PHE A 1 440 ? -22.615 13.100  36.430  1.00 20.42 ? 483 PHE A CG  1 
ATOM   3609 C  CD1 . PHE A 1 440 ? -22.891 13.143  37.797  1.00 17.25 ? 483 PHE A CD1 1 
ATOM   3610 C  CD2 . PHE A 1 440 ? -21.338 13.434  35.985  1.00 19.08 ? 483 PHE A CD2 1 
ATOM   3611 C  CE1 . PHE A 1 440 ? -21.912 13.525  38.708  1.00 18.90 ? 483 PHE A CE1 1 
ATOM   3612 C  CE2 . PHE A 1 440 ? -20.342 13.820  36.891  1.00 19.74 ? 483 PHE A CE2 1 
ATOM   3613 C  CZ  . PHE A 1 440 ? -20.630 13.865  38.260  1.00 18.27 ? 483 PHE A CZ  1 
ATOM   3614 N  N   . ARG A 1 441 ? -25.316 12.758  32.776  1.00 25.27 ? 484 ARG A N   1 
ATOM   3615 C  CA  . ARG A 1 441 ? -26.312 11.911  32.137  1.00 27.08 ? 484 ARG A CA  1 
ATOM   3616 C  C   . ARG A 1 441 ? -25.927 10.478  32.484  1.00 27.03 ? 484 ARG A C   1 
ATOM   3617 O  O   . ARG A 1 441 ? -24.736 10.130  32.463  1.00 27.17 ? 484 ARG A O   1 
ATOM   3618 C  CB  . ARG A 1 441 ? -26.326 12.104  30.607  1.00 27.35 ? 484 ARG A CB  1 
ATOM   3619 C  CG  . ARG A 1 441 ? -26.395 13.550  30.168  1.00 31.87 ? 484 ARG A CG  1 
ATOM   3620 C  CD  . ARG A 1 441 ? -26.840 13.744  28.708  1.00 38.14 ? 484 ARG A CD  1 
ATOM   3621 N  NE  . ARG A 1 441 ? -27.582 15.007  28.612  1.00 43.15 ? 484 ARG A NE  1 
ATOM   3622 C  CZ  . ARG A 1 441 ? -27.909 15.646  27.488  1.00 46.05 ? 484 ARG A CZ  1 
ATOM   3623 N  NH1 . ARG A 1 441 ? -27.564 15.163  26.291  1.00 46.94 ? 484 ARG A NH1 1 
ATOM   3624 N  NH2 . ARG A 1 441 ? -28.591 16.788  27.570  1.00 46.00 ? 484 ARG A NH2 1 
ATOM   3625 N  N   . VAL A 1 442 ? -26.922 9.656   32.811  1.00 27.38 ? 485 VAL A N   1 
ATOM   3626 C  CA  . VAL A 1 442 ? -26.669 8.266   33.197  1.00 27.94 ? 485 VAL A CA  1 
ATOM   3627 C  C   . VAL A 1 442 ? -27.189 7.245   32.179  1.00 28.74 ? 485 VAL A C   1 
ATOM   3628 O  O   . VAL A 1 442 ? -28.368 7.252   31.808  1.00 28.63 ? 485 VAL A O   1 
ATOM   3629 C  CB  . VAL A 1 442 ? -27.229 7.935   34.597  1.00 27.86 ? 485 VAL A CB  1 
ATOM   3630 C  CG1 . VAL A 1 442 ? -26.543 6.710   35.135  1.00 26.93 ? 485 VAL A CG1 1 
ATOM   3631 C  CG2 . VAL A 1 442 ? -27.034 9.121   35.569  1.00 27.73 ? 485 VAL A CG2 1 
ATOM   3632 N  N   . GLU A 1 443 ? -26.288 6.378   31.730  1.00 29.81 ? 486 GLU A N   1 
ATOM   3633 C  CA  . GLU A 1 443 ? -26.623 5.289   30.815  1.00 31.40 ? 486 GLU A CA  1 
ATOM   3634 C  C   . GLU A 1 443 ? -26.099 3.941   31.328  1.00 31.81 ? 486 GLU A C   1 
ATOM   3635 O  O   . GLU A 1 443 ? -25.249 3.907   32.222  1.00 31.60 ? 486 GLU A O   1 
ATOM   3636 C  CB  . GLU A 1 443 ? -26.036 5.576   29.435  1.00 31.57 ? 486 GLU A CB  1 
ATOM   3637 C  CG  . GLU A 1 443 ? -26.489 6.910   28.868  1.00 34.34 ? 486 GLU A CG  1 
ATOM   3638 C  CD  . GLU A 1 443 ? -26.144 7.092   27.408  1.00 37.87 ? 486 GLU A CD  1 
ATOM   3639 O  OE1 . GLU A 1 443 ? -25.087 6.574   26.960  1.00 39.69 ? 486 GLU A OE1 1 
ATOM   3640 O  OE2 . GLU A 1 443 ? -26.938 7.772   26.716  1.00 39.24 ? 486 GLU A OE2 1 
ATOM   3641 N  N   . ILE A 1 444 ? -26.619 2.844   30.775  1.00 32.47 ? 487 ILE A N   1 
ATOM   3642 C  CA  . ILE A 1 444 ? -26.036 1.518   30.986  1.00 33.54 ? 487 ILE A CA  1 
ATOM   3643 C  C   . ILE A 1 444 ? -25.801 0.883   29.632  1.00 34.68 ? 487 ILE A C   1 
ATOM   3644 O  O   . ILE A 1 444 ? -26.751 0.607   28.905  1.00 35.04 ? 487 ILE A O   1 
ATOM   3645 C  CB  . ILE A 1 444 ? -26.927 0.579   31.849  1.00 33.44 ? 487 ILE A CB  1 
ATOM   3646 C  CG1 . ILE A 1 444 ? -27.128 1.160   33.252  1.00 32.97 ? 487 ILE A CG1 1 
ATOM   3647 C  CG2 . ILE A 1 444 ? -26.312 -0.845  31.939  1.00 32.80 ? 487 ILE A CG2 1 
ATOM   3648 C  CD1 . ILE A 1 444 ? -28.298 0.559   34.010  1.00 32.28 ? 487 ILE A CD1 1 
ATOM   3649 N  N   . GLN A 1 445 ? -24.531 0.680   29.289  1.00 36.12 ? 488 GLN A N   1 
ATOM   3650 C  CA  . GLN A 1 445 ? -24.152 -0.030  28.069  1.00 37.46 ? 488 GLN A CA  1 
ATOM   3651 C  C   . GLN A 1 445 ? -24.615 -1.474  28.132  1.00 38.09 ? 488 GLN A C   1 
ATOM   3652 O  O   . GLN A 1 445 ? -24.613 -2.091  29.205  1.00 38.28 ? 488 GLN A O   1 
ATOM   3653 C  CB  . GLN A 1 445 ? -22.642 0.004   27.879  1.00 37.67 ? 488 GLN A CB  1 
ATOM   3654 C  CG  . GLN A 1 445 ? -22.134 1.297   27.275  1.00 39.75 ? 488 GLN A CG  1 
ATOM   3655 C  CD  . GLN A 1 445 ? -20.687 1.575   27.636  1.00 42.65 ? 488 GLN A CD  1 
ATOM   3656 O  OE1 . GLN A 1 445 ? -19.844 0.671   27.637  1.00 43.31 ? 488 GLN A OE1 1 
ATOM   3657 N  NE2 . GLN A 1 445 ? -20.391 2.838   27.951  1.00 42.92 ? 488 GLN A NE2 1 
ATOM   3658 N  N   . HIS A 1 446 ? -25.012 -2.012  26.983  1.00 38.92 ? 489 HIS A N   1 
ATOM   3659 C  CA  . HIS A 1 446 ? -25.533 -3.380  26.913  1.00 39.77 ? 489 HIS A CA  1 
ATOM   3660 C  C   . HIS A 1 446 ? -26.528 -3.628  28.068  1.00 39.76 ? 489 HIS A C   1 
ATOM   3661 O  O   . HIS A 1 446 ? -26.414 -4.607  28.810  1.00 39.96 ? 489 HIS A O   1 
ATOM   3662 C  CB  . HIS A 1 446 ? -24.383 -4.415  26.910  1.00 40.02 ? 489 HIS A CB  1 
ATOM   3663 C  CG  . HIS A 1 446 ? -23.273 -4.100  25.942  1.00 41.96 ? 489 HIS A CG  1 
ATOM   3664 N  ND1 . HIS A 1 446 ? -23.370 -4.336  24.582  1.00 43.56 ? 489 HIS A ND1 1 
ATOM   3665 C  CD2 . HIS A 1 446 ? -22.036 -3.579  26.141  1.00 43.76 ? 489 HIS A CD2 1 
ATOM   3666 C  CE1 . HIS A 1 446 ? -22.248 -3.966  23.987  1.00 43.70 ? 489 HIS A CE1 1 
ATOM   3667 N  NE2 . HIS A 1 446 ? -21.421 -3.505  24.910  1.00 44.03 ? 489 HIS A NE2 1 
ATOM   3668 N  N   . LEU A 1 447 ? -27.488 -2.713  28.217  1.00 39.62 ? 490 LEU A N   1 
ATOM   3669 C  CA  . LEU A 1 447 ? -28.529 -2.801  29.243  1.00 39.47 ? 490 LEU A CA  1 
ATOM   3670 C  C   . LEU A 1 447 ? -29.312 -4.116  29.153  1.00 38.99 ? 490 LEU A C   1 
ATOM   3671 O  O   . LEU A 1 447 ? -29.667 -4.563  28.060  1.00 39.06 ? 490 LEU A O   1 
ATOM   3672 C  CB  . LEU A 1 447 ? -29.489 -1.614  29.116  1.00 39.83 ? 490 LEU A CB  1 
ATOM   3673 C  CG  . LEU A 1 447 ? -30.708 -1.509  30.045  1.00 41.08 ? 490 LEU A CG  1 
ATOM   3674 C  CD1 . LEU A 1 447 ? -30.320 -1.052  31.443  1.00 41.00 ? 490 LEU A CD1 1 
ATOM   3675 C  CD2 . LEU A 1 447 ? -31.749 -0.560  29.452  1.00 42.39 ? 490 LEU A CD2 1 
ATOM   3676 N  N   . SER A 1 448 ? -29.554 -4.727  30.311  1.00 38.15 ? 491 SER A N   1 
ATOM   3677 C  CA  . SER A 1 448 ? -30.365 -5.940  30.426  1.00 37.34 ? 491 SER A CA  1 
ATOM   3678 C  C   . SER A 1 448 ? -31.190 -5.842  31.698  1.00 36.58 ? 491 SER A C   1 
ATOM   3679 O  O   . SER A 1 448 ? -30.901 -5.015  32.564  1.00 36.83 ? 491 SER A O   1 
ATOM   3680 C  CB  . SER A 1 448 ? -29.486 -7.188  30.469  1.00 37.32 ? 491 SER A CB  1 
ATOM   3681 O  OG  . SER A 1 448 ? -28.768 -7.243  31.687  1.00 38.01 ? 491 SER A OG  1 
ATOM   3682 N  N   . ASP A 1 449 ? -32.221 -6.672  31.803  1.00 35.53 ? 492 ASP A N   1 
ATOM   3683 C  CA  . ASP A 1 449 ? -33.069 -6.696  32.994  1.00 34.58 ? 492 ASP A CA  1 
ATOM   3684 C  C   . ASP A 1 449 ? -32.295 -7.235  34.198  1.00 33.25 ? 492 ASP A C   1 
ATOM   3685 O  O   . ASP A 1 449 ? -31.769 -8.350  34.162  1.00 32.89 ? 492 ASP A O   1 
ATOM   3686 C  CB  . ASP A 1 449 ? -34.330 -7.532  32.742  1.00 34.73 ? 492 ASP A CB  1 
ATOM   3687 C  CG  . ASP A 1 449 ? -35.205 -6.953  31.636  1.00 36.76 ? 492 ASP A CG  1 
ATOM   3688 O  OD1 . ASP A 1 449 ? -35.206 -5.711  31.427  1.00 37.59 ? 492 ASP A OD1 1 
ATOM   3689 O  OD2 . ASP A 1 449 ? -35.898 -7.749  30.967  1.00 39.58 ? 492 ASP A OD2 1 
ATOM   3690 N  N   . VAL A 1 450 ? -32.205 -6.430  35.252  1.00 31.61 ? 493 VAL A N   1 
ATOM   3691 C  CA  . VAL A 1 450 ? -31.544 -6.879  36.466  1.00 29.94 ? 493 VAL A CA  1 
ATOM   3692 C  C   . VAL A 1 450 ? -32.589 -7.314  37.484  1.00 28.87 ? 493 VAL A C   1 
ATOM   3693 O  O   . VAL A 1 450 ? -33.498 -6.550  37.810  1.00 28.84 ? 493 VAL A O   1 
ATOM   3694 C  CB  . VAL A 1 450 ? -30.603 -5.805  37.035  1.00 30.01 ? 493 VAL A CB  1 
ATOM   3695 C  CG1 . VAL A 1 450 ? -30.007 -6.245  38.369  1.00 28.98 ? 493 VAL A CG1 1 
ATOM   3696 C  CG2 . VAL A 1 450 ? -29.490 -5.513  36.035  1.00 30.07 ? 493 VAL A CG2 1 
ATOM   3697 N  N   . GLY A 1 451 ? -32.461 -8.554  37.955  1.00 27.37 ? 494 GLY A N   1 
ATOM   3698 C  CA  . GLY A 1 451 ? -33.373 -9.120  38.943  1.00 25.55 ? 494 GLY A CA  1 
ATOM   3699 C  C   . GLY A 1 451 ? -33.000 -8.786  40.379  1.00 24.54 ? 494 GLY A C   1 
ATOM   3700 O  O   . GLY A 1 451 ? -32.045 -8.040  40.640  1.00 23.93 ? 494 GLY A O   1 
ATOM   3701 N  N   . THR A 1 452 ? -33.747 -9.371  41.309  1.00 23.15 ? 495 THR A N   1 
ATOM   3702 C  CA  . THR A 1 452 ? -33.621 -9.058  42.722  1.00 22.20 ? 495 THR A CA  1 
ATOM   3703 C  C   . THR A 1 452 ? -33.245 -10.302 43.520  1.00 21.55 ? 495 THR A C   1 
ATOM   3704 O  O   . THR A 1 452 ? -33.790 -11.378 43.295  1.00 21.28 ? 495 THR A O   1 
ATOM   3705 C  CB  . THR A 1 452 ? -34.951 -8.484  43.258  1.00 21.76 ? 495 THR A CB  1 
ATOM   3706 O  OG1 . THR A 1 452 ? -35.262 -7.290  42.546  1.00 22.58 ? 495 THR A OG1 1 
ATOM   3707 C  CG2 . THR A 1 452 ? -34.865 -8.160  44.721  1.00 21.95 ? 495 THR A CG2 1 
ATOM   3708 N  N   . THR A 1 453 ? -32.318 -10.144 44.457  1.00 20.86 ? 496 THR A N   1 
ATOM   3709 C  CA  . THR A 1 453 ? -32.006 -11.214 45.399  1.00 20.70 ? 496 THR A CA  1 
ATOM   3710 C  C   . THR A 1 453 ? -32.321 -10.792 46.843  1.00 19.89 ? 496 THR A C   1 
ATOM   3711 O  O   . THR A 1 453 ? -32.266 -9.614  47.181  1.00 19.71 ? 496 THR A O   1 
ATOM   3712 C  CB  . THR A 1 453 ? -30.563 -11.723 45.228  1.00 20.67 ? 496 THR A CB  1 
ATOM   3713 O  OG1 . THR A 1 453 ? -30.344 -12.851 46.079  1.00 22.25 ? 496 THR A OG1 1 
ATOM   3714 C  CG2 . THR A 1 453 ? -29.549 -10.641 45.575  1.00 22.41 ? 496 THR A CG2 1 
ATOM   3715 N  N   . PHE A 1 454 ? -32.703 -11.753 47.674  1.00 19.47 ? 497 PHE A N   1 
ATOM   3716 C  CA  . PHE A 1 454 ? -33.053 -11.473 49.069  1.00 18.85 ? 497 PHE A CA  1 
ATOM   3717 C  C   . PHE A 1 454 ? -31.849 -11.712 49.978  1.00 19.16 ? 497 PHE A C   1 
ATOM   3718 O  O   . PHE A 1 454 ? -31.444 -12.860 50.215  1.00 19.32 ? 497 PHE A O   1 
ATOM   3719 C  CB  . PHE A 1 454 ? -34.254 -12.323 49.494  1.00 18.28 ? 497 PHE A CB  1 
ATOM   3720 C  CG  . PHE A 1 454 ? -34.628 -12.198 50.955  1.00 16.97 ? 497 PHE A CG  1 
ATOM   3721 C  CD1 . PHE A 1 454 ? -35.290 -11.066 51.433  1.00 14.65 ? 497 PHE A CD1 1 
ATOM   3722 C  CD2 . PHE A 1 454 ? -34.350 -13.237 51.848  1.00 15.78 ? 497 PHE A CD2 1 
ATOM   3723 C  CE1 . PHE A 1 454 ? -35.653 -10.963 52.777  1.00 14.64 ? 497 PHE A CE1 1 
ATOM   3724 C  CE2 . PHE A 1 454 ? -34.715 -13.149 53.198  1.00 15.49 ? 497 PHE A CE2 1 
ATOM   3725 C  CZ  . PHE A 1 454 ? -35.366 -12.013 53.666  1.00 14.58 ? 497 PHE A CZ  1 
ATOM   3726 N  N   . ASN A 1 455 ? -31.264 -10.611 50.445  1.00 19.37 ? 498 ASN A N   1 
ATOM   3727 C  CA  . ASN A 1 455 ? -30.134 -10.634 51.366  1.00 19.60 ? 498 ASN A CA  1 
ATOM   3728 C  C   . ASN A 1 455 ? -30.559 -9.968  52.643  1.00 19.61 ? 498 ASN A C   1 
ATOM   3729 O  O   . ASN A 1 455 ? -29.865 -9.102  53.182  1.00 19.69 ? 498 ASN A O   1 
ATOM   3730 C  CB  . ASN A 1 455 ? -28.935 -9.933  50.755  1.00 19.65 ? 498 ASN A CB  1 
ATOM   3731 C  CG  . ASN A 1 455 ? -28.173 -10.830 49.817  1.00 21.59 ? 498 ASN A CG  1 
ATOM   3732 O  OD1 . ASN A 1 455 ? -28.139 -12.049 50.002  1.00 22.52 ? 498 ASN A OD1 1 
ATOM   3733 N  ND2 . ASN A 1 455 ? -27.555 -10.241 48.802  1.00 23.84 ? 498 ASN A ND2 1 
ATOM   3734 N  N   . LEU A 1 456 ? -31.725 -10.410 53.108  1.00 19.62 ? 499 LEU A N   1 
ATOM   3735 C  CA  . LEU A 1 456 ? -32.479 -9.821  54.207  1.00 19.84 ? 499 LEU A CA  1 
ATOM   3736 C  C   . LEU A 1 456 ? -33.095 -8.493  53.788  1.00 19.97 ? 499 LEU A C   1 
ATOM   3737 O  O   . LEU A 1 456 ? -34.304 -8.318  53.876  1.00 19.90 ? 499 LEU A O   1 
ATOM   3738 C  CB  . LEU A 1 456 ? -31.698 -9.738  55.527  1.00 19.45 ? 499 LEU A CB  1 
ATOM   3739 C  CG  . LEU A 1 456 ? -32.817 -9.788  56.583  1.00 21.21 ? 499 LEU A CG  1 
ATOM   3740 C  CD1 . LEU A 1 456 ? -32.724 -10.977 57.536  1.00 20.43 ? 499 LEU A CD1 1 
ATOM   3741 C  CD2 . LEU A 1 456 ? -33.055 -8.459  57.311  1.00 18.54 ? 499 LEU A CD2 1 
ATOM   3742 N  N   . ILE A 1 457 ? -32.262 -7.565  53.338  1.00 20.13 ? 500 ILE A N   1 
ATOM   3743 C  CA  . ILE A 1 457 ? -32.746 -6.483  52.521  1.00 20.25 ? 500 ILE A CA  1 
ATOM   3744 C  C   . ILE A 1 457 ? -32.776 -7.017  51.089  1.00 20.18 ? 500 ILE A C   1 
ATOM   3745 O  O   . ILE A 1 457 ? -31.997 -7.918  50.737  1.00 19.54 ? 500 ILE A O   1 
ATOM   3746 C  CB  . ILE A 1 457 ? -31.861 -5.231  52.633  1.00 20.53 ? 500 ILE A CB  1 
ATOM   3747 C  CG1 . ILE A 1 457 ? -30.406 -5.572  52.334  1.00 21.33 ? 500 ILE A CG1 1 
ATOM   3748 C  CG2 . ILE A 1 457 ? -31.970 -4.625  54.035  1.00 20.62 ? 500 ILE A CG2 1 
ATOM   3749 C  CD1 . ILE A 1 457 ? -29.603 -4.368  51.930  1.00 24.79 ? 500 ILE A CD1 1 
ATOM   3750 N  N   . LEU A 1 458 ? -33.692 -6.495  50.273  1.00 20.00 ? 501 LEU A N   1 
ATOM   3751 C  CA  . LEU A 1 458 ? -33.691 -6.830  48.858  1.00 20.03 ? 501 LEU A CA  1 
ATOM   3752 C  C   . LEU A 1 458 ? -32.596 -6.042  48.154  1.00 20.51 ? 501 LEU A C   1 
ATOM   3753 O  O   . LEU A 1 458 ? -32.393 -4.866  48.442  1.00 19.84 ? 501 LEU A O   1 
ATOM   3754 C  CB  . LEU A 1 458 ? -35.054 -6.589  48.233  1.00 19.71 ? 501 LEU A CB  1 
ATOM   3755 C  CG  . LEU A 1 458 ? -36.190 -7.453  48.783  1.00 19.17 ? 501 LEU A CG  1 
ATOM   3756 C  CD1 . LEU A 1 458 ? -37.515 -6.971  48.237  1.00 18.42 ? 501 LEU A CD1 1 
ATOM   3757 C  CD2 . LEU A 1 458 ? -35.984 -8.940  48.472  1.00 18.43 ? 501 LEU A CD2 1 
ATOM   3758 N  N   . MET A 1 459 ? -31.870 -6.712  47.262  1.00 21.46 ? 502 MET A N   1 
ATOM   3759 C  CA  . MET A 1 459 ? -30.746 -6.106  46.547  1.00 22.81 ? 502 MET A CA  1 
ATOM   3760 C  C   . MET A 1 459 ? -30.746 -6.595  45.133  1.00 22.93 ? 502 MET A C   1 
ATOM   3761 O  O   . MET A 1 459 ? -31.343 -7.633  44.858  1.00 23.11 ? 502 MET A O   1 
ATOM   3762 C  CB  . MET A 1 459 ? -29.422 -6.504  47.191  1.00 23.33 ? 502 MET A CB  1 
ATOM   3763 C  CG  . MET A 1 459 ? -29.128 -5.761  48.472  1.00 26.42 ? 502 MET A CG  1 
ATOM   3764 S  SD  . MET A 1 459 ? -27.793 -6.552  49.352  1.00 33.15 ? 502 MET A SD  1 
ATOM   3765 C  CE  . MET A 1 459 ? -26.387 -5.983  48.370  1.00 31.63 ? 502 MET A CE  1 
ATOM   3766 N  N   . PRO A 1 460 ? -30.068 -5.864  44.223  1.00 23.38 ? 503 PRO A N   1 
ATOM   3767 C  CA  . PRO A 1 460 ? -29.923 -6.385  42.854  1.00 23.48 ? 503 PRO A CA  1 
ATOM   3768 C  C   . PRO A 1 460 ? -29.199 -7.719  42.873  1.00 23.98 ? 503 PRO A C   1 
ATOM   3769 O  O   . PRO A 1 460 ? -28.345 -7.950  43.728  1.00 23.58 ? 503 PRO A O   1 
ATOM   3770 C  CB  . PRO A 1 460 ? -29.059 -5.341  42.148  1.00 23.17 ? 503 PRO A CB  1 
ATOM   3771 C  CG  . PRO A 1 460 ? -29.104 -4.140  42.997  1.00 23.11 ? 503 PRO A CG  1 
ATOM   3772 C  CD  . PRO A 1 460 ? -29.374 -4.577  44.403  1.00 23.01 ? 503 PRO A CD  1 
ATOM   3773 N  N   . GLU A 1 461 ? -29.571 -8.581  41.936  1.00 24.98 ? 504 GLU A N   1 
ATOM   3774 C  CA  . GLU A 1 461 ? -29.043 -9.934  41.809  1.00 25.74 ? 504 GLU A CA  1 
ATOM   3775 C  C   . GLU A 1 461 ? -27.602 -9.988  41.297  1.00 25.20 ? 504 GLU A C   1 
ATOM   3776 O  O   . GLU A 1 461 ? -26.899 -10.960 41.560  1.00 25.11 ? 504 GLU A O   1 
ATOM   3777 C  CB  . GLU A 1 461 ? -29.963 -10.744 40.885  1.00 26.37 ? 504 GLU A CB  1 
ATOM   3778 C  CG  . GLU A 1 461 ? -29.388 -12.050 40.373  1.00 30.08 ? 504 GLU A CG  1 
ATOM   3779 C  CD  . GLU A 1 461 ? -30.458 -13.095 40.137  1.00 35.73 ? 504 GLU A CD  1 
ATOM   3780 O  OE1 . GLU A 1 461 ? -31.461 -12.772 39.452  1.00 36.45 ? 504 GLU A OE1 1 
ATOM   3781 O  OE2 . GLU A 1 461 ? -30.300 -14.236 40.654  1.00 37.94 ? 504 GLU A OE2 1 
ATOM   3782 N  N   . LYS A 1 462 ? -27.176 -8.955  40.565  1.00 25.01 ? 505 LYS A N   1 
ATOM   3783 C  CA  . LYS A 1 462 ? -25.853 -8.919  39.915  1.00 24.39 ? 505 LYS A CA  1 
ATOM   3784 C  C   . LYS A 1 462 ? -25.411 -7.463  39.742  1.00 23.77 ? 505 LYS A C   1 
ATOM   3785 O  O   . LYS A 1 462 ? -26.227 -6.550  39.896  1.00 23.88 ? 505 LYS A O   1 
ATOM   3786 C  CB  . LYS A 1 462 ? -25.908 -9.649  38.570  1.00 24.59 ? 505 LYS A CB  1 
ATOM   3787 C  CG  . LYS A 1 462 ? -27.067 -9.210  37.703  1.00 26.73 ? 505 LYS A CG  1 
ATOM   3788 C  CD  . LYS A 1 462 ? -26.968 -9.699  36.274  1.00 30.20 ? 505 LYS A CD  1 
ATOM   3789 C  CE  . LYS A 1 462 ? -27.706 -8.731  35.329  1.00 31.55 ? 505 LYS A CE  1 
ATOM   3790 N  NZ  . LYS A 1 462 ? -28.071 -9.373  34.027  1.00 31.97 ? 505 LYS A NZ  1 
ATOM   3791 N  N   . PRO A 1 463 ? -24.120 -7.225  39.446  1.00 23.14 ? 506 PRO A N   1 
ATOM   3792 C  CA  . PRO A 1 463 ? -23.663 -5.831  39.398  1.00 22.67 ? 506 PRO A CA  1 
ATOM   3793 C  C   . PRO A 1 463 ? -24.284 -5.012  38.272  1.00 22.54 ? 506 PRO A C   1 
ATOM   3794 O  O   . PRO A 1 463 ? -24.680 -5.569  37.248  1.00 22.21 ? 506 PRO A O   1 
ATOM   3795 C  CB  . PRO A 1 463 ? -22.149 -5.964  39.189  1.00 22.62 ? 506 PRO A CB  1 
ATOM   3796 C  CG  . PRO A 1 463 ? -21.814 -7.308  39.719  1.00 22.31 ? 506 PRO A CG  1 
ATOM   3797 C  CD  . PRO A 1 463 ? -22.989 -8.166  39.356  1.00 23.22 ? 506 PRO A CD  1 
ATOM   3798 N  N   . ILE A 1 464 ? -24.370 -3.697  38.478  1.00 22.42 ? 507 ILE A N   1 
ATOM   3799 C  CA  . ILE A 1 464 ? -24.860 -2.773  37.464  1.00 22.34 ? 507 ILE A CA  1 
ATOM   3800 C  C   . ILE A 1 464 ? -23.740 -1.801  37.134  1.00 22.71 ? 507 ILE A C   1 
ATOM   3801 O  O   . ILE A 1 464 ? -23.339 -1.018  37.984  1.00 23.40 ? 507 ILE A O   1 
ATOM   3802 C  CB  . ILE A 1 464 ? -26.095 -1.964  37.947  1.00 22.27 ? 507 ILE A CB  1 
ATOM   3803 C  CG1 . ILE A 1 464 ? -27.257 -2.886  38.333  1.00 21.45 ? 507 ILE A CG1 1 
ATOM   3804 C  CG2 . ILE A 1 464 ? -26.536 -0.956  36.878  1.00 22.07 ? 507 ILE A CG2 1 
ATOM   3805 C  CD1 . ILE A 1 464 ? -28.376 -2.184  39.114  1.00 19.17 ? 507 ILE A CD1 1 
ATOM   3806 N  N   . SER A 1 465 ? -23.250 -1.843  35.900  1.00 22.77 ? 508 SER A N   1 
ATOM   3807 C  CA  . SER A 1 465 ? -22.177 -0.969  35.467  1.00 22.87 ? 508 SER A CA  1 
ATOM   3808 C  C   . SER A 1 465 ? -22.705 0.246   34.694  1.00 22.81 ? 508 SER A C   1 
ATOM   3809 O  O   . SER A 1 465 ? -23.120 0.122   33.542  1.00 22.99 ? 508 SER A O   1 
ATOM   3810 C  CB  . SER A 1 465 ? -21.188 -1.759  34.611  1.00 23.04 ? 508 SER A CB  1 
ATOM   3811 O  OG  . SER A 1 465 ? -20.076 -0.945  34.270  1.00 25.64 ? 508 SER A OG  1 
ATOM   3812 N  N   . PHE A 1 466 ? -22.681 1.423   35.324  1.00 22.58 ? 509 PHE A N   1 
ATOM   3813 C  CA  . PHE A 1 466 ? -23.178 2.652   34.698  1.00 21.98 ? 509 PHE A CA  1 
ATOM   3814 C  C   . PHE A 1 466 ? -22.139 3.343   33.838  1.00 22.03 ? 509 PHE A C   1 
ATOM   3815 O  O   . PHE A 1 466 ? -20.947 3.157   34.037  1.00 22.13 ? 509 PHE A O   1 
ATOM   3816 C  CB  . PHE A 1 466 ? -23.602 3.658   35.760  1.00 21.91 ? 509 PHE A CB  1 
ATOM   3817 C  CG  . PHE A 1 466 ? -24.768 3.227   36.569  1.00 21.84 ? 509 PHE A CG  1 
ATOM   3818 C  CD1 . PHE A 1 466 ? -24.584 2.719   37.848  1.00 21.70 ? 509 PHE A CD1 1 
ATOM   3819 C  CD2 . PHE A 1 466 ? -26.058 3.322   36.056  1.00 22.39 ? 509 PHE A CD2 1 
ATOM   3820 C  CE1 . PHE A 1 466 ? -25.664 2.311   38.604  1.00 22.55 ? 509 PHE A CE1 1 
ATOM   3821 C  CE2 . PHE A 1 466 ? -27.149 2.922   36.806  1.00 22.73 ? 509 PHE A CE2 1 
ATOM   3822 C  CZ  . PHE A 1 466 ? -26.954 2.414   38.089  1.00 21.98 ? 509 PHE A CZ  1 
ATOM   3823 N  N   . THR A 1 467 ? -22.608 4.165   32.897  1.00 22.21 ? 510 THR A N   1 
ATOM   3824 C  CA  . THR A 1 467 ? -21.759 5.144   32.208  1.00 21.85 ? 510 THR A CA  1 
ATOM   3825 C  C   . THR A 1 467 ? -22.276 6.544   32.514  1.00 22.09 ? 510 THR A C   1 
ATOM   3826 O  O   . THR A 1 467 ? -23.482 6.814   32.420  1.00 21.91 ? 510 THR A O   1 
ATOM   3827 C  CB  . THR A 1 467 ? -21.633 4.871   30.677  1.00 21.67 ? 510 THR A CB  1 
ATOM   3828 O  OG1 . THR A 1 467 ? -20.891 3.658   30.469  1.00 20.52 ? 510 THR A OG1 1 
ATOM   3829 C  CG2 . THR A 1 467 ? -20.904 6.007   29.972  1.00 21.26 ? 510 THR A CG2 1 
ATOM   3830 N  N   . PHE A 1 468 ? -21.353 7.419   32.915  1.00 22.48 ? 511 PHE A N   1 
ATOM   3831 C  CA  . PHE A 1 468 ? -21.667 8.809   33.242  1.00 22.77 ? 511 PHE A CA  1 
ATOM   3832 C  C   . PHE A 1 468 ? -21.046 9.777   32.239  1.00 23.47 ? 511 PHE A C   1 
ATOM   3833 O  O   . PHE A 1 468 ? -19.860 9.664   31.913  1.00 23.52 ? 511 PHE A O   1 
ATOM   3834 C  CB  . PHE A 1 468 ? -21.180 9.148   34.646  1.00 22.45 ? 511 PHE A CB  1 
ATOM   3835 C  CG  . PHE A 1 468 ? -21.821 8.325   35.716  1.00 21.86 ? 511 PHE A CG  1 
ATOM   3836 C  CD1 . PHE A 1 468 ? -21.183 7.202   36.216  1.00 21.01 ? 511 PHE A CD1 1 
ATOM   3837 C  CD2 . PHE A 1 468 ? -23.080 8.658   36.208  1.00 20.88 ? 511 PHE A CD2 1 
ATOM   3838 C  CE1 . PHE A 1 468 ? -21.785 6.433   37.215  1.00 21.78 ? 511 PHE A CE1 1 
ATOM   3839 C  CE2 . PHE A 1 468 ? -23.684 7.892   37.190  1.00 20.68 ? 511 PHE A CE2 1 
ATOM   3840 C  CZ  . PHE A 1 468 ? -23.034 6.778   37.703  1.00 20.34 ? 511 PHE A CZ  1 
ATOM   3841 N  N   . TRP A 1 469 ? -21.862 10.713  31.753  1.00 23.92 ? 512 TRP A N   1 
ATOM   3842 C  CA  . TRP A 1 469 ? -21.400 11.785  30.874  1.00 24.71 ? 512 TRP A CA  1 
ATOM   3843 C  C   . TRP A 1 469 ? -21.598 13.148  31.559  1.00 25.17 ? 512 TRP A C   1 
ATOM   3844 O  O   . TRP A 1 469 ? -22.686 13.427  32.085  1.00 24.54 ? 512 TRP A O   1 
ATOM   3845 C  CB  . TRP A 1 469 ? -22.173 11.761  29.546  1.00 24.83 ? 512 TRP A CB  1 
ATOM   3846 C  CG  . TRP A 1 469 ? -22.158 10.444  28.803  1.00 25.54 ? 512 TRP A CG  1 
ATOM   3847 C  CD1 . TRP A 1 469 ? -22.946 9.345   29.048  1.00 25.93 ? 512 TRP A CD1 1 
ATOM   3848 C  CD2 . TRP A 1 469 ? -21.326 10.101  27.685  1.00 25.66 ? 512 TRP A CD2 1 
ATOM   3849 N  NE1 . TRP A 1 469 ? -22.642 8.340   28.154  1.00 27.58 ? 512 TRP A NE1 1 
ATOM   3850 C  CE2 . TRP A 1 469 ? -21.653 8.778   27.309  1.00 26.39 ? 512 TRP A CE2 1 
ATOM   3851 C  CE3 . TRP A 1 469 ? -20.332 10.784  26.966  1.00 27.21 ? 512 TRP A CE3 1 
ATOM   3852 C  CZ2 . TRP A 1 469 ? -21.027 8.125   26.236  1.00 26.69 ? 512 TRP A CZ2 1 
ATOM   3853 C  CZ3 . TRP A 1 469 ? -19.700 10.129  25.895  1.00 26.79 ? 512 TRP A CZ3 1 
ATOM   3854 C  CH2 . TRP A 1 469 ? -20.054 8.813   25.545  1.00 26.70 ? 512 TRP A CH2 1 
ATOM   3855 N  N   . PRO A 1 470 ? -20.548 13.996  31.570  1.00 26.07 ? 513 PRO A N   1 
ATOM   3856 C  CA  . PRO A 1 470 ? -20.703 15.380  32.048  1.00 26.79 ? 513 PRO A CA  1 
ATOM   3857 C  C   . PRO A 1 470 ? -21.821 16.058  31.249  1.00 27.97 ? 513 PRO A C   1 
ATOM   3858 O  O   . PRO A 1 470 ? -21.866 15.918  30.018  1.00 28.14 ? 513 PRO A O   1 
ATOM   3859 C  CB  . PRO A 1 470 ? -19.360 16.027  31.712  1.00 26.84 ? 513 PRO A CB  1 
ATOM   3860 C  CG  . PRO A 1 470 ? -18.403 14.908  31.530  1.00 26.23 ? 513 PRO A CG  1 
ATOM   3861 C  CD  . PRO A 1 470 ? -19.193 13.735  31.045  1.00 25.99 ? 513 PRO A CD  1 
ATOM   3862 N  N   . PHE A 1 471 ? -22.734 16.739  31.943  1.00 29.14 ? 514 PHE A N   1 
ATOM   3863 C  CA  . PHE A 1 471 ? -23.947 17.292  31.320  1.00 30.24 ? 514 PHE A CA  1 
ATOM   3864 C  C   . PHE A 1 471 ? -23.757 18.750  30.902  1.00 30.36 ? 514 PHE A C   1 
ATOM   3865 O  O   . PHE A 1 471 ? -23.361 19.580  31.722  1.00 30.66 ? 514 PHE A O   1 
ATOM   3866 C  CB  . PHE A 1 471 ? -25.164 17.150  32.255  1.00 30.56 ? 514 PHE A CB  1 
ATOM   3867 C  CG  . PHE A 1 471 ? -26.356 17.978  31.832  1.00 32.24 ? 514 PHE A CG  1 
ATOM   3868 C  CD1 . PHE A 1 471 ? -27.079 17.657  30.673  1.00 33.51 ? 514 PHE A CD1 1 
ATOM   3869 C  CD2 . PHE A 1 471 ? -26.752 19.093  32.584  1.00 33.38 ? 514 PHE A CD2 1 
ATOM   3870 C  CE1 . PHE A 1 471 ? -28.191 18.442  30.275  1.00 34.20 ? 514 PHE A CE1 1 
ATOM   3871 C  CE2 . PHE A 1 471 ? -27.854 19.887  32.194  1.00 33.52 ? 514 PHE A CE2 1 
ATOM   3872 C  CZ  . PHE A 1 471 ? -28.573 19.562  31.041  1.00 33.71 ? 514 PHE A CZ  1 
ATOM   3873 N  N   . PRO B 1 2   ? 21.098  14.985  -13.606 1.00 40.98 ? 45  PRO B N   1 
ATOM   3874 C  CA  . PRO B 1 2   ? 20.544  14.983  -12.243 1.00 40.70 ? 45  PRO B CA  1 
ATOM   3875 C  C   . PRO B 1 2   ? 20.541  16.384  -11.609 1.00 40.43 ? 45  PRO B C   1 
ATOM   3876 O  O   . PRO B 1 2   ? 21.578  17.053  -11.585 1.00 40.34 ? 45  PRO B O   1 
ATOM   3877 C  CB  . PRO B 1 2   ? 21.481  14.035  -11.481 1.00 40.73 ? 45  PRO B CB  1 
ATOM   3878 C  CG  . PRO B 1 2   ? 22.804  14.067  -12.269 1.00 41.08 ? 45  PRO B CG  1 
ATOM   3879 C  CD  . PRO B 1 2   ? 22.546  14.704  -13.630 1.00 41.10 ? 45  PRO B CD  1 
ATOM   3880 N  N   . ARG B 1 3   ? 19.382  16.814  -11.106 1.00 40.06 ? 46  ARG B N   1 
ATOM   3881 C  CA  . ARG B 1 3   ? 19.213  18.165  -10.554 1.00 39.59 ? 46  ARG B CA  1 
ATOM   3882 C  C   . ARG B 1 3   ? 19.925  18.312  -9.199  1.00 39.24 ? 46  ARG B C   1 
ATOM   3883 O  O   . ARG B 1 3   ? 20.061  17.331  -8.463  1.00 39.10 ? 46  ARG B O   1 
ATOM   3884 C  CB  . ARG B 1 3   ? 17.727  18.512  -10.438 1.00 39.54 ? 46  ARG B CB  1 
ATOM   3885 C  CG  . ARG B 1 3   ? 16.972  18.440  -11.760 1.00 40.10 ? 46  ARG B CG  1 
ATOM   3886 C  CD  . ARG B 1 3   ? 15.697  17.609  -11.619 1.00 42.43 ? 46  ARG B CD  1 
ATOM   3887 N  NE  . ARG B 1 3   ? 14.477  18.413  -11.468 1.00 44.16 ? 46  ARG B NE  1 
ATOM   3888 C  CZ  . ARG B 1 3   ? 13.272  17.914  -11.157 1.00 44.81 ? 46  ARG B CZ  1 
ATOM   3889 N  NH1 . ARG B 1 3   ? 13.104  16.610  -10.931 1.00 44.05 ? 46  ARG B NH1 1 
ATOM   3890 N  NH2 . ARG B 1 3   ? 12.225  18.724  -11.056 1.00 44.88 ? 46  ARG B NH2 1 
ATOM   3891 N  N   . PRO B 1 4   ? 20.394  19.538  -8.869  1.00 38.90 ? 47  PRO B N   1 
ATOM   3892 C  CA  . PRO B 1 4   ? 21.130  19.726  -7.605  1.00 38.28 ? 47  PRO B CA  1 
ATOM   3893 C  C   . PRO B 1 4   ? 20.209  19.635  -6.384  1.00 37.62 ? 47  PRO B C   1 
ATOM   3894 O  O   . PRO B 1 4   ? 19.009  19.915  -6.498  1.00 37.66 ? 47  PRO B O   1 
ATOM   3895 C  CB  . PRO B 1 4   ? 21.701  21.148  -7.737  1.00 38.19 ? 47  PRO B CB  1 
ATOM   3896 C  CG  . PRO B 1 4   ? 20.758  21.859  -8.651  1.00 38.35 ? 47  PRO B CG  1 
ATOM   3897 C  CD  . PRO B 1 4   ? 20.198  20.815  -9.593  1.00 38.80 ? 47  PRO B CD  1 
ATOM   3898 N  N   . PHE B 1 5   ? 20.778  19.255  -5.238  1.00 36.78 ? 48  PHE B N   1 
ATOM   3899 C  CA  . PHE B 1 5   ? 20.061  19.163  -3.952  1.00 36.06 ? 48  PHE B CA  1 
ATOM   3900 C  C   . PHE B 1 5   ? 19.063  20.308  -3.695  1.00 35.78 ? 48  PHE B C   1 
ATOM   3901 O  O   . PHE B 1 5   ? 17.909  20.064  -3.311  1.00 35.62 ? 48  PHE B O   1 
ATOM   3902 C  CB  . PHE B 1 5   ? 21.075  19.078  -2.799  1.00 35.96 ? 48  PHE B CB  1 
ATOM   3903 C  CG  . PHE B 1 5   ? 20.449  18.964  -1.433  1.00 35.99 ? 48  PHE B CG  1 
ATOM   3904 C  CD1 . PHE B 1 5   ? 19.961  17.741  -0.974  1.00 35.24 ? 48  PHE B CD1 1 
ATOM   3905 C  CD2 . PHE B 1 5   ? 20.361  20.080  -0.597  1.00 36.31 ? 48  PHE B CD2 1 
ATOM   3906 C  CE1 . PHE B 1 5   ? 19.397  17.627  0.275   1.00 34.45 ? 48  PHE B CE1 1 
ATOM   3907 C  CE2 . PHE B 1 5   ? 19.784  19.980  0.661   1.00 36.04 ? 48  PHE B CE2 1 
ATOM   3908 C  CZ  . PHE B 1 5   ? 19.305  18.748  1.098   1.00 36.41 ? 48  PHE B CZ  1 
ATOM   3909 N  N   . ASN B 1 6   ? 19.511  21.545  -3.929  1.00 35.24 ? 49  ASN B N   1 
ATOM   3910 C  CA  . ASN B 1 6   ? 18.738  22.747  -3.602  1.00 34.62 ? 49  ASN B CA  1 
ATOM   3911 C  C   . ASN B 1 6   ? 17.429  22.878  -4.379  1.00 33.89 ? 49  ASN B C   1 
ATOM   3912 O  O   . ASN B 1 6   ? 16.587  23.710  -4.030  1.00 34.00 ? 49  ASN B O   1 
ATOM   3913 C  CB  . ASN B 1 6   ? 19.588  24.012  -3.770  1.00 34.61 ? 49  ASN B CB  1 
ATOM   3914 C  CG  . ASN B 1 6   ? 19.783  24.389  -5.219  1.00 35.91 ? 49  ASN B CG  1 
ATOM   3915 O  OD1 . ASN B 1 6   ? 20.696  23.897  -5.879  1.00 37.48 ? 49  ASN B OD1 1 
ATOM   3916 N  ND2 . ASN B 1 6   ? 18.911  25.260  -5.733  1.00 37.95 ? 49  ASN B ND2 1 
ATOM   3917 N  N   . GLU B 1 7   ? 17.257  22.060  -5.417  1.00 32.95 ? 50  GLU B N   1 
ATOM   3918 C  CA  . GLU B 1 7   ? 16.035  22.107  -6.229  1.00 32.30 ? 50  GLU B CA  1 
ATOM   3919 C  C   . GLU B 1 7   ? 14.915  21.203  -5.736  1.00 31.40 ? 50  GLU B C   1 
ATOM   3920 O  O   . GLU B 1 7   ? 13.774  21.338  -6.176  1.00 31.36 ? 50  GLU B O   1 
ATOM   3921 C  CB  . GLU B 1 7   ? 16.328  21.878  -7.710  1.00 32.39 ? 50  GLU B CB  1 
ATOM   3922 C  CG  . GLU B 1 7   ? 16.748  23.169  -8.393  1.00 34.11 ? 50  GLU B CG  1 
ATOM   3923 C  CD  . GLU B 1 7   ? 17.215  22.976  -9.814  1.00 35.98 ? 50  GLU B CD  1 
ATOM   3924 O  OE1 . GLU B 1 7   ? 16.756  22.018  -10.468 1.00 37.37 ? 50  GLU B OE1 1 
ATOM   3925 O  OE2 . GLU B 1 7   ? 18.039  23.795  -10.280 1.00 37.44 ? 50  GLU B OE2 1 
ATOM   3926 N  N   . ILE B 1 8   ? 15.241  20.301  -4.810  1.00 30.22 ? 51  ILE B N   1 
ATOM   3927 C  CA  . ILE B 1 8   ? 14.233  19.499  -4.141  1.00 28.68 ? 51  ILE B CA  1 
ATOM   3928 C  C   . ILE B 1 8   ? 13.253  20.460  -3.472  1.00 28.40 ? 51  ILE B C   1 
ATOM   3929 O  O   . ILE B 1 8   ? 13.675  21.330  -2.710  1.00 28.47 ? 51  ILE B O   1 
ATOM   3930 C  CB  . ILE B 1 8   ? 14.872  18.540  -3.105  1.00 28.65 ? 51  ILE B CB  1 
ATOM   3931 C  CG1 . ILE B 1 8   ? 15.789  17.544  -3.812  1.00 27.36 ? 51  ILE B CG1 1 
ATOM   3932 C  CG2 . ILE B 1 8   ? 13.798  17.811  -2.289  1.00 27.55 ? 51  ILE B CG2 1 
ATOM   3933 C  CD1 . ILE B 1 8   ? 16.625  16.692  -2.904  1.00 26.74 ? 51  ILE B CD1 1 
ATOM   3934 N  N   . PRO B 1 9   ? 11.944  20.322  -3.771  1.00 28.00 ? 52  PRO B N   1 
ATOM   3935 C  CA  . PRO B 1 9   ? 10.934  21.160  -3.125  1.00 27.91 ? 52  PRO B CA  1 
ATOM   3936 C  C   . PRO B 1 9   ? 11.113  21.233  -1.596  1.00 28.03 ? 52  PRO B C   1 
ATOM   3937 O  O   . PRO B 1 9   ? 11.502  20.244  -0.966  1.00 27.60 ? 52  PRO B O   1 
ATOM   3938 C  CB  . PRO B 1 9   ? 9.624   20.458  -3.480  1.00 27.65 ? 52  PRO B CB  1 
ATOM   3939 C  CG  . PRO B 1 9   ? 9.908   19.784  -4.754  1.00 27.66 ? 52  PRO B CG  1 
ATOM   3940 C  CD  . PRO B 1 9   ? 11.332  19.342  -4.689  1.00 27.75 ? 52  PRO B CD  1 
ATOM   3941 N  N   . SER B 1 10  ? 10.820  22.407  -1.035  1.00 28.25 ? 53  SER B N   1 
ATOM   3942 C  CA  . SER B 1 10  ? 11.064  22.729  0.362   1.00 28.77 ? 53  SER B CA  1 
ATOM   3943 C  C   . SER B 1 10  ? 10.246  23.959  0.785   1.00 29.17 ? 53  SER B C   1 
ATOM   3944 O  O   . SER B 1 10  ? 10.071  24.877  -0.010  1.00 29.52 ? 53  SER B O   1 
ATOM   3945 C  CB  . SER B 1 10  ? 12.556  23.010  0.555   1.00 28.81 ? 53  SER B CB  1 
ATOM   3946 O  OG  . SER B 1 10  ? 12.841  23.431  1.879   1.00 30.12 ? 53  SER B OG  1 
ATOM   3947 N  N   . PRO B 1 11  ? 9.753   23.994  2.044   1.00 29.58 ? 54  PRO B N   1 
ATOM   3948 C  CA  . PRO B 1 11  ? 9.092   25.214  2.573   1.00 29.50 ? 54  PRO B CA  1 
ATOM   3949 C  C   . PRO B 1 11  ? 10.004  26.437  2.725   1.00 29.45 ? 54  PRO B C   1 
ATOM   3950 O  O   . PRO B 1 11  ? 9.503   27.529  3.000   1.00 29.61 ? 54  PRO B O   1 
ATOM   3951 C  CB  . PRO B 1 11  ? 8.592   24.778  3.958   1.00 29.20 ? 54  PRO B CB  1 
ATOM   3952 C  CG  . PRO B 1 11  ? 9.507   23.651  4.343   1.00 29.61 ? 54  PRO B CG  1 
ATOM   3953 C  CD  . PRO B 1 11  ? 9.739   22.906  3.041   1.00 29.58 ? 54  PRO B CD  1 
ATOM   3954 N  N   . GLY B 1 12  ? 11.314  26.253  2.556   1.00 29.30 ? 55  GLY B N   1 
ATOM   3955 C  CA  . GLY B 1 12  ? 12.292  27.324  2.746   1.00 29.07 ? 55  GLY B CA  1 
ATOM   3956 C  C   . GLY B 1 12  ? 13.500  26.835  3.532   1.00 29.30 ? 55  GLY B C   1 
ATOM   3957 O  O   . GLY B 1 12  ? 13.435  25.795  4.186   1.00 29.53 ? 55  GLY B O   1 
ATOM   3958 N  N   . ASP B 1 13  ? 14.594  27.594  3.481   1.00 29.02 ? 56  ASP B N   1 
ATOM   3959 C  CA  . ASP B 1 13  ? 15.864  27.201  4.096   1.00 29.06 ? 56  ASP B CA  1 
ATOM   3960 C  C   . ASP B 1 13  ? 16.006  27.597  5.559   1.00 28.42 ? 56  ASP B C   1 
ATOM   3961 O  O   . ASP B 1 13  ? 17.015  27.284  6.189   1.00 28.49 ? 56  ASP B O   1 
ATOM   3962 C  CB  . ASP B 1 13  ? 17.050  27.746  3.289   1.00 29.70 ? 56  ASP B CB  1 
ATOM   3963 C  CG  . ASP B 1 13  ? 17.389  26.870  2.090   1.00 32.64 ? 56  ASP B CG  1 
ATOM   3964 O  OD1 . ASP B 1 13  ? 17.831  25.706  2.286   1.00 35.48 ? 56  ASP B OD1 1 
ATOM   3965 O  OD2 . ASP B 1 13  ? 17.210  27.342  0.948   1.00 35.72 ? 56  ASP B OD2 1 
ATOM   3966 N  N   . ASN B 1 14  ? 14.998  28.269  6.106   1.00 27.70 ? 57  ASN B N   1 
ATOM   3967 C  CA  . ASN B 1 14  ? 15.061  28.692  7.495   1.00 27.08 ? 57  ASN B CA  1 
ATOM   3968 C  C   . ASN B 1 14  ? 14.345  27.719  8.440   1.00 26.78 ? 57  ASN B C   1 
ATOM   3969 O  O   . ASN B 1 14  ? 13.112  27.724  8.571   1.00 26.62 ? 57  ASN B O   1 
ATOM   3970 C  CB  . ASN B 1 14  ? 14.562  30.133  7.658   1.00 26.84 ? 57  ASN B CB  1 
ATOM   3971 C  CG  . ASN B 1 14  ? 14.766  30.665  9.061   1.00 26.93 ? 57  ASN B CG  1 
ATOM   3972 O  OD1 . ASN B 1 14  ? 14.902  29.907  10.018  1.00 27.18 ? 57  ASN B OD1 1 
ATOM   3973 N  ND2 . ASN B 1 14  ? 14.777  31.979  9.190   1.00 27.82 ? 57  ASN B ND2 1 
ATOM   3974 N  N   . GLY B 1 15  ? 15.152  26.899  9.105   1.00 26.51 ? 58  GLY B N   1 
ATOM   3975 C  CA  . GLY B 1 15  ? 14.667  25.832  9.976   1.00 26.00 ? 58  GLY B CA  1 
ATOM   3976 C  C   . GLY B 1 15  ? 13.857  26.308  11.165  1.00 25.84 ? 58  GLY B C   1 
ATOM   3977 O  O   . GLY B 1 15  ? 13.010  25.565  11.672  1.00 25.88 ? 58  GLY B O   1 
ATOM   3978 N  N   . TRP B 1 16  ? 14.116  27.542  11.609  1.00 25.08 ? 59  TRP B N   1 
ATOM   3979 C  CA  . TRP B 1 16  ? 13.417  28.123  12.761  1.00 24.36 ? 59  TRP B CA  1 
ATOM   3980 C  C   . TRP B 1 16  ? 12.054  28.634  12.352  1.00 24.00 ? 59  TRP B C   1 
ATOM   3981 O  O   . TRP B 1 16  ? 11.089  28.543  13.111  1.00 24.13 ? 59  TRP B O   1 
ATOM   3982 C  CB  . TRP B 1 16  ? 14.256  29.231  13.420  1.00 24.26 ? 59  TRP B CB  1 
ATOM   3983 C  CG  . TRP B 1 16  ? 15.629  28.739  13.794  1.00 24.53 ? 59  TRP B CG  1 
ATOM   3984 C  CD1 . TRP B 1 16  ? 16.830  29.136  13.255  1.00 24.17 ? 59  TRP B CD1 1 
ATOM   3985 C  CD2 . TRP B 1 16  ? 15.938  27.723  14.754  1.00 24.07 ? 59  TRP B CD2 1 
ATOM   3986 N  NE1 . TRP B 1 16  ? 17.861  28.437  13.835  1.00 23.98 ? 59  TRP B NE1 1 
ATOM   3987 C  CE2 . TRP B 1 16  ? 17.341  27.558  14.752  1.00 24.14 ? 59  TRP B CE2 1 
ATOM   3988 C  CE3 . TRP B 1 16  ? 15.165  26.927  15.609  1.00 23.79 ? 59  TRP B CE3 1 
ATOM   3989 C  CZ2 . TRP B 1 16  ? 17.984  26.635  15.576  1.00 23.85 ? 59  TRP B CZ2 1 
ATOM   3990 C  CZ3 . TRP B 1 16  ? 15.807  26.013  16.430  1.00 23.65 ? 59  TRP B CZ3 1 
ATOM   3991 C  CH2 . TRP B 1 16  ? 17.200  25.876  16.406  1.00 23.96 ? 59  TRP B CH2 1 
ATOM   3992 N  N   . LEU B 1 17  ? 11.979  29.167  11.140  1.00 23.56 ? 60  LEU B N   1 
ATOM   3993 C  CA  . LEU B 1 17  ? 10.712  29.581  10.565  1.00 22.96 ? 60  LEU B CA  1 
ATOM   3994 C  C   . LEU B 1 17  ? 9.852   28.356  10.234  1.00 22.33 ? 60  LEU B C   1 
ATOM   3995 O  O   . LEU B 1 17  ? 8.658   28.339  10.513  1.00 21.77 ? 60  LEU B O   1 
ATOM   3996 C  CB  . LEU B 1 17  ? 10.960  30.431  9.315   1.00 23.24 ? 60  LEU B CB  1 
ATOM   3997 C  CG  . LEU B 1 17  ? 9.773   31.184  8.704   1.00 23.72 ? 60  LEU B CG  1 
ATOM   3998 C  CD1 . LEU B 1 17  ? 9.069   32.080  9.739   1.00 23.34 ? 60  LEU B CD1 1 
ATOM   3999 C  CD2 . LEU B 1 17  ? 10.250  31.994  7.512   1.00 22.60 ? 60  LEU B CD2 1 
ATOM   4000 N  N   . ASN B 1 18  ? 10.473  27.339  9.638   1.00 21.89 ? 61  ASN B N   1 
ATOM   4001 C  CA  . ASN B 1 18  ? 9.798   26.072  9.357   1.00 21.83 ? 61  ASN B CA  1 
ATOM   4002 C  C   . ASN B 1 18  ? 9.198   25.442  10.615  1.00 21.71 ? 61  ASN B C   1 
ATOM   4003 O  O   . ASN B 1 18  ? 8.045   24.995  10.621  1.00 21.35 ? 61  ASN B O   1 
ATOM   4004 C  CB  . ASN B 1 18  ? 10.767  25.086  8.709   1.00 21.83 ? 61  ASN B CB  1 
ATOM   4005 C  CG  . ASN B 1 18  ? 11.236  25.535  7.343   1.00 22.00 ? 61  ASN B CG  1 
ATOM   4006 O  OD1 . ASN B 1 18  ? 10.659  26.436  6.738   1.00 24.80 ? 61  ASN B OD1 1 
ATOM   4007 N  ND2 . ASN B 1 18  ? 12.287  24.906  6.848   1.00 21.67 ? 61  ASN B ND2 1 
ATOM   4008 N  N   . LEU B 1 19  ? 9.990   25.429  11.680  1.00 21.55 ? 62  LEU B N   1 
ATOM   4009 C  CA  . LEU B 1 19  ? 9.572   24.863  12.939  1.00 21.77 ? 62  LEU B CA  1 
ATOM   4010 C  C   . LEU B 1 19  ? 8.413   25.663  13.523  1.00 22.24 ? 62  LEU B C   1 
ATOM   4011 O  O   . LEU B 1 19  ? 7.461   25.092  14.072  1.00 22.19 ? 62  LEU B O   1 
ATOM   4012 C  CB  . LEU B 1 19  ? 10.755  24.800  13.904  1.00 21.72 ? 62  LEU B CB  1 
ATOM   4013 C  CG  . LEU B 1 19  ? 10.535  24.026  15.205  1.00 22.14 ? 62  LEU B CG  1 
ATOM   4014 C  CD1 . LEU B 1 19  ? 10.145  22.576  14.940  1.00 21.96 ? 62  LEU B CD1 1 
ATOM   4015 C  CD2 . LEU B 1 19  ? 11.788  24.103  16.053  1.00 22.75 ? 62  LEU B CD2 1 
ATOM   4016 N  N   . TYR B 1 20  ? 8.491   26.984  13.381  1.00 22.77 ? 63  TYR B N   1 
ATOM   4017 C  CA  . TYR B 1 20  ? 7.409   27.875  13.764  1.00 23.23 ? 63  TYR B CA  1 
ATOM   4018 C  C   . TYR B 1 20  ? 6.084   27.562  13.046  1.00 23.37 ? 63  TYR B C   1 
ATOM   4019 O  O   . TYR B 1 20  ? 5.048   27.401  13.692  1.00 23.18 ? 63  TYR B O   1 
ATOM   4020 C  CB  . TYR B 1 20  ? 7.809   29.340  13.540  1.00 23.24 ? 63  TYR B CB  1 
ATOM   4021 C  CG  . TYR B 1 20  ? 6.660   30.289  13.760  1.00 24.32 ? 63  TYR B CG  1 
ATOM   4022 C  CD1 . TYR B 1 20  ? 6.270   30.650  15.045  1.00 26.09 ? 63  TYR B CD1 1 
ATOM   4023 C  CD2 . TYR B 1 20  ? 5.945   30.805  12.684  1.00 26.32 ? 63  TYR B CD2 1 
ATOM   4024 C  CE1 . TYR B 1 20  ? 5.205   31.514  15.260  1.00 27.97 ? 63  TYR B CE1 1 
ATOM   4025 C  CE2 . TYR B 1 20  ? 4.879   31.661  12.885  1.00 28.95 ? 63  TYR B CE2 1 
ATOM   4026 C  CZ  . TYR B 1 20  ? 4.518   32.012  14.177  1.00 29.88 ? 63  TYR B CZ  1 
ATOM   4027 O  OH  . TYR B 1 20  ? 3.463   32.867  14.379  1.00 33.40 ? 63  TYR B OH  1 
ATOM   4028 N  N   . HIS B 1 21  ? 6.119   27.506  11.716  1.00 23.93 ? 64  HIS B N   1 
ATOM   4029 C  CA  . HIS B 1 21  ? 4.929   27.160  10.928  1.00 24.76 ? 64  HIS B CA  1 
ATOM   4030 C  C   . HIS B 1 21  ? 4.392   25.758  11.244  1.00 24.37 ? 64  HIS B C   1 
ATOM   4031 O  O   . HIS B 1 21  ? 3.186   25.565  11.340  1.00 24.53 ? 64  HIS B O   1 
ATOM   4032 C  CB  . HIS B 1 21  ? 5.198   27.312  9.431   1.00 24.78 ? 64  HIS B CB  1 
ATOM   4033 C  CG  . HIS B 1 21  ? 5.324   28.735  8.992   1.00 27.21 ? 64  HIS B CG  1 
ATOM   4034 N  ND1 . HIS B 1 21  ? 4.466   29.724  9.423   1.00 28.84 ? 64  HIS B ND1 1 
ATOM   4035 C  CD2 . HIS B 1 21  ? 6.204   29.339  8.157   1.00 28.24 ? 64  HIS B CD2 1 
ATOM   4036 C  CE1 . HIS B 1 21  ? 4.817   30.877  8.881   1.00 28.67 ? 64  HIS B CE1 1 
ATOM   4037 N  NE2 . HIS B 1 21  ? 5.868   30.670  8.109   1.00 28.26 ? 64  HIS B NE2 1 
ATOM   4038 N  N   . PHE B 1 22  ? 5.294   24.799  11.424  1.00 24.11 ? 65  PHE B N   1 
ATOM   4039 C  CA  . PHE B 1 22  ? 4.914   23.439  11.798  1.00 24.35 ? 65  PHE B CA  1 
ATOM   4040 C  C   . PHE B 1 22  ? 4.151   23.424  13.135  1.00 24.64 ? 65  PHE B C   1 
ATOM   4041 O  O   . PHE B 1 22  ? 3.097   22.791  13.236  1.00 24.17 ? 65  PHE B O   1 
ATOM   4042 C  CB  . PHE B 1 22  ? 6.155   22.526  11.788  1.00 24.08 ? 65  PHE B CB  1 
ATOM   4043 C  CG  . PHE B 1 22  ? 5.994   21.232  12.545  1.00 24.69 ? 65  PHE B CG  1 
ATOM   4044 C  CD1 . PHE B 1 22  ? 4.878   20.416  12.364  1.00 24.56 ? 65  PHE B CD1 1 
ATOM   4045 C  CD2 . PHE B 1 22  ? 6.997   20.804  13.416  1.00 25.58 ? 65  PHE B CD2 1 
ATOM   4046 C  CE1 . PHE B 1 22  ? 4.738   19.235  13.064  1.00 23.31 ? 65  PHE B CE1 1 
ATOM   4047 C  CE2 . PHE B 1 22  ? 6.873   19.607  14.115  1.00 24.92 ? 65  PHE B CE2 1 
ATOM   4048 C  CZ  . PHE B 1 22  ? 5.737   18.822  13.933  1.00 25.41 ? 65  PHE B CZ  1 
ATOM   4049 N  N   . TRP B 1 23  ? 4.657   24.164  14.127  1.00 24.97 ? 66  TRP B N   1 
ATOM   4050 C  CA  . TRP B 1 23  ? 4.031   24.230  15.452  1.00 25.50 ? 66  TRP B CA  1 
ATOM   4051 C  C   . TRP B 1 23  ? 2.678   24.899  15.462  1.00 26.03 ? 66  TRP B C   1 
ATOM   4052 O  O   . TRP B 1 23  ? 1.751   24.392  16.079  1.00 26.24 ? 66  TRP B O   1 
ATOM   4053 C  CB  . TRP B 1 23  ? 4.938   24.941  16.461  1.00 25.48 ? 66  TRP B CB  1 
ATOM   4054 C  CG  . TRP B 1 23  ? 6.104   24.135  16.901  1.00 24.65 ? 66  TRP B CG  1 
ATOM   4055 C  CD1 . TRP B 1 23  ? 6.440   22.891  16.476  1.00 23.55 ? 66  TRP B CD1 1 
ATOM   4056 C  CD2 . TRP B 1 23  ? 7.116   24.536  17.822  1.00 24.70 ? 66  TRP B CD2 1 
ATOM   4057 N  NE1 . TRP B 1 23  ? 7.589   22.477  17.091  1.00 25.25 ? 66  TRP B NE1 1 
ATOM   4058 C  CE2 . TRP B 1 23  ? 8.032   23.470  17.921  1.00 25.30 ? 66  TRP B CE2 1 
ATOM   4059 C  CE3 . TRP B 1 23  ? 7.336   25.694  18.582  1.00 26.21 ? 66  TRP B CE3 1 
ATOM   4060 C  CZ2 . TRP B 1 23  ? 9.159   23.517  18.752  1.00 26.47 ? 66  TRP B CZ2 1 
ATOM   4061 C  CZ3 . TRP B 1 23  ? 8.458   25.751  19.406  1.00 26.45 ? 66  TRP B CZ3 1 
ATOM   4062 C  CH2 . TRP B 1 23  ? 9.354   24.663  19.487  1.00 27.39 ? 66  TRP B CH2 1 
ATOM   4063 N  N   . ARG B 1 24  ? 2.574   26.041  14.792  1.00 26.93 ? 67  ARG B N   1 
ATOM   4064 C  CA  . ARG B 1 24  ? 1.349   26.849  14.801  1.00 27.94 ? 67  ARG B CA  1 
ATOM   4065 C  C   . ARG B 1 24  ? 0.238   26.198  13.967  1.00 27.65 ? 67  ARG B C   1 
ATOM   4066 O  O   . ARG B 1 24  ? -0.929  26.196  14.378  1.00 27.77 ? 67  ARG B O   1 
ATOM   4067 C  CB  . ARG B 1 24  ? 1.638   28.295  14.324  1.00 28.33 ? 67  ARG B CB  1 
ATOM   4068 C  CG  . ARG B 1 24  ? 0.455   29.293  14.431  1.00 31.50 ? 67  ARG B CG  1 
ATOM   4069 C  CD  . ARG B 1 24  ? 0.610   30.467  13.439  1.00 37.20 ? 67  ARG B CD  1 
ATOM   4070 N  NE  . ARG B 1 24  ? 0.758   29.976  12.059  1.00 41.74 ? 67  ARG B NE  1 
ATOM   4071 C  CZ  . ARG B 1 24  ? 1.391   30.612  11.068  1.00 43.51 ? 67  ARG B CZ  1 
ATOM   4072 N  NH1 . ARG B 1 24  ? 1.968   31.794  11.270  1.00 45.22 ? 67  ARG B NH1 1 
ATOM   4073 N  NH2 . ARG B 1 24  ? 1.457   30.057  9.865   1.00 43.35 ? 67  ARG B NH2 1 
ATOM   4074 N  N   . GLU B 1 25  ? 0.606   25.636  12.815  1.00 27.30 ? 68  GLU B N   1 
ATOM   4075 C  CA  . GLU B 1 25  ? -0.368  25.080  11.873  1.00 27.40 ? 68  GLU B CA  1 
ATOM   4076 C  C   . GLU B 1 25  ? -0.810  23.655  12.204  1.00 26.54 ? 68  GLU B C   1 
ATOM   4077 O  O   . GLU B 1 25  ? -1.981  23.331  12.071  1.00 26.66 ? 68  GLU B O   1 
ATOM   4078 C  CB  . GLU B 1 25  ? 0.176   25.130  10.440  1.00 27.90 ? 68  GLU B CB  1 
ATOM   4079 C  CG  . GLU B 1 25  ? 0.221   26.543  9.832   1.00 31.49 ? 68  GLU B CG  1 
ATOM   4080 C  CD  . GLU B 1 25  ? 1.156   26.655  8.621   1.00 36.16 ? 68  GLU B CD  1 
ATOM   4081 O  OE1 . GLU B 1 25  ? 1.354   25.638  7.901   1.00 37.55 ? 68  GLU B OE1 1 
ATOM   4082 O  OE2 . GLU B 1 25  ? 1.693   27.769  8.388   1.00 37.93 ? 68  GLU B OE2 1 
ATOM   4083 N  N   . THR B 1 26  ? 0.122   22.808  12.624  1.00 25.75 ? 69  THR B N   1 
ATOM   4084 C  CA  . THR B 1 26  ? -0.160  21.381  12.766  1.00 25.13 ? 69  THR B CA  1 
ATOM   4085 C  C   . THR B 1 26  ? 0.015   20.889  14.198  1.00 24.90 ? 69  THR B C   1 
ATOM   4086 O  O   . THR B 1 26  ? -0.842  20.176  14.706  1.00 24.82 ? 69  THR B O   1 
ATOM   4087 C  CB  . THR B 1 26  ? 0.684   20.535  11.773  1.00 25.60 ? 69  THR B CB  1 
ATOM   4088 O  OG1 . THR B 1 26  ? 0.631   21.134  10.467  1.00 24.71 ? 69  THR B OG1 1 
ATOM   4089 C  CG2 . THR B 1 26  ? 0.162   19.104  11.684  1.00 24.38 ? 69  THR B CG2 1 
ATOM   4090 N  N   . GLY B 1 27  ? 1.106   21.296  14.850  1.00 24.57 ? 70  GLY B N   1 
ATOM   4091 C  CA  . GLY B 1 27  ? 1.366   20.935  16.236  1.00 24.10 ? 70  GLY B CA  1 
ATOM   4092 C  C   . GLY B 1 27  ? 2.343   19.785  16.387  1.00 24.36 ? 70  GLY B C   1 
ATOM   4093 O  O   . GLY B 1 27  ? 2.440   18.907  15.508  1.00 23.71 ? 70  GLY B O   1 
ATOM   4094 N  N   . THR B 1 28  ? 3.051   19.769  17.517  1.00 24.42 ? 71  THR B N   1 
ATOM   4095 C  CA  . THR B 1 28  ? 4.128   18.787  17.724  1.00 24.94 ? 71  THR B CA  1 
ATOM   4096 C  C   . THR B 1 28  ? 3.629   17.349  17.786  1.00 24.32 ? 71  THR B C   1 
ATOM   4097 O  O   . THR B 1 28  ? 4.348   16.428  17.411  1.00 24.30 ? 71  THR B O   1 
ATOM   4098 C  CB  . THR B 1 28  ? 4.973   19.086  18.977  1.00 25.23 ? 71  THR B CB  1 
ATOM   4099 O  OG1 . THR B 1 28  ? 4.611   20.358  19.517  1.00 27.23 ? 71  THR B OG1 1 
ATOM   4100 C  CG2 . THR B 1 28  ? 6.448   19.129  18.603  1.00 26.27 ? 71  THR B CG2 1 
ATOM   4101 N  N   . HIS B 1 29  ? 2.393   17.168  18.238  1.00 23.73 ? 72  HIS B N   1 
ATOM   4102 C  CA  . HIS B 1 29  ? 1.810   15.846  18.389  1.00 23.73 ? 72  HIS B CA  1 
ATOM   4103 C  C   . HIS B 1 29  ? 1.052   15.388  17.135  1.00 23.26 ? 72  HIS B C   1 
ATOM   4104 O  O   . HIS B 1 29  ? 0.325   14.393  17.148  1.00 23.35 ? 72  HIS B O   1 
ATOM   4105 C  CB  . HIS B 1 29  ? 0.903   15.813  19.622  1.00 23.58 ? 72  HIS B CB  1 
ATOM   4106 C  CG  . HIS B 1 29  ? 1.621   16.107  20.905  1.00 26.10 ? 72  HIS B CG  1 
ATOM   4107 N  ND1 . HIS B 1 29  ? 1.307   17.186  21.706  1.00 27.78 ? 72  HIS B ND1 1 
ATOM   4108 C  CD2 . HIS B 1 29  ? 2.643   15.464  21.524  1.00 27.07 ? 72  HIS B CD2 1 
ATOM   4109 C  CE1 . HIS B 1 29  ? 2.105   17.195  22.760  1.00 28.31 ? 72  HIS B CE1 1 
ATOM   4110 N  NE2 . HIS B 1 29  ? 2.924   16.161  22.674  1.00 28.33 ? 72  HIS B NE2 1 
ATOM   4111 N  N   . LYS B 1 30  ? 1.226   16.128  16.054  1.00 22.98 ? 73  LYS B N   1 
ATOM   4112 C  CA  . LYS B 1 30  ? 0.619   15.787  14.775  1.00 22.35 ? 73  LYS B CA  1 
ATOM   4113 C  C   . LYS B 1 30  ? 1.670   15.771  13.656  1.00 21.58 ? 73  LYS B C   1 
ATOM   4114 O  O   . LYS B 1 30  ? 1.383   16.121  12.518  1.00 21.28 ? 73  LYS B O   1 
ATOM   4115 C  CB  . LYS B 1 30  ? -0.523  16.757  14.462  1.00 22.35 ? 73  LYS B CB  1 
ATOM   4116 C  CG  . LYS B 1 30  ? -1.652  16.752  15.495  1.00 23.32 ? 73  LYS B CG  1 
ATOM   4117 C  CD  . LYS B 1 30  ? -2.572  15.541  15.326  1.00 24.57 ? 73  LYS B CD  1 
ATOM   4118 C  CE  . LYS B 1 30  ? -3.333  15.236  16.600  1.00 24.24 ? 73  LYS B CE  1 
ATOM   4119 N  NZ  . LYS B 1 30  ? -4.295  14.140  16.365  1.00 25.20 ? 73  LYS B NZ  1 
ATOM   4120 N  N   . VAL B 1 31  ? 2.887   15.349  13.987  1.00 21.28 ? 74  VAL B N   1 
ATOM   4121 C  CA  . VAL B 1 31  ? 3.958   15.268  12.994  1.00 21.28 ? 74  VAL B CA  1 
ATOM   4122 C  C   . VAL B 1 31  ? 3.588   14.337  11.810  1.00 20.82 ? 74  VAL B C   1 
ATOM   4123 O  O   . VAL B 1 31  ? 3.862   14.650  10.650  1.00 20.56 ? 74  VAL B O   1 
ATOM   4124 C  CB  . VAL B 1 31  ? 5.329   14.914  13.640  1.00 21.47 ? 74  VAL B CB  1 
ATOM   4125 C  CG1 . VAL B 1 31  ? 5.430   13.438  13.941  1.00 21.59 ? 74  VAL B CG1 1 
ATOM   4126 C  CG2 . VAL B 1 31  ? 6.483   15.350  12.730  1.00 22.29 ? 74  VAL B CG2 1 
ATOM   4127 N  N   . HIS B 1 32  ? 2.933   13.214  12.103  1.00 20.33 ? 75  HIS B N   1 
ATOM   4128 C  CA  . HIS B 1 32  ? 2.442   12.320  11.043  1.00 19.65 ? 75  HIS B CA  1 
ATOM   4129 C  C   . HIS B 1 32  ? 1.548   13.058  10.037  1.00 19.73 ? 75  HIS B C   1 
ATOM   4130 O  O   . HIS B 1 32  ? 1.659   12.821  8.831   1.00 19.20 ? 75  HIS B O   1 
ATOM   4131 C  CB  . HIS B 1 32  ? 1.708   11.115  11.634  1.00 19.14 ? 75  HIS B CB  1 
ATOM   4132 C  CG  . HIS B 1 32  ? 0.629   11.482  12.604  1.00 18.51 ? 75  HIS B CG  1 
ATOM   4133 N  ND1 . HIS B 1 32  ? 0.869   12.236  13.736  1.00 16.49 ? 75  HIS B ND1 1 
ATOM   4134 C  CD2 . HIS B 1 32  ? -0.691  11.193  12.617  1.00 17.50 ? 75  HIS B CD2 1 
ATOM   4135 C  CE1 . HIS B 1 32  ? -0.257  12.388  14.408  1.00 16.54 ? 75  HIS B CE1 1 
ATOM   4136 N  NE2 . HIS B 1 32  ? -1.222  11.772  13.747  1.00 18.43 ? 75  HIS B NE2 1 
ATOM   4137 N  N   . LEU B 1 33  ? 0.678   13.952  10.534  1.00 19.66 ? 76  LEU B N   1 
ATOM   4138 C  CA  . LEU B 1 33  ? -0.159  14.775  9.656   1.00 19.74 ? 76  LEU B CA  1 
ATOM   4139 C  C   . LEU B 1 33  ? 0.681   15.765  8.868   1.00 19.48 ? 76  LEU B C   1 
ATOM   4140 O  O   . LEU B 1 33  ? 0.437   15.985  7.690   1.00 19.84 ? 76  LEU B O   1 
ATOM   4141 C  CB  . LEU B 1 33  ? -1.279  15.494  10.413  1.00 19.49 ? 76  LEU B CB  1 
ATOM   4142 C  CG  . LEU B 1 33  ? -2.355  14.629  11.081  1.00 19.99 ? 76  LEU B CG  1 
ATOM   4143 C  CD1 . LEU B 1 33  ? -3.542  15.495  11.501  1.00 17.56 ? 76  LEU B CD1 1 
ATOM   4144 C  CD2 . LEU B 1 33  ? -2.813  13.428  10.207  1.00 19.25 ? 76  LEU B CD2 1 
ATOM   4145 N  N   . HIS B 1 34  ? 1.684   16.335  9.518   1.00 19.62 ? 77  HIS B N   1 
ATOM   4146 C  CA  . HIS B 1 34  ? 2.631   17.230  8.866   1.00 19.59 ? 77  HIS B CA  1 
ATOM   4147 C  C   . HIS B 1 34  ? 3.208   16.555  7.604   1.00 19.75 ? 77  HIS B C   1 
ATOM   4148 O  O   . HIS B 1 34  ? 3.243   17.174  6.538   1.00 19.57 ? 77  HIS B O   1 
ATOM   4149 C  CB  . HIS B 1 34  ? 3.719   17.640  9.862   1.00 19.52 ? 77  HIS B CB  1 
ATOM   4150 C  CG  . HIS B 1 34  ? 4.729   18.601  9.319   1.00 19.83 ? 77  HIS B CG  1 
ATOM   4151 N  ND1 . HIS B 1 34  ? 4.406   19.885  8.935   1.00 20.29 ? 77  HIS B ND1 1 
ATOM   4152 C  CD2 . HIS B 1 34  ? 6.066   18.476  9.132   1.00 20.25 ? 77  HIS B CD2 1 
ATOM   4153 C  CE1 . HIS B 1 34  ? 5.497   20.501  8.509   1.00 21.89 ? 77  HIS B CE1 1 
ATOM   4154 N  NE2 . HIS B 1 34  ? 6.520   19.671  8.625   1.00 20.68 ? 77  HIS B NE2 1 
ATOM   4155 N  N   . HIS B 1 35  ? 3.603   15.282  7.710   1.00 20.04 ? 78  HIS B N   1 
ATOM   4156 C  CA  . HIS B 1 35  ? 4.132   14.538  6.548   1.00 20.42 ? 78  HIS B CA  1 
ATOM   4157 C  C   . HIS B 1 35  ? 3.095   14.319  5.445   1.00 20.87 ? 78  HIS B C   1 
ATOM   4158 O  O   . HIS B 1 35  ? 3.405   14.499  4.279   1.00 21.34 ? 78  HIS B O   1 
ATOM   4159 C  CB  . HIS B 1 35  ? 4.764   13.195  6.942   1.00 20.08 ? 78  HIS B CB  1 
ATOM   4160 C  CG  . HIS B 1 35  ? 5.859   13.299  7.963   1.00 19.53 ? 78  HIS B CG  1 
ATOM   4161 N  ND1 . HIS B 1 35  ? 6.158   12.273  8.835   1.00 17.56 ? 78  HIS B ND1 1 
ATOM   4162 C  CD2 . HIS B 1 35  ? 6.716   14.306  8.259   1.00 19.07 ? 78  HIS B CD2 1 
ATOM   4163 C  CE1 . HIS B 1 35  ? 7.158   12.641  9.617   1.00 18.47 ? 78  HIS B CE1 1 
ATOM   4164 N  NE2 . HIS B 1 35  ? 7.516   13.870  9.287   1.00 19.02 ? 78  HIS B NE2 1 
ATOM   4165 N  N   . VAL B 1 36  ? 1.872   13.928  5.803   1.00 21.55 ? 79  VAL B N   1 
ATOM   4166 C  CA  . VAL B 1 36  ? 0.822   13.730  4.796   1.00 22.05 ? 79  VAL B CA  1 
ATOM   4167 C  C   . VAL B 1 36  ? 0.610   15.019  3.996   1.00 22.75 ? 79  VAL B C   1 
ATOM   4168 O  O   . VAL B 1 36  ? 0.659   15.017  2.767   1.00 22.78 ? 79  VAL B O   1 
ATOM   4169 C  CB  . VAL B 1 36  ? -0.513  13.239  5.420   1.00 21.93 ? 79  VAL B CB  1 
ATOM   4170 C  CG1 . VAL B 1 36  ? -1.611  13.150  4.365   1.00 20.24 ? 79  VAL B CG1 1 
ATOM   4171 C  CG2 . VAL B 1 36  ? -0.321  11.888  6.064   1.00 22.15 ? 79  VAL B CG2 1 
ATOM   4172 N  N   . GLN B 1 37  ? 0.410   16.118  4.717   1.00 23.91 ? 80  GLN B N   1 
ATOM   4173 C  CA  . GLN B 1 37  ? 0.194   17.443  4.123   1.00 24.57 ? 80  GLN B CA  1 
ATOM   4174 C  C   . GLN B 1 37  ? 1.376   17.899  3.257   1.00 24.47 ? 80  GLN B C   1 
ATOM   4175 O  O   . GLN B 1 37  ? 1.183   18.502  2.199   1.00 25.06 ? 80  GLN B O   1 
ATOM   4176 C  CB  . GLN B 1 37  ? -0.121  18.459  5.225   1.00 24.39 ? 80  GLN B CB  1 
ATOM   4177 C  CG  . GLN B 1 37  ? -1.417  18.143  5.964   1.00 26.45 ? 80  GLN B CG  1 
ATOM   4178 C  CD  . GLN B 1 37  ? -1.628  18.963  7.241   1.00 29.52 ? 80  GLN B CD  1 
ATOM   4179 O  OE1 . GLN B 1 37  ? -0.673  19.442  7.850   1.00 32.54 ? 80  GLN B OE1 1 
ATOM   4180 N  NE2 . GLN B 1 37  ? -2.883  19.109  7.654   1.00 29.34 ? 80  GLN B NE2 1 
ATOM   4181 N  N   . ASN B 1 38  ? 2.590   17.585  3.691   1.00 24.31 ? 81  ASN B N   1 
ATOM   4182 C  CA  . ASN B 1 38  ? 3.775   17.979  2.954   1.00 24.38 ? 81  ASN B CA  1 
ATOM   4183 C  C   . ASN B 1 38  ? 3.833   17.314  1.594   1.00 24.89 ? 81  ASN B C   1 
ATOM   4184 O  O   . ASN B 1 38  ? 3.984   18.007  0.592   1.00 25.25 ? 81  ASN B O   1 
ATOM   4185 C  CB  . ASN B 1 38  ? 5.053   17.714  3.756   1.00 24.17 ? 81  ASN B CB  1 
ATOM   4186 C  CG  . ASN B 1 38  ? 5.434   18.883  4.657   1.00 24.24 ? 81  ASN B CG  1 
ATOM   4187 O  OD1 . ASN B 1 38  ? 5.222   20.050  4.318   1.00 24.71 ? 81  ASN B OD1 1 
ATOM   4188 N  ND2 . ASN B 1 38  ? 6.000   18.572  5.808   1.00 23.75 ? 81  ASN B ND2 1 
ATOM   4189 N  N   . PHE B 1 39  ? 3.696   15.983  1.557   1.00 24.88 ? 82  PHE B N   1 
ATOM   4190 C  CA  . PHE B 1 39  ? 3.636   15.244  0.284   1.00 24.99 ? 82  PHE B CA  1 
ATOM   4191 C  C   . PHE B 1 39  ? 2.474   15.681  -0.632  1.00 25.46 ? 82  PHE B C   1 
ATOM   4192 O  O   . PHE B 1 39  ? 2.573   15.573  -1.855  1.00 25.33 ? 82  PHE B O   1 
ATOM   4193 C  CB  . PHE B 1 39  ? 3.578   13.731  0.518   1.00 24.43 ? 82  PHE B CB  1 
ATOM   4194 C  CG  . PHE B 1 39  ? 4.848   13.155  1.072   1.00 22.81 ? 82  PHE B CG  1 
ATOM   4195 C  CD1 . PHE B 1 39  ? 4.873   12.610  2.354   1.00 20.87 ? 82  PHE B CD1 1 
ATOM   4196 C  CD2 . PHE B 1 39  ? 6.021   13.153  0.312   1.00 19.56 ? 82  PHE B CD2 1 
ATOM   4197 C  CE1 . PHE B 1 39  ? 6.039   12.085  2.868   1.00 19.05 ? 82  PHE B CE1 1 
ATOM   4198 C  CE2 . PHE B 1 39  ? 7.183   12.624  0.814   1.00 18.15 ? 82  PHE B CE2 1 
ATOM   4199 C  CZ  . PHE B 1 39  ? 7.198   12.085  2.098   1.00 19.19 ? 82  PHE B CZ  1 
ATOM   4200 N  N   . GLN B 1 40  ? 1.380   16.161  -0.047  1.00 25.81 ? 83  GLN B N   1 
ATOM   4201 C  CA  . GLN B 1 40  ? 0.301   16.711  -0.854  1.00 26.75 ? 83  GLN B CA  1 
ATOM   4202 C  C   . GLN B 1 40  ? 0.688   18.078  -1.450  1.00 26.98 ? 83  GLN B C   1 
ATOM   4203 O  O   . GLN B 1 40  ? 0.288   18.395  -2.570  1.00 26.67 ? 83  GLN B O   1 
ATOM   4204 C  CB  . GLN B 1 40  ? -1.003  16.764  -0.063  1.00 26.91 ? 83  GLN B CB  1 
ATOM   4205 C  CG  . GLN B 1 40  ? -1.594  15.370  0.229   1.00 30.07 ? 83  GLN B CG  1 
ATOM   4206 C  CD  . GLN B 1 40  ? -2.698  15.398  1.287   1.00 35.44 ? 83  GLN B CD  1 
ATOM   4207 O  OE1 . GLN B 1 40  ? -2.937  16.429  1.940   1.00 37.73 ? 83  GLN B OE1 1 
ATOM   4208 N  NE2 . GLN B 1 40  ? -3.374  14.259  1.469   1.00 36.58 ? 83  GLN B NE2 1 
ATOM   4209 N  N   . LYS B 1 41  ? 1.495   18.857  -0.715  1.00 27.00 ? 84  LYS B N   1 
ATOM   4210 C  CA  . LYS B 1 41  ? 2.012   20.147  -1.189  1.00 26.81 ? 84  LYS B CA  1 
ATOM   4211 C  C   . LYS B 1 41  ? 3.149   20.014  -2.187  1.00 26.46 ? 84  LYS B C   1 
ATOM   4212 O  O   . LYS B 1 41  ? 3.205   20.760  -3.164  1.00 26.72 ? 84  LYS B O   1 
ATOM   4213 C  CB  . LYS B 1 41  ? 2.537   21.004  -0.026  1.00 27.40 ? 84  LYS B CB  1 
ATOM   4214 C  CG  . LYS B 1 41  ? 1.493   21.726  0.787   1.00 28.97 ? 84  LYS B CG  1 
ATOM   4215 C  CD  . LYS B 1 41  ? 2.023   23.092  1.270   1.00 34.28 ? 84  LYS B CD  1 
ATOM   4216 C  CE  . LYS B 1 41  ? 2.761   23.031  2.623   1.00 35.67 ? 84  LYS B CE  1 
ATOM   4217 N  NZ  . LYS B 1 41  ? 1.880   22.537  3.740   1.00 37.41 ? 84  LYS B NZ  1 
ATOM   4218 N  N   . TYR B 1 42  ? 4.079   19.097  -1.933  1.00 25.89 ? 85  TYR B N   1 
ATOM   4219 C  CA  . TYR B 1 42  ? 5.350   19.101  -2.667  1.00 25.48 ? 85  TYR B CA  1 
ATOM   4220 C  C   . TYR B 1 42  ? 5.525   17.963  -3.667  1.00 24.99 ? 85  TYR B C   1 
ATOM   4221 O  O   . TYR B 1 42  ? 6.451   17.975  -4.488  1.00 23.95 ? 85  TYR B O   1 
ATOM   4222 C  CB  . TYR B 1 42  ? 6.537   19.150  -1.695  1.00 25.55 ? 85  TYR B CB  1 
ATOM   4223 C  CG  . TYR B 1 42  ? 6.508   20.342  -0.760  1.00 27.14 ? 85  TYR B CG  1 
ATOM   4224 C  CD1 . TYR B 1 42  ? 6.425   20.160  0.626   1.00 27.52 ? 85  TYR B CD1 1 
ATOM   4225 C  CD2 . TYR B 1 42  ? 6.541   21.657  -1.262  1.00 27.56 ? 85  TYR B CD2 1 
ATOM   4226 C  CE1 . TYR B 1 42  ? 6.379   21.244  1.488   1.00 28.80 ? 85  TYR B CE1 1 
ATOM   4227 C  CE2 . TYR B 1 42  ? 6.492   22.757  -0.405  1.00 28.76 ? 85  TYR B CE2 1 
ATOM   4228 C  CZ  . TYR B 1 42  ? 6.415   22.544  0.971   1.00 30.08 ? 85  TYR B CZ  1 
ATOM   4229 O  OH  . TYR B 1 42  ? 6.371   23.617  1.836   1.00 31.08 ? 85  TYR B OH  1 
ATOM   4230 N  N   . GLY B 1 43  ? 4.627   16.989  -3.602  1.00 25.01 ? 86  GLY B N   1 
ATOM   4231 C  CA  . GLY B 1 43  ? 4.795   15.768  -4.373  1.00 25.24 ? 86  GLY B CA  1 
ATOM   4232 C  C   . GLY B 1 43  ? 5.587   14.754  -3.570  1.00 25.24 ? 86  GLY B C   1 
ATOM   4233 O  O   . GLY B 1 43  ? 5.764   14.923  -2.365  1.00 25.15 ? 86  GLY B O   1 
ATOM   4234 N  N   . PRO B 1 44  ? 6.081   13.698  -4.238  1.00 25.32 ? 87  PRO B N   1 
ATOM   4235 C  CA  . PRO B 1 44  ? 6.599   12.490  -3.576  1.00 25.12 ? 87  PRO B CA  1 
ATOM   4236 C  C   . PRO B 1 44  ? 7.952   12.640  -2.864  1.00 24.95 ? 87  PRO B C   1 
ATOM   4237 O  O   . PRO B 1 44  ? 8.389   11.717  -2.170  1.00 25.08 ? 87  PRO B O   1 
ATOM   4238 C  CB  . PRO B 1 44  ? 6.724   11.503  -4.738  1.00 25.13 ? 87  PRO B CB  1 
ATOM   4239 C  CG  . PRO B 1 44  ? 7.054   12.377  -5.901  1.00 24.99 ? 87  PRO B CG  1 
ATOM   4240 C  CD  . PRO B 1 44  ? 6.224   13.619  -5.702  1.00 25.07 ? 87  PRO B CD  1 
ATOM   4241 N  N   . ILE B 1 45  ? 8.620   13.774  -3.041  1.00 24.86 ? 88  ILE B N   1 
ATOM   4242 C  CA  . ILE B 1 45  ? 9.912   14.003  -2.376  1.00 24.72 ? 88  ILE B CA  1 
ATOM   4243 C  C   . ILE B 1 45  ? 10.099  15.466  -2.007  1.00 24.60 ? 88  ILE B C   1 
ATOM   4244 O  O   . ILE B 1 45  ? 9.785   16.368  -2.789  1.00 24.41 ? 88  ILE B O   1 
ATOM   4245 C  CB  . ILE B 1 45  ? 11.118  13.496  -3.218  1.00 24.60 ? 88  ILE B CB  1 
ATOM   4246 C  CG1 . ILE B 1 45  ? 12.430  13.663  -2.437  1.00 24.14 ? 88  ILE B CG1 1 
ATOM   4247 C  CG2 . ILE B 1 45  ? 11.165  14.194  -4.579  1.00 25.21 ? 88  ILE B CG2 1 
ATOM   4248 C  CD1 . ILE B 1 45  ? 13.639  13.097  -3.129  1.00 23.88 ? 88  ILE B CD1 1 
ATOM   4249 N  N   . TYR B 1 46  ? 10.594  15.697  -0.798  1.00 24.67 ? 89  TYR B N   1 
ATOM   4250 C  CA  . TYR B 1 46  ? 10.826  17.055  -0.339  1.00 24.57 ? 89  TYR B CA  1 
ATOM   4251 C  C   . TYR B 1 46  ? 11.916  17.073  0.701   1.00 24.35 ? 89  TYR B C   1 
ATOM   4252 O  O   . TYR B 1 46  ? 12.297  16.028  1.229   1.00 24.27 ? 89  TYR B O   1 
ATOM   4253 C  CB  . TYR B 1 46  ? 9.531   17.705  0.184   1.00 24.60 ? 89  TYR B CB  1 
ATOM   4254 C  CG  . TYR B 1 46  ? 9.043   17.192  1.523   1.00 26.11 ? 89  TYR B CG  1 
ATOM   4255 C  CD1 . TYR B 1 46  ? 9.486   17.776  2.722   1.00 27.56 ? 89  TYR B CD1 1 
ATOM   4256 C  CD2 . TYR B 1 46  ? 8.136   16.130  1.606   1.00 26.12 ? 89  TYR B CD2 1 
ATOM   4257 C  CE1 . TYR B 1 46  ? 9.043   17.304  3.971   1.00 26.84 ? 89  TYR B CE1 1 
ATOM   4258 C  CE2 . TYR B 1 46  ? 7.683   15.658  2.859   1.00 27.02 ? 89  TYR B CE2 1 
ATOM   4259 C  CZ  . TYR B 1 46  ? 8.146   16.252  4.031   1.00 27.22 ? 89  TYR B CZ  1 
ATOM   4260 O  OH  . TYR B 1 46  ? 7.708   15.808  5.264   1.00 27.91 ? 89  TYR B OH  1 
ATOM   4261 N  N   . ARG B 1 47  ? 12.430  18.269  0.969   1.00 24.81 ? 90  ARG B N   1 
ATOM   4262 C  CA  . ARG B 1 47  ? 13.388  18.494  2.051   1.00 24.90 ? 90  ARG B CA  1 
ATOM   4263 C  C   . ARG B 1 47  ? 12.831  19.528  3.021   1.00 24.83 ? 90  ARG B C   1 
ATOM   4264 O  O   . ARG B 1 47  ? 12.179  20.490  2.611   1.00 24.57 ? 90  ARG B O   1 
ATOM   4265 C  CB  . ARG B 1 47  ? 14.747  18.942  1.515   1.00 24.95 ? 90  ARG B CB  1 
ATOM   4266 C  CG  . ARG B 1 47  ? 14.733  20.207  0.707   1.00 25.93 ? 90  ARG B CG  1 
ATOM   4267 C  CD  . ARG B 1 47  ? 16.142  20.562  0.272   1.00 30.22 ? 90  ARG B CD  1 
ATOM   4268 N  NE  . ARG B 1 47  ? 16.161  21.732  -0.613  1.00 34.43 ? 90  ARG B NE  1 
ATOM   4269 C  CZ  . ARG B 1 47  ? 16.278  22.997  -0.207  1.00 36.04 ? 90  ARG B CZ  1 
ATOM   4270 N  NH1 . ARG B 1 47  ? 16.391  23.288  1.082   1.00 36.43 ? 90  ARG B NH1 1 
ATOM   4271 N  NH2 . ARG B 1 47  ? 16.286  23.983  -1.100  1.00 38.00 ? 90  ARG B NH2 1 
ATOM   4272 N  N   . GLU B 1 48  ? 13.067  19.310  4.308   1.00 24.45 ? 91  GLU B N   1 
ATOM   4273 C  CA  . GLU B 1 48  ? 12.661  20.275  5.308   1.00 24.45 ? 91  GLU B CA  1 
ATOM   4274 C  C   . GLU B 1 48  ? 13.687  20.325  6.421   1.00 24.34 ? 91  GLU B C   1 
ATOM   4275 O  O   . GLU B 1 48  ? 14.051  19.303  7.010   1.00 23.70 ? 91  GLU B O   1 
ATOM   4276 C  CB  . GLU B 1 48  ? 11.265  19.963  5.855   1.00 24.79 ? 91  GLU B CB  1 
ATOM   4277 C  CG  . GLU B 1 48  ? 10.737  20.988  6.862   1.00 25.38 ? 91  GLU B CG  1 
ATOM   4278 C  CD  . GLU B 1 48  ? 9.291   20.731  7.265   1.00 27.04 ? 91  GLU B CD  1 
ATOM   4279 O  OE1 . GLU B 1 48  ? 8.949   19.604  7.683   1.00 26.39 ? 91  GLU B OE1 1 
ATOM   4280 O  OE2 . GLU B 1 48  ? 8.489   21.677  7.178   1.00 28.85 ? 91  GLU B OE2 1 
ATOM   4281 N  N   . LYS B 1 49  ? 14.176  21.531  6.666   1.00 24.42 ? 92  LYS B N   1 
ATOM   4282 C  CA  . LYS B 1 49  ? 14.997  21.812  7.830   1.00 24.52 ? 92  LYS B CA  1 
ATOM   4283 C  C   . LYS B 1 49  ? 14.056  22.164  8.976   1.00 24.19 ? 92  LYS B C   1 
ATOM   4284 O  O   . LYS B 1 49  ? 13.234  23.088  8.862   1.00 23.38 ? 92  LYS B O   1 
ATOM   4285 C  CB  . LYS B 1 49  ? 15.939  22.973  7.539   1.00 24.55 ? 92  LYS B CB  1 
ATOM   4286 C  CG  . LYS B 1 49  ? 17.126  23.076  8.467   1.00 26.09 ? 92  LYS B CG  1 
ATOM   4287 C  CD  . LYS B 1 49  ? 18.021  24.210  8.001   1.00 28.39 ? 92  LYS B CD  1 
ATOM   4288 C  CE  . LYS B 1 49  ? 19.382  24.137  8.649   1.00 30.41 ? 92  LYS B CE  1 
ATOM   4289 N  NZ  . LYS B 1 49  ? 20.282  25.154  8.050   1.00 32.73 ? 92  LYS B NZ  1 
ATOM   4290 N  N   . LEU B 1 50  ? 14.138  21.389  10.052  1.00 24.15 ? 93  LEU B N   1 
ATOM   4291 C  CA  . LEU B 1 50  ? 13.417  21.717  11.274  1.00 24.61 ? 93  LEU B CA  1 
ATOM   4292 C  C   . LEU B 1 50  ? 14.432  22.071  12.352  1.00 25.10 ? 93  LEU B C   1 
ATOM   4293 O  O   . LEU B 1 50  ? 15.137  21.198  12.860  1.00 25.15 ? 93  LEU B O   1 
ATOM   4294 C  CB  . LEU B 1 50  ? 12.488  20.578  11.711  1.00 24.02 ? 93  LEU B CB  1 
ATOM   4295 C  CG  . LEU B 1 50  ? 11.219  20.399  10.875  1.00 23.68 ? 93  LEU B CG  1 
ATOM   4296 C  CD1 . LEU B 1 50  ? 10.384  19.256  11.430  1.00 24.00 ? 93  LEU B CD1 1 
ATOM   4297 C  CD2 . LEU B 1 50  ? 10.378  21.682  10.795  1.00 22.60 ? 93  LEU B CD2 1 
ATOM   4298 N  N   . GLY B 1 51  ? 14.536  23.363  12.658  1.00 25.80 ? 94  GLY B N   1 
ATOM   4299 C  CA  . GLY B 1 51  ? 15.547  23.849  13.592  1.00 26.74 ? 94  GLY B CA  1 
ATOM   4300 C  C   . GLY B 1 51  ? 16.923  23.706  12.973  1.00 27.54 ? 94  GLY B C   1 
ATOM   4301 O  O   . GLY B 1 51  ? 17.228  24.358  11.974  1.00 27.71 ? 94  GLY B O   1 
ATOM   4302 N  N   . ASN B 1 52  ? 17.757  22.845  13.550  1.00 28.43 ? 95  ASN B N   1 
ATOM   4303 C  CA  . ASN B 1 52  ? 19.103  22.643  13.009  1.00 29.24 ? 95  ASN B CA  1 
ATOM   4304 C  C   . ASN B 1 52  ? 19.193  21.462  12.047  1.00 29.04 ? 95  ASN B C   1 
ATOM   4305 O  O   . ASN B 1 52  ? 20.155  21.367  11.287  1.00 29.45 ? 95  ASN B O   1 
ATOM   4306 C  CB  . ASN B 1 52  ? 20.146  22.507  14.126  1.00 29.62 ? 95  ASN B CB  1 
ATOM   4307 C  CG  . ASN B 1 52  ? 20.630  23.862  14.663  1.00 32.40 ? 95  ASN B CG  1 
ATOM   4308 O  OD1 . ASN B 1 52  ? 20.516  24.906  13.992  1.00 35.27 ? 95  ASN B OD1 1 
ATOM   4309 N  ND2 . ASN B 1 52  ? 21.196  23.845  15.878  1.00 33.36 ? 95  ASN B ND2 1 
ATOM   4310 N  N   . VAL B 1 53  ? 18.190  20.580  12.066  1.00 28.58 ? 96  VAL B N   1 
ATOM   4311 C  CA  . VAL B 1 53  ? 18.236  19.335  11.275  1.00 27.94 ? 96  VAL B CA  1 
ATOM   4312 C  C   . VAL B 1 53  ? 17.441  19.361  9.960   1.00 27.10 ? 96  VAL B C   1 
ATOM   4313 O  O   . VAL B 1 53  ? 16.238  19.600  9.942   1.00 26.77 ? 96  VAL B O   1 
ATOM   4314 C  CB  . VAL B 1 53  ? 17.846  18.109  12.146  1.00 28.35 ? 96  VAL B CB  1 
ATOM   4315 C  CG1 . VAL B 1 53  ? 17.850  16.809  11.332  1.00 28.13 ? 96  VAL B CG1 1 
ATOM   4316 C  CG2 . VAL B 1 53  ? 18.802  18.007  13.344  1.00 28.13 ? 96  VAL B CG2 1 
ATOM   4317 N  N   . GLU B 1 54  ? 18.148  19.115  8.863   1.00 26.61 ? 97  GLU B N   1 
ATOM   4318 C  CA  . GLU B 1 54  ? 17.527  18.932  7.550   1.00 26.47 ? 97  GLU B CA  1 
ATOM   4319 C  C   . GLU B 1 54  ? 17.401  17.449  7.204   1.00 25.61 ? 97  GLU B C   1 
ATOM   4320 O  O   . GLU B 1 54  ? 18.294  16.654  7.502   1.00 25.00 ? 97  GLU B O   1 
ATOM   4321 C  CB  . GLU B 1 54  ? 18.311  19.658  6.444   1.00 26.76 ? 97  GLU B CB  1 
ATOM   4322 C  CG  . GLU B 1 54  ? 17.557  19.751  5.119   1.00 28.88 ? 97  GLU B CG  1 
ATOM   4323 C  CD  . GLU B 1 54  ? 18.016  20.901  4.232   1.00 32.85 ? 97  GLU B CD  1 
ATOM   4324 O  OE1 . GLU B 1 54  ? 19.244  21.135  4.155   1.00 34.59 ? 97  GLU B OE1 1 
ATOM   4325 O  OE2 . GLU B 1 54  ? 17.142  21.560  3.601   1.00 33.79 ? 97  GLU B OE2 1 
ATOM   4326 N  N   . SER B 1 55  ? 16.275  17.096  6.588   1.00 24.93 ? 98  SER B N   1 
ATOM   4327 C  CA  . SER B 1 55  ? 16.085  15.773  6.020   1.00 24.53 ? 98  SER B CA  1 
ATOM   4328 C  C   . SER B 1 55  ? 15.506  15.910  4.635   1.00 23.89 ? 98  SER B C   1 
ATOM   4329 O  O   . SER B 1 55  ? 14.834  16.893  4.322   1.00 24.12 ? 98  SER B O   1 
ATOM   4330 C  CB  . SER B 1 55  ? 15.110  14.931  6.855   1.00 24.58 ? 98  SER B CB  1 
ATOM   4331 O  OG  . SER B 1 55  ? 15.525  14.792  8.198   1.00 26.34 ? 98  SER B OG  1 
ATOM   4332 N  N   . VAL B 1 56  ? 15.771  14.909  3.811   1.00 23.35 ? 99  VAL B N   1 
ATOM   4333 C  CA  . VAL B 1 56  ? 14.982  14.665  2.624   1.00 22.87 ? 99  VAL B CA  1 
ATOM   4334 C  C   . VAL B 1 56  ? 13.941  13.644  3.059   1.00 22.87 ? 99  VAL B C   1 
ATOM   4335 O  O   . VAL B 1 56  ? 14.263  12.680  3.775   1.00 22.55 ? 99  VAL B O   1 
ATOM   4336 C  CB  . VAL B 1 56  ? 15.858  14.095  1.493   1.00 23.03 ? 99  VAL B CB  1 
ATOM   4337 C  CG1 . VAL B 1 56  ? 15.011  13.568  0.340   1.00 21.60 ? 99  VAL B CG1 1 
ATOM   4338 C  CG2 . VAL B 1 56  ? 16.838  15.163  1.009   1.00 22.90 ? 99  VAL B CG2 1 
ATOM   4339 N  N   . TYR B 1 57  ? 12.692  13.868  2.667   1.00 22.58 ? 100 TYR B N   1 
ATOM   4340 C  CA  . TYR B 1 57  ? 11.640  12.901  2.954   1.00 22.59 ? 100 TYR B CA  1 
ATOM   4341 C  C   . TYR B 1 57  ? 11.154  12.234  1.678   1.00 22.62 ? 100 TYR B C   1 
ATOM   4342 O  O   . TYR B 1 57  ? 10.875  12.917  0.678   1.00 22.82 ? 100 TYR B O   1 
ATOM   4343 C  CB  . TYR B 1 57  ? 10.459  13.563  3.656   1.00 22.69 ? 100 TYR B CB  1 
ATOM   4344 C  CG  . TYR B 1 57  ? 10.742  14.099  5.041   1.00 22.16 ? 100 TYR B CG  1 
ATOM   4345 C  CD1 . TYR B 1 57  ? 11.452  15.293  5.209   1.00 22.59 ? 100 TYR B CD1 1 
ATOM   4346 C  CD2 . TYR B 1 57  ? 10.266  13.447  6.177   1.00 21.17 ? 100 TYR B CD2 1 
ATOM   4347 C  CE1 . TYR B 1 57  ? 11.687  15.816  6.457   1.00 22.40 ? 100 TYR B CE1 1 
ATOM   4348 C  CE2 . TYR B 1 57  ? 10.501  13.967  7.452   1.00 20.87 ? 100 TYR B CE2 1 
ATOM   4349 C  CZ  . TYR B 1 57  ? 11.217  15.151  7.573   1.00 21.15 ? 100 TYR B CZ  1 
ATOM   4350 O  OH  . TYR B 1 57  ? 11.480  15.701  8.789   1.00 19.52 ? 100 TYR B OH  1 
ATOM   4351 N  N   . VAL B 1 58  ? 11.045  10.905  1.729   1.00 22.65 ? 101 VAL B N   1 
ATOM   4352 C  CA  . VAL B 1 58  ? 10.539  10.100  0.612   1.00 22.32 ? 101 VAL B CA  1 
ATOM   4353 C  C   . VAL B 1 58  ? 9.313   9.310   1.044   1.00 22.67 ? 101 VAL B C   1 
ATOM   4354 O  O   . VAL B 1 58  ? 9.100   9.094   2.240   1.00 22.54 ? 101 VAL B O   1 
ATOM   4355 C  CB  . VAL B 1 58  ? 11.627  9.154   0.011   1.00 22.52 ? 101 VAL B CB  1 
ATOM   4356 C  CG1 . VAL B 1 58  ? 12.789  9.954   -0.579  1.00 22.13 ? 101 VAL B CG1 1 
ATOM   4357 C  CG2 . VAL B 1 58  ? 12.133  8.133   1.035   1.00 21.49 ? 101 VAL B CG2 1 
ATOM   4358 N  N   . ILE B 1 59  ? 8.507   8.893   0.066   1.00 23.41 ? 102 ILE B N   1 
ATOM   4359 C  CA  . ILE B 1 59  ? 7.261   8.150   0.323   1.00 23.96 ? 102 ILE B CA  1 
ATOM   4360 C  C   . ILE B 1 59  ? 7.134   6.909   -0.575  1.00 24.72 ? 102 ILE B C   1 
ATOM   4361 O  O   . ILE B 1 59  ? 6.679   5.857   -0.124  1.00 24.95 ? 102 ILE B O   1 
ATOM   4362 C  CB  . ILE B 1 59  ? 5.979   9.063   0.241   1.00 23.76 ? 102 ILE B CB  1 
ATOM   4363 C  CG1 . ILE B 1 59  ? 4.736   8.318   0.761   1.00 23.10 ? 102 ILE B CG1 1 
ATOM   4364 C  CG2 . ILE B 1 59  ? 5.769   9.617   -1.182  1.00 22.70 ? 102 ILE B CG2 1 
ATOM   4365 C  CD1 . ILE B 1 59  ? 3.493   9.201   0.997   1.00 21.65 ? 102 ILE B CD1 1 
ATOM   4366 N  N   . ASP B 1 60  ? 7.558   7.038   -1.829  1.00 25.29 ? 103 ASP B N   1 
ATOM   4367 C  CA  . ASP B 1 60  ? 7.460   5.963   -2.819  1.00 25.84 ? 103 ASP B CA  1 
ATOM   4368 C  C   . ASP B 1 60  ? 8.341   4.762   -2.499  1.00 25.96 ? 103 ASP B C   1 
ATOM   4369 O  O   . ASP B 1 60  ? 9.550   4.919   -2.346  1.00 26.10 ? 103 ASP B O   1 
ATOM   4370 C  CB  . ASP B 1 60  ? 7.835   6.504   -4.202  1.00 26.32 ? 103 ASP B CB  1 
ATOM   4371 C  CG  . ASP B 1 60  ? 7.526   5.529   -5.332  1.00 27.24 ? 103 ASP B CG  1 
ATOM   4372 O  OD1 . ASP B 1 60  ? 7.821   4.320   -5.209  1.00 27.23 ? 103 ASP B OD1 1 
ATOM   4373 O  OD2 . ASP B 1 60  ? 6.993   5.994   -6.361  1.00 29.01 ? 103 ASP B OD2 1 
ATOM   4374 N  N   . PRO B 1 61  ? 7.747   3.549   -2.435  1.00 26.32 ? 104 PRO B N   1 
ATOM   4375 C  CA  . PRO B 1 61  ? 8.526   2.336   -2.189  1.00 26.66 ? 104 PRO B CA  1 
ATOM   4376 C  C   . PRO B 1 61  ? 9.724   2.141   -3.137  1.00 27.65 ? 104 PRO B C   1 
ATOM   4377 O  O   . PRO B 1 61  ? 10.747  1.581   -2.727  1.00 27.59 ? 104 PRO B O   1 
ATOM   4378 C  CB  . PRO B 1 61  ? 7.485   1.231   -2.358  1.00 26.26 ? 104 PRO B CB  1 
ATOM   4379 C  CG  . PRO B 1 61  ? 6.238   1.848   -1.880  1.00 25.64 ? 104 PRO B CG  1 
ATOM   4380 C  CD  . PRO B 1 61  ? 6.297   3.261   -2.406  1.00 26.16 ? 104 PRO B CD  1 
ATOM   4381 N  N   . GLU B 1 62  ? 9.604   2.617   -4.376  1.00 28.70 ? 105 GLU B N   1 
ATOM   4382 C  CA  . GLU B 1 62  ? 10.697  2.570   -5.359  1.00 30.02 ? 105 GLU B CA  1 
ATOM   4383 C  C   . GLU B 1 62  ? 11.934  3.332   -4.891  1.00 29.73 ? 105 GLU B C   1 
ATOM   4384 O  O   . GLU B 1 62  ? 13.066  2.902   -5.118  1.00 29.77 ? 105 GLU B O   1 
ATOM   4385 C  CB  . GLU B 1 62  ? 10.240  3.188   -6.675  1.00 30.88 ? 105 GLU B CB  1 
ATOM   4386 C  CG  . GLU B 1 62  ? 10.616  2.394   -7.901  1.00 34.50 ? 105 GLU B CG  1 
ATOM   4387 C  CD  . GLU B 1 62  ? 9.605   1.302   -8.172  1.00 39.32 ? 105 GLU B CD  1 
ATOM   4388 O  OE1 . GLU B 1 62  ? 8.390   1.575   -8.000  1.00 40.85 ? 105 GLU B OE1 1 
ATOM   4389 O  OE2 . GLU B 1 62  ? 10.022  0.177   -8.545  1.00 40.99 ? 105 GLU B OE2 1 
ATOM   4390 N  N   . ASP B 1 63  ? 11.709  4.484   -4.265  1.00 29.63 ? 106 ASP B N   1 
ATOM   4391 C  CA  . ASP B 1 63  ? 12.794  5.262   -3.661  1.00 29.23 ? 106 ASP B CA  1 
ATOM   4392 C  C   . ASP B 1 63  ? 13.285  4.613   -2.363  1.00 28.82 ? 106 ASP B C   1 
ATOM   4393 O  O   . ASP B 1 63  ? 14.468  4.661   -2.052  1.00 28.59 ? 106 ASP B O   1 
ATOM   4394 C  CB  . ASP B 1 63  ? 12.344  6.712   -3.440  1.00 29.36 ? 106 ASP B CB  1 
ATOM   4395 C  CG  . ASP B 1 63  ? 11.901  7.392   -4.734  1.00 29.64 ? 106 ASP B CG  1 
ATOM   4396 O  OD1 . ASP B 1 63  ? 12.411  7.007   -5.802  1.00 32.07 ? 106 ASP B OD1 1 
ATOM   4397 O  OD2 . ASP B 1 63  ? 11.050  8.308   -4.699  1.00 29.23 ? 106 ASP B OD2 1 
ATOM   4398 N  N   . VAL B 1 64  ? 12.373  3.985   -1.626  1.00 28.84 ? 107 VAL B N   1 
ATOM   4399 C  CA  . VAL B 1 64  ? 12.731  3.270   -0.406  1.00 29.08 ? 107 VAL B CA  1 
ATOM   4400 C  C   . VAL B 1 64  ? 13.700  2.142   -0.762  1.00 29.63 ? 107 VAL B C   1 
ATOM   4401 O  O   . VAL B 1 64  ? 14.739  1.978   -0.121  1.00 29.75 ? 107 VAL B O   1 
ATOM   4402 C  CB  . VAL B 1 64  ? 11.482  2.706   0.333   1.00 29.08 ? 107 VAL B CB  1 
ATOM   4403 C  CG1 . VAL B 1 64  ? 11.879  1.937   1.595   1.00 28.56 ? 107 VAL B CG1 1 
ATOM   4404 C  CG2 . VAL B 1 64  ? 10.524  3.810   0.680   1.00 28.55 ? 107 VAL B CG2 1 
ATOM   4405 N  N   . ALA B 1 65  ? 13.366  1.397   -1.810  1.00 30.23 ? 108 ALA B N   1 
ATOM   4406 C  CA  . ALA B 1 65  ? 14.222  0.319   -2.311  1.00 31.08 ? 108 ALA B CA  1 
ATOM   4407 C  C   . ALA B 1 65  ? 15.634  0.800   -2.680  1.00 31.63 ? 108 ALA B C   1 
ATOM   4408 O  O   . ALA B 1 65  ? 16.626  0.145   -2.330  1.00 31.50 ? 108 ALA B O   1 
ATOM   4409 C  CB  . ALA B 1 65  ? 13.565  -0.377  -3.497  1.00 31.06 ? 108 ALA B CB  1 
ATOM   4410 N  N   . LEU B 1 66  ? 15.722  1.940   -3.370  1.00 32.02 ? 109 LEU B N   1 
ATOM   4411 C  CA  . LEU B 1 66  ? 17.024  2.497   -3.736  1.00 32.68 ? 109 LEU B CA  1 
ATOM   4412 C  C   . LEU B 1 66  ? 17.822  2.930   -2.519  1.00 33.08 ? 109 LEU B C   1 
ATOM   4413 O  O   . LEU B 1 66  ? 19.036  2.726   -2.464  1.00 32.95 ? 109 LEU B O   1 
ATOM   4414 C  CB  . LEU B 1 66  ? 16.885  3.648   -4.733  1.00 32.71 ? 109 LEU B CB  1 
ATOM   4415 C  CG  . LEU B 1 66  ? 16.321  3.260   -6.110  1.00 33.57 ? 109 LEU B CG  1 
ATOM   4416 C  CD1 . LEU B 1 66  ? 16.198  4.490   -7.023  1.00 33.41 ? 109 LEU B CD1 1 
ATOM   4417 C  CD2 . LEU B 1 66  ? 17.135  2.130   -6.783  1.00 32.29 ? 109 LEU B CD2 1 
ATOM   4418 N  N   . LEU B 1 67  ? 17.129  3.504   -1.538  1.00 33.90 ? 110 LEU B N   1 
ATOM   4419 C  CA  . LEU B 1 67  ? 17.773  3.963   -0.317  1.00 34.72 ? 110 LEU B CA  1 
ATOM   4420 C  C   . LEU B 1 67  ? 18.479  2.817   0.395   1.00 35.88 ? 110 LEU B C   1 
ATOM   4421 O  O   . LEU B 1 67  ? 19.677  2.877   0.649   1.00 36.20 ? 110 LEU B O   1 
ATOM   4422 C  CB  . LEU B 1 67  ? 16.760  4.638   0.620   1.00 34.31 ? 110 LEU B CB  1 
ATOM   4423 C  CG  . LEU B 1 67  ? 17.273  4.932   2.035   1.00 32.69 ? 110 LEU B CG  1 
ATOM   4424 C  CD1 . LEU B 1 67  ? 18.344  6.001   2.006   1.00 31.80 ? 110 LEU B CD1 1 
ATOM   4425 C  CD2 . LEU B 1 67  ? 16.162  5.327   2.967   1.00 31.57 ? 110 LEU B CD2 1 
ATOM   4426 N  N   . PHE B 1 68  ? 17.733  1.768   0.703   1.00 37.56 ? 111 PHE B N   1 
ATOM   4427 C  CA  . PHE B 1 68  ? 18.295  0.629   1.411   1.00 39.24 ? 111 PHE B CA  1 
ATOM   4428 C  C   . PHE B 1 68  ? 19.231  -0.227  0.544   1.00 40.30 ? 111 PHE B C   1 
ATOM   4429 O  O   . PHE B 1 68  ? 19.989  -1.046  1.074   1.00 40.74 ? 111 PHE B O   1 
ATOM   4430 C  CB  . PHE B 1 68  ? 17.180  -0.212  2.042   1.00 39.15 ? 111 PHE B CB  1 
ATOM   4431 C  CG  . PHE B 1 68  ? 16.508  0.453   3.222   1.00 39.66 ? 111 PHE B CG  1 
ATOM   4432 C  CD1 . PHE B 1 68  ? 15.193  0.910   3.132   1.00 40.01 ? 111 PHE B CD1 1 
ATOM   4433 C  CD2 . PHE B 1 68  ? 17.187  0.626   4.426   1.00 39.91 ? 111 PHE B CD2 1 
ATOM   4434 C  CE1 . PHE B 1 68  ? 14.563  1.526   4.220   1.00 38.59 ? 111 PHE B CE1 1 
ATOM   4435 C  CE2 . PHE B 1 68  ? 16.561  1.242   5.513   1.00 39.43 ? 111 PHE B CE2 1 
ATOM   4436 C  CZ  . PHE B 1 68  ? 15.248  1.693   5.402   1.00 38.23 ? 111 PHE B CZ  1 
ATOM   4437 N  N   . LYS B 1 69  ? 19.195  -0.027  -0.775  1.00 41.40 ? 112 LYS B N   1 
ATOM   4438 C  CA  . LYS B 1 69  ? 20.074  -0.768  -1.691  1.00 42.37 ? 112 LYS B CA  1 
ATOM   4439 C  C   . LYS B 1 69  ? 21.516  -0.301  -1.535  1.00 42.66 ? 112 LYS B C   1 
ATOM   4440 O  O   . LYS B 1 69  ? 22.454  -1.107  -1.584  1.00 43.03 ? 112 LYS B O   1 
ATOM   4441 C  CB  . LYS B 1 69  ? 19.639  -0.584  -3.146  1.00 42.68 ? 112 LYS B CB  1 
ATOM   4442 C  CG  . LYS B 1 69  ? 19.460  -1.884  -3.921  1.00 43.90 ? 112 LYS B CG  1 
ATOM   4443 C  CD  . LYS B 1 69  ? 18.031  -2.447  -3.739  1.00 45.46 ? 112 LYS B CD  1 
ATOM   4444 C  CE  . LYS B 1 69  ? 17.711  -3.540  -4.750  1.00 46.22 ? 112 LYS B CE  1 
ATOM   4445 N  NZ  . LYS B 1 69  ? 17.973  -3.084  -6.152  1.00 46.65 ? 112 LYS B NZ  1 
ATOM   4446 N  N   . SER B 1 70  ? 21.685  1.005   -1.356  1.00 42.57 ? 113 SER B N   1 
ATOM   4447 C  CA  . SER B 1 70  ? 23.003  1.576   -1.145  1.00 42.82 ? 113 SER B CA  1 
ATOM   4448 C  C   . SER B 1 70  ? 23.192  1.838   0.334   1.00 42.60 ? 113 SER B C   1 
ATOM   4449 O  O   . SER B 1 70  ? 23.447  2.966   0.752   1.00 43.00 ? 113 SER B O   1 
ATOM   4450 C  CB  . SER B 1 70  ? 23.168  2.869   -1.944  1.00 43.05 ? 113 SER B CB  1 
ATOM   4451 O  OG  . SER B 1 70  ? 22.154  3.793   -1.597  1.00 43.71 ? 113 SER B OG  1 
ATOM   4452 N  N   . GLU B 1 71  ? 23.043  0.786   1.126   1.00 42.22 ? 114 GLU B N   1 
ATOM   4453 C  CA  . GLU B 1 71  ? 23.256  0.885   2.554   1.00 41.65 ? 114 GLU B CA  1 
ATOM   4454 C  C   . GLU B 1 71  ? 24.627  0.328   2.916   1.00 41.35 ? 114 GLU B C   1 
ATOM   4455 O  O   . GLU B 1 71  ? 25.035  -0.729  2.412   1.00 41.21 ? 114 GLU B O   1 
ATOM   4456 C  CB  . GLU B 1 71  ? 22.161  0.150   3.323   1.00 41.55 ? 114 GLU B CB  1 
ATOM   4457 C  CG  . GLU B 1 71  ? 21.959  0.713   4.712   1.00 41.37 ? 114 GLU B CG  1 
ATOM   4458 C  CD  . GLU B 1 71  ? 20.787  0.120   5.434   1.00 40.54 ? 114 GLU B CD  1 
ATOM   4459 O  OE1 . GLU B 1 71  ? 20.825  -1.087  5.765   1.00 40.18 ? 114 GLU B OE1 1 
ATOM   4460 O  OE2 . GLU B 1 71  ? 19.833  0.876   5.685   1.00 40.72 ? 114 GLU B OE2 1 
ATOM   4461 N  N   . GLY B 1 72  ? 25.328  1.056   3.785   1.00 40.62 ? 115 GLY B N   1 
ATOM   4462 C  CA  . GLY B 1 72  ? 26.646  0.657   4.260   1.00 39.87 ? 115 GLY B CA  1 
ATOM   4463 C  C   . GLY B 1 72  ? 26.564  -0.537  5.187   1.00 39.14 ? 115 GLY B C   1 
ATOM   4464 O  O   . GLY B 1 72  ? 25.467  -0.974  5.534   1.00 39.50 ? 115 GLY B O   1 
ATOM   4465 N  N   . PRO B 1 73  ? 27.723  -1.092  5.580   1.00 38.47 ? 116 PRO B N   1 
ATOM   4466 C  CA  . PRO B 1 73  ? 27.717  -2.186  6.558   1.00 37.81 ? 116 PRO B CA  1 
ATOM   4467 C  C   . PRO B 1 73  ? 27.335  -1.733  7.972   1.00 37.04 ? 116 PRO B C   1 
ATOM   4468 O  O   . PRO B 1 73  ? 26.922  -2.564  8.782   1.00 37.39 ? 116 PRO B O   1 
ATOM   4469 C  CB  . PRO B 1 73  ? 29.166  -2.686  6.537   1.00 37.70 ? 116 PRO B CB  1 
ATOM   4470 C  CG  . PRO B 1 73  ? 29.966  -1.524  6.059   1.00 37.91 ? 116 PRO B CG  1 
ATOM   4471 C  CD  . PRO B 1 73  ? 29.079  -0.819  5.068   1.00 38.28 ? 116 PRO B CD  1 
ATOM   4472 N  N   . ASN B 1 74  ? 27.473  -0.436  8.257   1.00 35.94 ? 117 ASN B N   1 
ATOM   4473 C  CA  . ASN B 1 74  ? 27.167  0.112   9.586   1.00 34.73 ? 117 ASN B CA  1 
ATOM   4474 C  C   . ASN B 1 74  ? 26.153  1.272   9.570   1.00 33.41 ? 117 ASN B C   1 
ATOM   4475 O  O   . ASN B 1 74  ? 26.527  2.429   9.797   1.00 32.89 ? 117 ASN B O   1 
ATOM   4476 C  CB  . ASN B 1 74  ? 28.459  0.533   10.296  1.00 35.06 ? 117 ASN B CB  1 
ATOM   4477 C  CG  . ASN B 1 74  ? 29.289  -0.656  10.771  1.00 36.12 ? 117 ASN B CG  1 
ATOM   4478 O  OD1 . ASN B 1 74  ? 28.756  -1.689  11.188  1.00 37.57 ? 117 ASN B OD1 1 
ATOM   4479 N  ND2 . ASN B 1 74  ? 30.604  -0.506  10.725  1.00 36.36 ? 117 ASN B ND2 1 
ATOM   4480 N  N   . PRO B 1 75  ? 24.861  0.959   9.328   1.00 32.16 ? 118 PRO B N   1 
ATOM   4481 C  CA  . PRO B 1 75  ? 23.818  1.971   9.104   1.00 31.30 ? 118 PRO B CA  1 
ATOM   4482 C  C   . PRO B 1 75  ? 23.549  2.872   10.317  1.00 30.26 ? 118 PRO B C   1 
ATOM   4483 O  O   . PRO B 1 75  ? 23.707  2.452   11.466  1.00 29.72 ? 118 PRO B O   1 
ATOM   4484 C  CB  . PRO B 1 75  ? 22.565  1.138   8.798   1.00 31.21 ? 118 PRO B CB  1 
ATOM   4485 C  CG  . PRO B 1 75  ? 23.028  -0.257  8.639   1.00 31.45 ? 118 PRO B CG  1 
ATOM   4486 C  CD  . PRO B 1 75  ? 24.287  -0.391  9.405   1.00 32.01 ? 118 PRO B CD  1 
ATOM   4487 N  N   . GLU B 1 76  ? 23.143  4.106   10.043  1.00 29.13 ? 119 GLU B N   1 
ATOM   4488 C  CA  . GLU B 1 76  ? 22.806  5.051   11.100  1.00 28.39 ? 119 GLU B CA  1 
ATOM   4489 C  C   . GLU B 1 76  ? 21.452  5.681   10.843  1.00 26.87 ? 119 GLU B C   1 
ATOM   4490 O  O   . GLU B 1 76  ? 21.186  6.162   9.745   1.00 26.68 ? 119 GLU B O   1 
ATOM   4491 C  CB  . GLU B 1 76  ? 23.887  6.122   11.238  1.00 28.51 ? 119 GLU B CB  1 
ATOM   4492 C  CG  . GLU B 1 76  ? 25.182  5.590   11.834  1.00 30.80 ? 119 GLU B CG  1 
ATOM   4493 C  CD  . GLU B 1 76  ? 26.313  6.597   11.774  1.00 34.55 ? 119 GLU B CD  1 
ATOM   4494 O  OE1 . GLU B 1 76  ? 27.166  6.573   12.678  1.00 37.05 ? 119 GLU B OE1 1 
ATOM   4495 O  OE2 . GLU B 1 76  ? 26.356  7.417   10.834  1.00 36.04 ? 119 GLU B OE2 1 
ATOM   4496 N  N   . ARG B 1 77  ? 20.592  5.631   11.858  1.00 25.43 ? 120 ARG B N   1 
ATOM   4497 C  CA  . ARG B 1 77  ? 19.286  6.274   11.811  1.00 23.56 ? 120 ARG B CA  1 
ATOM   4498 C  C   . ARG B 1 77  ? 19.397  7.580   12.592  1.00 22.88 ? 120 ARG B C   1 
ATOM   4499 O  O   . ARG B 1 77  ? 20.481  7.930   13.045  1.00 22.80 ? 120 ARG B O   1 
ATOM   4500 C  CB  . ARG B 1 77  ? 18.206  5.351   12.375  1.00 23.19 ? 120 ARG B CB  1 
ATOM   4501 C  CG  . ARG B 1 77  ? 18.132  5.249   13.891  1.00 22.08 ? 120 ARG B CG  1 
ATOM   4502 C  CD  . ARG B 1 77  ? 16.919  4.444   14.325  1.00 21.56 ? 120 ARG B CD  1 
ATOM   4503 N  NE  . ARG B 1 77  ? 17.010  3.037   13.915  1.00 21.71 ? 120 ARG B NE  1 
ATOM   4504 C  CZ  . ARG B 1 77  ? 17.674  2.089   14.578  1.00 22.03 ? 120 ARG B CZ  1 
ATOM   4505 N  NH1 . ARG B 1 77  ? 18.319  2.367   15.705  1.00 19.67 ? 120 ARG B NH1 1 
ATOM   4506 N  NH2 . ARG B 1 77  ? 17.691  0.848   14.110  1.00 23.28 ? 120 ARG B NH2 1 
ATOM   4507 N  N   . PHE B 1 78  ? 18.298  8.304   12.746  1.00 21.94 ? 121 PHE B N   1 
ATOM   4508 C  CA  . PHE B 1 78  ? 18.342  9.567   13.452  1.00 21.33 ? 121 PHE B CA  1 
ATOM   4509 C  C   . PHE B 1 78  ? 18.390  9.279   14.947  1.00 21.15 ? 121 PHE B C   1 
ATOM   4510 O  O   . PHE B 1 78  ? 17.614  8.460   15.452  1.00 21.02 ? 121 PHE B O   1 
ATOM   4511 C  CB  . PHE B 1 78  ? 17.125  10.422  13.074  1.00 21.44 ? 121 PHE B CB  1 
ATOM   4512 C  CG  . PHE B 1 78  ? 17.009  11.710  13.849  1.00 20.84 ? 121 PHE B CG  1 
ATOM   4513 C  CD1 . PHE B 1 78  ? 17.906  12.763  13.626  1.00 19.87 ? 121 PHE B CD1 1 
ATOM   4514 C  CD2 . PHE B 1 78  ? 15.979  11.882  14.781  1.00 20.11 ? 121 PHE B CD2 1 
ATOM   4515 C  CE1 . PHE B 1 78  ? 17.793  13.963  14.337  1.00 20.07 ? 121 PHE B CE1 1 
ATOM   4516 C  CE2 . PHE B 1 78  ? 15.853  13.081  15.500  1.00 19.72 ? 121 PHE B CE2 1 
ATOM   4517 C  CZ  . PHE B 1 78  ? 16.766  14.125  15.278  1.00 19.23 ? 121 PHE B CZ  1 
ATOM   4518 N  N   . LEU B 1 79  ? 19.326  9.932   15.636  1.00 20.57 ? 122 LEU B N   1 
ATOM   4519 C  CA  . LEU B 1 79  ? 19.459  9.815   17.084  1.00 20.07 ? 122 LEU B CA  1 
ATOM   4520 C  C   . LEU B 1 79  ? 18.605  10.869  17.767  1.00 19.73 ? 122 LEU B C   1 
ATOM   4521 O  O   . LEU B 1 79  ? 18.619  12.034  17.374  1.00 19.62 ? 122 LEU B O   1 
ATOM   4522 C  CB  . LEU B 1 79  ? 20.922  9.950   17.509  1.00 20.30 ? 122 LEU B CB  1 
ATOM   4523 C  CG  . LEU B 1 79  ? 21.903  8.831   17.104  1.00 21.09 ? 122 LEU B CG  1 
ATOM   4524 C  CD1 . LEU B 1 79  ? 23.325  9.176   17.534  1.00 20.36 ? 122 LEU B CD1 1 
ATOM   4525 C  CD2 . LEU B 1 79  ? 21.496  7.463   17.682  1.00 20.88 ? 122 LEU B CD2 1 
ATOM   4526 N  N   . ILE B 1 80  ? 17.851  10.452  18.779  1.00 19.13 ? 123 ILE B N   1 
ATOM   4527 C  CA  . ILE B 1 80  ? 16.971  11.357  19.501  1.00 18.94 ? 123 ILE B CA  1 
ATOM   4528 C  C   . ILE B 1 80  ? 17.760  12.182  20.527  1.00 18.77 ? 123 ILE B C   1 
ATOM   4529 O  O   . ILE B 1 80  ? 18.278  11.646  21.507  1.00 18.65 ? 123 ILE B O   1 
ATOM   4530 C  CB  . ILE B 1 80  ? 15.772  10.603  20.101  1.00 19.27 ? 123 ILE B CB  1 
ATOM   4531 C  CG1 . ILE B 1 80  ? 14.824  10.205  18.965  1.00 20.13 ? 123 ILE B CG1 1 
ATOM   4532 C  CG2 . ILE B 1 80  ? 15.009  11.467  21.104  1.00 19.60 ? 123 ILE B CG2 1 
ATOM   4533 C  CD1 . ILE B 1 80  ? 14.058  8.982   19.253  1.00 21.77 ? 123 ILE B CD1 1 
ATOM   4534 N  N   . PRO B 1 81  ? 17.875  13.498  20.276  1.00 18.79 ? 124 PRO B N   1 
ATOM   4535 C  CA  . PRO B 1 81  ? 18.785  14.365  21.042  1.00 18.67 ? 124 PRO B CA  1 
ATOM   4536 C  C   . PRO B 1 81  ? 18.572  14.375  22.568  1.00 18.39 ? 124 PRO B C   1 
ATOM   4537 O  O   . PRO B 1 81  ? 19.547  14.236  23.314  1.00 18.05 ? 124 PRO B O   1 
ATOM   4538 C  CB  . PRO B 1 81  ? 18.567  15.747  20.405  1.00 18.44 ? 124 PRO B CB  1 
ATOM   4539 C  CG  . PRO B 1 81  ? 18.171  15.422  18.989  1.00 18.49 ? 124 PRO B CG  1 
ATOM   4540 C  CD  . PRO B 1 81  ? 17.260  14.228  19.145  1.00 18.48 ? 124 PRO B CD  1 
ATOM   4541 N  N   . PRO B 1 82  ? 17.316  14.509  23.040  1.00 18.43 ? 125 PRO B N   1 
ATOM   4542 C  CA  . PRO B 1 82  ? 17.163  14.362  24.492  1.00 18.37 ? 125 PRO B CA  1 
ATOM   4543 C  C   . PRO B 1 82  ? 17.715  13.034  25.039  1.00 18.50 ? 125 PRO B C   1 
ATOM   4544 O  O   . PRO B 1 82  ? 18.266  13.016  26.132  1.00 19.30 ? 125 PRO B O   1 
ATOM   4545 C  CB  . PRO B 1 82  ? 15.646  14.466  24.713  1.00 18.27 ? 125 PRO B CB  1 
ATOM   4546 C  CG  . PRO B 1 82  ? 15.022  14.389  23.356  1.00 18.28 ? 125 PRO B CG  1 
ATOM   4547 C  CD  . PRO B 1 82  ? 16.045  14.876  22.389  1.00 18.16 ? 125 PRO B CD  1 
ATOM   4548 N  N   . TRP B 1 83  ? 17.592  11.945  24.288  1.00 18.15 ? 126 TRP B N   1 
ATOM   4549 C  CA  . TRP B 1 83  ? 18.108  10.649  24.732  1.00 18.36 ? 126 TRP B CA  1 
ATOM   4550 C  C   . TRP B 1 83  ? 19.639  10.641  24.772  1.00 18.49 ? 126 TRP B C   1 
ATOM   4551 O  O   . TRP B 1 83  ? 20.246  10.203  25.758  1.00 18.14 ? 126 TRP B O   1 
ATOM   4552 C  CB  . TRP B 1 83  ? 17.590  9.503   23.827  1.00 18.04 ? 126 TRP B CB  1 
ATOM   4553 C  CG  . TRP B 1 83  ? 16.094  9.322   23.803  1.00 16.77 ? 126 TRP B CG  1 
ATOM   4554 C  CD1 . TRP B 1 83  ? 15.146  10.098  24.430  1.00 16.60 ? 126 TRP B CD1 1 
ATOM   4555 C  CD2 . TRP B 1 83  ? 15.370  8.303   23.105  1.00 16.79 ? 126 TRP B CD2 1 
ATOM   4556 N  NE1 . TRP B 1 83  ? 13.879  9.620   24.162  1.00 15.06 ? 126 TRP B NE1 1 
ATOM   4557 C  CE2 . TRP B 1 83  ? 13.989  8.520   23.353  1.00 15.42 ? 126 TRP B CE2 1 
ATOM   4558 C  CE3 . TRP B 1 83  ? 15.751  7.225   22.291  1.00 16.19 ? 126 TRP B CE3 1 
ATOM   4559 C  CZ2 . TRP B 1 83  ? 12.996  7.706   22.813  1.00 14.62 ? 126 TRP B CZ2 1 
ATOM   4560 C  CZ3 . TRP B 1 83  ? 14.758  6.422   21.744  1.00 16.69 ? 126 TRP B CZ3 1 
ATOM   4561 C  CH2 . TRP B 1 83  ? 13.394  6.668   22.012  1.00 15.81 ? 126 TRP B CH2 1 
ATOM   4562 N  N   . VAL B 1 84  ? 20.255  11.118  23.692  1.00 19.10 ? 127 VAL B N   1 
ATOM   4563 C  CA  . VAL B 1 84  ? 21.713  11.201  23.607  1.00 19.52 ? 127 VAL B CA  1 
ATOM   4564 C  C   . VAL B 1 84  ? 22.220  12.034  24.770  1.00 20.52 ? 127 VAL B C   1 
ATOM   4565 O  O   . VAL B 1 84  ? 23.087  11.576  25.535  1.00 21.00 ? 127 VAL B O   1 
ATOM   4566 C  CB  . VAL B 1 84  ? 22.188  11.781  22.242  1.00 19.48 ? 127 VAL B CB  1 
ATOM   4567 C  CG1 . VAL B 1 84  ? 23.656  12.177  22.284  1.00 17.41 ? 127 VAL B CG1 1 
ATOM   4568 C  CG2 . VAL B 1 84  ? 21.926  10.782  21.119  1.00 18.92 ? 127 VAL B CG2 1 
ATOM   4569 N  N   . ALA B 1 85  ? 21.634  13.221  24.935  1.00 20.97 ? 128 ALA B N   1 
ATOM   4570 C  CA  . ALA B 1 85  ? 22.083  14.175  25.951  1.00 21.79 ? 128 ALA B CA  1 
ATOM   4571 C  C   . ALA B 1 85  ? 22.014  13.614  27.354  1.00 22.71 ? 128 ALA B C   1 
ATOM   4572 O  O   . ALA B 1 85  ? 22.936  13.827  28.150  1.00 23.20 ? 128 ALA B O   1 
ATOM   4573 C  CB  . ALA B 1 85  ? 21.304  15.484  25.868  1.00 21.37 ? 128 ALA B CB  1 
ATOM   4574 N  N   . TYR B 1 86  ? 20.935  12.896  27.660  1.00 23.39 ? 129 TYR B N   1 
ATOM   4575 C  CA  . TYR B 1 86  ? 20.796  12.279  28.968  1.00 24.24 ? 129 TYR B CA  1 
ATOM   4576 C  C   . TYR B 1 86  ? 21.938  11.292  29.221  1.00 25.01 ? 129 TYR B C   1 
ATOM   4577 O  O   . TYR B 1 86  ? 22.557  11.298  30.279  1.00 25.56 ? 129 TYR B O   1 
ATOM   4578 C  CB  . TYR B 1 86  ? 19.451  11.568  29.101  1.00 24.09 ? 129 TYR B CB  1 
ATOM   4579 C  CG  . TYR B 1 86  ? 19.378  10.669  30.320  1.00 24.15 ? 129 TYR B CG  1 
ATOM   4580 C  CD1 . TYR B 1 86  ? 19.063  11.191  31.568  1.00 22.97 ? 129 TYR B CD1 1 
ATOM   4581 C  CD2 . TYR B 1 86  ? 19.644  9.298   30.226  1.00 24.05 ? 129 TYR B CD2 1 
ATOM   4582 C  CE1 . TYR B 1 86  ? 19.006  10.386  32.686  1.00 23.56 ? 129 TYR B CE1 1 
ATOM   4583 C  CE2 . TYR B 1 86  ? 19.590  8.475   31.355  1.00 23.54 ? 129 TYR B CE2 1 
ATOM   4584 C  CZ  . TYR B 1 86  ? 19.271  9.032   32.578  1.00 23.34 ? 129 TYR B CZ  1 
ATOM   4585 O  OH  . TYR B 1 86  ? 19.203  8.259   33.705  1.00 22.99 ? 129 TYR B OH  1 
ATOM   4586 N  N   . HIS B 1 87  ? 22.222  10.454  28.237  1.00 26.17 ? 130 HIS B N   1 
ATOM   4587 C  CA  . HIS B 1 87  ? 23.212  9.400   28.400  1.00 27.02 ? 130 HIS B CA  1 
ATOM   4588 C  C   . HIS B 1 87  ? 24.603  10.005  28.499  1.00 27.91 ? 130 HIS B C   1 
ATOM   4589 O  O   . HIS B 1 87  ? 25.421  9.539   29.281  1.00 27.76 ? 130 HIS B O   1 
ATOM   4590 C  CB  . HIS B 1 87  ? 23.153  8.410   27.231  1.00 26.63 ? 130 HIS B CB  1 
ATOM   4591 C  CG  . HIS B 1 87  ? 22.014  7.442   27.303  1.00 26.49 ? 130 HIS B CG  1 
ATOM   4592 N  ND1 . HIS B 1 87  ? 20.768  7.717   26.783  1.00 26.10 ? 130 HIS B ND1 1 
ATOM   4593 C  CD2 . HIS B 1 87  ? 21.942  6.186   27.804  1.00 26.07 ? 130 HIS B CD2 1 
ATOM   4594 C  CE1 . HIS B 1 87  ? 19.972  6.680   26.976  1.00 24.36 ? 130 HIS B CE1 1 
ATOM   4595 N  NE2 . HIS B 1 87  ? 20.659  5.741   27.599  1.00 25.03 ? 130 HIS B NE2 1 
ATOM   4596 N  N   . GLN B 1 88  ? 24.872  11.033  27.696  1.00 29.19 ? 131 GLN B N   1 
ATOM   4597 C  CA  . GLN B 1 88  ? 26.173  11.686  27.730  1.00 30.49 ? 131 GLN B CA  1 
ATOM   4598 C  C   . GLN B 1 88  ? 26.348  12.449  29.030  1.00 31.08 ? 131 GLN B C   1 
ATOM   4599 O  O   . GLN B 1 88  ? 27.262  12.163  29.807  1.00 31.39 ? 131 GLN B O   1 
ATOM   4600 C  CB  . GLN B 1 88  ? 26.398  12.583  26.507  1.00 30.72 ? 131 GLN B CB  1 
ATOM   4601 C  CG  . GLN B 1 88  ? 26.918  11.795  25.289  1.00 32.33 ? 131 GLN B CG  1 
ATOM   4602 C  CD  . GLN B 1 88  ? 26.858  12.565  23.961  1.00 34.08 ? 131 GLN B CD  1 
ATOM   4603 O  OE1 . GLN B 1 88  ? 26.511  13.755  23.920  1.00 35.25 ? 131 GLN B OE1 1 
ATOM   4604 N  NE2 . GLN B 1 88  ? 27.198  11.875  22.865  1.00 32.53 ? 131 GLN B NE2 1 
ATOM   4605 N  N   . TYR B 1 89  ? 25.449  13.382  29.302  1.00 31.97 ? 132 TYR B N   1 
ATOM   4606 C  CA  . TYR B 1 89  ? 25.603  14.203  30.496  1.00 32.76 ? 132 TYR B CA  1 
ATOM   4607 C  C   . TYR B 1 89  ? 25.688  13.408  31.799  1.00 32.85 ? 132 TYR B C   1 
ATOM   4608 O  O   . TYR B 1 89  ? 26.555  13.681  32.634  1.00 33.26 ? 132 TYR B O   1 
ATOM   4609 C  CB  . TYR B 1 89  ? 24.523  15.273  30.586  1.00 33.05 ? 132 TYR B CB  1 
ATOM   4610 C  CG  . TYR B 1 89  ? 24.783  16.235  31.707  1.00 35.39 ? 132 TYR B CG  1 
ATOM   4611 C  CD1 . TYR B 1 89  ? 25.706  17.280  31.555  1.00 37.15 ? 132 TYR B CD1 1 
ATOM   4612 C  CD2 . TYR B 1 89  ? 24.134  16.091  32.943  1.00 36.91 ? 132 TYR B CD2 1 
ATOM   4613 C  CE1 . TYR B 1 89  ? 25.959  18.172  32.602  1.00 38.42 ? 132 TYR B CE1 1 
ATOM   4614 C  CE2 . TYR B 1 89  ? 24.380  16.972  33.991  1.00 37.64 ? 132 TYR B CE2 1 
ATOM   4615 C  CZ  . TYR B 1 89  ? 25.295  18.005  33.814  1.00 38.83 ? 132 TYR B CZ  1 
ATOM   4616 O  OH  . TYR B 1 89  ? 25.539  18.878  34.847  1.00 40.45 ? 132 TYR B OH  1 
ATOM   4617 N  N   . TYR B 1 90  ? 24.810  12.420  31.974  1.00 32.81 ? 133 TYR B N   1 
ATOM   4618 C  CA  . TYR B 1 90  ? 24.803  11.629  33.208  1.00 32.50 ? 133 TYR B CA  1 
ATOM   4619 C  C   . TYR B 1 90  ? 25.666  10.381  33.094  1.00 32.40 ? 133 TYR B C   1 
ATOM   4620 O  O   . TYR B 1 90  ? 25.633  9.502   33.955  1.00 32.18 ? 133 TYR B O   1 
ATOM   4621 C  CB  . TYR B 1 90  ? 23.367  11.301  33.644  1.00 32.47 ? 133 TYR B CB  1 
ATOM   4622 C  CG  . TYR B 1 90  ? 22.605  12.529  34.095  1.00 32.84 ? 133 TYR B CG  1 
ATOM   4623 C  CD1 . TYR B 1 90  ? 21.856  13.281  33.190  1.00 32.95 ? 133 TYR B CD1 1 
ATOM   4624 C  CD2 . TYR B 1 90  ? 22.658  12.961  35.422  1.00 32.48 ? 133 TYR B CD2 1 
ATOM   4625 C  CE1 . TYR B 1 90  ? 21.170  14.425  33.599  1.00 32.99 ? 133 TYR B CE1 1 
ATOM   4626 C  CE2 . TYR B 1 90  ? 21.975  14.100  35.840  1.00 32.44 ? 133 TYR B CE2 1 
ATOM   4627 C  CZ  . TYR B 1 90  ? 21.232  14.828  34.926  1.00 32.62 ? 133 TYR B CZ  1 
ATOM   4628 O  OH  . TYR B 1 90  ? 20.547  15.956  35.332  1.00 31.89 ? 133 TYR B OH  1 
ATOM   4629 N  N   . GLN B 1 91  ? 26.453  10.319  32.028  1.00 32.70 ? 134 GLN B N   1 
ATOM   4630 C  CA  . GLN B 1 91  ? 27.345  9.182   31.773  1.00 33.26 ? 134 GLN B CA  1 
ATOM   4631 C  C   . GLN B 1 91  ? 26.674  7.849   32.111  1.00 32.85 ? 134 GLN B C   1 
ATOM   4632 O  O   . GLN B 1 91  ? 27.087  7.138   33.033  1.00 33.06 ? 134 GLN B O   1 
ATOM   4633 C  CB  . GLN B 1 91  ? 28.681  9.356   32.502  1.00 33.42 ? 134 GLN B CB  1 
ATOM   4634 C  CG  . GLN B 1 91  ? 29.403  10.651  32.117  1.00 36.03 ? 134 GLN B CG  1 
ATOM   4635 C  CD  . GLN B 1 91  ? 30.789  10.777  32.739  1.00 38.86 ? 134 GLN B CD  1 
ATOM   4636 O  OE1 . GLN B 1 91  ? 30.982  10.511  33.934  1.00 38.86 ? 134 GLN B OE1 1 
ATOM   4637 N  NE2 . GLN B 1 91  ? 31.764  11.199  31.926  1.00 39.59 ? 134 GLN B NE2 1 
ATOM   4638 N  N   . ARG B 1 92  ? 25.608  7.548   31.375  1.00 32.16 ? 135 ARG B N   1 
ATOM   4639 C  CA  . ARG B 1 92  ? 24.932  6.266   31.469  1.00 31.76 ? 135 ARG B CA  1 
ATOM   4640 C  C   . ARG B 1 92  ? 25.470  5.380   30.356  1.00 31.23 ? 135 ARG B C   1 
ATOM   4641 O  O   . ARG B 1 92  ? 25.771  5.870   29.272  1.00 31.10 ? 135 ARG B O   1 
ATOM   4642 C  CB  . ARG B 1 92  ? 23.424  6.441   31.331  1.00 31.76 ? 135 ARG B CB  1 
ATOM   4643 C  CG  . ARG B 1 92  ? 22.810  7.359   32.373  1.00 33.25 ? 135 ARG B CG  1 
ATOM   4644 C  CD  . ARG B 1 92  ? 22.458  6.636   33.675  1.00 35.55 ? 135 ARG B CD  1 
ATOM   4645 N  NE  . ARG B 1 92  ? 22.417  7.569   34.801  1.00 38.41 ? 135 ARG B NE  1 
ATOM   4646 C  CZ  . ARG B 1 92  ? 22.002  7.269   36.031  1.00 40.02 ? 135 ARG B CZ  1 
ATOM   4647 N  NH1 . ARG B 1 92  ? 21.569  6.042   36.325  1.00 39.94 ? 135 ARG B NH1 1 
ATOM   4648 N  NH2 . ARG B 1 92  ? 22.016  8.210   36.974  1.00 40.22 ? 135 ARG B NH2 1 
ATOM   4649 N  N   . PRO B 1 93  ? 25.606  4.070   30.620  1.00 30.91 ? 136 PRO B N   1 
ATOM   4650 C  CA  . PRO B 1 93  ? 26.165  3.209   29.573  1.00 30.41 ? 136 PRO B CA  1 
ATOM   4651 C  C   . PRO B 1 93  ? 25.155  3.025   28.447  1.00 29.97 ? 136 PRO B C   1 
ATOM   4652 O  O   . PRO B 1 93  ? 23.969  2.837   28.705  1.00 29.55 ? 136 PRO B O   1 
ATOM   4653 C  CB  . PRO B 1 93  ? 26.421  1.888   30.297  1.00 30.62 ? 136 PRO B CB  1 
ATOM   4654 C  CG  . PRO B 1 93  ? 25.420  1.881   31.454  1.00 31.12 ? 136 PRO B CG  1 
ATOM   4655 C  CD  . PRO B 1 93  ? 25.149  3.318   31.811  1.00 30.72 ? 136 PRO B CD  1 
ATOM   4656 N  N   . ILE B 1 94  ? 25.623  3.103   27.209  1.00 29.58 ? 137 ILE B N   1 
ATOM   4657 C  CA  . ILE B 1 94  ? 24.722  3.062   26.073  1.00 29.34 ? 137 ILE B CA  1 
ATOM   4658 C  C   . ILE B 1 94  ? 24.652  1.657   25.484  1.00 29.47 ? 137 ILE B C   1 
ATOM   4659 O  O   . ILE B 1 94  ? 25.613  0.893   25.543  1.00 29.30 ? 137 ILE B O   1 
ATOM   4660 C  CB  . ILE B 1 94  ? 25.090  4.115   24.985  1.00 29.12 ? 137 ILE B CB  1 
ATOM   4661 C  CG1 . ILE B 1 94  ? 26.450  3.811   24.356  1.00 27.85 ? 137 ILE B CG1 1 
ATOM   4662 C  CG2 . ILE B 1 94  ? 25.044  5.538   25.577  1.00 29.15 ? 137 ILE B CG2 1 
ATOM   4663 C  CD1 . ILE B 1 94  ? 26.837  4.761   23.261  1.00 27.29 ? 137 ILE B CD1 1 
ATOM   4664 N  N   . GLY B 1 95  ? 23.494  1.325   24.928  1.00 29.42 ? 138 GLY B N   1 
ATOM   4665 C  CA  . GLY B 1 95  ? 23.309  0.049   24.273  1.00 28.90 ? 138 GLY B CA  1 
ATOM   4666 C  C   . GLY B 1 95  ? 23.272  0.219   22.772  1.00 28.60 ? 138 GLY B C   1 
ATOM   4667 O  O   . GLY B 1 95  ? 23.591  1.286   22.238  1.00 28.92 ? 138 GLY B O   1 
ATOM   4668 N  N   . VAL B 1 96  ? 22.852  -0.841  22.098  1.00 27.97 ? 139 VAL B N   1 
ATOM   4669 C  CA  . VAL B 1 96  ? 22.860  -0.911  20.654  1.00 27.46 ? 139 VAL B CA  1 
ATOM   4670 C  C   . VAL B 1 96  ? 22.162  0.278   19.961  1.00 27.50 ? 139 VAL B C   1 
ATOM   4671 O  O   . VAL B 1 96  ? 22.619  0.733   18.915  1.00 27.72 ? 139 VAL B O   1 
ATOM   4672 C  CB  . VAL B 1 96  ? 22.335  -2.299  20.179  1.00 27.63 ? 139 VAL B CB  1 
ATOM   4673 C  CG1 . VAL B 1 96  ? 20.799  -2.351  20.133  1.00 26.35 ? 139 VAL B CG1 1 
ATOM   4674 C  CG2 . VAL B 1 96  ? 22.959  -2.675  18.849  1.00 27.21 ? 139 VAL B CG2 1 
ATOM   4675 N  N   . LEU B 1 97  ? 21.084  0.790   20.549  1.00 27.21 ? 140 LEU B N   1 
ATOM   4676 C  CA  . LEU B 1 97  ? 20.358  1.911   19.954  1.00 27.16 ? 140 LEU B CA  1 
ATOM   4677 C  C   . LEU B 1 97  ? 21.232  3.156   19.758  1.00 27.07 ? 140 LEU B C   1 
ATOM   4678 O  O   . LEU B 1 97  ? 21.093  3.856   18.760  1.00 26.63 ? 140 LEU B O   1 
ATOM   4679 C  CB  . LEU B 1 97  ? 19.105  2.271   20.773  1.00 27.03 ? 140 LEU B CB  1 
ATOM   4680 C  CG  . LEU B 1 97  ? 18.278  3.494   20.327  1.00 27.05 ? 140 LEU B CG  1 
ATOM   4681 C  CD1 . LEU B 1 97  ? 17.596  3.263   18.993  1.00 27.13 ? 140 LEU B CD1 1 
ATOM   4682 C  CD2 . LEU B 1 97  ? 17.247  3.882   21.362  1.00 27.20 ? 140 LEU B CD2 1 
ATOM   4683 N  N   . LEU B 1 98  ? 22.124  3.418   20.709  1.00 27.17 ? 141 LEU B N   1 
ATOM   4684 C  CA  . LEU B 1 98  ? 22.880  4.675   20.730  1.00 27.40 ? 141 LEU B CA  1 
ATOM   4685 C  C   . LEU B 1 98  ? 24.320  4.568   20.250  1.00 27.56 ? 141 LEU B C   1 
ATOM   4686 O  O   . LEU B 1 98  ? 25.061  5.549   20.279  1.00 28.02 ? 141 LEU B O   1 
ATOM   4687 C  CB  . LEU B 1 98  ? 22.834  5.305   22.119  1.00 26.93 ? 141 LEU B CB  1 
ATOM   4688 C  CG  . LEU B 1 98  ? 21.456  5.791   22.580  1.00 27.47 ? 141 LEU B CG  1 
ATOM   4689 C  CD1 . LEU B 1 98  ? 21.548  6.316   23.990  1.00 27.52 ? 141 LEU B CD1 1 
ATOM   4690 C  CD2 . LEU B 1 98  ? 20.867  6.859   21.658  1.00 26.55 ? 141 LEU B CD2 1 
ATOM   4691 N  N   . LYS B 1 99  ? 24.702  3.380   19.799  1.00 27.87 ? 142 LYS B N   1 
ATOM   4692 C  CA  . LYS B 1 99  ? 26.042  3.133   19.295  1.00 27.96 ? 142 LYS B CA  1 
ATOM   4693 C  C   . LYS B 1 99  ? 26.063  3.239   17.792  1.00 28.72 ? 142 LYS B C   1 
ATOM   4694 O  O   . LYS B 1 99  ? 25.025  3.169   17.143  1.00 29.27 ? 142 LYS B O   1 
ATOM   4695 C  CB  . LYS B 1 99  ? 26.536  1.745   19.724  1.00 27.85 ? 142 LYS B CB  1 
ATOM   4696 C  CG  . LYS B 1 99  ? 26.763  1.615   21.218  1.00 26.01 ? 142 LYS B CG  1 
ATOM   4697 C  CD  . LYS B 1 99  ? 27.440  0.324   21.559  1.00 24.58 ? 142 LYS B CD  1 
ATOM   4698 C  CE  . LYS B 1 99  ? 27.524  0.181   23.061  1.00 24.29 ? 142 LYS B CE  1 
ATOM   4699 N  NZ  . LYS B 1 99  ? 28.349  -0.959  23.464  1.00 22.90 ? 142 LYS B NZ  1 
ATOM   4700 N  N   . LYS B 1 100 ? 27.255  3.406   17.236  1.00 29.48 ? 143 LYS B N   1 
ATOM   4701 C  CA  . LYS B 1 100 ? 27.435  3.374   15.797  1.00 30.11 ? 143 LYS B CA  1 
ATOM   4702 C  C   . LYS B 1 100 ? 28.650  2.530   15.440  1.00 30.00 ? 143 LYS B C   1 
ATOM   4703 O  O   . LYS B 1 100 ? 29.369  2.048   16.322  1.00 29.62 ? 143 LYS B O   1 
ATOM   4704 C  CB  . LYS B 1 100 ? 27.624  4.786   15.252  1.00 30.62 ? 143 LYS B CB  1 
ATOM   4705 C  CG  . LYS B 1 100 ? 28.638  5.624   16.007  1.00 33.00 ? 143 LYS B CG  1 
ATOM   4706 C  CD  . LYS B 1 100 ? 29.362  6.585   15.082  1.00 37.20 ? 143 LYS B CD  1 
ATOM   4707 C  CE  . LYS B 1 100 ? 29.912  7.765   15.863  1.00 40.10 ? 143 LYS B CE  1 
ATOM   4708 N  NZ  . LYS B 1 100 ? 28.813  8.732   16.208  1.00 42.85 ? 143 LYS B NZ  1 
ATOM   4709 N  N   . SER B 1 101 ? 28.858  2.350   14.138  1.00 29.99 ? 144 SER B N   1 
ATOM   4710 C  CA  . SER B 1 101 ? 30.112  1.831   13.617  1.00 30.15 ? 144 SER B CA  1 
ATOM   4711 C  C   . SER B 1 101 ? 30.407  0.429   14.180  1.00 29.79 ? 144 SER B C   1 
ATOM   4712 O  O   . SER B 1 101 ? 29.474  -0.344  14.416  1.00 29.81 ? 144 SER B O   1 
ATOM   4713 C  CB  . SER B 1 101 ? 31.239  2.837   13.924  1.00 30.05 ? 144 SER B CB  1 
ATOM   4714 O  OG  . SER B 1 101 ? 32.472  2.410   13.390  1.00 31.24 ? 144 SER B OG  1 
ATOM   4715 N  N   . ALA B 1 102 ? 31.691  0.115   14.390  1.00 29.15 ? 145 ALA B N   1 
ATOM   4716 C  CA  . ALA B 1 102 ? 32.120  -1.204  14.871  1.00 28.86 ? 145 ALA B CA  1 
ATOM   4717 C  C   . ALA B 1 102 ? 31.530  -1.568  16.244  1.00 28.67 ? 145 ALA B C   1 
ATOM   4718 O  O   . ALA B 1 102 ? 31.095  -2.712  16.449  1.00 28.90 ? 145 ALA B O   1 
ATOM   4719 C  CB  . ALA B 1 102 ? 33.658  -1.313  14.884  1.00 28.37 ? 145 ALA B CB  1 
ATOM   4720 N  N   . ALA B 1 103 ? 31.519  -0.600  17.167  1.00 27.89 ? 146 ALA B N   1 
ATOM   4721 C  CA  . ALA B 1 103 ? 30.931  -0.797  18.488  1.00 27.66 ? 146 ALA B CA  1 
ATOM   4722 C  C   . ALA B 1 103 ? 29.442  -1.199  18.399  1.00 27.75 ? 146 ALA B C   1 
ATOM   4723 O  O   . ALA B 1 103 ? 28.935  -1.938  19.258  1.00 27.82 ? 146 ALA B O   1 
ATOM   4724 C  CB  . ALA B 1 103 ? 31.121  0.435   19.355  1.00 27.03 ? 146 ALA B CB  1 
ATOM   4725 N  N   . TRP B 1 104 ? 28.754  -0.736  17.355  1.00 27.38 ? 147 TRP B N   1 
ATOM   4726 C  CA  . TRP B 1 104 ? 27.368  -1.121  17.150  1.00 27.19 ? 147 TRP B CA  1 
ATOM   4727 C  C   . TRP B 1 104 ? 27.281  -2.570  16.679  1.00 27.61 ? 147 TRP B C   1 
ATOM   4728 O  O   . TRP B 1 104 ? 26.423  -3.323  17.147  1.00 27.21 ? 147 TRP B O   1 
ATOM   4729 C  CB  . TRP B 1 104 ? 26.641  -0.202  16.150  1.00 26.71 ? 147 TRP B CB  1 
ATOM   4730 C  CG  . TRP B 1 104 ? 25.328  -0.802  15.737  1.00 25.29 ? 147 TRP B CG  1 
ATOM   4731 C  CD1 . TRP B 1 104 ? 24.161  -0.768  16.439  1.00 24.48 ? 147 TRP B CD1 1 
ATOM   4732 C  CD2 . TRP B 1 104 ? 25.072  -1.592  14.571  1.00 24.15 ? 147 TRP B CD2 1 
ATOM   4733 N  NE1 . TRP B 1 104 ? 23.187  -1.468  15.778  1.00 25.09 ? 147 TRP B NE1 1 
ATOM   4734 C  CE2 . TRP B 1 104 ? 23.716  -1.990  14.628  1.00 24.71 ? 147 TRP B CE2 1 
ATOM   4735 C  CE3 . TRP B 1 104 ? 25.849  -1.987  13.475  1.00 23.83 ? 147 TRP B CE3 1 
ATOM   4736 C  CZ2 . TRP B 1 104 ? 23.112  -2.768  13.624  1.00 24.57 ? 147 TRP B CZ2 1 
ATOM   4737 C  CZ3 . TRP B 1 104 ? 25.251  -2.763  12.473  1.00 25.09 ? 147 TRP B CZ3 1 
ATOM   4738 C  CH2 . TRP B 1 104 ? 23.893  -3.147  12.560  1.00 25.19 ? 147 TRP B CH2 1 
ATOM   4739 N  N   . LYS B 1 105 ? 28.168  -2.934  15.750  1.00 28.16 ? 148 LYS B N   1 
ATOM   4740 C  CA  . LYS B 1 105 ? 28.148  -4.242  15.092  1.00 29.05 ? 148 LYS B CA  1 
ATOM   4741 C  C   . LYS B 1 105 ? 28.462  -5.357  16.072  1.00 29.20 ? 148 LYS B C   1 
ATOM   4742 O  O   . LYS B 1 105 ? 27.841  -6.421  16.035  1.00 29.23 ? 148 LYS B O   1 
ATOM   4743 C  CB  . LYS B 1 105 ? 29.143  -4.281  13.924  1.00 29.28 ? 148 LYS B CB  1 
ATOM   4744 C  CG  . LYS B 1 105 ? 29.138  -5.594  13.119  1.00 30.98 ? 148 LYS B CG  1 
ATOM   4745 C  CD  . LYS B 1 105 ? 27.986  -5.632  12.115  1.00 33.45 ? 148 LYS B CD  1 
ATOM   4746 C  CE  . LYS B 1 105 ? 28.264  -6.569  10.942  1.00 33.29 ? 148 LYS B CE  1 
ATOM   4747 N  NZ  . LYS B 1 105 ? 27.375  -6.220  9.781   1.00 33.85 ? 148 LYS B NZ  1 
ATOM   4748 N  N   . LYS B 1 106 ? 29.424  -5.085  16.945  1.00 29.28 ? 149 LYS B N   1 
ATOM   4749 C  CA  . LYS B 1 106 ? 29.857  -6.006  17.973  1.00 29.78 ? 149 LYS B CA  1 
ATOM   4750 C  C   . LYS B 1 106 ? 28.693  -6.373  18.898  1.00 29.76 ? 149 LYS B C   1 
ATOM   4751 O  O   . LYS B 1 106 ? 28.497  -7.544  19.214  1.00 30.11 ? 149 LYS B O   1 
ATOM   4752 C  CB  . LYS B 1 106 ? 30.989  -5.358  18.774  1.00 30.27 ? 149 LYS B CB  1 
ATOM   4753 C  CG  . LYS B 1 106 ? 31.871  -6.327  19.524  1.00 31.52 ? 149 LYS B CG  1 
ATOM   4754 C  CD  . LYS B 1 106 ? 32.529  -5.646  20.710  1.00 32.74 ? 149 LYS B CD  1 
ATOM   4755 C  CE  . LYS B 1 106 ? 33.558  -6.559  21.320  1.00 33.98 ? 149 LYS B CE  1 
ATOM   4756 N  NZ  . LYS B 1 106 ? 33.863  -6.108  22.691  1.00 36.53 ? 149 LYS B NZ  1 
ATOM   4757 N  N   . ASP B 1 107 ? 27.923  -5.373  19.328  1.00 29.53 ? 150 ASP B N   1 
ATOM   4758 C  CA  . ASP B 1 107 ? 26.730  -5.604  20.131  1.00 29.15 ? 150 ASP B CA  1 
ATOM   4759 C  C   . ASP B 1 107 ? 25.630  -6.281  19.332  1.00 29.07 ? 150 ASP B C   1 
ATOM   4760 O  O   . ASP B 1 107 ? 25.029  -7.245  19.791  1.00 29.17 ? 150 ASP B O   1 
ATOM   4761 C  CB  . ASP B 1 107 ? 26.194  -4.292  20.694  1.00 29.43 ? 150 ASP B CB  1 
ATOM   4762 C  CG  . ASP B 1 107 ? 26.849  -3.900  22.004  1.00 29.82 ? 150 ASP B CG  1 
ATOM   4763 O  OD1 . ASP B 1 107 ? 27.964  -4.394  22.301  1.00 29.88 ? 150 ASP B OD1 1 
ATOM   4764 O  OD2 . ASP B 1 107 ? 26.240  -3.088  22.737  1.00 30.14 ? 150 ASP B OD2 1 
ATOM   4765 N  N   . ARG B 1 108 ? 25.365  -5.774  18.135  1.00 28.91 ? 151 ARG B N   1 
ATOM   4766 C  CA  . ARG B 1 108 ? 24.276  -6.308  17.323  1.00 28.89 ? 151 ARG B CA  1 
ATOM   4767 C  C   . ARG B 1 108 ? 24.465  -7.799  17.037  1.00 29.26 ? 151 ARG B C   1 
ATOM   4768 O  O   . ARG B 1 108 ? 23.517  -8.585  17.179  1.00 29.39 ? 151 ARG B O   1 
ATOM   4769 C  CB  . ARG B 1 108 ? 24.091  -5.514  16.022  1.00 28.34 ? 151 ARG B CB  1 
ATOM   4770 C  CG  . ARG B 1 108 ? 22.838  -5.884  15.252  1.00 26.97 ? 151 ARG B CG  1 
ATOM   4771 C  CD  . ARG B 1 108 ? 21.589  -5.766  16.107  1.00 25.17 ? 151 ARG B CD  1 
ATOM   4772 N  NE  . ARG B 1 108 ? 20.427  -6.292  15.393  1.00 25.77 ? 151 ARG B NE  1 
ATOM   4773 C  CZ  . ARG B 1 108 ? 19.391  -5.572  14.962  1.00 24.99 ? 151 ARG B CZ  1 
ATOM   4774 N  NH1 . ARG B 1 108 ? 19.327  -4.261  15.193  1.00 24.66 ? 151 ARG B NH1 1 
ATOM   4775 N  NH2 . ARG B 1 108 ? 18.401  -6.175  14.311  1.00 22.98 ? 151 ARG B NH2 1 
ATOM   4776 N  N   . VAL B 1 109 ? 25.685  -8.183  16.661  1.00 29.20 ? 152 VAL B N   1 
ATOM   4777 C  CA  . VAL B 1 109 ? 25.985  -9.584  16.374  1.00 29.16 ? 152 VAL B CA  1 
ATOM   4778 C  C   . VAL B 1 109 ? 25.777  -10.461 17.618  1.00 29.09 ? 152 VAL B C   1 
ATOM   4779 O  O   . VAL B 1 109 ? 25.120  -11.498 17.540  1.00 29.07 ? 152 VAL B O   1 
ATOM   4780 C  CB  . VAL B 1 109 ? 27.394  -9.772  15.750  1.00 29.13 ? 152 VAL B CB  1 
ATOM   4781 C  CG1 . VAL B 1 109 ? 27.752  -11.252 15.655  1.00 29.94 ? 152 VAL B CG1 1 
ATOM   4782 C  CG2 . VAL B 1 109 ? 27.439  -9.150  14.367  1.00 28.50 ? 152 VAL B CG2 1 
ATOM   4783 N  N   . ALA B 1 110 ? 26.298  -10.030 18.764  1.00 29.14 ? 153 ALA B N   1 
ATOM   4784 C  CA  . ALA B 1 110 ? 26.160  -10.811 20.000  1.00 29.38 ? 153 ALA B CA  1 
ATOM   4785 C  C   . ALA B 1 110 ? 24.696  -10.944 20.406  1.00 29.73 ? 153 ALA B C   1 
ATOM   4786 O  O   . ALA B 1 110 ? 24.256  -12.004 20.875  1.00 29.77 ? 153 ALA B O   1 
ATOM   4787 C  CB  . ALA B 1 110 ? 26.967  -10.196 21.123  1.00 29.29 ? 153 ALA B CB  1 
ATOM   4788 N  N   . LEU B 1 111 ? 23.951  -9.860  20.198  1.00 29.74 ? 154 LEU B N   1 
ATOM   4789 C  CA  . LEU B 1 111 ? 22.544  -9.809  20.542  1.00 29.62 ? 154 LEU B CA  1 
ATOM   4790 C  C   . LEU B 1 111 ? 21.660  -10.588 19.569  1.00 29.66 ? 154 LEU B C   1 
ATOM   4791 O  O   . LEU B 1 111 ? 20.718  -11.271 19.995  1.00 29.47 ? 154 LEU B O   1 
ATOM   4792 C  CB  . LEU B 1 111 ? 22.081  -8.355  20.680  1.00 29.50 ? 154 LEU B CB  1 
ATOM   4793 C  CG  . LEU B 1 111 ? 22.484  -7.684  21.995  1.00 29.06 ? 154 LEU B CG  1 
ATOM   4794 C  CD1 . LEU B 1 111 ? 22.093  -6.220  21.981  1.00 28.94 ? 154 LEU B CD1 1 
ATOM   4795 C  CD2 . LEU B 1 111 ? 21.866  -8.400  23.191  1.00 27.64 ? 154 LEU B CD2 1 
ATOM   4796 N  N   . ASN B 1 112 ? 21.967  -10.495 18.277  1.00 29.51 ? 155 ASN B N   1 
ATOM   4797 C  CA  . ASN B 1 112 ? 21.233  -11.245 17.260  1.00 29.67 ? 155 ASN B CA  1 
ATOM   4798 C  C   . ASN B 1 112 ? 21.186  -12.745 17.528  1.00 30.21 ? 155 ASN B C   1 
ATOM   4799 O  O   . ASN B 1 112 ? 20.147  -13.374 17.334  1.00 30.53 ? 155 ASN B O   1 
ATOM   4800 C  CB  . ASN B 1 112 ? 21.785  -10.978 15.854  1.00 29.39 ? 155 ASN B CB  1 
ATOM   4801 C  CG  . ASN B 1 112 ? 21.222  -9.706  15.231  1.00 28.95 ? 155 ASN B CG  1 
ATOM   4802 O  OD1 . ASN B 1 112 ? 20.355  -9.048  15.800  1.00 27.59 ? 155 ASN B OD1 1 
ATOM   4803 N  ND2 . ASN B 1 112 ? 21.717  -9.359  14.052  1.00 29.32 ? 155 ASN B ND2 1 
ATOM   4804 N  N   . GLN B 1 113 ? 22.287  -13.327 17.988  1.00 30.70 ? 156 GLN B N   1 
ATOM   4805 C  CA  . GLN B 1 113 ? 22.284  -14.770 18.197  1.00 31.36 ? 156 GLN B CA  1 
ATOM   4806 C  C   . GLN B 1 113 ? 21.380  -15.217 19.369  1.00 30.95 ? 156 GLN B C   1 
ATOM   4807 O  O   . GLN B 1 113 ? 20.895  -16.349 19.379  1.00 31.04 ? 156 GLN B O   1 
ATOM   4808 C  CB  . GLN B 1 113 ? 23.708  -15.361 18.236  1.00 31.64 ? 156 GLN B CB  1 
ATOM   4809 C  CG  . GLN B 1 113 ? 24.462  -15.194 19.543  1.00 34.26 ? 156 GLN B CG  1 
ATOM   4810 C  CD  . GLN B 1 113 ? 25.706  -16.092 19.634  1.00 36.59 ? 156 GLN B CD  1 
ATOM   4811 O  OE1 . GLN B 1 113 ? 26.621  -15.992 18.812  1.00 37.58 ? 156 GLN B OE1 1 
ATOM   4812 N  NE2 . GLN B 1 113 ? 25.745  -16.954 20.652  1.00 36.24 ? 156 GLN B NE2 1 
ATOM   4813 N  N   . GLU B 1 114 ? 21.102  -14.316 20.307  1.00 30.53 ? 157 GLU B N   1 
ATOM   4814 C  CA  . GLU B 1 114 ? 20.195  -14.638 21.421  1.00 30.46 ? 157 GLU B CA  1 
ATOM   4815 C  C   . GLU B 1 114 ? 18.756  -14.133 21.280  1.00 30.00 ? 157 GLU B C   1 
ATOM   4816 O  O   . GLU B 1 114 ? 17.867  -14.556 22.018  1.00 29.93 ? 157 GLU B O   1 
ATOM   4817 C  CB  . GLU B 1 114 ? 20.781  -14.173 22.758  1.00 30.60 ? 157 GLU B CB  1 
ATOM   4818 C  CG  . GLU B 1 114 ? 22.028  -14.953 23.194  1.00 32.22 ? 157 GLU B CG  1 
ATOM   4819 C  CD  . GLU B 1 114 ? 21.865  -16.471 23.075  1.00 34.22 ? 157 GLU B CD  1 
ATOM   4820 O  OE1 . GLU B 1 114 ? 20.726  -16.984 23.142  1.00 34.32 ? 157 GLU B OE1 1 
ATOM   4821 O  OE2 . GLU B 1 114 ? 22.894  -17.156 22.921  1.00 35.84 ? 157 GLU B OE2 1 
ATOM   4822 N  N   . VAL B 1 115 ? 18.519  -13.260 20.313  1.00 29.72 ? 158 VAL B N   1 
ATOM   4823 C  CA  . VAL B 1 115 ? 17.263  -12.517 20.251  1.00 29.45 ? 158 VAL B CA  1 
ATOM   4824 C  C   . VAL B 1 115 ? 16.547  -12.585 18.891  1.00 29.57 ? 158 VAL B C   1 
ATOM   4825 O  O   . VAL B 1 115 ? 15.317  -12.506 18.829  1.00 29.08 ? 158 VAL B O   1 
ATOM   4826 C  CB  . VAL B 1 115 ? 17.491  -11.058 20.754  1.00 29.65 ? 158 VAL B CB  1 
ATOM   4827 C  CG1 . VAL B 1 115 ? 17.058  -10.010 19.732  1.00 28.33 ? 158 VAL B CG1 1 
ATOM   4828 C  CG2 . VAL B 1 115 ? 16.847  -10.857 22.114  1.00 28.64 ? 158 VAL B CG2 1 
ATOM   4829 N  N   . MET B 1 116 ? 17.321  -12.759 17.821  1.00 29.92 ? 159 MET B N   1 
ATOM   4830 C  CA  . MET B 1 116 ? 16.789  -12.818 16.456  1.00 30.51 ? 159 MET B CA  1 
ATOM   4831 C  C   . MET B 1 116 ? 16.890  -14.219 15.853  1.00 30.41 ? 159 MET B C   1 
ATOM   4832 O  O   . MET B 1 116 ? 16.018  -14.613 15.084  1.00 30.80 ? 159 MET B O   1 
ATOM   4833 C  CB  . MET B 1 116 ? 17.508  -11.815 15.534  1.00 30.53 ? 159 MET B CB  1 
ATOM   4834 C  CG  . MET B 1 116 ? 17.195  -10.343 15.796  1.00 32.21 ? 159 MET B CG  1 
ATOM   4835 S  SD  . MET B 1 116 ? 15.542  -9.866  15.222  1.00 36.78 ? 159 MET B SD  1 
ATOM   4836 C  CE  . MET B 1 116 ? 15.872  -9.348  13.546  1.00 35.15 ? 159 MET B CE  1 
ATOM   4837 N  N   . ALA B 1 117 ? 17.952  -14.952 16.193  1.00 30.28 ? 160 ALA B N   1 
ATOM   4838 C  CA  . ALA B 1 117 ? 18.224  -16.289 15.625  1.00 30.54 ? 160 ALA B CA  1 
ATOM   4839 C  C   . ALA B 1 117 ? 17.124  -17.331 15.917  1.00 30.80 ? 160 ALA B C   1 
ATOM   4840 O  O   . ALA B 1 117 ? 16.727  -17.513 17.079  1.00 30.78 ? 160 ALA B O   1 
ATOM   4841 C  CB  . ALA B 1 117 ? 19.589  -16.803 16.095  1.00 29.85 ? 160 ALA B CB  1 
ATOM   4842 N  N   . PRO B 1 118 ? 16.636  -18.020 14.865  1.00 31.12 ? 161 PRO B N   1 
ATOM   4843 C  CA  . PRO B 1 118 ? 15.580  -19.042 14.997  1.00 31.41 ? 161 PRO B CA  1 
ATOM   4844 C  C   . PRO B 1 118 ? 15.845  -20.064 16.107  1.00 31.77 ? 161 PRO B C   1 
ATOM   4845 O  O   . PRO B 1 118 ? 14.923  -20.431 16.820  1.00 31.91 ? 161 PRO B O   1 
ATOM   4846 C  CB  . PRO B 1 118 ? 15.583  -19.727 13.629  1.00 31.24 ? 161 PRO B CB  1 
ATOM   4847 C  CG  . PRO B 1 118 ? 16.070  -18.666 12.683  1.00 30.98 ? 161 PRO B CG  1 
ATOM   4848 C  CD  . PRO B 1 118 ? 17.049  -17.828 13.458  1.00 31.00 ? 161 PRO B CD  1 
ATOM   4849 N  N   . GLU B 1 119 ? 17.092  -20.496 16.269  1.00 32.32 ? 162 GLU B N   1 
ATOM   4850 C  CA  . GLU B 1 119 ? 17.434  -21.493 17.290  1.00 33.08 ? 162 GLU B CA  1 
ATOM   4851 C  C   . GLU B 1 119 ? 17.239  -20.982 18.713  1.00 32.73 ? 162 GLU B C   1 
ATOM   4852 O  O   . GLU B 1 119 ? 16.870  -21.745 19.611  1.00 32.85 ? 162 GLU B O   1 
ATOM   4853 C  CB  . GLU B 1 119 ? 18.866  -22.015 17.101  1.00 33.63 ? 162 GLU B CB  1 
ATOM   4854 C  CG  . GLU B 1 119 ? 19.111  -22.714 15.742  1.00 36.69 ? 162 GLU B CG  1 
ATOM   4855 C  CD  . GLU B 1 119 ? 17.957  -23.649 15.318  1.00 40.04 ? 162 GLU B CD  1 
ATOM   4856 O  OE1 . GLU B 1 119 ? 17.646  -24.624 16.061  1.00 40.90 ? 162 GLU B OE1 1 
ATOM   4857 O  OE2 . GLU B 1 119 ? 17.367  -23.396 14.237  1.00 40.23 ? 162 GLU B OE2 1 
ATOM   4858 N  N   . ALA B 1 120 ? 17.493  -19.688 18.900  1.00 32.24 ? 163 ALA B N   1 
ATOM   4859 C  CA  . ALA B 1 120 ? 17.261  -19.010 20.170  1.00 31.42 ? 163 ALA B CA  1 
ATOM   4860 C  C   . ALA B 1 120 ? 15.788  -18.654 20.352  1.00 31.01 ? 163 ALA B C   1 
ATOM   4861 O  O   . ALA B 1 120 ? 15.243  -18.827 21.441  1.00 31.36 ? 163 ALA B O   1 
ATOM   4862 C  CB  . ALA B 1 120 ? 18.114  -17.767 20.258  1.00 31.50 ? 163 ALA B CB  1 
ATOM   4863 N  N   . THR B 1 121 ? 15.138  -18.178 19.290  1.00 30.25 ? 164 THR B N   1 
ATOM   4864 C  CA  . THR B 1 121 ? 13.767  -17.683 19.415  1.00 29.72 ? 164 THR B CA  1 
ATOM   4865 C  C   . THR B 1 121 ? 12.718  -18.762 19.673  1.00 29.28 ? 164 THR B C   1 
ATOM   4866 O  O   . THR B 1 121 ? 11.681  -18.474 20.266  1.00 28.53 ? 164 THR B O   1 
ATOM   4867 C  CB  . THR B 1 121 ? 13.317  -16.765 18.228  1.00 29.76 ? 164 THR B CB  1 
ATOM   4868 O  OG1 . THR B 1 121 ? 13.308  -17.499 17.000  1.00 29.87 ? 164 THR B OG1 1 
ATOM   4869 C  CG2 . THR B 1 121 ? 14.222  -15.556 18.107  1.00 29.27 ? 164 THR B CG2 1 
ATOM   4870 N  N   . LYS B 1 122 ? 12.988  -19.996 19.243  1.00 29.14 ? 165 LYS B N   1 
ATOM   4871 C  CA  . LYS B 1 122 ? 12.033  -21.089 19.435  1.00 29.01 ? 165 LYS B CA  1 
ATOM   4872 C  C   . LYS B 1 122 ? 11.781  -21.329 20.927  1.00 28.38 ? 165 LYS B C   1 
ATOM   4873 O  O   . LYS B 1 122 ? 10.718  -21.794 21.307  1.00 28.22 ? 165 LYS B O   1 
ATOM   4874 C  CB  . LYS B 1 122 ? 12.489  -22.364 18.712  1.00 29.41 ? 165 LYS B CB  1 
ATOM   4875 C  CG  . LYS B 1 122 ? 13.262  -23.362 19.575  1.00 31.66 ? 165 LYS B CG  1 
ATOM   4876 C  CD  . LYS B 1 122 ? 14.208  -24.230 18.758  1.00 34.81 ? 165 LYS B CD  1 
ATOM   4877 C  CE  . LYS B 1 122 ? 14.976  -25.186 19.670  1.00 36.74 ? 165 LYS B CE  1 
ATOM   4878 N  NZ  . LYS B 1 122 ? 16.329  -25.490 19.124  1.00 38.45 ? 165 LYS B NZ  1 
ATOM   4879 N  N   . ASN B 1 123 ? 12.747  -20.966 21.768  1.00 28.17 ? 166 ASN B N   1 
ATOM   4880 C  CA  . ASN B 1 123 ? 12.582  -21.033 23.228  1.00 27.94 ? 166 ASN B CA  1 
ATOM   4881 C  C   . ASN B 1 123 ? 11.633  -19.992 23.846  1.00 27.32 ? 166 ASN B C   1 
ATOM   4882 O  O   . ASN B 1 123 ? 11.206  -20.137 24.998  1.00 27.08 ? 166 ASN B O   1 
ATOM   4883 C  CB  . ASN B 1 123 ? 13.946  -20.964 23.906  1.00 28.26 ? 166 ASN B CB  1 
ATOM   4884 C  CG  . ASN B 1 123 ? 14.843  -22.111 23.506  1.00 29.51 ? 166 ASN B CG  1 
ATOM   4885 O  OD1 . ASN B 1 123 ? 14.385  -23.239 23.357  1.00 31.32 ? 166 ASN B OD1 1 
ATOM   4886 N  ND2 . ASN B 1 123 ? 16.125  -21.829 23.315  1.00 31.15 ? 166 ASN B ND2 1 
ATOM   4887 N  N   . PHE B 1 124 ? 11.308  -18.948 23.085  1.00 26.40 ? 167 PHE B N   1 
ATOM   4888 C  CA  . PHE B 1 124 ? 10.390  -17.914 23.556  1.00 25.88 ? 167 PHE B CA  1 
ATOM   4889 C  C   . PHE B 1 124 ? 8.942   -18.411 23.672  1.00 26.03 ? 167 PHE B C   1 
ATOM   4890 O  O   . PHE B 1 124 ? 8.146   -17.876 24.470  1.00 26.15 ? 167 PHE B O   1 
ATOM   4891 C  CB  . PHE B 1 124 ? 10.452  -16.652 22.671  1.00 25.56 ? 167 PHE B CB  1 
ATOM   4892 C  CG  . PHE B 1 124 ? 11.824  -15.981 22.610  1.00 24.63 ? 167 PHE B CG  1 
ATOM   4893 C  CD1 . PHE B 1 124 ? 12.787  -16.192 23.600  1.00 23.49 ? 167 PHE B CD1 1 
ATOM   4894 C  CD2 . PHE B 1 124 ? 12.131  -15.109 21.565  1.00 23.90 ? 167 PHE B CD2 1 
ATOM   4895 C  CE1 . PHE B 1 124 ? 14.038  -15.567 23.539  1.00 23.06 ? 167 PHE B CE1 1 
ATOM   4896 C  CE2 . PHE B 1 124 ? 13.376  -14.456 21.503  1.00 23.03 ? 167 PHE B CE2 1 
ATOM   4897 C  CZ  . PHE B 1 124 ? 14.331  -14.690 22.491  1.00 23.01 ? 167 PHE B CZ  1 
ATOM   4898 N  N   . LEU B 1 125 ? 8.603   -19.444 22.898  1.00 25.78 ? 168 LEU B N   1 
ATOM   4899 C  CA  . LEU B 1 125 ? 7.204   -19.860 22.744  1.00 25.29 ? 168 LEU B CA  1 
ATOM   4900 C  C   . LEU B 1 125 ? 6.467   -20.163 24.057  1.00 25.33 ? 168 LEU B C   1 
ATOM   4901 O  O   . LEU B 1 125 ? 5.432   -19.548 24.313  1.00 25.74 ? 168 LEU B O   1 
ATOM   4902 C  CB  . LEU B 1 125 ? 7.051   -20.982 21.721  1.00 25.12 ? 168 LEU B CB  1 
ATOM   4903 C  CG  . LEU B 1 125 ? 7.704   -20.775 20.351  1.00 24.92 ? 168 LEU B CG  1 
ATOM   4904 C  CD1 . LEU B 1 125 ? 6.956   -21.586 19.357  1.00 25.30 ? 168 LEU B CD1 1 
ATOM   4905 C  CD2 . LEU B 1 125 ? 7.738   -19.332 19.893  1.00 24.30 ? 168 LEU B CD2 1 
ATOM   4906 N  N   . PRO B 1 126 ? 7.012   -21.060 24.911  1.00 24.95 ? 169 PRO B N   1 
ATOM   4907 C  CA  . PRO B 1 126 ? 6.310   -21.351 26.168  1.00 24.59 ? 169 PRO B CA  1 
ATOM   4908 C  C   . PRO B 1 126 ? 6.281   -20.158 27.137  1.00 24.51 ? 169 PRO B C   1 
ATOM   4909 O  O   . PRO B 1 126 ? 5.327   -20.011 27.922  1.00 24.74 ? 169 PRO B O   1 
ATOM   4910 C  CB  . PRO B 1 126 ? 7.134   -22.501 26.775  1.00 24.35 ? 169 PRO B CB  1 
ATOM   4911 C  CG  . PRO B 1 126 ? 8.063   -22.959 25.686  1.00 24.03 ? 169 PRO B CG  1 
ATOM   4912 C  CD  . PRO B 1 126 ? 8.299   -21.780 24.836  1.00 24.71 ? 169 PRO B CD  1 
ATOM   4913 N  N   . LEU B 1 127 ? 7.327   -19.331 27.090  1.00 23.89 ? 170 LEU B N   1 
ATOM   4914 C  CA  . LEU B 1 127 ? 7.454   -18.179 27.981  1.00 22.89 ? 170 LEU B CA  1 
ATOM   4915 C  C   . LEU B 1 127 ? 6.440   -17.077 27.634  1.00 22.67 ? 170 LEU B C   1 
ATOM   4916 O  O   . LEU B 1 127 ? 5.817   -16.491 28.537  1.00 22.73 ? 170 LEU B O   1 
ATOM   4917 C  CB  . LEU B 1 127 ? 8.886   -17.641 27.971  1.00 22.25 ? 170 LEU B CB  1 
ATOM   4918 C  CG  . LEU B 1 127 ? 9.981   -18.560 28.519  1.00 22.03 ? 170 LEU B CG  1 
ATOM   4919 C  CD1 . LEU B 1 127 ? 11.367  -17.926 28.328  1.00 20.26 ? 170 LEU B CD1 1 
ATOM   4920 C  CD2 . LEU B 1 127 ? 9.750   -18.900 29.996  1.00 21.21 ? 170 LEU B CD2 1 
ATOM   4921 N  N   . LEU B 1 128 ? 6.267   -16.816 26.335  1.00 21.67 ? 171 LEU B N   1 
ATOM   4922 C  CA  . LEU B 1 128 ? 5.313   -15.810 25.878  1.00 21.06 ? 171 LEU B CA  1 
ATOM   4923 C  C   . LEU B 1 128 ? 3.885   -16.334 25.998  1.00 21.00 ? 171 LEU B C   1 
ATOM   4924 O  O   . LEU B 1 128 ? 3.000   -15.626 26.474  1.00 21.41 ? 171 LEU B O   1 
ATOM   4925 C  CB  . LEU B 1 128 ? 5.625   -15.354 24.444  1.00 20.59 ? 171 LEU B CB  1 
ATOM   4926 C  CG  . LEU B 1 128 ? 6.983   -14.679 24.136  1.00 19.71 ? 171 LEU B CG  1 
ATOM   4927 C  CD1 . LEU B 1 128 ? 7.187   -14.563 22.637  1.00 16.39 ? 171 LEU B CD1 1 
ATOM   4928 C  CD2 . LEU B 1 128 ? 7.107   -13.308 24.771  1.00 17.57 ? 171 LEU B CD2 1 
ATOM   4929 N  N   . ASP B 1 129 ? 3.675   -17.582 25.588  1.00 20.96 ? 172 ASP B N   1 
ATOM   4930 C  CA  . ASP B 1 129 ? 2.377   -18.254 25.704  1.00 20.93 ? 172 ASP B CA  1 
ATOM   4931 C  C   . ASP B 1 129 ? 1.825   -18.295 27.141  1.00 20.60 ? 172 ASP B C   1 
ATOM   4932 O  O   . ASP B 1 129 ? 0.636   -18.058 27.352  1.00 20.38 ? 172 ASP B O   1 
ATOM   4933 C  CB  . ASP B 1 129 ? 2.484   -19.664 25.136  1.00 21.39 ? 172 ASP B CB  1 
ATOM   4934 C  CG  . ASP B 1 129 ? 1.138   -20.303 24.888  1.00 23.57 ? 172 ASP B CG  1 
ATOM   4935 O  OD1 . ASP B 1 129 ? 1.082   -21.551 24.970  1.00 26.59 ? 172 ASP B OD1 1 
ATOM   4936 O  OD2 . ASP B 1 129 ? 0.147   -19.575 24.612  1.00 24.52 ? 172 ASP B OD2 1 
ATOM   4937 N  N   . ALA B 1 130 ? 2.691   -18.573 28.116  1.00 19.98 ? 173 ALA B N   1 
ATOM   4938 C  CA  . ALA B 1 130 ? 2.308   -18.530 29.525  1.00 20.03 ? 173 ALA B CA  1 
ATOM   4939 C  C   . ALA B 1 130 ? 1.758   -17.160 29.919  1.00 20.38 ? 173 ALA B C   1 
ATOM   4940 O  O   . ALA B 1 130 ? 0.752   -17.072 30.640  1.00 20.62 ? 173 ALA B O   1 
ATOM   4941 C  CB  . ALA B 1 130 ? 3.482   -18.916 30.431  1.00 19.37 ? 173 ALA B CB  1 
ATOM   4942 N  N   . VAL B 1 131 ? 2.408   -16.091 29.460  1.00 20.38 ? 174 VAL B N   1 
ATOM   4943 C  CA  . VAL B 1 131 ? 1.925   -14.755 29.786  1.00 20.78 ? 174 VAL B CA  1 
ATOM   4944 C  C   . VAL B 1 131 ? 0.565   -14.506 29.118  1.00 20.96 ? 174 VAL B C   1 
ATOM   4945 O  O   . VAL B 1 131 ? -0.391  -14.123 29.795  1.00 20.47 ? 174 VAL B O   1 
ATOM   4946 C  CB  . VAL B 1 131 ? 2.937   -13.647 29.453  1.00 20.62 ? 174 VAL B CB  1 
ATOM   4947 C  CG1 . VAL B 1 131 ? 2.359   -12.303 29.803  1.00 19.81 ? 174 VAL B CG1 1 
ATOM   4948 C  CG2 . VAL B 1 131 ? 4.215   -13.866 30.226  1.00 20.86 ? 174 VAL B CG2 1 
ATOM   4949 N  N   . SER B 1 132 ? 0.474   -14.774 27.814  1.00 21.47 ? 175 SER B N   1 
ATOM   4950 C  CA  . SER B 1 132 ? -0.803  -14.636 27.080  1.00 22.11 ? 175 SER B CA  1 
ATOM   4951 C  C   . SER B 1 132 ? -1.974  -15.418 27.707  1.00 22.31 ? 175 SER B C   1 
ATOM   4952 O  O   . SER B 1 132 ? -3.076  -14.888 27.833  1.00 21.96 ? 175 SER B O   1 
ATOM   4953 C  CB  . SER B 1 132 ? -0.640  -14.999 25.609  1.00 21.61 ? 175 SER B CB  1 
ATOM   4954 O  OG  . SER B 1 132 ? 0.122   -14.010 24.964  1.00 22.02 ? 175 SER B OG  1 
ATOM   4955 N  N   . ARG B 1 133 ? -1.727  -16.656 28.128  1.00 22.91 ? 176 ARG B N   1 
ATOM   4956 C  CA  . ARG B 1 133 ? -2.782  -17.452 28.776  1.00 23.49 ? 176 ARG B CA  1 
ATOM   4957 C  C   . ARG B 1 133 ? -3.276  -16.801 30.067  1.00 23.08 ? 176 ARG B C   1 
ATOM   4958 O  O   . ARG B 1 133 ? -4.480  -16.747 30.317  1.00 23.21 ? 176 ARG B O   1 
ATOM   4959 C  CB  . ARG B 1 133 ? -2.328  -18.891 29.005  1.00 23.52 ? 176 ARG B CB  1 
ATOM   4960 C  CG  . ARG B 1 133 ? -2.172  -19.663 27.703  1.00 26.18 ? 176 ARG B CG  1 
ATOM   4961 C  CD  . ARG B 1 133 ? -1.348  -20.912 27.895  1.00 31.38 ? 176 ARG B CD  1 
ATOM   4962 N  NE  . ARG B 1 133 ? -2.057  -21.875 28.727  1.00 36.04 ? 176 ARG B NE  1 
ATOM   4963 C  CZ  . ARG B 1 133 ? -2.859  -22.834 28.263  1.00 39.12 ? 176 ARG B CZ  1 
ATOM   4964 N  NH1 . ARG B 1 133 ? -3.058  -22.980 26.954  1.00 39.39 ? 176 ARG B NH1 1 
ATOM   4965 N  NH2 . ARG B 1 133 ? -3.462  -23.660 29.119  1.00 40.04 ? 176 ARG B NH2 1 
ATOM   4966 N  N   . ASP B 1 134 ? -2.341  -16.289 30.863  1.00 23.04 ? 177 ASP B N   1 
ATOM   4967 C  CA  . ASP B 1 134 ? -2.666  -15.525 32.069  1.00 23.14 ? 177 ASP B CA  1 
ATOM   4968 C  C   . ASP B 1 134 ? -3.470  -14.259 31.779  1.00 22.78 ? 177 ASP B C   1 
ATOM   4969 O  O   . ASP B 1 134 ? -4.380  -13.926 32.535  1.00 23.15 ? 177 ASP B O   1 
ATOM   4970 C  CB  . ASP B 1 134 ? -1.402  -15.211 32.894  1.00 23.29 ? 177 ASP B CB  1 
ATOM   4971 C  CG  . ASP B 1 134 ? -0.903  -16.423 33.668  1.00 24.71 ? 177 ASP B CG  1 
ATOM   4972 O  OD1 . ASP B 1 134 ? -1.705  -17.363 33.842  1.00 25.71 ? 177 ASP B OD1 1 
ATOM   4973 O  OD2 . ASP B 1 134 ? 0.278   -16.451 34.092  1.00 26.05 ? 177 ASP B OD2 1 
ATOM   4974 N  N   . PHE B 1 135 ? -3.147  -13.568 30.689  1.00 22.31 ? 178 PHE B N   1 
ATOM   4975 C  CA  . PHE B 1 135 ? -3.920  -12.402 30.281  1.00 22.16 ? 178 PHE B CA  1 
ATOM   4976 C  C   . PHE B 1 135 ? -5.368  -12.787 29.988  1.00 22.54 ? 178 PHE B C   1 
ATOM   4977 O  O   . PHE B 1 135 ? -6.307  -12.121 30.450  1.00 22.94 ? 178 PHE B O   1 
ATOM   4978 C  CB  . PHE B 1 135 ? -3.303  -11.715 29.060  1.00 21.81 ? 178 PHE B CB  1 
ATOM   4979 C  CG  . PHE B 1 135 ? -3.914  -10.396 28.762  1.00 20.75 ? 178 PHE B CG  1 
ATOM   4980 C  CD1 . PHE B 1 135 ? -3.499  -9.260  29.443  1.00 21.11 ? 178 PHE B CD1 1 
ATOM   4981 C  CD2 . PHE B 1 135 ? -4.932  -10.282 27.831  1.00 21.22 ? 178 PHE B CD2 1 
ATOM   4982 C  CE1 . PHE B 1 135 ? -4.075  -8.017  29.189  1.00 20.32 ? 178 PHE B CE1 1 
ATOM   4983 C  CE2 . PHE B 1 135 ? -5.522  -9.042  27.569  1.00 21.61 ? 178 PHE B CE2 1 
ATOM   4984 C  CZ  . PHE B 1 135 ? -5.088  -7.904  28.258  1.00 20.60 ? 178 PHE B CZ  1 
ATOM   4985 N  N   . VAL B 1 136 ? -5.541  -13.863 29.224  1.00 22.63 ? 179 VAL B N   1 
ATOM   4986 C  CA  . VAL B 1 136 ? -6.861  -14.438 28.964  1.00 22.91 ? 179 VAL B CA  1 
ATOM   4987 C  C   . VAL B 1 136 ? -7.634  -14.692 30.270  1.00 23.33 ? 179 VAL B C   1 
ATOM   4988 O  O   . VAL B 1 136 ? -8.803  -14.325 30.366  1.00 23.68 ? 179 VAL B O   1 
ATOM   4989 C  CB  . VAL B 1 136 ? -6.754  -15.701 28.050  1.00 22.63 ? 179 VAL B CB  1 
ATOM   4990 C  CG1 . VAL B 1 136 ? -7.956  -16.621 28.200  1.00 22.35 ? 179 VAL B CG1 1 
ATOM   4991 C  CG2 . VAL B 1 136 ? -6.593  -15.267 26.599  1.00 22.20 ? 179 VAL B CG2 1 
ATOM   4992 N  N   . SER B 1 137 ? -6.968  -15.269 31.275  1.00 23.68 ? 180 SER B N   1 
ATOM   4993 C  CA  . SER B 1 137 ? -7.585  -15.526 32.589  1.00 24.26 ? 180 SER B CA  1 
ATOM   4994 C  C   . SER B 1 137 ? -8.078  -14.278 33.310  1.00 24.52 ? 180 SER B C   1 
ATOM   4995 O  O   . SER B 1 137 ? -9.168  -14.298 33.885  1.00 24.78 ? 180 SER B O   1 
ATOM   4996 C  CB  . SER B 1 137 ? -6.631  -16.284 33.511  1.00 24.14 ? 180 SER B CB  1 
ATOM   4997 O  OG  . SER B 1 137 ? -6.496  -17.624 33.088  1.00 24.76 ? 180 SER B OG  1 
ATOM   4998 N  N   . VAL B 1 138 ? -7.273  -13.208 33.299  1.00 24.66 ? 181 VAL B N   1 
ATOM   4999 C  CA  . VAL B 1 138 ? -7.692  -11.912 33.852  1.00 24.75 ? 181 VAL B CA  1 
ATOM   5000 C  C   . VAL B 1 138 ? -9.042  -11.494 33.268  1.00 24.73 ? 181 VAL B C   1 
ATOM   5001 O  O   . VAL B 1 138 ? -9.995  -11.225 34.005  1.00 24.75 ? 181 VAL B O   1 
ATOM   5002 C  CB  . VAL B 1 138 ? -6.667  -10.788 33.572  1.00 24.61 ? 181 VAL B CB  1 
ATOM   5003 C  CG1 . VAL B 1 138 ? -7.213  -9.444  34.018  1.00 24.23 ? 181 VAL B CG1 1 
ATOM   5004 C  CG2 . VAL B 1 138 ? -5.368  -11.075 34.270  1.00 25.41 ? 181 VAL B CG2 1 
ATOM   5005 N  N   . LEU B 1 139 ? -9.120  -11.450 31.940  1.00 24.69 ? 182 LEU B N   1 
ATOM   5006 C  CA  . LEU B 1 139 ? -10.371 -11.072 31.284  1.00 24.90 ? 182 LEU B CA  1 
ATOM   5007 C  C   . LEU B 1 139 ? -11.519 -12.004 31.681  1.00 24.84 ? 182 LEU B C   1 
ATOM   5008 O  O   . LEU B 1 139 ? -12.596 -11.528 32.027  1.00 24.29 ? 182 LEU B O   1 
ATOM   5009 C  CB  . LEU B 1 139 ? -10.211 -10.973 29.768  1.00 24.30 ? 182 LEU B CB  1 
ATOM   5010 C  CG  . LEU B 1 139 ? -9.373  -9.786  29.296  1.00 24.63 ? 182 LEU B CG  1 
ATOM   5011 C  CD1 . LEU B 1 139 ? -9.062  -9.923  27.824  1.00 24.14 ? 182 LEU B CD1 1 
ATOM   5012 C  CD2 . LEU B 1 139 ? -10.055 -8.432  29.589  1.00 24.69 ? 182 LEU B CD2 1 
ATOM   5013 N  N   . HIS B 1 140 ? -11.273 -13.314 31.661  1.00 25.25 ? 183 HIS B N   1 
ATOM   5014 C  CA  . HIS B 1 140 ? -12.280 -14.287 32.127  1.00 26.30 ? 183 HIS B CA  1 
ATOM   5015 C  C   . HIS B 1 140 ? -12.768 -13.974 33.548  1.00 26.74 ? 183 HIS B C   1 
ATOM   5016 O  O   . HIS B 1 140 ? -13.959 -14.069 33.814  1.00 26.95 ? 183 HIS B O   1 
ATOM   5017 C  CB  . HIS B 1 140 ? -11.789 -15.747 32.019  1.00 25.55 ? 183 HIS B CB  1 
ATOM   5018 C  CG  . HIS B 1 140 ? -12.013 -16.366 30.673  1.00 25.56 ? 183 HIS B CG  1 
ATOM   5019 N  ND1 . HIS B 1 140 ? -13.242 -16.357 30.042  1.00 25.09 ? 183 HIS B ND1 1 
ATOM   5020 C  CD2 . HIS B 1 140 ? -11.165 -17.013 29.835  1.00 25.00 ? 183 HIS B CD2 1 
ATOM   5021 C  CE1 . HIS B 1 140 ? -13.138 -16.967 28.874  1.00 24.86 ? 183 HIS B CE1 1 
ATOM   5022 N  NE2 . HIS B 1 140 ? -11.889 -17.376 28.725  1.00 24.53 ? 183 HIS B NE2 1 
ATOM   5023 N  N   . ARG B 1 141 ? -11.852 -13.583 34.434  1.00 27.57 ? 184 ARG B N   1 
ATOM   5024 C  CA  . ARG B 1 141 ? -12.208 -13.198 35.799  1.00 29.12 ? 184 ARG B CA  1 
ATOM   5025 C  C   . ARG B 1 141 ? -13.067 -11.934 35.808  1.00 29.11 ? 184 ARG B C   1 
ATOM   5026 O  O   . ARG B 1 141 ? -14.028 -11.833 36.588  1.00 29.36 ? 184 ARG B O   1 
ATOM   5027 C  CB  . ARG B 1 141 ? -10.964 -12.989 36.684  1.00 29.63 ? 184 ARG B CB  1 
ATOM   5028 C  CG  . ARG B 1 141 ? -10.250 -14.267 37.070  1.00 32.92 ? 184 ARG B CG  1 
ATOM   5029 C  CD  . ARG B 1 141 ? -9.291  -14.059 38.248  1.00 38.33 ? 184 ARG B CD  1 
ATOM   5030 N  NE  . ARG B 1 141 ? -7.945  -13.615 37.849  1.00 41.66 ? 184 ARG B NE  1 
ATOM   5031 C  CZ  . ARG B 1 141 ? -7.507  -12.355 37.935  1.00 43.44 ? 184 ARG B CZ  1 
ATOM   5032 N  NH1 . ARG B 1 141 ? -8.310  -11.398 38.399  1.00 43.37 ? 184 ARG B NH1 1 
ATOM   5033 N  NH2 . ARG B 1 141 ? -6.265  -12.048 37.549  1.00 43.64 ? 184 ARG B NH2 1 
ATOM   5034 N  N   . ARG B 1 142 ? -12.719 -10.977 34.948  1.00 28.87 ? 185 ARG B N   1 
ATOM   5035 C  CA  . ARG B 1 142 ? -13.464 -9.720  34.867  1.00 29.05 ? 185 ARG B CA  1 
ATOM   5036 C  C   . ARG B 1 142 ? -14.873 -9.872  34.293  1.00 29.24 ? 185 ARG B C   1 
ATOM   5037 O  O   . ARG B 1 142 ? -15.789 -9.200  34.737  1.00 29.36 ? 185 ARG B O   1 
ATOM   5038 C  CB  . ARG B 1 142 ? -12.673 -8.665  34.099  1.00 28.76 ? 185 ARG B CB  1 
ATOM   5039 C  CG  . ARG B 1 142 ? -11.491 -8.181  34.874  1.00 27.51 ? 185 ARG B CG  1 
ATOM   5040 C  CD  . ARG B 1 142 ? -10.985 -6.880  34.340  1.00 27.42 ? 185 ARG B CD  1 
ATOM   5041 N  NE  . ARG B 1 142 ? -9.614  -6.660  34.769  1.00 26.42 ? 185 ARG B NE  1 
ATOM   5042 C  CZ  . ARG B 1 142 ? -8.760  -5.849  34.165  1.00 25.57 ? 185 ARG B CZ  1 
ATOM   5043 N  NH1 . ARG B 1 142 ? -9.122  -5.156  33.093  1.00 24.97 ? 185 ARG B NH1 1 
ATOM   5044 N  NH2 . ARG B 1 142 ? -7.536  -5.736  34.639  1.00 25.78 ? 185 ARG B NH2 1 
ATOM   5045 N  N   . ILE B 1 143 ? -15.024 -10.762 33.318  1.00 29.76 ? 186 ILE B N   1 
ATOM   5046 C  CA  . ILE B 1 143 ? -16.316 -11.133 32.749  1.00 30.13 ? 186 ILE B CA  1 
ATOM   5047 C  C   . ILE B 1 143 ? -17.207 -11.747 33.837  1.00 30.92 ? 186 ILE B C   1 
ATOM   5048 O  O   . ILE B 1 143 ? -18.396 -11.430 33.941  1.00 31.06 ? 186 ILE B O   1 
ATOM   5049 C  CB  . ILE B 1 143 ? -16.121 -12.124 31.556  1.00 29.99 ? 186 ILE B CB  1 
ATOM   5050 C  CG1 . ILE B 1 143 ? -15.420 -11.409 30.385  1.00 29.62 ? 186 ILE B CG1 1 
ATOM   5051 C  CG2 . ILE B 1 143 ? -17.445 -12.725 31.121  1.00 29.03 ? 186 ILE B CG2 1 
ATOM   5052 C  CD1 . ILE B 1 143 ? -14.973 -12.297 29.240  1.00 28.35 ? 186 ILE B CD1 1 
ATOM   5053 N  N   . LYS B 1 144 ? -16.619 -12.610 34.659  1.00 31.63 ? 187 LYS B N   1 
ATOM   5054 C  CA  . LYS B 1 144 ? -17.345 -13.262 35.750  1.00 32.53 ? 187 LYS B CA  1 
ATOM   5055 C  C   . LYS B 1 144 ? -17.768 -12.261 36.835  1.00 32.18 ? 187 LYS B C   1 
ATOM   5056 O  O   . LYS B 1 144 ? -18.927 -12.245 37.231  1.00 31.86 ? 187 LYS B O   1 
ATOM   5057 C  CB  . LYS B 1 144 ? -16.515 -14.422 36.331  1.00 33.15 ? 187 LYS B CB  1 
ATOM   5058 C  CG  . LYS B 1 144 ? -17.185 -15.188 37.464  1.00 35.78 ? 187 LYS B CG  1 
ATOM   5059 C  CD  . LYS B 1 144 ? -16.840 -16.687 37.427  1.00 39.87 ? 187 LYS B CD  1 
ATOM   5060 C  CE  . LYS B 1 144 ? -17.763 -17.481 38.371  1.00 40.65 ? 187 LYS B CE  1 
ATOM   5061 N  NZ  . LYS B 1 144 ? -17.806 -18.928 38.027  1.00 41.75 ? 187 LYS B NZ  1 
ATOM   5062 N  N   . LYS B 1 145 ? -16.834 -11.422 37.293  1.00 32.21 ? 188 LYS B N   1 
ATOM   5063 C  CA  . LYS B 1 145 ? -17.134 -10.381 38.292  1.00 32.18 ? 188 LYS B CA  1 
ATOM   5064 C  C   . LYS B 1 145 ? -18.171 -9.345  37.833  1.00 31.85 ? 188 LYS B C   1 
ATOM   5065 O  O   . LYS B 1 145 ? -18.968 -8.865  38.656  1.00 32.10 ? 188 LYS B O   1 
ATOM   5066 C  CB  . LYS B 1 145 ? -15.864 -9.674  38.768  1.00 32.41 ? 188 LYS B CB  1 
ATOM   5067 C  CG  . LYS B 1 145 ? -16.135 -8.441  39.636  1.00 33.91 ? 188 LYS B CG  1 
ATOM   5068 C  CD  . LYS B 1 145 ? -14.887 -7.921  40.331  1.00 37.28 ? 188 LYS B CD  1 
ATOM   5069 C  CE  . LYS B 1 145 ? -14.601 -8.685  41.641  1.00 39.63 ? 188 LYS B CE  1 
ATOM   5070 N  NZ  . LYS B 1 145 ? -13.896 -9.998  41.430  1.00 39.16 ? 188 LYS B NZ  1 
ATOM   5071 N  N   . ALA B 1 146 ? -18.149 -9.000  36.543  1.00 30.82 ? 189 ALA B N   1 
ATOM   5072 C  CA  . ALA B 1 146 ? -19.127 -8.082  35.963  1.00 30.20 ? 189 ALA B CA  1 
ATOM   5073 C  C   . ALA B 1 146 ? -20.526 -8.693  35.901  1.00 30.08 ? 189 ALA B C   1 
ATOM   5074 O  O   . ALA B 1 146 ? -21.516 -7.970  35.897  1.00 30.24 ? 189 ALA B O   1 
ATOM   5075 C  CB  . ALA B 1 146 ? -18.686 -7.625  34.595  1.00 30.02 ? 189 ALA B CB  1 
ATOM   5076 N  N   . GLY B 1 147 ? -20.605 -10.019 35.834  1.00 29.59 ? 190 GLY B N   1 
ATOM   5077 C  CA  . GLY B 1 147 ? -21.867 -10.717 36.026  1.00 29.06 ? 190 GLY B CA  1 
ATOM   5078 C  C   . GLY B 1 147 ? -22.902 -10.733 34.912  1.00 29.16 ? 190 GLY B C   1 
ATOM   5079 O  O   . GLY B 1 147 ? -23.951 -11.341 35.082  1.00 29.28 ? 190 GLY B O   1 
ATOM   5080 N  N   . SER B 1 148 ? -22.646 -10.082 33.780  1.00 29.10 ? 191 SER B N   1 
ATOM   5081 C  CA  . SER B 1 148 ? -23.578 -10.175 32.645  1.00 29.27 ? 191 SER B CA  1 
ATOM   5082 C  C   . SER B 1 148 ? -22.987 -10.851 31.402  1.00 29.38 ? 191 SER B C   1 
ATOM   5083 O  O   . SER B 1 148 ? -23.417 -10.577 30.290  1.00 29.15 ? 191 SER B O   1 
ATOM   5084 C  CB  . SER B 1 148 ? -24.152 -8.807  32.286  1.00 29.38 ? 191 SER B CB  1 
ATOM   5085 O  OG  . SER B 1 148 ? -25.030 -8.345  33.303  1.00 29.35 ? 191 SER B OG  1 
ATOM   5086 N  N   . GLY B 1 149 ? -22.011 -11.735 31.606  1.00 29.48 ? 192 GLY B N   1 
ATOM   5087 C  CA  . GLY B 1 149 ? -21.382 -12.498 30.518  1.00 29.84 ? 192 GLY B CA  1 
ATOM   5088 C  C   . GLY B 1 149 ? -20.604 -11.621 29.553  1.00 29.67 ? 192 GLY B C   1 
ATOM   5089 O  O   . GLY B 1 149 ? -20.613 -11.860 28.346  1.00 30.15 ? 192 GLY B O   1 
ATOM   5090 N  N   . ASN B 1 150 ? -19.879 -10.648 30.101  1.00 29.25 ? 193 ASN B N   1 
ATOM   5091 C  CA  . ASN B 1 150 ? -19.549 -9.430  29.389  1.00 28.57 ? 193 ASN B CA  1 
ATOM   5092 C  C   . ASN B 1 150 ? -18.517 -8.582  30.164  1.00 27.70 ? 193 ASN B C   1 
ATOM   5093 O  O   . ASN B 1 150 ? -18.690 -8.376  31.364  1.00 27.60 ? 193 ASN B O   1 
ATOM   5094 C  CB  . ASN B 1 150 ? -20.858 -8.660  29.336  1.00 29.12 ? 193 ASN B CB  1 
ATOM   5095 C  CG  . ASN B 1 150 ? -20.778 -7.449  28.527  1.00 30.86 ? 193 ASN B CG  1 
ATOM   5096 O  OD1 . ASN B 1 150 ? -20.893 -7.524  27.315  1.00 37.46 ? 193 ASN B OD1 1 
ATOM   5097 N  ND2 . ASN B 1 150 ? -20.600 -6.303  29.167  1.00 31.20 ? 193 ASN B ND2 1 
ATOM   5098 N  N   . TYR B 1 151 ? -17.465 -8.088  29.504  1.00 26.31 ? 194 TYR B N   1 
ATOM   5099 C  CA  . TYR B 1 151 ? -16.580 -7.085  30.124  1.00 24.84 ? 194 TYR B CA  1 
ATOM   5100 C  C   . TYR B 1 151 ? -16.243 -5.901  29.220  1.00 24.07 ? 194 TYR B C   1 
ATOM   5101 O  O   . TYR B 1 151 ? -15.783 -6.081  28.105  1.00 23.97 ? 194 TYR B O   1 
ATOM   5102 C  CB  . TYR B 1 151 ? -15.277 -7.697  30.660  1.00 24.94 ? 194 TYR B CB  1 
ATOM   5103 C  CG  . TYR B 1 151 ? -14.327 -6.642  31.214  1.00 24.88 ? 194 TYR B CG  1 
ATOM   5104 C  CD1 . TYR B 1 151 ? -14.668 -5.917  32.363  1.00 25.16 ? 194 TYR B CD1 1 
ATOM   5105 C  CD2 . TYR B 1 151 ? -13.112 -6.350  30.585  1.00 24.05 ? 194 TYR B CD2 1 
ATOM   5106 C  CE1 . TYR B 1 151 ? -13.840 -4.943  32.877  1.00 24.95 ? 194 TYR B CE1 1 
ATOM   5107 C  CE2 . TYR B 1 151 ? -12.254 -5.365  31.103  1.00 25.22 ? 194 TYR B CE2 1 
ATOM   5108 C  CZ  . TYR B 1 151 ? -12.636 -4.661  32.248  1.00 26.40 ? 194 TYR B CZ  1 
ATOM   5109 O  OH  . TYR B 1 151 ? -11.836 -3.675  32.797  1.00 27.11 ? 194 TYR B OH  1 
ATOM   5110 N  N   . SER B 1 152 ? -16.454 -4.691  29.727  1.00 22.97 ? 195 SER B N   1 
ATOM   5111 C  CA  . SER B 1 152 ? -16.112 -3.472  29.006  1.00 22.30 ? 195 SER B CA  1 
ATOM   5112 C  C   . SER B 1 152 ? -15.104 -2.682  29.786  1.00 21.56 ? 195 SER B C   1 
ATOM   5113 O  O   . SER B 1 152 ? -15.136 -2.664  31.026  1.00 21.80 ? 195 SER B O   1 
ATOM   5114 C  CB  . SER B 1 152 ? -17.338 -2.586  28.778  1.00 21.98 ? 195 SER B CB  1 
ATOM   5115 O  OG  . SER B 1 152 ? -18.255 -3.242  27.933  1.00 23.17 ? 195 SER B OG  1 
ATOM   5116 N  N   . GLY B 1 153 ? -14.220 -2.018  29.054  1.00 20.71 ? 196 GLY B N   1 
ATOM   5117 C  CA  . GLY B 1 153 ? -13.216 -1.168  29.661  1.00 19.78 ? 196 GLY B CA  1 
ATOM   5118 C  C   . GLY B 1 153 ? -12.071 -0.816  28.735  1.00 19.51 ? 196 GLY B C   1 
ATOM   5119 O  O   . GLY B 1 153 ? -11.879 -1.429  27.686  1.00 18.86 ? 196 GLY B O   1 
ATOM   5120 N  N   . ASP B 1 154 ? -11.329 0.210   29.140  1.00 19.18 ? 197 ASP B N   1 
ATOM   5121 C  CA  . ASP B 1 154 ? -10.092 0.599   28.512  1.00 18.73 ? 197 ASP B CA  1 
ATOM   5122 C  C   . ASP B 1 154 ? -9.037  -0.328  29.094  1.00 18.16 ? 197 ASP B C   1 
ATOM   5123 O  O   . ASP B 1 154 ? -8.793  -0.306  30.301  1.00 18.32 ? 197 ASP B O   1 
ATOM   5124 C  CB  . ASP B 1 154 ? -9.797  2.052   28.883  1.00 18.80 ? 197 ASP B CB  1 
ATOM   5125 C  CG  . ASP B 1 154 ? -8.466  2.551   28.350  1.00 20.08 ? 197 ASP B CG  1 
ATOM   5126 O  OD1 . ASP B 1 154 ? -7.580  1.751   27.998  1.00 20.83 ? 197 ASP B OD1 1 
ATOM   5127 O  OD2 . ASP B 1 154 ? -8.293  3.780   28.299  1.00 24.06 ? 197 ASP B OD2 1 
ATOM   5128 N  N   . ILE B 1 155 ? -8.419  -1.146  28.243  1.00 17.43 ? 198 ILE B N   1 
ATOM   5129 C  CA  . ILE B 1 155 ? -7.427  -2.122  28.702  1.00 16.41 ? 198 ILE B CA  1 
ATOM   5130 C  C   . ILE B 1 155 ? -5.980  -1.706  28.410  1.00 16.16 ? 198 ILE B C   1 
ATOM   5131 O  O   . ILE B 1 155 ? -5.062  -2.540  28.486  1.00 15.90 ? 198 ILE B O   1 
ATOM   5132 C  CB  . ILE B 1 155 ? -7.707  -3.563  28.158  1.00 16.09 ? 198 ILE B CB  1 
ATOM   5133 C  CG1 . ILE B 1 155 ? -7.641  -3.588  26.621  1.00 16.17 ? 198 ILE B CG1 1 
ATOM   5134 C  CG2 . ILE B 1 155 ? -9.031  -4.092  28.682  1.00 14.65 ? 198 ILE B CG2 1 
ATOM   5135 C  CD1 . ILE B 1 155 ? -7.321  -4.948  26.029  1.00 12.81 ? 198 ILE B CD1 1 
ATOM   5136 N  N   . SER B 1 156 ? -5.765  -0.425  28.112  1.00 15.81 ? 199 SER B N   1 
ATOM   5137 C  CA  . SER B 1 156 ? -4.402  0.071   27.859  1.00 16.31 ? 199 SER B CA  1 
ATOM   5138 C  C   . SER B 1 156 ? -3.404  -0.276  28.969  1.00 16.14 ? 199 SER B C   1 
ATOM   5139 O  O   . SER B 1 156 ? -2.347  -0.815  28.689  1.00 16.01 ? 199 SER B O   1 
ATOM   5140 C  CB  . SER B 1 156 ? -4.376  1.577   27.576  1.00 16.37 ? 199 SER B CB  1 
ATOM   5141 O  OG  . SER B 1 156 ? -5.208  2.286   28.481  1.00 17.16 ? 199 SER B OG  1 
ATOM   5142 N  N   . ASP B 1 157 ? -3.749  0.019   30.219  1.00 16.89 ? 200 ASP B N   1 
ATOM   5143 C  CA  . ASP B 1 157 ? -2.855  -0.256  31.355  1.00 17.97 ? 200 ASP B CA  1 
ATOM   5144 C  C   . ASP B 1 157 ? -2.537  -1.743  31.496  1.00 17.93 ? 200 ASP B C   1 
ATOM   5145 O  O   . ASP B 1 157 ? -1.382  -2.114  31.733  1.00 17.62 ? 200 ASP B O   1 
ATOM   5146 C  CB  . ASP B 1 157 ? -3.438  0.279   32.664  1.00 18.41 ? 200 ASP B CB  1 
ATOM   5147 C  CG  . ASP B 1 157 ? -3.492  1.799   32.710  1.00 20.46 ? 200 ASP B CG  1 
ATOM   5148 O  OD1 . ASP B 1 157 ? -2.710  2.471   32.000  1.00 23.74 ? 200 ASP B OD1 1 
ATOM   5149 O  OD2 . ASP B 1 157 ? -4.326  2.327   33.470  1.00 23.58 ? 200 ASP B OD2 1 
ATOM   5150 N  N   . ASP B 1 158 ? -3.565  -2.576  31.330  1.00 18.05 ? 201 ASP B N   1 
ATOM   5151 C  CA  . ASP B 1 158 ? -3.407  -4.027  31.303  1.00 18.55 ? 201 ASP B CA  1 
ATOM   5152 C  C   . ASP B 1 158 ? -2.503  -4.480  30.177  1.00 18.08 ? 201 ASP B C   1 
ATOM   5153 O  O   . ASP B 1 158 ? -1.733  -5.425  30.339  1.00 18.03 ? 201 ASP B O   1 
ATOM   5154 C  CB  . ASP B 1 158 ? -4.757  -4.702  31.143  1.00 18.80 ? 201 ASP B CB  1 
ATOM   5155 C  CG  . ASP B 1 158 ? -5.660  -4.438  32.298  1.00 20.28 ? 201 ASP B CG  1 
ATOM   5156 O  OD1 . ASP B 1 158 ? -5.251  -4.732  33.447  1.00 21.12 ? 201 ASP B OD1 1 
ATOM   5157 O  OD2 . ASP B 1 158 ? -6.788  -3.951  32.058  1.00 24.11 ? 201 ASP B OD2 1 
ATOM   5158 N  N   . LEU B 1 159 ? -2.613  -3.810  29.036  1.00 17.66 ? 202 LEU B N   1 
ATOM   5159 C  CA  . LEU B 1 159 ? -1.789  -4.147  27.899  1.00 17.69 ? 202 LEU B CA  1 
ATOM   5160 C  C   . LEU B 1 159 ? -0.334  -3.780  28.178  1.00 17.96 ? 202 LEU B C   1 
ATOM   5161 O  O   . LEU B 1 159 ? 0.557   -4.556  27.840  1.00 18.38 ? 202 LEU B O   1 
ATOM   5162 C  CB  . LEU B 1 159 ? -2.315  -3.498  26.611  1.00 17.36 ? 202 LEU B CB  1 
ATOM   5163 C  CG  . LEU B 1 159 ? -3.586  -4.148  26.045  1.00 17.85 ? 202 LEU B CG  1 
ATOM   5164 C  CD1 . LEU B 1 159 ? -4.099  -3.394  24.840  1.00 16.77 ? 202 LEU B CD1 1 
ATOM   5165 C  CD2 . LEU B 1 159 ? -3.364  -5.630  25.706  1.00 16.46 ? 202 LEU B CD2 1 
ATOM   5166 N  N   . PHE B 1 160 ? -0.096  -2.615  28.797  1.00 17.77 ? 203 PHE B N   1 
ATOM   5167 C  CA  . PHE B 1 160 ? 1.260   -2.236  29.257  1.00 17.58 ? 203 PHE B CA  1 
ATOM   5168 C  C   . PHE B 1 160 ? 1.840   -3.298  30.219  1.00 17.63 ? 203 PHE B C   1 
ATOM   5169 O  O   . PHE B 1 160 ? 2.987   -3.749  30.028  1.00 17.85 ? 203 PHE B O   1 
ATOM   5170 C  CB  . PHE B 1 160 ? 1.291   -0.836  29.916  1.00 17.43 ? 203 PHE B CB  1 
ATOM   5171 C  CG  . PHE B 1 160 ? 1.010   0.309   28.969  1.00 16.84 ? 203 PHE B CG  1 
ATOM   5172 C  CD1 . PHE B 1 160 ? -0.014  1.208   29.234  1.00 17.58 ? 203 PHE B CD1 1 
ATOM   5173 C  CD2 . PHE B 1 160 ? 1.773   0.500   27.821  1.00 17.57 ? 203 PHE B CD2 1 
ATOM   5174 C  CE1 . PHE B 1 160 ? -0.279  2.272   28.365  1.00 16.17 ? 203 PHE B CE1 1 
ATOM   5175 C  CE2 . PHE B 1 160 ? 1.514   1.562   26.952  1.00 16.77 ? 203 PHE B CE2 1 
ATOM   5176 C  CZ  . PHE B 1 160 ? 0.486   2.442   27.231  1.00 16.59 ? 203 PHE B CZ  1 
ATOM   5177 N  N   . ARG B 1 161 ? 1.058   -3.715  31.221  1.00 16.91 ? 204 ARG B N   1 
ATOM   5178 C  CA  . ARG B 1 161 ? 1.504   -4.782  32.124  1.00 17.37 ? 204 ARG B CA  1 
ATOM   5179 C  C   . ARG B 1 161 ? 1.788   -6.096  31.370  1.00 17.46 ? 204 ARG B C   1 
ATOM   5180 O  O   . ARG B 1 161 ? 2.771   -6.796  31.677  1.00 17.34 ? 204 ARG B O   1 
ATOM   5181 C  CB  . ARG B 1 161 ? 0.513   -5.022  33.262  1.00 17.29 ? 204 ARG B CB  1 
ATOM   5182 C  CG  . ARG B 1 161 ? 0.492   -3.922  34.302  1.00 18.50 ? 204 ARG B CG  1 
ATOM   5183 C  CD  . ARG B 1 161 ? -0.624  -4.121  35.318  1.00 21.18 ? 204 ARG B CD  1 
ATOM   5184 N  NE  . ARG B 1 161 ? -1.304  -2.848  35.583  1.00 24.77 ? 204 ARG B NE  1 
ATOM   5185 C  CZ  . ARG B 1 161 ? -2.575  -2.596  35.285  1.00 24.12 ? 204 ARG B CZ  1 
ATOM   5186 N  NH1 . ARG B 1 161 ? -3.335  -3.519  34.735  1.00 25.44 ? 204 ARG B NH1 1 
ATOM   5187 N  NH2 . ARG B 1 161 ? -3.091  -1.421  35.548  1.00 25.88 ? 204 ARG B NH2 1 
ATOM   5188 N  N   . PHE B 1 162 ? 0.936   -6.425  30.392  1.00 17.30 ? 205 PHE B N   1 
ATOM   5189 C  CA  . PHE B 1 162 ? 1.164   -7.605  29.563  1.00 17.37 ? 205 PHE B CA  1 
ATOM   5190 C  C   . PHE B 1 162 ? 2.514   -7.504  28.846  1.00 17.69 ? 205 PHE B C   1 
ATOM   5191 O  O   . PHE B 1 162 ? 3.347   -8.405  28.939  1.00 17.66 ? 205 PHE B O   1 
ATOM   5192 C  CB  . PHE B 1 162 ? 0.039   -7.824  28.548  1.00 17.36 ? 205 PHE B CB  1 
ATOM   5193 C  CG  . PHE B 1 162 ? 0.376   -8.853  27.502  1.00 17.33 ? 205 PHE B CG  1 
ATOM   5194 C  CD1 . PHE B 1 162 ? 0.369   -10.213 27.817  1.00 16.71 ? 205 PHE B CD1 1 
ATOM   5195 C  CD2 . PHE B 1 162 ? 0.746   -8.471  26.221  1.00 15.92 ? 205 PHE B CD2 1 
ATOM   5196 C  CE1 . PHE B 1 162 ? 0.714   -11.167 26.857  1.00 16.51 ? 205 PHE B CE1 1 
ATOM   5197 C  CE2 . PHE B 1 162 ? 1.096   -9.431  25.261  1.00 15.39 ? 205 PHE B CE2 1 
ATOM   5198 C  CZ  . PHE B 1 162 ? 1.080   -10.763 25.577  1.00 15.13 ? 205 PHE B CZ  1 
ATOM   5199 N  N   . ALA B 1 163 ? 2.732   -6.395  28.149  1.00 17.79 ? 206 ALA B N   1 
ATOM   5200 C  CA  . ALA B 1 163 ? 3.974   -6.198  27.429  1.00 18.25 ? 206 ALA B CA  1 
ATOM   5201 C  C   . ALA B 1 163 ? 5.204   -6.366  28.343  1.00 18.36 ? 206 ALA B C   1 
ATOM   5202 O  O   . ALA B 1 163 ? 6.197   -6.994  27.961  1.00 18.76 ? 206 ALA B O   1 
ATOM   5203 C  CB  . ALA B 1 163 ? 3.970   -4.844  26.735  1.00 18.07 ? 206 ALA B CB  1 
ATOM   5204 N  N   . PHE B 1 164 ? 5.109   -5.822  29.551  1.00 18.52 ? 207 PHE B N   1 
ATOM   5205 C  CA  . PHE B 1 164 ? 6.168   -5.898  30.547  1.00 18.40 ? 207 PHE B CA  1 
ATOM   5206 C  C   . PHE B 1 164 ? 6.450   -7.317  31.085  1.00 18.63 ? 207 PHE B C   1 
ATOM   5207 O  O   . PHE B 1 164 ? 7.617   -7.693  31.175  1.00 18.44 ? 207 PHE B O   1 
ATOM   5208 C  CB  . PHE B 1 164 ? 5.860   -4.943  31.692  1.00 18.46 ? 207 PHE B CB  1 
ATOM   5209 C  CG  . PHE B 1 164 ? 6.897   -4.935  32.766  1.00 18.94 ? 207 PHE B CG  1 
ATOM   5210 C  CD1 . PHE B 1 164 ? 8.053   -4.190  32.621  1.00 20.46 ? 207 PHE B CD1 1 
ATOM   5211 C  CD2 . PHE B 1 164 ? 6.722   -5.685  33.920  1.00 19.07 ? 207 PHE B CD2 1 
ATOM   5212 C  CE1 . PHE B 1 164 ? 9.013   -4.187  33.613  1.00 21.50 ? 207 PHE B CE1 1 
ATOM   5213 C  CE2 . PHE B 1 164 ? 7.672   -5.691  34.912  1.00 19.40 ? 207 PHE B CE2 1 
ATOM   5214 C  CZ  . PHE B 1 164 ? 8.815   -4.943  34.770  1.00 20.32 ? 207 PHE B CZ  1 
ATOM   5215 N  N   . GLU B 1 165 ? 5.405   -8.073  31.459  1.00 18.66 ? 208 GLU B N   1 
ATOM   5216 C  CA  . GLU B 1 165 ? 5.529   -9.504  31.786  1.00 19.31 ? 208 GLU B CA  1 
ATOM   5217 C  C   . GLU B 1 165 ? 6.248   -10.258 30.677  1.00 18.70 ? 208 GLU B C   1 
ATOM   5218 O  O   . GLU B 1 165 ? 7.168   -11.025 30.939  1.00 18.81 ? 208 GLU B O   1 
ATOM   5219 C  CB  . GLU B 1 165 ? 4.167   -10.192 31.944  1.00 19.66 ? 208 GLU B CB  1 
ATOM   5220 C  CG  . GLU B 1 165 ? 3.483   -10.121 33.285  1.00 22.80 ? 208 GLU B CG  1 
ATOM   5221 C  CD  . GLU B 1 165 ? 4.309   -10.661 34.448  1.00 26.25 ? 208 GLU B CD  1 
ATOM   5222 O  OE1 . GLU B 1 165 ? 4.312   -11.893 34.712  1.00 26.64 ? 208 GLU B OE1 1 
ATOM   5223 O  OE2 . GLU B 1 165 ? 4.910   -9.815  35.142  1.00 27.07 ? 208 GLU B OE2 1 
ATOM   5224 N  N   . SER B 1 166 ? 5.801   -10.042 29.443  1.00 18.09 ? 209 SER B N   1 
ATOM   5225 C  CA  . SER B 1 166 ? 6.318   -10.761 28.283  1.00 17.47 ? 209 SER B CA  1 
ATOM   5226 C  C   . SER B 1 166 ? 7.807   -10.506 28.085  1.00 17.62 ? 209 SER B C   1 
ATOM   5227 O  O   . SER B 1 166 ? 8.596   -11.459 28.112  1.00 17.93 ? 209 SER B O   1 
ATOM   5228 C  CB  . SER B 1 166 ? 5.519   -10.410 27.024  1.00 17.20 ? 209 SER B CB  1 
ATOM   5229 O  OG  . SER B 1 166 ? 4.131   -10.489 27.289  1.00 15.56 ? 209 SER B OG  1 
ATOM   5230 N  N   . ILE B 1 167 ? 8.202   -9.238  27.921  1.00 16.96 ? 210 ILE B N   1 
ATOM   5231 C  CA  . ILE B 1 167 ? 9.628   -8.931  27.726  1.00 16.51 ? 210 ILE B CA  1 
ATOM   5232 C  C   . ILE B 1 167 ? 10.505  -9.402  28.896  1.00 16.72 ? 210 ILE B C   1 
ATOM   5233 O  O   . ILE B 1 167 ? 11.598  -9.923  28.665  1.00 17.41 ? 210 ILE B O   1 
ATOM   5234 C  CB  . ILE B 1 167 ? 9.908   -7.426  27.393  1.00 16.42 ? 210 ILE B CB  1 
ATOM   5235 C  CG1 . ILE B 1 167 ? 11.347  -7.223  26.914  1.00 15.62 ? 210 ILE B CG1 1 
ATOM   5236 C  CG2 . ILE B 1 167 ? 9.666   -6.526  28.595  1.00 15.29 ? 210 ILE B CG2 1 
ATOM   5237 C  CD1 . ILE B 1 167 ? 11.687  -7.924  25.608  1.00 15.03 ? 210 ILE B CD1 1 
ATOM   5238 N  N   . THR B 1 168 ? 10.029  -9.228  30.131  1.00 16.56 ? 211 THR B N   1 
ATOM   5239 C  CA  . THR B 1 168 ? 10.791  -9.628  31.317  1.00 16.82 ? 211 THR B CA  1 
ATOM   5240 C  C   . THR B 1 168 ? 10.850  -11.143 31.410  1.00 17.16 ? 211 THR B C   1 
ATOM   5241 O  O   . THR B 1 168 ? 11.821  -11.700 31.884  1.00 16.96 ? 211 THR B O   1 
ATOM   5242 C  CB  . THR B 1 168 ? 10.193  -9.093  32.649  1.00 16.82 ? 211 THR B CB  1 
ATOM   5243 O  OG1 . THR B 1 168 ? 8.785   -9.360  32.694  1.00 16.03 ? 211 THR B OG1 1 
ATOM   5244 C  CG2 . THR B 1 168 ? 10.447  -7.604  32.824  1.00 16.17 ? 211 THR B CG2 1 
ATOM   5245 N  N   . ASN B 1 169 ? 9.806   -11.809 30.946  1.00 18.02 ? 212 ASN B N   1 
ATOM   5246 C  CA  . ASN B 1 169 ? 9.798   -13.255 30.985  1.00 18.62 ? 212 ASN B CA  1 
ATOM   5247 C  C   . ASN B 1 169 ? 10.838  -13.859 30.047  1.00 19.09 ? 212 ASN B C   1 
ATOM   5248 O  O   . ASN B 1 169 ? 11.508  -14.808 30.433  1.00 18.45 ? 212 ASN B O   1 
ATOM   5249 C  CB  . ASN B 1 169 ? 8.409   -13.815 30.702  1.00 18.59 ? 212 ASN B CB  1 
ATOM   5250 C  CG  . ASN B 1 169 ? 8.185   -15.167 31.352  1.00 19.12 ? 212 ASN B CG  1 
ATOM   5251 O  OD1 . ASN B 1 169 ? 8.727   -15.466 32.425  1.00 17.96 ? 212 ASN B OD1 1 
ATOM   5252 N  ND2 . ASN B 1 169 ? 7.370   -15.992 30.706  1.00 20.29 ? 212 ASN B ND2 1 
ATOM   5253 N  N   . VAL B 1 170 ? 11.003  -13.296 28.844  1.00 19.73 ? 213 VAL B N   1 
ATOM   5254 C  CA  . VAL B 1 170 ? 12.013  -13.828 27.905  1.00 20.64 ? 213 VAL B CA  1 
ATOM   5255 C  C   . VAL B 1 170 ? 13.448  -13.457 28.301  1.00 21.24 ? 213 VAL B C   1 
ATOM   5256 O  O   . VAL B 1 170 ? 14.380  -14.219 28.047  1.00 21.69 ? 213 VAL B O   1 
ATOM   5257 C  CB  . VAL B 1 170 ? 11.741  -13.484 26.400  1.00 20.50 ? 213 VAL B CB  1 
ATOM   5258 C  CG1 . VAL B 1 170 ? 10.562  -14.266 25.875  1.00 20.93 ? 213 VAL B CG1 1 
ATOM   5259 C  CG2 . VAL B 1 170 ? 11.502  -11.999 26.192  1.00 21.25 ? 213 VAL B CG2 1 
ATOM   5260 N  N   . ILE B 1 171 ? 13.615  -12.299 28.938  1.00 21.77 ? 214 ILE B N   1 
ATOM   5261 C  CA  . ILE B 1 171 ? 14.936  -11.835 29.364  1.00 22.23 ? 214 ILE B CA  1 
ATOM   5262 C  C   . ILE B 1 171 ? 15.395  -12.551 30.652  1.00 22.54 ? 214 ILE B C   1 
ATOM   5263 O  O   . ILE B 1 171 ? 16.511  -13.080 30.727  1.00 22.50 ? 214 ILE B O   1 
ATOM   5264 C  CB  . ILE B 1 171 ? 14.962  -10.274 29.537  1.00 22.42 ? 214 ILE B CB  1 
ATOM   5265 C  CG1 . ILE B 1 171 ? 14.857  -9.574  28.172  1.00 22.45 ? 214 ILE B CG1 1 
ATOM   5266 C  CG2 . ILE B 1 171 ? 16.222  -9.819  30.248  1.00 22.05 ? 214 ILE B CG2 1 
ATOM   5267 C  CD1 . ILE B 1 171 ? 14.758  -8.079  28.257  1.00 22.31 ? 214 ILE B CD1 1 
ATOM   5268 N  N   . PHE B 1 172 ? 14.519  -12.578 31.647  1.00 22.49 ? 215 PHE B N   1 
ATOM   5269 C  CA  . PHE B 1 172 ? 14.874  -13.080 32.953  1.00 22.92 ? 215 PHE B CA  1 
ATOM   5270 C  C   . PHE B 1 172 ? 14.412  -14.510 33.229  1.00 22.87 ? 215 PHE B C   1 
ATOM   5271 O  O   . PHE B 1 172 ? 14.844  -15.108 34.198  1.00 22.61 ? 215 PHE B O   1 
ATOM   5272 C  CB  . PHE B 1 172 ? 14.356  -12.115 34.034  1.00 23.21 ? 215 PHE B CB  1 
ATOM   5273 C  CG  . PHE B 1 172 ? 14.926  -10.722 33.919  1.00 25.00 ? 215 PHE B CG  1 
ATOM   5274 C  CD1 . PHE B 1 172 ? 14.112  -9.647  33.563  1.00 24.97 ? 215 PHE B CD1 1 
ATOM   5275 C  CD2 . PHE B 1 172 ? 16.291  -10.490 34.140  1.00 25.78 ? 215 PHE B CD2 1 
ATOM   5276 C  CE1 . PHE B 1 172 ? 14.644  -8.358  33.448  1.00 25.83 ? 215 PHE B CE1 1 
ATOM   5277 C  CE2 . PHE B 1 172 ? 16.830  -9.208  34.019  1.00 25.57 ? 215 PHE B CE2 1 
ATOM   5278 C  CZ  . PHE B 1 172 ? 16.004  -8.137  33.675  1.00 25.90 ? 215 PHE B CZ  1 
ATOM   5279 N  N   . GLY B 1 173 ? 13.535  -15.058 32.390  1.00 23.24 ? 216 GLY B N   1 
ATOM   5280 C  CA  . GLY B 1 173 ? 12.933  -16.370 32.659  1.00 23.65 ? 216 GLY B CA  1 
ATOM   5281 C  C   . GLY B 1 173 ? 12.212  -16.449 33.997  1.00 24.35 ? 216 GLY B C   1 
ATOM   5282 O  O   . GLY B 1 173 ? 12.156  -17.511 34.605  1.00 24.33 ? 216 GLY B O   1 
ATOM   5283 N  N   . GLU B 1 174 ? 11.680  -15.320 34.466  1.00 24.97 ? 217 GLU B N   1 
ATOM   5284 C  CA  . GLU B 1 174 ? 10.971  -15.265 35.737  1.00 26.33 ? 217 GLU B CA  1 
ATOM   5285 C  C   . GLU B 1 174 ? 9.719   -14.419 35.583  1.00 26.44 ? 217 GLU B C   1 
ATOM   5286 O  O   . GLU B 1 174 ? 9.717   -13.424 34.852  1.00 27.09 ? 217 GLU B O   1 
ATOM   5287 C  CB  . GLU B 1 174 ? 11.843  -14.664 36.847  1.00 26.56 ? 217 GLU B CB  1 
ATOM   5288 C  CG  . GLU B 1 174 ? 13.199  -15.346 37.040  1.00 30.56 ? 217 GLU B CG  1 
ATOM   5289 C  CD  . GLU B 1 174 ? 13.949  -14.899 38.309  1.00 35.16 ? 217 GLU B CD  1 
ATOM   5290 O  OE1 . GLU B 1 174 ? 13.453  -13.995 39.045  1.00 36.32 ? 217 GLU B OE1 1 
ATOM   5291 O  OE2 . GLU B 1 174 ? 15.041  -15.471 38.561  1.00 35.78 ? 217 GLU B OE2 1 
ATOM   5292 N  N   . ARG B 1 175 ? 8.659   -14.798 36.289  1.00 26.09 ? 218 ARG B N   1 
ATOM   5293 C  CA  . ARG B 1 175 ? 7.419   -14.051 36.237  1.00 25.68 ? 218 ARG B CA  1 
ATOM   5294 C  C   . ARG B 1 175 ? 7.476   -12.903 37.231  1.00 26.16 ? 218 ARG B C   1 
ATOM   5295 O  O   . ARG B 1 175 ? 7.872   -13.105 38.371  1.00 26.68 ? 218 ARG B O   1 
ATOM   5296 C  CB  . ARG B 1 175 ? 6.215   -14.975 36.471  1.00 24.94 ? 218 ARG B CB  1 
ATOM   5297 C  CG  . ARG B 1 175 ? 5.970   -15.958 35.302  1.00 22.90 ? 218 ARG B CG  1 
ATOM   5298 C  CD  . ARG B 1 175 ? 5.639   -15.256 33.943  1.00 19.38 ? 218 ARG B CD  1 
ATOM   5299 N  NE  . ARG B 1 175 ? 4.374   -14.530 34.015  1.00 17.58 ? 218 ARG B NE  1 
ATOM   5300 C  CZ  . ARG B 1 175 ? 3.172   -15.073 33.819  1.00 16.40 ? 218 ARG B CZ  1 
ATOM   5301 N  NH1 . ARG B 1 175 ? 3.052   -16.361 33.494  1.00 15.55 ? 218 ARG B NH1 1 
ATOM   5302 N  NH2 . ARG B 1 175 ? 2.086   -14.329 33.951  1.00 13.10 ? 218 ARG B NH2 1 
ATOM   5303 N  N   . GLN B 1 176 ? 7.112   -11.697 36.788  1.00 26.24 ? 219 GLN B N   1 
ATOM   5304 C  CA  . GLN B 1 176 ? 7.131   -10.510 37.648  1.00 26.08 ? 219 GLN B CA  1 
ATOM   5305 C  C   . GLN B 1 176 ? 5.806   -10.327 38.381  1.00 25.90 ? 219 GLN B C   1 
ATOM   5306 O  O   . GLN B 1 176 ? 5.690   -9.492  39.276  1.00 25.66 ? 219 GLN B O   1 
ATOM   5307 C  CB  . GLN B 1 176 ? 7.437   -9.257  36.824  1.00 26.30 ? 219 GLN B CB  1 
ATOM   5308 C  CG  . GLN B 1 176 ? 8.717   -9.338  36.022  1.00 27.48 ? 219 GLN B CG  1 
ATOM   5309 C  CD  . GLN B 1 176 ? 9.940   -9.476  36.898  1.00 29.41 ? 219 GLN B CD  1 
ATOM   5310 O  OE1 . GLN B 1 176 ? 10.161  -8.658  37.791  1.00 30.72 ? 219 GLN B OE1 1 
ATOM   5311 N  NE2 . GLN B 1 176 ? 10.749  -10.513 36.649  1.00 29.92 ? 219 GLN B NE2 1 
ATOM   5312 N  N   . GLY B 1 177 ? 4.805   -11.098 37.970  1.00 26.05 ? 220 GLY B N   1 
ATOM   5313 C  CA  . GLY B 1 177 ? 3.484   -11.089 38.588  1.00 25.98 ? 220 GLY B CA  1 
ATOM   5314 C  C   . GLY B 1 177 ? 2.625   -9.882  38.273  1.00 26.25 ? 220 GLY B C   1 
ATOM   5315 O  O   . GLY B 1 177 ? 1.792   -9.505  39.087  1.00 26.32 ? 220 GLY B O   1 
ATOM   5316 N  N   . MET B 1 178 ? 2.791   -9.284  37.092  1.00 26.62 ? 221 MET B N   1 
ATOM   5317 C  CA  . MET B 1 178 ? 2.035   -8.066  36.759  1.00 26.97 ? 221 MET B CA  1 
ATOM   5318 C  C   . MET B 1 178 ? 0.613   -8.325  36.220  1.00 27.45 ? 221 MET B C   1 
ATOM   5319 O  O   . MET B 1 178 ? -0.162  -7.390  36.028  1.00 27.24 ? 221 MET B O   1 
ATOM   5320 C  CB  . MET B 1 178 ? 2.829   -7.145  35.822  1.00 27.03 ? 221 MET B CB  1 
ATOM   5321 C  CG  . MET B 1 178 ? 4.209   -6.725  36.340  1.00 26.63 ? 221 MET B CG  1 
ATOM   5322 S  SD  . MET B 1 178 ? 4.146   -5.953  37.977  1.00 27.35 ? 221 MET B SD  1 
ATOM   5323 C  CE  . MET B 1 178 ? 3.377   -4.362  37.606  1.00 24.21 ? 221 MET B CE  1 
ATOM   5324 N  N   . LEU B 1 179 ? 0.266   -9.591  35.995  1.00 28.23 ? 222 LEU B N   1 
ATOM   5325 C  CA  . LEU B 1 179 ? -1.096  -9.940  35.581  1.00 28.84 ? 222 LEU B CA  1 
ATOM   5326 C  C   . LEU B 1 179 ? -1.952  -10.460 36.738  1.00 30.06 ? 222 LEU B C   1 
ATOM   5327 O  O   . LEU B 1 179 ? -3.105  -10.849 36.549  1.00 30.17 ? 222 LEU B O   1 
ATOM   5328 C  CB  . LEU B 1 179 ? -1.089  -10.892 34.376  1.00 28.11 ? 222 LEU B CB  1 
ATOM   5329 C  CG  . LEU B 1 179 ? -0.606  -10.252 33.066  1.00 27.08 ? 222 LEU B CG  1 
ATOM   5330 C  CD1 . LEU B 1 179 ? -0.737  -11.243 31.933  1.00 24.78 ? 222 LEU B CD1 1 
ATOM   5331 C  CD2 . LEU B 1 179 ? -1.351  -8.950  32.731  1.00 24.59 ? 222 LEU B CD2 1 
ATOM   5332 N  N   . GLU B 1 180 ? -1.392  -10.427 37.945  1.00 31.70 ? 223 GLU B N   1 
ATOM   5333 C  CA  . GLU B 1 180 ? -2.150  -10.773 39.147  1.00 33.44 ? 223 GLU B CA  1 
ATOM   5334 C  C   . GLU B 1 180 ? -2.874  -9.591  39.768  1.00 34.01 ? 223 GLU B C   1 
ATOM   5335 O  O   . GLU B 1 180 ? -2.618  -8.444  39.399  1.00 34.32 ? 223 GLU B O   1 
ATOM   5336 C  CB  . GLU B 1 180 ? -1.272  -11.505 40.151  1.00 33.52 ? 223 GLU B CB  1 
ATOM   5337 C  CG  . GLU B 1 180 ? -1.466  -13.005 40.017  1.00 36.55 ? 223 GLU B CG  1 
ATOM   5338 C  CD  . GLU B 1 180 ? -0.178  -13.781 40.060  1.00 40.05 ? 223 GLU B CD  1 
ATOM   5339 O  OE1 . GLU B 1 180 ? 0.855   -13.209 40.478  1.00 42.31 ? 223 GLU B OE1 1 
ATOM   5340 O  OE2 . GLU B 1 180 ? -0.202  -14.974 39.677  1.00 41.53 ? 223 GLU B OE2 1 
ATOM   5341 N  N   . GLU B 1 181 ? -3.792  -9.874  40.691  1.00 34.88 ? 224 GLU B N   1 
ATOM   5342 C  CA  . GLU B 1 181 ? -4.691  -8.847  41.224  1.00 35.68 ? 224 GLU B CA  1 
ATOM   5343 C  C   . GLU B 1 181 ? -3.966  -7.781  42.028  1.00 35.49 ? 224 GLU B C   1 
ATOM   5344 O  O   . GLU B 1 181 ? -4.298  -6.606  41.929  1.00 36.02 ? 224 GLU B O   1 
ATOM   5345 C  CB  . GLU B 1 181 ? -5.817  -9.462  42.055  1.00 35.91 ? 224 GLU B CB  1 
ATOM   5346 C  CG  . GLU B 1 181 ? -6.847  -10.172 41.211  1.00 39.10 ? 224 GLU B CG  1 
ATOM   5347 C  CD  . GLU B 1 181 ? -8.221  -10.230 41.863  1.00 42.77 ? 224 GLU B CD  1 
ATOM   5348 O  OE1 . GLU B 1 181 ? -8.742  -9.158  42.254  1.00 43.94 ? 224 GLU B OE1 1 
ATOM   5349 O  OE2 . GLU B 1 181 ? -8.784  -11.348 41.965  1.00 43.73 ? 224 GLU B OE2 1 
ATOM   5350 N  N   . VAL B 1 182 ? -2.994  -8.199  42.830  1.00 35.41 ? 225 VAL B N   1 
ATOM   5351 C  CA  . VAL B 1 182 ? -2.149  -7.275  43.569  1.00 35.17 ? 225 VAL B CA  1 
ATOM   5352 C  C   . VAL B 1 182 ? -0.772  -7.281  42.920  1.00 34.81 ? 225 VAL B C   1 
ATOM   5353 O  O   . VAL B 1 182 ? -0.130  -8.330  42.782  1.00 34.76 ? 225 VAL B O   1 
ATOM   5354 C  CB  . VAL B 1 182 ? -2.088  -7.612  45.083  1.00 35.32 ? 225 VAL B CB  1 
ATOM   5355 C  CG1 . VAL B 1 182 ? -0.919  -6.896  45.760  1.00 35.26 ? 225 VAL B CG1 1 
ATOM   5356 C  CG2 . VAL B 1 182 ? -3.410  -7.234  45.755  1.00 35.44 ? 225 VAL B CG2 1 
ATOM   5357 N  N   . VAL B 1 183 ? -0.341  -6.088  42.530  1.00 34.12 ? 226 VAL B N   1 
ATOM   5358 C  CA  . VAL B 1 183 ? 0.768   -5.907  41.603  1.00 33.37 ? 226 VAL B CA  1 
ATOM   5359 C  C   . VAL B 1 183 ? 1.983   -5.310  42.304  1.00 32.76 ? 226 VAL B C   1 
ATOM   5360 O  O   . VAL B 1 183 ? 1.842   -4.593  43.294  1.00 32.47 ? 226 VAL B O   1 
ATOM   5361 C  CB  . VAL B 1 183 ? 0.286   -5.063  40.371  1.00 33.56 ? 226 VAL B CB  1 
ATOM   5362 C  CG1 . VAL B 1 183 ? 1.160   -3.821  40.098  1.00 33.14 ? 226 VAL B CG1 1 
ATOM   5363 C  CG2 . VAL B 1 183 ? 0.098   -5.967  39.142  1.00 33.09 ? 226 VAL B CG2 1 
ATOM   5364 N  N   . ASN B 1 184 ? 3.172   -5.641  41.808  1.00 31.94 ? 227 ASN B N   1 
ATOM   5365 C  CA  . ASN B 1 184 ? 4.391   -5.011  42.279  1.00 31.35 ? 227 ASN B CA  1 
ATOM   5366 C  C   . ASN B 1 184 ? 4.384   -3.512  41.922  1.00 30.85 ? 227 ASN B C   1 
ATOM   5367 O  O   . ASN B 1 184 ? 4.545   -3.157  40.753  1.00 30.75 ? 227 ASN B O   1 
ATOM   5368 C  CB  . ASN B 1 184 ? 5.599   -5.705  41.670  1.00 31.17 ? 227 ASN B CB  1 
ATOM   5369 C  CG  . ASN B 1 184 ? 6.887   -5.311  42.341  1.00 32.92 ? 227 ASN B CG  1 
ATOM   5370 O  OD1 . ASN B 1 184 ? 7.004   -4.222  42.905  1.00 34.62 ? 227 ASN B OD1 1 
ATOM   5371 N  ND2 . ASN B 1 184 ? 7.871   -6.200  42.290  1.00 34.92 ? 227 ASN B ND2 1 
ATOM   5372 N  N   . PRO B 1 185 ? 4.205   -2.629  42.930  1.00 30.33 ? 228 PRO B N   1 
ATOM   5373 C  CA  . PRO B 1 185 ? 4.061   -1.196  42.641  1.00 29.82 ? 228 PRO B CA  1 
ATOM   5374 C  C   . PRO B 1 185 ? 5.351   -0.552  42.102  1.00 29.25 ? 228 PRO B C   1 
ATOM   5375 O  O   . PRO B 1 185 ? 5.285   0.424   41.358  1.00 28.79 ? 228 PRO B O   1 
ATOM   5376 C  CB  . PRO B 1 185 ? 3.660   -0.604  43.999  1.00 29.95 ? 228 PRO B CB  1 
ATOM   5377 C  CG  . PRO B 1 185 ? 4.302   -1.518  45.000  1.00 30.25 ? 228 PRO B CG  1 
ATOM   5378 C  CD  . PRO B 1 185 ? 4.291   -2.896  44.382  1.00 30.18 ? 228 PRO B CD  1 
ATOM   5379 N  N   . GLU B 1 186 ? 6.503   -1.114  42.455  1.00 29.07 ? 229 GLU B N   1 
ATOM   5380 C  CA  . GLU B 1 186 ? 7.772   -0.663  41.898  1.00 29.28 ? 229 GLU B CA  1 
ATOM   5381 C  C   . GLU B 1 186 ? 7.932   -1.076  40.439  1.00 28.63 ? 229 GLU B C   1 
ATOM   5382 O  O   . GLU B 1 186 ? 8.580   -0.370  39.668  1.00 28.90 ? 229 GLU B O   1 
ATOM   5383 C  CB  . GLU B 1 186 ? 8.977   -1.120  42.742  1.00 29.51 ? 229 GLU B CB  1 
ATOM   5384 C  CG  . GLU B 1 186 ? 9.073   -0.444  44.128  1.00 31.92 ? 229 GLU B CG  1 
ATOM   5385 C  CD  . GLU B 1 186 ? 9.061   1.104   44.070  1.00 35.08 ? 229 GLU B CD  1 
ATOM   5386 O  OE1 . GLU B 1 186 ? 9.826   1.694   43.270  1.00 36.66 ? 229 GLU B OE1 1 
ATOM   5387 O  OE2 . GLU B 1 186 ? 8.291   1.732   44.832  1.00 35.27 ? 229 GLU B OE2 1 
ATOM   5388 N  N   . ALA B 1 187 ? 7.348   -2.208  40.047  1.00 27.85 ? 230 ALA B N   1 
ATOM   5389 C  CA  . ALA B 1 187 ? 7.374   -2.599  38.633  1.00 26.50 ? 230 ALA B CA  1 
ATOM   5390 C  C   . ALA B 1 187 ? 6.436   -1.695  37.818  1.00 25.86 ? 230 ALA B C   1 
ATOM   5391 O  O   . ALA B 1 187 ? 6.750   -1.296  36.691  1.00 25.15 ? 230 ALA B O   1 
ATOM   5392 C  CB  . ALA B 1 187 ? 7.020   -4.057  38.470  1.00 26.50 ? 230 ALA B CB  1 
ATOM   5393 N  N   . GLN B 1 188 ? 5.297   -1.347  38.405  1.00 25.21 ? 231 GLN B N   1 
ATOM   5394 C  CA  . GLN B 1 188 ? 4.396   -0.376  37.792  1.00 25.16 ? 231 GLN B CA  1 
ATOM   5395 C  C   . GLN B 1 188 ? 5.082   0.988   37.578  1.00 25.53 ? 231 GLN B C   1 
ATOM   5396 O  O   . GLN B 1 188 ? 4.848   1.662   36.562  1.00 25.71 ? 231 GLN B O   1 
ATOM   5397 C  CB  . GLN B 1 188 ? 3.130   -0.218  38.633  1.00 24.69 ? 231 GLN B CB  1 
ATOM   5398 C  CG  . GLN B 1 188 ? 2.012   0.565   37.955  1.00 23.56 ? 231 GLN B CG  1 
ATOM   5399 C  CD  . GLN B 1 188 ? 1.470   -0.129  36.716  1.00 22.32 ? 231 GLN B CD  1 
ATOM   5400 O  OE1 . GLN B 1 188 ? 0.845   -1.193  36.804  1.00 22.15 ? 231 GLN B OE1 1 
ATOM   5401 N  NE2 . GLN B 1 188 ? 1.692   0.482   35.555  1.00 20.74 ? 231 GLN B NE2 1 
ATOM   5402 N  N   . ARG B 1 189 ? 5.931   1.377   38.532  1.00 25.55 ? 232 ARG B N   1 
ATOM   5403 C  CA  . ARG B 1 189 ? 6.632   2.658   38.484  1.00 25.63 ? 232 ARG B CA  1 
ATOM   5404 C  C   . ARG B 1 189 ? 7.568   2.664   37.277  1.00 24.96 ? 232 ARG B C   1 
ATOM   5405 O  O   . ARG B 1 189 ? 7.735   3.695   36.611  1.00 24.91 ? 232 ARG B O   1 
ATOM   5406 C  CB  . ARG B 1 189 ? 7.404   2.897   39.787  1.00 26.03 ? 232 ARG B CB  1 
ATOM   5407 C  CG  . ARG B 1 189 ? 7.151   4.268   40.429  1.00 29.26 ? 232 ARG B CG  1 
ATOM   5408 C  CD  . ARG B 1 189 ? 7.808   4.434   41.827  1.00 33.54 ? 232 ARG B CD  1 
ATOM   5409 N  NE  . ARG B 1 189 ? 9.281   4.370   41.796  1.00 36.16 ? 232 ARG B NE  1 
ATOM   5410 C  CZ  . ARG B 1 189 ? 10.094  5.372   41.447  1.00 37.16 ? 232 ARG B CZ  1 
ATOM   5411 N  NH1 . ARG B 1 189 ? 9.611   6.557   41.082  1.00 37.95 ? 232 ARG B NH1 1 
ATOM   5412 N  NH2 . ARG B 1 189 ? 11.406  5.185   41.458  1.00 37.75 ? 232 ARG B NH2 1 
ATOM   5413 N  N   . PHE B 1 190 ? 8.158   1.501   36.991  1.00 23.78 ? 233 PHE B N   1 
ATOM   5414 C  CA  . PHE B 1 190 ? 9.008   1.329   35.811  1.00 23.21 ? 233 PHE B CA  1 
ATOM   5415 C  C   . PHE B 1 190 ? 8.198   1.456   34.501  1.00 22.25 ? 233 PHE B C   1 
ATOM   5416 O  O   . PHE B 1 190 ? 8.600   2.167   33.583  1.00 21.88 ? 233 PHE B O   1 
ATOM   5417 C  CB  . PHE B 1 190 ? 9.738   -0.019  35.885  1.00 23.52 ? 233 PHE B CB  1 
ATOM   5418 C  CG  . PHE B 1 190 ? 10.659  -0.289  34.719  1.00 24.93 ? 233 PHE B CG  1 
ATOM   5419 C  CD1 . PHE B 1 190 ? 11.950  0.216   34.702  1.00 25.53 ? 233 PHE B CD1 1 
ATOM   5420 C  CD2 . PHE B 1 190 ? 10.236  -1.058  33.644  1.00 27.54 ? 233 PHE B CD2 1 
ATOM   5421 C  CE1 . PHE B 1 190 ? 12.807  -0.041  33.648  1.00 25.95 ? 233 PHE B CE1 1 
ATOM   5422 C  CE2 . PHE B 1 190 ? 11.096  -1.316  32.572  1.00 28.54 ? 233 PHE B CE2 1 
ATOM   5423 C  CZ  . PHE B 1 190 ? 12.388  -0.799  32.582  1.00 27.11 ? 233 PHE B CZ  1 
ATOM   5424 N  N   . ILE B 1 191 ? 7.061   0.764   34.436  1.00 21.23 ? 234 ILE B N   1 
ATOM   5425 C  CA  . ILE B 1 191 ? 6.160   0.820   33.292  1.00 20.52 ? 234 ILE B CA  1 
ATOM   5426 C  C   . ILE B 1 191 ? 5.782   2.279   32.987  1.00 20.48 ? 234 ILE B C   1 
ATOM   5427 O  O   . ILE B 1 191 ? 5.877   2.723   31.839  1.00 20.28 ? 234 ILE B O   1 
ATOM   5428 C  CB  . ILE B 1 191 ? 4.883   -0.041  33.529  1.00 20.18 ? 234 ILE B CB  1 
ATOM   5429 C  CG1 . ILE B 1 191 ? 5.199   -1.529  33.406  1.00 19.79 ? 234 ILE B CG1 1 
ATOM   5430 C  CG2 . ILE B 1 191 ? 3.785   0.321   32.534  1.00 20.53 ? 234 ILE B CG2 1 
ATOM   5431 C  CD1 . ILE B 1 191 ? 4.198   -2.447  34.085  1.00 18.76 ? 234 ILE B CD1 1 
ATOM   5432 N  N   . ASP B 1 192 ? 5.368   3.004   34.029  1.00 20.14 ? 235 ASP B N   1 
ATOM   5433 C  CA  . ASP B 1 192 ? 4.968   4.405   33.924  1.00 20.03 ? 235 ASP B CA  1 
ATOM   5434 C  C   . ASP B 1 192 ? 6.119   5.296   33.475  1.00 19.23 ? 235 ASP B C   1 
ATOM   5435 O  O   . ASP B 1 192 ? 5.913   6.194   32.673  1.00 19.37 ? 235 ASP B O   1 
ATOM   5436 C  CB  . ASP B 1 192 ? 4.377   4.909   35.251  1.00 20.02 ? 235 ASP B CB  1 
ATOM   5437 C  CG  . ASP B 1 192 ? 3.080   4.175   35.654  1.00 22.71 ? 235 ASP B CG  1 
ATOM   5438 O  OD1 . ASP B 1 192 ? 2.516   3.366   34.871  1.00 21.64 ? 235 ASP B OD1 1 
ATOM   5439 O  OD2 . ASP B 1 192 ? 2.608   4.420   36.787  1.00 27.80 ? 235 ASP B OD2 1 
ATOM   5440 N  N   . ALA B 1 193 ? 7.326   5.028   33.964  1.00 18.89 ? 236 ALA B N   1 
ATOM   5441 C  CA  . ALA B 1 193 ? 8.498   5.803   33.566  1.00 18.88 ? 236 ALA B CA  1 
ATOM   5442 C  C   . ALA B 1 193 ? 8.733   5.715   32.063  1.00 19.16 ? 236 ALA B C   1 
ATOM   5443 O  O   . ALA B 1 193 ? 9.109   6.721   31.436  1.00 19.42 ? 236 ALA B O   1 
ATOM   5444 C  CB  . ALA B 1 193 ? 9.729   5.366   34.325  1.00 18.24 ? 236 ALA B CB  1 
ATOM   5445 N  N   . ILE B 1 194 ? 8.489   4.535   31.483  1.00 19.00 ? 237 ILE B N   1 
ATOM   5446 C  CA  . ILE B 1 194 ? 8.704   4.337   30.046  1.00 19.41 ? 237 ILE B CA  1 
ATOM   5447 C  C   . ILE B 1 194 ? 7.824   5.272   29.213  1.00 20.24 ? 237 ILE B C   1 
ATOM   5448 O  O   . ILE B 1 194 ? 8.314   5.941   28.298  1.00 20.21 ? 237 ILE B O   1 
ATOM   5449 C  CB  . ILE B 1 194 ? 8.532   2.855   29.601  1.00 19.36 ? 237 ILE B CB  1 
ATOM   5450 C  CG1 . ILE B 1 194 ? 9.726   2.027   30.090  1.00 18.21 ? 237 ILE B CG1 1 
ATOM   5451 C  CG2 . ILE B 1 194 ? 8.409   2.751   28.069  1.00 17.67 ? 237 ILE B CG2 1 
ATOM   5452 C  CD1 . ILE B 1 194 ? 9.367   0.642   30.484  1.00 17.19 ? 237 ILE B CD1 1 
ATOM   5453 N  N   . TYR B 1 195 ? 6.535   5.316   29.538  1.00 20.85 ? 238 TYR B N   1 
ATOM   5454 C  CA  . TYR B 1 195 ? 5.625   6.206   28.847  1.00 22.00 ? 238 TYR B CA  1 
ATOM   5455 C  C   . TYR B 1 195 ? 6.037   7.681   29.055  1.00 22.12 ? 238 TYR B C   1 
ATOM   5456 O  O   . TYR B 1 195 ? 6.025   8.473   28.101  1.00 21.65 ? 238 TYR B O   1 
ATOM   5457 C  CB  . TYR B 1 195 ? 4.167   5.926   29.259  1.00 22.55 ? 238 TYR B CB  1 
ATOM   5458 C  CG  . TYR B 1 195 ? 3.197   6.964   28.759  1.00 24.48 ? 238 TYR B CG  1 
ATOM   5459 C  CD1 . TYR B 1 195 ? 2.806   6.993   27.425  1.00 27.98 ? 238 TYR B CD1 1 
ATOM   5460 C  CD2 . TYR B 1 195 ? 2.697   7.943   29.615  1.00 25.75 ? 238 TYR B CD2 1 
ATOM   5461 C  CE1 . TYR B 1 195 ? 1.923   7.971   26.954  1.00 29.82 ? 238 TYR B CE1 1 
ATOM   5462 C  CE2 . TYR B 1 195 ? 1.823   8.921   29.165  1.00 27.21 ? 238 TYR B CE2 1 
ATOM   5463 C  CZ  . TYR B 1 195 ? 1.434   8.930   27.837  1.00 29.68 ? 238 TYR B CZ  1 
ATOM   5464 O  OH  . TYR B 1 195 ? 0.564   9.907   27.390  1.00 32.08 ? 238 TYR B OH  1 
ATOM   5465 N  N   . GLN B 1 196 ? 6.432   8.021   30.289  1.00 22.20 ? 239 GLN B N   1 
ATOM   5466 C  CA  . GLN B 1 196 ? 6.885   9.375   30.626  1.00 22.30 ? 239 GLN B CA  1 
ATOM   5467 C  C   . GLN B 1 196 ? 8.090   9.785   29.808  1.00 21.58 ? 239 GLN B C   1 
ATOM   5468 O  O   . GLN B 1 196 ? 8.152   10.906  29.303  1.00 21.55 ? 239 GLN B O   1 
ATOM   5469 C  CB  . GLN B 1 196 ? 7.212   9.509   32.116  1.00 22.56 ? 239 GLN B CB  1 
ATOM   5470 C  CG  . GLN B 1 196 ? 5.999   9.623   33.020  1.00 26.21 ? 239 GLN B CG  1 
ATOM   5471 C  CD  . GLN B 1 196 ? 5.042   10.735  32.576  1.00 31.51 ? 239 GLN B CD  1 
ATOM   5472 O  OE1 . GLN B 1 196 ? 5.459   11.887  32.316  1.00 32.19 ? 239 GLN B OE1 1 
ATOM   5473 N  NE2 . GLN B 1 196 ? 3.753   10.389  32.469  1.00 31.28 ? 239 GLN B NE2 1 
ATOM   5474 N  N   . MET B 1 197 ? 9.049   8.873   29.692  1.00 20.94 ? 240 MET B N   1 
ATOM   5475 C  CA  . MET B 1 197 ? 10.241  9.089   28.876  1.00 20.35 ? 240 MET B CA  1 
ATOM   5476 C  C   . MET B 1 197 ? 9.858   9.454   27.428  1.00 19.97 ? 240 MET B C   1 
ATOM   5477 O  O   . MET B 1 197 ? 10.392  10.410  26.876  1.00 19.98 ? 240 MET B O   1 
ATOM   5478 C  CB  . MET B 1 197 ? 11.114  7.840   28.916  1.00 20.04 ? 240 MET B CB  1 
ATOM   5479 C  CG  . MET B 1 197 ? 12.485  7.991   28.301  1.00 21.58 ? 240 MET B CG  1 
ATOM   5480 S  SD  . MET B 1 197 ? 12.526  7.848   26.498  1.00 21.41 ? 240 MET B SD  1 
ATOM   5481 C  CE  . MET B 1 197 ? 12.341  6.074   26.324  1.00 22.33 ? 240 MET B CE  1 
ATOM   5482 N  N   . PHE B 1 198 ? 8.919   8.713   26.836  1.00 19.15 ? 241 PHE B N   1 
ATOM   5483 C  CA  . PHE B 1 198 ? 8.469   8.987   25.476  1.00 18.73 ? 241 PHE B CA  1 
ATOM   5484 C  C   . PHE B 1 198 ? 7.720   10.312  25.378  1.00 18.94 ? 241 PHE B C   1 
ATOM   5485 O  O   . PHE B 1 198 ? 8.084   11.182  24.571  1.00 18.60 ? 241 PHE B O   1 
ATOM   5486 C  CB  . PHE B 1 198 ? 7.577   7.859   24.952  1.00 18.56 ? 241 PHE B CB  1 
ATOM   5487 C  CG  . PHE B 1 198 ? 8.329   6.628   24.533  1.00 17.45 ? 241 PHE B CG  1 
ATOM   5488 C  CD1 . PHE B 1 198 ? 7.932   5.367   24.991  1.00 16.41 ? 241 PHE B CD1 1 
ATOM   5489 C  CD2 . PHE B 1 198 ? 9.422   6.717   23.669  1.00 16.83 ? 241 PHE B CD2 1 
ATOM   5490 C  CE1 . PHE B 1 198 ? 8.615   4.216   24.598  1.00 16.22 ? 241 PHE B CE1 1 
ATOM   5491 C  CE2 . PHE B 1 198 ? 10.123  5.562   23.266  1.00 16.57 ? 241 PHE B CE2 1 
ATOM   5492 C  CZ  . PHE B 1 198 ? 9.724   4.315   23.732  1.00 15.67 ? 241 PHE B CZ  1 
ATOM   5493 N  N   . HIS B 1 199 ? 6.677   10.450  26.200  1.00 18.87 ? 242 HIS B N   1 
ATOM   5494 C  CA  . HIS B 1 199 ? 5.862   11.660  26.235  1.00 19.35 ? 242 HIS B CA  1 
ATOM   5495 C  C   . HIS B 1 199 ? 6.726   12.921  26.382  1.00 18.99 ? 242 HIS B C   1 
ATOM   5496 O  O   . HIS B 1 199 ? 6.607   13.845  25.570  1.00 19.34 ? 242 HIS B O   1 
ATOM   5497 C  CB  . HIS B 1 199 ? 4.789   11.577  27.329  1.00 19.40 ? 242 HIS B CB  1 
ATOM   5498 C  CG  . HIS B 1 199 ? 3.848   12.743  27.351  1.00 21.44 ? 242 HIS B CG  1 
ATOM   5499 N  ND1 . HIS B 1 199 ? 2.922   12.977  26.353  1.00 23.72 ? 242 HIS B ND1 1 
ATOM   5500 C  CD2 . HIS B 1 199 ? 3.668   13.730  28.262  1.00 22.09 ? 242 HIS B CD2 1 
ATOM   5501 C  CE1 . HIS B 1 199 ? 2.232   14.069  26.635  1.00 20.89 ? 242 HIS B CE1 1 
ATOM   5502 N  NE2 . HIS B 1 199 ? 2.661   14.541  27.790  1.00 21.69 ? 242 HIS B NE2 1 
ATOM   5503 N  N   . THR B 1 200 ? 7.620   12.939  27.375  1.00 18.48 ? 243 THR B N   1 
ATOM   5504 C  CA  . THR B 1 200 ? 8.478   14.120  27.619  1.00 17.77 ? 243 THR B CA  1 
ATOM   5505 C  C   . THR B 1 200 ? 9.556   14.338  26.550  1.00 17.55 ? 243 THR B C   1 
ATOM   5506 O  O   . THR B 1 200 ? 10.235  15.353  26.565  1.00 17.86 ? 243 THR B O   1 
ATOM   5507 C  CB  . THR B 1 200 ? 9.154   14.130  29.038  1.00 17.28 ? 243 THR B CB  1 
ATOM   5508 O  OG1 . THR B 1 200 ? 10.059  13.028  29.166  1.00 18.14 ? 243 THR B OG1 1 
ATOM   5509 C  CG2 . THR B 1 200 ? 8.135   14.083  30.144  1.00 16.62 ? 243 THR B CG2 1 
ATOM   5510 N  N   . SER B 1 201 ? 9.719   13.406  25.620  1.00 17.55 ? 244 SER B N   1 
ATOM   5511 C  CA  . SER B 1 201 ? 10.696  13.612  24.557  1.00 17.60 ? 244 SER B CA  1 
ATOM   5512 C  C   . SER B 1 201 ? 10.204  14.683  23.594  1.00 18.00 ? 244 SER B C   1 
ATOM   5513 O  O   . SER B 1 201 ? 10.998  15.455  23.063  1.00 18.03 ? 244 SER B O   1 
ATOM   5514 C  CB  . SER B 1 201 ? 10.946  12.336  23.772  1.00 17.11 ? 244 SER B CB  1 
ATOM   5515 O  OG  . SER B 1 201 ? 11.254  11.238  24.603  1.00 18.52 ? 244 SER B OG  1 
ATOM   5516 N  N   . VAL B 1 202 ? 8.885   14.731  23.388  1.00 18.48 ? 245 VAL B N   1 
ATOM   5517 C  CA  . VAL B 1 202 ? 8.301   15.464  22.267  1.00 18.52 ? 245 VAL B CA  1 
ATOM   5518 C  C   . VAL B 1 202 ? 8.663   16.952  22.291  1.00 18.97 ? 245 VAL B C   1 
ATOM   5519 O  O   . VAL B 1 202 ? 9.222   17.458  21.307  1.00 18.55 ? 245 VAL B O   1 
ATOM   5520 C  CB  . VAL B 1 202 ? 6.777   15.203  22.132  1.00 18.60 ? 245 VAL B CB  1 
ATOM   5521 C  CG1 . VAL B 1 202 ? 6.176   16.041  21.006  1.00 17.49 ? 245 VAL B CG1 1 
ATOM   5522 C  CG2 . VAL B 1 202 ? 6.518   13.709  21.888  1.00 18.18 ? 245 VAL B CG2 1 
ATOM   5523 N  N   . PRO B 1 203 ? 8.402   17.645  23.422  1.00 19.53 ? 246 PRO B N   1 
ATOM   5524 C  CA  . PRO B 1 203 ? 8.705   19.084  23.440  1.00 19.94 ? 246 PRO B CA  1 
ATOM   5525 C  C   . PRO B 1 203 ? 10.175  19.410  23.144  1.00 20.31 ? 246 PRO B C   1 
ATOM   5526 O  O   . PRO B 1 203 ? 10.490  20.536  22.829  1.00 20.36 ? 246 PRO B O   1 
ATOM   5527 C  CB  . PRO B 1 203 ? 8.331   19.507  24.872  1.00 19.70 ? 246 PRO B CB  1 
ATOM   5528 C  CG  . PRO B 1 203 ? 7.338   18.473  25.327  1.00 19.76 ? 246 PRO B CG  1 
ATOM   5529 C  CD  . PRO B 1 203 ? 7.898   17.194  24.736  1.00 19.53 ? 246 PRO B CD  1 
ATOM   5530 N  N   . MET B 1 204 ? 11.061  18.430  23.212  1.00 21.02 ? 247 MET B N   1 
ATOM   5531 C  CA  . MET B 1 204 ? 12.470  18.713  23.025  1.00 22.02 ? 247 MET B CA  1 
ATOM   5532 C  C   . MET B 1 204 ? 12.997  18.250  21.663  1.00 22.91 ? 247 MET B C   1 
ATOM   5533 O  O   . MET B 1 204 ? 14.194  18.342  21.398  1.00 22.97 ? 247 MET B O   1 
ATOM   5534 C  CB  . MET B 1 204 ? 13.281  18.061  24.147  1.00 21.90 ? 247 MET B CB  1 
ATOM   5535 C  CG  . MET B 1 204 ? 12.976  18.584  25.555  1.00 21.63 ? 247 MET B CG  1 
ATOM   5536 S  SD  . MET B 1 204 ? 14.109  17.891  26.792  1.00 19.65 ? 247 MET B SD  1 
ATOM   5537 C  CE  . MET B 1 204 ? 13.486  16.204  26.873  1.00 20.26 ? 247 MET B CE  1 
ATOM   5538 N  N   . LEU B 1 205 ? 12.101  17.785  20.794  1.00 23.80 ? 248 LEU B N   1 
ATOM   5539 C  CA  . LEU B 1 205 ? 12.491  16.962  19.644  1.00 24.45 ? 248 LEU B CA  1 
ATOM   5540 C  C   . LEU B 1 205 ? 13.288  17.618  18.487  1.00 24.62 ? 248 LEU B C   1 
ATOM   5541 O  O   . LEU B 1 205 ? 14.135  16.956  17.856  1.00 25.26 ? 248 LEU B O   1 
ATOM   5542 C  CB  . LEU B 1 205 ? 11.271  16.219  19.100  1.00 24.80 ? 248 LEU B CB  1 
ATOM   5543 C  CG  . LEU B 1 205 ? 11.624  15.038  18.191  1.00 26.23 ? 248 LEU B CG  1 
ATOM   5544 C  CD1 . LEU B 1 205 ? 12.404  13.991  18.973  1.00 26.39 ? 248 LEU B CD1 1 
ATOM   5545 C  CD2 . LEU B 1 205 ? 10.386  14.447  17.514  1.00 26.62 ? 248 LEU B CD2 1 
ATOM   5546 N  N   . ASN B 1 206 ? 13.045  18.891  18.205  1.00 24.12 ? 249 ASN B N   1 
ATOM   5547 C  CA  . ASN B 1 206 ? 13.709  19.522  17.057  1.00 23.78 ? 249 ASN B CA  1 
ATOM   5548 C  C   . ASN B 1 206 ? 14.768  20.555  17.449  1.00 23.91 ? 249 ASN B C   1 
ATOM   5549 O  O   . ASN B 1 206 ? 15.145  21.425  16.648  1.00 24.14 ? 249 ASN B O   1 
ATOM   5550 C  CB  . ASN B 1 206 ? 12.667  20.136  16.126  1.00 23.45 ? 249 ASN B CB  1 
ATOM   5551 C  CG  . ASN B 1 206 ? 11.890  19.091  15.371  1.00 22.82 ? 249 ASN B CG  1 
ATOM   5552 O  OD1 . ASN B 1 206 ? 12.395  18.515  14.407  1.00 21.98 ? 249 ASN B OD1 1 
ATOM   5553 N  ND2 . ASN B 1 206 ? 10.653  18.834  15.801  1.00 20.44 ? 249 ASN B ND2 1 
ATOM   5554 N  N   . LEU B 1 207 ? 15.259  20.428  18.675  1.00 23.57 ? 250 LEU B N   1 
ATOM   5555 C  CA  . LEU B 1 207 ? 16.123  21.427  19.281  1.00 23.36 ? 250 LEU B CA  1 
ATOM   5556 C  C   . LEU B 1 207 ? 17.466  20.846  19.655  1.00 23.09 ? 250 LEU B C   1 
ATOM   5557 O  O   . LEU B 1 207 ? 17.536  19.703  20.092  1.00 22.97 ? 250 LEU B O   1 
ATOM   5558 C  CB  . LEU B 1 207 ? 15.455  21.999  20.536  1.00 23.06 ? 250 LEU B CB  1 
ATOM   5559 C  CG  . LEU B 1 207 ? 14.037  22.549  20.365  1.00 23.36 ? 250 LEU B CG  1 
ATOM   5560 C  CD1 . LEU B 1 207 ? 13.410  22.831  21.725  1.00 22.57 ? 250 LEU B CD1 1 
ATOM   5561 C  CD2 . LEU B 1 207 ? 14.005  23.776  19.463  1.00 22.11 ? 250 LEU B CD2 1 
ATOM   5562 N  N   . PRO B 1 208 ? 18.543  21.636  19.504  1.00 23.38 ? 251 PRO B N   1 
ATOM   5563 C  CA  . PRO B 1 208 ? 19.844  21.183  20.020  1.00 23.29 ? 251 PRO B CA  1 
ATOM   5564 C  C   . PRO B 1 208 ? 19.810  21.211  21.545  1.00 23.50 ? 251 PRO B C   1 
ATOM   5565 O  O   . PRO B 1 208 ? 18.972  21.919  22.114  1.00 23.09 ? 251 PRO B O   1 
ATOM   5566 C  CB  . PRO B 1 208 ? 20.828  22.209  19.455  1.00 23.17 ? 251 PRO B CB  1 
ATOM   5567 C  CG  . PRO B 1 208 ? 20.011  23.449  19.256  1.00 23.63 ? 251 PRO B CG  1 
ATOM   5568 C  CD  . PRO B 1 208 ? 18.620  22.979  18.892  1.00 23.37 ? 251 PRO B CD  1 
ATOM   5569 N  N   . PRO B 1 209 ? 20.671  20.413  22.210  1.00 24.21 ? 252 PRO B N   1 
ATOM   5570 C  CA  . PRO B 1 209 ? 20.633  20.366  23.678  1.00 24.74 ? 252 PRO B CA  1 
ATOM   5571 C  C   . PRO B 1 209 ? 20.824  21.717  24.362  1.00 25.45 ? 252 PRO B C   1 
ATOM   5572 O  O   . PRO B 1 209 ? 20.235  21.943  25.416  1.00 26.31 ? 252 PRO B O   1 
ATOM   5573 C  CB  . PRO B 1 209 ? 21.754  19.373  24.047  1.00 24.80 ? 252 PRO B CB  1 
ATOM   5574 C  CG  . PRO B 1 209 ? 22.498  19.084  22.759  1.00 24.30 ? 252 PRO B CG  1 
ATOM   5575 C  CD  . PRO B 1 209 ? 21.529  19.349  21.654  1.00 24.06 ? 252 PRO B CD  1 
ATOM   5576 N  N   . ASP B 1 210 ? 21.595  22.615  23.757  1.00 26.06 ? 253 ASP B N   1 
ATOM   5577 C  CA  . ASP B 1 210 ? 21.775  23.982  24.274  1.00 26.84 ? 253 ASP B CA  1 
ATOM   5578 C  C   . ASP B 1 210 ? 20.487  24.758  24.473  1.00 27.52 ? 253 ASP B C   1 
ATOM   5579 O  O   . ASP B 1 210 ? 20.396  25.572  25.390  1.00 27.77 ? 253 ASP B O   1 
ATOM   5580 C  CB  . ASP B 1 210 ? 22.686  24.805  23.357  1.00 26.73 ? 253 ASP B CB  1 
ATOM   5581 C  CG  . ASP B 1 210 ? 24.169  24.553  23.610  1.00 27.02 ? 253 ASP B CG  1 
ATOM   5582 O  OD1 . ASP B 1 210 ? 24.519  23.986  24.672  1.00 26.57 ? 253 ASP B OD1 1 
ATOM   5583 O  OD2 . ASP B 1 210 ? 24.987  24.935  22.740  1.00 28.06 ? 253 ASP B OD2 1 
ATOM   5584 N  N   . LEU B 1 211 ? 19.503  24.532  23.606  1.00 28.55 ? 254 LEU B N   1 
ATOM   5585 C  CA  . LEU B 1 211 ? 18.244  25.288  23.671  1.00 29.23 ? 254 LEU B CA  1 
ATOM   5586 C  C   . LEU B 1 211 ? 17.209  24.661  24.585  1.00 29.72 ? 254 LEU B C   1 
ATOM   5587 O  O   . LEU B 1 211 ? 16.408  25.377  25.199  1.00 30.03 ? 254 LEU B O   1 
ATOM   5588 C  CB  . LEU B 1 211 ? 17.654  25.553  22.276  1.00 29.17 ? 254 LEU B CB  1 
ATOM   5589 C  CG  . LEU B 1 211 ? 18.495  26.434  21.335  1.00 29.60 ? 254 LEU B CG  1 
ATOM   5590 C  CD1 . LEU B 1 211 ? 17.723  26.780  20.086  1.00 29.58 ? 254 LEU B CD1 1 
ATOM   5591 C  CD2 . LEU B 1 211 ? 18.987  27.711  22.019  1.00 29.34 ? 254 LEU B CD2 1 
ATOM   5592 N  N   . PHE B 1 212 ? 17.215  23.337  24.709  1.00 30.18 ? 255 PHE B N   1 
ATOM   5593 C  CA  . PHE B 1 212 ? 16.182  22.734  25.544  1.00 30.32 ? 255 PHE B CA  1 
ATOM   5594 C  C   . PHE B 1 212 ? 16.430  22.784  27.052  1.00 30.82 ? 255 PHE B C   1 
ATOM   5595 O  O   . PHE B 1 212 ? 15.480  22.838  27.843  1.00 31.69 ? 255 PHE B O   1 
ATOM   5596 C  CB  . PHE B 1 212 ? 15.629  21.386  25.008  1.00 29.96 ? 255 PHE B CB  1 
ATOM   5597 C  CG  . PHE B 1 212 ? 16.627  20.255  24.907  1.00 28.18 ? 255 PHE B CG  1 
ATOM   5598 C  CD1 . PHE B 1 212 ? 17.201  19.690  26.046  1.00 26.17 ? 255 PHE B CD1 1 
ATOM   5599 C  CD2 . PHE B 1 212 ? 16.907  19.682  23.662  1.00 26.98 ? 255 PHE B CD2 1 
ATOM   5600 C  CE1 . PHE B 1 212 ? 18.076  18.606  25.940  1.00 25.67 ? 255 PHE B CE1 1 
ATOM   5601 C  CE2 . PHE B 1 212 ? 17.775  18.596  23.542  1.00 25.84 ? 255 PHE B CE2 1 
ATOM   5602 C  CZ  . PHE B 1 212 ? 18.364  18.058  24.687  1.00 26.07 ? 255 PHE B CZ  1 
ATOM   5603 N  N   . ARG B 1 213 ? 17.688  22.861  27.457  1.00 31.21 ? 256 ARG B N   1 
ATOM   5604 C  CA  . ARG B 1 213 ? 17.998  23.128  28.875  1.00 31.52 ? 256 ARG B CA  1 
ATOM   5605 C  C   . ARG B 1 213 ? 17.415  24.467  29.361  1.00 30.78 ? 256 ARG B C   1 
ATOM   5606 O  O   . ARG B 1 213 ? 17.249  24.693  30.568  1.00 31.39 ? 256 ARG B O   1 
ATOM   5607 C  CB  . ARG B 1 213 ? 19.516  23.052  29.121  1.00 32.15 ? 256 ARG B CB  1 
ATOM   5608 C  CG  . ARG B 1 213 ? 20.115  21.685  28.707  1.00 35.16 ? 256 ARG B CG  1 
ATOM   5609 C  CD  . ARG B 1 213 ? 21.313  21.245  29.570  1.00 40.36 ? 256 ARG B CD  1 
ATOM   5610 N  NE  . ARG B 1 213 ? 21.749  19.875  29.249  1.00 42.92 ? 256 ARG B NE  1 
ATOM   5611 C  CZ  . ARG B 1 213 ? 22.665  19.554  28.329  1.00 43.76 ? 256 ARG B CZ  1 
ATOM   5612 N  NH1 . ARG B 1 213 ? 23.275  20.493  27.611  1.00 43.67 ? 256 ARG B NH1 1 
ATOM   5613 N  NH2 . ARG B 1 213 ? 22.974  18.281  28.126  1.00 44.17 ? 256 ARG B NH2 1 
ATOM   5614 N  N   . LEU B 1 214 ? 17.041  25.302  28.391  1.00 29.62 ? 257 LEU B N   1 
ATOM   5615 C  CA  . LEU B 1 214 ? 16.813  26.732  28.549  1.00 28.14 ? 257 LEU B CA  1 
ATOM   5616 C  C   . LEU B 1 214 ? 15.361  27.142  28.254  1.00 27.69 ? 257 LEU B C   1 
ATOM   5617 O  O   . LEU B 1 214 ? 14.836  28.077  28.864  1.00 27.56 ? 257 LEU B O   1 
ATOM   5618 C  CB  . LEU B 1 214 ? 17.764  27.450  27.579  1.00 27.95 ? 257 LEU B CB  1 
ATOM   5619 C  CG  . LEU B 1 214 ? 18.023  28.950  27.581  1.00 26.87 ? 257 LEU B CG  1 
ATOM   5620 C  CD1 . LEU B 1 214 ? 18.608  29.407  28.894  1.00 26.44 ? 257 LEU B CD1 1 
ATOM   5621 C  CD2 . LEU B 1 214 ? 18.974  29.273  26.457  1.00 25.00 ? 257 LEU B CD2 1 
ATOM   5622 N  N   . PHE B 1 215 ? 14.723  26.449  27.308  1.00 26.76 ? 258 PHE B N   1 
ATOM   5623 C  CA  . PHE B 1 215 ? 13.315  26.693  26.986  1.00 25.97 ? 258 PHE B CA  1 
ATOM   5624 C  C   . PHE B 1 215 ? 12.377  25.535  27.344  1.00 25.64 ? 258 PHE B C   1 
ATOM   5625 O  O   . PHE B 1 215 ? 11.164  25.692  27.324  1.00 25.40 ? 258 PHE B O   1 
ATOM   5626 C  CB  . PHE B 1 215 ? 13.165  27.068  25.514  1.00 25.72 ? 258 PHE B CB  1 
ATOM   5627 C  CG  . PHE B 1 215 ? 13.901  28.314  25.132  1.00 25.82 ? 258 PHE B CG  1 
ATOM   5628 C  CD1 . PHE B 1 215 ? 15.021  28.247  24.300  1.00 26.62 ? 258 PHE B CD1 1 
ATOM   5629 C  CD2 . PHE B 1 215 ? 13.488  29.555  25.610  1.00 24.85 ? 258 PHE B CD2 1 
ATOM   5630 C  CE1 . PHE B 1 215 ? 15.710  29.394  23.930  1.00 26.51 ? 258 PHE B CE1 1 
ATOM   5631 C  CE2 . PHE B 1 215 ? 14.167  30.717  25.254  1.00 25.88 ? 258 PHE B CE2 1 
ATOM   5632 C  CZ  . PHE B 1 215 ? 15.286  30.639  24.412  1.00 26.60 ? 258 PHE B CZ  1 
ATOM   5633 N  N   . ARG B 1 216 ? 12.948  24.378  27.671  1.00 25.64 ? 259 ARG B N   1 
ATOM   5634 C  CA  . ARG B 1 216 ? 12.174  23.193  28.020  1.00 25.62 ? 259 ARG B CA  1 
ATOM   5635 C  C   . ARG B 1 216 ? 12.692  22.635  29.334  1.00 25.89 ? 259 ARG B C   1 
ATOM   5636 O  O   . ARG B 1 216 ? 12.618  21.430  29.585  1.00 25.73 ? 259 ARG B O   1 
ATOM   5637 C  CB  . ARG B 1 216 ? 12.301  22.119  26.930  1.00 25.41 ? 259 ARG B CB  1 
ATOM   5638 C  CG  . ARG B 1 216 ? 11.844  22.528  25.530  1.00 24.56 ? 259 ARG B CG  1 
ATOM   5639 C  CD  . ARG B 1 216 ? 10.355  22.371  25.347  1.00 21.72 ? 259 ARG B CD  1 
ATOM   5640 N  NE  . ARG B 1 216 ? 9.717   23.669  25.224  1.00 24.14 ? 259 ARG B NE  1 
ATOM   5641 C  CZ  . ARG B 1 216 ? 9.260   24.181  24.087  1.00 24.17 ? 259 ARG B CZ  1 
ATOM   5642 N  NH1 . ARG B 1 216 ? 9.349   23.507  22.952  1.00 24.83 ? 259 ARG B NH1 1 
ATOM   5643 N  NH2 . ARG B 1 216 ? 8.705   25.377  24.088  1.00 25.20 ? 259 ARG B NH2 1 
ATOM   5644 N  N   . THR B 1 217 ? 13.216  23.521  30.173  1.00 26.30 ? 260 THR B N   1 
ATOM   5645 C  CA  . THR B 1 217 ? 13.814  23.144  31.463  1.00 26.43 ? 260 THR B CA  1 
ATOM   5646 C  C   . THR B 1 217 ? 12.958  22.163  32.276  1.00 26.23 ? 260 THR B C   1 
ATOM   5647 O  O   . THR B 1 217 ? 13.481  21.165  32.773  1.00 26.37 ? 260 THR B O   1 
ATOM   5648 C  CB  . THR B 1 217 ? 14.151  24.393  32.324  1.00 26.49 ? 260 THR B CB  1 
ATOM   5649 O  OG1 . THR B 1 217 ? 14.822  25.376  31.515  1.00 27.63 ? 260 THR B OG1 1 
ATOM   5650 C  CG2 . THR B 1 217 ? 15.048  24.006  33.489  1.00 26.43 ? 260 THR B CG2 1 
ATOM   5651 N  N   . LYS B 1 218 ? 11.659  22.445  32.405  1.00 25.89 ? 261 LYS B N   1 
ATOM   5652 C  CA  . LYS B 1 218 ? 10.737  21.565  33.129  1.00 26.03 ? 261 LYS B CA  1 
ATOM   5653 C  C   . LYS B 1 218 ? 10.573  20.168  32.466  1.00 25.83 ? 261 LYS B C   1 
ATOM   5654 O  O   . LYS B 1 218 ? 10.647  19.127  33.143  1.00 25.54 ? 261 LYS B O   1 
ATOM   5655 C  CB  . LYS B 1 218 ? 9.374   22.243  33.310  1.00 26.24 ? 261 LYS B CB  1 
ATOM   5656 C  CG  . LYS B 1 218 ? 8.430   21.476  34.234  1.00 28.58 ? 261 LYS B CG  1 
ATOM   5657 C  CD  . LYS B 1 218 ? 6.958   21.688  33.859  1.00 32.42 ? 261 LYS B CD  1 
ATOM   5658 C  CE  . LYS B 1 218 ? 5.982   20.988  34.846  1.00 33.57 ? 261 LYS B CE  1 
ATOM   5659 N  NZ  . LYS B 1 218 ? 6.142   19.499  34.890  1.00 33.83 ? 261 LYS B NZ  1 
ATOM   5660 N  N   . THR B 1 219 ? 10.359  20.152  31.146  1.00 25.24 ? 262 THR B N   1 
ATOM   5661 C  CA  . THR B 1 219 ? 10.237  18.902  30.392  1.00 24.48 ? 262 THR B CA  1 
ATOM   5662 C  C   . THR B 1 219 ? 11.496  18.047  30.541  1.00 24.15 ? 262 THR B C   1 
ATOM   5663 O  O   . THR B 1 219 ? 11.425  16.837  30.772  1.00 23.93 ? 262 THR B O   1 
ATOM   5664 C  CB  . THR B 1 219 ? 9.947   19.178  28.903  1.00 24.55 ? 262 THR B CB  1 
ATOM   5665 O  OG1 . THR B 1 219 ? 8.561   19.512  28.748  1.00 24.75 ? 262 THR B OG1 1 
ATOM   5666 C  CG2 . THR B 1 219 ? 10.258  17.952  28.048  1.00 24.02 ? 262 THR B CG2 1 
ATOM   5667 N  N   . TRP B 1 220 ? 12.640  18.707  30.426  1.00 23.61 ? 263 TRP B N   1 
ATOM   5668 C  CA  . TRP B 1 220 ? 13.921  18.069  30.520  1.00 23.55 ? 263 TRP B CA  1 
ATOM   5669 C  C   . TRP B 1 220 ? 14.130  17.452  31.900  1.00 24.00 ? 263 TRP B C   1 
ATOM   5670 O  O   . TRP B 1 220 ? 14.608  16.317  32.027  1.00 23.97 ? 263 TRP B O   1 
ATOM   5671 C  CB  . TRP B 1 220 ? 15.005  19.093  30.214  1.00 23.40 ? 263 TRP B CB  1 
ATOM   5672 C  CG  . TRP B 1 220 ? 16.366  18.634  30.565  1.00 22.98 ? 263 TRP B CG  1 
ATOM   5673 C  CD1 . TRP B 1 220 ? 17.129  19.072  31.603  1.00 21.86 ? 263 TRP B CD1 1 
ATOM   5674 C  CD2 . TRP B 1 220 ? 17.132  17.630  29.891  1.00 21.71 ? 263 TRP B CD2 1 
ATOM   5675 N  NE1 . TRP B 1 220 ? 18.326  18.406  31.617  1.00 22.02 ? 263 TRP B NE1 1 
ATOM   5676 C  CE2 . TRP B 1 220 ? 18.356  17.515  30.577  1.00 22.62 ? 263 TRP B CE2 1 
ATOM   5677 C  CE3 . TRP B 1 220 ? 16.902  16.817  28.776  1.00 21.87 ? 263 TRP B CE3 1 
ATOM   5678 C  CZ2 . TRP B 1 220 ? 19.364  16.619  30.179  1.00 23.56 ? 263 TRP B CZ2 1 
ATOM   5679 C  CZ3 . TRP B 1 220 ? 17.907  15.925  28.370  1.00 22.64 ? 263 TRP B CZ3 1 
ATOM   5680 C  CH2 . TRP B 1 220 ? 19.121  15.840  29.070  1.00 23.27 ? 263 TRP B CH2 1 
ATOM   5681 N  N   . LYS B 1 221 ? 13.764  18.207  32.928  1.00 24.07 ? 264 LYS B N   1 
ATOM   5682 C  CA  . LYS B 1 221 ? 13.882  17.750  34.292  1.00 24.10 ? 264 LYS B CA  1 
ATOM   5683 C  C   . LYS B 1 221 ? 13.113  16.425  34.421  1.00 23.26 ? 264 LYS B C   1 
ATOM   5684 O  O   . LYS B 1 221 ? 13.654  15.435  34.936  1.00 23.16 ? 264 LYS B O   1 
ATOM   5685 C  CB  . LYS B 1 221 ? 13.296  18.807  35.231  1.00 24.75 ? 264 LYS B CB  1 
ATOM   5686 C  CG  . LYS B 1 221 ? 14.055  19.039  36.505  1.00 27.07 ? 264 LYS B CG  1 
ATOM   5687 C  CD  . LYS B 1 221 ? 13.078  19.390  37.638  1.00 32.06 ? 264 LYS B CD  1 
ATOM   5688 C  CE  . LYS B 1 221 ? 13.743  19.274  39.013  1.00 33.77 ? 264 LYS B CE  1 
ATOM   5689 N  NZ  . LYS B 1 221 ? 12.755  19.276  40.127  1.00 35.29 ? 264 LYS B NZ  1 
ATOM   5690 N  N   . ASP B 1 222 ? 11.867  16.425  33.935  1.00 21.96 ? 265 ASP B N   1 
ATOM   5691 C  CA  . ASP B 1 222 ? 10.955  15.271  33.993  1.00 21.05 ? 265 ASP B CA  1 
ATOM   5692 C  C   . ASP B 1 222 ? 11.432  14.079  33.144  1.00 20.38 ? 265 ASP B C   1 
ATOM   5693 O  O   . ASP B 1 222 ? 11.265  12.909  33.511  1.00 20.43 ? 265 ASP B O   1 
ATOM   5694 C  CB  . ASP B 1 222 ? 9.559   15.687  33.508  1.00 21.31 ? 265 ASP B CB  1 
ATOM   5695 C  CG  . ASP B 1 222 ? 8.831   16.614  34.478  1.00 21.48 ? 265 ASP B CG  1 
ATOM   5696 O  OD1 . ASP B 1 222 ? 9.319   16.840  35.600  1.00 24.03 ? 265 ASP B OD1 1 
ATOM   5697 O  OD2 . ASP B 1 222 ? 7.745   17.114  34.123  1.00 21.31 ? 265 ASP B OD2 1 
ATOM   5698 N  N   . HIS B 1 223 ? 12.005  14.396  31.994  1.00 19.00 ? 266 HIS B N   1 
ATOM   5699 C  CA  . HIS B 1 223 ? 12.580  13.419  31.120  1.00 18.22 ? 266 HIS B CA  1 
ATOM   5700 C  C   . HIS B 1 223 ? 13.747  12.689  31.791  1.00 18.93 ? 266 HIS B C   1 
ATOM   5701 O  O   . HIS B 1 223 ? 13.844  11.451  31.697  1.00 19.35 ? 266 HIS B O   1 
ATOM   5702 C  CB  . HIS B 1 223 ? 13.032  14.120  29.852  1.00 17.72 ? 266 HIS B CB  1 
ATOM   5703 C  CG  . HIS B 1 223 ? 13.494  13.196  28.784  1.00 14.73 ? 266 HIS B CG  1 
ATOM   5704 N  ND1 . HIS B 1 223 ? 12.626  12.415  28.055  1.00 12.25 ? 266 HIS B ND1 1 
ATOM   5705 C  CD2 . HIS B 1 223 ? 14.733  12.948  28.298  1.00 12.62 ? 266 HIS B CD2 1 
ATOM   5706 C  CE1 . HIS B 1 223 ? 13.316  11.704  27.180  1.00 13.28 ? 266 HIS B CE1 1 
ATOM   5707 N  NE2 . HIS B 1 223 ? 14.596  12.015  27.300  1.00 13.14 ? 266 HIS B NE2 1 
ATOM   5708 N  N   . VAL B 1 224 ? 14.621  13.455  32.454  1.00 18.85 ? 267 VAL B N   1 
ATOM   5709 C  CA  . VAL B 1 224 ? 15.710  12.925  33.290  1.00 18.71 ? 267 VAL B CA  1 
ATOM   5710 C  C   . VAL B 1 224 ? 15.171  12.037  34.418  1.00 18.64 ? 267 VAL B C   1 
ATOM   5711 O  O   . VAL B 1 224 ? 15.681  10.942  34.646  1.00 19.16 ? 267 VAL B O   1 
ATOM   5712 C  CB  . VAL B 1 224 ? 16.593  14.073  33.889  1.00 19.02 ? 267 VAL B CB  1 
ATOM   5713 C  CG1 . VAL B 1 224 ? 17.539  13.566  34.988  1.00 17.75 ? 267 VAL B CG1 1 
ATOM   5714 C  CG2 . VAL B 1 224 ? 17.381  14.773  32.788  1.00 19.27 ? 267 VAL B CG2 1 
ATOM   5715 N  N   . ALA B 1 225 ? 14.139  12.490  35.122  1.00 18.27 ? 268 ALA B N   1 
ATOM   5716 C  CA  . ALA B 1 225 ? 13.563  11.669  36.183  1.00 17.90 ? 268 ALA B CA  1 
ATOM   5717 C  C   . ALA B 1 225 ? 13.074  10.324  35.627  1.00 18.19 ? 268 ALA B C   1 
ATOM   5718 O  O   . ALA B 1 225 ? 13.259  9.287   36.267  1.00 18.61 ? 268 ALA B O   1 
ATOM   5719 C  CB  . ALA B 1 225 ? 12.452  12.395  36.888  1.00 17.53 ? 268 ALA B CB  1 
ATOM   5720 N  N   . ALA B 1 226 ? 12.483  10.347  34.427  1.00 17.91 ? 269 ALA B N   1 
ATOM   5721 C  CA  . ALA B 1 226 ? 11.922  9.140   33.795  1.00 17.45 ? 269 ALA B CA  1 
ATOM   5722 C  C   . ALA B 1 226 ? 12.991  8.118   33.398  1.00 16.97 ? 269 ALA B C   1 
ATOM   5723 O  O   . ALA B 1 226 ? 12.851  6.940   33.696  1.00 16.81 ? 269 ALA B O   1 
ATOM   5724 C  CB  . ALA B 1 226 ? 11.015  9.509   32.601  1.00 16.84 ? 269 ALA B CB  1 
ATOM   5725 N  N   . TRP B 1 227 ? 14.066  8.571   32.753  1.00 17.13 ? 270 TRP B N   1 
ATOM   5726 C  CA  . TRP B 1 227 ? 15.212  7.699   32.463  1.00 16.90 ? 270 TRP B CA  1 
ATOM   5727 C  C   . TRP B 1 227 ? 15.890  7.162   33.739  1.00 17.92 ? 270 TRP B C   1 
ATOM   5728 O  O   . TRP B 1 227 ? 16.342  6.011   33.761  1.00 18.18 ? 270 TRP B O   1 
ATOM   5729 C  CB  . TRP B 1 227 ? 16.253  8.418   31.614  1.00 16.33 ? 270 TRP B CB  1 
ATOM   5730 C  CG  . TRP B 1 227 ? 16.021  8.431   30.138  1.00 13.67 ? 270 TRP B CG  1 
ATOM   5731 C  CD1 . TRP B 1 227 ? 15.689  9.512   29.379  1.00 12.85 ? 270 TRP B CD1 1 
ATOM   5732 C  CD2 . TRP B 1 227 ? 16.131  7.328   29.236  1.00 12.12 ? 270 TRP B CD2 1 
ATOM   5733 N  NE1 . TRP B 1 227 ? 15.575  9.155   28.065  1.00 13.64 ? 270 TRP B NE1 1 
ATOM   5734 C  CE2 . TRP B 1 227 ? 15.842  7.818   27.943  1.00 11.82 ? 270 TRP B CE2 1 
ATOM   5735 C  CE3 . TRP B 1 227 ? 16.428  5.964   29.392  1.00 10.70 ? 270 TRP B CE3 1 
ATOM   5736 C  CZ2 . TRP B 1 227 ? 15.847  7.000   26.813  1.00 10.67 ? 270 TRP B CZ2 1 
ATOM   5737 C  CZ3 . TRP B 1 227 ? 16.444  5.153   28.270  1.00 9.42  ? 270 TRP B CZ3 1 
ATOM   5738 C  CH2 . TRP B 1 227 ? 16.152  5.674   26.993  1.00 10.83 ? 270 TRP B CH2 1 
ATOM   5739 N  N   . ASP B 1 228 ? 15.966  7.985   34.791  1.00 18.67 ? 271 ASP B N   1 
ATOM   5740 C  CA  . ASP B 1 228 ? 16.555  7.551   36.072  1.00 19.61 ? 271 ASP B CA  1 
ATOM   5741 C  C   . ASP B 1 228 ? 15.795  6.364   36.659  1.00 20.05 ? 271 ASP B C   1 
ATOM   5742 O  O   . ASP B 1 228 ? 16.418  5.405   37.138  1.00 19.84 ? 271 ASP B O   1 
ATOM   5743 C  CB  . ASP B 1 228 ? 16.650  8.699   37.096  1.00 19.65 ? 271 ASP B CB  1 
ATOM   5744 C  CG  . ASP B 1 228 ? 17.844  9.634   36.832  1.00 21.25 ? 271 ASP B CG  1 
ATOM   5745 O  OD1 . ASP B 1 228 ? 18.787  9.247   36.090  1.00 22.34 ? 271 ASP B OD1 1 
ATOM   5746 O  OD2 . ASP B 1 228 ? 17.836  10.769  37.362  1.00 22.31 ? 271 ASP B OD2 1 
ATOM   5747 N  N   . VAL B 1 229 ? 14.461  6.408   36.593  1.00 20.46 ? 272 VAL B N   1 
ATOM   5748 C  CA  . VAL B 1 229 ? 13.662  5.270   37.031  1.00 21.14 ? 272 VAL B CA  1 
ATOM   5749 C  C   . VAL B 1 229 ? 13.977  4.058   36.167  1.00 22.03 ? 272 VAL B C   1 
ATOM   5750 O  O   . VAL B 1 229 ? 14.164  2.965   36.697  1.00 22.40 ? 272 VAL B O   1 
ATOM   5751 C  CB  . VAL B 1 229 ? 12.156  5.552   37.022  1.00 21.41 ? 272 VAL B CB  1 
ATOM   5752 C  CG1 . VAL B 1 229 ? 11.372  4.295   37.465  1.00 20.80 ? 272 VAL B CG1 1 
ATOM   5753 C  CG2 . VAL B 1 229 ? 11.832  6.742   37.919  1.00 19.96 ? 272 VAL B CG2 1 
ATOM   5754 N  N   . ILE B 1 230 ? 14.085  4.269   34.849  1.00 22.53 ? 273 ILE B N   1 
ATOM   5755 C  CA  . ILE B 1 230 ? 14.371  3.184   33.900  1.00 22.58 ? 273 ILE B CA  1 
ATOM   5756 C  C   . ILE B 1 230 ? 15.709  2.508   34.205  1.00 23.02 ? 273 ILE B C   1 
ATOM   5757 O  O   . ILE B 1 230 ? 15.799  1.278   34.201  1.00 23.19 ? 273 ILE B O   1 
ATOM   5758 C  CB  . ILE B 1 230 ? 14.272  3.661   32.395  1.00 22.76 ? 273 ILE B CB  1 
ATOM   5759 C  CG1 . ILE B 1 230 ? 12.806  3.930   32.021  1.00 22.58 ? 273 ILE B CG1 1 
ATOM   5760 C  CG2 . ILE B 1 230 ? 14.934  2.653   31.413  1.00 21.24 ? 273 ILE B CG2 1 
ATOM   5761 C  CD1 . ILE B 1 230 ? 12.609  4.623   30.689  1.00 21.97 ? 273 ILE B CD1 1 
ATOM   5762 N  N   . PHE B 1 231 ? 16.731  3.311   34.492  1.00 23.29 ? 274 PHE B N   1 
ATOM   5763 C  CA  . PHE B 1 231 ? 18.072  2.792   34.752  1.00 23.44 ? 274 PHE B CA  1 
ATOM   5764 C  C   . PHE B 1 231 ? 18.251  2.165   36.135  1.00 24.05 ? 274 PHE B C   1 
ATOM   5765 O  O   . PHE B 1 231 ? 18.914  1.143   36.264  1.00 24.06 ? 274 PHE B O   1 
ATOM   5766 C  CB  . PHE B 1 231 ? 19.121  3.872   34.528  1.00 23.26 ? 274 PHE B CB  1 
ATOM   5767 C  CG  . PHE B 1 231 ? 19.630  3.931   33.123  1.00 23.03 ? 274 PHE B CG  1 
ATOM   5768 C  CD1 . PHE B 1 231 ? 19.134  4.875   32.223  1.00 22.78 ? 274 PHE B CD1 1 
ATOM   5769 C  CD2 . PHE B 1 231 ? 20.603  3.038   32.688  1.00 21.63 ? 274 PHE B CD2 1 
ATOM   5770 C  CE1 . PHE B 1 231 ? 19.614  4.932   30.905  1.00 21.75 ? 274 PHE B CE1 1 
ATOM   5771 C  CE2 . PHE B 1 231 ? 21.078  3.083   31.383  1.00 22.29 ? 274 PHE B CE2 1 
ATOM   5772 C  CZ  . PHE B 1 231 ? 20.584  4.035   30.487  1.00 21.67 ? 274 PHE B CZ  1 
ATOM   5773 N  N   . SER B 1 232 ? 17.669  2.758   37.167  1.00 24.80 ? 275 SER B N   1 
ATOM   5774 C  CA  . SER B 1 232 ? 17.746  2.157   38.495  1.00 26.20 ? 275 SER B CA  1 
ATOM   5775 C  C   . SER B 1 232 ? 17.175  0.744   38.485  1.00 26.81 ? 275 SER B C   1 
ATOM   5776 O  O   . SER B 1 232 ? 17.825  -0.193  38.958  1.00 26.66 ? 275 SER B O   1 
ATOM   5777 C  CB  . SER B 1 232 ? 16.982  2.982   39.519  1.00 25.98 ? 275 SER B CB  1 
ATOM   5778 O  OG  . SER B 1 232 ? 17.382  4.326   39.433  1.00 28.82 ? 275 SER B OG  1 
ATOM   5779 N  N   . LYS B 1 233 ? 15.959  0.623   37.945  1.00 27.39 ? 276 LYS B N   1 
ATOM   5780 C  CA  . LYS B 1 233 ? 15.200  -0.618  37.954  1.00 28.08 ? 276 LYS B CA  1 
ATOM   5781 C  C   . LYS B 1 233 ? 15.835  -1.691  37.089  1.00 28.24 ? 276 LYS B C   1 
ATOM   5782 O  O   . LYS B 1 233 ? 15.893  -2.849  37.495  1.00 28.12 ? 276 LYS B O   1 
ATOM   5783 C  CB  . LYS B 1 233 ? 13.754  -0.380  37.516  1.00 28.26 ? 276 LYS B CB  1 
ATOM   5784 C  CG  . LYS B 1 233 ? 12.751  -0.268  38.654  1.00 29.83 ? 276 LYS B CG  1 
ATOM   5785 C  CD  . LYS B 1 233 ? 12.877  1.049   39.382  1.00 32.44 ? 276 LYS B CD  1 
ATOM   5786 C  CE  . LYS B 1 233 ? 12.565  0.899   40.865  1.00 33.43 ? 276 LYS B CE  1 
ATOM   5787 N  NZ  . LYS B 1 233 ? 11.128  1.125   41.136  1.00 34.48 ? 276 LYS B NZ  1 
ATOM   5788 N  N   . ALA B 1 234 ? 16.320  -1.319  35.907  1.00 28.35 ? 277 ALA B N   1 
ATOM   5789 C  CA  . ALA B 1 234 ? 16.950  -2.312  35.045  1.00 28.56 ? 277 ALA B CA  1 
ATOM   5790 C  C   . ALA B 1 234 ? 18.220  -2.828  35.715  1.00 28.89 ? 277 ALA B C   1 
ATOM   5791 O  O   . ALA B 1 234 ? 18.476  -4.028  35.724  1.00 28.74 ? 277 ALA B O   1 
ATOM   5792 C  CB  . ALA B 1 234 ? 17.243  -1.742  33.660  1.00 28.26 ? 277 ALA B CB  1 
ATOM   5793 N  N   . ASP B 1 235 ? 18.994  -1.907  36.290  1.00 29.36 ? 278 ASP B N   1 
ATOM   5794 C  CA  . ASP B 1 235 ? 20.219  -2.231  37.009  1.00 29.78 ? 278 ASP B CA  1 
ATOM   5795 C  C   . ASP B 1 235 ? 19.956  -3.237  38.134  1.00 29.10 ? 278 ASP B C   1 
ATOM   5796 O  O   . ASP B 1 235 ? 20.562  -4.303  38.162  1.00 28.51 ? 278 ASP B O   1 
ATOM   5797 C  CB  . ASP B 1 235 ? 20.843  -0.962  37.593  1.00 30.52 ? 278 ASP B CB  1 
ATOM   5798 C  CG  . ASP B 1 235 ? 21.607  -0.133  36.558  1.00 34.09 ? 278 ASP B CG  1 
ATOM   5799 O  OD1 . ASP B 1 235 ? 21.342  -0.222  35.324  1.00 36.91 ? 278 ASP B OD1 1 
ATOM   5800 O  OD2 . ASP B 1 235 ? 22.482  0.644   37.000  1.00 38.32 ? 278 ASP B OD2 1 
ATOM   5801 N  N   . ILE B 1 236 ? 19.049  -2.886  39.046  1.00 28.38 ? 279 ILE B N   1 
ATOM   5802 C  CA  . ILE B 1 236 ? 18.644  -3.764  40.140  1.00 28.11 ? 279 ILE B CA  1 
ATOM   5803 C  C   . ILE B 1 236 ? 18.256  -5.176  39.652  1.00 28.09 ? 279 ILE B C   1 
ATOM   5804 O  O   . ILE B 1 236 ? 18.778  -6.165  40.181  1.00 27.99 ? 279 ILE B O   1 
ATOM   5805 C  CB  . ILE B 1 236 ? 17.556  -3.095  41.012  1.00 28.32 ? 279 ILE B CB  1 
ATOM   5806 C  CG1 . ILE B 1 236 ? 18.190  -1.957  41.824  1.00 28.23 ? 279 ILE B CG1 1 
ATOM   5807 C  CG2 . ILE B 1 236 ? 16.851  -4.111  41.938  1.00 28.27 ? 279 ILE B CG2 1 
ATOM   5808 C  CD1 . ILE B 1 236 ? 17.201  -0.948  42.396  1.00 28.70 ? 279 ILE B CD1 1 
ATOM   5809 N  N   . TYR B 1 237 ? 17.403  -5.265  38.624  1.00 27.66 ? 280 TYR B N   1 
ATOM   5810 C  CA  . TYR B 1 237 ? 17.041  -6.554  38.001  1.00 27.37 ? 280 TYR B CA  1 
ATOM   5811 C  C   . TYR B 1 237 ? 18.236  -7.353  37.477  1.00 27.15 ? 280 TYR B C   1 
ATOM   5812 O  O   . TYR B 1 237 ? 18.354  -8.539  37.763  1.00 26.93 ? 280 TYR B O   1 
ATOM   5813 C  CB  . TYR B 1 237 ? 16.049  -6.381  36.845  1.00 27.20 ? 280 TYR B CB  1 
ATOM   5814 C  CG  . TYR B 1 237 ? 14.660  -5.887  37.201  1.00 27.53 ? 280 TYR B CG  1 
ATOM   5815 C  CD1 . TYR B 1 237 ? 13.970  -5.068  36.319  1.00 27.66 ? 280 TYR B CD1 1 
ATOM   5816 C  CD2 . TYR B 1 237 ? 14.030  -6.252  38.394  1.00 28.10 ? 280 TYR B CD2 1 
ATOM   5817 C  CE1 . TYR B 1 237 ? 12.705  -4.604  36.603  1.00 29.51 ? 280 TYR B CE1 1 
ATOM   5818 C  CE2 . TYR B 1 237 ? 12.757  -5.786  38.698  1.00 29.81 ? 280 TYR B CE2 1 
ATOM   5819 C  CZ  . TYR B 1 237 ? 12.101  -4.958  37.786  1.00 30.74 ? 280 TYR B CZ  1 
ATOM   5820 O  OH  . TYR B 1 237 ? 10.847  -4.474  38.031  1.00 31.76 ? 280 TYR B OH  1 
ATOM   5821 N  N   . THR B 1 238 ? 19.093  -6.708  36.691  1.00 27.16 ? 281 THR B N   1 
ATOM   5822 C  CA  . THR B 1 238 ? 20.278  -7.355  36.115  1.00 27.45 ? 281 THR B CA  1 
ATOM   5823 C  C   . THR B 1 238 ? 21.224  -7.847  37.210  1.00 27.90 ? 281 THR B C   1 
ATOM   5824 O  O   . THR B 1 238 ? 21.678  -8.983  37.170  1.00 28.32 ? 281 THR B O   1 
ATOM   5825 C  CB  . THR B 1 238 ? 21.024  -6.419  35.116  1.00 27.24 ? 281 THR B CB  1 
ATOM   5826 O  OG1 . THR B 1 238 ? 20.100  -5.966  34.120  1.00 28.33 ? 281 THR B OG1 1 
ATOM   5827 C  CG2 . THR B 1 238 ? 22.171  -7.143  34.406  1.00 26.07 ? 281 THR B CG2 1 
ATOM   5828 N  N   . GLN B 1 239 ? 21.476  -7.000  38.201  1.00 28.43 ? 282 GLN B N   1 
ATOM   5829 C  CA  . GLN B 1 239 ? 22.426  -7.296  39.260  1.00 29.24 ? 282 GLN B CA  1 
ATOM   5830 C  C   . GLN B 1 239 ? 21.962  -8.405  40.212  1.00 29.10 ? 282 GLN B C   1 
ATOM   5831 O  O   . GLN B 1 239 ? 22.742  -9.304  40.527  1.00 28.74 ? 282 GLN B O   1 
ATOM   5832 C  CB  . GLN B 1 239 ? 22.814  -6.013  40.009  1.00 29.63 ? 282 GLN B CB  1 
ATOM   5833 C  CG  . GLN B 1 239 ? 23.445  -4.967  39.063  1.00 32.82 ? 282 GLN B CG  1 
ATOM   5834 C  CD  . GLN B 1 239 ? 24.157  -3.814  39.767  1.00 35.92 ? 282 GLN B CD  1 
ATOM   5835 O  OE1 . GLN B 1 239 ? 24.218  -3.760  41.007  1.00 36.89 ? 282 GLN B OE1 1 
ATOM   5836 N  NE2 . GLN B 1 239 ? 24.726  -2.890  38.964  1.00 35.03 ? 282 GLN B NE2 1 
ATOM   5837 N  N   . ASN B 1 240 ? 20.707  -8.339  40.661  1.00 28.98 ? 283 ASN B N   1 
ATOM   5838 C  CA  . ASN B 1 240 ? 20.101  -9.442  41.398  1.00 28.91 ? 283 ASN B CA  1 
ATOM   5839 C  C   . ASN B 1 240 ? 20.227  -10.764 40.632  1.00 29.11 ? 283 ASN B C   1 
ATOM   5840 O  O   . ASN B 1 240 ? 20.720  -11.762 41.174  1.00 29.17 ? 283 ASN B O   1 
ATOM   5841 C  CB  . ASN B 1 240 ? 18.639  -9.146  41.726  1.00 28.73 ? 283 ASN B CB  1 
ATOM   5842 C  CG  . ASN B 1 240 ? 18.485  -8.031  42.737  1.00 29.56 ? 283 ASN B CG  1 
ATOM   5843 O  OD1 . ASN B 1 240 ? 19.463  -7.583  43.342  1.00 31.55 ? 283 ASN B OD1 1 
ATOM   5844 N  ND2 . ASN B 1 240 ? 17.255  -7.572  42.931  1.00 29.65 ? 283 ASN B ND2 1 
ATOM   5845 N  N   . PHE B 1 241 ? 19.818  -10.757 39.365  1.00 28.76 ? 284 PHE B N   1 
ATOM   5846 C  CA  . PHE B 1 241 ? 19.886  -11.951 38.537  1.00 28.66 ? 284 PHE B CA  1 
ATOM   5847 C  C   . PHE B 1 241 ? 21.309  -12.513 38.524  1.00 28.99 ? 284 PHE B C   1 
ATOM   5848 O  O   . PHE B 1 241 ? 21.519  -13.732 38.620  1.00 28.64 ? 284 PHE B O   1 
ATOM   5849 C  CB  . PHE B 1 241 ? 19.424  -11.636 37.111  1.00 28.31 ? 284 PHE B CB  1 
ATOM   5850 C  CG  . PHE B 1 241 ? 19.374  -12.837 36.212  1.00 27.47 ? 284 PHE B CG  1 
ATOM   5851 C  CD1 . PHE B 1 241 ? 18.186  -13.536 36.039  1.00 26.13 ? 284 PHE B CD1 1 
ATOM   5852 C  CD2 . PHE B 1 241 ? 20.523  -13.278 35.550  1.00 26.58 ? 284 PHE B CD2 1 
ATOM   5853 C  CE1 . PHE B 1 241 ? 18.131  -14.646 35.221  1.00 25.50 ? 284 PHE B CE1 1 
ATOM   5854 C  CE2 . PHE B 1 241 ? 20.485  -14.401 34.726  1.00 26.10 ? 284 PHE B CE2 1 
ATOM   5855 C  CZ  . PHE B 1 241 ? 19.287  -15.083 34.556  1.00 26.23 ? 284 PHE B CZ  1 
ATOM   5856 N  N   . TYR B 1 242 ? 22.276  -11.608 38.399  1.00 29.28 ? 285 TYR B N   1 
ATOM   5857 C  CA  . TYR B 1 242 ? 23.692  -11.953 38.321  1.00 29.75 ? 285 TYR B CA  1 
ATOM   5858 C  C   . TYR B 1 242 ? 24.145  -12.691 39.576  1.00 29.99 ? 285 TYR B C   1 
ATOM   5859 O  O   . TYR B 1 242 ? 24.844  -13.707 39.494  1.00 29.62 ? 285 TYR B O   1 
ATOM   5860 C  CB  . TYR B 1 242 ? 24.501  -10.673 38.130  1.00 29.60 ? 285 TYR B CB  1 
ATOM   5861 C  CG  . TYR B 1 242 ? 26.014  -10.780 38.120  1.00 29.42 ? 285 TYR B CG  1 
ATOM   5862 C  CD1 . TYR B 1 242 ? 26.723  -10.836 36.909  1.00 29.33 ? 285 TYR B CD1 1 
ATOM   5863 C  CD2 . TYR B 1 242 ? 26.743  -10.751 39.312  1.00 29.14 ? 285 TYR B CD2 1 
ATOM   5864 C  CE1 . TYR B 1 242 ? 28.120  -10.888 36.883  1.00 29.20 ? 285 TYR B CE1 1 
ATOM   5865 C  CE2 . TYR B 1 242 ? 28.144  -10.799 39.300  1.00 29.78 ? 285 TYR B CE2 1 
ATOM   5866 C  CZ  . TYR B 1 242 ? 28.820  -10.862 38.082  1.00 30.71 ? 285 TYR B CZ  1 
ATOM   5867 O  OH  . TYR B 1 242 ? 30.196  -10.913 38.077  1.00 32.60 ? 285 TYR B OH  1 
ATOM   5868 N  N   . TRP B 1 243 ? 23.729  -12.176 40.728  1.00 30.32 ? 286 TRP B N   1 
ATOM   5869 C  CA  . TRP B 1 243 ? 24.159  -12.732 41.987  1.00 31.11 ? 286 TRP B CA  1 
ATOM   5870 C  C   . TRP B 1 243 ? 23.443  -14.024 42.330  1.00 32.13 ? 286 TRP B C   1 
ATOM   5871 O  O   . TRP B 1 243 ? 24.073  -14.935 42.856  1.00 32.24 ? 286 TRP B O   1 
ATOM   5872 C  CB  . TRP B 1 243 ? 24.100  -11.689 43.107  1.00 30.43 ? 286 TRP B CB  1 
ATOM   5873 C  CG  . TRP B 1 243 ? 25.303  -10.794 43.043  1.00 30.21 ? 286 TRP B CG  1 
ATOM   5874 C  CD1 . TRP B 1 243 ? 25.321  -9.457  42.759  1.00 29.52 ? 286 TRP B CD1 1 
ATOM   5875 C  CD2 . TRP B 1 243 ? 26.680  -11.185 43.204  1.00 29.43 ? 286 TRP B CD2 1 
ATOM   5876 N  NE1 . TRP B 1 243 ? 26.609  -8.990  42.757  1.00 28.20 ? 286 TRP B NE1 1 
ATOM   5877 C  CE2 . TRP B 1 243 ? 27.464  -10.027 43.028  1.00 28.64 ? 286 TRP B CE2 1 
ATOM   5878 C  CE3 . TRP B 1 243 ? 27.324  -12.398 43.495  1.00 28.51 ? 286 TRP B CE3 1 
ATOM   5879 C  CZ2 . TRP B 1 243 ? 28.862  -10.045 43.132  1.00 27.56 ? 286 TRP B CZ2 1 
ATOM   5880 C  CZ3 . TRP B 1 243 ? 28.712  -12.413 43.595  1.00 27.62 ? 286 TRP B CZ3 1 
ATOM   5881 C  CH2 . TRP B 1 243 ? 29.462  -11.243 43.415  1.00 26.88 ? 286 TRP B CH2 1 
ATOM   5882 N  N   . GLU B 1 244 ? 22.151  -14.113 42.001  1.00 33.50 ? 287 GLU B N   1 
ATOM   5883 C  CA  . GLU B 1 244 ? 21.360  -15.341 42.194  1.00 34.85 ? 287 GLU B CA  1 
ATOM   5884 C  C   . GLU B 1 244 ? 21.776  -16.469 41.260  1.00 35.39 ? 287 GLU B C   1 
ATOM   5885 O  O   . GLU B 1 244 ? 21.586  -17.637 41.576  1.00 35.39 ? 287 GLU B O   1 
ATOM   5886 C  CB  . GLU B 1 244 ? 19.873  -15.071 42.023  1.00 35.01 ? 287 GLU B CB  1 
ATOM   5887 C  CG  . GLU B 1 244 ? 19.206  -14.411 43.218  1.00 36.57 ? 287 GLU B CG  1 
ATOM   5888 C  CD  . GLU B 1 244 ? 17.926  -13.714 42.823  1.00 38.55 ? 287 GLU B CD  1 
ATOM   5889 O  OE1 . GLU B 1 244 ? 17.278  -14.179 41.863  1.00 40.28 ? 287 GLU B OE1 1 
ATOM   5890 O  OE2 . GLU B 1 244 ? 17.575  -12.693 43.450  1.00 39.92 ? 287 GLU B OE2 1 
ATOM   5891 N  N   . LEU B 1 245 ? 22.345  -16.117 40.114  1.00 36.29 ? 288 LEU B N   1 
ATOM   5892 C  CA  . LEU B 1 245 ? 22.945  -17.105 39.233  1.00 37.33 ? 288 LEU B CA  1 
ATOM   5893 C  C   . LEU B 1 245 ? 24.052  -17.829 39.996  1.00 38.05 ? 288 LEU B C   1 
ATOM   5894 O  O   . LEU B 1 245 ? 24.225  -19.043 39.861  1.00 37.86 ? 288 LEU B O   1 
ATOM   5895 C  CB  . LEU B 1 245 ? 23.526  -16.420 37.996  1.00 37.49 ? 288 LEU B CB  1 
ATOM   5896 C  CG  . LEU B 1 245 ? 23.717  -17.258 36.735  1.00 38.04 ? 288 LEU B CG  1 
ATOM   5897 C  CD1 . LEU B 1 245 ? 22.348  -17.626 36.190  1.00 38.97 ? 288 LEU B CD1 1 
ATOM   5898 C  CD2 . LEU B 1 245 ? 24.538  -16.506 35.682  1.00 37.53 ? 288 LEU B CD2 1 
ATOM   5899 N  N   . ARG B 1 246 ? 24.779  -17.064 40.808  1.00 38.92 ? 289 ARG B N   1 
ATOM   5900 C  CA  . ARG B 1 246 ? 25.917  -17.559 41.568  1.00 39.92 ? 289 ARG B CA  1 
ATOM   5901 C  C   . ARG B 1 246 ? 25.514  -18.252 42.867  1.00 40.98 ? 289 ARG B C   1 
ATOM   5902 O  O   . ARG B 1 246 ? 26.238  -19.122 43.342  1.00 40.98 ? 289 ARG B O   1 
ATOM   5903 C  CB  . ARG B 1 246 ? 26.911  -16.427 41.829  1.00 39.73 ? 289 ARG B CB  1 
ATOM   5904 C  CG  . ARG B 1 246 ? 27.902  -16.263 40.707  1.00 39.62 ? 289 ARG B CG  1 
ATOM   5905 C  CD  . ARG B 1 246 ? 28.366  -14.840 40.511  1.00 40.12 ? 289 ARG B CD  1 
ATOM   5906 N  NE  . ARG B 1 246 ? 28.580  -14.659 39.080  1.00 42.73 ? 289 ARG B NE  1 
ATOM   5907 C  CZ  . ARG B 1 246 ? 29.741  -14.388 38.486  1.00 43.66 ? 289 ARG B CZ  1 
ATOM   5908 N  NH1 . ARG B 1 246 ? 30.851  -14.200 39.194  1.00 43.62 ? 289 ARG B NH1 1 
ATOM   5909 N  NH2 . ARG B 1 246 ? 29.777  -14.277 37.160  1.00 43.89 ? 289 ARG B NH2 1 
ATOM   5910 N  N   . GLN B 1 247 ? 24.365  -17.868 43.427  1.00 42.59 ? 290 GLN B N   1 
ATOM   5911 C  CA  . GLN B 1 247 ? 23.802  -18.520 44.616  1.00 44.54 ? 290 GLN B CA  1 
ATOM   5912 C  C   . GLN B 1 247 ? 23.203  -19.893 44.293  1.00 45.81 ? 290 GLN B C   1 
ATOM   5913 O  O   . GLN B 1 247 ? 23.473  -20.868 44.986  1.00 46.21 ? 290 GLN B O   1 
ATOM   5914 C  CB  . GLN B 1 247 ? 22.717  -17.660 45.264  1.00 44.50 ? 290 GLN B CB  1 
ATOM   5915 C  CG  . GLN B 1 247 ? 23.172  -16.336 45.847  1.00 44.93 ? 290 GLN B CG  1 
ATOM   5916 C  CD  . GLN B 1 247 ? 21.998  -15.400 46.140  1.00 46.47 ? 290 GLN B CD  1 
ATOM   5917 O  OE1 . GLN B 1 247 ? 20.895  -15.848 46.472  1.00 46.47 ? 290 GLN B OE1 1 
ATOM   5918 N  NE2 . GLN B 1 247 ? 22.230  -14.093 46.014  1.00 46.86 ? 290 GLN B NE2 1 
ATOM   5919 N  N   . LYS B 1 248 ? 22.381  -19.950 43.247  1.00 47.61 ? 291 LYS B N   1 
ATOM   5920 C  CA  . LYS B 1 248 ? 21.718  -21.186 42.805  1.00 49.26 ? 291 LYS B CA  1 
ATOM   5921 C  C   . LYS B 1 248 ? 22.661  -22.028 41.950  1.00 50.25 ? 291 LYS B C   1 
ATOM   5922 O  O   . LYS B 1 248 ? 22.321  -23.142 41.534  1.00 50.26 ? 291 LYS B O   1 
ATOM   5923 C  CB  . LYS B 1 248 ? 20.433  -20.847 42.043  1.00 49.19 ? 291 LYS B CB  1 
ATOM   5924 C  CG  . LYS B 1 248 ? 19.345  -20.246 42.942  1.00 50.45 ? 291 LYS B CG  1 
ATOM   5925 C  CD  . LYS B 1 248 ? 18.398  -19.303 42.182  1.00 53.01 ? 291 LYS B CD  1 
ATOM   5926 C  CE  . LYS B 1 248 ? 17.330  -18.710 43.117  1.00 54.22 ? 291 LYS B CE  1 
ATOM   5927 N  NZ  . LYS B 1 248 ? 16.949  -17.300 42.766  1.00 54.52 ? 291 LYS B NZ  1 
ATOM   5928 N  N   . GLY B 1 249 ? 23.857  -21.471 41.738  1.00 51.61 ? 292 GLY B N   1 
ATOM   5929 C  CA  . GLY B 1 249 ? 24.937  -22.014 40.908  1.00 53.24 ? 292 GLY B CA  1 
ATOM   5930 C  C   . GLY B 1 249 ? 24.920  -23.472 40.509  1.00 54.53 ? 292 GLY B C   1 
ATOM   5931 O  O   . GLY B 1 249 ? 25.587  -24.323 41.127  1.00 54.76 ? 292 GLY B O   1 
ATOM   5932 N  N   . SER B 1 250 ? 24.158  -23.745 39.456  1.00 55.59 ? 293 SER B N   1 
ATOM   5933 C  CA  . SER B 1 250 ? 24.101  -25.060 38.835  1.00 56.53 ? 293 SER B CA  1 
ATOM   5934 C  C   . SER B 1 250 ? 24.106  -24.881 37.314  1.00 56.90 ? 293 SER B C   1 
ATOM   5935 O  O   . SER B 1 250 ? 23.747  -23.808 36.807  1.00 57.13 ? 293 SER B O   1 
ATOM   5936 C  CB  . SER B 1 250 ? 22.840  -25.808 39.292  1.00 56.59 ? 293 SER B CB  1 
ATOM   5937 O  OG  . SER B 1 250 ? 22.706  -27.057 38.631  1.00 57.22 ? 293 SER B OG  1 
ATOM   5938 N  N   . VAL B 1 251 ? 24.539  -25.914 36.593  1.00 57.05 ? 294 VAL B N   1 
ATOM   5939 C  CA  . VAL B 1 251 ? 24.311  -25.969 35.153  1.00 57.10 ? 294 VAL B CA  1 
ATOM   5940 C  C   . VAL B 1 251 ? 22.818  -26.265 34.960  1.00 57.01 ? 294 VAL B C   1 
ATOM   5941 O  O   . VAL B 1 251 ? 22.212  -26.994 35.753  1.00 56.93 ? 294 VAL B O   1 
ATOM   5942 C  CB  . VAL B 1 251 ? 25.184  -27.053 34.442  1.00 57.28 ? 294 VAL B CB  1 
ATOM   5943 C  CG1 . VAL B 1 251 ? 25.252  -26.794 32.917  1.00 56.89 ? 294 VAL B CG1 1 
ATOM   5944 C  CG2 . VAL B 1 251 ? 26.597  -27.109 35.044  1.00 57.22 ? 294 VAL B CG2 1 
ATOM   5945 N  N   . HIS B 1 252 ? 22.222  -25.663 33.934  1.00 56.86 ? 295 HIS B N   1 
ATOM   5946 C  CA  . HIS B 1 252 ? 20.813  -25.885 33.624  1.00 56.54 ? 295 HIS B CA  1 
ATOM   5947 C  C   . HIS B 1 252 ? 20.652  -26.358 32.193  1.00 55.87 ? 295 HIS B C   1 
ATOM   5948 O  O   . HIS B 1 252 ? 21.278  -25.814 31.283  1.00 55.86 ? 295 HIS B O   1 
ATOM   5949 C  CB  . HIS B 1 252 ? 20.005  -24.609 33.851  1.00 56.78 ? 295 HIS B CB  1 
ATOM   5950 C  CG  . HIS B 1 252 ? 19.804  -24.272 35.296  1.00 58.31 ? 295 HIS B CG  1 
ATOM   5951 N  ND1 . HIS B 1 252 ? 18.630  -24.545 35.968  1.00 59.55 ? 295 HIS B ND1 1 
ATOM   5952 C  CD2 . HIS B 1 252 ? 20.630  -23.693 36.201  1.00 59.37 ? 295 HIS B CD2 1 
ATOM   5953 C  CE1 . HIS B 1 252 ? 18.742  -24.147 37.224  1.00 59.89 ? 295 HIS B CE1 1 
ATOM   5954 N  NE2 . HIS B 1 252 ? 19.945  -23.628 37.393  1.00 59.99 ? 295 HIS B NE2 1 
ATOM   5955 N  N   . HIS B 1 253 ? 19.813  -27.374 32.005  1.00 55.16 ? 296 HIS B N   1 
ATOM   5956 C  CA  . HIS B 1 253 ? 19.505  -27.903 30.673  1.00 54.39 ? 296 HIS B CA  1 
ATOM   5957 C  C   . HIS B 1 253 ? 18.198  -27.316 30.131  1.00 53.44 ? 296 HIS B C   1 
ATOM   5958 O  O   . HIS B 1 253 ? 18.023  -27.201 28.919  1.00 53.36 ? 296 HIS B O   1 
ATOM   5959 C  CB  . HIS B 1 253 ? 19.458  -29.436 30.689  1.00 54.79 ? 296 HIS B CB  1 
ATOM   5960 C  CG  . HIS B 1 253 ? 20.756  -30.082 31.082  1.00 55.83 ? 296 HIS B CG  1 
ATOM   5961 N  ND1 . HIS B 1 253 ? 21.411  -30.988 30.275  1.00 56.84 ? 296 HIS B ND1 1 
ATOM   5962 C  CD2 . HIS B 1 253 ? 21.518  -29.955 32.196  1.00 57.24 ? 296 HIS B CD2 1 
ATOM   5963 C  CE1 . HIS B 1 253 ? 22.520  -31.388 30.872  1.00 57.57 ? 296 HIS B CE1 1 
ATOM   5964 N  NE2 . HIS B 1 253 ? 22.609  -30.776 32.040  1.00 57.81 ? 296 HIS B NE2 1 
ATOM   5965 N  N   . ASP B 1 254 ? 17.283  -26.953 31.029  1.00 52.28 ? 297 ASP B N   1 
ATOM   5966 C  CA  . ASP B 1 254 ? 16.082  -26.214 30.644  1.00 51.02 ? 297 ASP B CA  1 
ATOM   5967 C  C   . ASP B 1 254 ? 16.485  -24.791 30.288  1.00 49.98 ? 297 ASP B C   1 
ATOM   5968 O  O   . ASP B 1 254 ? 17.368  -24.216 30.931  1.00 49.99 ? 297 ASP B O   1 
ATOM   5969 C  CB  . ASP B 1 254 ? 15.035  -26.220 31.768  1.00 51.20 ? 297 ASP B CB  1 
ATOM   5970 C  CG  . ASP B 1 254 ? 15.511  -25.512 33.042  1.00 51.78 ? 297 ASP B CG  1 
ATOM   5971 O  OD1 . ASP B 1 254 ? 16.716  -25.597 33.380  1.00 52.62 ? 297 ASP B OD1 1 
ATOM   5972 O  OD2 . ASP B 1 254 ? 14.666  -24.882 33.719  1.00 51.87 ? 297 ASP B OD2 1 
ATOM   5973 N  N   . TYR B 1 255 ? 15.859  -24.232 29.256  1.00 48.62 ? 298 TYR B N   1 
ATOM   5974 C  CA  . TYR B 1 255 ? 16.170  -22.870 28.828  1.00 47.25 ? 298 TYR B CA  1 
ATOM   5975 C  C   . TYR B 1 255 ? 15.781  -21.839 29.894  1.00 46.14 ? 298 TYR B C   1 
ATOM   5976 O  O   . TYR B 1 255 ? 14.670  -21.863 30.423  1.00 45.95 ? 298 TYR B O   1 
ATOM   5977 C  CB  . TYR B 1 255 ? 15.497  -22.561 27.501  1.00 47.32 ? 298 TYR B CB  1 
ATOM   5978 C  CG  . TYR B 1 255 ? 15.657  -21.131 27.057  1.00 48.00 ? 298 TYR B CG  1 
ATOM   5979 C  CD1 . TYR B 1 255 ? 16.842  -20.696 26.448  1.00 48.42 ? 298 TYR B CD1 1 
ATOM   5980 C  CD2 . TYR B 1 255 ? 14.626  -20.205 27.245  1.00 48.08 ? 298 TYR B CD2 1 
ATOM   5981 C  CE1 . TYR B 1 255 ? 16.994  -19.378 26.032  1.00 48.62 ? 298 TYR B CE1 1 
ATOM   5982 C  CE2 . TYR B 1 255 ? 14.767  -18.884 26.829  1.00 48.75 ? 298 TYR B CE2 1 
ATOM   5983 C  CZ  . TYR B 1 255 ? 15.952  -18.480 26.225  1.00 48.19 ? 298 TYR B CZ  1 
ATOM   5984 O  OH  . TYR B 1 255 ? 16.091  -17.183 25.817  1.00 47.76 ? 298 TYR B OH  1 
ATOM   5985 N  N   . ARG B 1 256 ? 16.700  -20.934 30.203  1.00 44.80 ? 299 ARG B N   1 
ATOM   5986 C  CA  . ARG B 1 256 ? 16.509  -20.035 31.336  1.00 43.49 ? 299 ARG B CA  1 
ATOM   5987 C  C   . ARG B 1 256 ? 16.229  -18.586 30.948  1.00 42.12 ? 299 ARG B C   1 
ATOM   5988 O  O   . ARG B 1 256 ? 15.849  -17.791 31.807  1.00 42.12 ? 299 ARG B O   1 
ATOM   5989 C  CB  . ARG B 1 256 ? 17.725  -20.079 32.272  1.00 43.82 ? 299 ARG B CB  1 
ATOM   5990 C  CG  . ARG B 1 256 ? 18.210  -21.466 32.679  1.00 45.09 ? 299 ARG B CG  1 
ATOM   5991 C  CD  . ARG B 1 256 ? 17.219  -22.198 33.573  1.00 47.73 ? 299 ARG B CD  1 
ATOM   5992 N  NE  . ARG B 1 256 ? 16.984  -21.530 34.853  1.00 49.85 ? 299 ARG B NE  1 
ATOM   5993 C  CZ  . ARG B 1 256 ? 16.245  -22.047 35.837  1.00 51.24 ? 299 ARG B CZ  1 
ATOM   5994 N  NH1 . ARG B 1 256 ? 15.677  -23.242 35.699  1.00 51.34 ? 299 ARG B NH1 1 
ATOM   5995 N  NH2 . ARG B 1 256 ? 16.073  -21.372 36.964  1.00 51.53 ? 299 ARG B NH2 1 
ATOM   5996 N  N   . GLY B 1 257 ? 16.441  -18.231 29.681  1.00 40.32 ? 300 GLY B N   1 
ATOM   5997 C  CA  . GLY B 1 257 ? 16.187  -16.862 29.226  1.00 38.32 ? 300 GLY B CA  1 
ATOM   5998 C  C   . GLY B 1 257 ? 17.362  -16.207 28.528  1.00 36.89 ? 300 GLY B C   1 
ATOM   5999 O  O   . GLY B 1 257 ? 18.436  -16.796 28.430  1.00 37.04 ? 300 GLY B O   1 
ATOM   6000 N  N   . ILE B 1 258 ? 17.159  -14.984 28.043  1.00 35.15 ? 301 ILE B N   1 
ATOM   6001 C  CA  . ILE B 1 258 ? 18.187  -14.282 27.273  1.00 33.57 ? 301 ILE B CA  1 
ATOM   6002 C  C   . ILE B 1 258 ? 19.416  -13.886 28.116  1.00 32.85 ? 301 ILE B C   1 
ATOM   6003 O  O   . ILE B 1 258 ? 20.555  -14.133 27.704  1.00 32.46 ? 301 ILE B O   1 
ATOM   6004 C  CB  . ILE B 1 258 ? 17.609  -13.052 26.527  1.00 33.44 ? 301 ILE B CB  1 
ATOM   6005 C  CG1 . ILE B 1 258 ? 16.534  -13.491 25.534  1.00 32.96 ? 301 ILE B CG1 1 
ATOM   6006 C  CG2 . ILE B 1 258 ? 18.707  -12.296 25.796  1.00 32.30 ? 301 ILE B CG2 1 
ATOM   6007 C  CD1 . ILE B 1 258 ? 15.474  -12.434 25.275  1.00 33.06 ? 301 ILE B CD1 1 
ATOM   6008 N  N   . LEU B 1 259 ? 19.179  -13.285 29.282  1.00 31.67 ? 302 LEU B N   1 
ATOM   6009 C  CA  . LEU B 1 259 ? 20.257  -12.802 30.136  1.00 31.15 ? 302 LEU B CA  1 
ATOM   6010 C  C   . LEU B 1 259 ? 21.183  -13.931 30.569  1.00 31.37 ? 302 LEU B C   1 
ATOM   6011 O  O   . LEU B 1 259 ? 22.414  -13.782 30.553  1.00 31.03 ? 302 LEU B O   1 
ATOM   6012 C  CB  . LEU B 1 259 ? 19.696  -12.061 31.357  1.00 30.75 ? 302 LEU B CB  1 
ATOM   6013 C  CG  . LEU B 1 259 ? 20.691  -11.427 32.336  1.00 28.94 ? 302 LEU B CG  1 
ATOM   6014 C  CD1 . LEU B 1 259 ? 21.708  -10.568 31.619  1.00 27.95 ? 302 LEU B CD1 1 
ATOM   6015 C  CD2 . LEU B 1 259 ? 19.962  -10.615 33.380  1.00 28.53 ? 302 LEU B CD2 1 
ATOM   6016 N  N   . TYR B 1 260 ? 20.573  -15.055 30.937  1.00 31.60 ? 303 TYR B N   1 
ATOM   6017 C  CA  . TYR B 1 260 ? 21.282  -16.280 31.267  1.00 32.03 ? 303 TYR B CA  1 
ATOM   6018 C  C   . TYR B 1 260 ? 22.241  -16.674 30.154  1.00 32.07 ? 303 TYR B C   1 
ATOM   6019 O  O   . TYR B 1 260 ? 23.399  -16.996 30.419  1.00 32.58 ? 303 TYR B O   1 
ATOM   6020 C  CB  . TYR B 1 260 ? 20.280  -17.413 31.526  1.00 32.57 ? 303 TYR B CB  1 
ATOM   6021 C  CG  . TYR B 1 260 ? 20.911  -18.730 31.935  1.00 33.10 ? 303 TYR B CG  1 
ATOM   6022 C  CD1 . TYR B 1 260 ? 21.000  -19.089 33.277  1.00 33.61 ? 303 TYR B CD1 1 
ATOM   6023 C  CD2 . TYR B 1 260 ? 21.415  -19.617 30.977  1.00 33.49 ? 303 TYR B CD2 1 
ATOM   6024 C  CE1 . TYR B 1 260 ? 21.579  -20.299 33.659  1.00 34.79 ? 303 TYR B CE1 1 
ATOM   6025 C  CE2 . TYR B 1 260 ? 22.006  -20.823 31.346  1.00 33.71 ? 303 TYR B CE2 1 
ATOM   6026 C  CZ  . TYR B 1 260 ? 22.082  -21.160 32.687  1.00 34.74 ? 303 TYR B CZ  1 
ATOM   6027 O  OH  . TYR B 1 260 ? 22.658  -22.361 33.063  1.00 36.40 ? 303 TYR B OH  1 
ATOM   6028 N  N   . ARG B 1 261 ? 21.756  -16.656 28.915  1.00 31.91 ? 304 ARG B N   1 
ATOM   6029 C  CA  . ARG B 1 261 ? 22.565  -17.018 27.757  1.00 32.19 ? 304 ARG B CA  1 
ATOM   6030 C  C   . ARG B 1 261 ? 23.716  -16.031 27.529  1.00 32.12 ? 304 ARG B C   1 
ATOM   6031 O  O   . ARG B 1 261 ? 24.822  -16.429 27.179  1.00 32.34 ? 304 ARG B O   1 
ATOM   6032 C  CB  . ARG B 1 261 ? 21.689  -17.098 26.508  1.00 32.45 ? 304 ARG B CB  1 
ATOM   6033 C  CG  . ARG B 1 261 ? 20.807  -18.319 26.409  1.00 33.62 ? 304 ARG B CG  1 
ATOM   6034 C  CD  . ARG B 1 261 ? 21.541  -19.436 25.697  1.00 37.03 ? 304 ARG B CD  1 
ATOM   6035 N  NE  . ARG B 1 261 ? 20.648  -20.524 25.292  1.00 38.55 ? 304 ARG B NE  1 
ATOM   6036 C  CZ  . ARG B 1 261 ? 20.089  -20.633 24.089  1.00 39.06 ? 304 ARG B CZ  1 
ATOM   6037 N  NH1 . ARG B 1 261 ? 20.317  -19.712 23.155  1.00 38.79 ? 304 ARG B NH1 1 
ATOM   6038 N  NH2 . ARG B 1 261 ? 19.296  -21.667 23.820  1.00 38.49 ? 304 ARG B NH2 1 
ATOM   6039 N  N   . LEU B 1 262 ? 23.453  -14.747 27.738  1.00 32.13 ? 305 LEU B N   1 
ATOM   6040 C  CA  . LEU B 1 262 ? 24.467  -13.722 27.523  1.00 32.17 ? 305 LEU B CA  1 
ATOM   6041 C  C   . LEU B 1 262 ? 25.545  -13.745 28.610  1.00 32.25 ? 305 LEU B C   1 
ATOM   6042 O  O   . LEU B 1 262 ? 26.730  -13.726 28.299  1.00 32.51 ? 305 LEU B O   1 
ATOM   6043 C  CB  . LEU B 1 262 ? 23.838  -12.331 27.406  1.00 31.77 ? 305 LEU B CB  1 
ATOM   6044 C  CG  . LEU B 1 262 ? 22.901  -12.037 26.235  1.00 31.28 ? 305 LEU B CG  1 
ATOM   6045 C  CD1 . LEU B 1 262 ? 22.167  -10.724 26.492  1.00 29.34 ? 305 LEU B CD1 1 
ATOM   6046 C  CD2 . LEU B 1 262 ? 23.649  -12.002 24.898  1.00 30.55 ? 305 LEU B CD2 1 
ATOM   6047 N  N   . LEU B 1 263 ? 25.133  -13.793 29.874  1.00 32.21 ? 306 LEU B N   1 
ATOM   6048 C  CA  . LEU B 1 263 ? 26.069  -13.876 30.992  1.00 32.30 ? 306 LEU B CA  1 
ATOM   6049 C  C   . LEU B 1 263 ? 26.862  -15.183 30.971  1.00 33.17 ? 306 LEU B C   1 
ATOM   6050 O  O   . LEU B 1 263 ? 28.012  -15.220 31.383  1.00 33.13 ? 306 LEU B O   1 
ATOM   6051 C  CB  . LEU B 1 263 ? 25.322  -13.777 32.318  1.00 32.03 ? 306 LEU B CB  1 
ATOM   6052 C  CG  . LEU B 1 263 ? 24.601  -12.494 32.731  1.00 30.52 ? 306 LEU B CG  1 
ATOM   6053 C  CD1 . LEU B 1 263 ? 23.831  -12.759 34.011  1.00 29.56 ? 306 LEU B CD1 1 
ATOM   6054 C  CD2 . LEU B 1 263 ? 25.550  -11.339 32.908  1.00 28.66 ? 306 LEU B CD2 1 
ATOM   6055 N  N   . GLY B 1 264 ? 26.232  -16.249 30.483  1.00 34.28 ? 307 GLY B N   1 
ATOM   6056 C  CA  . GLY B 1 264 ? 26.848  -17.562 30.413  1.00 35.31 ? 307 GLY B CA  1 
ATOM   6057 C  C   . GLY B 1 264 ? 27.822  -17.725 29.261  1.00 36.33 ? 307 GLY B C   1 
ATOM   6058 O  O   . GLY B 1 264 ? 28.871  -18.332 29.434  1.00 36.29 ? 307 GLY B O   1 
ATOM   6059 N  N   . ASP B 1 265 ? 27.489  -17.195 28.085  1.00 37.54 ? 308 ASP B N   1 
ATOM   6060 C  CA  . ASP B 1 265 ? 28.305  -17.465 26.889  1.00 39.13 ? 308 ASP B CA  1 
ATOM   6061 C  C   . ASP B 1 265 ? 28.253  -16.375 25.803  1.00 39.21 ? 308 ASP B C   1 
ATOM   6062 O  O   . ASP B 1 265 ? 27.934  -16.649 24.646  1.00 39.35 ? 308 ASP B O   1 
ATOM   6063 C  CB  . ASP B 1 265 ? 27.943  -18.844 26.293  1.00 39.90 ? 308 ASP B CB  1 
ATOM   6064 C  CG  . ASP B 1 265 ? 29.036  -19.407 25.362  1.00 42.06 ? 308 ASP B CG  1 
ATOM   6065 O  OD1 . ASP B 1 265 ? 30.087  -18.739 25.151  1.00 43.63 ? 308 ASP B OD1 1 
ATOM   6066 O  OD2 . ASP B 1 265 ? 28.831  -20.529 24.832  1.00 44.25 ? 308 ASP B OD2 1 
ATOM   6067 N  N   . SER B 1 266 ? 28.598  -15.147 26.168  1.00 39.38 ? 309 SER B N   1 
ATOM   6068 C  CA  . SER B 1 266 ? 28.551  -14.052 25.214  1.00 39.36 ? 309 SER B CA  1 
ATOM   6069 C  C   . SER B 1 266 ? 29.924  -13.431 25.023  1.00 39.35 ? 309 SER B C   1 
ATOM   6070 O  O   . SER B 1 266 ? 30.752  -13.432 25.935  1.00 39.59 ? 309 SER B O   1 
ATOM   6071 C  CB  . SER B 1 266 ? 27.558  -12.989 25.679  1.00 39.07 ? 309 SER B CB  1 
ATOM   6072 O  OG  . SER B 1 266 ? 27.331  -12.021 24.673  1.00 39.72 ? 309 SER B OG  1 
ATOM   6073 N  N   . LYS B 1 267 ? 30.160  -12.889 23.835  1.00 38.99 ? 310 LYS B N   1 
ATOM   6074 C  CA  . LYS B 1 267 ? 31.356  -12.102 23.608  1.00 38.85 ? 310 LYS B CA  1 
ATOM   6075 C  C   . LYS B 1 267 ? 31.269  -10.747 24.318  1.00 38.57 ? 310 LYS B C   1 
ATOM   6076 O  O   . LYS B 1 267 ? 32.263  -10.032 24.408  1.00 38.94 ? 310 LYS B O   1 
ATOM   6077 C  CB  . LYS B 1 267 ? 31.621  -11.936 22.109  1.00 39.02 ? 310 LYS B CB  1 
ATOM   6078 C  CG  . LYS B 1 267 ? 32.154  -13.208 21.453  1.00 39.79 ? 310 LYS B CG  1 
ATOM   6079 C  CD  . LYS B 1 267 ? 32.472  -13.030 19.985  1.00 40.32 ? 310 LYS B CD  1 
ATOM   6080 C  CE  . LYS B 1 267 ? 33.333  -14.187 19.505  1.00 40.97 ? 310 LYS B CE  1 
ATOM   6081 N  NZ  . LYS B 1 267 ? 33.490  -14.171 18.023  1.00 42.31 ? 310 LYS B NZ  1 
ATOM   6082 N  N   . MET B 1 268 ? 30.087  -10.411 24.835  1.00 37.83 ? 311 MET B N   1 
ATOM   6083 C  CA  . MET B 1 268 ? 29.849  -9.121  25.482  1.00 37.00 ? 311 MET B CA  1 
ATOM   6084 C  C   . MET B 1 268 ? 30.390  -9.062  26.911  1.00 36.26 ? 311 MET B C   1 
ATOM   6085 O  O   . MET B 1 268 ? 30.420  -10.071 27.625  1.00 36.54 ? 311 MET B O   1 
ATOM   6086 C  CB  . MET B 1 268 ? 28.354  -8.818  25.523  1.00 37.11 ? 311 MET B CB  1 
ATOM   6087 C  CG  . MET B 1 268 ? 27.771  -8.258  24.249  1.00 38.33 ? 311 MET B CG  1 
ATOM   6088 S  SD  . MET B 1 268 ? 26.040  -7.796  24.504  1.00 40.78 ? 311 MET B SD  1 
ATOM   6089 C  CE  . MET B 1 268 ? 25.742  -6.866  23.027  1.00 39.80 ? 311 MET B CE  1 
ATOM   6090 N  N   . SER B 1 269 ? 30.800  -7.869  27.326  1.00 34.88 ? 312 SER B N   1 
ATOM   6091 C  CA  . SER B 1 269 ? 31.117  -7.610  28.724  1.00 33.71 ? 312 SER B CA  1 
ATOM   6092 C  C   . SER B 1 269 ? 29.825  -7.366  29.492  1.00 32.71 ? 312 SER B C   1 
ATOM   6093 O  O   . SER B 1 269 ? 28.777  -7.116  28.887  1.00 32.73 ? 312 SER B O   1 
ATOM   6094 C  CB  . SER B 1 269 ? 32.023  -6.385  28.839  1.00 33.57 ? 312 SER B CB  1 
ATOM   6095 O  OG  . SER B 1 269 ? 31.401  -5.269  28.236  1.00 33.53 ? 312 SER B OG  1 
ATOM   6096 N  N   . PHE B 1 270 ? 29.905  -7.423  30.820  1.00 31.46 ? 313 PHE B N   1 
ATOM   6097 C  CA  . PHE B 1 270 ? 28.742  -7.180  31.672  1.00 30.46 ? 313 PHE B CA  1 
ATOM   6098 C  C   . PHE B 1 270 ? 28.159  -5.777  31.456  1.00 30.40 ? 313 PHE B C   1 
ATOM   6099 O  O   . PHE B 1 270 ? 26.944  -5.609  31.381  1.00 30.35 ? 313 PHE B O   1 
ATOM   6100 C  CB  . PHE B 1 270 ? 29.090  -7.396  33.142  1.00 29.69 ? 313 PHE B CB  1 
ATOM   6101 C  CG  . PHE B 1 270 ? 27.948  -7.127  34.082  1.00 28.16 ? 313 PHE B CG  1 
ATOM   6102 C  CD1 . PHE B 1 270 ? 26.967  -8.095  34.304  1.00 25.38 ? 313 PHE B CD1 1 
ATOM   6103 C  CD2 . PHE B 1 270 ? 27.853  -5.899  34.755  1.00 25.95 ? 313 PHE B CD2 1 
ATOM   6104 C  CE1 . PHE B 1 270 ? 25.909  -7.841  35.171  1.00 24.30 ? 313 PHE B CE1 1 
ATOM   6105 C  CE2 . PHE B 1 270 ? 26.800  -5.638  35.635  1.00 23.71 ? 313 PHE B CE2 1 
ATOM   6106 C  CZ  . PHE B 1 270 ? 25.825  -6.601  35.843  1.00 23.93 ? 313 PHE B CZ  1 
ATOM   6107 N  N   . GLU B 1 271 ? 29.045  -4.789  31.367  1.00 30.22 ? 314 GLU B N   1 
ATOM   6108 C  CA  . GLU B 1 271 ? 28.699  -3.397  31.093  1.00 30.05 ? 314 GLU B CA  1 
ATOM   6109 C  C   . GLU B 1 271 ? 27.752  -3.296  29.895  1.00 29.61 ? 314 GLU B C   1 
ATOM   6110 O  O   . GLU B 1 271 ? 26.687  -2.678  29.983  1.00 29.22 ? 314 GLU B O   1 
ATOM   6111 C  CB  . GLU B 1 271 ? 29.974  -2.588  30.814  1.00 29.94 ? 314 GLU B CB  1 
ATOM   6112 C  CG  . GLU B 1 271 ? 30.869  -2.288  32.035  1.00 32.19 ? 314 GLU B CG  1 
ATOM   6113 C  CD  . GLU B 1 271 ? 31.437  -3.533  32.768  1.00 34.26 ? 314 GLU B CD  1 
ATOM   6114 O  OE1 . GLU B 1 271 ? 31.917  -4.483  32.092  1.00 34.23 ? 314 GLU B OE1 1 
ATOM   6115 O  OE2 . GLU B 1 271 ? 31.406  -3.543  34.032  1.00 33.96 ? 314 GLU B OE2 1 
ATOM   6116 N  N   . ASP B 1 272 ? 28.147  -3.912  28.784  1.00 29.08 ? 315 ASP B N   1 
ATOM   6117 C  CA  . ASP B 1 272 ? 27.342  -3.905  27.573  1.00 29.11 ? 315 ASP B CA  1 
ATOM   6118 C  C   . ASP B 1 272 ? 26.034  -4.692  27.705  1.00 29.01 ? 315 ASP B C   1 
ATOM   6119 O  O   . ASP B 1 272 ? 24.972  -4.233  27.273  1.00 28.99 ? 315 ASP B O   1 
ATOM   6120 C  CB  . ASP B 1 272 ? 28.167  -4.412  26.391  1.00 29.44 ? 315 ASP B CB  1 
ATOM   6121 C  CG  . ASP B 1 272 ? 29.201  -3.395  25.920  1.00 29.52 ? 315 ASP B CG  1 
ATOM   6122 O  OD1 . ASP B 1 272 ? 28.886  -2.189  25.866  1.00 30.53 ? 315 ASP B OD1 1 
ATOM   6123 O  OD2 . ASP B 1 272 ? 30.328  -3.801  25.592  1.00 30.24 ? 315 ASP B OD2 1 
ATOM   6124 N  N   . ILE B 1 273 ? 26.110  -5.871  28.309  1.00 28.90 ? 316 ILE B N   1 
ATOM   6125 C  CA  . ILE B 1 273 ? 24.930  -6.690  28.516  1.00 28.55 ? 316 ILE B CA  1 
ATOM   6126 C  C   . ILE B 1 273 ? 23.871  -5.897  29.265  1.00 28.38 ? 316 ILE B C   1 
ATOM   6127 O  O   . ILE B 1 273 ? 22.724  -5.827  28.835  1.00 28.59 ? 316 ILE B O   1 
ATOM   6128 C  CB  . ILE B 1 273 ? 25.275  -7.989  29.271  1.00 28.67 ? 316 ILE B CB  1 
ATOM   6129 C  CG1 . ILE B 1 273 ? 26.000  -8.962  28.328  1.00 29.37 ? 316 ILE B CG1 1 
ATOM   6130 C  CG2 . ILE B 1 273 ? 24.021  -8.624  29.861  1.00 28.16 ? 316 ILE B CG2 1 
ATOM   6131 C  CD1 . ILE B 1 273 ? 26.544  -10.235 29.002  1.00 28.32 ? 316 ILE B CD1 1 
ATOM   6132 N  N   . LYS B 1 274 ? 24.261  -5.287  30.379  1.00 28.08 ? 317 LYS B N   1 
ATOM   6133 C  CA  . LYS B 1 274 ? 23.331  -4.517  31.198  1.00 27.63 ? 317 LYS B CA  1 
ATOM   6134 C  C   . LYS B 1 274 ? 22.794  -3.277  30.463  1.00 26.85 ? 317 LYS B C   1 
ATOM   6135 O  O   . LYS B 1 274 ? 21.644  -2.872  30.655  1.00 26.84 ? 317 LYS B O   1 
ATOM   6136 C  CB  . LYS B 1 274 ? 23.999  -4.147  32.525  1.00 27.98 ? 317 LYS B CB  1 
ATOM   6137 C  CG  . LYS B 1 274 ? 23.055  -3.640  33.600  1.00 29.02 ? 317 LYS B CG  1 
ATOM   6138 C  CD  . LYS B 1 274 ? 23.272  -2.173  33.888  1.00 32.61 ? 317 LYS B CD  1 
ATOM   6139 C  CE  . LYS B 1 274 ? 24.300  -1.951  34.999  1.00 33.31 ? 317 LYS B CE  1 
ATOM   6140 N  NZ  . LYS B 1 274 ? 25.683  -2.065  34.466  1.00 34.72 ? 317 LYS B NZ  1 
ATOM   6141 N  N   . ALA B 1 275 ? 23.618  -2.679  29.613  1.00 26.01 ? 318 ALA B N   1 
ATOM   6142 C  CA  . ALA B 1 275 ? 23.156  -1.541  28.816  1.00 25.42 ? 318 ALA B CA  1 
ATOM   6143 C  C   . ALA B 1 275 ? 22.024  -1.981  27.876  1.00 24.72 ? 318 ALA B C   1 
ATOM   6144 O  O   . ALA B 1 275 ? 20.990  -1.309  27.765  1.00 24.57 ? 318 ALA B O   1 
ATOM   6145 C  CB  . ALA B 1 275 ? 24.301  -0.923  28.039  1.00 25.36 ? 318 ALA B CB  1 
ATOM   6146 N  N   . ASN B 1 276 ? 22.225  -3.128  27.232  1.00 23.66 ? 319 ASN B N   1 
ATOM   6147 C  CA  . ASN B 1 276 ? 21.248  -3.686  26.306  1.00 22.86 ? 319 ASN B CA  1 
ATOM   6148 C  C   . ASN B 1 276 ? 19.994  -4.276  26.956  1.00 22.48 ? 319 ASN B C   1 
ATOM   6149 O  O   . ASN B 1 276 ? 18.894  -4.159  26.399  1.00 22.93 ? 319 ASN B O   1 
ATOM   6150 C  CB  . ASN B 1 276 ? 21.925  -4.644  25.333  1.00 22.45 ? 319 ASN B CB  1 
ATOM   6151 C  CG  . ASN B 1 276 ? 22.802  -3.903  24.328  1.00 22.85 ? 319 ASN B CG  1 
ATOM   6152 O  OD1 . ASN B 1 276 ? 22.309  -3.084  23.547  1.00 23.11 ? 319 ASN B OD1 1 
ATOM   6153 N  ND2 . ASN B 1 276 ? 24.102  -4.166  24.357  1.00 20.81 ? 319 ASN B ND2 1 
ATOM   6154 N  N   . VAL B 1 277 ? 20.142  -4.879  28.134  1.00 21.53 ? 320 VAL B N   1 
ATOM   6155 C  CA  . VAL B 1 277 ? 18.985  -5.322  28.898  1.00 20.94 ? 320 VAL B CA  1 
ATOM   6156 C  C   . VAL B 1 277 ? 18.059  -4.137  29.174  1.00 21.13 ? 320 VAL B C   1 
ATOM   6157 O  O   . VAL B 1 277 ? 16.835  -4.225  28.959  1.00 20.87 ? 320 VAL B O   1 
ATOM   6158 C  CB  . VAL B 1 277 ? 19.393  -6.054  30.193  1.00 20.83 ? 320 VAL B CB  1 
ATOM   6159 C  CG1 . VAL B 1 277 ? 18.225  -6.192  31.142  1.00 20.45 ? 320 VAL B CG1 1 
ATOM   6160 C  CG2 . VAL B 1 277 ? 19.945  -7.437  29.859  1.00 21.19 ? 320 VAL B CG2 1 
ATOM   6161 N  N   . THR B 1 278 ? 18.650  -3.022  29.605  1.00 21.23 ? 321 THR B N   1 
ATOM   6162 C  CA  . THR B 1 278 ? 17.896  -1.795  29.851  1.00 21.77 ? 321 THR B CA  1 
ATOM   6163 C  C   . THR B 1 278 ? 17.092  -1.335  28.624  1.00 21.57 ? 321 THR B C   1 
ATOM   6164 O  O   . THR B 1 278 ? 15.903  -1.021  28.741  1.00 21.54 ? 321 THR B O   1 
ATOM   6165 C  CB  . THR B 1 278 ? 18.816  -0.659  30.365  1.00 22.02 ? 321 THR B CB  1 
ATOM   6166 O  OG1 . THR B 1 278 ? 19.559  -1.132  31.489  1.00 24.48 ? 321 THR B OG1 1 
ATOM   6167 C  CG2 . THR B 1 278 ? 18.012  0.568   30.800  1.00 21.08 ? 321 THR B CG2 1 
ATOM   6168 N  N   . GLU B 1 279 ? 17.733  -1.317  27.459  1.00 21.65 ? 322 GLU B N   1 
ATOM   6169 C  CA  . GLU B 1 279 ? 17.078  -0.863  26.230  1.00 21.99 ? 322 GLU B CA  1 
ATOM   6170 C  C   . GLU B 1 279 ? 16.012  -1.835  25.753  1.00 21.84 ? 322 GLU B C   1 
ATOM   6171 O  O   . GLU B 1 279 ? 14.936  -1.415  25.327  1.00 21.83 ? 322 GLU B O   1 
ATOM   6172 C  CB  . GLU B 1 279 ? 18.095  -0.595  25.116  1.00 21.77 ? 322 GLU B CB  1 
ATOM   6173 C  CG  . GLU B 1 279 ? 19.027  0.529   25.454  1.00 22.54 ? 322 GLU B CG  1 
ATOM   6174 C  CD  . GLU B 1 279 ? 19.933  0.918   24.311  1.00 24.59 ? 322 GLU B CD  1 
ATOM   6175 O  OE1 . GLU B 1 279 ? 20.017  0.161   23.319  1.00 26.78 ? 322 GLU B OE1 1 
ATOM   6176 O  OE2 . GLU B 1 279 ? 20.576  1.987   24.408  1.00 25.72 ? 322 GLU B OE2 1 
ATOM   6177 N  N   . MET B 1 280 ? 16.314  -3.126  25.836  1.00 21.96 ? 323 MET B N   1 
ATOM   6178 C  CA  . MET B 1 280 ? 15.352  -4.161  25.468  1.00 22.27 ? 323 MET B CA  1 
ATOM   6179 C  C   . MET B 1 280 ? 14.119  -4.093  26.352  1.00 21.90 ? 323 MET B C   1 
ATOM   6180 O  O   . MET B 1 280 ? 13.001  -4.250  25.861  1.00 21.64 ? 323 MET B O   1 
ATOM   6181 C  CB  . MET B 1 280 ? 15.993  -5.554  25.487  1.00 22.40 ? 323 MET B CB  1 
ATOM   6182 C  CG  . MET B 1 280 ? 16.686  -5.882  24.162  1.00 23.93 ? 323 MET B CG  1 
ATOM   6183 S  SD  . MET B 1 280 ? 17.724  -7.372  24.089  1.00 29.28 ? 323 MET B SD  1 
ATOM   6184 C  CE  . MET B 1 280 ? 17.256  -8.316  25.529  1.00 28.89 ? 323 MET B CE  1 
ATOM   6185 N  N   . LEU B 1 281 ? 14.323  -3.805  27.639  1.00 21.72 ? 324 LEU B N   1 
ATOM   6186 C  CA  . LEU B 1 281 ? 13.208  -3.702  28.585  1.00 21.48 ? 324 LEU B CA  1 
ATOM   6187 C  C   . LEU B 1 281 ? 12.370  -2.482  28.301  1.00 21.26 ? 324 LEU B C   1 
ATOM   6188 O  O   . LEU B 1 281 ? 11.142  -2.551  28.331  1.00 21.45 ? 324 LEU B O   1 
ATOM   6189 C  CB  . LEU B 1 281 ? 13.685  -3.652  30.030  1.00 21.46 ? 324 LEU B CB  1 
ATOM   6190 C  CG  . LEU B 1 281 ? 14.262  -4.917  30.653  1.00 21.92 ? 324 LEU B CG  1 
ATOM   6191 C  CD1 . LEU B 1 281 ? 14.956  -4.515  31.942  1.00 23.35 ? 324 LEU B CD1 1 
ATOM   6192 C  CD2 . LEU B 1 281 ? 13.178  -5.952  30.917  1.00 22.20 ? 324 LEU B CD2 1 
ATOM   6193 N  N   . ALA B 1 282 ? 13.029  -1.364  28.022  1.00 20.61 ? 325 ALA B N   1 
ATOM   6194 C  CA  . ALA B 1 282 ? 12.299  -0.141  27.754  1.00 20.46 ? 325 ALA B CA  1 
ATOM   6195 C  C   . ALA B 1 282 ? 11.614  -0.214  26.387  1.00 20.29 ? 325 ALA B C   1 
ATOM   6196 O  O   . ALA B 1 282 ? 10.534  0.341   26.193  1.00 20.50 ? 325 ALA B O   1 
ATOM   6197 C  CB  . ALA B 1 282 ? 13.221  1.062   27.849  1.00 20.27 ? 325 ALA B CB  1 
ATOM   6198 N  N   . GLY B 1 283 ? 12.249  -0.899  25.442  1.00 19.96 ? 326 GLY B N   1 
ATOM   6199 C  CA  . GLY B 1 283 ? 11.690  -1.054  24.109  1.00 20.00 ? 326 GLY B CA  1 
ATOM   6200 C  C   . GLY B 1 283 ? 10.453  -1.933  24.108  1.00 19.95 ? 326 GLY B C   1 
ATOM   6201 O  O   . GLY B 1 283 ? 9.558   -1.754  23.287  1.00 19.91 ? 326 GLY B O   1 
ATOM   6202 N  N   . GLY B 1 284 ? 10.400  -2.864  25.051  1.00 19.99 ? 327 GLY B N   1 
ATOM   6203 C  CA  . GLY B 1 284 ? 9.376   -3.885  25.060  1.00 20.57 ? 327 GLY B CA  1 
ATOM   6204 C  C   . GLY B 1 284 ? 7.975   -3.481  25.479  1.00 20.70 ? 327 GLY B C   1 
ATOM   6205 O  O   . GLY B 1 284 ? 7.012   -4.140  25.101  1.00 21.27 ? 327 GLY B O   1 
ATOM   6206 N  N   . VAL B 1 285 ? 7.847   -2.403  26.245  1.00 20.44 ? 328 VAL B N   1 
ATOM   6207 C  CA  . VAL B 1 285 ? 6.599   -2.128  26.975  1.00 20.16 ? 328 VAL B CA  1 
ATOM   6208 C  C   . VAL B 1 285 ? 5.512   -1.377  26.162  1.00 20.47 ? 328 VAL B C   1 
ATOM   6209 O  O   . VAL B 1 285 ? 4.337   -1.764  26.177  1.00 20.41 ? 328 VAL B O   1 
ATOM   6210 C  CB  . VAL B 1 285 ? 6.906   -1.382  28.304  1.00 19.93 ? 328 VAL B CB  1 
ATOM   6211 C  CG1 . VAL B 1 285 ? 5.640   -1.020  29.041  1.00 18.44 ? 328 VAL B CG1 1 
ATOM   6212 C  CG2 . VAL B 1 285 ? 7.828   -2.222  29.181  1.00 19.91 ? 328 VAL B CG2 1 
ATOM   6213 N  N   . ASP B 1 286 ? 5.894   -0.300  25.479  1.00 20.06 ? 329 ASP B N   1 
ATOM   6214 C  CA  . ASP B 1 286 ? 4.898   0.584   24.857  1.00 20.02 ? 329 ASP B CA  1 
ATOM   6215 C  C   . ASP B 1 286 ? 4.616   0.258   23.385  1.00 19.65 ? 329 ASP B C   1 
ATOM   6216 O  O   . ASP B 1 286 ? 3.616   0.709   22.830  1.00 19.60 ? 329 ASP B O   1 
ATOM   6217 C  CB  . ASP B 1 286 ? 5.321   2.053   25.002  1.00 19.68 ? 329 ASP B CB  1 
ATOM   6218 C  CG  . ASP B 1 286 ? 5.144   2.579   26.415  1.00 21.32 ? 329 ASP B CG  1 
ATOM   6219 O  OD1 . ASP B 1 286 ? 4.799   1.789   27.332  1.00 23.00 ? 329 ASP B OD1 1 
ATOM   6220 O  OD2 . ASP B 1 286 ? 5.344   3.796   26.613  1.00 21.48 ? 329 ASP B OD2 1 
ATOM   6221 N  N   . THR B 1 287 ? 5.509   -0.514  22.771  1.00 19.01 ? 330 THR B N   1 
ATOM   6222 C  CA  . THR B 1 287 ? 5.447   -0.810  21.352  1.00 18.81 ? 330 THR B CA  1 
ATOM   6223 C  C   . THR B 1 287 ? 4.407   -1.895  21.076  1.00 18.42 ? 330 THR B C   1 
ATOM   6224 O  O   . THR B 1 287 ? 3.393   -1.664  20.415  1.00 18.80 ? 330 THR B O   1 
ATOM   6225 C  CB  . THR B 1 287 ? 6.823   -1.286  20.831  1.00 18.70 ? 330 THR B CB  1 
ATOM   6226 O  OG1 . THR B 1 287 ? 7.301   -2.343  21.668  1.00 18.81 ? 330 THR B OG1 1 
ATOM   6227 C  CG2 . THR B 1 287 ? 7.836   -0.151  20.821  1.00 18.57 ? 330 THR B CG2 1 
ATOM   6228 N  N   . THR B 1 288 ? 4.691   -3.077  21.588  1.00 18.05 ? 331 THR B N   1 
ATOM   6229 C  CA  . THR B 1 288 ? 3.820   -4.233  21.523  1.00 17.94 ? 331 THR B CA  1 
ATOM   6230 C  C   . THR B 1 288 ? 2.398   -3.989  22.084  1.00 18.01 ? 331 THR B C   1 
ATOM   6231 O  O   . THR B 1 288 ? 1.402   -4.393  21.477  1.00 17.98 ? 331 THR B O   1 
ATOM   6232 C  CB  . THR B 1 288 ? 4.523   -5.361  22.273  1.00 17.74 ? 331 THR B CB  1 
ATOM   6233 O  OG1 . THR B 1 288 ? 5.299   -6.121  21.342  1.00 17.53 ? 331 THR B OG1 1 
ATOM   6234 C  CG2 . THR B 1 288 ? 3.549   -6.242  22.956  1.00 18.83 ? 331 THR B CG2 1 
ATOM   6235 N  N   . SER B 1 289 ? 2.306   -3.311  23.225  1.00 17.78 ? 332 SER B N   1 
ATOM   6236 C  CA  . SER B 1 289 ? 1.015   -2.992  23.829  1.00 17.93 ? 332 SER B CA  1 
ATOM   6237 C  C   . SER B 1 289 ? 0.114   -2.119  22.943  1.00 18.09 ? 332 SER B C   1 
ATOM   6238 O  O   . SER B 1 289 ? -1.083  -2.399  22.811  1.00 18.06 ? 332 SER B O   1 
ATOM   6239 C  CB  . SER B 1 289 ? 1.238   -2.286  25.159  1.00 17.95 ? 332 SER B CB  1 
ATOM   6240 O  OG  . SER B 1 289 ? 2.103   -1.181  24.964  1.00 17.89 ? 332 SER B OG  1 
ATOM   6241 N  N   . MET B 1 290 ? 0.679   -1.066  22.344  1.00 18.13 ? 333 MET B N   1 
ATOM   6242 C  CA  . MET B 1 290 ? -0.108  -0.174  21.487  1.00 18.09 ? 333 MET B CA  1 
ATOM   6243 C  C   . MET B 1 290 ? -0.567  -0.855  20.201  1.00 17.66 ? 333 MET B C   1 
ATOM   6244 O  O   . MET B 1 290 ? -1.701  -0.641  19.748  1.00 16.93 ? 333 MET B O   1 
ATOM   6245 C  CB  . MET B 1 290 ? 0.642   1.129   21.187  1.00 18.30 ? 333 MET B CB  1 
ATOM   6246 C  CG  . MET B 1 290 ? 0.766   2.064   22.399  1.00 20.34 ? 333 MET B CG  1 
ATOM   6247 S  SD  . MET B 1 290 ? -0.816  2.435   23.204  1.00 22.63 ? 333 MET B SD  1 
ATOM   6248 C  CE  . MET B 1 290 ? -1.037  1.054   24.326  1.00 21.81 ? 333 MET B CE  1 
ATOM   6249 N  N   . THR B 1 291 ? 0.315   -1.690  19.643  1.00 17.32 ? 334 THR B N   1 
ATOM   6250 C  CA  . THR B 1 291 ? 0.071   -2.375  18.368  1.00 16.88 ? 334 THR B CA  1 
ATOM   6251 C  C   . THR B 1 291 ? -1.064  -3.391  18.501  1.00 16.62 ? 334 THR B C   1 
ATOM   6252 O  O   . THR B 1 291 ? -1.963  -3.434  17.655  1.00 16.43 ? 334 THR B O   1 
ATOM   6253 C  CB  . THR B 1 291 ? 1.354   -3.029  17.838  1.00 16.90 ? 334 THR B CB  1 
ATOM   6254 O  OG1 . THR B 1 291 ? 2.394   -2.036  17.768  1.00 17.19 ? 334 THR B OG1 1 
ATOM   6255 C  CG2 . THR B 1 291 ? 1.141   -3.632  16.462  1.00 17.17 ? 334 THR B CG2 1 
ATOM   6256 N  N   . LEU B 1 292 ? -1.047  -4.160  19.587  1.00 16.01 ? 335 LEU B N   1 
ATOM   6257 C  CA  . LEU B 1 292 ? -2.124  -5.087  19.907  1.00 15.58 ? 335 LEU B CA  1 
ATOM   6258 C  C   . LEU B 1 292 ? -3.444  -4.364  20.148  1.00 15.51 ? 335 LEU B C   1 
ATOM   6259 O  O   . LEU B 1 292 ? -4.512  -4.834  19.745  1.00 15.21 ? 335 LEU B O   1 
ATOM   6260 C  CB  . LEU B 1 292 ? -1.747  -5.913  21.136  1.00 15.67 ? 335 LEU B CB  1 
ATOM   6261 C  CG  . LEU B 1 292 ? -0.624  -6.919  20.913  1.00 16.47 ? 335 LEU B CG  1 
ATOM   6262 C  CD1 . LEU B 1 292 ? -0.164  -7.552  22.224  1.00 16.08 ? 335 LEU B CD1 1 
ATOM   6263 C  CD2 . LEU B 1 292 ? -1.109  -7.991  19.911  1.00 16.99 ? 335 LEU B CD2 1 
ATOM   6264 N  N   . GLN B 1 293 ? -3.376  -3.213  20.806  1.00 15.63 ? 336 GLN B N   1 
ATOM   6265 C  CA  . GLN B 1 293 ? -4.577  -2.443  21.061  1.00 15.70 ? 336 GLN B CA  1 
ATOM   6266 C  C   . GLN B 1 293 ? -5.190  -1.984  19.741  1.00 15.81 ? 336 GLN B C   1 
ATOM   6267 O  O   . GLN B 1 293 ? -6.424  -2.006  19.580  1.00 16.25 ? 336 GLN B O   1 
ATOM   6268 C  CB  . GLN B 1 293 ? -4.302  -1.243  21.965  1.00 15.44 ? 336 GLN B CB  1 
ATOM   6269 C  CG  . GLN B 1 293 ? -5.586  -0.595  22.477  1.00 15.84 ? 336 GLN B CG  1 
ATOM   6270 C  CD  . GLN B 1 293 ? -5.349  0.600   23.375  1.00 16.32 ? 336 GLN B CD  1 
ATOM   6271 O  OE1 . GLN B 1 293 ? -6.055  0.790   24.377  1.00 16.88 ? 336 GLN B OE1 1 
ATOM   6272 N  NE2 . GLN B 1 293 ? -4.357  1.417   23.027  1.00 14.63 ? 336 GLN B NE2 1 
ATOM   6273 N  N   . TRP B 1 294 ? -4.335  -1.581  18.804  1.00 15.31 ? 337 TRP B N   1 
ATOM   6274 C  CA  . TRP B 1 294 ? -4.801  -1.181  17.474  1.00 15.29 ? 337 TRP B CA  1 
ATOM   6275 C  C   . TRP B 1 294 ? -5.373  -2.376  16.720  1.00 15.73 ? 337 TRP B C   1 
ATOM   6276 O  O   . TRP B 1 294 ? -6.390  -2.273  16.044  1.00 15.50 ? 337 TRP B O   1 
ATOM   6277 C  CB  . TRP B 1 294 ? -3.655  -0.601  16.652  1.00 14.78 ? 337 TRP B CB  1 
ATOM   6278 C  CG  . TRP B 1 294 ? -3.366  0.835   16.875  1.00 13.61 ? 337 TRP B CG  1 
ATOM   6279 C  CD1 . TRP B 1 294 ? -2.164  1.381   17.215  1.00 12.09 ? 337 TRP B CD1 1 
ATOM   6280 C  CD2 . TRP B 1 294 ? -4.282  1.928   16.739  1.00 14.37 ? 337 TRP B CD2 1 
ATOM   6281 N  NE1 . TRP B 1 294 ? -2.269  2.747   17.296  1.00 13.43 ? 337 TRP B NE1 1 
ATOM   6282 C  CE2 . TRP B 1 294 ? -3.564  3.110   17.031  1.00 13.84 ? 337 TRP B CE2 1 
ATOM   6283 C  CE3 . TRP B 1 294 ? -5.643  2.026   16.403  1.00 13.13 ? 337 TRP B CE3 1 
ATOM   6284 C  CZ2 . TRP B 1 294 ? -4.152  4.371   16.987  1.00 13.28 ? 337 TRP B CZ2 1 
ATOM   6285 C  CZ3 . TRP B 1 294 ? -6.233  3.289   16.374  1.00 12.77 ? 337 TRP B CZ3 1 
ATOM   6286 C  CH2 . TRP B 1 294 ? -5.486  4.440   16.666  1.00 13.18 ? 337 TRP B CH2 1 
ATOM   6287 N  N   . HIS B 1 295 ? -4.685  -3.507  16.821  1.00 16.43 ? 338 HIS B N   1 
ATOM   6288 C  CA  . HIS B 1 295 ? -5.137  -4.714  16.183  1.00 17.11 ? 338 HIS B CA  1 
ATOM   6289 C  C   . HIS B 1 295 ? -6.530  -5.042  16.696  1.00 17.58 ? 338 HIS B C   1 
ATOM   6290 O  O   . HIS B 1 295 ? -7.443  -5.300  15.913  1.00 17.82 ? 338 HIS B O   1 
ATOM   6291 C  CB  . HIS B 1 295 ? -4.176  -5.877  16.439  1.00 16.98 ? 338 HIS B CB  1 
ATOM   6292 C  CG  . HIS B 1 295 ? -4.542  -7.106  15.683  1.00 17.12 ? 338 HIS B CG  1 
ATOM   6293 N  ND1 . HIS B 1 295 ? -3.796  -7.578  14.625  1.00 18.41 ? 338 HIS B ND1 1 
ATOM   6294 C  CD2 . HIS B 1 295 ? -5.618  -7.921  15.781  1.00 16.46 ? 338 HIS B CD2 1 
ATOM   6295 C  CE1 . HIS B 1 295 ? -4.379  -8.655  14.124  1.00 17.98 ? 338 HIS B CE1 1 
ATOM   6296 N  NE2 . HIS B 1 295 ? -5.491  -8.877  14.801  1.00 17.96 ? 338 HIS B NE2 1 
ATOM   6297 N  N   . LEU B 1 296 ? -6.698  -5.008  18.016  1.00 18.31 ? 339 LEU B N   1 
ATOM   6298 C  CA  . LEU B 1 296 ? -7.994  -5.310  18.628  1.00 18.39 ? 339 LEU B CA  1 
ATOM   6299 C  C   . LEU B 1 296 ? -9.053  -4.361  18.112  1.00 18.80 ? 339 LEU B C   1 
ATOM   6300 O  O   . LEU B 1 296 ? -10.152 -4.787  17.761  1.00 18.94 ? 339 LEU B O   1 
ATOM   6301 C  CB  . LEU B 1 296 ? -7.907  -5.238  20.151  1.00 17.95 ? 339 LEU B CB  1 
ATOM   6302 C  CG  . LEU B 1 296 ? -7.166  -6.394  20.822  1.00 18.18 ? 339 LEU B CG  1 
ATOM   6303 C  CD1 . LEU B 1 296 ? -6.939  -6.086  22.302  1.00 14.76 ? 339 LEU B CD1 1 
ATOM   6304 C  CD2 . LEU B 1 296 ? -7.906  -7.746  20.611  1.00 17.92 ? 339 LEU B CD2 1 
ATOM   6305 N  N   . TYR B 1 297 ? -8.700  -3.078  18.064  1.00 19.29 ? 340 TYR B N   1 
ATOM   6306 C  CA  . TYR B 1 297 ? -9.554  -2.043  17.497  1.00 20.10 ? 340 TYR B CA  1 
ATOM   6307 C  C   . TYR B 1 297 ? -9.901  -2.323  16.029  1.00 20.45 ? 340 TYR B C   1 
ATOM   6308 O  O   . TYR B 1 297 ? -11.052 -2.203  15.635  1.00 20.45 ? 340 TYR B O   1 
ATOM   6309 C  CB  . TYR B 1 297 ? -8.890  -0.678  17.673  1.00 19.84 ? 340 TYR B CB  1 
ATOM   6310 C  CG  . TYR B 1 297 ? -9.492  0.475   16.905  1.00 20.02 ? 340 TYR B CG  1 
ATOM   6311 C  CD1 . TYR B 1 297 ? -10.558 1.206   17.421  1.00 21.86 ? 340 TYR B CD1 1 
ATOM   6312 C  CD2 . TYR B 1 297 ? -8.951  0.882   15.697  1.00 22.26 ? 340 TYR B CD2 1 
ATOM   6313 C  CE1 . TYR B 1 297 ? -11.097 2.302   16.733  1.00 22.85 ? 340 TYR B CE1 1 
ATOM   6314 C  CE2 . TYR B 1 297 ? -9.476  1.984   14.999  1.00 23.38 ? 340 TYR B CE2 1 
ATOM   6315 C  CZ  . TYR B 1 297 ? -10.551 2.677   15.522  1.00 23.82 ? 340 TYR B CZ  1 
ATOM   6316 O  OH  . TYR B 1 297 ? -11.067 3.752   14.825  1.00 26.53 ? 340 TYR B OH  1 
ATOM   6317 N  N   . GLU B 1 298 ? -8.918  -2.719  15.231  1.00 21.21 ? 341 GLU B N   1 
ATOM   6318 C  CA  . GLU B 1 298 ? -9.201  -3.075  13.830  1.00 22.46 ? 341 GLU B CA  1 
ATOM   6319 C  C   . GLU B 1 298 ? -10.112 -4.290  13.660  1.00 22.55 ? 341 GLU B C   1 
ATOM   6320 O  O   . GLU B 1 298 ? -10.905 -4.331  12.728  1.00 22.71 ? 341 GLU B O   1 
ATOM   6321 C  CB  . GLU B 1 298 ? -7.927  -3.236  13.005  1.00 22.13 ? 341 GLU B CB  1 
ATOM   6322 C  CG  . GLU B 1 298 ? -7.153  -1.932  12.802  1.00 24.17 ? 341 GLU B CG  1 
ATOM   6323 C  CD  . GLU B 1 298 ? -7.989  -0.831  12.174  1.00 25.87 ? 341 GLU B CD  1 
ATOM   6324 O  OE1 . GLU B 1 298 ? -7.638  0.360   12.343  1.00 27.58 ? 341 GLU B OE1 1 
ATOM   6325 O  OE2 . GLU B 1 298 ? -8.995  -1.155  11.511  1.00 27.32 ? 341 GLU B OE2 1 
ATOM   6326 N  N   . MET B 1 299 ? -10.004 -5.261  14.565  1.00 22.90 ? 342 MET B N   1 
ATOM   6327 C  CA  . MET B 1 299 ? -10.857 -6.447  14.531  1.00 23.17 ? 342 MET B CA  1 
ATOM   6328 C  C   . MET B 1 299 ? -12.266 -6.113  14.960  1.00 23.87 ? 342 MET B C   1 
ATOM   6329 O  O   . MET B 1 299 ? -13.226 -6.751  14.517  1.00 23.95 ? 342 MET B O   1 
ATOM   6330 C  CB  . MET B 1 299 ? -10.308 -7.545  15.437  1.00 22.97 ? 342 MET B CB  1 
ATOM   6331 C  CG  . MET B 1 299 ? -9.099  -8.262  14.874  1.00 22.41 ? 342 MET B CG  1 
ATOM   6332 S  SD  . MET B 1 299 ? -8.922  -9.924  15.548  1.00 22.66 ? 342 MET B SD  1 
ATOM   6333 C  CE  . MET B 1 299 ? -8.301  -9.598  17.195  1.00 22.23 ? 342 MET B CE  1 
ATOM   6334 N  N   . ALA B 1 300 ? -12.394 -5.123  15.838  1.00 24.50 ? 343 ALA B N   1 
ATOM   6335 C  CA  . ALA B 1 300 ? -13.715 -4.727  16.305  1.00 25.26 ? 343 ALA B CA  1 
ATOM   6336 C  C   . ALA B 1 300 ? -14.406 -3.873  15.251  1.00 25.83 ? 343 ALA B C   1 
ATOM   6337 O  O   . ALA B 1 300 ? -15.633 -3.871  15.160  1.00 25.55 ? 343 ALA B O   1 
ATOM   6338 C  CB  . ALA B 1 300 ? -13.624 -3.991  17.615  1.00 25.07 ? 343 ALA B CB  1 
ATOM   6339 N  N   . ARG B 1 301 ? -13.599 -3.158  14.467  1.00 26.61 ? 344 ARG B N   1 
ATOM   6340 C  CA  . ARG B 1 301 ? -14.084 -2.276  13.413  1.00 27.67 ? 344 ARG B CA  1 
ATOM   6341 C  C   . ARG B 1 301 ? -14.477 -3.059  12.158  1.00 27.82 ? 344 ARG B C   1 
ATOM   6342 O  O   . ARG B 1 301 ? -15.252 -2.568  11.344  1.00 28.20 ? 344 ARG B O   1 
ATOM   6343 C  CB  . ARG B 1 301 ? -13.024 -1.227  13.055  1.00 27.95 ? 344 ARG B CB  1 
ATOM   6344 C  CG  . ARG B 1 301 ? -13.334 0.198   13.506  1.00 30.27 ? 344 ARG B CG  1 
ATOM   6345 C  CD  . ARG B 1 301 ? -12.384 1.225   12.853  1.00 33.46 ? 344 ARG B CD  1 
ATOM   6346 N  NE  . ARG B 1 301 ? -12.633 1.478   11.424  1.00 36.20 ? 344 ARG B NE  1 
ATOM   6347 C  CZ  . ARG B 1 301 ? -11.812 1.147   10.411  1.00 37.91 ? 344 ARG B CZ  1 
ATOM   6348 N  NH1 . ARG B 1 301 ? -10.654 0.530   10.619  1.00 37.17 ? 344 ARG B NH1 1 
ATOM   6349 N  NH2 . ARG B 1 301 ? -12.151 1.444   9.158   1.00 38.38 ? 344 ARG B NH2 1 
ATOM   6350 N  N   . ASN B 1 302 ? -13.923 -4.263  12.001  1.00 27.91 ? 345 ASN B N   1 
ATOM   6351 C  CA  . ASN B 1 302 ? -14.188 -5.105  10.841  1.00 27.79 ? 345 ASN B CA  1 
ATOM   6352 C  C   . ASN B 1 302 ? -14.544 -6.517  11.284  1.00 27.16 ? 345 ASN B C   1 
ATOM   6353 O  O   . ASN B 1 302 ? -13.705 -7.418  11.268  1.00 26.81 ? 345 ASN B O   1 
ATOM   6354 C  CB  . ASN B 1 302 ? -12.994 -5.101  9.877   1.00 28.00 ? 345 ASN B CB  1 
ATOM   6355 C  CG  . ASN B 1 302 ? -12.609 -3.687  9.420   1.00 30.71 ? 345 ASN B CG  1 
ATOM   6356 O  OD1 . ASN B 1 302 ? -13.013 -3.248  8.337   1.00 33.86 ? 345 ASN B OD1 1 
ATOM   6357 N  ND2 . ASN B 1 302 ? -11.834 -2.963  10.251  1.00 31.09 ? 345 ASN B ND2 1 
ATOM   6358 N  N   . LEU B 1 303 ? -15.800 -6.699  11.679  1.00 26.89 ? 346 LEU B N   1 
ATOM   6359 C  CA  . LEU B 1 303 ? -16.257 -7.970  12.266  1.00 27.09 ? 346 LEU B CA  1 
ATOM   6360 C  C   . LEU B 1 303 ? -16.110 -9.204  11.371  1.00 26.77 ? 346 LEU B C   1 
ATOM   6361 O  O   . LEU B 1 303 ? -15.878 -10.297 11.876  1.00 27.20 ? 346 LEU B O   1 
ATOM   6362 C  CB  . LEU B 1 303 ? -17.676 -7.849  12.840  1.00 26.99 ? 346 LEU B CB  1 
ATOM   6363 C  CG  . LEU B 1 303 ? -17.819 -6.964  14.095  1.00 27.53 ? 346 LEU B CG  1 
ATOM   6364 C  CD1 . LEU B 1 303 ? -19.271 -6.868  14.556  1.00 28.17 ? 346 LEU B CD1 1 
ATOM   6365 C  CD2 . LEU B 1 303 ? -16.959 -7.454  15.250  1.00 27.12 ? 346 LEU B CD2 1 
ATOM   6366 N  N   . LYS B 1 304 ? -16.206 -9.024  10.057  1.00 26.77 ? 347 LYS B N   1 
ATOM   6367 C  CA  . LYS B 1 304 ? -16.010 -10.110 9.094   1.00 26.53 ? 347 LYS B CA  1 
ATOM   6368 C  C   . LYS B 1 304 ? -14.565 -10.589 9.068   1.00 25.66 ? 347 LYS B C   1 
ATOM   6369 O  O   . LYS B 1 304 ? -14.290 -11.800 8.962   1.00 25.54 ? 347 LYS B O   1 
ATOM   6370 C  CB  . LYS B 1 304 ? -16.447 -9.687  7.687   1.00 27.13 ? 347 LYS B CB  1 
ATOM   6371 C  CG  . LYS B 1 304 ? -17.855 -10.146 7.292   1.00 30.39 ? 347 LYS B CG  1 
ATOM   6372 C  CD  . LYS B 1 304 ? -18.927 -9.091  7.604   1.00 34.41 ? 347 LYS B CD  1 
ATOM   6373 C  CE  . LYS B 1 304 ? -20.221 -9.378  6.831   1.00 37.17 ? 347 LYS B CE  1 
ATOM   6374 N  NZ  . LYS B 1 304 ? -21.171 -8.206  6.861   1.00 39.52 ? 347 LYS B NZ  1 
ATOM   6375 N  N   . VAL B 1 305 ? -13.644 -9.637  9.168   1.00 24.81 ? 348 VAL B N   1 
ATOM   6376 C  CA  . VAL B 1 305 ? -12.224 -9.965  9.268   1.00 24.03 ? 348 VAL B CA  1 
ATOM   6377 C  C   . VAL B 1 305 ? -11.908 -10.690 10.582  1.00 23.53 ? 348 VAL B C   1 
ATOM   6378 O  O   . VAL B 1 305 ? -11.169 -11.675 10.575  1.00 23.50 ? 348 VAL B O   1 
ATOM   6379 C  CB  . VAL B 1 305 ? -11.331 -8.733  9.064   1.00 24.11 ? 348 VAL B CB  1 
ATOM   6380 C  CG1 . VAL B 1 305 ? -9.855  -9.111  9.169   1.00 23.88 ? 348 VAL B CG1 1 
ATOM   6381 C  CG2 . VAL B 1 305 ? -11.605 -8.120  7.703   1.00 23.84 ? 348 VAL B CG2 1 
ATOM   6382 N  N   . GLN B 1 306 ? -12.482 -10.228 11.692  1.00 22.86 ? 349 GLN B N   1 
ATOM   6383 C  CA  . GLN B 1 306 ? -12.315 -10.918 12.968  1.00 22.90 ? 349 GLN B CA  1 
ATOM   6384 C  C   . GLN B 1 306 ? -12.749 -12.397 12.865  1.00 23.49 ? 349 GLN B C   1 
ATOM   6385 O  O   . GLN B 1 306 ? -12.037 -13.300 13.333  1.00 23.11 ? 349 GLN B O   1 
ATOM   6386 C  CB  . GLN B 1 306 ? -13.059 -10.184 14.101  1.00 22.60 ? 349 GLN B CB  1 
ATOM   6387 C  CG  . GLN B 1 306 ? -12.783 -10.751 15.505  1.00 20.07 ? 349 GLN B CG  1 
ATOM   6388 C  CD  . GLN B 1 306 ? -13.537 -10.029 16.617  1.00 18.90 ? 349 GLN B CD  1 
ATOM   6389 O  OE1 . GLN B 1 306 ? -13.967 -8.878  16.470  1.00 20.41 ? 349 GLN B OE1 1 
ATOM   6390 N  NE2 . GLN B 1 306 ? -13.694 -10.703 17.743  1.00 15.44 ? 349 GLN B NE2 1 
ATOM   6391 N  N   . ASP B 1 307 ? -13.904 -12.635 12.239  1.00 24.14 ? 350 ASP B N   1 
ATOM   6392 C  CA  . ASP B 1 307 ? -14.398 -14.009 11.975  1.00 24.84 ? 350 ASP B CA  1 
ATOM   6393 C  C   . ASP B 1 307 ? -13.401 -14.871 11.179  1.00 24.99 ? 350 ASP B C   1 
ATOM   6394 O  O   . ASP B 1 307 ? -13.092 -16.002 11.571  1.00 24.98 ? 350 ASP B O   1 
ATOM   6395 C  CB  . ASP B 1 307 ? -15.765 -13.981 11.270  1.00 24.82 ? 350 ASP B CB  1 
ATOM   6396 C  CG  . ASP B 1 307 ? -16.916 -13.597 12.213  1.00 25.83 ? 350 ASP B CG  1 
ATOM   6397 O  OD1 . ASP B 1 307 ? -16.835 -13.907 13.420  1.00 25.48 ? 350 ASP B OD1 1 
ATOM   6398 O  OD2 . ASP B 1 307 ? -17.910 -12.994 11.740  1.00 26.78 ? 350 ASP B OD2 1 
ATOM   6399 N  N   . MET B 1 308 ? -12.894 -14.333 10.073  1.00 25.37 ? 351 MET B N   1 
ATOM   6400 C  CA  . MET B 1 308 ? -11.917 -15.054 9.261   1.00 25.93 ? 351 MET B CA  1 
ATOM   6401 C  C   . MET B 1 308 ? -10.663 -15.396 10.071  1.00 25.63 ? 351 MET B C   1 
ATOM   6402 O  O   . MET B 1 308 ? -10.131 -16.508 9.961   1.00 25.97 ? 351 MET B O   1 
ATOM   6403 C  CB  . MET B 1 308 ? -11.550 -14.253 8.012   1.00 26.44 ? 351 MET B CB  1 
ATOM   6404 C  CG  . MET B 1 308 ? -12.546 -14.381 6.861   1.00 29.61 ? 351 MET B CG  1 
ATOM   6405 S  SD  . MET B 1 308 ? -12.243 -13.202 5.499   1.00 38.53 ? 351 MET B SD  1 
ATOM   6406 C  CE  . MET B 1 308 ? -10.530 -13.566 5.030   1.00 35.09 ? 351 MET B CE  1 
ATOM   6407 N  N   . LEU B 1 309 ? -10.211 -14.455 10.903  1.00 24.85 ? 352 LEU B N   1 
ATOM   6408 C  CA  . LEU B 1 309 ? -9.023  -14.677 11.714  1.00 24.21 ? 352 LEU B CA  1 
ATOM   6409 C  C   . LEU B 1 309 ? -9.238  -15.745 12.776  1.00 24.06 ? 352 LEU B C   1 
ATOM   6410 O  O   . LEU B 1 309 ? -8.345  -16.562 13.025  1.00 23.62 ? 352 LEU B O   1 
ATOM   6411 C  CB  . LEU B 1 309 ? -8.527  -13.369 12.335  1.00 24.18 ? 352 LEU B CB  1 
ATOM   6412 C  CG  . LEU B 1 309 ? -7.887  -12.376 11.347  1.00 24.04 ? 352 LEU B CG  1 
ATOM   6413 C  CD1 . LEU B 1 309 ? -7.694  -11.033 12.021  1.00 25.15 ? 352 LEU B CD1 1 
ATOM   6414 C  CD2 . LEU B 1 309 ? -6.567  -12.881 10.786  1.00 22.04 ? 352 LEU B CD2 1 
ATOM   6415 N  N   . ARG B 1 310 ? -10.422 -15.743 13.388  1.00 23.84 ? 353 ARG B N   1 
ATOM   6416 C  CA  . ARG B 1 310 ? -10.764 -16.754 14.380  1.00 23.98 ? 353 ARG B CA  1 
ATOM   6417 C  C   . ARG B 1 310 ? -10.862 -18.141 13.728  1.00 24.38 ? 353 ARG B C   1 
ATOM   6418 O  O   . ARG B 1 310 ? -10.306 -19.109 14.251  1.00 24.68 ? 353 ARG B O   1 
ATOM   6419 C  CB  . ARG B 1 310 ? -12.067 -16.400 15.106  1.00 23.89 ? 353 ARG B CB  1 
ATOM   6420 C  CG  . ARG B 1 310 ? -12.472 -17.397 16.171  1.00 21.87 ? 353 ARG B CG  1 
ATOM   6421 C  CD  . ARG B 1 310 ? -13.663 -16.899 16.968  1.00 22.20 ? 353 ARG B CD  1 
ATOM   6422 N  NE  . ARG B 1 310 ? -13.315 -15.731 17.775  1.00 22.19 ? 353 ARG B NE  1 
ATOM   6423 C  CZ  . ARG B 1 310 ? -13.676 -14.476 17.505  1.00 22.97 ? 353 ARG B CZ  1 
ATOM   6424 N  NH1 . ARG B 1 310 ? -14.443 -14.168 16.455  1.00 21.26 ? 353 ARG B NH1 1 
ATOM   6425 N  NH2 . ARG B 1 310 ? -13.270 -13.514 18.311  1.00 24.73 ? 353 ARG B NH2 1 
ATOM   6426 N  N   . ALA B 1 311 ? -11.553 -18.227 12.588  1.00 24.43 ? 354 ALA B N   1 
ATOM   6427 C  CA  . ALA B 1 311 ? -11.663 -19.485 11.836  1.00 24.61 ? 354 ALA B CA  1 
ATOM   6428 C  C   . ALA B 1 311 ? -10.291 -20.075 11.541  1.00 25.15 ? 354 ALA B C   1 
ATOM   6429 O  O   . ALA B 1 311 ? -10.081 -21.289 11.695  1.00 25.45 ? 354 ALA B O   1 
ATOM   6430 C  CB  . ALA B 1 311 ? -12.441 -19.289 10.556  1.00 23.87 ? 354 ALA B CB  1 
ATOM   6431 N  N   . GLU B 1 312 ? -9.344  -19.223 11.155  1.00 25.59 ? 355 GLU B N   1 
ATOM   6432 C  CA  . GLU B 1 312 ? -8.011  -19.716 10.839  1.00 26.09 ? 355 GLU B CA  1 
ATOM   6433 C  C   . GLU B 1 312 ? -7.320  -20.276 12.075  1.00 26.15 ? 355 GLU B C   1 
ATOM   6434 O  O   . GLU B 1 312 ? -6.712  -21.345 12.005  1.00 26.32 ? 355 GLU B O   1 
ATOM   6435 C  CB  . GLU B 1 312 ? -7.138  -18.656 10.177  1.00 26.18 ? 355 GLU B CB  1 
ATOM   6436 C  CG  . GLU B 1 312 ? -5.849  -19.245 9.619   1.00 27.61 ? 355 GLU B CG  1 
ATOM   6437 C  CD  . GLU B 1 312 ? -4.905  -18.200 9.043   1.00 30.95 ? 355 GLU B CD  1 
ATOM   6438 O  OE1 . GLU B 1 312 ? -4.398  -17.356 9.810   1.00 31.51 ? 355 GLU B OE1 1 
ATOM   6439 O  OE2 . GLU B 1 312 ? -4.652  -18.238 7.819   1.00 32.32 ? 355 GLU B OE2 1 
ATOM   6440 N  N   . VAL B 1 313 ? -7.438  -19.571 13.202  1.00 25.89 ? 356 VAL B N   1 
ATOM   6441 C  CA  . VAL B 1 313 ? -6.768  -19.976 14.437  1.00 25.60 ? 356 VAL B CA  1 
ATOM   6442 C  C   . VAL B 1 313 ? -7.310  -21.297 14.983  1.00 25.78 ? 356 VAL B C   1 
ATOM   6443 O  O   . VAL B 1 313 ? -6.525  -22.152 15.400  1.00 25.59 ? 356 VAL B O   1 
ATOM   6444 C  CB  . VAL B 1 313 ? -6.815  -18.860 15.513  1.00 25.75 ? 356 VAL B CB  1 
ATOM   6445 C  CG1 . VAL B 1 313 ? -6.401  -19.394 16.871  1.00 25.27 ? 356 VAL B CG1 1 
ATOM   6446 C  CG2 . VAL B 1 313 ? -5.912  -17.701 15.112  1.00 25.13 ? 356 VAL B CG2 1 
ATOM   6447 N  N   . LEU B 1 314 ? -8.639  -21.456 14.971  1.00 25.89 ? 357 LEU B N   1 
ATOM   6448 C  CA  . LEU B 1 314 ? -9.299  -22.712 15.366  1.00 26.43 ? 357 LEU B CA  1 
ATOM   6449 C  C   . LEU B 1 314 ? -8.853  -23.889 14.506  1.00 26.86 ? 357 LEU B C   1 
ATOM   6450 O  O   . LEU B 1 314 ? -8.555  -24.961 15.028  1.00 26.52 ? 357 LEU B O   1 
ATOM   6451 C  CB  . LEU B 1 314 ? -10.829 -22.586 15.303  1.00 26.44 ? 357 LEU B CB  1 
ATOM   6452 C  CG  . LEU B 1 314 ? -11.576 -21.585 16.206  1.00 27.00 ? 357 LEU B CG  1 
ATOM   6453 C  CD1 . LEU B 1 314 ? -13.081 -21.813 16.111  1.00 25.78 ? 357 LEU B CD1 1 
ATOM   6454 C  CD2 . LEU B 1 314 ? -11.112 -21.638 17.671  1.00 25.47 ? 357 LEU B CD2 1 
ATOM   6455 N  N   . ALA B 1 315 ? -8.798  -23.677 13.190  1.00 27.57 ? 358 ALA B N   1 
ATOM   6456 C  CA  . ALA B 1 315 ? -8.327  -24.701 12.257  1.00 28.21 ? 358 ALA B CA  1 
ATOM   6457 C  C   . ALA B 1 315 ? -6.901  -25.085 12.576  1.00 28.87 ? 358 ALA B C   1 
ATOM   6458 O  O   . ALA B 1 315 ? -6.560  -26.271 12.589  1.00 29.54 ? 358 ALA B O   1 
ATOM   6459 C  CB  . ALA B 1 315 ? -8.435  -24.224 10.810  1.00 27.81 ? 358 ALA B CB  1 
ATOM   6460 N  N   . ALA B 1 316 ? -6.078  -24.082 12.867  1.00 29.34 ? 359 ALA B N   1 
ATOM   6461 C  CA  . ALA B 1 316 ? -4.657  -24.304 13.087  1.00 29.92 ? 359 ALA B CA  1 
ATOM   6462 C  C   . ALA B 1 316 ? -4.378  -25.002 14.418  1.00 30.49 ? 359 ALA B C   1 
ATOM   6463 O  O   . ALA B 1 316 ? -3.490  -25.846 14.497  1.00 30.73 ? 359 ALA B O   1 
ATOM   6464 C  CB  . ALA B 1 316 ? -3.886  -22.991 12.983  1.00 29.86 ? 359 ALA B CB  1 
ATOM   6465 N  N   . ARG B 1 317 ? -5.129  -24.646 15.458  1.00 31.20 ? 360 ARG B N   1 
ATOM   6466 C  CA  . ARG B 1 317 ? -4.995  -25.291 16.759  1.00 32.16 ? 360 ARG B CA  1 
ATOM   6467 C  C   . ARG B 1 317 ? -5.316  -26.785 16.633  1.00 32.98 ? 360 ARG B C   1 
ATOM   6468 O  O   . ARG B 1 317 ? -4.662  -27.623 17.257  1.00 32.69 ? 360 ARG B O   1 
ATOM   6469 C  CB  . ARG B 1 317 ? -5.900  -24.605 17.801  1.00 32.10 ? 360 ARG B CB  1 
ATOM   6470 C  CG  . ARG B 1 317 ? -5.862  -25.217 19.207  1.00 31.54 ? 360 ARG B CG  1 
ATOM   6471 C  CD  . ARG B 1 317 ? -4.531  -24.985 19.918  1.00 32.11 ? 360 ARG B CD  1 
ATOM   6472 N  NE  . ARG B 1 317 ? -4.437  -23.637 20.486  1.00 32.91 ? 360 ARG B NE  1 
ATOM   6473 C  CZ  . ARG B 1 317 ? -3.479  -23.219 21.310  1.00 31.43 ? 360 ARG B CZ  1 
ATOM   6474 N  NH1 . ARG B 1 317 ? -2.502  -24.031 21.669  1.00 31.39 ? 360 ARG B NH1 1 
ATOM   6475 N  NH2 . ARG B 1 317 ? -3.497  -21.980 21.775  1.00 31.05 ? 360 ARG B NH2 1 
ATOM   6476 N  N   . HIS B 1 318 ? -6.317  -27.090 15.808  1.00 34.13 ? 361 HIS B N   1 
ATOM   6477 C  CA  . HIS B 1 318 ? -6.732  -28.461 15.517  1.00 35.46 ? 361 HIS B CA  1 
ATOM   6478 C  C   . HIS B 1 318 ? -5.717  -29.180 14.624  1.00 35.76 ? 361 HIS B C   1 
ATOM   6479 O  O   . HIS B 1 318 ? -5.254  -30.271 14.950  1.00 35.52 ? 361 HIS B O   1 
ATOM   6480 C  CB  . HIS B 1 318 ? -8.135  -28.466 14.883  1.00 35.92 ? 361 HIS B CB  1 
ATOM   6481 C  CG  . HIS B 1 318 ? -8.664  -29.836 14.578  1.00 37.53 ? 361 HIS B CG  1 
ATOM   6482 N  ND1 . HIS B 1 318 ? -8.581  -30.405 13.323  1.00 38.13 ? 361 HIS B ND1 1 
ATOM   6483 C  CD2 . HIS B 1 318 ? -9.282  -30.749 15.365  1.00 39.00 ? 361 HIS B CD2 1 
ATOM   6484 C  CE1 . HIS B 1 318 ? -9.124  -31.608 13.349  1.00 38.95 ? 361 HIS B CE1 1 
ATOM   6485 N  NE2 . HIS B 1 318 ? -9.555  -31.843 14.576  1.00 40.06 ? 361 HIS B NE2 1 
ATOM   6486 N  N   . GLN B 1 319 ? -5.361  -28.555 13.507  1.00 36.61 ? 362 GLN B N   1 
ATOM   6487 C  CA  . GLN B 1 319 ? -4.386  -29.127 12.583  1.00 37.67 ? 362 GLN B CA  1 
ATOM   6488 C  C   . GLN B 1 319 ? -3.064  -29.412 13.295  1.00 37.89 ? 362 GLN B C   1 
ATOM   6489 O  O   . GLN B 1 319 ? -2.332  -30.312 12.903  1.00 38.17 ? 362 GLN B O   1 
ATOM   6490 C  CB  . GLN B 1 319 ? -4.172  -28.186 11.391  1.00 37.88 ? 362 GLN B CB  1 
ATOM   6491 C  CG  . GLN B 1 319 ? -3.412  -28.780 10.197  1.00 40.92 ? 362 GLN B CG  1 
ATOM   6492 C  CD  . GLN B 1 319 ? -4.211  -29.837 9.428   1.00 44.94 ? 362 GLN B CD  1 
ATOM   6493 O  OE1 . GLN B 1 319 ? -5.436  -29.737 9.284   1.00 46.84 ? 362 GLN B OE1 1 
ATOM   6494 N  NE2 . GLN B 1 319 ? -3.512  -30.855 8.926   1.00 45.70 ? 362 GLN B NE2 1 
ATOM   6495 N  N   . ALA B 1 320 ? -2.769  -28.651 14.349  1.00 38.32 ? 363 ALA B N   1 
ATOM   6496 C  CA  . ALA B 1 320 ? -1.479  -28.746 15.040  1.00 38.43 ? 363 ALA B CA  1 
ATOM   6497 C  C   . ALA B 1 320 ? -1.571  -29.611 16.285  1.00 38.72 ? 363 ALA B C   1 
ATOM   6498 O  O   . ALA B 1 320 ? -0.610  -29.694 17.067  1.00 38.90 ? 363 ALA B O   1 
ATOM   6499 C  CB  . ALA B 1 320 ? -0.970  -27.362 15.404  1.00 38.40 ? 363 ALA B CB  1 
ATOM   6500 N  N   . GLN B 1 321 ? -2.730  -30.247 16.462  1.00 38.69 ? 364 GLN B N   1 
ATOM   6501 C  CA  . GLN B 1 321 ? -3.056  -30.994 17.679  1.00 38.74 ? 364 GLN B CA  1 
ATOM   6502 C  C   . GLN B 1 321 ? -2.618  -30.249 18.945  1.00 38.13 ? 364 GLN B C   1 
ATOM   6503 O  O   . GLN B 1 321 ? -2.159  -30.859 19.898  1.00 38.31 ? 364 GLN B O   1 
ATOM   6504 C  CB  . GLN B 1 321 ? -2.456  -32.407 17.629  1.00 39.03 ? 364 GLN B CB  1 
ATOM   6505 C  CG  . GLN B 1 321 ? -3.042  -33.317 16.530  1.00 41.09 ? 364 GLN B CG  1 
ATOM   6506 C  CD  . GLN B 1 321 ? -2.668  -34.789 16.723  1.00 43.57 ? 364 GLN B CD  1 
ATOM   6507 O  OE1 . GLN B 1 321 ? -3.521  -35.630 17.024  1.00 44.56 ? 364 GLN B OE1 1 
ATOM   6508 N  NE2 . GLN B 1 321 ? -1.387  -35.097 16.568  1.00 43.92 ? 364 GLN B NE2 1 
ATOM   6509 N  N   . GLY B 1 322 ? -2.733  -28.922 18.931  1.00 37.61 ? 365 GLY B N   1 
ATOM   6510 C  CA  . GLY B 1 322 ? -2.462  -28.108 20.113  1.00 36.74 ? 365 GLY B CA  1 
ATOM   6511 C  C   . GLY B 1 322 ? -1.064  -27.519 20.266  1.00 36.30 ? 365 GLY B C   1 
ATOM   6512 O  O   . GLY B 1 322 ? -0.881  -26.604 21.075  1.00 36.25 ? 365 GLY B O   1 
ATOM   6513 N  N   . ASP B 1 323 ? -0.085  -28.026 19.505  1.00 35.33 ? 366 ASP B N   1 
ATOM   6514 C  CA  . ASP B 1 323 ? 1.318   -27.568 19.601  1.00 34.46 ? 366 ASP B CA  1 
ATOM   6515 C  C   . ASP B 1 323 ? 1.544   -26.128 19.096  1.00 33.47 ? 366 ASP B C   1 
ATOM   6516 O  O   . ASP B 1 323 ? 1.347   -25.846 17.917  1.00 33.37 ? 366 ASP B O   1 
ATOM   6517 C  CB  . ASP B 1 323 ? 2.249   -28.535 18.851  1.00 34.72 ? 366 ASP B CB  1 
ATOM   6518 C  CG  . ASP B 1 323 ? 3.718   -28.137 18.955  1.00 35.69 ? 366 ASP B CG  1 
ATOM   6519 O  OD1 . ASP B 1 323 ? 4.217   -28.043 20.090  1.00 37.44 ? 366 ASP B OD1 1 
ATOM   6520 O  OD2 . ASP B 1 323 ? 4.380   -27.920 17.912  1.00 36.93 ? 366 ASP B OD2 1 
ATOM   6521 N  N   . MET B 1 324 ? 1.988   -25.234 19.981  1.00 32.49 ? 367 MET B N   1 
ATOM   6522 C  CA  . MET B 1 324 ? 2.157   -23.814 19.623  1.00 31.25 ? 367 MET B CA  1 
ATOM   6523 C  C   . MET B 1 324 ? 3.161   -23.576 18.490  1.00 30.58 ? 367 MET B C   1 
ATOM   6524 O  O   . MET B 1 324 ? 2.896   -22.784 17.594  1.00 30.53 ? 367 MET B O   1 
ATOM   6525 C  CB  . MET B 1 324 ? 2.504   -22.948 20.843  1.00 31.01 ? 367 MET B CB  1 
ATOM   6526 C  CG  . MET B 1 324 ? 2.677   -21.436 20.532  1.00 30.10 ? 367 MET B CG  1 
ATOM   6527 S  SD  . MET B 1 324 ? 1.252   -20.622 19.734  1.00 30.35 ? 367 MET B SD  1 
ATOM   6528 C  CE  . MET B 1 324 ? 0.004   -20.666 21.022  1.00 29.34 ? 367 MET B CE  1 
ATOM   6529 N  N   . ALA B 1 325 ? 4.299   -24.259 18.538  1.00 29.94 ? 368 ALA B N   1 
ATOM   6530 C  CA  . ALA B 1 325 ? 5.323   -24.145 17.495  1.00 29.62 ? 368 ALA B CA  1 
ATOM   6531 C  C   . ALA B 1 325 ? 4.756   -24.438 16.106  1.00 29.59 ? 368 ALA B C   1 
ATOM   6532 O  O   . ALA B 1 325 ? 4.940   -23.646 15.175  1.00 29.29 ? 368 ALA B O   1 
ATOM   6533 C  CB  . ALA B 1 325 ? 6.501   -25.046 17.807  1.00 29.26 ? 368 ALA B CB  1 
ATOM   6534 N  N   . THR B 1 326 ? 4.035   -25.556 15.999  1.00 29.76 ? 369 THR B N   1 
ATOM   6535 C  CA  . THR B 1 326 ? 3.312   -25.948 14.778  1.00 30.02 ? 369 THR B CA  1 
ATOM   6536 C  C   . THR B 1 326 ? 2.218   -24.951 14.333  1.00 29.81 ? 369 THR B C   1 
ATOM   6537 O  O   . THR B 1 326 ? 2.137   -24.626 13.155  1.00 29.87 ? 369 THR B O   1 
ATOM   6538 C  CB  . THR B 1 326 ? 2.709   -27.391 14.915  1.00 30.26 ? 369 THR B CB  1 
ATOM   6539 O  OG1 . THR B 1 326 ? 3.730   -28.299 15.356  1.00 30.96 ? 369 THR B OG1 1 
ATOM   6540 C  CG2 . THR B 1 326 ? 2.126   -27.886 13.586  1.00 28.87 ? 369 THR B CG2 1 
ATOM   6541 N  N   . MET B 1 327 ? 1.382   -24.495 15.265  1.00 29.73 ? 370 MET B N   1 
ATOM   6542 C  CA  . MET B 1 327 ? 0.354   -23.473 14.996  1.00 30.22 ? 370 MET B CA  1 
ATOM   6543 C  C   . MET B 1 327 ? 0.868   -22.238 14.263  1.00 30.02 ? 370 MET B C   1 
ATOM   6544 O  O   . MET B 1 327 ? 0.214   -21.729 13.358  1.00 29.82 ? 370 MET B O   1 
ATOM   6545 C  CB  . MET B 1 327 ? -0.277  -22.985 16.301  1.00 30.49 ? 370 MET B CB  1 
ATOM   6546 C  CG  . MET B 1 327 ? -1.450  -23.784 16.757  1.00 31.84 ? 370 MET B CG  1 
ATOM   6547 S  SD  . MET B 1 327 ? -2.384  -22.869 17.982  1.00 34.44 ? 370 MET B SD  1 
ATOM   6548 C  CE  . MET B 1 327 ? -3.357  -21.820 16.902  1.00 33.58 ? 370 MET B CE  1 
ATOM   6549 N  N   . LEU B 1 328 ? 2.033   -21.751 14.680  1.00 30.05 ? 371 LEU B N   1 
ATOM   6550 C  CA  . LEU B 1 328 ? 2.556   -20.494 14.181  1.00 30.13 ? 371 LEU B CA  1 
ATOM   6551 C  C   . LEU B 1 328 ? 2.965   -20.611 12.714  1.00 30.56 ? 371 LEU B C   1 
ATOM   6552 O  O   . LEU B 1 328 ? 3.257   -19.601 12.067  1.00 30.60 ? 371 LEU B O   1 
ATOM   6553 C  CB  . LEU B 1 328 ? 3.730   -20.023 15.045  1.00 30.12 ? 371 LEU B CB  1 
ATOM   6554 C  CG  . LEU B 1 328 ? 3.438   -19.708 16.514  1.00 29.51 ? 371 LEU B CG  1 
ATOM   6555 C  CD1 . LEU B 1 328 ? 4.718   -19.677 17.292  1.00 28.33 ? 371 LEU B CD1 1 
ATOM   6556 C  CD2 . LEU B 1 328 ? 2.671   -18.391 16.667  1.00 29.46 ? 371 LEU B CD2 1 
ATOM   6557 N  N   . GLN B 1 329 ? 2.988   -21.844 12.197  1.00 30.65 ? 372 GLN B N   1 
ATOM   6558 C  CA  . GLN B 1 329 ? 3.219   -22.084 10.766  1.00 30.70 ? 372 GLN B CA  1 
ATOM   6559 C  C   . GLN B 1 329 ? 1.882   -22.298 10.026  1.00 29.87 ? 372 GLN B C   1 
ATOM   6560 O  O   . GLN B 1 329 ? 1.855   -22.555 8.817   1.00 29.73 ? 372 GLN B O   1 
ATOM   6561 C  CB  . GLN B 1 329 ? 4.189   -23.257 10.543  1.00 31.10 ? 372 GLN B CB  1 
ATOM   6562 C  CG  . GLN B 1 329 ? 5.577   -23.083 11.182  1.00 34.43 ? 372 GLN B CG  1 
ATOM   6563 C  CD  . GLN B 1 329 ? 6.388   -21.924 10.575  1.00 39.78 ? 372 GLN B CD  1 
ATOM   6564 O  OE1 . GLN B 1 329 ? 6.404   -20.807 11.113  1.00 42.27 ? 372 GLN B OE1 1 
ATOM   6565 N  NE2 . GLN B 1 329 ? 7.057   -22.188 9.449   1.00 41.76 ? 372 GLN B NE2 1 
ATOM   6566 N  N   . LEU B 1 330 ? 0.775   -22.159 10.750  1.00 28.69 ? 373 LEU B N   1 
ATOM   6567 C  CA  . LEU B 1 330 ? -0.540  -22.375 10.154  1.00 27.76 ? 373 LEU B CA  1 
ATOM   6568 C  C   . LEU B 1 330 ? -1.484  -21.186 10.307  1.00 27.48 ? 373 LEU B C   1 
ATOM   6569 O  O   . LEU B 1 330 ? -2.690  -21.336 10.159  1.00 27.54 ? 373 LEU B O   1 
ATOM   6570 C  CB  . LEU B 1 330 ? -1.180  -23.658 10.716  1.00 27.66 ? 373 LEU B CB  1 
ATOM   6571 C  CG  . LEU B 1 330 ? -0.496  -25.015 10.457  1.00 26.57 ? 373 LEU B CG  1 
ATOM   6572 C  CD1 . LEU B 1 330 ? -1.031  -26.081 11.392  1.00 26.36 ? 373 LEU B CD1 1 
ATOM   6573 C  CD2 . LEU B 1 330 ? -0.647  -25.460 9.018   1.00 24.41 ? 373 LEU B CD2 1 
ATOM   6574 N  N   . VAL B 1 331 ? -0.942  -20.003 10.590  1.00 27.22 ? 374 VAL B N   1 
ATOM   6575 C  CA  . VAL B 1 331 ? -1.774  -18.795 10.695  1.00 26.63 ? 374 VAL B CA  1 
ATOM   6576 C  C   . VAL B 1 331 ? -1.325  -17.650 9.760   1.00 26.63 ? 374 VAL B C   1 
ATOM   6577 O  O   . VAL B 1 331 ? -1.041  -16.536 10.229  1.00 26.83 ? 374 VAL B O   1 
ATOM   6578 C  CB  . VAL B 1 331 ? -1.929  -18.295 12.172  1.00 26.84 ? 374 VAL B CB  1 
ATOM   6579 C  CG1 . VAL B 1 331 ? -2.862  -19.219 12.959  1.00 26.30 ? 374 VAL B CG1 1 
ATOM   6580 C  CG2 . VAL B 1 331 ? -0.555  -18.122 12.883  1.00 25.51 ? 374 VAL B CG2 1 
ATOM   6581 N  N   . PRO B 1 332 ? -1.273  -17.909 8.427   1.00 26.16 ? 375 PRO B N   1 
ATOM   6582 C  CA  . PRO B 1 332 ? -0.772  -16.870 7.525   1.00 25.37 ? 375 PRO B CA  1 
ATOM   6583 C  C   . PRO B 1 332 ? -1.614  -15.589 7.517   1.00 24.62 ? 375 PRO B C   1 
ATOM   6584 O  O   . PRO B 1 332 ? -1.060  -14.497 7.379   1.00 23.92 ? 375 PRO B O   1 
ATOM   6585 C  CB  . PRO B 1 332 ? -0.787  -17.552 6.144   1.00 25.09 ? 375 PRO B CB  1 
ATOM   6586 C  CG  . PRO B 1 332 ? -1.712  -18.673 6.276   1.00 25.69 ? 375 PRO B CG  1 
ATOM   6587 C  CD  . PRO B 1 332 ? -1.607  -19.142 7.688   1.00 26.09 ? 375 PRO B CD  1 
ATOM   6588 N  N   . LEU B 1 333 ? -2.929  -15.722 7.660   1.00 24.20 ? 376 LEU B N   1 
ATOM   6589 C  CA  . LEU B 1 333 ? -3.799  -14.542 7.710   1.00 24.06 ? 376 LEU B CA  1 
ATOM   6590 C  C   . LEU B 1 333 ? -3.602  -13.712 8.993   1.00 23.92 ? 376 LEU B C   1 
ATOM   6591 O  O   . LEU B 1 333 ? -3.720  -12.489 8.954   1.00 23.98 ? 376 LEU B O   1 
ATOM   6592 C  CB  . LEU B 1 333 ? -5.278  -14.907 7.507   1.00 23.66 ? 376 LEU B CB  1 
ATOM   6593 C  CG  . LEU B 1 333 ? -6.221  -13.760 7.113   1.00 23.31 ? 376 LEU B CG  1 
ATOM   6594 C  CD1 . LEU B 1 333 ? -6.011  -13.300 5.662   1.00 23.67 ? 376 LEU B CD1 1 
ATOM   6595 C  CD2 . LEU B 1 333 ? -7.692  -14.108 7.331   1.00 23.86 ? 376 LEU B CD2 1 
ATOM   6596 N  N   . LEU B 1 334 ? -3.304  -14.367 10.115  1.00 23.55 ? 377 LEU B N   1 
ATOM   6597 C  CA  . LEU B 1 334 ? -3.035  -13.647 11.358  1.00 23.51 ? 377 LEU B CA  1 
ATOM   6598 C  C   . LEU B 1 334 ? -1.756  -12.829 11.198  1.00 23.54 ? 377 LEU B C   1 
ATOM   6599 O  O   . LEU B 1 334 ? -1.713  -11.640 11.560  1.00 23.68 ? 377 LEU B O   1 
ATOM   6600 C  CB  . LEU B 1 334 ? -2.875  -14.599 12.546  1.00 23.45 ? 377 LEU B CB  1 
ATOM   6601 C  CG  . LEU B 1 334 ? -3.607  -14.326 13.868  1.00 22.50 ? 377 LEU B CG  1 
ATOM   6602 C  CD1 . LEU B 1 334 ? -2.898  -15.027 15.024  1.00 20.09 ? 377 LEU B CD1 1 
ATOM   6603 C  CD2 . LEU B 1 334 ? -3.791  -12.855 14.157  1.00 21.04 ? 377 LEU B CD2 1 
ATOM   6604 N  N   . LYS B 1 335 ? -0.729  -13.467 10.641  1.00 22.99 ? 378 LYS B N   1 
ATOM   6605 C  CA  . LYS B 1 335 ? 0.568   -12.821 10.437  1.00 22.93 ? 378 LYS B CA  1 
ATOM   6606 C  C   . LYS B 1 335 ? 0.472   -11.622 9.511   1.00 22.95 ? 378 LYS B C   1 
ATOM   6607 O  O   . LYS B 1 335 ? 1.187   -10.625 9.696   1.00 23.31 ? 378 LYS B O   1 
ATOM   6608 C  CB  . LYS B 1 335 ? 1.612   -13.817 9.937   1.00 22.72 ? 378 LYS B CB  1 
ATOM   6609 C  CG  . LYS B 1 335 ? 1.947   -14.871 10.966  1.00 22.64 ? 378 LYS B CG  1 
ATOM   6610 C  CD  . LYS B 1 335 ? 3.335   -15.394 10.780  1.00 25.22 ? 378 LYS B CD  1 
ATOM   6611 C  CE  . LYS B 1 335 ? 3.649   -16.420 11.846  1.00 27.14 ? 378 LYS B CE  1 
ATOM   6612 N  NZ  . LYS B 1 335 ? 4.797   -17.284 11.437  1.00 29.96 ? 378 LYS B NZ  1 
ATOM   6613 N  N   . ALA B 1 336 ? -0.437  -11.713 8.542   1.00 22.46 ? 379 ALA B N   1 
ATOM   6614 C  CA  . ALA B 1 336 ? -0.702  -10.624 7.620   1.00 21.75 ? 379 ALA B CA  1 
ATOM   6615 C  C   . ALA B 1 336 ? -1.483  -9.527  8.316   1.00 21.33 ? 379 ALA B C   1 
ATOM   6616 O  O   . ALA B 1 336 ? -1.333  -8.358  7.993   1.00 21.68 ? 379 ALA B O   1 
ATOM   6617 C  CB  . ALA B 1 336 ? -1.464  -11.127 6.394   1.00 21.17 ? 379 ALA B CB  1 
ATOM   6618 N  N   . SER B 1 337 ? -2.339  -9.895  9.253   1.00 21.12 ? 380 SER B N   1 
ATOM   6619 C  CA  . SER B 1 337 ? -3.139  -8.891  9.937   1.00 21.24 ? 380 SER B CA  1 
ATOM   6620 C  C   . SER B 1 337 ? -2.233  -8.019  10.830  1.00 21.39 ? 380 SER B C   1 
ATOM   6621 O  O   . SER B 1 337 ? -2.517  -6.846  11.061  1.00 21.48 ? 380 SER B O   1 
ATOM   6622 C  CB  . SER B 1 337 ? -4.251  -9.543  10.747  1.00 20.97 ? 380 SER B CB  1 
ATOM   6623 O  OG  . SER B 1 337 ? -3.708  -10.409 11.723  1.00 20.61 ? 380 SER B OG  1 
ATOM   6624 N  N   . ILE B 1 338 ? -1.136  -8.605  11.304  1.00 21.29 ? 381 ILE B N   1 
ATOM   6625 C  CA  . ILE B 1 338 ? -0.169  -7.893  12.119  1.00 21.28 ? 381 ILE B CA  1 
ATOM   6626 C  C   . ILE B 1 338 ? 0.584   -6.890  11.245  1.00 21.55 ? 381 ILE B C   1 
ATOM   6627 O  O   . ILE B 1 338 ? 0.762   -5.722  11.636  1.00 21.59 ? 381 ILE B O   1 
ATOM   6628 C  CB  . ILE B 1 338 ? 0.753   -8.868  12.870  1.00 21.16 ? 381 ILE B CB  1 
ATOM   6629 C  CG1 . ILE B 1 338 ? -0.072  -9.593  13.952  1.00 21.62 ? 381 ILE B CG1 1 
ATOM   6630 C  CG2 . ILE B 1 338 ? 1.947   -8.138  13.474  1.00 21.00 ? 381 ILE B CG2 1 
ATOM   6631 C  CD1 . ILE B 1 338 ? 0.589   -10.816 14.589  1.00 20.43 ? 381 ILE B CD1 1 
ATOM   6632 N  N   . LYS B 1 339 ? 0.989   -7.333  10.053  1.00 21.17 ? 382 LYS B N   1 
ATOM   6633 C  CA  . LYS B 1 339 ? 1.519   -6.437  9.032   1.00 20.54 ? 382 LYS B CA  1 
ATOM   6634 C  C   . LYS B 1 339 ? 0.489   -5.366  8.655   1.00 20.28 ? 382 LYS B C   1 
ATOM   6635 O  O   . LYS B 1 339 ? 0.822   -4.191  8.557   1.00 20.79 ? 382 LYS B O   1 
ATOM   6636 C  CB  . LYS B 1 339 ? 1.894   -7.225  7.796   1.00 20.43 ? 382 LYS B CB  1 
ATOM   6637 C  CG  . LYS B 1 339 ? 3.107   -8.085  7.951   1.00 20.74 ? 382 LYS B CG  1 
ATOM   6638 C  CD  . LYS B 1 339 ? 3.304   -8.896  6.680   1.00 20.71 ? 382 LYS B CD  1 
ATOM   6639 C  CE  . LYS B 1 339 ? 4.152   -10.105 6.937   1.00 20.55 ? 382 LYS B CE  1 
ATOM   6640 N  NZ  . LYS B 1 339 ? 4.362   -10.851 5.670   1.00 21.69 ? 382 LYS B NZ  1 
ATOM   6641 N  N   . GLU B 1 340 ? -0.769  -5.757  8.473   1.00 19.67 ? 383 GLU B N   1 
ATOM   6642 C  CA  . GLU B 1 340 ? -1.797  -4.779  8.147   1.00 19.34 ? 383 GLU B CA  1 
ATOM   6643 C  C   . GLU B 1 340 ? -2.014  -3.746  9.268   1.00 19.26 ? 383 GLU B C   1 
ATOM   6644 O  O   . GLU B 1 340 ? -2.302  -2.587  8.969   1.00 19.52 ? 383 GLU B O   1 
ATOM   6645 C  CB  . GLU B 1 340 ? -3.100  -5.462  7.737   1.00 19.23 ? 383 GLU B CB  1 
ATOM   6646 C  CG  . GLU B 1 340 ? -4.232  -4.511  7.288   1.00 20.14 ? 383 GLU B CG  1 
ATOM   6647 C  CD  . GLU B 1 340 ? -4.060  -3.934  5.877   1.00 20.25 ? 383 GLU B CD  1 
ATOM   6648 O  OE1 . GLU B 1 340 ? -2.935  -3.989  5.318   1.00 19.53 ? 383 GLU B OE1 1 
ATOM   6649 O  OE2 . GLU B 1 340 ? -5.067  -3.416  5.335   1.00 19.76 ? 383 GLU B OE2 1 
ATOM   6650 N  N   . THR B 1 341 ? -1.859  -4.148  10.536  1.00 18.77 ? 384 THR B N   1 
ATOM   6651 C  CA  . THR B 1 341 ? -2.036  -3.216  11.662  1.00 18.66 ? 384 THR B CA  1 
ATOM   6652 C  C   . THR B 1 341 ? -0.918  -2.167  11.667  1.00 18.52 ? 384 THR B C   1 
ATOM   6653 O  O   . THR B 1 341 ? -1.175  -0.968  11.806  1.00 18.28 ? 384 THR B O   1 
ATOM   6654 C  CB  . THR B 1 341 ? -2.097  -3.935  13.043  1.00 18.82 ? 384 THR B CB  1 
ATOM   6655 O  OG1 . THR B 1 341 ? -3.258  -4.770  13.106  1.00 19.64 ? 384 THR B OG1 1 
ATOM   6656 C  CG2 . THR B 1 341 ? -2.166  -2.926  14.182  1.00 17.56 ? 384 THR B CG2 1 
ATOM   6657 N  N   . LEU B 1 342 ? 0.314   -2.642  11.485  1.00 18.16 ? 385 LEU B N   1 
ATOM   6658 C  CA  . LEU B 1 342 ? 1.496   -1.796  11.397  1.00 17.67 ? 385 LEU B CA  1 
ATOM   6659 C  C   . LEU B 1 342 ? 1.554   -0.856  10.185  1.00 17.66 ? 385 LEU B C   1 
ATOM   6660 O  O   . LEU B 1 342 ? 2.314   0.117   10.191  1.00 17.25 ? 385 LEU B O   1 
ATOM   6661 C  CB  . LEU B 1 342 ? 2.752   -2.657  11.467  1.00 17.51 ? 385 LEU B CB  1 
ATOM   6662 C  CG  . LEU B 1 342 ? 3.099   -3.164  12.870  1.00 16.60 ? 385 LEU B CG  1 
ATOM   6663 C  CD1 . LEU B 1 342 ? 4.191   -4.166  12.722  1.00 14.69 ? 385 LEU B CD1 1 
ATOM   6664 C  CD2 . LEU B 1 342 ? 3.533   -1.984  13.783  1.00 15.14 ? 385 LEU B CD2 1 
ATOM   6665 N  N   . ARG B 1 343 ? 0.766   -1.153  9.156   1.00 17.95 ? 386 ARG B N   1 
ATOM   6666 C  CA  . ARG B 1 343 ? 0.649   -0.281  7.988   1.00 17.97 ? 386 ARG B CA  1 
ATOM   6667 C  C   . ARG B 1 343 ? -0.187  0.946   8.341   1.00 18.27 ? 386 ARG B C   1 
ATOM   6668 O  O   . ARG B 1 343 ? 0.219   2.077   8.073   1.00 18.69 ? 386 ARG B O   1 
ATOM   6669 C  CB  . ARG B 1 343 ? -0.008  -1.030  6.823   1.00 18.14 ? 386 ARG B CB  1 
ATOM   6670 C  CG  . ARG B 1 343 ? -0.307  -0.154  5.606   1.00 16.08 ? 386 ARG B CG  1 
ATOM   6671 C  CD  . ARG B 1 343 ? -1.077  -0.913  4.534   1.00 14.29 ? 386 ARG B CD  1 
ATOM   6672 N  NE  . ARG B 1 343 ? -2.465  -1.131  4.912   1.00 13.14 ? 386 ARG B NE  1 
ATOM   6673 C  CZ  . ARG B 1 343 ? -3.424  -0.218  4.797   1.00 15.70 ? 386 ARG B CZ  1 
ATOM   6674 N  NH1 . ARG B 1 343 ? -3.166  0.995   4.323   1.00 16.78 ? 386 ARG B NH1 1 
ATOM   6675 N  NH2 . ARG B 1 343 ? -4.652  -0.503  5.177   1.00 16.94 ? 386 ARG B NH2 1 
ATOM   6676 N  N   . LEU B 1 344 ? -1.357  0.713   8.927   1.00 18.11 ? 387 LEU B N   1 
ATOM   6677 C  CA  . LEU B 1 344 ? -2.250  1.790   9.336   1.00 18.48 ? 387 LEU B CA  1 
ATOM   6678 C  C   . LEU B 1 344 ? -1.794  2.497   10.611  1.00 18.73 ? 387 LEU B C   1 
ATOM   6679 O  O   . LEU B 1 344 ? -2.083  3.676   10.805  1.00 19.45 ? 387 LEU B O   1 
ATOM   6680 C  CB  . LEU B 1 344 ? -3.659  1.244   9.558   1.00 18.49 ? 387 LEU B CB  1 
ATOM   6681 C  CG  . LEU B 1 344 ? -4.550  1.087   8.326   1.00 19.48 ? 387 LEU B CG  1 
ATOM   6682 C  CD1 . LEU B 1 344 ? -5.730  0.204   8.680   1.00 19.34 ? 387 LEU B CD1 1 
ATOM   6683 C  CD2 . LEU B 1 344 ? -5.022  2.459   7.789   1.00 17.67 ? 387 LEU B CD2 1 
ATOM   6684 N  N   . HIS B 1 345 ? -1.092  1.778   11.479  1.00 18.44 ? 388 HIS B N   1 
ATOM   6685 C  CA  . HIS B 1 345 ? -0.706  2.301   12.781  1.00 18.23 ? 388 HIS B CA  1 
ATOM   6686 C  C   . HIS B 1 345 ? 0.748   1.925   13.097  1.00 18.14 ? 388 HIS B C   1 
ATOM   6687 O  O   . HIS B 1 345 ? 1.000   1.094   13.982  1.00 18.13 ? 388 HIS B O   1 
ATOM   6688 C  CB  . HIS B 1 345 ? -1.636  1.761   13.884  1.00 17.90 ? 388 HIS B CB  1 
ATOM   6689 C  CG  . HIS B 1 345 ? -3.101  1.867   13.571  1.00 18.91 ? 388 HIS B CG  1 
ATOM   6690 N  ND1 . HIS B 1 345 ? -3.779  3.069   13.555  1.00 19.19 ? 388 HIS B ND1 1 
ATOM   6691 C  CD2 . HIS B 1 345 ? -4.026  0.913   13.295  1.00 18.52 ? 388 HIS B CD2 1 
ATOM   6692 C  CE1 . HIS B 1 345 ? -5.052  2.853   13.259  1.00 18.37 ? 388 HIS B CE1 1 
ATOM   6693 N  NE2 . HIS B 1 345 ? -5.228  1.553   13.097  1.00 18.04 ? 388 HIS B NE2 1 
ATOM   6694 N  N   . PRO B 1 346 ? 1.714   2.512   12.370  1.00 17.79 ? 389 PRO B N   1 
ATOM   6695 C  CA  . PRO B 1 346 ? 3.108   2.263   12.729  1.00 17.81 ? 389 PRO B CA  1 
ATOM   6696 C  C   . PRO B 1 346 ? 3.457   2.801   14.118  1.00 18.17 ? 389 PRO B C   1 
ATOM   6697 O  O   . PRO B 1 346 ? 2.839   3.774   14.598  1.00 18.44 ? 389 PRO B O   1 
ATOM   6698 C  CB  . PRO B 1 346 ? 3.887   3.057   11.680  1.00 17.41 ? 389 PRO B CB  1 
ATOM   6699 C  CG  . PRO B 1 346 ? 2.953   4.087   11.219  1.00 17.25 ? 389 PRO B CG  1 
ATOM   6700 C  CD  . PRO B 1 346 ? 1.605   3.463   11.255  1.00 17.96 ? 389 PRO B CD  1 
ATOM   6701 N  N   . ILE B 1 347 ? 4.439   2.173   14.755  1.00 17.55 ? 390 ILE B N   1 
ATOM   6702 C  CA  . ILE B 1 347 ? 4.999   2.705   15.988  1.00 17.43 ? 390 ILE B CA  1 
ATOM   6703 C  C   . ILE B 1 347 ? 5.914   3.892   15.645  1.00 17.37 ? 390 ILE B C   1 
ATOM   6704 O  O   . ILE B 1 347 ? 5.940   4.907   16.361  1.00 17.59 ? 390 ILE B O   1 
ATOM   6705 C  CB  . ILE B 1 347 ? 5.743   1.586   16.775  1.00 16.90 ? 390 ILE B CB  1 
ATOM   6706 C  CG1 . ILE B 1 347 ? 4.733   0.674   17.477  1.00 16.37 ? 390 ILE B CG1 1 
ATOM   6707 C  CG2 . ILE B 1 347 ? 6.761   2.160   17.763  1.00 17.38 ? 390 ILE B CG2 1 
ATOM   6708 C  CD1 . ILE B 1 347 ? 3.923   1.340   18.627  1.00 15.00 ? 390 ILE B CD1 1 
ATOM   6709 N  N   . SER B 1 348 ? 6.614   3.745   14.523  1.00 17.00 ? 391 SER B N   1 
ATOM   6710 C  CA  . SER B 1 348 ? 7.660   4.641   14.044  1.00 17.29 ? 391 SER B CA  1 
ATOM   6711 C  C   . SER B 1 348 ? 7.153   5.517   12.869  1.00 17.35 ? 391 SER B C   1 
ATOM   6712 O  O   . SER B 1 348 ? 6.905   4.987   11.773  1.00 17.95 ? 391 SER B O   1 
ATOM   6713 C  CB  . SER B 1 348 ? 8.803   3.750   13.539  1.00 17.23 ? 391 SER B CB  1 
ATOM   6714 O  OG  . SER B 1 348 ? 10.059  4.386   13.576  1.00 16.88 ? 391 SER B OG  1 
ATOM   6715 N  N   . VAL B 1 349 ? 6.991   6.831   13.070  1.00 16.54 ? 392 VAL B N   1 
ATOM   6716 C  CA  . VAL B 1 349 ? 6.477   7.684   11.987  1.00 16.26 ? 392 VAL B CA  1 
ATOM   6717 C  C   . VAL B 1 349 ? 7.288   7.539   10.719  1.00 15.69 ? 392 VAL B C   1 
ATOM   6718 O  O   . VAL B 1 349 ? 6.739   7.628   9.621   1.00 15.70 ? 392 VAL B O   1 
ATOM   6719 C  CB  . VAL B 1 349 ? 6.503   9.222   12.255  1.00 16.39 ? 392 VAL B CB  1 
ATOM   6720 C  CG1 . VAL B 1 349 ? 5.115   9.765   12.438  1.00 18.04 ? 392 VAL B CG1 1 
ATOM   6721 C  CG2 . VAL B 1 349 ? 7.493   9.635   13.341  1.00 15.43 ? 392 VAL B CG2 1 
ATOM   6722 N  N   . THR B 1 350 ? 8.598   7.388   10.891  1.00 14.90 ? 393 THR B N   1 
ATOM   6723 C  CA  . THR B 1 350 ? 9.523   7.297   9.795   1.00 14.41 ? 393 THR B CA  1 
ATOM   6724 C  C   . THR B 1 350 ? 10.565  6.235   10.070  1.00 15.16 ? 393 THR B C   1 
ATOM   6725 O  O   . THR B 1 350 ? 10.685  5.714   11.175  1.00 14.70 ? 393 THR B O   1 
ATOM   6726 C  CB  . THR B 1 350 ? 10.274  8.625   9.546   1.00 14.62 ? 393 THR B CB  1 
ATOM   6727 O  OG1 . THR B 1 350 ? 11.111  8.945   10.671  1.00 13.37 ? 393 THR B OG1 1 
ATOM   6728 C  CG2 . THR B 1 350 ? 9.309   9.772   9.255   1.00 13.52 ? 393 THR B CG2 1 
ATOM   6729 N  N   . LEU B 1 351 ? 11.287  5.897   9.013   1.00 16.00 ? 394 LEU B N   1 
ATOM   6730 C  CA  . LEU B 1 351 ? 12.584  5.270   9.104   1.00 16.29 ? 394 LEU B CA  1 
ATOM   6731 C  C   . LEU B 1 351 ? 13.534  6.350   8.625   1.00 16.29 ? 394 LEU B C   1 
ATOM   6732 O  O   . LEU B 1 351 ? 13.122  7.240   7.881   1.00 16.11 ? 394 LEU B O   1 
ATOM   6733 C  CB  . LEU B 1 351 ? 12.642  4.078   8.163   1.00 16.27 ? 394 LEU B CB  1 
ATOM   6734 C  CG  . LEU B 1 351 ? 11.621  2.974   8.401   1.00 16.98 ? 394 LEU B CG  1 
ATOM   6735 C  CD1 . LEU B 1 351 ? 11.826  1.877   7.368   1.00 18.15 ? 394 LEU B CD1 1 
ATOM   6736 C  CD2 . LEU B 1 351 ? 11.771  2.410   9.804   1.00 16.66 ? 394 LEU B CD2 1 
ATOM   6737 N  N   . GLN B 1 352 ? 14.786  6.292   9.064   1.00 16.61 ? 395 GLN B N   1 
ATOM   6738 C  CA  . GLN B 1 352 ? 15.798  7.233   8.601   1.00 17.21 ? 395 GLN B CA  1 
ATOM   6739 C  C   . GLN B 1 352 ? 17.163  6.556   8.420   1.00 18.03 ? 395 GLN B C   1 
ATOM   6740 O  O   . GLN B 1 352 ? 17.529  5.638   9.160   1.00 17.92 ? 395 GLN B O   1 
ATOM   6741 C  CB  . GLN B 1 352 ? 15.944  8.443   9.542   1.00 16.54 ? 395 GLN B CB  1 
ATOM   6742 C  CG  . GLN B 1 352 ? 14.772  8.753   10.446  1.00 16.49 ? 395 GLN B CG  1 
ATOM   6743 C  CD  . GLN B 1 352 ? 14.681  7.808   11.633  1.00 17.40 ? 395 GLN B CD  1 
ATOM   6744 O  OE1 . GLN B 1 352 ? 15.705  7.439   12.239  1.00 16.43 ? 395 GLN B OE1 1 
ATOM   6745 N  NE2 . GLN B 1 352 ? 13.450  7.405   11.976  1.00 15.84 ? 395 GLN B NE2 1 
ATOM   6746 N  N   . ARG B 1 353 ? 17.909  7.023   7.428   1.00 18.85 ? 396 ARG B N   1 
ATOM   6747 C  CA  . ARG B 1 353 ? 19.293  6.637   7.257   1.00 20.12 ? 396 ARG B CA  1 
ATOM   6748 C  C   . ARG B 1 353 ? 20.121  7.880   6.891   1.00 21.23 ? 396 ARG B C   1 
ATOM   6749 O  O   . ARG B 1 353 ? 19.632  8.773   6.182   1.00 21.57 ? 396 ARG B O   1 
ATOM   6750 C  CB  . ARG B 1 353 ? 19.428  5.547   6.177   1.00 19.83 ? 396 ARG B CB  1 
ATOM   6751 C  CG  . ARG B 1 353 ? 18.864  4.160   6.542   1.00 19.80 ? 396 ARG B CG  1 
ATOM   6752 C  CD  . ARG B 1 353 ? 19.573  3.516   7.737   1.00 18.85 ? 396 ARG B CD  1 
ATOM   6753 N  NE  . ARG B 1 353 ? 19.087  2.157   8.019   1.00 20.39 ? 396 ARG B NE  1 
ATOM   6754 C  CZ  . ARG B 1 353 ? 18.157  1.822   8.931   1.00 20.68 ? 396 ARG B CZ  1 
ATOM   6755 N  NH1 . ARG B 1 353 ? 17.553  2.732   9.685   1.00 18.95 ? 396 ARG B NH1 1 
ATOM   6756 N  NH2 . ARG B 1 353 ? 17.821  0.551   9.094   1.00 19.96 ? 396 ARG B NH2 1 
ATOM   6757 N  N   . TYR B 1 354 ? 21.344  7.966   7.405   1.00 22.17 ? 397 TYR B N   1 
ATOM   6758 C  CA  . TYR B 1 354 ? 22.289  8.942   6.893   1.00 23.69 ? 397 TYR B CA  1 
ATOM   6759 C  C   . TYR B 1 354 ? 23.003  8.297   5.716   1.00 25.10 ? 397 TYR B C   1 
ATOM   6760 O  O   . TYR B 1 354 ? 23.497  7.171   5.826   1.00 25.24 ? 397 TYR B O   1 
ATOM   6761 C  CB  . TYR B 1 354 ? 23.305  9.366   7.953   1.00 23.25 ? 397 TYR B CB  1 
ATOM   6762 C  CG  . TYR B 1 354 ? 22.762  10.284  9.038   1.00 22.67 ? 397 TYR B CG  1 
ATOM   6763 C  CD1 . TYR B 1 354 ? 22.311  9.761   10.244  1.00 20.70 ? 397 TYR B CD1 1 
ATOM   6764 C  CD2 . TYR B 1 354 ? 22.723  11.674  8.863   1.00 20.90 ? 397 TYR B CD2 1 
ATOM   6765 C  CE1 . TYR B 1 354 ? 21.829  10.578  11.240  1.00 20.35 ? 397 TYR B CE1 1 
ATOM   6766 C  CE2 . TYR B 1 354 ? 22.232  12.506  9.856   1.00 19.08 ? 397 TYR B CE2 1 
ATOM   6767 C  CZ  . TYR B 1 354 ? 21.790  11.948  11.048  1.00 20.60 ? 397 TYR B CZ  1 
ATOM   6768 O  OH  . TYR B 1 354 ? 21.310  12.736  12.075  1.00 18.63 ? 397 TYR B OH  1 
ATOM   6769 N  N   . LEU B 1 355 ? 23.039  8.998   4.586   1.00 26.81 ? 398 LEU B N   1 
ATOM   6770 C  CA  . LEU B 1 355 ? 23.668  8.462   3.381   1.00 28.33 ? 398 LEU B CA  1 
ATOM   6771 C  C   . LEU B 1 355 ? 25.165  8.316   3.578   1.00 29.57 ? 398 LEU B C   1 
ATOM   6772 O  O   . LEU B 1 355 ? 25.820  9.208   4.119   1.00 30.11 ? 398 LEU B O   1 
ATOM   6773 C  CB  . LEU B 1 355 ? 23.381  9.346   2.164   1.00 27.98 ? 398 LEU B CB  1 
ATOM   6774 C  CG  . LEU B 1 355 ? 21.936  9.401   1.660   1.00 28.28 ? 398 LEU B CG  1 
ATOM   6775 C  CD1 . LEU B 1 355 ? 21.850  10.195  0.353   1.00 26.30 ? 398 LEU B CD1 1 
ATOM   6776 C  CD2 . LEU B 1 355 ? 21.343  8.001   1.480   1.00 26.52 ? 398 LEU B CD2 1 
ATOM   6777 N  N   . VAL B 1 356 ? 25.697  7.176   3.156   1.00 31.01 ? 399 VAL B N   1 
ATOM   6778 C  CA  . VAL B 1 356 ? 27.139  6.939   3.199   1.00 32.23 ? 399 VAL B CA  1 
ATOM   6779 C  C   . VAL B 1 356 ? 27.774  7.470   1.909   1.00 32.79 ? 399 VAL B C   1 
ATOM   6780 O  O   . VAL B 1 356 ? 28.819  8.115   1.949   1.00 33.03 ? 399 VAL B O   1 
ATOM   6781 C  CB  . VAL B 1 356 ? 27.464  5.441   3.462   1.00 32.22 ? 399 VAL B CB  1 
ATOM   6782 C  CG1 . VAL B 1 356 ? 28.944  5.171   3.292   1.00 33.44 ? 399 VAL B CG1 1 
ATOM   6783 C  CG2 . VAL B 1 356 ? 27.041  5.058   4.873   1.00 31.98 ? 399 VAL B CG2 1 
ATOM   6784 N  N   . ASN B 1 357 ? 27.111  7.217   0.783   1.00 33.60 ? 400 ASN B N   1 
ATOM   6785 C  CA  . ASN B 1 357 ? 27.499  7.761   -0.519  1.00 34.42 ? 400 ASN B CA  1 
ATOM   6786 C  C   . ASN B 1 357 ? 26.394  8.613   -1.117  1.00 34.58 ? 400 ASN B C   1 
ATOM   6787 O  O   . ASN B 1 357 ? 25.222  8.438   -0.779  1.00 34.55 ? 400 ASN B O   1 
ATOM   6788 C  CB  . ASN B 1 357 ? 27.781  6.627   -1.509  1.00 34.75 ? 400 ASN B CB  1 
ATOM   6789 C  CG  . ASN B 1 357 ? 28.939  5.765   -1.090  1.00 36.11 ? 400 ASN B CG  1 
ATOM   6790 O  OD1 . ASN B 1 357 ? 30.001  6.273   -0.740  1.00 38.25 ? 400 ASN B OD1 1 
ATOM   6791 N  ND2 . ASN B 1 357 ? 28.750  4.448   -1.132  1.00 36.86 ? 400 ASN B ND2 1 
ATOM   6792 N  N   . ASP B 1 358 ? 26.777  9.509   -2.030  1.00 34.86 ? 401 ASP B N   1 
ATOM   6793 C  CA  . ASP B 1 358 ? 25.836  10.247  -2.872  1.00 34.98 ? 401 ASP B CA  1 
ATOM   6794 C  C   . ASP B 1 358 ? 24.806  9.293   -3.448  1.00 34.80 ? 401 ASP B C   1 
ATOM   6795 O  O   . ASP B 1 358 ? 25.120  8.139   -3.743  1.00 34.82 ? 401 ASP B O   1 
ATOM   6796 C  CB  . ASP B 1 358 ? 26.569  10.942  -4.031  1.00 35.28 ? 401 ASP B CB  1 
ATOM   6797 C  CG  . ASP B 1 358 ? 27.538  12.037  -3.566  1.00 36.35 ? 401 ASP B CG  1 
ATOM   6798 O  OD1 . ASP B 1 358 ? 27.495  12.452  -2.382  1.00 37.89 ? 401 ASP B OD1 1 
ATOM   6799 O  OD2 . ASP B 1 358 ? 28.349  12.488  -4.402  1.00 36.38 ? 401 ASP B OD2 1 
ATOM   6800 N  N   . LEU B 1 359 ? 23.579  9.775   -3.603  1.00 34.81 ? 402 LEU B N   1 
ATOM   6801 C  CA  . LEU B 1 359 ? 22.504  8.964   -4.142  1.00 34.78 ? 402 LEU B CA  1 
ATOM   6802 C  C   . LEU B 1 359 ? 21.567  9.783   -5.009  1.00 34.98 ? 402 LEU B C   1 
ATOM   6803 O  O   . LEU B 1 359 ? 21.286  10.942  -4.703  1.00 35.46 ? 402 LEU B O   1 
ATOM   6804 C  CB  . LEU B 1 359 ? 21.712  8.324   -3.006  1.00 34.68 ? 402 LEU B CB  1 
ATOM   6805 C  CG  . LEU B 1 359 ? 20.600  7.380   -3.463  1.00 34.93 ? 402 LEU B CG  1 
ATOM   6806 C  CD1 . LEU B 1 359 ? 21.187  6.080   -3.997  1.00 34.50 ? 402 LEU B CD1 1 
ATOM   6807 C  CD2 . LEU B 1 359 ? 19.638  7.120   -2.323  1.00 35.59 ? 402 LEU B CD2 1 
ATOM   6808 N  N   . VAL B 1 360 ? 21.067  9.176   -6.083  1.00 35.02 ? 403 VAL B N   1 
ATOM   6809 C  CA  . VAL B 1 360 ? 20.068  9.833   -6.911  1.00 34.97 ? 403 VAL B CA  1 
ATOM   6810 C  C   . VAL B 1 360 ? 18.678  9.259   -6.661  1.00 35.23 ? 403 VAL B C   1 
ATOM   6811 O  O   . VAL B 1 360 ? 18.441  8.073   -6.881  1.00 35.57 ? 403 VAL B O   1 
ATOM   6812 C  CB  . VAL B 1 360 ? 20.423  9.793   -8.425  1.00 34.89 ? 403 VAL B CB  1 
ATOM   6813 C  CG1 . VAL B 1 360 ? 19.272  10.337  -9.268  1.00 34.23 ? 403 VAL B CG1 1 
ATOM   6814 C  CG2 . VAL B 1 360 ? 21.681  10.600  -8.690  1.00 34.12 ? 403 VAL B CG2 1 
ATOM   6815 N  N   . LEU B 1 361 ? 17.777  10.119  -6.192  1.00 35.41 ? 404 LEU B N   1 
ATOM   6816 C  CA  . LEU B 1 361 ? 16.359  9.802   -6.056  1.00 35.72 ? 404 LEU B CA  1 
ATOM   6817 C  C   . LEU B 1 361 ? 15.551  10.833  -6.832  1.00 35.96 ? 404 LEU B C   1 
ATOM   6818 O  O   . LEU B 1 361 ? 15.760  12.034  -6.670  1.00 36.15 ? 404 LEU B O   1 
ATOM   6819 C  CB  . LEU B 1 361 ? 15.930  9.774   -4.578  1.00 35.43 ? 404 LEU B CB  1 
ATOM   6820 C  CG  . LEU B 1 361 ? 16.546  8.698   -3.674  1.00 35.36 ? 404 LEU B CG  1 
ATOM   6821 C  CD1 . LEU B 1 361 ? 16.178  8.914   -2.214  1.00 35.99 ? 404 LEU B CD1 1 
ATOM   6822 C  CD2 . LEU B 1 361 ? 16.162  7.293   -4.106  1.00 34.72 ? 404 LEU B CD2 1 
ATOM   6823 N  N   . ARG B 1 362 ? 14.644  10.354  -7.681  1.00 36.47 ? 405 ARG B N   1 
ATOM   6824 C  CA  . ARG B 1 362 ? 13.807  11.207  -8.546  1.00 36.63 ? 405 ARG B CA  1 
ATOM   6825 C  C   . ARG B 1 362 ? 14.582  12.278  -9.328  1.00 36.60 ? 405 ARG B C   1 
ATOM   6826 O  O   . ARG B 1 362 ? 14.133  13.423  -9.431  1.00 36.66 ? 405 ARG B O   1 
ATOM   6827 C  CB  . ARG B 1 362 ? 12.671  11.861  -7.746  1.00 36.68 ? 405 ARG B CB  1 
ATOM   6828 C  CG  . ARG B 1 362 ? 11.886  10.917  -6.867  1.00 37.32 ? 405 ARG B CG  1 
ATOM   6829 C  CD  . ARG B 1 362 ? 10.398  11.154  -7.003  1.00 37.79 ? 405 ARG B CD  1 
ATOM   6830 N  NE  . ARG B 1 362 ? 9.708   9.886   -6.803  1.00 40.08 ? 405 ARG B NE  1 
ATOM   6831 C  CZ  . ARG B 1 362 ? 8.588   9.508   -7.414  1.00 39.69 ? 405 ARG B CZ  1 
ATOM   6832 N  NH1 . ARG B 1 362 ? 7.976   10.300  -8.285  1.00 39.82 ? 405 ARG B NH1 1 
ATOM   6833 N  NH2 . ARG B 1 362 ? 8.076   8.320   -7.138  1.00 39.99 ? 405 ARG B NH2 1 
ATOM   6834 N  N   . ASP B 1 363 ? 15.729  11.904  -9.890  1.00 36.59 ? 406 ASP B N   1 
ATOM   6835 C  CA  . ASP B 1 363 ? 16.623  12.854  -10.589 1.00 36.89 ? 406 ASP B CA  1 
ATOM   6836 C  C   . ASP B 1 363 ? 17.055  14.050  -9.746  1.00 36.11 ? 406 ASP B C   1 
ATOM   6837 O  O   . ASP B 1 363 ? 17.173  15.174  -10.241 1.00 36.25 ? 406 ASP B O   1 
ATOM   6838 C  CB  . ASP B 1 363 ? 16.032  13.322  -11.932 1.00 37.39 ? 406 ASP B CB  1 
ATOM   6839 C  CG  . ASP B 1 363 ? 16.126  12.256  -13.005 1.00 39.60 ? 406 ASP B CG  1 
ATOM   6840 O  OD1 . ASP B 1 363 ? 17.124  11.494  -13.010 1.00 41.11 ? 406 ASP B OD1 1 
ATOM   6841 O  OD2 . ASP B 1 363 ? 15.195  12.167  -13.836 1.00 42.98 ? 406 ASP B OD2 1 
ATOM   6842 N  N   . TYR B 1 364 ? 17.288  13.787  -8.468  1.00 35.30 ? 407 TYR B N   1 
ATOM   6843 C  CA  . TYR B 1 364 ? 17.847  14.771  -7.571  1.00 34.13 ? 407 TYR B CA  1 
ATOM   6844 C  C   . TYR B 1 364 ? 19.086  14.158  -6.933  1.00 34.01 ? 407 TYR B C   1 
ATOM   6845 O  O   . TYR B 1 364 ? 19.061  13.019  -6.458  1.00 33.56 ? 407 TYR B O   1 
ATOM   6846 C  CB  . TYR B 1 364 ? 16.842  15.138  -6.479  1.00 33.73 ? 407 TYR B CB  1 
ATOM   6847 C  CG  . TYR B 1 364 ? 15.632  15.973  -6.882  1.00 31.24 ? 407 TYR B CG  1 
ATOM   6848 C  CD1 . TYR B 1 364 ? 14.361  15.408  -6.913  1.00 29.05 ? 407 TYR B CD1 1 
ATOM   6849 C  CD2 . TYR B 1 364 ? 15.752  17.335  -7.162  1.00 28.83 ? 407 TYR B CD2 1 
ATOM   6850 C  CE1 . TYR B 1 364 ? 13.246  16.157  -7.249  1.00 28.32 ? 407 TYR B CE1 1 
ATOM   6851 C  CE2 . TYR B 1 364 ? 14.640  18.101  -7.490  1.00 27.61 ? 407 TYR B CE2 1 
ATOM   6852 C  CZ  . TYR B 1 364 ? 13.389  17.505  -7.533  1.00 28.42 ? 407 TYR B CZ  1 
ATOM   6853 O  OH  . TYR B 1 364 ? 12.276  18.244  -7.860  1.00 27.64 ? 407 TYR B OH  1 
ATOM   6854 N  N   . MET B 1 365 ? 20.171  14.916  -6.928  1.00 33.87 ? 408 MET B N   1 
ATOM   6855 C  CA  . MET B 1 365 ? 21.381  14.484  -6.247  1.00 34.39 ? 408 MET B CA  1 
ATOM   6856 C  C   . MET B 1 365 ? 21.263  14.712  -4.755  1.00 33.64 ? 408 MET B C   1 
ATOM   6857 O  O   . MET B 1 365 ? 21.072  15.840  -4.310  1.00 33.44 ? 408 MET B O   1 
ATOM   6858 C  CB  . MET B 1 365 ? 22.619  15.222  -6.783  1.00 35.04 ? 408 MET B CB  1 
ATOM   6859 C  CG  . MET B 1 365 ? 23.573  14.354  -7.621  1.00 37.19 ? 408 MET B CG  1 
ATOM   6860 S  SD  . MET B 1 365 ? 24.475  13.127  -6.634  1.00 42.54 ? 408 MET B SD  1 
ATOM   6861 C  CE  . MET B 1 365 ? 25.110  14.172  -5.311  1.00 41.66 ? 408 MET B CE  1 
ATOM   6862 N  N   . ILE B 1 366 ? 21.385  13.640  -3.984  1.00 32.90 ? 409 ILE B N   1 
ATOM   6863 C  CA  . ILE B 1 366 ? 21.445  13.787  -2.543  1.00 32.38 ? 409 ILE B CA  1 
ATOM   6864 C  C   . ILE B 1 366 ? 22.851  13.471  -2.010  1.00 32.26 ? 409 ILE B C   1 
ATOM   6865 O  O   . ILE B 1 366 ? 23.322  12.334  -2.105  1.00 32.14 ? 409 ILE B O   1 
ATOM   6866 C  CB  . ILE B 1 366 ? 20.334  13.003  -1.818  1.00 32.37 ? 409 ILE B CB  1 
ATOM   6867 C  CG1 . ILE B 1 366 ? 18.970  13.345  -2.428  1.00 32.11 ? 409 ILE B CG1 1 
ATOM   6868 C  CG2 . ILE B 1 366 ? 20.319  13.377  -0.334  1.00 31.89 ? 409 ILE B CG2 1 
ATOM   6869 C  CD1 . ILE B 1 366 ? 18.031  12.182  -2.541  1.00 31.72 ? 409 ILE B CD1 1 
ATOM   6870 N  N   . PRO B 1 367 ? 23.529  14.499  -1.462  1.00 31.94 ? 410 PRO B N   1 
ATOM   6871 C  CA  . PRO B 1 367 ? 24.894  14.369  -0.963  1.00 31.67 ? 410 PRO B CA  1 
ATOM   6872 C  C   . PRO B 1 367 ? 25.021  13.336  0.143   1.00 31.46 ? 410 PRO B C   1 
ATOM   6873 O  O   . PRO B 1 367 ? 24.120  13.192  0.975   1.00 31.57 ? 410 PRO B O   1 
ATOM   6874 C  CB  . PRO B 1 367 ? 25.207  15.760  -0.391  1.00 31.61 ? 410 PRO B CB  1 
ATOM   6875 C  CG  . PRO B 1 367 ? 24.254  16.682  -1.037  1.00 31.86 ? 410 PRO B CG  1 
ATOM   6876 C  CD  . PRO B 1 367 ? 23.026  15.883  -1.357  1.00 31.95 ? 410 PRO B CD  1 
ATOM   6877 N  N   . ALA B 1 368 ? 26.148  12.631  0.140   1.00 31.06 ? 411 ALA B N   1 
ATOM   6878 C  CA  . ALA B 1 368 ? 26.539  11.769  1.246   1.00 30.60 ? 411 ALA B CA  1 
ATOM   6879 C  C   . ALA B 1 368 ? 26.465  12.536  2.564   1.00 30.21 ? 411 ALA B C   1 
ATOM   6880 O  O   . ALA B 1 368 ? 26.785  13.729  2.620   1.00 29.95 ? 411 ALA B O   1 
ATOM   6881 C  CB  . ALA B 1 368 ? 27.959  11.227  1.018   1.00 30.73 ? 411 ALA B CB  1 
ATOM   6882 N  N   . LYS B 1 369 ? 26.039  11.823  3.609   1.00 29.73 ? 412 LYS B N   1 
ATOM   6883 C  CA  . LYS B 1 369 ? 25.857  12.350  4.967   1.00 28.74 ? 412 LYS B CA  1 
ATOM   6884 C  C   . LYS B 1 369 ? 24.513  13.070  5.157   1.00 27.82 ? 412 LYS B C   1 
ATOM   6885 O  O   . LYS B 1 369 ? 24.248  13.595  6.243   1.00 28.04 ? 412 LYS B O   1 
ATOM   6886 C  CB  . LYS B 1 369 ? 27.020  13.258  5.396   1.00 29.11 ? 412 LYS B CB  1 
ATOM   6887 C  CG  . LYS B 1 369 ? 28.343  12.563  5.648   1.00 30.48 ? 412 LYS B CG  1 
ATOM   6888 C  CD  . LYS B 1 369 ? 29.438  13.593  5.992   1.00 32.17 ? 412 LYS B CD  1 
ATOM   6889 C  CE  . LYS B 1 369 ? 30.858  13.021  5.787   1.00 34.04 ? 412 LYS B CE  1 
ATOM   6890 N  NZ  . LYS B 1 369 ? 31.914  14.085  5.516   1.00 34.22 ? 412 LYS B NZ  1 
ATOM   6891 N  N   . THR B 1 370 ? 23.675  13.112  4.118   1.00 26.23 ? 413 THR B N   1 
ATOM   6892 C  CA  . THR B 1 370 ? 22.318  13.652  4.265   1.00 24.82 ? 413 THR B CA  1 
ATOM   6893 C  C   . THR B 1 370 ? 21.429  12.650  5.019   1.00 23.79 ? 413 THR B C   1 
ATOM   6894 O  O   . THR B 1 370 ? 21.562  11.434  4.870   1.00 23.77 ? 413 THR B O   1 
ATOM   6895 C  CB  . THR B 1 370 ? 21.643  13.986  2.911   1.00 24.91 ? 413 THR B CB  1 
ATOM   6896 O  OG1 . THR B 1 370 ? 22.514  14.785  2.099   1.00 25.83 ? 413 THR B OG1 1 
ATOM   6897 C  CG2 . THR B 1 370 ? 20.363  14.751  3.124   1.00 24.58 ? 413 THR B CG2 1 
ATOM   6898 N  N   . LEU B 1 371 ? 20.538  13.182  5.841   1.00 22.13 ? 414 LEU B N   1 
ATOM   6899 C  CA  . LEU B 1 371 ? 19.537  12.396  6.496   1.00 20.53 ? 414 LEU B CA  1 
ATOM   6900 C  C   . LEU B 1 371 ? 18.373  12.237  5.531   1.00 19.85 ? 414 LEU B C   1 
ATOM   6901 O  O   . LEU B 1 371 ? 17.841  13.224  5.023   1.00 19.54 ? 414 LEU B O   1 
ATOM   6902 C  CB  . LEU B 1 371 ? 19.092  13.089  7.783   1.00 20.01 ? 414 LEU B CB  1 
ATOM   6903 C  CG  . LEU B 1 371 ? 18.119  12.304  8.659   1.00 19.68 ? 414 LEU B CG  1 
ATOM   6904 C  CD1 . LEU B 1 371 ? 18.667  10.910  9.007   1.00 18.12 ? 414 LEU B CD1 1 
ATOM   6905 C  CD2 . LEU B 1 371 ? 17.767  13.096  9.915   1.00 18.88 ? 414 LEU B CD2 1 
ATOM   6906 N  N   . VAL B 1 372 ? 18.005  10.984  5.271   1.00 19.12 ? 415 VAL B N   1 
ATOM   6907 C  CA  . VAL B 1 372 ? 16.863  10.640  4.415   1.00 18.24 ? 415 VAL B CA  1 
ATOM   6908 C  C   . VAL B 1 372 ? 15.827  9.903   5.249   1.00 17.65 ? 415 VAL B C   1 
ATOM   6909 O  O   . VAL B 1 372 ? 16.169  8.967   5.980   1.00 17.48 ? 415 VAL B O   1 
ATOM   6910 C  CB  . VAL B 1 372 ? 17.300  9.771   3.201   1.00 18.50 ? 415 VAL B CB  1 
ATOM   6911 C  CG1 . VAL B 1 372 ? 16.100  9.377   2.344   1.00 17.77 ? 415 VAL B CG1 1 
ATOM   6912 C  CG2 . VAL B 1 372 ? 18.341  10.520  2.356   1.00 18.34 ? 415 VAL B CG2 1 
ATOM   6913 N  N   . GLN B 1 373 ? 14.572  10.338  5.165   1.00 17.19 ? 416 GLN B N   1 
ATOM   6914 C  CA  . GLN B 1 373 ? 13.509  9.758   5.983   1.00 16.71 ? 416 GLN B CA  1 
ATOM   6915 C  C   . GLN B 1 373 ? 12.404  9.179   5.126   1.00 16.99 ? 416 GLN B C   1 
ATOM   6916 O  O   . GLN B 1 373 ? 11.924  9.820   4.177   1.00 16.85 ? 416 GLN B O   1 
ATOM   6917 C  CB  . GLN B 1 373 ? 12.937  10.775  6.968   1.00 16.46 ? 416 GLN B CB  1 
ATOM   6918 C  CG  . GLN B 1 373 ? 13.969  11.307  7.969   1.00 16.88 ? 416 GLN B CG  1 
ATOM   6919 C  CD  . GLN B 1 373 ? 13.356  11.890  9.238   1.00 17.29 ? 416 GLN B CD  1 
ATOM   6920 O  OE1 . GLN B 1 373 ? 12.347  11.393  9.746   1.00 17.81 ? 416 GLN B OE1 1 
ATOM   6921 N  NE2 . GLN B 1 373 ? 13.982  12.939  9.770   1.00 17.99 ? 416 GLN B NE2 1 
ATOM   6922 N  N   . VAL B 1 374 ? 12.014  7.950   5.454   1.00 16.86 ? 417 VAL B N   1 
ATOM   6923 C  CA  . VAL B 1 374 ? 10.900  7.301   4.773   1.00 16.57 ? 417 VAL B CA  1 
ATOM   6924 C  C   . VAL B 1 374 ? 9.647   7.534   5.601   1.00 16.87 ? 417 VAL B C   1 
ATOM   6925 O  O   . VAL B 1 374 ? 9.554   7.052   6.734   1.00 17.25 ? 417 VAL B O   1 
ATOM   6926 C  CB  . VAL B 1 374 ? 11.148  5.784   4.623   1.00 16.68 ? 417 VAL B CB  1 
ATOM   6927 C  CG1 . VAL B 1 374 ? 10.008  5.121   3.889   1.00 15.28 ? 417 VAL B CG1 1 
ATOM   6928 C  CG2 . VAL B 1 374 ? 12.499  5.518   3.913   1.00 16.43 ? 417 VAL B CG2 1 
ATOM   6929 N  N   . ALA B 1 375 ? 8.681   8.260   5.046   1.00 16.44 ? 418 ALA B N   1 
ATOM   6930 C  CA  . ALA B 1 375 ? 7.474   8.571   5.790   1.00 16.47 ? 418 ALA B CA  1 
ATOM   6931 C  C   . ALA B 1 375 ? 6.514   7.376   5.843   1.00 17.25 ? 418 ALA B C   1 
ATOM   6932 O  O   . ALA B 1 375 ? 5.474   7.328   5.151   1.00 17.45 ? 418 ALA B O   1 
ATOM   6933 C  CB  . ALA B 1 375 ? 6.799   9.808   5.248   1.00 15.71 ? 418 ALA B CB  1 
ATOM   6934 N  N   . ILE B 1 376 ? 6.867   6.430   6.707   1.00 17.54 ? 419 ILE B N   1 
ATOM   6935 C  CA  . ILE B 1 376 ? 6.130   5.183   6.879   1.00 18.15 ? 419 ILE B CA  1 
ATOM   6936 C  C   . ILE B 1 376 ? 4.640   5.395   7.123   1.00 18.10 ? 419 ILE B C   1 
ATOM   6937 O  O   . ILE B 1 376 ? 3.818   4.710   6.513   1.00 18.20 ? 419 ILE B O   1 
ATOM   6938 C  CB  . ILE B 1 376 ? 6.832   4.277   7.951   1.00 18.84 ? 419 ILE B CB  1 
ATOM   6939 C  CG1 . ILE B 1 376 ? 7.526   3.117   7.256   1.00 20.18 ? 419 ILE B CG1 1 
ATOM   6940 C  CG2 . ILE B 1 376 ? 5.874   3.654   8.931   1.00 18.64 ? 419 ILE B CG2 1 
ATOM   6941 C  CD1 . ILE B 1 376 ? 8.627   3.524   6.358   1.00 21.47 ? 419 ILE B CD1 1 
ATOM   6942 N  N   . TYR B 1 377 ? 4.288   6.357   7.978   1.00 17.91 ? 420 TYR B N   1 
ATOM   6943 C  CA  . TYR B 1 377 ? 2.886   6.616   8.261   1.00 17.69 ? 420 TYR B CA  1 
ATOM   6944 C  C   . TYR B 1 377 ? 2.148   7.099   7.016   1.00 18.34 ? 420 TYR B C   1 
ATOM   6945 O  O   . TYR B 1 377 ? 1.035   6.649   6.743   1.00 18.48 ? 420 TYR B O   1 
ATOM   6946 C  CB  . TYR B 1 377 ? 2.703   7.631   9.404   1.00 17.37 ? 420 TYR B CB  1 
ATOM   6947 C  CG  . TYR B 1 377 ? 1.243   7.979   9.658   1.00 15.72 ? 420 TYR B CG  1 
ATOM   6948 C  CD1 . TYR B 1 377 ? 0.502   7.291   10.603  1.00 15.15 ? 420 TYR B CD1 1 
ATOM   6949 C  CD2 . TYR B 1 377 ? 0.605   8.994   8.936   1.00 16.31 ? 420 TYR B CD2 1 
ATOM   6950 C  CE1 . TYR B 1 377 ? -0.832  7.598   10.837  1.00 15.47 ? 420 TYR B CE1 1 
ATOM   6951 C  CE2 . TYR B 1 377 ? -0.736  9.309   9.153   1.00 14.75 ? 420 TYR B CE2 1 
ATOM   6952 C  CZ  . TYR B 1 377 ? -1.448  8.606   10.093  1.00 15.64 ? 420 TYR B CZ  1 
ATOM   6953 O  OH  . TYR B 1 377 ? -2.775  8.913   10.322  1.00 17.18 ? 420 TYR B OH  1 
ATOM   6954 N  N   . ALA B 1 378 ? 2.756   8.032   6.282   1.00 18.66 ? 421 ALA B N   1 
ATOM   6955 C  CA  . ALA B 1 378 ? 2.095   8.635   5.131   1.00 19.43 ? 421 ALA B CA  1 
ATOM   6956 C  C   . ALA B 1 378 ? 1.989   7.626   3.987   1.00 19.90 ? 421 ALA B C   1 
ATOM   6957 O  O   . ALA B 1 378 ? 0.971   7.565   3.297   1.00 19.89 ? 421 ALA B O   1 
ATOM   6958 C  CB  . ALA B 1 378 ? 2.815   9.890   4.690   1.00 19.11 ? 421 ALA B CB  1 
ATOM   6959 N  N   . LEU B 1 379 ? 3.046   6.834   3.816   1.00 20.44 ? 422 LEU B N   1 
ATOM   6960 C  CA  . LEU B 1 379 ? 3.038   5.689   2.925   1.00 21.41 ? 422 LEU B CA  1 
ATOM   6961 C  C   . LEU B 1 379 ? 1.780   4.822   3.106   1.00 21.85 ? 422 LEU B C   1 
ATOM   6962 O  O   . LEU B 1 379 ? 1.028   4.626   2.161   1.00 21.88 ? 422 LEU B O   1 
ATOM   6963 C  CB  . LEU B 1 379 ? 4.307   4.864   3.121   1.00 21.14 ? 422 LEU B CB  1 
ATOM   6964 C  CG  . LEU B 1 379 ? 4.475   3.540   2.363   1.00 22.26 ? 422 LEU B CG  1 
ATOM   6965 C  CD1 . LEU B 1 379 ? 3.960   3.604   0.918   1.00 21.55 ? 422 LEU B CD1 1 
ATOM   6966 C  CD2 . LEU B 1 379 ? 5.941   3.116   2.401   1.00 21.87 ? 422 LEU B CD2 1 
ATOM   6967 N  N   . GLY B 1 380 ? 1.541   4.350   4.323   1.00 22.42 ? 423 GLY B N   1 
ATOM   6968 C  CA  . GLY B 1 380 ? 0.409   3.476   4.612   1.00 23.05 ? 423 GLY B CA  1 
ATOM   6969 C  C   . GLY B 1 380 ? -0.972  4.077   4.408   1.00 23.69 ? 423 GLY B C   1 
ATOM   6970 O  O   . GLY B 1 380 ? -1.962  3.346   4.329   1.00 24.01 ? 423 GLY B O   1 
ATOM   6971 N  N   . ARG B 1 381 ? -1.062  5.398   4.341   1.00 24.05 ? 424 ARG B N   1 
ATOM   6972 C  CA  . ARG B 1 381 ? -2.365  6.046   4.130   1.00 24.43 ? 424 ARG B CA  1 
ATOM   6973 C  C   . ARG B 1 381 ? -2.525  6.489   2.685   1.00 24.55 ? 424 ARG B C   1 
ATOM   6974 O  O   . ARG B 1 381 ? -3.588  6.961   2.298   1.00 24.46 ? 424 ARG B O   1 
ATOM   6975 C  CB  . ARG B 1 381 ? -2.560  7.262   5.051   1.00 24.10 ? 424 ARG B CB  1 
ATOM   6976 C  CG  . ARG B 1 381 ? -2.418  6.988   6.527   1.00 24.53 ? 424 ARG B CG  1 
ATOM   6977 C  CD  . ARG B 1 381 ? -3.298  5.857   6.967   1.00 24.35 ? 424 ARG B CD  1 
ATOM   6978 N  NE  . ARG B 1 381 ? -3.127  5.585   8.388   1.00 24.98 ? 424 ARG B NE  1 
ATOM   6979 C  CZ  . ARG B 1 381 ? -3.981  5.961   9.333   1.00 24.78 ? 424 ARG B CZ  1 
ATOM   6980 N  NH1 . ARG B 1 381 ? -5.069  6.634   9.021   1.00 24.28 ? 424 ARG B NH1 1 
ATOM   6981 N  NH2 . ARG B 1 381 ? -3.747  5.659   10.599  1.00 26.60 ? 424 ARG B NH2 1 
ATOM   6982 N  N   . GLU B 1 382 ? -1.459  6.321   1.909   1.00 24.97 ? 425 GLU B N   1 
ATOM   6983 C  CA  . GLU B 1 382 ? -1.379  6.798   0.543   1.00 25.81 ? 425 GLU B CA  1 
ATOM   6984 C  C   . GLU B 1 382 ? -2.102  5.865   -0.455  1.00 26.07 ? 425 GLU B C   1 
ATOM   6985 O  O   . GLU B 1 382 ? -1.663  4.730   -0.679  1.00 26.05 ? 425 GLU B O   1 
ATOM   6986 C  CB  . GLU B 1 382 ? 0.095   7.007   0.163   1.00 25.86 ? 425 GLU B CB  1 
ATOM   6987 C  CG  . GLU B 1 382 ? 0.353   7.587   -1.232  1.00 27.74 ? 425 GLU B CG  1 
ATOM   6988 C  CD  . GLU B 1 382 ? -0.611  8.702   -1.630  1.00 29.09 ? 425 GLU B CD  1 
ATOM   6989 O  OE1 . GLU B 1 382 ? -0.713  9.707   -0.900  1.00 27.61 ? 425 GLU B OE1 1 
ATOM   6990 O  OE2 . GLU B 1 382 ? -1.270  8.558   -2.687  1.00 30.78 ? 425 GLU B OE2 1 
ATOM   6991 N  N   . PRO B 1 383 ? -3.203  6.357   -1.072  1.00 26.42 ? 426 PRO B N   1 
ATOM   6992 C  CA  . PRO B 1 383 ? -4.007  5.512   -1.957  1.00 26.83 ? 426 PRO B CA  1 
ATOM   6993 C  C   . PRO B 1 383 ? -3.345  5.122   -3.278  1.00 27.58 ? 426 PRO B C   1 
ATOM   6994 O  O   . PRO B 1 383 ? -3.884  4.268   -3.983  1.00 28.10 ? 426 PRO B O   1 
ATOM   6995 C  CB  . PRO B 1 383 ? -5.264  6.347   -2.209  1.00 26.47 ? 426 PRO B CB  1 
ATOM   6996 C  CG  . PRO B 1 383 ? -4.867  7.715   -1.940  1.00 26.75 ? 426 PRO B CG  1 
ATOM   6997 C  CD  . PRO B 1 383 ? -3.824  7.680   -0.879  1.00 26.02 ? 426 PRO B CD  1 
ATOM   6998 N  N   . THR B 1 384 ? -2.206  5.728   -3.613  1.00 27.94 ? 427 THR B N   1 
ATOM   6999 C  CA  . THR B 1 384 ? -1.462  5.321   -4.807  1.00 28.14 ? 427 THR B CA  1 
ATOM   7000 C  C   . THR B 1 384 ? -0.502  4.182   -4.530  1.00 28.33 ? 427 THR B C   1 
ATOM   7001 O  O   . THR B 1 384 ? 0.069   3.618   -5.461  1.00 28.65 ? 427 THR B O   1 
ATOM   7002 C  CB  . THR B 1 384 ? -0.672  6.490   -5.452  1.00 28.43 ? 427 THR B CB  1 
ATOM   7003 O  OG1 . THR B 1 384 ? 0.190   7.100   -4.481  1.00 28.67 ? 427 THR B OG1 1 
ATOM   7004 C  CG2 . THR B 1 384 ? -1.631  7.534   -5.997  1.00 28.01 ? 427 THR B CG2 1 
ATOM   7005 N  N   . PHE B 1 385 ? -0.297  3.848   -3.255  1.00 28.48 ? 428 PHE B N   1 
ATOM   7006 C  CA  . PHE B 1 385 ? 0.587   2.721   -2.918  1.00 28.19 ? 428 PHE B CA  1 
ATOM   7007 C  C   . PHE B 1 385 ? -0.146  1.541   -2.281  1.00 27.79 ? 428 PHE B C   1 
ATOM   7008 O  O   . PHE B 1 385 ? 0.379   0.424   -2.254  1.00 27.22 ? 428 PHE B O   1 
ATOM   7009 C  CB  . PHE B 1 385 ? 1.783   3.172   -2.079  1.00 27.96 ? 428 PHE B CB  1 
ATOM   7010 C  CG  . PHE B 1 385 ? 2.634   4.196   -2.763  1.00 29.76 ? 428 PHE B CG  1 
ATOM   7011 C  CD1 . PHE B 1 385 ? 2.877   5.428   -2.170  1.00 29.82 ? 428 PHE B CD1 1 
ATOM   7012 C  CD2 . PHE B 1 385 ? 3.178   3.941   -4.029  1.00 31.60 ? 428 PHE B CD2 1 
ATOM   7013 C  CE1 . PHE B 1 385 ? 3.665   6.386   -2.819  1.00 30.32 ? 428 PHE B CE1 1 
ATOM   7014 C  CE2 . PHE B 1 385 ? 3.977   4.899   -4.681  1.00 31.36 ? 428 PHE B CE2 1 
ATOM   7015 C  CZ  . PHE B 1 385 ? 4.212   6.121   -4.071  1.00 30.10 ? 428 PHE B CZ  1 
ATOM   7016 N  N   . PHE B 1 386 ? -1.351  1.787   -1.776  1.00 27.37 ? 429 PHE B N   1 
ATOM   7017 C  CA  . PHE B 1 386 ? -2.173  0.707   -1.278  1.00 27.77 ? 429 PHE B CA  1 
ATOM   7018 C  C   . PHE B 1 386 ? -3.579  0.882   -1.784  1.00 28.55 ? 429 PHE B C   1 
ATOM   7019 O  O   . PHE B 1 386 ? -4.145  1.960   -1.669  1.00 28.24 ? 429 PHE B O   1 
ATOM   7020 C  CB  . PHE B 1 386 ? -2.181  0.638   0.257   1.00 27.19 ? 429 PHE B CB  1 
ATOM   7021 C  CG  . PHE B 1 386 ? -0.851  0.297   0.860   1.00 26.09 ? 429 PHE B CG  1 
ATOM   7022 C  CD1 . PHE B 1 386 ? -0.011  1.310   1.344   1.00 23.94 ? 429 PHE B CD1 1 
ATOM   7023 C  CD2 . PHE B 1 386 ? -0.435  -1.028  0.959   1.00 25.13 ? 429 PHE B CD2 1 
ATOM   7024 C  CE1 . PHE B 1 386 ? 1.227   1.008   1.899   1.00 23.26 ? 429 PHE B CE1 1 
ATOM   7025 C  CE2 . PHE B 1 386 ? 0.812   -1.352  1.531   1.00 25.17 ? 429 PHE B CE2 1 
ATOM   7026 C  CZ  . PHE B 1 386 ? 1.642   -0.317  2.003   1.00 24.70 ? 429 PHE B CZ  1 
ATOM   7027 N  N   . PHE B 1 387 ? -4.138  -0.187  -2.342  1.00 29.95 ? 430 PHE B N   1 
ATOM   7028 C  CA  . PHE B 1 387 ? -5.532  -0.179  -2.731  1.00 31.42 ? 430 PHE B CA  1 
ATOM   7029 C  C   . PHE B 1 387 ? -6.384  0.020   -1.494  1.00 31.68 ? 430 PHE B C   1 
ATOM   7030 O  O   . PHE B 1 387 ? -6.191  -0.678  -0.495  1.00 31.93 ? 430 PHE B O   1 
ATOM   7031 C  CB  . PHE B 1 387 ? -5.932  -1.484  -3.420  1.00 31.95 ? 430 PHE B CB  1 
ATOM   7032 C  CG  . PHE B 1 387 ? -7.364  -1.493  -3.877  1.00 34.56 ? 430 PHE B CG  1 
ATOM   7033 C  CD1 . PHE B 1 387 ? -7.735  -0.841  -5.065  1.00 37.08 ? 430 PHE B CD1 1 
ATOM   7034 C  CD2 . PHE B 1 387 ? -8.350  -2.115  -3.109  1.00 36.12 ? 430 PHE B CD2 1 
ATOM   7035 C  CE1 . PHE B 1 387 ? -9.074  -0.834  -5.491  1.00 38.87 ? 430 PHE B CE1 1 
ATOM   7036 C  CE2 . PHE B 1 387 ? -9.698  -2.105  -3.519  1.00 38.85 ? 430 PHE B CE2 1 
ATOM   7037 C  CZ  . PHE B 1 387 ? -10.062 -1.464  -4.712  1.00 38.75 ? 430 PHE B CZ  1 
ATOM   7038 N  N   . ASP B 1 388 ? -7.316  0.967   -1.575  1.00 32.05 ? 431 ASP B N   1 
ATOM   7039 C  CA  . ASP B 1 388 ? -8.255  1.281   -0.492  1.00 32.90 ? 431 ASP B CA  1 
ATOM   7040 C  C   . ASP B 1 388 ? -7.568  1.339   0.889   1.00 32.77 ? 431 ASP B C   1 
ATOM   7041 O  O   . ASP B 1 388 ? -7.926  0.578   1.799   1.00 32.70 ? 431 ASP B O   1 
ATOM   7042 C  CB  . ASP B 1 388 ? -9.431  0.286   -0.506  1.00 33.36 ? 431 ASP B CB  1 
ATOM   7043 C  CG  . ASP B 1 388 ? -10.592 0.726   0.381   1.00 35.49 ? 431 ASP B CG  1 
ATOM   7044 O  OD1 . ASP B 1 388 ? -10.661 1.921   0.755   1.00 37.95 ? 431 ASP B OD1 1 
ATOM   7045 O  OD2 . ASP B 1 388 ? -11.436 -0.136  0.721   1.00 38.40 ? 431 ASP B OD2 1 
ATOM   7046 N  N   . PRO B 1 389 ? -6.595  2.265   1.055   1.00 32.68 ? 432 PRO B N   1 
ATOM   7047 C  CA  . PRO B 1 389 ? -5.675  2.249   2.213   1.00 32.49 ? 432 PRO B CA  1 
ATOM   7048 C  C   . PRO B 1 389 ? -6.360  2.371   3.592   1.00 32.42 ? 432 PRO B C   1 
ATOM   7049 O  O   . PRO B 1 389 ? -5.810  1.911   4.598   1.00 32.11 ? 432 PRO B O   1 
ATOM   7050 C  CB  . PRO B 1 389 ? -4.746  3.444   1.938   1.00 32.37 ? 432 PRO B CB  1 
ATOM   7051 C  CG  . PRO B 1 389 ? -5.571  4.379   1.123   1.00 32.15 ? 432 PRO B CG  1 
ATOM   7052 C  CD  . PRO B 1 389 ? -6.466  3.515   0.272   1.00 32.58 ? 432 PRO B CD  1 
ATOM   7053 N  N   . GLU B 1 390 ? -7.551  2.963   3.621   1.00 32.25 ? 433 GLU B N   1 
ATOM   7054 C  CA  . GLU B 1 390 ? -8.336  3.079   4.842   1.00 32.77 ? 433 GLU B CA  1 
ATOM   7055 C  C   . GLU B 1 390 ? -9.069  1.787   5.226   1.00 32.45 ? 433 GLU B C   1 
ATOM   7056 O  O   . GLU B 1 390 ? -9.788  1.748   6.233   1.00 32.28 ? 433 GLU B O   1 
ATOM   7057 C  CB  . GLU B 1 390 ? -9.343  4.222   4.718   1.00 33.11 ? 433 GLU B CB  1 
ATOM   7058 C  CG  . GLU B 1 390 ? -8.722  5.616   4.754   1.00 36.64 ? 433 GLU B CG  1 
ATOM   7059 C  CD  . GLU B 1 390 ? -9.751  6.715   5.011   1.00 41.21 ? 433 GLU B CD  1 
ATOM   7060 O  OE1 . GLU B 1 390 ? -10.896 6.622   4.495   1.00 42.27 ? 433 GLU B OE1 1 
ATOM   7061 O  OE2 . GLU B 1 390 ? -9.408  7.679   5.740   1.00 43.39 ? 433 GLU B OE2 1 
ATOM   7062 N  N   . ASN B 1 391 ? -8.906  0.733   4.430   1.00 31.92 ? 434 ASN B N   1 
ATOM   7063 C  CA  . ASN B 1 391 ? -9.578  -0.522  4.734   1.00 31.49 ? 434 ASN B CA  1 
ATOM   7064 C  C   . ASN B 1 391 ? -8.624  -1.482  5.415   1.00 30.85 ? 434 ASN B C   1 
ATOM   7065 O  O   . ASN B 1 391 ? -7.475  -1.666  4.982   1.00 30.72 ? 434 ASN B O   1 
ATOM   7066 C  CB  . ASN B 1 391 ? -10.194 -1.157  3.476   1.00 32.05 ? 434 ASN B CB  1 
ATOM   7067 C  CG  . ASN B 1 391 ? -11.203 -2.265  3.803   1.00 33.28 ? 434 ASN B CG  1 
ATOM   7068 O  OD1 . ASN B 1 391 ? -12.288 -2.007  4.339   1.00 35.64 ? 434 ASN B OD1 1 
ATOM   7069 N  ND2 . ASN B 1 391 ? -10.848 -3.499  3.477   1.00 33.85 ? 434 ASN B ND2 1 
ATOM   7070 N  N   . PHE B 1 392 ? -9.093  -2.091  6.495   1.00 29.75 ? 435 PHE B N   1 
ATOM   7071 C  CA  . PHE B 1 392 ? -8.289  -3.086  7.172   1.00 28.99 ? 435 PHE B CA  1 
ATOM   7072 C  C   . PHE B 1 392 ? -8.433  -4.407  6.409   1.00 28.51 ? 435 PHE B C   1 
ATOM   7073 O  O   . PHE B 1 392 ? -9.426  -5.109  6.568   1.00 28.51 ? 435 PHE B O   1 
ATOM   7074 C  CB  . PHE B 1 392 ? -8.704  -3.195  8.649   1.00 28.78 ? 435 PHE B CB  1 
ATOM   7075 C  CG  . PHE B 1 392 ? -7.859  -4.147  9.456   1.00 28.45 ? 435 PHE B CG  1 
ATOM   7076 C  CD1 . PHE B 1 392 ? -6.566  -3.799  9.845   1.00 27.04 ? 435 PHE B CD1 1 
ATOM   7077 C  CD2 . PHE B 1 392 ? -8.356  -5.390  9.826   1.00 27.05 ? 435 PHE B CD2 1 
ATOM   7078 C  CE1 . PHE B 1 392 ? -5.794  -4.669  10.590  1.00 26.80 ? 435 PHE B CE1 1 
ATOM   7079 C  CE2 . PHE B 1 392 ? -7.582  -6.267  10.576  1.00 26.98 ? 435 PHE B CE2 1 
ATOM   7080 C  CZ  . PHE B 1 392 ? -6.307  -5.907  10.960  1.00 26.84 ? 435 PHE B CZ  1 
ATOM   7081 N  N   . ASP B 1 393 ? -7.457  -4.713  5.548   1.00 28.36 ? 436 ASP B N   1 
ATOM   7082 C  CA  . ASP B 1 393 ? -7.499  -5.922  4.714   1.00 28.16 ? 436 ASP B CA  1 
ATOM   7083 C  C   . ASP B 1 393 ? -6.196  -6.728  4.714   1.00 27.95 ? 436 ASP B C   1 
ATOM   7084 O  O   . ASP B 1 393 ? -5.304  -6.463  3.921   1.00 27.57 ? 436 ASP B O   1 
ATOM   7085 C  CB  . ASP B 1 393 ? -7.933  -5.608  3.275   1.00 28.31 ? 436 ASP B CB  1 
ATOM   7086 C  CG  . ASP B 1 393 ? -8.151  -6.881  2.421   1.00 29.65 ? 436 ASP B CG  1 
ATOM   7087 O  OD1 . ASP B 1 393 ? -8.477  -6.737  1.223   1.00 30.79 ? 436 ASP B OD1 1 
ATOM   7088 O  OD2 . ASP B 1 393 ? -8.002  -8.026  2.929   1.00 30.25 ? 436 ASP B OD2 1 
ATOM   7089 N  N   . PRO B 1 394 ? -6.109  -7.746  5.591   1.00 28.05 ? 437 PRO B N   1 
ATOM   7090 C  CA  . PRO B 1 394 ? -4.940  -8.612  5.716   1.00 28.06 ? 437 PRO B CA  1 
ATOM   7091 C  C   . PRO B 1 394 ? -4.605  -9.422  4.465   1.00 28.14 ? 437 PRO B C   1 
ATOM   7092 O  O   . PRO B 1 394 ? -3.440  -9.773  4.273   1.00 28.37 ? 437 PRO B O   1 
ATOM   7093 C  CB  . PRO B 1 394 ? -5.333  -9.563  6.851   1.00 28.24 ? 437 PRO B CB  1 
ATOM   7094 C  CG  . PRO B 1 394 ? -6.363  -8.840  7.605   1.00 28.10 ? 437 PRO B CG  1 
ATOM   7095 C  CD  . PRO B 1 394 ? -7.135  -8.085  6.591   1.00 27.65 ? 437 PRO B CD  1 
ATOM   7096 N  N   . THR B 1 395 ? -5.602  -9.726  3.634   1.00 28.15 ? 438 THR B N   1 
ATOM   7097 C  CA  . THR B 1 395 ? -5.381  -10.533 2.420   1.00 28.52 ? 438 THR B CA  1 
ATOM   7098 C  C   . THR B 1 395 ? -4.453  -9.817  1.436   1.00 28.82 ? 438 THR B C   1 
ATOM   7099 O  O   . THR B 1 395 ? -3.827  -10.441 0.577   1.00 28.95 ? 438 THR B O   1 
ATOM   7100 C  CB  . THR B 1 395 ? -6.707  -10.903 1.688   1.00 28.54 ? 438 THR B CB  1 
ATOM   7101 O  OG1 . THR B 1 395 ? -7.335  -9.715  1.176   1.00 28.37 ? 438 THR B OG1 1 
ATOM   7102 C  CG2 . THR B 1 395 ? -7.678  -11.639 2.619   1.00 28.00 ? 438 THR B CG2 1 
ATOM   7103 N  N   . ARG B 1 396 ? -4.397  -8.499  1.570   1.00 29.04 ? 439 ARG B N   1 
ATOM   7104 C  CA  . ARG B 1 396 ? -3.475  -7.634  0.853   1.00 29.61 ? 439 ARG B CA  1 
ATOM   7105 C  C   . ARG B 1 396 ? -2.029  -8.175  0.835   1.00 30.37 ? 439 ARG B C   1 
ATOM   7106 O  O   . ARG B 1 396 ? -1.323  -8.017  -0.156  1.00 30.46 ? 439 ARG B O   1 
ATOM   7107 C  CB  . ARG B 1 396 ? -3.537  -6.272  1.526   1.00 29.19 ? 439 ARG B CB  1 
ATOM   7108 C  CG  . ARG B 1 396 ? -2.698  -5.199  0.944   1.00 29.07 ? 439 ARG B CG  1 
ATOM   7109 C  CD  . ARG B 1 396 ? -2.620  -4.022  1.926   1.00 27.04 ? 439 ARG B CD  1 
ATOM   7110 N  NE  . ARG B 1 396 ? -3.933  -3.475  2.309   1.00 24.27 ? 439 ARG B NE  1 
ATOM   7111 C  CZ  . ARG B 1 396 ? -4.682  -2.683  1.542   1.00 22.90 ? 439 ARG B CZ  1 
ATOM   7112 N  NH1 . ARG B 1 396 ? -4.287  -2.329  0.314   1.00 21.47 ? 439 ARG B NH1 1 
ATOM   7113 N  NH2 . ARG B 1 396 ? -5.836  -2.242  2.009   1.00 21.34 ? 439 ARG B NH2 1 
ATOM   7114 N  N   . TRP B 1 397 ? -1.614  -8.833  1.919   1.00 31.26 ? 440 TRP B N   1 
ATOM   7115 C  CA  . TRP B 1 397 ? -0.230  -9.292  2.100   1.00 32.34 ? 440 TRP B CA  1 
ATOM   7116 C  C   . TRP B 1 397 ? 0.019   -10.710 1.587   1.00 34.23 ? 440 TRP B C   1 
ATOM   7117 O  O   . TRP B 1 397 ? 1.169   -11.175 1.538   1.00 34.13 ? 440 TRP B O   1 
ATOM   7118 C  CB  . TRP B 1 397 ? 0.167   -9.190  3.573   1.00 31.48 ? 440 TRP B CB  1 
ATOM   7119 C  CG  . TRP B 1 397 ? 0.084   -7.792  4.064   1.00 29.53 ? 440 TRP B CG  1 
ATOM   7120 C  CD1 . TRP B 1 397 ? -0.958  -7.210  4.745   1.00 26.82 ? 440 TRP B CD1 1 
ATOM   7121 C  CD2 . TRP B 1 397 ? 1.061   -6.772  3.873   1.00 26.77 ? 440 TRP B CD2 1 
ATOM   7122 N  NE1 . TRP B 1 397 ? -0.676  -5.895  4.993   1.00 25.02 ? 440 TRP B NE1 1 
ATOM   7123 C  CE2 . TRP B 1 397 ? 0.561   -5.600  4.478   1.00 25.53 ? 440 TRP B CE2 1 
ATOM   7124 C  CE3 . TRP B 1 397 ? 2.320   -6.734  3.254   1.00 26.11 ? 440 TRP B CE3 1 
ATOM   7125 C  CZ2 . TRP B 1 397 ? 1.276   -4.396  4.480   1.00 24.84 ? 440 TRP B CZ2 1 
ATOM   7126 C  CZ3 . TRP B 1 397 ? 3.031   -5.539  3.261   1.00 25.09 ? 440 TRP B CZ3 1 
ATOM   7127 C  CH2 . TRP B 1 397 ? 2.501   -4.386  3.868   1.00 23.89 ? 440 TRP B CH2 1 
ATOM   7128 N  N   . LEU B 1 398 ? -1.069  -11.385 1.212   1.00 36.36 ? 441 LEU B N   1 
ATOM   7129 C  CA  . LEU B 1 398 ? -1.016  -12.741 0.681   1.00 38.28 ? 441 LEU B CA  1 
ATOM   7130 C  C   . LEU B 1 398 ? -1.014  -12.732 -0.848  1.00 39.86 ? 441 LEU B C   1 
ATOM   7131 O  O   . LEU B 1 398 ? -0.634  -13.715 -1.473  1.00 40.33 ? 441 LEU B O   1 
ATOM   7132 C  CB  . LEU B 1 398 ? -2.182  -13.579 1.231   1.00 37.81 ? 441 LEU B CB  1 
ATOM   7133 C  CG  . LEU B 1 398 ? -2.282  -13.745 2.760   1.00 37.55 ? 441 LEU B CG  1 
ATOM   7134 C  CD1 . LEU B 1 398 ? -3.598  -14.397 3.190   1.00 36.80 ? 441 LEU B CD1 1 
ATOM   7135 C  CD2 . LEU B 1 398 ? -1.097  -14.519 3.334   1.00 37.56 ? 441 LEU B CD2 1 
ATOM   7136 N  N   . SER B 1 399 ? -1.416  -11.601 -1.425  1.00 42.05 ? 442 SER B N   1 
ATOM   7137 C  CA  . SER B 1 399 ? -1.570  -11.400 -2.874  1.00 44.17 ? 442 SER B CA  1 
ATOM   7138 C  C   . SER B 1 399 ? -0.590  -12.158 -3.785  1.00 45.80 ? 442 SER B C   1 
ATOM   7139 O  O   . SER B 1 399 ? 0.598   -12.320 -3.456  1.00 46.00 ? 442 SER B O   1 
ATOM   7140 C  CB  . SER B 1 399 ? -1.502  -9.901  -3.194  1.00 44.23 ? 442 SER B CB  1 
ATOM   7141 O  OG  . SER B 1 399 ? -1.633  -9.651  -4.587  1.00 44.26 ? 442 SER B OG  1 
ATOM   7142 N  N   . LYS B 1 400 ? -1.113  -12.608 -4.931  1.00 47.64 ? 443 LYS B N   1 
ATOM   7143 C  CA  . LYS B 1 400 ? -0.307  -13.185 -6.027  1.00 49.22 ? 443 LYS B CA  1 
ATOM   7144 C  C   . LYS B 1 400 ? 0.673   -12.135 -6.559  1.00 49.80 ? 443 LYS B C   1 
ATOM   7145 O  O   . LYS B 1 400 ? 1.869   -12.405 -6.753  1.00 50.01 ? 443 LYS B O   1 
ATOM   7146 C  CB  . LYS B 1 400 ? -1.216  -13.670 -7.180  1.00 49.56 ? 443 LYS B CB  1 
ATOM   7147 C  CG  . LYS B 1 400 ? -2.322  -14.704 -6.809  1.00 51.22 ? 443 LYS B CG  1 
ATOM   7148 C  CD  . LYS B 1 400 ? -1.762  -16.130 -6.569  1.00 53.78 ? 443 LYS B CD  1 
ATOM   7149 C  CE  . LYS B 1 400 ? -1.286  -16.354 -5.110  1.00 55.05 ? 443 LYS B CE  1 
ATOM   7150 N  NZ  . LYS B 1 400 ? -0.610  -17.681 -4.883  1.00 55.25 ? 443 LYS B NZ  1 
ATOM   7151 N  N   . ASP B 1 401 ? 0.140   -10.931 -6.758  1.00 50.33 ? 444 ASP B N   1 
ATOM   7152 C  CA  . ASP B 1 401 ? 0.851   -9.805  -7.343  1.00 50.76 ? 444 ASP B CA  1 
ATOM   7153 C  C   . ASP B 1 401 ? 1.940   -9.272  -6.399  1.00 50.94 ? 444 ASP B C   1 
ATOM   7154 O  O   . ASP B 1 401 ? 1.655   -8.627  -5.385  1.00 51.12 ? 444 ASP B O   1 
ATOM   7155 C  CB  . ASP B 1 401 ? -0.169  -8.716  -7.701  1.00 50.76 ? 444 ASP B CB  1 
ATOM   7156 C  CG  . ASP B 1 401 ? 0.382   -7.676  -8.642  1.00 51.45 ? 444 ASP B CG  1 
ATOM   7157 O  OD1 . ASP B 1 401 ? -0.382  -6.753  -9.003  1.00 51.76 ? 444 ASP B OD1 1 
ATOM   7158 O  OD2 . ASP B 1 401 ? 1.570   -7.773  -9.020  1.00 52.58 ? 444 ASP B OD2 1 
ATOM   7159 N  N   . LYS B 1 402 ? 3.192   -9.544  -6.746  1.00 50.97 ? 445 LYS B N   1 
ATOM   7160 C  CA  . LYS B 1 402 ? 4.317   -9.148  -5.901  1.00 50.96 ? 445 LYS B CA  1 
ATOM   7161 C  C   . LYS B 1 402 ? 4.880   -7.748  -6.193  1.00 50.35 ? 445 LYS B C   1 
ATOM   7162 O  O   . LYS B 1 402 ? 5.975   -7.408  -5.742  1.00 50.32 ? 445 LYS B O   1 
ATOM   7163 C  CB  . LYS B 1 402 ? 5.411   -10.226 -5.914  1.00 51.31 ? 445 LYS B CB  1 
ATOM   7164 C  CG  . LYS B 1 402 ? 4.998   -11.549 -5.221  1.00 52.88 ? 445 LYS B CG  1 
ATOM   7165 C  CD  . LYS B 1 402 ? 5.254   -11.535 -3.701  1.00 55.51 ? 445 LYS B CD  1 
ATOM   7166 C  CE  . LYS B 1 402 ? 4.037   -11.056 -2.887  1.00 56.70 ? 445 LYS B CE  1 
ATOM   7167 N  NZ  . LYS B 1 402 ? 3.009   -12.131 -2.715  1.00 57.45 ? 445 LYS B NZ  1 
ATOM   7168 N  N   . ASN B 1 403 ? 4.126   -6.941  -6.940  1.00 49.58 ? 446 ASN B N   1 
ATOM   7169 C  CA  . ASN B 1 403 ? 4.374   -5.498  -7.007  1.00 48.66 ? 446 ASN B CA  1 
ATOM   7170 C  C   . ASN B 1 403 ? 3.671   -4.891  -5.819  1.00 47.45 ? 446 ASN B C   1 
ATOM   7171 O  O   . ASN B 1 403 ? 4.122   -3.904  -5.257  1.00 47.44 ? 446 ASN B O   1 
ATOM   7172 C  CB  . ASN B 1 403 ? 3.784   -4.860  -8.272  1.00 48.93 ? 446 ASN B CB  1 
ATOM   7173 C  CG  . ASN B 1 403 ? 4.238   -5.542  -9.549  1.00 50.48 ? 446 ASN B CG  1 
ATOM   7174 O  OD1 . ASN B 1 403 ? 5.413   -5.481  -9.919  1.00 51.91 ? 446 ASN B OD1 1 
ATOM   7175 N  ND2 . ASN B 1 403 ? 3.296   -6.181  -10.248 1.00 51.53 ? 446 ASN B ND2 1 
ATOM   7176 N  N   . ILE B 1 404 ? 2.555   -5.514  -5.449  1.00 46.04 ? 447 ILE B N   1 
ATOM   7177 C  CA  . ILE B 1 404 ? 1.631   -4.980  -4.454  1.00 44.53 ? 447 ILE B CA  1 
ATOM   7178 C  C   . ILE B 1 404 ? 2.217   -4.898  -3.035  1.00 43.18 ? 447 ILE B C   1 
ATOM   7179 O  O   . ILE B 1 404 ? 1.832   -4.025  -2.261  1.00 43.10 ? 447 ILE B O   1 
ATOM   7180 C  CB  . ILE B 1 404 ? 0.254   -5.714  -4.523  1.00 44.67 ? 447 ILE B CB  1 
ATOM   7181 C  CG1 . ILE B 1 404 ? -0.655  -4.985  -5.519  1.00 44.97 ? 447 ILE B CG1 1 
ATOM   7182 C  CG2 . ILE B 1 404 ? -0.418  -5.819  -3.143  1.00 44.67 ? 447 ILE B CG2 1 
ATOM   7183 C  CD1 . ILE B 1 404 ? -1.805  -5.814  -6.063  1.00 46.88 ? 447 ILE B CD1 1 
ATOM   7184 N  N   . THR B 1 405 ? 3.165   -5.771  -2.710  1.00 41.40 ? 448 THR B N   1 
ATOM   7185 C  CA  . THR B 1 405 ? 3.791   -5.715  -1.390  1.00 40.08 ? 448 THR B CA  1 
ATOM   7186 C  C   . THR B 1 405 ? 5.275   -5.315  -1.426  1.00 38.96 ? 448 THR B C   1 
ATOM   7187 O  O   . THR B 1 405 ? 5.984   -5.431  -0.419  1.00 39.01 ? 448 THR B O   1 
ATOM   7188 C  CB  . THR B 1 405 ? 3.608   -7.032  -0.591  1.00 40.03 ? 448 THR B CB  1 
ATOM   7189 O  OG1 . THR B 1 405 ? 4.546   -8.010  -1.055  1.00 40.48 ? 448 THR B OG1 1 
ATOM   7190 C  CG2 . THR B 1 405 ? 2.181   -7.560  -0.729  1.00 40.01 ? 448 THR B CG2 1 
ATOM   7191 N  N   . TYR B 1 406 ? 5.729   -4.817  -2.576  1.00 37.51 ? 449 TYR B N   1 
ATOM   7192 C  CA  . TYR B 1 406 ? 7.122   -4.396  -2.750  1.00 35.78 ? 449 TYR B CA  1 
ATOM   7193 C  C   . TYR B 1 406 ? 7.488   -3.226  -1.834  1.00 34.56 ? 449 TYR B C   1 
ATOM   7194 O  O   . TYR B 1 406 ? 6.907   -2.146  -1.946  1.00 34.48 ? 449 TYR B O   1 
ATOM   7195 C  CB  . TYR B 1 406 ? 7.389   -4.020  -4.209  1.00 35.82 ? 449 TYR B CB  1 
ATOM   7196 C  CG  . TYR B 1 406 ? 8.849   -3.792  -4.508  1.00 35.39 ? 449 TYR B CG  1 
ATOM   7197 C  CD1 . TYR B 1 406 ? 9.778   -4.816  -4.325  1.00 35.26 ? 449 TYR B CD1 1 
ATOM   7198 C  CD2 . TYR B 1 406 ? 9.305   -2.556  -4.975  1.00 34.56 ? 449 TYR B CD2 1 
ATOM   7199 C  CE1 . TYR B 1 406 ? 11.126  -4.620  -4.601  1.00 36.09 ? 449 TYR B CE1 1 
ATOM   7200 C  CE2 . TYR B 1 406 ? 10.652  -2.351  -5.259  1.00 34.47 ? 449 TYR B CE2 1 
ATOM   7201 C  CZ  . TYR B 1 406 ? 11.554  -3.387  -5.069  1.00 35.36 ? 449 TYR B CZ  1 
ATOM   7202 O  OH  . TYR B 1 406 ? 12.891  -3.211  -5.332  1.00 35.77 ? 449 TYR B OH  1 
ATOM   7203 N  N   . PHE B 1 407 ? 8.457   -3.459  -0.949  1.00 32.92 ? 450 PHE B N   1 
ATOM   7204 C  CA  . PHE B 1 407 ? 8.856   -2.511  0.100   1.00 31.39 ? 450 PHE B CA  1 
ATOM   7205 C  C   . PHE B 1 407 ? 7.696   -1.785  0.812   1.00 30.75 ? 450 PHE B C   1 
ATOM   7206 O  O   . PHE B 1 407 ? 7.697   -0.558  0.919   1.00 30.24 ? 450 PHE B O   1 
ATOM   7207 C  CB  . PHE B 1 407 ? 9.903   -1.521  -0.434  1.00 31.46 ? 450 PHE B CB  1 
ATOM   7208 C  CG  . PHE B 1 407 ? 11.312  -2.056  -0.408  1.00 29.68 ? 450 PHE B CG  1 
ATOM   7209 C  CD1 . PHE B 1 407 ? 11.781  -2.879  -1.434  1.00 27.74 ? 450 PHE B CD1 1 
ATOM   7210 C  CD2 . PHE B 1 407 ? 12.168  -1.736  0.639   1.00 27.87 ? 450 PHE B CD2 1 
ATOM   7211 C  CE1 . PHE B 1 407 ? 13.077  -3.370  -1.416  1.00 27.00 ? 450 PHE B CE1 1 
ATOM   7212 C  CE2 . PHE B 1 407 ? 13.477  -2.233  0.668   1.00 27.72 ? 450 PHE B CE2 1 
ATOM   7213 C  CZ  . PHE B 1 407 ? 13.928  -3.049  -0.361  1.00 27.27 ? 450 PHE B CZ  1 
ATOM   7214 N  N   . ARG B 1 408 ? 6.717   -2.557  1.291   1.00 29.98 ? 451 ARG B N   1 
ATOM   7215 C  CA  . ARG B 1 408 ? 5.576   -2.011  2.040   1.00 29.35 ? 451 ARG B CA  1 
ATOM   7216 C  C   . ARG B 1 408 ? 5.603   -2.427  3.502   1.00 28.21 ? 451 ARG B C   1 
ATOM   7217 O  O   . ARG B 1 408 ? 4.963   -1.789  4.340   1.00 28.06 ? 451 ARG B O   1 
ATOM   7218 C  CB  . ARG B 1 408 ? 4.233   -2.468  1.459   1.00 29.87 ? 451 ARG B CB  1 
ATOM   7219 C  CG  . ARG B 1 408 ? 4.109   -2.497  -0.044  1.00 30.82 ? 451 ARG B CG  1 
ATOM   7220 C  CD  . ARG B 1 408 ? 3.896   -1.137  -0.638  1.00 31.96 ? 451 ARG B CD  1 
ATOM   7221 N  NE  . ARG B 1 408 ? 4.380   -1.115  -2.016  1.00 32.57 ? 451 ARG B NE  1 
ATOM   7222 C  CZ  . ARG B 1 408 ? 3.683   -0.668  -3.043  1.00 31.95 ? 451 ARG B CZ  1 
ATOM   7223 N  NH1 . ARG B 1 408 ? 2.465   -0.184  -2.874  1.00 32.94 ? 451 ARG B NH1 1 
ATOM   7224 N  NH2 . ARG B 1 408 ? 4.219   -0.682  -4.239  1.00 33.66 ? 451 ARG B NH2 1 
ATOM   7225 N  N   . ASN B 1 409 ? 6.314   -3.513  3.800   1.00 27.12 ? 452 ASN B N   1 
ATOM   7226 C  CA  . ASN B 1 409 ? 6.334   -4.080  5.153   1.00 25.84 ? 452 ASN B CA  1 
ATOM   7227 C  C   . ASN B 1 409 ? 7.485   -3.481  5.958   1.00 24.72 ? 452 ASN B C   1 
ATOM   7228 O  O   . ASN B 1 409 ? 8.520   -4.107  6.158   1.00 24.99 ? 452 ASN B O   1 
ATOM   7229 C  CB  . ASN B 1 409 ? 6.404   -5.617  5.101   1.00 25.88 ? 452 ASN B CB  1 
ATOM   7230 C  CG  . ASN B 1 409 ? 6.234   -6.281  6.486   1.00 26.13 ? 452 ASN B CG  1 
ATOM   7231 O  OD1 . ASN B 1 409 ? 5.561   -5.759  7.375   1.00 26.06 ? 452 ASN B OD1 1 
ATOM   7232 N  ND2 . ASN B 1 409 ? 6.845   -7.446  6.652   1.00 26.98 ? 452 ASN B ND2 1 
ATOM   7233 N  N   . LEU B 1 410 ? 7.280   -2.265  6.436   1.00 23.15 ? 453 LEU B N   1 
ATOM   7234 C  CA  . LEU B 1 410 ? 8.374   -1.451  6.933   1.00 21.82 ? 453 LEU B CA  1 
ATOM   7235 C  C   . LEU B 1 410 ? 8.286   -1.096  8.416   1.00 21.21 ? 453 LEU B C   1 
ATOM   7236 O  O   . LEU B 1 410 ? 9.193   -0.477  8.961   1.00 21.56 ? 453 LEU B O   1 
ATOM   7237 C  CB  . LEU B 1 410 ? 8.490   -0.195  6.072   1.00 21.34 ? 453 LEU B CB  1 
ATOM   7238 C  CG  . LEU B 1 410 ? 8.882   -0.419  4.598   1.00 20.84 ? 453 LEU B CG  1 
ATOM   7239 C  CD1 . LEU B 1 410 ? 8.705   0.862   3.792   1.00 19.91 ? 453 LEU B CD1 1 
ATOM   7240 C  CD2 . LEU B 1 410 ? 10.310  -0.925  4.466   1.00 18.38 ? 453 LEU B CD2 1 
ATOM   7241 N  N   . GLY B 1 411 ? 7.211   -1.520  9.065   1.00 20.63 ? 454 GLY B N   1 
ATOM   7242 C  CA  . GLY B 1 411 ? 6.971   -1.244  10.481  1.00 20.57 ? 454 GLY B CA  1 
ATOM   7243 C  C   . GLY B 1 411 ? 8.104   -1.588  11.432  1.00 20.64 ? 454 GLY B C   1 
ATOM   7244 O  O   . GLY B 1 411 ? 8.280   -0.903  12.443  1.00 20.82 ? 454 GLY B O   1 
ATOM   7245 N  N   . PHE B 1 412 ? 8.868   -2.639  11.120  1.00 20.04 ? 455 PHE B N   1 
ATOM   7246 C  CA  . PHE B 1 412 ? 10.051  -2.987  11.909  1.00 20.06 ? 455 PHE B CA  1 
ATOM   7247 C  C   . PHE B 1 412 ? 11.364  -2.577  11.246  1.00 20.60 ? 455 PHE B C   1 
ATOM   7248 O  O   . PHE B 1 412 ? 12.428  -3.026  11.673  1.00 20.95 ? 455 PHE B O   1 
ATOM   7249 C  CB  . PHE B 1 412 ? 10.128  -4.486  12.209  1.00 19.55 ? 455 PHE B CB  1 
ATOM   7250 C  CG  . PHE B 1 412 ? 8.986   -5.015  13.002  1.00 17.91 ? 455 PHE B CG  1 
ATOM   7251 C  CD1 . PHE B 1 412 ? 7.894   -5.601  12.359  1.00 16.03 ? 455 PHE B CD1 1 
ATOM   7252 C  CD2 . PHE B 1 412 ? 9.008   -4.963  14.389  1.00 18.41 ? 455 PHE B CD2 1 
ATOM   7253 C  CE1 . PHE B 1 412 ? 6.834   -6.109  13.077  1.00 15.16 ? 455 PHE B CE1 1 
ATOM   7254 C  CE2 . PHE B 1 412 ? 7.941   -5.472  15.134  1.00 18.61 ? 455 PHE B CE2 1 
ATOM   7255 C  CZ  . PHE B 1 412 ? 6.849   -6.051  14.466  1.00 17.95 ? 455 PHE B CZ  1 
ATOM   7256 N  N   . GLY B 1 413 ? 11.304  -1.734  10.221  1.00 20.98 ? 456 GLY B N   1 
ATOM   7257 C  CA  . GLY B 1 413 ? 12.525  -1.287  9.554   1.00 21.79 ? 456 GLY B CA  1 
ATOM   7258 C  C   . GLY B 1 413 ? 13.115  -2.327  8.612   1.00 22.32 ? 456 GLY B C   1 
ATOM   7259 O  O   . GLY B 1 413 ? 12.439  -3.266  8.221   1.00 22.36 ? 456 GLY B O   1 
ATOM   7260 N  N   . TRP B 1 414 ? 14.381  -2.161  8.255   1.00 22.99 ? 457 TRP B N   1 
ATOM   7261 C  CA  . TRP B 1 414 ? 14.987  -2.934  7.182   1.00 23.94 ? 457 TRP B CA  1 
ATOM   7262 C  C   . TRP B 1 414 ? 16.430  -3.253  7.503   1.00 23.48 ? 457 TRP B C   1 
ATOM   7263 O  O   . TRP B 1 414 ? 17.098  -2.473  8.184   1.00 23.97 ? 457 TRP B O   1 
ATOM   7264 C  CB  . TRP B 1 414 ? 14.962  -2.117  5.888   1.00 24.81 ? 457 TRP B CB  1 
ATOM   7265 C  CG  . TRP B 1 414 ? 15.277  -2.920  4.664   1.00 29.07 ? 457 TRP B CG  1 
ATOM   7266 C  CD1 . TRP B 1 414 ? 14.385  -3.619  3.900   1.00 32.34 ? 457 TRP B CD1 1 
ATOM   7267 C  CD2 . TRP B 1 414 ? 16.569  -3.117  4.055   1.00 32.96 ? 457 TRP B CD2 1 
ATOM   7268 N  NE1 . TRP B 1 414 ? 15.034  -4.240  2.854   1.00 34.51 ? 457 TRP B NE1 1 
ATOM   7269 C  CE2 . TRP B 1 414 ? 16.373  -3.950  2.920   1.00 34.08 ? 457 TRP B CE2 1 
ATOM   7270 C  CE3 . TRP B 1 414 ? 17.871  -2.675  4.355   1.00 34.48 ? 457 TRP B CE3 1 
ATOM   7271 C  CZ2 . TRP B 1 414 ? 17.431  -4.352  2.080   1.00 34.18 ? 457 TRP B CZ2 1 
ATOM   7272 C  CZ3 . TRP B 1 414 ? 18.928  -3.081  3.520   1.00 35.24 ? 457 TRP B CZ3 1 
ATOM   7273 C  CH2 . TRP B 1 414 ? 18.693  -3.915  2.395   1.00 34.98 ? 457 TRP B CH2 1 
ATOM   7274 N  N   . GLY B 1 415 ? 16.906  -4.388  6.996   1.00 22.67 ? 458 GLY B N   1 
ATOM   7275 C  CA  . GLY B 1 415 ? 18.324  -4.678  6.934   1.00 21.77 ? 458 GLY B CA  1 
ATOM   7276 C  C   . GLY B 1 415 ? 18.920  -5.022  8.265   1.00 21.93 ? 458 GLY B C   1 
ATOM   7277 O  O   . GLY B 1 415 ? 18.202  -5.417  9.188   1.00 22.06 ? 458 GLY B O   1 
ATOM   7278 N  N   . VAL B 1 416 ? 20.242  -4.872  8.366   1.00 21.76 ? 459 VAL B N   1 
ATOM   7279 C  CA  . VAL B 1 416 ? 20.983  -5.297  9.558   1.00 21.24 ? 459 VAL B CA  1 
ATOM   7280 C  C   . VAL B 1 416 ? 20.645  -4.513  10.816  1.00 21.00 ? 459 VAL B C   1 
ATOM   7281 O  O   . VAL B 1 416 ? 20.872  -5.004  11.918  1.00 20.94 ? 459 VAL B O   1 
ATOM   7282 C  CB  . VAL B 1 416 ? 22.522  -5.302  9.340   1.00 21.34 ? 459 VAL B CB  1 
ATOM   7283 C  CG1 . VAL B 1 416 ? 22.894  -6.360  8.339   1.00 21.35 ? 459 VAL B CG1 1 
ATOM   7284 C  CG2 . VAL B 1 416 ? 23.032  -3.932  8.902   1.00 20.56 ? 459 VAL B CG2 1 
ATOM   7285 N  N   . ARG B 1 417 ? 20.117  -3.300  10.649  1.00 21.10 ? 460 ARG B N   1 
ATOM   7286 C  CA  . ARG B 1 417 ? 19.688  -2.476  11.791  1.00 21.34 ? 460 ARG B CA  1 
ATOM   7287 C  C   . ARG B 1 417 ? 18.152  -2.306  11.911  1.00 21.67 ? 460 ARG B C   1 
ATOM   7288 O  O   . ARG B 1 417 ? 17.652  -1.322  12.495  1.00 22.30 ? 460 ARG B O   1 
ATOM   7289 C  CB  . ARG B 1 417 ? 20.400  -1.124  11.796  1.00 21.03 ? 460 ARG B CB  1 
ATOM   7290 C  CG  . ARG B 1 417 ? 20.444  -0.481  13.177  1.00 21.68 ? 460 ARG B CG  1 
ATOM   7291 C  CD  . ARG B 1 417 ? 21.546  0.556   13.318  1.00 19.82 ? 460 ARG B CD  1 
ATOM   7292 N  NE  . ARG B 1 417 ? 21.637  1.044   14.693  1.00 18.92 ? 460 ARG B NE  1 
ATOM   7293 C  CZ  . ARG B 1 417 ? 22.462  2.010   15.101  1.00 18.46 ? 460 ARG B CZ  1 
ATOM   7294 N  NH1 . ARG B 1 417 ? 23.277  2.613   14.243  1.00 17.36 ? 460 ARG B NH1 1 
ATOM   7295 N  NH2 . ARG B 1 417 ? 22.463  2.380   16.372  1.00 17.01 ? 460 ARG B NH2 1 
ATOM   7296 N  N   . GLN B 1 418 ? 17.406  -3.269  11.375  1.00 21.24 ? 461 GLN B N   1 
ATOM   7297 C  CA  . GLN B 1 418 ? 15.983  -3.373  11.663  1.00 21.32 ? 461 GLN B CA  1 
ATOM   7298 C  C   . GLN B 1 418 ? 15.753  -3.501  13.178  1.00 21.21 ? 461 GLN B C   1 
ATOM   7299 O  O   . GLN B 1 418 ? 16.708  -3.684  13.941  1.00 21.28 ? 461 GLN B O   1 
ATOM   7300 C  CB  . GLN B 1 418 ? 15.377  -4.561  10.926  1.00 21.35 ? 461 GLN B CB  1 
ATOM   7301 C  CG  . GLN B 1 418 ? 15.878  -5.929  11.375  1.00 23.05 ? 461 GLN B CG  1 
ATOM   7302 C  CD  . GLN B 1 418 ? 15.366  -7.037  10.481  1.00 25.28 ? 461 GLN B CD  1 
ATOM   7303 O  OE1 . GLN B 1 418 ? 16.115  -7.590  9.681   1.00 28.34 ? 461 GLN B OE1 1 
ATOM   7304 N  NE2 . GLN B 1 418 ? 14.077  -7.344  10.585  1.00 26.26 ? 461 GLN B NE2 1 
ATOM   7305 N  N   . CYS B 1 419 ? 14.498  -3.397  13.609  1.00 20.71 ? 462 CYS B N   1 
ATOM   7306 C  CA  . CYS B 1 419 ? 14.153  -3.628  15.001  1.00 20.25 ? 462 CYS B CA  1 
ATOM   7307 C  C   . CYS B 1 419 ? 14.883  -4.841  15.570  1.00 20.47 ? 462 CYS B C   1 
ATOM   7308 O  O   . CYS B 1 419 ? 14.815  -5.943  15.012  1.00 20.78 ? 462 CYS B O   1 
ATOM   7309 C  CB  . CYS B 1 419 ? 12.649  -3.843  15.141  1.00 20.18 ? 462 CYS B CB  1 
ATOM   7310 S  SG  . CYS B 1 419 ? 12.125  -4.086  16.844  1.00 19.17 ? 462 CYS B SG  1 
ATOM   7311 N  N   . LEU B 1 420 ? 15.585  -4.640  16.680  1.00 20.46 ? 463 LEU B N   1 
ATOM   7312 C  CA  . LEU B 1 420 ? 16.224  -5.758  17.375  1.00 20.30 ? 463 LEU B CA  1 
ATOM   7313 C  C   . LEU B 1 420 ? 15.180  -6.701  18.011  1.00 20.35 ? 463 LEU B C   1 
ATOM   7314 O  O   . LEU B 1 420 ? 15.379  -7.920  18.042  1.00 20.52 ? 463 LEU B O   1 
ATOM   7315 C  CB  . LEU B 1 420 ? 17.241  -5.253  18.412  1.00 20.12 ? 463 LEU B CB  1 
ATOM   7316 C  CG  . LEU B 1 420 ? 17.946  -6.337  19.237  1.00 19.50 ? 463 LEU B CG  1 
ATOM   7317 C  CD1 . LEU B 1 420 ? 18.920  -7.140  18.365  1.00 19.94 ? 463 LEU B CD1 1 
ATOM   7318 C  CD2 . LEU B 1 420 ? 18.655  -5.740  20.434  1.00 18.60 ? 463 LEU B CD2 1 
ATOM   7319 N  N   . GLY B 1 421 ? 14.067  -6.136  18.485  1.00 19.89 ? 464 GLY B N   1 
ATOM   7320 C  CA  . GLY B 1 421 ? 13.029  -6.911  19.160  1.00 19.67 ? 464 GLY B CA  1 
ATOM   7321 C  C   . GLY B 1 421 ? 11.961  -7.441  18.218  1.00 19.73 ? 464 GLY B C   1 
ATOM   7322 O  O   . GLY B 1 421 ? 10.857  -7.785  18.646  1.00 19.19 ? 464 GLY B O   1 
ATOM   7323 N  N   . ARG B 1 422 ? 12.289  -7.522  16.931  1.00 19.57 ? 465 ARG B N   1 
ATOM   7324 C  CA  . ARG B 1 422 ? 11.296  -7.927  15.942  1.00 19.73 ? 465 ARG B CA  1 
ATOM   7325 C  C   . ARG B 1 422 ? 10.679  -9.317  16.210  1.00 19.63 ? 465 ARG B C   1 
ATOM   7326 O  O   . ARG B 1 422 ? 9.453   -9.473  16.226  1.00 19.15 ? 465 ARG B O   1 
ATOM   7327 C  CB  . ARG B 1 422 ? 11.869  -7.865  14.526  1.00 19.48 ? 465 ARG B CB  1 
ATOM   7328 C  CG  . ARG B 1 422 ? 10.797  -8.103  13.510  1.00 19.45 ? 465 ARG B CG  1 
ATOM   7329 C  CD  . ARG B 1 422 ? 11.312  -8.233  12.099  1.00 19.27 ? 465 ARG B CD  1 
ATOM   7330 N  NE  . ARG B 1 422 ? 10.177  -8.146  11.188  1.00 18.49 ? 465 ARG B NE  1 
ATOM   7331 C  CZ  . ARG B 1 422 ? 10.259  -7.786  9.917   1.00 19.29 ? 465 ARG B CZ  1 
ATOM   7332 N  NH1 . ARG B 1 422 ? 11.437  -7.500  9.381   1.00 19.88 ? 465 ARG B NH1 1 
ATOM   7333 N  NH2 . ARG B 1 422 ? 9.159   -7.717  9.183   1.00 20.12 ? 465 ARG B NH2 1 
ATOM   7334 N  N   . ARG B 1 423 ? 11.532  -10.316 16.410  1.00 19.43 ? 466 ARG B N   1 
ATOM   7335 C  CA  . ARG B 1 423 ? 11.061  -11.687 16.589  1.00 19.46 ? 466 ARG B CA  1 
ATOM   7336 C  C   . ARG B 1 423 ? 10.252  -11.798 17.866  1.00 19.03 ? 466 ARG B C   1 
ATOM   7337 O  O   . ARG B 1 423 ? 9.188   -12.427 17.888  1.00 19.17 ? 466 ARG B O   1 
ATOM   7338 C  CB  . ARG B 1 423 ? 12.226  -12.663 16.613  1.00 19.59 ? 466 ARG B CB  1 
ATOM   7339 C  CG  . ARG B 1 423 ? 13.090  -12.630 15.363  1.00 20.90 ? 466 ARG B CG  1 
ATOM   7340 C  CD  . ARG B 1 423 ? 12.489  -13.458 14.243  1.00 25.85 ? 466 ARG B CD  1 
ATOM   7341 N  NE  . ARG B 1 423 ? 11.748  -12.652 13.271  1.00 29.53 ? 466 ARG B NE  1 
ATOM   7342 C  CZ  . ARG B 1 423 ? 12.241  -12.221 12.103  1.00 31.42 ? 466 ARG B CZ  1 
ATOM   7343 N  NH1 . ARG B 1 423 ? 13.495  -12.515 11.753  1.00 32.93 ? 466 ARG B NH1 1 
ATOM   7344 N  NH2 . ARG B 1 423 ? 11.477  -11.502 11.278  1.00 29.95 ? 466 ARG B NH2 1 
ATOM   7345 N  N   . ILE B 1 424 ? 10.750  -11.155 18.918  1.00 18.44 ? 467 ILE B N   1 
ATOM   7346 C  CA  . ILE B 1 424 ? 10.057  -11.107 20.204  1.00 17.58 ? 467 ILE B CA  1 
ATOM   7347 C  C   . ILE B 1 424 ? 8.686   -10.471 20.033  1.00 17.45 ? 467 ILE B C   1 
ATOM   7348 O  O   . ILE B 1 424 ? 7.691   -11.000 20.538  1.00 17.88 ? 467 ILE B O   1 
ATOM   7349 C  CB  . ILE B 1 424 ? 10.888  -10.344 21.260  1.00 17.61 ? 467 ILE B CB  1 
ATOM   7350 C  CG1 . ILE B 1 424 ? 12.181  -11.119 21.562  1.00 16.60 ? 467 ILE B CG1 1 
ATOM   7351 C  CG2 . ILE B 1 424 ? 10.048  -10.034 22.515  1.00 16.77 ? 467 ILE B CG2 1 
ATOM   7352 C  CD1 . ILE B 1 424 ? 13.064  -10.474 22.567  1.00 16.71 ? 467 ILE B CD1 1 
ATOM   7353 N  N   . ALA B 1 425 ? 8.640   -9.355  19.305  1.00 16.69 ? 468 ALA B N   1 
ATOM   7354 C  CA  . ALA B 1 425 ? 7.403   -8.635  19.070  1.00 16.17 ? 468 ALA B CA  1 
ATOM   7355 C  C   . ALA B 1 425 ? 6.431   -9.465  18.230  1.00 16.12 ? 468 ALA B C   1 
ATOM   7356 O  O   . ALA B 1 425 ? 5.268   -9.588  18.593  1.00 16.18 ? 468 ALA B O   1 
ATOM   7357 C  CB  . ALA B 1 425 ? 7.675   -7.274  18.418  1.00 15.74 ? 468 ALA B CB  1 
ATOM   7358 N  N   . GLU B 1 426 ? 6.909   -10.039 17.130  1.00 16.55 ? 469 GLU B N   1 
ATOM   7359 C  CA  . GLU B 1 426 ? 6.062   -10.868 16.245  1.00 17.53 ? 469 GLU B CA  1 
ATOM   7360 C  C   . GLU B 1 426 ? 5.489   -12.077 16.974  1.00 18.02 ? 469 GLU B C   1 
ATOM   7361 O  O   . GLU B 1 426 ? 4.269   -12.273 17.000  1.00 18.60 ? 469 GLU B O   1 
ATOM   7362 C  CB  . GLU B 1 426 ? 6.810   -11.294 14.984  1.00 16.86 ? 469 GLU B CB  1 
ATOM   7363 C  CG  . GLU B 1 426 ? 7.072   -10.132 14.071  1.00 18.21 ? 469 GLU B CG  1 
ATOM   7364 C  CD  . GLU B 1 426 ? 7.968   -10.446 12.872  1.00 19.52 ? 469 GLU B CD  1 
ATOM   7365 O  OE1 . GLU B 1 426 ? 8.851   -11.346 12.942  1.00 18.09 ? 469 GLU B OE1 1 
ATOM   7366 O  OE2 . GLU B 1 426 ? 7.785   -9.742  11.850  1.00 20.06 ? 469 GLU B OE2 1 
ATOM   7367 N  N   . LEU B 1 427 ? 6.367   -12.848 17.607  1.00 18.78 ? 470 LEU B N   1 
ATOM   7368 C  CA  . LEU B 1 427 ? 5.962   -14.018 18.382  1.00 19.58 ? 470 LEU B CA  1 
ATOM   7369 C  C   . LEU B 1 427 ? 5.029   -13.644 19.535  1.00 19.81 ? 470 LEU B C   1 
ATOM   7370 O  O   . LEU B 1 427 ? 4.051   -14.349 19.795  1.00 19.99 ? 470 LEU B O   1 
ATOM   7371 C  CB  . LEU B 1 427 ? 7.196   -14.800 18.888  1.00 19.66 ? 470 LEU B CB  1 
ATOM   7372 C  CG  . LEU B 1 427 ? 8.203   -15.428 17.894  1.00 19.89 ? 470 LEU B CG  1 
ATOM   7373 C  CD1 . LEU B 1 427 ? 9.484   -15.899 18.599  1.00 19.38 ? 470 LEU B CD1 1 
ATOM   7374 C  CD2 . LEU B 1 427 ? 7.590   -16.592 17.102  1.00 19.88 ? 470 LEU B CD2 1 
ATOM   7375 N  N   . GLU B 1 428 ? 5.314   -12.530 20.210  1.00 19.94 ? 471 GLU B N   1 
ATOM   7376 C  CA  . GLU B 1 428 ? 4.480   -12.107 21.340  1.00 20.28 ? 471 GLU B CA  1 
ATOM   7377 C  C   . GLU B 1 428 ? 3.077   -11.701 20.895  1.00 19.98 ? 471 GLU B C   1 
ATOM   7378 O  O   . GLU B 1 428 ? 2.096   -12.063 21.545  1.00 20.53 ? 471 GLU B O   1 
ATOM   7379 C  CB  . GLU B 1 428 ? 5.135   -10.969 22.122  1.00 20.38 ? 471 GLU B CB  1 
ATOM   7380 C  CG  . GLU B 1 428 ? 4.283   -10.426 23.256  1.00 21.34 ? 471 GLU B CG  1 
ATOM   7381 C  CD  . GLU B 1 428 ? 4.858   -9.150  23.863  1.00 24.88 ? 471 GLU B CD  1 
ATOM   7382 O  OE1 . GLU B 1 428 ? 6.095   -8.954  23.831  1.00 25.54 ? 471 GLU B OE1 1 
ATOM   7383 O  OE2 . GLU B 1 428 ? 4.069   -8.337  24.398  1.00 26.05 ? 471 GLU B OE2 1 
ATOM   7384 N  N   . MET B 1 429 ? 2.983   -10.954 19.799  1.00 19.22 ? 472 MET B N   1 
ATOM   7385 C  CA  . MET B 1 429 ? 1.685   -10.509 19.306  1.00 19.04 ? 472 MET B CA  1 
ATOM   7386 C  C   . MET B 1 429 ? 0.890   -11.646 18.696  1.00 19.04 ? 472 MET B C   1 
ATOM   7387 O  O   . MET B 1 429 ? -0.309  -11.757 18.908  1.00 18.91 ? 472 MET B O   1 
ATOM   7388 C  CB  . MET B 1 429 ? 1.836   -9.362  18.319  1.00 18.43 ? 472 MET B CB  1 
ATOM   7389 C  CG  . MET B 1 429 ? 2.306   -8.092  19.005  1.00 19.07 ? 472 MET B CG  1 
ATOM   7390 S  SD  . MET B 1 429 ? 2.469   -6.637  17.964  1.00 17.76 ? 472 MET B SD  1 
ATOM   7391 C  CE  . MET B 1 429 ? 3.690   -7.196  16.760  1.00 17.94 ? 472 MET B CE  1 
ATOM   7392 N  N   . THR B 1 430 ? 1.558   -12.507 17.944  1.00 19.48 ? 473 THR B N   1 
ATOM   7393 C  CA  . THR B 1 430 ? 0.852   -13.615 17.310  1.00 19.62 ? 473 THR B CA  1 
ATOM   7394 C  C   . THR B 1 430 ? 0.257   -14.571 18.358  1.00 19.33 ? 473 THR B C   1 
ATOM   7395 O  O   . THR B 1 430 ? -0.896  -14.984 18.229  1.00 19.44 ? 473 THR B O   1 
ATOM   7396 C  CB  . THR B 1 430 ? 1.734   -14.327 16.288  1.00 19.61 ? 473 THR B CB  1 
ATOM   7397 O  OG1 . THR B 1 430 ? 2.374   -13.333 15.484  1.00 19.79 ? 473 THR B OG1 1 
ATOM   7398 C  CG2 . THR B 1 430 ? 0.894   -15.203 15.388  1.00 19.07 ? 473 THR B CG2 1 
ATOM   7399 N  N   . ILE B 1 431 ? 1.026   -14.854 19.411  1.00 18.95 ? 474 ILE B N   1 
ATOM   7400 C  CA  . ILE B 1 431 ? 0.590   -15.723 20.492  1.00 18.42 ? 474 ILE B CA  1 
ATOM   7401 C  C   . ILE B 1 431 ? -0.527  -15.093 21.299  1.00 18.64 ? 474 ILE B C   1 
ATOM   7402 O  O   . ILE B 1 431 ? -1.519  -15.754 21.646  1.00 19.51 ? 474 ILE B O   1 
ATOM   7403 C  CB  . ILE B 1 431 ? 1.766   -16.177 21.388  1.00 18.37 ? 474 ILE B CB  1 
ATOM   7404 C  CG1 . ILE B 1 431 ? 2.668   -17.141 20.594  1.00 17.99 ? 474 ILE B CG1 1 
ATOM   7405 C  CG2 . ILE B 1 431 ? 1.242   -16.877 22.618  1.00 17.01 ? 474 ILE B CG2 1 
ATOM   7406 C  CD1 . ILE B 1 431 ? 4.109   -17.257 21.075  1.00 17.47 ? 474 ILE B CD1 1 
ATOM   7407 N  N   . PHE B 1 432 ? -0.395  -13.801 21.561  1.00 18.52 ? 475 PHE B N   1 
ATOM   7408 C  CA  . PHE B 1 432 ? -1.438  -13.065 22.259  1.00 17.82 ? 475 PHE B CA  1 
ATOM   7409 C  C   . PHE B 1 432 ? -2.741  -13.214 21.496  1.00 17.46 ? 475 PHE B C   1 
ATOM   7410 O  O   . PHE B 1 432 ? -3.764  -13.600 22.052  1.00 16.91 ? 475 PHE B O   1 
ATOM   7411 C  CB  . PHE B 1 432 ? -1.045  -11.592 22.370  1.00 17.89 ? 475 PHE B CB  1 
ATOM   7412 C  CG  . PHE B 1 432 ? -2.091  -10.723 23.030  1.00 17.48 ? 475 PHE B CG  1 
ATOM   7413 C  CD1 . PHE B 1 432 ? -2.148  -10.615 24.417  1.00 16.47 ? 475 PHE B CD1 1 
ATOM   7414 C  CD2 . PHE B 1 432 ? -2.995  -9.998  22.261  1.00 16.05 ? 475 PHE B CD2 1 
ATOM   7415 C  CE1 . PHE B 1 432 ? -3.091  -9.796  25.034  1.00 17.62 ? 475 PHE B CE1 1 
ATOM   7416 C  CE2 . PHE B 1 432 ? -3.948  -9.192  22.863  1.00 17.82 ? 475 PHE B CE2 1 
ATOM   7417 C  CZ  . PHE B 1 432 ? -4.000  -9.086  24.262  1.00 17.58 ? 475 PHE B CZ  1 
ATOM   7418 N  N   . LEU B 1 433 ? -2.679  -12.909 20.207  1.00 17.50 ? 476 LEU B N   1 
ATOM   7419 C  CA  . LEU B 1 433 ? -3.867  -12.915 19.357  1.00 17.68 ? 476 LEU B CA  1 
ATOM   7420 C  C   . LEU B 1 433 ? -4.449  -14.319 19.123  1.00 17.85 ? 476 LEU B C   1 
ATOM   7421 O  O   . LEU B 1 433 ? -5.666  -14.446 19.013  1.00 17.86 ? 476 LEU B O   1 
ATOM   7422 C  CB  . LEU B 1 433 ? -3.613  -12.163 18.048  1.00 17.26 ? 476 LEU B CB  1 
ATOM   7423 C  CG  . LEU B 1 433 ? -3.388  -10.646 18.237  1.00 17.26 ? 476 LEU B CG  1 
ATOM   7424 C  CD1 . LEU B 1 433 ? -2.727  -9.997  17.007  1.00 15.11 ? 476 LEU B CD1 1 
ATOM   7425 C  CD2 . LEU B 1 433 ? -4.699  -9.923  18.629  1.00 16.30 ? 476 LEU B CD2 1 
ATOM   7426 N  N   . ILE B 1 434 ? -3.597  -15.351 19.073  1.00 17.62 ? 477 ILE B N   1 
ATOM   7427 C  CA  . ILE B 1 434 ? -4.076  -16.735 19.031  1.00 17.93 ? 477 ILE B CA  1 
ATOM   7428 C  C   . ILE B 1 434 ? -4.969  -16.996 20.250  1.00 18.57 ? 477 ILE B C   1 
ATOM   7429 O  O   . ILE B 1 434 ? -6.104  -17.467 20.116  1.00 18.48 ? 477 ILE B O   1 
ATOM   7430 C  CB  . ILE B 1 434 ? -2.902  -17.780 18.979  1.00 18.09 ? 477 ILE B CB  1 
ATOM   7431 C  CG1 . ILE B 1 434 ? -2.339  -17.879 17.561  1.00 17.03 ? 477 ILE B CG1 1 
ATOM   7432 C  CG2 . ILE B 1 434 ? -3.364  -19.175 19.476  1.00 17.10 ? 477 ILE B CG2 1 
ATOM   7433 C  CD1 . ILE B 1 434 ? -1.168  -18.798 17.407  1.00 17.23 ? 477 ILE B CD1 1 
ATOM   7434 N  N   . ASN B 1 435 ? -4.449  -16.657 21.432  1.00 19.31 ? 478 ASN B N   1 
ATOM   7435 C  CA  . ASN B 1 435 ? -5.169  -16.833 22.699  1.00 19.58 ? 478 ASN B CA  1 
ATOM   7436 C  C   . ASN B 1 435 ? -6.463  -16.031 22.823  1.00 19.49 ? 478 ASN B C   1 
ATOM   7437 O  O   . ASN B 1 435 ? -7.493  -16.563 23.245  1.00 20.02 ? 478 ASN B O   1 
ATOM   7438 C  CB  . ASN B 1 435 ? -4.239  -16.564 23.878  1.00 19.44 ? 478 ASN B CB  1 
ATOM   7439 C  CG  . ASN B 1 435 ? -3.334  -17.739 24.167  1.00 20.34 ? 478 ASN B CG  1 
ATOM   7440 O  OD1 . ASN B 1 435 ? -3.760  -18.721 24.779  1.00 23.40 ? 478 ASN B OD1 1 
ATOM   7441 N  ND2 . ASN B 1 435 ? -2.084  -17.659 23.722  1.00 19.99 ? 478 ASN B ND2 1 
ATOM   7442 N  N   . MET B 1 436 ? -6.419  -14.762 22.446  1.00 19.59 ? 479 MET B N   1 
ATOM   7443 C  CA  . MET B 1 436 ? -7.609  -13.916 22.514  1.00 19.58 ? 479 MET B CA  1 
ATOM   7444 C  C   . MET B 1 436 ? -8.701  -14.422 21.563  1.00 19.66 ? 479 MET B C   1 
ATOM   7445 O  O   . MET B 1 436 ? -9.864  -14.536 21.954  1.00 19.12 ? 479 MET B O   1 
ATOM   7446 C  CB  . MET B 1 436 ? -7.248  -12.459 22.209  1.00 19.51 ? 479 MET B CB  1 
ATOM   7447 C  CG  . MET B 1 436 ? -6.406  -11.782 23.295  1.00 19.64 ? 479 MET B CG  1 
ATOM   7448 S  SD  . MET B 1 436 ? -7.340  -11.347 24.785  1.00 21.16 ? 479 MET B SD  1 
ATOM   7449 C  CE  . MET B 1 436 ? -8.578  -10.253 24.109  1.00 16.75 ? 479 MET B CE  1 
ATOM   7450 N  N   . LEU B 1 437 ? -8.309  -14.744 20.325  1.00 19.86 ? 480 LEU B N   1 
ATOM   7451 C  CA  . LEU B 1 437 ? -9.255  -15.200 19.297  1.00 20.30 ? 480 LEU B CA  1 
ATOM   7452 C  C   . LEU B 1 437 ? -9.977  -16.504 19.654  1.00 20.74 ? 480 LEU B C   1 
ATOM   7453 O  O   . LEU B 1 437 ? -11.147 -16.672 19.327  1.00 20.37 ? 480 LEU B O   1 
ATOM   7454 C  CB  . LEU B 1 437 ? -8.581  -15.300 17.931  1.00 19.94 ? 480 LEU B CB  1 
ATOM   7455 C  CG  . LEU B 1 437 ? -8.431  -13.943 17.220  1.00 21.18 ? 480 LEU B CG  1 
ATOM   7456 C  CD1 . LEU B 1 437 ? -7.540  -14.039 15.978  1.00 19.51 ? 480 LEU B CD1 1 
ATOM   7457 C  CD2 . LEU B 1 437 ? -9.811  -13.316 16.887  1.00 20.92 ? 480 LEU B CD2 1 
ATOM   7458 N  N   . GLU B 1 438 ? -9.270  -17.413 20.324  1.00 21.52 ? 481 GLU B N   1 
ATOM   7459 C  CA  . GLU B 1 438 ? -9.860  -18.659 20.836  1.00 22.32 ? 481 GLU B CA  1 
ATOM   7460 C  C   . GLU B 1 438 ? -10.856 -18.421 21.970  1.00 22.18 ? 481 GLU B C   1 
ATOM   7461 O  O   . GLU B 1 438 ? -11.741 -19.245 22.195  1.00 22.28 ? 481 GLU B O   1 
ATOM   7462 C  CB  . GLU B 1 438 ? -8.769  -19.623 21.324  1.00 22.31 ? 481 GLU B CB  1 
ATOM   7463 C  CG  . GLU B 1 438 ? -8.000  -20.268 20.194  1.00 24.22 ? 481 GLU B CG  1 
ATOM   7464 C  CD  . GLU B 1 438 ? -6.789  -21.056 20.654  1.00 26.82 ? 481 GLU B CD  1 
ATOM   7465 O  OE1 . GLU B 1 438 ? -6.221  -20.732 21.726  1.00 27.48 ? 481 GLU B OE1 1 
ATOM   7466 O  OE2 . GLU B 1 438 ? -6.398  -21.999 19.924  1.00 28.25 ? 481 GLU B OE2 1 
ATOM   7467 N  N   . ASN B 1 439 ? -10.720 -17.291 22.664  1.00 22.23 ? 482 ASN B N   1 
ATOM   7468 C  CA  . ASN B 1 439 ? -11.452 -17.061 23.914  1.00 21.89 ? 482 ASN B CA  1 
ATOM   7469 C  C   . ASN B 1 439 ? -12.532 -15.988 23.921  1.00 21.99 ? 482 ASN B C   1 
ATOM   7470 O  O   . ASN B 1 439 ? -13.469 -16.085 24.714  1.00 22.08 ? 482 ASN B O   1 
ATOM   7471 C  CB  . ASN B 1 439 ? -10.465 -16.789 25.044  1.00 21.77 ? 482 ASN B CB  1 
ATOM   7472 C  CG  . ASN B 1 439 ? -9.790  -18.058 25.547  1.00 22.40 ? 482 ASN B CG  1 
ATOM   7473 O  OD1 . ASN B 1 439 ? -10.415 -18.877 26.224  1.00 21.42 ? 482 ASN B OD1 1 
ATOM   7474 N  ND2 . ASN B 1 439 ? -8.509  -18.221 25.224  1.00 20.83 ? 482 ASN B ND2 1 
ATOM   7475 N  N   . PHE B 1 440 ? -12.402 -14.964 23.068  1.00 21.85 ? 483 PHE B N   1 
ATOM   7476 C  CA  . PHE B 1 440 ? -13.315 -13.818 23.108  1.00 22.14 ? 483 PHE B CA  1 
ATOM   7477 C  C   . PHE B 1 440 ? -13.709 -13.278 21.742  1.00 23.22 ? 483 PHE B C   1 
ATOM   7478 O  O   . PHE B 1 440 ? -12.947 -13.351 20.772  1.00 22.77 ? 483 PHE B O   1 
ATOM   7479 C  CB  . PHE B 1 440 ? -12.721 -12.653 23.918  1.00 21.84 ? 483 PHE B CB  1 
ATOM   7480 C  CG  . PHE B 1 440 ? -12.054 -13.065 25.201  1.00 20.30 ? 483 PHE B CG  1 
ATOM   7481 C  CD1 . PHE B 1 440 ? -10.675 -13.157 25.276  1.00 18.01 ? 483 PHE B CD1 1 
ATOM   7482 C  CD2 . PHE B 1 440 ? -12.804 -13.349 26.332  1.00 19.87 ? 483 PHE B CD2 1 
ATOM   7483 C  CE1 . PHE B 1 440 ? -10.052 -13.538 26.454  1.00 18.92 ? 483 PHE B CE1 1 
ATOM   7484 C  CE2 . PHE B 1 440 ? -12.184 -13.733 27.512  1.00 20.27 ? 483 PHE B CE2 1 
ATOM   7485 C  CZ  . PHE B 1 440 ? -10.804 -13.828 27.571  1.00 18.89 ? 483 PHE B CZ  1 
ATOM   7486 N  N   . ARG B 1 441 ? -14.918 -12.737 21.685  1.00 24.65 ? 484 ARG B N   1 
ATOM   7487 C  CA  . ARG B 1 441 ? -15.296 -11.818 20.631  1.00 26.62 ? 484 ARG B CA  1 
ATOM   7488 C  C   . ARG B 1 441 ? -15.064 -10.413 21.166  1.00 27.08 ? 484 ARG B C   1 
ATOM   7489 O  O   . ARG B 1 441 ? -15.383 -10.116 22.325  1.00 27.15 ? 484 ARG B O   1 
ATOM   7490 C  CB  . ARG B 1 441 ? -16.763 -12.013 20.221  1.00 26.92 ? 484 ARG B CB  1 
ATOM   7491 C  CG  . ARG B 1 441 ? -17.005 -13.333 19.538  1.00 30.03 ? 484 ARG B CG  1 
ATOM   7492 C  CD  . ARG B 1 441 ? -18.351 -13.456 18.825  1.00 34.25 ? 484 ARG B CD  1 
ATOM   7493 N  NE  . ARG B 1 441 ? -18.226 -14.566 17.876  1.00 37.81 ? 484 ARG B NE  1 
ATOM   7494 C  CZ  . ARG B 1 441 ? -19.121 -15.529 17.668  1.00 39.68 ? 484 ARG B CZ  1 
ATOM   7495 N  NH1 . ARG B 1 441 ? -20.282 -15.549 18.322  1.00 40.48 ? 484 ARG B NH1 1 
ATOM   7496 N  NH2 . ARG B 1 441 ? -18.844 -16.484 16.788  1.00 40.05 ? 484 ARG B NH2 1 
ATOM   7497 N  N   . VAL B 1 442 ? -14.503 -9.555  20.327  1.00 28.44 ? 485 VAL B N   1 
ATOM   7498 C  CA  . VAL B 1 442 ? -14.206 -8.177  20.727  1.00 29.98 ? 485 VAL B CA  1 
ATOM   7499 C  C   . VAL B 1 442 ? -14.998 -7.131  19.930  1.00 31.04 ? 485 VAL B C   1 
ATOM   7500 O  O   . VAL B 1 442 ? -15.064 -7.187  18.706  1.00 30.96 ? 485 VAL B O   1 
ATOM   7501 C  CB  . VAL B 1 442 ? -12.666 -7.896  20.728  1.00 29.84 ? 485 VAL B CB  1 
ATOM   7502 C  CG1 . VAL B 1 442 ? -12.047 -8.179  19.376  1.00 30.06 ? 485 VAL B CG1 1 
ATOM   7503 C  CG2 . VAL B 1 442 ? -12.367 -6.475  21.177  1.00 28.90 ? 485 VAL B CG2 1 
ATOM   7504 N  N   . GLU B 1 443 ? -15.604 -6.192  20.654  1.00 33.16 ? 486 GLU B N   1 
ATOM   7505 C  CA  . GLU B 1 443 ? -16.412 -5.113  20.069  1.00 35.37 ? 486 GLU B CA  1 
ATOM   7506 C  C   . GLU B 1 443 ? -16.068 -3.742  20.643  1.00 36.18 ? 486 GLU B C   1 
ATOM   7507 O  O   . GLU B 1 443 ? -15.425 -3.654  21.686  1.00 36.00 ? 486 GLU B O   1 
ATOM   7508 C  CB  . GLU B 1 443 ? -17.890 -5.382  20.326  1.00 35.46 ? 486 GLU B CB  1 
ATOM   7509 C  CG  . GLU B 1 443 ? -18.401 -6.656  19.687  1.00 38.07 ? 486 GLU B CG  1 
ATOM   7510 C  CD  . GLU B 1 443 ? -19.864 -6.901  19.971  1.00 41.18 ? 486 GLU B CD  1 
ATOM   7511 O  OE1 . GLU B 1 443 ? -20.417 -6.245  20.899  1.00 42.95 ? 486 GLU B OE1 1 
ATOM   7512 O  OE2 . GLU B 1 443 ? -20.451 -7.748  19.257  1.00 41.43 ? 486 GLU B OE2 1 
ATOM   7513 N  N   . ILE B 1 444 ? -16.499 -2.687  19.952  1.00 37.88 ? 487 ILE B N   1 
ATOM   7514 C  CA  . ILE B 1 444 ? -16.481 -1.319  20.487  1.00 39.92 ? 487 ILE B CA  1 
ATOM   7515 C  C   . ILE B 1 444 ? -17.871 -0.711  20.358  1.00 41.57 ? 487 ILE B C   1 
ATOM   7516 O  O   . ILE B 1 444 ? -18.632 -1.082  19.468  1.00 41.44 ? 487 ILE B O   1 
ATOM   7517 C  CB  . ILE B 1 444 ? -15.474 -0.382  19.765  1.00 39.86 ? 487 ILE B CB  1 
ATOM   7518 C  CG1 . ILE B 1 444 ? -14.094 -1.030  19.662  1.00 39.91 ? 487 ILE B CG1 1 
ATOM   7519 C  CG2 . ILE B 1 444 ? -15.369 0.992   20.489  1.00 39.63 ? 487 ILE B CG2 1 
ATOM   7520 C  CD1 . ILE B 1 444 ? -13.051 -0.139  19.020  1.00 40.56 ? 487 ILE B CD1 1 
ATOM   7521 N  N   . GLN B 1 445 ? -18.184 0.224   21.256  1.00 44.18 ? 488 GLN B N   1 
ATOM   7522 C  CA  . GLN B 1 445 ? -19.447 0.972   21.250  1.00 46.50 ? 488 GLN B CA  1 
ATOM   7523 C  C   . GLN B 1 445 ? -19.553 1.931   20.064  1.00 47.64 ? 488 GLN B C   1 
ATOM   7524 O  O   . GLN B 1 445 ? -19.175 1.580   18.951  1.00 47.80 ? 488 GLN B O   1 
ATOM   7525 C  CB  . GLN B 1 445 ? -19.648 1.731   22.578  1.00 46.66 ? 488 GLN B CB  1 
ATOM   7526 C  CG  . GLN B 1 445 ? -19.913 0.850   23.810  1.00 48.06 ? 488 GLN B CG  1 
ATOM   7527 C  CD  . GLN B 1 445 ? -20.972 -0.226  23.572  1.00 50.12 ? 488 GLN B CD  1 
ATOM   7528 O  OE1 . GLN B 1 445 ? -22.139 -0.056  23.938  1.00 51.29 ? 488 GLN B OE1 1 
ATOM   7529 N  NE2 . GLN B 1 445 ? -20.568 -1.336  22.951  1.00 50.15 ? 488 GLN B NE2 1 
ATOM   7530 N  N   . HIS B 1 446 ? -20.061 3.136   20.325  1.00 49.28 ? 489 HIS B N   1 
ATOM   7531 C  CA  . HIS B 1 446 ? -20.379 4.161   19.302  1.00 50.77 ? 489 HIS B CA  1 
ATOM   7532 C  C   . HIS B 1 446 ? -19.630 3.976   17.973  1.00 50.81 ? 489 HIS B C   1 
ATOM   7533 O  O   . HIS B 1 446 ? -20.200 4.211   16.899  1.00 50.99 ? 489 HIS B O   1 
ATOM   7534 C  CB  . HIS B 1 446 ? -20.185 5.584   19.874  1.00 51.36 ? 489 HIS B CB  1 
ATOM   7535 C  CG  . HIS B 1 446 ? -20.357 5.666   21.368  1.00 54.30 ? 489 HIS B CG  1 
ATOM   7536 N  ND1 . HIS B 1 446 ? -21.427 5.094   22.033  1.00 56.73 ? 489 HIS B ND1 1 
ATOM   7537 C  CD2 . HIS B 1 446 ? -19.588 6.240   22.325  1.00 55.66 ? 489 HIS B CD2 1 
ATOM   7538 C  CE1 . HIS B 1 446 ? -21.307 5.311   23.333  1.00 56.90 ? 489 HIS B CE1 1 
ATOM   7539 N  NE2 . HIS B 1 446 ? -20.201 6.007   23.536  1.00 56.99 ? 489 HIS B NE2 1 
ATOM   7540 N  N   . LEU B 1 447 ? -18.364 3.547   18.070  1.00 50.69 ? 490 LEU B N   1 
ATOM   7541 C  CA  . LEU B 1 447 ? -17.547 3.126   16.924  1.00 50.28 ? 490 LEU B CA  1 
ATOM   7542 C  C   . LEU B 1 447 ? -17.175 4.326   16.047  1.00 49.50 ? 490 LEU B C   1 
ATOM   7543 O  O   . LEU B 1 447 ? -17.314 4.289   14.818  1.00 49.72 ? 490 LEU B O   1 
ATOM   7544 C  CB  . LEU B 1 447 ? -18.265 2.026   16.113  1.00 50.61 ? 490 LEU B CB  1 
ATOM   7545 C  CG  . LEU B 1 447 ? -17.560 0.680   15.882  1.00 51.68 ? 490 LEU B CG  1 
ATOM   7546 C  CD1 . LEU B 1 447 ? -18.566 -0.498  15.927  1.00 51.89 ? 490 LEU B CD1 1 
ATOM   7547 C  CD2 . LEU B 1 447 ? -16.730 0.676   14.588  1.00 51.73 ? 490 LEU B CD2 1 
ATOM   7548 N  N   . SER B 1 448 ? -16.721 5.395   16.695  1.00 48.16 ? 491 SER B N   1 
ATOM   7549 C  CA  . SER B 1 448 ? -16.144 6.530   15.982  1.00 46.85 ? 491 SER B CA  1 
ATOM   7550 C  C   . SER B 1 448 ? -14.702 6.194   15.645  1.00 45.58 ? 491 SER B C   1 
ATOM   7551 O  O   . SER B 1 448 ? -14.091 5.340   16.294  1.00 45.62 ? 491 SER B O   1 
ATOM   7552 C  CB  . SER B 1 448 ? -16.181 7.788   16.845  1.00 46.84 ? 491 SER B CB  1 
ATOM   7553 O  OG  . SER B 1 448 ? -15.265 7.673   17.921  1.00 47.48 ? 491 SER B OG  1 
ATOM   7554 N  N   . ASP B 1 449 ? -14.166 6.868   14.634  1.00 43.93 ? 492 ASP B N   1 
ATOM   7555 C  CA  . ASP B 1 449 ? -12.767 6.714   14.269  1.00 42.30 ? 492 ASP B CA  1 
ATOM   7556 C  C   . ASP B 1 449 ? -11.860 7.365   15.300  1.00 40.31 ? 492 ASP B C   1 
ATOM   7557 O  O   . ASP B 1 449 ? -12.096 8.503   15.724  1.00 39.95 ? 492 ASP B O   1 
ATOM   7558 C  CB  . ASP B 1 449 ? -12.509 7.300   12.885  1.00 42.84 ? 492 ASP B CB  1 
ATOM   7559 C  CG  . ASP B 1 449 ? -13.422 6.712   11.849  1.00 45.02 ? 492 ASP B CG  1 
ATOM   7560 O  OD1 . ASP B 1 449 ? -13.351 5.480   11.602  1.00 47.03 ? 492 ASP B OD1 1 
ATOM   7561 O  OD2 . ASP B 1 449 ? -14.232 7.483   11.295  1.00 48.53 ? 492 ASP B OD2 1 
ATOM   7562 N  N   . VAL B 1 450 ? -10.831 6.623   15.702  1.00 37.61 ? 493 VAL B N   1 
ATOM   7563 C  CA  . VAL B 1 450 ? -9.865  7.108   16.668  1.00 35.05 ? 493 VAL B CA  1 
ATOM   7564 C  C   . VAL B 1 450 ? -8.621  7.555   15.908  1.00 33.53 ? 493 VAL B C   1 
ATOM   7565 O  O   . VAL B 1 450 ? -8.026  6.775   15.159  1.00 33.30 ? 493 VAL B O   1 
ATOM   7566 C  CB  . VAL B 1 450 ? -9.556  6.026   17.744  1.00 35.32 ? 493 VAL B CB  1 
ATOM   7567 C  CG1 . VAL B 1 450 ? -8.364  6.420   18.628  1.00 34.34 ? 493 VAL B CG1 1 
ATOM   7568 C  CG2 . VAL B 1 450 ? -10.799 5.763   18.599  1.00 34.21 ? 493 VAL B CG2 1 
ATOM   7569 N  N   . GLY B 1 451 ? -8.259  8.825   16.084  1.00 31.38 ? 494 GLY B N   1 
ATOM   7570 C  CA  . GLY B 1 451 ? -7.091  9.400   15.443  1.00 28.96 ? 494 GLY B CA  1 
ATOM   7571 C  C   . GLY B 1 451 ? -5.785  9.004   16.112  1.00 27.73 ? 494 GLY B C   1 
ATOM   7572 O  O   . GLY B 1 451 ? -5.771  8.222   17.074  1.00 27.12 ? 494 GLY B O   1 
ATOM   7573 N  N   . THR B 1 452 ? -4.690  9.563   15.602  1.00 25.89 ? 495 THR B N   1 
ATOM   7574 C  CA  . THR B 1 452 ? -3.353  9.232   16.081  1.00 24.54 ? 495 THR B CA  1 
ATOM   7575 C  C   . THR B 1 452 ? -2.657  10.441  16.685  1.00 23.78 ? 495 THR B C   1 
ATOM   7576 O  O   . THR B 1 452 ? -2.707  11.537  16.130  1.00 23.95 ? 495 THR B O   1 
ATOM   7577 C  CB  . THR B 1 452 ? -2.479  8.668   14.936  1.00 23.89 ? 495 THR B CB  1 
ATOM   7578 O  OG1 . THR B 1 452 ? -3.086  7.482   14.444  1.00 24.38 ? 495 THR B OG1 1 
ATOM   7579 C  CG2 . THR B 1 452 ? -1.099  8.332   15.408  1.00 22.87 ? 495 THR B CG2 1 
ATOM   7580 N  N   . THR B 1 453 ? -1.990  10.226  17.809  1.00 22.53 ? 496 THR B N   1 
ATOM   7581 C  CA  . THR B 1 453 ? -1.148  11.251  18.387  1.00 21.78 ? 496 THR B CA  1 
ATOM   7582 C  C   . THR B 1 453 ? 0.315   10.807  18.392  1.00 20.92 ? 496 THR B C   1 
ATOM   7583 O  O   . THR B 1 453 ? 0.627   9.635   18.571  1.00 20.74 ? 496 THR B O   1 
ATOM   7584 C  CB  . THR B 1 453 ? -1.628  11.634  19.798  1.00 21.69 ? 496 THR B CB  1 
ATOM   7585 O  OG1 . THR B 1 453 ? -1.138  12.931  20.130  1.00 23.42 ? 496 THR B OG1 1 
ATOM   7586 C  CG2 . THR B 1 453 ? -1.146  10.644  20.835  1.00 22.55 ? 496 THR B CG2 1 
ATOM   7587 N  N   . PHE B 1 454 ? 1.210   11.752  18.163  1.00 20.48 ? 497 PHE B N   1 
ATOM   7588 C  CA  . PHE B 1 454 ? 2.641   11.466  18.192  1.00 19.55 ? 497 PHE B CA  1 
ATOM   7589 C  C   . PHE B 1 454 ? 3.156   11.768  19.602  1.00 19.76 ? 497 PHE B C   1 
ATOM   7590 O  O   . PHE B 1 454 ? 3.210   12.934  20.023  1.00 20.22 ? 497 PHE B O   1 
ATOM   7591 C  CB  . PHE B 1 454 ? 3.352   12.287  17.117  1.00 18.45 ? 497 PHE B CB  1 
ATOM   7592 C  CG  . PHE B 1 454 ? 4.849   12.229  17.177  1.00 17.68 ? 497 PHE B CG  1 
ATOM   7593 C  CD1 . PHE B 1 454 ? 5.549   11.169  16.592  1.00 15.51 ? 497 PHE B CD1 1 
ATOM   7594 C  CD2 . PHE B 1 454 ? 5.580   13.269  17.770  1.00 16.15 ? 497 PHE B CD2 1 
ATOM   7595 C  CE1 . PHE B 1 454 ? 6.934   11.132  16.621  1.00 13.19 ? 497 PHE B CE1 1 
ATOM   7596 C  CE2 . PHE B 1 454 ? 6.972   13.238  17.795  1.00 13.65 ? 497 PHE B CE2 1 
ATOM   7597 C  CZ  . PHE B 1 454 ? 7.646   12.167  17.224  1.00 13.33 ? 497 PHE B CZ  1 
ATOM   7598 N  N   . ASN B 1 455 ? 3.465   10.702  20.341  1.00 19.27 ? 498 ASN B N   1 
ATOM   7599 C  CA  . ASN B 1 455 ? 4.110   10.793  21.638  1.00 18.88 ? 498 ASN B CA  1 
ATOM   7600 C  C   . ASN B 1 455 ? 5.473   10.147  21.574  1.00 18.75 ? 498 ASN B C   1 
ATOM   7601 O  O   . ASN B 1 455 ? 5.824   9.310   22.405  1.00 18.59 ? 498 ASN B O   1 
ATOM   7602 C  CB  . ASN B 1 455 ? 3.252   10.137  22.703  1.00 19.07 ? 498 ASN B CB  1 
ATOM   7603 C  CG  . ASN B 1 455 ? 2.186   11.065  23.220  1.00 19.95 ? 498 ASN B CG  1 
ATOM   7604 O  OD1 . ASN B 1 455 ? 2.458   12.215  23.528  1.00 21.12 ? 498 ASN B OD1 1 
ATOM   7605 N  ND2 . ASN B 1 455 ? 0.971   10.575  23.318  1.00 21.58 ? 498 ASN B ND2 1 
ATOM   7606 N  N   . LEU B 1 456 ? 6.235   10.573  20.569  1.00 18.79 ? 499 LEU B N   1 
ATOM   7607 C  CA  . LEU B 1 456 ? 7.470   9.936   20.131  1.00 18.93 ? 499 LEU B CA  1 
ATOM   7608 C  C   . LEU B 1 456 ? 7.195   8.603   19.448  1.00 19.12 ? 499 LEU B C   1 
ATOM   7609 O  O   . LEU B 1 456 ? 7.566   8.426   18.295  1.00 19.53 ? 499 LEU B O   1 
ATOM   7610 C  CB  . LEU B 1 456 ? 8.518   9.802   21.239  1.00 18.71 ? 499 LEU B CB  1 
ATOM   7611 C  CG  . LEU B 1 456 ? 9.833   9.819   20.463  1.00 20.01 ? 499 LEU B CG  1 
ATOM   7612 C  CD1 . LEU B 1 456 ? 10.524  11.177  20.489  1.00 18.24 ? 499 LEU B CD1 1 
ATOM   7613 C  CD2 . LEU B 1 456 ? 10.746  8.722   20.908  1.00 20.86 ? 499 LEU B CD2 1 
ATOM   7614 N  N   . ILE B 1 457 ? 6.572   7.666   20.160  1.00 19.07 ? 500 ILE B N   1 
ATOM   7615 C  CA  . ILE B 1 457 ? 5.915   6.562   19.502  1.00 19.28 ? 500 ILE B CA  1 
ATOM   7616 C  C   . ILE B 1 457 ? 4.510   7.042   19.135  1.00 19.30 ? 500 ILE B C   1 
ATOM   7617 O  O   . ILE B 1 457 ? 3.947   7.910   19.816  1.00 19.22 ? 500 ILE B O   1 
ATOM   7618 C  CB  . ILE B 1 457 ? 5.895   5.265   20.347  1.00 19.23 ? 500 ILE B CB  1 
ATOM   7619 C  CG1 . ILE B 1 457 ? 5.197   5.495   21.680  1.00 20.82 ? 500 ILE B CG1 1 
ATOM   7620 C  CG2 . ILE B 1 457 ? 7.322   4.751   20.572  1.00 18.36 ? 500 ILE B CG2 1 
ATOM   7621 C  CD1 . ILE B 1 457 ? 4.513   4.271   22.214  1.00 22.96 ? 500 ILE B CD1 1 
ATOM   7622 N  N   . LEU B 1 458 ? 3.963   6.517   18.041  1.00 18.95 ? 501 LEU B N   1 
ATOM   7623 C  CA  . LEU B 1 458 ? 2.613   6.877   17.646  1.00 18.70 ? 501 LEU B CA  1 
ATOM   7624 C  C   . LEU B 1 458 ? 1.606   6.103   18.490  1.00 19.52 ? 501 LEU B C   1 
ATOM   7625 O  O   . LEU B 1 458 ? 1.776   4.903   18.736  1.00 18.37 ? 501 LEU B O   1 
ATOM   7626 C  CB  . LEU B 1 458 ? 2.394   6.655   16.157  1.00 18.16 ? 501 LEU B CB  1 
ATOM   7627 C  CG  . LEU B 1 458 ? 3.110   7.596   15.192  1.00 17.80 ? 501 LEU B CG  1 
ATOM   7628 C  CD1 . LEU B 1 458 ? 2.870   7.173   13.743  1.00 16.93 ? 501 LEU B CD1 1 
ATOM   7629 C  CD2 . LEU B 1 458 ? 2.654   9.044   15.401  1.00 17.52 ? 501 LEU B CD2 1 
ATOM   7630 N  N   . MET B 1 459 ? 0.573   6.813   18.952  1.00 20.52 ? 502 MET B N   1 
ATOM   7631 C  CA  . MET B 1 459 ? -0.396  6.267   19.896  1.00 21.87 ? 502 MET B CA  1 
ATOM   7632 C  C   . MET B 1 459 ? -1.800  6.729   19.528  1.00 22.13 ? 502 MET B C   1 
ATOM   7633 O  O   . MET B 1 459 ? -1.950  7.712   18.781  1.00 22.27 ? 502 MET B O   1 
ATOM   7634 C  CB  . MET B 1 459 ? -0.068  6.732   21.311  1.00 22.56 ? 502 MET B CB  1 
ATOM   7635 C  CG  . MET B 1 459 ? 1.208   6.142   21.895  1.00 25.99 ? 502 MET B CG  1 
ATOM   7636 S  SD  . MET B 1 459 ? 1.454   6.650   23.604  1.00 32.63 ? 502 MET B SD  1 
ATOM   7637 C  CE  . MET B 1 459 ? 0.078   5.833   24.425  1.00 31.49 ? 502 MET B CE  1 
ATOM   7638 N  N   . PRO B 1 460 ? -2.840  6.028   20.039  1.00 22.07 ? 503 PRO B N   1 
ATOM   7639 C  CA  . PRO B 1 460 ? -4.225  6.509   19.839  1.00 21.95 ? 503 PRO B CA  1 
ATOM   7640 C  C   . PRO B 1 460 ? -4.397  7.884   20.463  1.00 22.36 ? 503 PRO B C   1 
ATOM   7641 O  O   . PRO B 1 460 ? -3.773  8.172   21.485  1.00 22.11 ? 503 PRO B O   1 
ATOM   7642 C  CB  . PRO B 1 460 ? -5.078  5.485   20.585  1.00 22.04 ? 503 PRO B CB  1 
ATOM   7643 C  CG  . PRO B 1 460 ? -4.216  4.262   20.709  1.00 21.92 ? 503 PRO B CG  1 
ATOM   7644 C  CD  . PRO B 1 460 ? -2.787  4.723   20.723  1.00 21.60 ? 503 PRO B CD  1 
ATOM   7645 N  N   . GLU B 1 461 ? -5.219  8.719   19.834  1.00 23.11 ? 504 GLU B N   1 
ATOM   7646 C  CA  . GLU B 1 461 ? -5.444  10.100  20.265  1.00 23.82 ? 504 GLU B CA  1 
ATOM   7647 C  C   . GLU B 1 461 ? -6.241  10.158  21.549  1.00 23.25 ? 504 GLU B C   1 
ATOM   7648 O  O   . GLU B 1 461 ? -6.075  11.084  22.343  1.00 23.09 ? 504 GLU B O   1 
ATOM   7649 C  CB  . GLU B 1 461 ? -6.175  10.915  19.176  1.00 24.48 ? 504 GLU B CB  1 
ATOM   7650 C  CG  . GLU B 1 461 ? -6.653  12.301  19.664  1.00 27.73 ? 504 GLU B CG  1 
ATOM   7651 C  CD  . GLU B 1 461 ? -6.614  13.370  18.578  1.00 33.69 ? 504 GLU B CD  1 
ATOM   7652 O  OE1 . GLU B 1 461 ? -7.189  13.120  17.488  1.00 35.26 ? 504 GLU B OE1 1 
ATOM   7653 O  OE2 . GLU B 1 461 ? -6.008  14.458  18.814  1.00 34.32 ? 504 GLU B OE2 1 
ATOM   7654 N  N   . LYS B 1 462 ? -7.118  9.179   21.731  1.00 23.14 ? 505 LYS B N   1 
ATOM   7655 C  CA  . LYS B 1 462 ? -7.979  9.105   22.913  1.00 23.69 ? 505 LYS B CA  1 
ATOM   7656 C  C   . LYS B 1 462 ? -8.187  7.622   23.287  1.00 23.42 ? 505 LYS B C   1 
ATOM   7657 O  O   . LYS B 1 462 ? -7.848  6.734   22.504  1.00 23.54 ? 505 LYS B O   1 
ATOM   7658 C  CB  . LYS B 1 462 ? -9.305  9.836   22.648  1.00 23.66 ? 505 LYS B CB  1 
ATOM   7659 C  CG  . LYS B 1 462 ? -10.215 9.112   21.664  1.00 25.39 ? 505 LYS B CG  1 
ATOM   7660 C  CD  . LYS B 1 462 ? -11.224 10.034  21.013  1.00 28.18 ? 505 LYS B CD  1 
ATOM   7661 C  CE  . LYS B 1 462 ? -12.159 9.234   20.103  1.00 29.83 ? 505 LYS B CE  1 
ATOM   7662 N  NZ  . LYS B 1 462 ? -12.987 10.131  19.255  1.00 31.23 ? 505 LYS B NZ  1 
ATOM   7663 N  N   . PRO B 1 463 ? -8.705  7.349   24.494  1.00 23.03 ? 506 PRO B N   1 
ATOM   7664 C  CA  . PRO B 1 463 ? -8.894  5.971   24.947  1.00 22.49 ? 506 PRO B CA  1 
ATOM   7665 C  C   . PRO B 1 463 ? -9.874  5.157   24.112  1.00 22.22 ? 506 PRO B C   1 
ATOM   7666 O  O   . PRO B 1 463 ? -10.835 5.692   23.559  1.00 21.72 ? 506 PRO B O   1 
ATOM   7667 C  CB  . PRO B 1 463 ? -9.434  6.141   26.371  1.00 22.36 ? 506 PRO B CB  1 
ATOM   7668 C  CG  . PRO B 1 463 ? -8.862  7.424   26.824  1.00 22.56 ? 506 PRO B CG  1 
ATOM   7669 C  CD  . PRO B 1 463 ? -8.899  8.309   25.595  1.00 23.24 ? 506 PRO B CD  1 
ATOM   7670 N  N   . ILE B 1 464 ? -9.606  3.857   24.036  1.00 22.12 ? 507 ILE B N   1 
ATOM   7671 C  CA  . ILE B 1 464 ? -10.442 2.920   23.307  1.00 21.75 ? 507 ILE B CA  1 
ATOM   7672 C  C   . ILE B 1 464 ? -10.973 1.937   24.325  1.00 21.87 ? 507 ILE B C   1 
ATOM   7673 O  O   . ILE B 1 464 ? -10.176 1.250   24.960  1.00 22.52 ? 507 ILE B O   1 
ATOM   7674 C  CB  . ILE B 1 464 ? -9.610  2.118   22.270  1.00 21.61 ? 507 ILE B CB  1 
ATOM   7675 C  CG1 . ILE B 1 464 ? -8.913  3.053   21.285  1.00 19.93 ? 507 ILE B CG1 1 
ATOM   7676 C  CG2 . ILE B 1 464 ? -10.489 1.065   21.565  1.00 21.58 ? 507 ILE B CG2 1 
ATOM   7677 C  CD1 . ILE B 1 464 ? -7.943  2.342   20.352  1.00 20.96 ? 507 ILE B CD1 1 
ATOM   7678 N  N   . SER B 1 465 ? -12.294 1.867   24.504  1.00 21.48 ? 508 SER B N   1 
ATOM   7679 C  CA  . SER B 1 465 ? -12.857 0.821   25.353  1.00 21.58 ? 508 SER B CA  1 
ATOM   7680 C  C   . SER B 1 465 ? -13.520 -0.299  24.574  1.00 21.43 ? 508 SER B C   1 
ATOM   7681 O  O   . SER B 1 465 ? -14.413 -0.083  23.755  1.00 21.52 ? 508 SER B O   1 
ATOM   7682 C  CB  . SER B 1 465 ? -13.787 1.364   26.445  1.00 21.62 ? 508 SER B CB  1 
ATOM   7683 O  OG  . SER B 1 465 ? -14.644 2.350   25.932  1.00 22.78 ? 508 SER B OG  1 
ATOM   7684 N  N   . PHE B 1 466 ? -13.054 -1.507  24.855  1.00 21.16 ? 509 PHE B N   1 
ATOM   7685 C  CA  . PHE B 1 466 ? -13.535 -2.708  24.217  1.00 20.98 ? 509 PHE B CA  1 
ATOM   7686 C  C   . PHE B 1 466 ? -14.614 -3.366  25.046  1.00 21.35 ? 509 PHE B C   1 
ATOM   7687 O  O   . PHE B 1 466 ? -14.639 -3.216  26.268  1.00 21.64 ? 509 PHE B O   1 
ATOM   7688 C  CB  . PHE B 1 466 ? -12.386 -3.691  24.085  1.00 20.64 ? 509 PHE B CB  1 
ATOM   7689 C  CG  . PHE B 1 466 ? -11.282 -3.204  23.222  1.00 20.12 ? 509 PHE B CG  1 
ATOM   7690 C  CD1 . PHE B 1 466 ? -10.140 -2.656  23.783  1.00 21.00 ? 509 PHE B CD1 1 
ATOM   7691 C  CD2 . PHE B 1 466 ? -11.385 -3.275  21.841  1.00 19.21 ? 509 PHE B CD2 1 
ATOM   7692 C  CE1 . PHE B 1 466 ? -9.114  -2.206  22.980  1.00 20.20 ? 509 PHE B CE1 1 
ATOM   7693 C  CE2 . PHE B 1 466 ? -10.366 -2.835  21.035  1.00 18.45 ? 509 PHE B CE2 1 
ATOM   7694 C  CZ  . PHE B 1 466 ? -9.227  -2.297  21.603  1.00 19.37 ? 509 PHE B CZ  1 
ATOM   7695 N  N   . THR B 1 467 ? -15.509 -4.090  24.378  1.00 21.71 ? 510 THR B N   1 
ATOM   7696 C  CA  . THR B 1 467 ? -16.391 -5.027  25.058  1.00 21.93 ? 510 THR B CA  1 
ATOM   7697 C  C   . THR B 1 467 ? -15.954 -6.439  24.665  1.00 21.97 ? 510 THR B C   1 
ATOM   7698 O  O   . THR B 1 467 ? -15.825 -6.747  23.480  1.00 22.15 ? 510 THR B O   1 
ATOM   7699 C  CB  . THR B 1 467 ? -17.901 -4.774  24.761  1.00 22.02 ? 510 THR B CB  1 
ATOM   7700 O  OG1 . THR B 1 467 ? -18.277 -3.464  25.217  1.00 21.54 ? 510 THR B OG1 1 
ATOM   7701 C  CG2 . THR B 1 467 ? -18.774 -5.803  25.491  1.00 21.77 ? 510 THR B CG2 1 
ATOM   7702 N  N   . PHE B 1 468 ? -15.690 -7.271  25.670  1.00 22.21 ? 511 PHE B N   1 
ATOM   7703 C  CA  . PHE B 1 468 ? -15.321 -8.674  25.456  1.00 22.47 ? 511 PHE B CA  1 
ATOM   7704 C  C   . PHE B 1 468 ? -16.453 -9.635  25.815  1.00 22.81 ? 511 PHE B C   1 
ATOM   7705 O  O   . PHE B 1 468 ? -17.050 -9.516  26.876  1.00 22.51 ? 511 PHE B O   1 
ATOM   7706 C  CB  . PHE B 1 468 ? -14.067 -9.026  26.249  1.00 22.00 ? 511 PHE B CB  1 
ATOM   7707 C  CG  . PHE B 1 468 ? -12.845 -8.254  25.824  1.00 21.31 ? 511 PHE B CG  1 
ATOM   7708 C  CD1 . PHE B 1 468 ? -12.448 -7.122  26.525  1.00 18.97 ? 511 PHE B CD1 1 
ATOM   7709 C  CD2 . PHE B 1 468 ? -12.095 -8.663  24.713  1.00 18.86 ? 511 PHE B CD2 1 
ATOM   7710 C  CE1 . PHE B 1 468 ? -11.314 -6.416  26.142  1.00 19.24 ? 511 PHE B CE1 1 
ATOM   7711 C  CE2 . PHE B 1 468 ? -10.984 -7.957  24.315  1.00 17.68 ? 511 PHE B CE2 1 
ATOM   7712 C  CZ  . PHE B 1 468 ? -10.582 -6.829  25.032  1.00 19.35 ? 511 PHE B CZ  1 
ATOM   7713 N  N   . TRP B 1 469 ? -16.732 -10.573 24.908  1.00 23.80 ? 512 TRP B N   1 
ATOM   7714 C  CA  . TRP B 1 469 ? -17.734 -11.633 25.104  1.00 25.07 ? 512 TRP B CA  1 
ATOM   7715 C  C   . TRP B 1 469 ? -17.033 -12.984 25.029  1.00 25.86 ? 512 TRP B C   1 
ATOM   7716 O  O   . TRP B 1 469 ? -16.212 -13.188 24.132  1.00 26.20 ? 512 TRP B O   1 
ATOM   7717 C  CB  . TRP B 1 469 ? -18.804 -11.591 23.999  1.00 24.86 ? 512 TRP B CB  1 
ATOM   7718 C  CG  . TRP B 1 469 ? -19.514 -10.282 23.860  1.00 25.17 ? 512 TRP B CG  1 
ATOM   7719 C  CD1 . TRP B 1 469 ? -19.096 -9.186  23.155  1.00 25.55 ? 512 TRP B CD1 1 
ATOM   7720 C  CD2 . TRP B 1 469 ? -20.771 -9.931  24.439  1.00 26.17 ? 512 TRP B CD2 1 
ATOM   7721 N  NE1 . TRP B 1 469 ? -20.013 -8.171  23.267  1.00 26.34 ? 512 TRP B NE1 1 
ATOM   7722 C  CE2 . TRP B 1 469 ? -21.053 -8.601  24.050  1.00 26.55 ? 512 TRP B CE2 1 
ATOM   7723 C  CE3 . TRP B 1 469 ? -21.689 -10.610 25.254  1.00 26.29 ? 512 TRP B CE3 1 
ATOM   7724 C  CZ2 . TRP B 1 469 ? -22.220 -7.939  24.436  1.00 27.06 ? 512 TRP B CZ2 1 
ATOM   7725 C  CZ3 . TRP B 1 469 ? -22.840 -9.948  25.651  1.00 27.42 ? 512 TRP B CZ3 1 
ATOM   7726 C  CH2 . TRP B 1 469 ? -23.099 -8.624  25.237  1.00 27.09 ? 512 TRP B CH2 1 
ATOM   7727 N  N   . PRO B 1 470 ? -17.352 -13.916 25.952  1.00 26.85 ? 513 PRO B N   1 
ATOM   7728 C  CA  . PRO B 1 470 ? -16.739 -15.256 25.903  1.00 27.68 ? 513 PRO B CA  1 
ATOM   7729 C  C   . PRO B 1 470 ? -17.188 -15.991 24.648  1.00 28.83 ? 513 PRO B C   1 
ATOM   7730 O  O   . PRO B 1 470 ? -18.394 -16.072 24.393  1.00 29.15 ? 513 PRO B O   1 
ATOM   7731 C  CB  . PRO B 1 470 ? -17.306 -15.959 27.135  1.00 27.63 ? 513 PRO B CB  1 
ATOM   7732 C  CG  . PRO B 1 470 ? -17.931 -14.907 27.966  1.00 27.44 ? 513 PRO B CG  1 
ATOM   7733 C  CD  . PRO B 1 470 ? -18.322 -13.792 27.051  1.00 26.91 ? 513 PRO B CD  1 
ATOM   7734 N  N   . PHE B 1 471 ? -16.235 -16.494 23.859  1.00 29.89 ? 514 PHE B N   1 
ATOM   7735 C  CA  . PHE B 1 471 ? -16.549 -17.159 22.582  1.00 30.86 ? 514 PHE B CA  1 
ATOM   7736 C  C   . PHE B 1 471 ? -16.942 -18.619 22.790  1.00 31.00 ? 514 PHE B C   1 
ATOM   7737 O  O   . PHE B 1 471 ? -16.285 -19.335 23.540  1.00 31.42 ? 514 PHE B O   1 
ATOM   7738 C  CB  . PHE B 1 471 ? -15.382 -17.048 21.583  1.00 30.98 ? 514 PHE B CB  1 
ATOM   7739 C  CG  . PHE B 1 471 ? -15.477 -18.013 20.430  1.00 32.78 ? 514 PHE B CG  1 
ATOM   7740 C  CD1 . PHE B 1 471 ? -16.320 -17.756 19.355  1.00 33.99 ? 514 PHE B CD1 1 
ATOM   7741 C  CD2 . PHE B 1 471 ? -14.727 -19.191 20.424  1.00 34.22 ? 514 PHE B CD2 1 
ATOM   7742 C  CE1 . PHE B 1 471 ? -16.411 -18.658 18.283  1.00 34.64 ? 514 PHE B CE1 1 
ATOM   7743 C  CE2 . PHE B 1 471 ? -14.817 -20.101 19.357  1.00 33.73 ? 514 PHE B CE2 1 
ATOM   7744 C  CZ  . PHE B 1 471 ? -15.658 -19.834 18.291  1.00 33.49 ? 514 PHE B CZ  1 
ATOM   7745 N  N   . PHE C 2 16  ? -55.123 9.863   69.234  1.00 73.16 ? 43  PHE C N   1 
ATOM   7746 C  CA  . PHE C 2 16  ? -54.791 11.218  68.703  1.00 73.31 ? 43  PHE C CA  1 
ATOM   7747 C  C   . PHE C 2 16  ? -53.377 11.657  69.110  1.00 73.47 ? 43  PHE C C   1 
ATOM   7748 O  O   . PHE C 2 16  ? -53.014 11.590  70.289  1.00 73.60 ? 43  PHE C O   1 
ATOM   7749 C  CB  . PHE C 2 16  ? -55.836 12.254  69.160  1.00 73.19 ? 43  PHE C CB  1 
ATOM   7750 C  CG  . PHE C 2 16  ? -55.692 13.613  68.499  1.00 72.88 ? 43  PHE C CG  1 
ATOM   7751 C  CD1 . PHE C 2 16  ? -54.838 14.584  69.032  1.00 72.30 ? 43  PHE C CD1 1 
ATOM   7752 C  CD2 . PHE C 2 16  ? -56.420 13.926  67.351  1.00 72.33 ? 43  PHE C CD2 1 
ATOM   7753 C  CE1 . PHE C 2 16  ? -54.702 15.837  68.427  1.00 71.86 ? 43  PHE C CE1 1 
ATOM   7754 C  CE2 . PHE C 2 16  ? -56.290 15.177  66.741  1.00 71.95 ? 43  PHE C CE2 1 
ATOM   7755 C  CZ  . PHE C 2 16  ? -55.430 16.133  67.282  1.00 71.67 ? 43  PHE C CZ  1 
ATOM   7756 N  N   . GLY C 2 17  ? -52.595 12.106  68.124  1.00 73.48 ? 44  GLY C N   1 
ATOM   7757 C  CA  . GLY C 2 17  ? -51.249 12.652  68.349  1.00 73.23 ? 44  GLY C CA  1 
ATOM   7758 C  C   . GLY C 2 17  ? -50.243 11.647  68.881  1.00 73.03 ? 44  GLY C C   1 
ATOM   7759 O  O   . GLY C 2 17  ? -49.392 11.991  69.707  1.00 72.97 ? 44  GLY C O   1 
ATOM   7760 N  N   . ALA C 2 18  ? -50.339 10.411  68.393  1.00 72.82 ? 45  ALA C N   1 
ATOM   7761 C  CA  . ALA C 2 18  ? -49.543 9.290   68.902  1.00 72.59 ? 45  ALA C CA  1 
ATOM   7762 C  C   . ALA C 2 18  ? -48.020 9.471   68.757  1.00 72.43 ? 45  ALA C C   1 
ATOM   7763 O  O   . ALA C 2 18  ? -47.262 9.056   69.638  1.00 72.42 ? 45  ALA C O   1 
ATOM   7764 C  CB  . ALA C 2 18  ? -50.011 7.973   68.270  1.00 72.45 ? 45  ALA C CB  1 
ATOM   7765 N  N   . CYS C 2 19  ? -47.582 10.101  67.664  1.00 72.21 ? 46  CYS C N   1 
ATOM   7766 C  CA  . CYS C 2 19  ? -46.154 10.381  67.440  1.00 71.97 ? 46  CYS C CA  1 
ATOM   7767 C  C   . CYS C 2 19  ? -45.682 11.667  68.142  1.00 71.79 ? 46  CYS C C   1 
ATOM   7768 O  O   . CYS C 2 19  ? -44.477 11.927  68.236  1.00 71.49 ? 46  CYS C O   1 
ATOM   7769 C  CB  . CYS C 2 19  ? -45.839 10.433  65.941  1.00 71.92 ? 46  CYS C CB  1 
ATOM   7770 S  SG  . CYS C 2 19  ? -46.130 12.041  65.156  1.00 71.97 ? 46  CYS C SG  1 
ATOM   7771 N  N   . GLU C 2 20  ? -46.655 12.454  68.610  1.00 71.78 ? 47  GLU C N   1 
ATOM   7772 C  CA  . GLU C 2 20  ? -46.463 13.676  69.424  1.00 71.75 ? 47  GLU C CA  1 
ATOM   7773 C  C   . GLU C 2 20  ? -45.952 14.924  68.678  1.00 71.54 ? 47  GLU C C   1 
ATOM   7774 O  O   . GLU C 2 20  ? -44.967 15.543  69.083  1.00 71.46 ? 47  GLU C O   1 
ATOM   7775 C  CB  . GLU C 2 20  ? -45.673 13.384  70.720  1.00 71.77 ? 47  GLU C CB  1 
ATOM   7776 C  CG  . GLU C 2 20  ? -46.544 12.781  71.833  1.00 72.01 ? 47  GLU C CG  1 
ATOM   7777 C  CD  . GLU C 2 20  ? -45.752 12.031  72.896  1.00 72.04 ? 47  GLU C CD  1 
ATOM   7778 O  OE1 . GLU C 2 20  ? -44.794 12.604  73.456  1.00 72.03 ? 47  GLU C OE1 1 
ATOM   7779 O  OE2 . GLU C 2 20  ? -46.105 10.866  73.185  1.00 71.87 ? 47  GLU C OE2 1 
ATOM   7780 N  N   . GLY C 2 21  ? -46.655 15.298  67.608  1.00 71.38 ? 48  GLY C N   1 
ATOM   7781 C  CA  . GLY C 2 21  ? -46.379 16.531  66.865  1.00 71.33 ? 48  GLY C CA  1 
ATOM   7782 C  C   . GLY C 2 21  ? -45.052 16.539  66.126  1.00 71.30 ? 48  GLY C C   1 
ATOM   7783 O  O   . GLY C 2 21  ? -44.310 17.525  66.174  1.00 71.27 ? 48  GLY C O   1 
ATOM   7784 N  N   . THR C 2 22  ? -44.769 15.441  65.427  1.00 71.20 ? 49  THR C N   1 
ATOM   7785 C  CA  . THR C 2 22  ? -43.468 15.204  64.799  1.00 70.96 ? 49  THR C CA  1 
ATOM   7786 C  C   . THR C 2 22  ? -43.602 14.951  63.287  1.00 71.00 ? 49  THR C C   1 
ATOM   7787 O  O   . THR C 2 22  ? -42.607 14.969  62.557  1.00 71.07 ? 49  THR C O   1 
ATOM   7788 C  CB  . THR C 2 22  ? -42.711 14.049  65.541  1.00 70.91 ? 49  THR C CB  1 
ATOM   7789 O  OG1 . THR C 2 22  ? -41.880 14.598  66.575  1.00 70.26 ? 49  THR C OG1 1 
ATOM   7790 C  CG2 . THR C 2 22  ? -41.842 13.242  64.607  1.00 71.06 ? 49  THR C CG2 1 
ATOM   7791 N  N   . LEU C 2 23  ? -44.841 14.757  62.830  1.00 71.02 ? 50  LEU C N   1 
ATOM   7792 C  CA  . LEU C 2 23  ? -45.161 14.380  61.441  1.00 71.09 ? 50  LEU C CA  1 
ATOM   7793 C  C   . LEU C 2 23  ? -44.646 12.966  61.117  1.00 71.26 ? 50  LEU C C   1 
ATOM   7794 O  O   . LEU C 2 23  ? -44.096 12.710  60.044  1.00 71.17 ? 50  LEU C O   1 
ATOM   7795 C  CB  . LEU C 2 23  ? -44.691 15.453  60.430  1.00 71.00 ? 50  LEU C CB  1 
ATOM   7796 C  CG  . LEU C 2 23  ? -45.129 15.461  58.952  1.00 70.79 ? 50  LEU C CG  1 
ATOM   7797 C  CD1 . LEU C 2 23  ? -46.613 15.170  58.758  1.00 70.21 ? 50  LEU C CD1 1 
ATOM   7798 C  CD2 . LEU C 2 23  ? -44.751 16.778  58.286  1.00 70.37 ? 50  LEU C CD2 1 
ATOM   7799 N  N   . ALA C 2 24  ? -44.853 12.055  62.069  1.00 71.58 ? 51  ALA C N   1 
ATOM   7800 C  CA  . ALA C 2 24  ? -44.424 10.659  61.957  1.00 71.96 ? 51  ALA C CA  1 
ATOM   7801 C  C   . ALA C 2 24  ? -45.573 9.663   62.211  1.00 72.24 ? 51  ALA C C   1 
ATOM   7802 O  O   . ALA C 2 24  ? -45.347 8.537   62.673  1.00 72.29 ? 51  ALA C O   1 
ATOM   7803 C  CB  . ALA C 2 24  ? -43.256 10.393  62.900  1.00 71.89 ? 51  ALA C CB  1 
ATOM   7804 N  N   . CYS C 2 25  ? -46.796 10.101  61.908  1.00 72.52 ? 52  CYS C N   1 
ATOM   7805 C  CA  . CYS C 2 25  ? -48.017 9.280   61.952  1.00 72.69 ? 52  CYS C CA  1 
ATOM   7806 C  C   . CYS C 2 25  ? -49.137 10.048  61.241  1.00 73.01 ? 52  CYS C C   1 
ATOM   7807 O  O   . CYS C 2 25  ? -48.866 11.026  60.540  1.00 73.14 ? 52  CYS C O   1 
ATOM   7808 C  CB  . CYS C 2 25  ? -48.414 8.923   63.399  1.00 72.72 ? 52  CYS C CB  1 
ATOM   7809 S  SG  . CYS C 2 25  ? -49.245 10.221  64.368  1.00 71.66 ? 52  CYS C SG  1 
ATOM   7810 N  N   . SER C 2 26  ? -50.383 9.605   61.404  1.00 73.29 ? 53  SER C N   1 
ATOM   7811 C  CA  . SER C 2 26  ? -51.542 10.359  60.906  1.00 73.54 ? 53  SER C CA  1 
ATOM   7812 C  C   . SER C 2 26  ? -52.766 10.207  61.820  1.00 73.83 ? 53  SER C C   1 
ATOM   7813 O  O   . SER C 2 26  ? -53.871 9.901   61.361  1.00 73.89 ? 53  SER C O   1 
ATOM   7814 C  CB  . SER C 2 26  ? -51.864 10.009  59.438  1.00 73.49 ? 53  SER C CB  1 
ATOM   7815 O  OG  . SER C 2 26  ? -52.036 8.615   59.235  1.00 73.07 ? 53  SER C OG  1 
ATOM   7816 N  N   . THR C 2 27  ? -52.557 10.434  63.116  1.00 74.08 ? 54  THR C N   1 
ATOM   7817 C  CA  . THR C 2 27  ? -53.623 10.290  64.110  1.00 74.33 ? 54  THR C CA  1 
ATOM   7818 C  C   . THR C 2 27  ? -54.273 11.637  64.458  1.00 74.56 ? 54  THR C C   1 
ATOM   7819 O  O   . THR C 2 27  ? -55.010 11.741  65.441  1.00 74.53 ? 54  THR C O   1 
ATOM   7820 C  CB  . THR C 2 27  ? -53.128 9.560   65.404  1.00 74.35 ? 54  THR C CB  1 
ATOM   7821 O  OG1 . THR C 2 27  ? -52.050 10.290  66.002  1.00 74.29 ? 54  THR C OG1 1 
ATOM   7822 C  CG2 . THR C 2 27  ? -52.664 8.134   65.094  1.00 74.14 ? 54  THR C CG2 1 
ATOM   7823 N  N   . CYS C 2 28  ? -54.017 12.651  63.627  1.00 74.84 ? 55  CYS C N   1 
ATOM   7824 C  CA  . CYS C 2 28  ? -54.482 14.022  63.871  1.00 75.10 ? 55  CYS C CA  1 
ATOM   7825 C  C   . CYS C 2 28  ? -54.961 14.730  62.600  1.00 75.07 ? 55  CYS C C   1 
ATOM   7826 O  O   . CYS C 2 28  ? -55.923 14.306  61.955  1.00 75.13 ? 55  CYS C O   1 
ATOM   7827 C  CB  . CYS C 2 28  ? -53.364 14.845  64.520  1.00 75.16 ? 55  CYS C CB  1 
ATOM   7828 S  SG  . CYS C 2 28  ? -51.855 14.976  63.506  1.00 76.04 ? 55  CYS C SG  1 
ATOM   7829 N  N   . THR C 2 44  ? -47.120 20.764  52.962  1.00 71.07 ? 71  THR C N   1 
ATOM   7830 C  CA  . THR C 2 44  ? -45.820 20.181  52.630  1.00 70.97 ? 71  THR C CA  1 
ATOM   7831 C  C   . THR C 2 44  ? -45.983 18.861  51.865  1.00 71.02 ? 71  THR C C   1 
ATOM   7832 O  O   . THR C 2 44  ? -47.061 18.256  51.881  1.00 70.99 ? 71  THR C O   1 
ATOM   7833 C  CB  . THR C 2 44  ? -44.952 19.952  53.897  1.00 70.97 ? 71  THR C CB  1 
ATOM   7834 O  OG1 . THR C 2 44  ? -45.457 18.834  54.640  1.00 70.71 ? 71  THR C OG1 1 
ATOM   7835 C  CG2 . THR C 2 44  ? -44.940 21.201  54.788  1.00 70.85 ? 71  THR C CG2 1 
ATOM   7836 N  N   . ASP C 2 45  ? -44.909 18.429  51.198  1.00 71.01 ? 72  ASP C N   1 
ATOM   7837 C  CA  . ASP C 2 45  ? -44.884 17.164  50.448  1.00 70.93 ? 72  ASP C CA  1 
ATOM   7838 C  C   . ASP C 2 45  ? -45.026 15.943  51.373  1.00 70.82 ? 72  ASP C C   1 
ATOM   7839 O  O   . ASP C 2 45  ? -45.613 14.932  50.986  1.00 70.71 ? 72  ASP C O   1 
ATOM   7840 C  CB  . ASP C 2 45  ? -43.598 17.048  49.609  1.00 70.90 ? 72  ASP C CB  1 
ATOM   7841 C  CG  . ASP C 2 45  ? -43.416 18.205  48.619  1.00 70.99 ? 72  ASP C CG  1 
ATOM   7842 O  OD1 . ASP C 2 45  ? -44.211 18.321  47.662  1.00 70.60 ? 72  ASP C OD1 1 
ATOM   7843 O  OD2 . ASP C 2 45  ? -42.455 18.988  48.783  1.00 70.96 ? 72  ASP C OD2 1 
ATOM   7844 N  N   . GLU C 2 46  ? -44.489 16.062  52.590  1.00 70.80 ? 73  GLU C N   1 
ATOM   7845 C  CA  . GLU C 2 46  ? -44.504 15.001  53.609  1.00 70.80 ? 73  GLU C CA  1 
ATOM   7846 C  C   . GLU C 2 46  ? -45.877 14.847  54.251  1.00 70.90 ? 73  GLU C C   1 
ATOM   7847 O  O   . GLU C 2 46  ? -46.263 13.747  54.658  1.00 70.82 ? 73  GLU C O   1 
ATOM   7848 C  CB  . GLU C 2 46  ? -43.460 15.282  54.701  1.00 70.70 ? 73  GLU C CB  1 
ATOM   7849 C  CG  . GLU C 2 46  ? -42.001 15.197  54.242  1.00 70.55 ? 73  GLU C CG  1 
ATOM   7850 C  CD  . GLU C 2 46  ? -41.605 16.304  53.263  1.00 70.44 ? 73  GLU C CD  1 
ATOM   7851 O  OE1 . GLU C 2 46  ? -41.823 17.497  53.574  1.00 70.09 ? 73  GLU C OE1 1 
ATOM   7852 O  OE2 . GLU C 2 46  ? -41.075 15.975  52.179  1.00 70.08 ? 73  GLU C OE2 1 
ATOM   7853 N  N   . GLU C 2 47  ? -46.592 15.966  54.355  1.00 71.19 ? 74  GLU C N   1 
ATOM   7854 C  CA  . GLU C 2 47  ? -47.977 15.995  54.828  1.00 71.40 ? 74  GLU C CA  1 
ATOM   7855 C  C   . GLU C 2 47  ? -48.878 15.232  53.851  1.00 71.41 ? 74  GLU C C   1 
ATOM   7856 O  O   . GLU C 2 47  ? -49.742 14.458  54.269  1.00 71.31 ? 74  GLU C O   1 
ATOM   7857 C  CB  . GLU C 2 47  ? -48.438 17.447  54.984  1.00 71.45 ? 74  GLU C CB  1 
ATOM   7858 C  CG  . GLU C 2 47  ? -49.692 17.648  55.829  1.00 71.98 ? 74  GLU C CG  1 
ATOM   7859 C  CD  . GLU C 2 47  ? -49.821 19.065  56.377  1.00 72.42 ? 74  GLU C CD  1 
ATOM   7860 O  OE1 . GLU C 2 47  ? -49.237 20.003  55.788  1.00 72.91 ? 74  GLU C OE1 1 
ATOM   7861 O  OE2 . GLU C 2 47  ? -50.512 19.241  57.403  1.00 72.23 ? 74  GLU C OE2 1 
ATOM   7862 N  N   . ASN C 2 48  ? -48.649 15.455  52.555  1.00 71.48 ? 75  ASN C N   1 
ATOM   7863 C  CA  . ASN C 2 48  ? -49.320 14.729  51.471  1.00 71.56 ? 75  ASN C CA  1 
ATOM   7864 C  C   . ASN C 2 48  ? -49.209 13.207  51.576  1.00 71.42 ? 75  ASN C C   1 
ATOM   7865 O  O   . ASN C 2 48  ? -50.173 12.492  51.292  1.00 71.37 ? 75  ASN C O   1 
ATOM   7866 C  CB  . ASN C 2 48  ? -48.784 15.190  50.105  1.00 71.65 ? 75  ASN C CB  1 
ATOM   7867 C  CG  . ASN C 2 48  ? -49.440 16.473  49.615  1.00 71.89 ? 75  ASN C CG  1 
ATOM   7868 O  OD1 . ASN C 2 48  ? -50.667 16.592  49.598  1.00 72.10 ? 75  ASN C OD1 1 
ATOM   7869 N  ND2 . ASN C 2 48  ? -48.621 17.433  49.195  1.00 71.80 ? 75  ASN C ND2 1 
ATOM   7870 N  N   . ASP C 2 49  ? -48.034 12.727  51.984  1.00 71.36 ? 76  ASP C N   1 
ATOM   7871 C  CA  . ASP C 2 49  ? -47.759 11.292  52.107  1.00 71.37 ? 76  ASP C CA  1 
ATOM   7872 C  C   . ASP C 2 49  ? -48.515 10.662  53.277  1.00 71.40 ? 76  ASP C C   1 
ATOM   7873 O  O   . ASP C 2 49  ? -49.110 9.588   53.135  1.00 71.29 ? 76  ASP C O   1 
ATOM   7874 C  CB  . ASP C 2 49  ? -46.252 11.036  52.244  1.00 71.33 ? 76  ASP C CB  1 
ATOM   7875 C  CG  . ASP C 2 49  ? -45.434 11.691  51.131  1.00 71.32 ? 76  ASP C CG  1 
ATOM   7876 O  OD1 . ASP C 2 49  ? -46.018 12.093  50.099  1.00 70.71 ? 76  ASP C OD1 1 
ATOM   7877 O  OD2 . ASP C 2 49  ? -44.196 11.804  51.294  1.00 71.34 ? 76  ASP C OD2 1 
ATOM   7878 N  N   . MET C 2 50  ? -48.496 11.344  54.423  1.00 71.49 ? 77  MET C N   1 
ATOM   7879 C  CA  . MET C 2 50  ? -49.235 10.912  55.616  1.00 71.60 ? 77  MET C CA  1 
ATOM   7880 C  C   . MET C 2 50  ? -50.756 10.922  55.400  1.00 71.76 ? 77  MET C C   1 
ATOM   7881 O  O   . MET C 2 50  ? -51.494 10.189  56.068  1.00 71.79 ? 77  MET C O   1 
ATOM   7882 C  CB  . MET C 2 50  ? -48.859 11.775  56.828  1.00 71.41 ? 77  MET C CB  1 
ATOM   7883 C  CG  . MET C 2 50  ? -47.385 11.713  57.251  1.00 71.31 ? 77  MET C CG  1 
ATOM   7884 S  SD  . MET C 2 50  ? -46.847 10.144  57.991  1.00 70.91 ? 77  MET C SD  1 
ATOM   7885 C  CE  . MET C 2 50  ? -46.398 9.217   56.530  1.00 70.41 ? 77  MET C CE  1 
ATOM   7886 N  N   . LEU C 2 51  ? -51.202 11.748  54.454  1.00 71.97 ? 78  LEU C N   1 
ATOM   7887 C  CA  . LEU C 2 51  ? -52.619 11.920  54.139  1.00 72.06 ? 78  LEU C CA  1 
ATOM   7888 C  C   . LEU C 2 51  ? -53.189 10.865  53.183  1.00 72.15 ? 78  LEU C C   1 
ATOM   7889 O  O   . LEU C 2 51  ? -54.340 10.451  53.342  1.00 72.22 ? 78  LEU C O   1 
ATOM   7890 C  CB  . LEU C 2 51  ? -52.878 13.334  53.601  1.00 72.09 ? 78  LEU C CB  1 
ATOM   7891 C  CG  . LEU C 2 51  ? -53.532 14.383  54.516  1.00 72.17 ? 78  LEU C CG  1 
ATOM   7892 C  CD1 . LEU C 2 51  ? -53.075 14.290  55.976  1.00 71.59 ? 78  LEU C CD1 1 
ATOM   7893 C  CD2 . LEU C 2 51  ? -53.324 15.797  53.955  1.00 72.04 ? 78  LEU C CD2 1 
ATOM   7894 N  N   . ASP C 2 52  ? -52.391 10.431  52.204  1.00 72.16 ? 79  ASP C N   1 
ATOM   7895 C  CA  . ASP C 2 52  ? -52.824 9.404   51.241  1.00 72.23 ? 79  ASP C CA  1 
ATOM   7896 C  C   . ASP C 2 52  ? -53.057 8.036   51.917  1.00 72.18 ? 79  ASP C C   1 
ATOM   7897 O  O   . ASP C 2 52  ? -53.339 7.024   51.254  1.00 71.98 ? 79  ASP C O   1 
ATOM   7898 C  CB  . ASP C 2 52  ? -51.837 9.308   50.063  1.00 72.25 ? 79  ASP C CB  1 
ATOM   7899 C  CG  . ASP C 2 52  ? -51.719 10.620  49.277  1.00 72.73 ? 79  ASP C CG  1 
ATOM   7900 O  OD1 . ASP C 2 52  ? -50.613 10.918  48.781  1.00 72.84 ? 79  ASP C OD1 1 
ATOM   7901 O  OD2 . ASP C 2 52  ? -52.723 11.362  49.157  1.00 73.01 ? 79  ASP C OD2 1 
ATOM   7902 N  N   . LEU C 2 53  ? -52.934 8.040   53.247  1.00 72.16 ? 80  LEU C N   1 
ATOM   7903 C  CA  . LEU C 2 53  ? -53.228 6.897   54.106  1.00 72.09 ? 80  LEU C CA  1 
ATOM   7904 C  C   . LEU C 2 53  ? -54.176 7.354   55.223  1.00 72.16 ? 80  LEU C C   1 
ATOM   7905 O  O   . LEU C 2 53  ? -53.735 7.711   56.324  1.00 72.24 ? 80  LEU C O   1 
ATOM   7906 C  CB  . LEU C 2 53  ? -51.936 6.307   54.693  1.00 71.96 ? 80  LEU C CB  1 
ATOM   7907 C  CG  . LEU C 2 53  ? -50.735 6.060   53.767  1.00 71.81 ? 80  LEU C CG  1 
ATOM   7908 C  CD1 . LEU C 2 53  ? -49.505 5.662   54.549  1.00 71.60 ? 80  LEU C CD1 1 
ATOM   7909 C  CD2 . LEU C 2 53  ? -51.030 5.031   52.693  1.00 71.52 ? 80  LEU C CD2 1 
ATOM   7910 N  N   . ALA C 2 54  ? -55.475 7.359   54.918  1.00 72.14 ? 81  ALA C N   1 
ATOM   7911 C  CA  . ALA C 2 54  ? -56.523 7.772   55.860  1.00 72.05 ? 81  ALA C CA  1 
ATOM   7912 C  C   . ALA C 2 54  ? -57.817 6.995   55.604  1.00 72.05 ? 81  ALA C C   1 
ATOM   7913 O  O   . ALA C 2 54  ? -58.845 7.230   56.245  1.00 71.97 ? 81  ALA C O   1 
ATOM   7914 C  CB  . ALA C 2 54  ? -56.771 9.278   55.761  1.00 71.95 ? 81  ALA C CB  1 
ATOM   7915 N  N   . LEU C 2 63  ? -52.853 17.368  58.317  1.00 88.13 ? 90  LEU C N   1 
ATOM   7916 C  CA  . LEU C 2 63  ? -52.826 16.866  59.688  1.00 88.10 ? 90  LEU C CA  1 
ATOM   7917 C  C   . LEU C 2 63  ? -53.053 17.969  60.714  1.00 88.01 ? 90  LEU C C   1 
ATOM   7918 O  O   . LEU C 2 63  ? -52.743 19.133  60.464  1.00 88.01 ? 90  LEU C O   1 
ATOM   7919 C  CB  . LEU C 2 63  ? -51.505 16.151  59.982  1.00 88.13 ? 90  LEU C CB  1 
ATOM   7920 C  CG  . LEU C 2 63  ? -51.236 14.870  59.195  1.00 88.23 ? 90  LEU C CG  1 
ATOM   7921 C  CD1 . LEU C 2 63  ? -50.225 15.125  58.094  1.00 88.15 ? 90  LEU C CD1 1 
ATOM   7922 C  CD2 . LEU C 2 63  ? -50.730 13.797  60.123  1.00 88.26 ? 90  LEU C CD2 1 
ATOM   7923 N  N   . GLY C 2 64  ? -53.582 17.584  61.873  1.00 87.96 ? 91  GLY C N   1 
ATOM   7924 C  CA  . GLY C 2 64  ? -53.907 18.521  62.947  1.00 87.86 ? 91  GLY C CA  1 
ATOM   7925 C  C   . GLY C 2 64  ? -52.739 19.246  63.603  1.00 87.83 ? 91  GLY C C   1 
ATOM   7926 O  O   . GLY C 2 64  ? -52.914 20.355  64.117  1.00 87.91 ? 91  GLY C O   1 
ATOM   7927 N  N   . CYS C 2 65  ? -51.553 18.633  63.597  1.00 87.70 ? 92  CYS C N   1 
ATOM   7928 C  CA  . CYS C 2 65  ? -50.379 19.222  64.266  1.00 87.52 ? 92  CYS C CA  1 
ATOM   7929 C  C   . CYS C 2 65  ? -49.515 20.102  63.351  1.00 87.32 ? 92  CYS C C   1 
ATOM   7930 O  O   . CYS C 2 65  ? -48.510 20.663  63.797  1.00 87.25 ? 92  CYS C O   1 
ATOM   7931 C  CB  . CYS C 2 65  ? -49.532 18.147  64.980  1.00 87.57 ? 92  CYS C CB  1 
ATOM   7932 S  SG  . CYS C 2 65  ? -48.358 17.183  63.955  1.00 87.56 ? 92  CYS C SG  1 
ATOM   7933 N  N   . GLN C 2 66  ? -49.922 20.230  62.086  1.00 87.12 ? 93  GLN C N   1 
ATOM   7934 C  CA  . GLN C 2 66  ? -49.206 21.053  61.102  1.00 86.84 ? 93  GLN C CA  1 
ATOM   7935 C  C   . GLN C 2 66  ? -50.130 22.100  60.473  1.00 86.74 ? 93  GLN C C   1 
ATOM   7936 O  O   . GLN C 2 66  ? -50.520 23.075  61.117  1.00 86.55 ? 93  GLN C O   1 
ATOM   7937 C  CB  . GLN C 2 66  ? -48.582 20.181  60.000  1.00 86.71 ? 93  GLN C CB  1 
ATOM   7938 C  CG  . GLN C 2 66  ? -47.688 19.028  60.488  1.00 86.32 ? 93  GLN C CG  1 
ATOM   7939 C  CD  . GLN C 2 66  ? -46.348 19.483  61.052  1.00 85.81 ? 93  GLN C CD  1 
ATOM   7940 O  OE1 . GLN C 2 66  ? -45.728 20.419  60.546  1.00 85.81 ? 93  GLN C OE1 1 
ATOM   7941 N  NE2 . GLN C 2 66  ? -45.889 18.807  62.100  1.00 85.29 ? 93  GLN C NE2 1 
ATOM   7942 N  N   . PHE D 2 16  ? 27.970  -9.805  2.046   1.00 71.71 ? 43  PHE D N   1 
ATOM   7943 C  CA  . PHE D 2 16  ? 27.307  -11.131 2.220   1.00 71.71 ? 43  PHE D CA  1 
ATOM   7944 C  C   . PHE D 2 16  ? 27.116  -11.469 3.701   1.00 71.76 ? 43  PHE D C   1 
ATOM   7945 O  O   . PHE D 2 16  ? 28.083  -11.497 4.468   1.00 71.75 ? 43  PHE D O   1 
ATOM   7946 C  CB  . PHE D 2 16  ? 28.113  -12.236 1.513   1.00 71.69 ? 43  PHE D CB  1 
ATOM   7947 C  CG  . PHE D 2 16  ? 27.394  -13.572 1.424   1.00 71.59 ? 43  PHE D CG  1 
ATOM   7948 C  CD1 . PHE D 2 16  ? 27.682  -14.599 2.328   1.00 70.92 ? 43  PHE D CD1 1 
ATOM   7949 C  CD2 . PHE D 2 16  ? 26.442  -13.806 0.424   1.00 71.10 ? 43  PHE D CD2 1 
ATOM   7950 C  CE1 . PHE D 2 16  ? 27.029  -15.832 2.248   1.00 70.52 ? 43  PHE D CE1 1 
ATOM   7951 C  CE2 . PHE D 2 16  ? 25.784  -15.035 0.335   1.00 70.82 ? 43  PHE D CE2 1 
ATOM   7952 C  CZ  . PHE D 2 16  ? 26.080  -16.050 1.252   1.00 70.73 ? 43  PHE D CZ  1 
ATOM   7953 N  N   . GLY D 2 17  ? 25.862  -11.714 4.087   1.00 71.74 ? 44  GLY D N   1 
ATOM   7954 C  CA  . GLY D 2 17  ? 25.513  -12.192 5.427   1.00 71.44 ? 44  GLY D CA  1 
ATOM   7955 C  C   . GLY D 2 17  ? 25.993  -11.315 6.563   1.00 71.30 ? 44  GLY D C   1 
ATOM   7956 O  O   . GLY D 2 17  ? 26.681  -11.788 7.476   1.00 71.31 ? 44  GLY D O   1 
ATOM   7957 N  N   . ALA D 2 18  ? 25.618  -10.039 6.510   1.00 71.13 ? 45  ALA D N   1 
ATOM   7958 C  CA  . ALA D 2 18  ? 26.108  -9.041  7.462   1.00 70.85 ? 45  ALA D CA  1 
ATOM   7959 C  C   . ALA D 2 18  ? 25.652  -9.281  8.911   1.00 70.63 ? 45  ALA D C   1 
ATOM   7960 O  O   . ALA D 2 18  ? 26.417  -9.032  9.849   1.00 70.66 ? 45  ALA D O   1 
ATOM   7961 C  CB  . ALA D 2 18  ? 25.745  -7.632  6.991   1.00 70.78 ? 45  ALA D CB  1 
ATOM   7962 N  N   . CYS D 2 19  ? 24.425  -9.782  9.082   1.00 70.35 ? 46  CYS D N   1 
ATOM   7963 C  CA  . CYS D 2 19  ? 23.877  -10.128 10.407  1.00 70.01 ? 46  CYS D CA  1 
ATOM   7964 C  C   . CYS D 2 19  ? 24.502  -11.409 10.970  1.00 69.94 ? 46  CYS D C   1 
ATOM   7965 O  O   . CYS D 2 19  ? 24.350  -11.722 12.159  1.00 69.58 ? 46  CYS D O   1 
ATOM   7966 C  CB  . CYS D 2 19  ? 22.353  -10.277 10.339  1.00 70.01 ? 46  CYS D CB  1 
ATOM   7967 S  SG  . CYS D 2 19  ? 21.760  -11.953 9.961   1.00 69.22 ? 46  CYS D SG  1 
ATOM   7968 N  N   . GLU D 2 20  ? 25.181  -12.136 10.078  1.00 70.01 ? 47  GLU D N   1 
ATOM   7969 C  CA  . GLU D 2 20  ? 25.958  -13.357 10.361  1.00 70.02 ? 47  GLU D CA  1 
ATOM   7970 C  C   . GLU D 2 20  ? 25.109  -14.612 10.669  1.00 69.87 ? 47  GLU D C   1 
ATOM   7971 O  O   . GLU D 2 20  ? 25.333  -15.311 11.661  1.00 69.84 ? 47  GLU D O   1 
ATOM   7972 C  CB  . GLU D 2 20  ? 27.087  -13.105 11.390  1.00 70.09 ? 47  GLU D CB  1 
ATOM   7973 C  CG  . GLU D 2 20  ? 28.038  -11.949 11.008  1.00 70.45 ? 47  GLU D CG  1 
ATOM   7974 C  CD  . GLU D 2 20  ? 29.444  -12.110 11.574  1.00 71.21 ? 47  GLU D CD  1 
ATOM   7975 O  OE1 . GLU D 2 20  ? 30.254  -12.852 10.974  1.00 71.70 ? 47  GLU D OE1 1 
ATOM   7976 O  OE2 . GLU D 2 20  ? 29.746  -11.481 12.608  1.00 71.13 ? 47  GLU D OE2 1 
ATOM   7977 N  N   . GLY D 2 21  ? 24.142  -14.879 9.791   1.00 69.65 ? 48  GLY D N   1 
ATOM   7978 C  CA  . GLY D 2 21  ? 23.350  -16.110 9.820   1.00 69.61 ? 48  GLY D CA  1 
ATOM   7979 C  C   . GLY D 2 21  ? 22.302  -16.233 10.912  1.00 69.58 ? 48  GLY D C   1 
ATOM   7980 O  O   . GLY D 2 21  ? 22.002  -17.345 11.359  1.00 69.57 ? 48  GLY D O   1 
ATOM   7981 N  N   . THR D 2 22  ? 21.737  -15.100 11.334  1.00 69.56 ? 49  THR D N   1 
ATOM   7982 C  CA  . THR D 2 22  ? 20.711  -15.068 12.392  1.00 69.33 ? 49  THR D CA  1 
ATOM   7983 C  C   . THR D 2 22  ? 19.312  -14.730 11.858  1.00 69.38 ? 49  THR D C   1 
ATOM   7984 O  O   . THR D 2 22  ? 18.398  -14.453 12.639  1.00 69.40 ? 49  THR D O   1 
ATOM   7985 C  CB  . THR D 2 22  ? 21.078  -14.075 13.534  1.00 69.25 ? 49  THR D CB  1 
ATOM   7986 O  OG1 . THR D 2 22  ? 21.446  -12.804 12.977  1.00 69.23 ? 49  THR D OG1 1 
ATOM   7987 C  CG2 . THR D 2 22  ? 22.225  -14.612 14.391  1.00 68.76 ? 49  THR D CG2 1 
ATOM   7988 N  N   . LEU D 2 23  ? 19.157  -14.774 10.533  1.00 69.41 ? 50  LEU D N   1 
ATOM   7989 C  CA  . LEU D 2 23  ? 17.921  -14.378 9.834   1.00 69.67 ? 50  LEU D CA  1 
ATOM   7990 C  C   . LEU D 2 23  ? 17.467  -12.945 10.191  1.00 69.84 ? 50  LEU D C   1 
ATOM   7991 O  O   . LEU D 2 23  ? 16.344  -12.730 10.657  1.00 69.87 ? 50  LEU D O   1 
ATOM   7992 C  CB  . LEU D 2 23  ? 16.801  -15.419 10.044  1.00 69.64 ? 50  LEU D CB  1 
ATOM   7993 C  CG  . LEU D 2 23  ? 15.634  -15.516 9.046   1.00 69.61 ? 50  LEU D CG  1 
ATOM   7994 C  CD1 . LEU D 2 23  ? 16.105  -15.931 7.667   1.00 69.59 ? 50  LEU D CD1 1 
ATOM   7995 C  CD2 . LEU D 2 23  ? 14.563  -16.483 9.540   1.00 69.67 ? 50  LEU D CD2 1 
ATOM   7996 N  N   . ALA D 2 24  ? 18.357  -11.979 9.957   1.00 70.06 ? 51  ALA D N   1 
ATOM   7997 C  CA  . ALA D 2 24  ? 18.136  -10.571 10.316  1.00 70.36 ? 51  ALA D CA  1 
ATOM   7998 C  C   . ALA D 2 24  ? 18.654  -9.587  9.249   1.00 70.60 ? 51  ALA D C   1 
ATOM   7999 O  O   . ALA D 2 24  ? 19.001  -8.441  9.556   1.00 70.52 ? 51  ALA D O   1 
ATOM   8000 C  CB  . ALA D 2 24  ? 18.758  -10.272 11.678  1.00 70.36 ? 51  ALA D CB  1 
ATOM   8001 N  N   . CYS D 2 25  ? 18.705  -10.067 8.004   1.00 70.98 ? 52  CYS D N   1 
ATOM   8002 C  CA  . CYS D 2 25  ? 19.027  -9.275  6.803   1.00 71.20 ? 52  CYS D CA  1 
ATOM   8003 C  C   . CYS D 2 25  ? 18.730  -10.116 5.547   1.00 71.62 ? 52  CYS D C   1 
ATOM   8004 O  O   . CYS D 2 25  ? 18.388  -11.296 5.651   1.00 71.66 ? 52  CYS D O   1 
ATOM   8005 C  CB  . CYS D 2 25  ? 20.485  -8.768  6.812   1.00 71.09 ? 52  CYS D CB  1 
ATOM   8006 S  SG  . CYS D 2 25  ? 21.811  -10.010 6.640   1.00 69.77 ? 52  CYS D SG  1 
ATOM   8007 N  N   . SER D 2 26  ? 18.840  -9.511  4.367   1.00 72.02 ? 53  SER D N   1 
ATOM   8008 C  CA  . SER D 2 26  ? 18.641  -10.254 3.117   1.00 72.29 ? 53  SER D CA  1 
ATOM   8009 C  C   . SER D 2 26  ? 19.849  -10.146 2.177   1.00 72.57 ? 53  SER D C   1 
ATOM   8010 O  O   . SER D 2 26  ? 19.694  -10.042 0.955   1.00 72.59 ? 53  SER D O   1 
ATOM   8011 C  CB  . SER D 2 26  ? 17.338  -9.829  2.425   1.00 72.25 ? 53  SER D CB  1 
ATOM   8012 O  OG  . SER D 2 26  ? 17.176  -8.422  2.430   1.00 71.91 ? 53  SER D OG  1 
ATOM   8013 N  N   . THR D 2 27  ? 21.047  -10.187 2.767   1.00 72.85 ? 54  THR D N   1 
ATOM   8014 C  CA  . THR D 2 27  ? 22.311  -10.042 2.029   1.00 72.97 ? 54  THR D CA  1 
ATOM   8015 C  C   . THR D 2 27  ? 22.921  -11.393 1.631   1.00 73.14 ? 54  THR D C   1 
ATOM   8016 O  O   . THR D 2 27  ? 24.059  -11.450 1.159   1.00 73.06 ? 54  THR D O   1 
ATOM   8017 C  CB  . THR D 2 27  ? 23.356  -9.193  2.820   1.00 72.93 ? 54  THR D CB  1 
ATOM   8018 O  OG1 . THR D 2 27  ? 23.569  -9.761  4.119   1.00 72.83 ? 54  THR D OG1 1 
ATOM   8019 C  CG2 . THR D 2 27  ? 22.891  -7.743  2.972   1.00 72.79 ? 54  THR D CG2 1 
ATOM   8020 N  N   . CYS D 2 28  ? 22.154  -12.469 1.814   1.00 73.41 ? 55  CYS D N   1 
ATOM   8021 C  CA  . CYS D 2 28  ? 22.589  -13.823 1.444   1.00 73.71 ? 55  CYS D CA  1 
ATOM   8022 C  C   . CYS D 2 28  ? 21.641  -14.499 0.451   1.00 73.64 ? 55  CYS D C   1 
ATOM   8023 O  O   . CYS D 2 28  ? 21.023  -13.841 -0.388  1.00 73.72 ? 55  CYS D O   1 
ATOM   8024 C  CB  . CYS D 2 28  ? 22.757  -14.699 2.691   1.00 73.75 ? 55  CYS D CB  1 
ATOM   8025 S  SG  . CYS D 2 28  ? 21.214  -15.045 3.592   1.00 74.58 ? 55  CYS D SG  1 
ATOM   8026 N  N   . THR D 2 44  ? 9.909   -20.705 5.804   1.00 79.04 ? 71  THR D N   1 
ATOM   8027 C  CA  . THR D 2 44  ? 9.265   -20.060 6.949   1.00 78.93 ? 71  THR D CA  1 
ATOM   8028 C  C   . THR D 2 44  ? 8.626   -18.720 6.563   1.00 79.00 ? 71  THR D C   1 
ATOM   8029 O  O   . THR D 2 44  ? 9.059   -18.071 5.603   1.00 78.92 ? 71  THR D O   1 
ATOM   8030 C  CB  . THR D 2 44  ? 10.260  -19.843 8.121   1.00 78.91 ? 71  THR D CB  1 
ATOM   8031 O  OG1 . THR D 2 44  ? 11.358  -19.031 7.683   1.00 78.65 ? 71  THR D OG1 1 
ATOM   8032 C  CG2 . THR D 2 44  ? 10.785  -21.179 8.647   1.00 78.71 ? 71  THR D CG2 1 
ATOM   8033 N  N   . ASP D 2 45  ? 7.599   -18.319 7.319   1.00 79.04 ? 72  ASP D N   1 
ATOM   8034 C  CA  . ASP D 2 45  ? 6.918   -17.025 7.141   1.00 79.01 ? 72  ASP D CA  1 
ATOM   8035 C  C   . ASP D 2 45  ? 7.878   -15.838 7.303   1.00 78.99 ? 72  ASP D C   1 
ATOM   8036 O  O   . ASP D 2 45  ? 7.700   -14.799 6.667   1.00 79.00 ? 72  ASP D O   1 
ATOM   8037 C  CB  . ASP D 2 45  ? 5.751   -16.875 8.136   1.00 78.99 ? 72  ASP D CB  1 
ATOM   8038 C  CG  . ASP D 2 45  ? 4.780   -18.054 8.106   1.00 78.86 ? 72  ASP D CG  1 
ATOM   8039 O  OD1 . ASP D 2 45  ? 3.861   -18.061 7.260   1.00 78.28 ? 72  ASP D OD1 1 
ATOM   8040 O  OD2 . ASP D 2 45  ? 4.922   -18.965 8.951   1.00 78.83 ? 72  ASP D OD2 1 
ATOM   8041 N  N   . GLU D 2 46  ? 8.885   -16.012 8.159   1.00 79.04 ? 73  GLU D N   1 
ATOM   8042 C  CA  . GLU D 2 46  ? 9.874   -14.977 8.483   1.00 79.09 ? 73  GLU D CA  1 
ATOM   8043 C  C   . GLU D 2 46  ? 10.849  -14.741 7.336   1.00 79.25 ? 73  GLU D C   1 
ATOM   8044 O  O   . GLU D 2 46  ? 11.253  -13.602 7.077   1.00 79.22 ? 73  GLU D O   1 
ATOM   8045 C  CB  . GLU D 2 46  ? 10.651  -15.358 9.751   1.00 79.00 ? 73  GLU D CB  1 
ATOM   8046 C  CG  . GLU D 2 46  ? 9.870   -15.214 11.057  1.00 79.03 ? 73  GLU D CG  1 
ATOM   8047 C  CD  . GLU D 2 46  ? 8.648   -16.130 11.150  1.00 79.24 ? 73  GLU D CD  1 
ATOM   8048 O  OE1 . GLU D 2 46  ? 8.811   -17.373 11.100  1.00 78.88 ? 73  GLU D OE1 1 
ATOM   8049 O  OE2 . GLU D 2 46  ? 7.521   -15.598 11.277  1.00 78.94 ? 73  GLU D OE2 1 
ATOM   8050 N  N   . GLU D 2 47  ? 11.228  -15.825 6.662   1.00 79.41 ? 74  GLU D N   1 
ATOM   8051 C  CA  . GLU D 2 47  ? 12.096  -15.755 5.488   1.00 79.51 ? 74  GLU D CA  1 
ATOM   8052 C  C   . GLU D 2 47  ? 11.388  -15.072 4.317   1.00 79.50 ? 74  GLU D C   1 
ATOM   8053 O  O   . GLU D 2 47  ? 12.029  -14.408 3.501   1.00 79.44 ? 74  GLU D O   1 
ATOM   8054 C  CB  . GLU D 2 47  ? 12.563  -17.156 5.089   1.00 79.53 ? 74  GLU D CB  1 
ATOM   8055 C  CG  . GLU D 2 47  ? 13.767  -17.174 4.156   1.00 79.60 ? 74  GLU D CG  1 
ATOM   8056 C  CD  . GLU D 2 47  ? 14.364  -18.558 3.994   1.00 79.72 ? 74  GLU D CD  1 
ATOM   8057 O  OE1 . GLU D 2 47  ? 14.481  -19.285 5.004   1.00 79.89 ? 74  GLU D OE1 1 
ATOM   8058 O  OE2 . GLU D 2 47  ? 14.723  -18.916 2.853   1.00 79.64 ? 74  GLU D OE2 1 
ATOM   8059 N  N   . ASN D 2 48  ? 10.066  -15.240 4.257   1.00 79.63 ? 75  ASN D N   1 
ATOM   8060 C  CA  . ASN D 2 48  ? 9.222   -14.619 3.235   1.00 79.77 ? 75  ASN D CA  1 
ATOM   8061 C  C   . ASN D 2 48  ? 9.222   -13.092 3.291   1.00 79.72 ? 75  ASN D C   1 
ATOM   8062 O  O   . ASN D 2 48  ? 9.239   -12.430 2.251   1.00 79.65 ? 75  ASN D O   1 
ATOM   8063 C  CB  . ASN D 2 48  ? 7.781   -15.140 3.340   1.00 79.90 ? 75  ASN D CB  1 
ATOM   8064 C  CG  . ASN D 2 48  ? 7.673   -16.639 3.094   1.00 80.21 ? 75  ASN D CG  1 
ATOM   8065 O  OD1 . ASN D 2 48  ? 8.509   -17.239 2.412   1.00 80.69 ? 75  ASN D OD1 1 
ATOM   8066 N  ND2 . ASN D 2 48  ? 6.632   -17.250 3.649   1.00 80.19 ? 75  ASN D ND2 1 
ATOM   8067 N  N   . ASP D 2 49  ? 9.200   -12.544 4.505   1.00 79.71 ? 76  ASP D N   1 
ATOM   8068 C  CA  . ASP D 2 49  ? 9.202   -11.093 4.712   1.00 79.81 ? 76  ASP D CA  1 
ATOM   8069 C  C   . ASP D 2 49  ? 10.572  -10.488 4.400   1.00 79.82 ? 76  ASP D C   1 
ATOM   8070 O  O   . ASP D 2 49  ? 10.662  -9.379  3.866   1.00 79.73 ? 76  ASP D O   1 
ATOM   8071 C  CB  . ASP D 2 49  ? 8.778   -10.750 6.145   1.00 79.89 ? 76  ASP D CB  1 
ATOM   8072 C  CG  . ASP D 2 49  ? 7.530   -11.508 6.592   1.00 80.02 ? 76  ASP D CG  1 
ATOM   8073 O  OD1 . ASP D 2 49  ? 6.750   -11.962 5.725   1.00 79.80 ? 76  ASP D OD1 1 
ATOM   8074 O  OD2 . ASP D 2 49  ? 7.334   -11.651 7.820   1.00 80.40 ? 76  ASP D OD2 1 
ATOM   8075 N  N   . MET D 2 50  ? 11.628  -11.229 4.737   1.00 79.88 ? 77  MET D N   1 
ATOM   8076 C  CA  . MET D 2 50  ? 13.002  -10.872 4.369   1.00 79.94 ? 77  MET D CA  1 
ATOM   8077 C  C   . MET D 2 50  ? 13.206  -10.904 2.854   1.00 80.10 ? 77  MET D C   1 
ATOM   8078 O  O   . MET D 2 50  ? 14.058  -10.190 2.317   1.00 80.13 ? 77  MET D O   1 
ATOM   8079 C  CB  . MET D 2 50  ? 14.003  -11.827 5.032   1.00 79.79 ? 77  MET D CB  1 
ATOM   8080 C  CG  . MET D 2 50  ? 14.216  -11.628 6.530   1.00 79.50 ? 77  MET D CG  1 
ATOM   8081 S  SD  . MET D 2 50  ? 15.094  -10.110 6.975   1.00 78.60 ? 77  MET D SD  1 
ATOM   8082 C  CE  . MET D 2 50  ? 13.726  -9.005  7.308   1.00 78.36 ? 77  MET D CE  1 
ATOM   8083 N  N   . LEU D 2 51  ? 12.406  -11.731 2.181   1.00 80.23 ? 78  LEU D N   1 
ATOM   8084 C  CA  . LEU D 2 51  ? 12.531  -11.984 0.750   1.00 80.30 ? 78  LEU D CA  1 
ATOM   8085 C  C   . LEU D 2 51  ? 11.851  -10.910 -0.114  1.00 80.34 ? 78  LEU D C   1 
ATOM   8086 O  O   . LEU D 2 51  ? 12.333  -10.604 -1.209  1.00 80.42 ? 78  LEU D O   1 
ATOM   8087 C  CB  . LEU D 2 51  ? 11.976  -13.378 0.426   1.00 80.38 ? 78  LEU D CB  1 
ATOM   8088 C  CG  . LEU D 2 51  ? 12.810  -14.374 -0.393  1.00 80.61 ? 78  LEU D CG  1 
ATOM   8089 C  CD1 . LEU D 2 51  ? 14.120  -14.731 0.313   1.00 80.41 ? 78  LEU D CD1 1 
ATOM   8090 C  CD2 . LEU D 2 51  ? 11.996  -15.639 -0.691  1.00 80.25 ? 78  LEU D CD2 1 
ATOM   8091 N  N   . ASP D 2 52  ? 10.748  -10.339 0.381   1.00 80.34 ? 79  ASP D N   1 
ATOM   8092 C  CA  . ASP D 2 52  ? 10.001  -9.281  -0.331  1.00 80.41 ? 79  ASP D CA  1 
ATOM   8093 C  C   . ASP D 2 52  ? 10.777  -7.955  -0.413  1.00 80.43 ? 79  ASP D C   1 
ATOM   8094 O  O   . ASP D 2 52  ? 10.352  -7.008  -1.085  1.00 80.26 ? 79  ASP D O   1 
ATOM   8095 C  CB  . ASP D 2 52  ? 8.619   -9.048  0.312   1.00 80.46 ? 79  ASP D CB  1 
ATOM   8096 C  CG  . ASP D 2 52  ? 7.651   -10.221 0.108   1.00 80.52 ? 79  ASP D CG  1 
ATOM   8097 O  OD1 . ASP D 2 52  ? 6.753   -10.397 0.958   1.00 80.22 ? 79  ASP D OD1 1 
ATOM   8098 O  OD2 . ASP D 2 52  ? 7.774   -10.962 -0.893  1.00 80.44 ? 79  ASP D OD2 1 
ATOM   8099 N  N   . LEU D 2 53  ? 11.906  -7.904  0.294   1.00 80.54 ? 80  LEU D N   1 
ATOM   8100 C  CA  . LEU D 2 53  ? 12.820  -6.769  0.267   1.00 80.66 ? 80  LEU D CA  1 
ATOM   8101 C  C   . LEU D 2 53  ? 14.231  -7.278  -0.060  1.00 80.82 ? 80  LEU D C   1 
ATOM   8102 O  O   . LEU D 2 53  ? 15.172  -7.072  0.715   1.00 81.04 ? 80  LEU D O   1 
ATOM   8103 C  CB  . LEU D 2 53  ? 12.816  -6.028  1.616   1.00 80.50 ? 80  LEU D CB  1 
ATOM   8104 C  CG  . LEU D 2 53  ? 11.525  -5.842  2.423   1.00 80.46 ? 80  LEU D CG  1 
ATOM   8105 C  CD1 . LEU D 2 53  ? 11.823  -5.506  3.877   1.00 80.17 ? 80  LEU D CD1 1 
ATOM   8106 C  CD2 . LEU D 2 53  ? 10.619  -4.797  1.809   1.00 80.16 ? 80  LEU D CD2 1 
ATOM   8107 N  N   . ALA D 2 54  ? 14.368  -7.940  -1.212  1.00 80.95 ? 81  ALA D N   1 
ATOM   8108 C  CA  . ALA D 2 54  ? 15.629  -8.572  -1.622  1.00 80.96 ? 81  ALA D CA  1 
ATOM   8109 C  C   . ALA D 2 54  ? 16.769  -7.568  -1.839  1.00 80.96 ? 81  ALA D C   1 
ATOM   8110 O  O   . ALA D 2 54  ? 16.691  -6.689  -2.703  1.00 81.02 ? 81  ALA D O   1 
ATOM   8111 C  CB  . ALA D 2 54  ? 15.410  -9.425  -2.879  1.00 81.02 ? 81  ALA D CB  1 
ATOM   8112 N  N   . LEU D 2 63  ? 16.764  -17.757 1.410   1.00 84.20 ? 90  LEU D N   1 
ATOM   8113 C  CA  . LEU D 2 63  ? 17.961  -17.029 1.811   1.00 84.20 ? 90  LEU D CA  1 
ATOM   8114 C  C   . LEU D 2 63  ? 19.138  -17.972 2.005   1.00 84.13 ? 90  LEU D C   1 
ATOM   8115 O  O   . LEU D 2 63  ? 18.968  -19.112 2.435   1.00 84.06 ? 90  LEU D O   1 
ATOM   8116 C  CB  . LEU D 2 63  ? 17.704  -16.218 3.088   1.00 84.25 ? 90  LEU D CB  1 
ATOM   8117 C  CG  . LEU D 2 63  ? 16.820  -14.969 2.974   1.00 84.26 ? 90  LEU D CG  1 
ATOM   8118 C  CD1 . LEU D 2 63  ? 16.430  -14.475 4.351   1.00 84.37 ? 90  LEU D CD1 1 
ATOM   8119 C  CD2 . LEU D 2 63  ? 17.503  -13.853 2.186   1.00 84.31 ? 90  LEU D CD2 1 
ATOM   8120 N  N   . GLY D 2 64  ? 20.332  -17.473 1.700   1.00 84.19 ? 91  GLY D N   1 
ATOM   8121 C  CA  . GLY D 2 64  ? 21.555  -18.278 1.687   1.00 84.27 ? 91  GLY D CA  1 
ATOM   8122 C  C   . GLY D 2 64  ? 21.969  -19.011 2.956   1.00 84.26 ? 91  GLY D C   1 
ATOM   8123 O  O   . GLY D 2 64  ? 22.818  -19.904 2.898   1.00 84.30 ? 91  GLY D O   1 
ATOM   8124 N  N   . CYS D 2 65  ? 21.386  -18.648 4.098   1.00 84.22 ? 92  CYS D N   1 
ATOM   8125 C  CA  . CYS D 2 65  ? 21.774  -19.263 5.375   1.00 84.15 ? 92  CYS D CA  1 
ATOM   8126 C  C   . CYS D 2 65  ? 20.706  -20.181 5.995   1.00 84.02 ? 92  CYS D C   1 
ATOM   8127 O  O   . CYS D 2 65  ? 20.810  -20.550 7.170   1.00 84.01 ? 92  CYS D O   1 
ATOM   8128 C  CB  . CYS D 2 65  ? 22.254  -18.197 6.382   1.00 84.22 ? 92  CYS D CB  1 
ATOM   8129 S  SG  . CYS D 2 65  ? 21.003  -17.005 6.995   1.00 84.38 ? 92  CYS D SG  1 
ATOM   8130 N  N   . GLN D 2 66  ? 19.702  -20.563 5.201   1.00 83.84 ? 93  GLN D N   1 
ATOM   8131 C  CA  . GLN D 2 66  ? 18.587  -21.393 5.689   1.00 83.61 ? 93  GLN D CA  1 
ATOM   8132 C  C   . GLN D 2 66  ? 18.306  -22.608 4.799   1.00 83.54 ? 93  GLN D C   1 
ATOM   8133 O  O   . GLN D 2 66  ? 19.201  -23.145 4.141   1.00 83.48 ? 93  GLN D O   1 
ATOM   8134 C  CB  . GLN D 2 66  ? 17.303  -20.560 5.838   1.00 83.52 ? 93  GLN D CB  1 
ATOM   8135 C  CG  . GLN D 2 66  ? 17.447  -19.236 6.605   1.00 82.85 ? 93  GLN D CG  1 
ATOM   8136 C  CD  . GLN D 2 66  ? 17.511  -19.409 8.114   1.00 82.02 ? 93  GLN D CD  1 
ATOM   8137 O  OE1 . GLN D 2 66  ? 16.655  -20.058 8.717   1.00 81.99 ? 93  GLN D OE1 1 
ATOM   8138 N  NE2 . GLN D 2 66  ? 18.520  -18.812 8.732   1.00 81.37 ? 93  GLN D NE2 1 
HETATM 8139 C  CHA . HEM E 3 .   ? -37.806 0.593   60.036  1.00 17.79 ? 601 HEM A CHA 1 
HETATM 8140 C  CHB . HEM E 3 .   ? -37.487 0.851   55.153  1.00 18.00 ? 601 HEM A CHB 1 
HETATM 8141 C  CHC . HEM E 3 .   ? -33.664 3.716   55.656  1.00 18.56 ? 601 HEM A CHC 1 
HETATM 8142 C  CHD . HEM E 3 .   ? -33.505 2.880   60.443  1.00 18.92 ? 601 HEM A CHD 1 
HETATM 8143 C  C1A . HEM E 3 .   ? -38.042 0.450   58.676  1.00 18.42 ? 601 HEM A C1A 1 
HETATM 8144 C  C2A . HEM E 3 .   ? -39.166 -0.272  58.090  1.00 18.36 ? 601 HEM A C2A 1 
HETATM 8145 C  C3A . HEM E 3 .   ? -39.080 -0.197  56.766  1.00 17.89 ? 601 HEM A C3A 1 
HETATM 8146 C  C4A . HEM E 3 .   ? -37.901 0.573   56.443  1.00 18.42 ? 601 HEM A C4A 1 
HETATM 8147 C  CMA . HEM E 3 .   ? -40.044 -0.820  55.740  1.00 16.71 ? 601 HEM A CMA 1 
HETATM 8148 C  CAA . HEM E 3 .   ? -40.280 -0.989  58.882  1.00 18.94 ? 601 HEM A CAA 1 
HETATM 8149 C  CBA . HEM E 3 .   ? -41.406 0.010   59.076  1.00 19.53 ? 601 HEM A CBA 1 
HETATM 8150 C  CGA . HEM E 3 .   ? -42.637 -0.636  59.658  1.00 20.29 ? 601 HEM A CGA 1 
HETATM 8151 O  O1A . HEM E 3 .   ? -42.518 -1.717  60.299  1.00 22.11 ? 601 HEM A O1A 1 
HETATM 8152 O  O2A . HEM E 3 .   ? -43.738 -0.052  59.484  1.00 18.30 ? 601 HEM A O2A 1 
HETATM 8153 C  C1B . HEM E 3 .   ? -36.449 1.683   54.829  1.00 17.97 ? 601 HEM A C1B 1 
HETATM 8154 C  C2B . HEM E 3 .   ? -36.074 2.164   53.513  1.00 18.08 ? 601 HEM A C2B 1 
HETATM 8155 C  C3B . HEM E 3 .   ? -35.002 2.968   53.667  1.00 18.14 ? 601 HEM A C3B 1 
HETATM 8156 C  C4B . HEM E 3 .   ? -34.686 3.007   55.079  1.00 18.13 ? 601 HEM A C4B 1 
HETATM 8157 C  CMB . HEM E 3 .   ? -36.833 1.800   52.212  1.00 17.79 ? 601 HEM A CMB 1 
HETATM 8158 C  CAB . HEM E 3 .   ? -34.195 3.760   52.608  1.00 17.39 ? 601 HEM A CAB 1 
HETATM 8159 C  CBB . HEM E 3 .   ? -34.515 3.728   51.312  1.00 18.55 ? 601 HEM A CBB 1 
HETATM 8160 C  C1C . HEM E 3 .   ? -33.306 3.776   56.983  1.00 18.25 ? 601 HEM A C1C 1 
HETATM 8161 C  C2C . HEM E 3 .   ? -32.248 4.598   57.524  1.00 17.70 ? 601 HEM A C2C 1 
HETATM 8162 C  C3C . HEM E 3 .   ? -32.196 4.368   58.835  1.00 17.33 ? 601 HEM A C3C 1 
HETATM 8163 C  C4C . HEM E 3 .   ? -33.216 3.401   59.188  1.00 17.75 ? 601 HEM A C4C 1 
HETATM 8164 C  CMC . HEM E 3 .   ? -31.361 5.576   56.706  1.00 16.51 ? 601 HEM A CMC 1 
HETATM 8165 C  CAC . HEM E 3 .   ? -31.223 5.063   59.801  1.00 20.17 ? 601 HEM A CAC 1 
HETATM 8166 C  CBC . HEM E 3 .   ? -31.700 6.024   60.606  1.00 20.82 ? 601 HEM A CBC 1 
HETATM 8167 C  C1D . HEM E 3 .   ? -34.650 2.184   60.828  1.00 18.70 ? 601 HEM A C1D 1 
HETATM 8168 C  C2D . HEM E 3 .   ? -35.010 1.767   62.174  1.00 19.26 ? 601 HEM A C2D 1 
HETATM 8169 C  C3D . HEM E 3 .   ? -36.351 1.064   62.043  1.00 19.52 ? 601 HEM A C3D 1 
HETATM 8170 C  C4D . HEM E 3 .   ? -36.678 1.104   60.634  1.00 18.42 ? 601 HEM A C4D 1 
HETATM 8171 C  CMD . HEM E 3 .   ? -34.257 1.968   63.506  1.00 18.67 ? 601 HEM A CMD 1 
HETATM 8172 C  CAD . HEM E 3 .   ? -37.148 0.464   63.218  1.00 21.75 ? 601 HEM A CAD 1 
HETATM 8173 C  CBD . HEM E 3 .   ? -37.965 1.622   63.793  1.00 23.26 ? 601 HEM A CBD 1 
HETATM 8174 C  CGD . HEM E 3 .   ? -38.888 1.212   64.918  1.00 24.77 ? 601 HEM A CGD 1 
HETATM 8175 O  O1D . HEM E 3 .   ? -39.416 2.122   65.608  1.00 25.64 ? 601 HEM A O1D 1 
HETATM 8176 O  O2D . HEM E 3 .   ? -39.124 -0.004  65.134  1.00 26.63 ? 601 HEM A O2D 1 
HETATM 8177 N  NA  . HEM E 3 .   ? -37.303 0.971   57.635  1.00 17.12 ? 601 HEM A NA  1 
HETATM 8178 N  NB  . HEM E 3 .   ? -35.587 2.222   55.752  1.00 18.26 ? 601 HEM A NB  1 
HETATM 8179 N  NC  . HEM E 3 .   ? -33.880 3.075   58.022  1.00 18.02 ? 601 HEM A NC  1 
HETATM 8180 N  ND  . HEM E 3 .   ? -35.670 1.778   59.969  1.00 18.30 ? 601 HEM A ND  1 
HETATM 8181 FE FE  . HEM E 3 .   ? -35.664 2.046   57.833  1.00 18.95 ? 601 HEM A FE  1 
HETATM 8182 C  C1  . 2DC F 4 .   ? -36.962 -9.184  56.326  1.00 17.16 ? 602 2DC A C1  1 
HETATM 8183 O  O1  . 2DC F 4 .   ? -39.269 -12.119 56.837  1.00 20.23 ? 602 2DC A O1  1 
HETATM 8184 C  C2  . 2DC F 4 .   ? -37.800 -10.408 55.969  1.00 18.08 ? 602 2DC A C2  1 
HETATM 8185 O  O2  . 2DC F 4 .   ? -34.896 -1.149  57.447  1.00 18.33 ? 602 2DC A O2  1 
HETATM 8186 C  C3  . 2DC F 4 .   ? -38.528 -10.944 57.193  1.00 18.96 ? 602 2DC A C3  1 
HETATM 8187 O  O3  . 2DC F 4 .   ? -32.917 -0.174  58.646  1.00 21.48 ? 602 2DC A O3  1 
HETATM 8188 C  C4  . 2DC F 4 .   ? -39.476 -9.871  57.722  1.00 18.00 ? 602 2DC A C4  1 
HETATM 8189 C  C5  . 2DC F 4 .   ? -38.737 -8.564  57.940  1.00 17.49 ? 602 2DC A C5  1 
HETATM 8190 C  C6  . 2DC F 4 .   ? -38.957 -7.910  59.099  1.00 17.90 ? 602 2DC A C6  1 
HETATM 8191 C  C7  . 2DC F 4 .   ? -38.262 -6.635  59.516  1.00 17.48 ? 602 2DC A C7  1 
HETATM 8192 C  C8  . 2DC F 4 .   ? -37.548 -5.955  58.347  1.00 16.92 ? 602 2DC A C8  1 
HETATM 8193 C  C9  . 2DC F 4 .   ? -36.869 -6.970  57.412  1.00 16.56 ? 602 2DC A C9  1 
HETATM 8194 C  C10 . 2DC F 4 .   ? -37.823 -8.034  56.856  1.00 17.72 ? 602 2DC A C10 1 
HETATM 8195 C  C11 . 2DC F 4 .   ? -36.076 -6.265  56.296  1.00 14.23 ? 602 2DC A C11 1 
HETATM 8196 C  C12 . 2DC F 4 .   ? -35.093 -5.236  56.863  1.00 15.30 ? 602 2DC A C12 1 
HETATM 8197 C  C13 . 2DC F 4 .   ? -35.808 -4.198  57.731  1.00 15.75 ? 602 2DC A C13 1 
HETATM 8198 C  C14 . 2DC F 4 .   ? -36.497 -4.965  58.839  1.00 15.57 ? 602 2DC A C14 1 
HETATM 8199 C  C15 . 2DC F 4 .   ? -36.929 -3.906  59.844  1.00 17.68 ? 602 2DC A C15 1 
HETATM 8200 C  C16 . 2DC F 4 .   ? -35.782 -2.902  59.794  1.00 16.85 ? 602 2DC A C16 1 
HETATM 8201 C  C17 . 2DC F 4 .   ? -34.892 -3.345  58.626  1.00 16.29 ? 602 2DC A C17 1 
HETATM 8202 C  C18 . 2DC F 4 .   ? -36.790 -3.360  56.893  1.00 13.86 ? 602 2DC A C18 1 
HETATM 8203 C  C19 . 2DC F 4 .   ? -38.727 -7.459  55.748  1.00 17.41 ? 602 2DC A C19 1 
HETATM 8204 C  C20 . 2DC F 4 .   ? -34.069 -2.183  58.020  1.00 18.06 ? 602 2DC A C20 1 
HETATM 8205 C  C21 . 2DC F 4 .   ? -33.090 -2.663  56.948  1.00 15.75 ? 602 2DC A C21 1 
HETATM 8206 C  C22 . 2DC F 4 .   ? -33.320 -1.468  59.144  1.00 19.00 ? 602 2DC A C22 1 
HETATM 8207 C  C23 . 2DC F 4 .   ? -32.138 -2.271  59.681  1.00 18.94 ? 602 2DC A C23 1 
HETATM 8208 C  C24 . 2DC F 4 .   ? -31.584 -1.668  60.965  1.00 20.09 ? 602 2DC A C24 1 
HETATM 8209 C  C25 . 2DC F 4 .   ? -30.662 -2.635  61.708  1.00 20.33 ? 602 2DC A C25 1 
HETATM 8210 C  C26 . 2DC F 4 .   ? -30.295 -2.053  63.067  1.00 19.53 ? 602 2DC A C26 1 
HETATM 8211 C  C27 . 2DC F 4 .   ? -29.407 -2.931  60.893  1.00 20.04 ? 602 2DC A C27 1 
HETATM 8212 C  CHA . HEM G 3 .   ? 14.422  -0.451  16.415  1.00 16.31 ? 601 HEM B CHA 1 
HETATM 8213 C  CHB . HEM G 3 .   ? 9.657   -0.857  15.455  1.00 18.20 ? 601 HEM B CHB 1 
HETATM 8214 C  CHC . HEM G 3 .   ? 9.287   -3.605  19.414  1.00 17.55 ? 601 HEM B CHC 1 
HETATM 8215 C  CHD . HEM G 3 .   ? 13.906  -2.791  20.676  1.00 18.24 ? 601 HEM B CHD 1 
HETATM 8216 C  C1A . HEM G 3 .   ? 13.182  -0.335  15.820  1.00 17.63 ? 601 HEM B C1A 1 
HETATM 8217 C  C2A . HEM G 3 .   ? 12.908  0.368   14.574  1.00 18.51 ? 601 HEM B C2A 1 
HETATM 8218 C  C3A . HEM G 3 .   ? 11.602  0.262   14.307  1.00 18.91 ? 601 HEM B C3A 1 
HETATM 8219 C  C4A . HEM G 3 .   ? 10.990  -0.521  15.362  1.00 17.53 ? 601 HEM B C4A 1 
HETATM 8220 C  CMA . HEM G 3 .   ? 10.886  0.870   13.076  1.00 18.98 ? 601 HEM B CMA 1 
HETATM 8221 C  CAA . HEM G 3 .   ? 13.941  1.111   13.711  1.00 17.32 ? 601 HEM B CAA 1 
HETATM 8222 C  CBA . HEM G 3 .   ? 14.526  0.107   12.734  1.00 21.64 ? 601 HEM B CBA 1 
HETATM 8223 C  CGA . HEM G 3 .   ? 15.384  0.750   11.661  1.00 22.58 ? 601 HEM B CGA 1 
HETATM 8224 O  O1A . HEM G 3 .   ? 15.952  1.863   11.861  1.00 24.21 ? 601 HEM B O1A 1 
HETATM 8225 O  O2A . HEM G 3 .   ? 15.511  0.119   10.586  1.00 21.43 ? 601 HEM B O2A 1 
HETATM 8226 C  C1B . HEM G 3 .   ? 9.114   -1.658  16.443  1.00 18.11 ? 601 HEM B C1B 1 
HETATM 8227 C  C2B . HEM G 3 .   ? 7.743   -2.144  16.542  1.00 17.41 ? 601 HEM B C2B 1 
HETATM 8228 C  C3B . HEM G 3 .   ? 7.661   -2.909  17.654  1.00 16.86 ? 601 HEM B C3B 1 
HETATM 8229 C  C4B . HEM G 3 .   ? 8.967   -2.925  18.270  1.00 17.65 ? 601 HEM B C4B 1 
HETATM 8230 C  CMB . HEM G 3 .   ? 6.630   -1.820  15.509  1.00 17.01 ? 601 HEM B CMB 1 
HETATM 8231 C  CAB . HEM G 3 .   ? 6.470   -3.689  18.265  1.00 16.56 ? 601 HEM B CAB 1 
HETATM 8232 C  CBB . HEM G 3 .   ? 5.256   -3.761  17.699  1.00 17.18 ? 601 HEM B CBB 1 
HETATM 8233 C  C1C . HEM G 3 .   ? 10.498  -3.668  20.055  1.00 18.65 ? 601 HEM B C1C 1 
HETATM 8234 C  C2C . HEM G 3 .   ? 10.785  -4.513  21.188  1.00 19.10 ? 601 HEM B C2C 1 
HETATM 8235 C  C3C . HEM G 3 .   ? 12.056  -4.299  21.553  1.00 18.45 ? 601 HEM B C3C 1 
HETATM 8236 C  C4C . HEM G 3 .   ? 12.626  -3.310  20.659  1.00 18.41 ? 601 HEM B C4C 1 
HETATM 8237 C  CMC . HEM G 3 .   ? 9.765   -5.487  21.829  1.00 18.84 ? 601 HEM B CMC 1 
HETATM 8238 C  CAC . HEM G 3 .   ? 12.779  -4.992  22.727  1.00 20.16 ? 601 HEM B CAC 1 
HETATM 8239 C  CBC . HEM G 3 .   ? 13.587  -6.037  22.520  1.00 21.11 ? 601 HEM B CBC 1 
HETATM 8240 C  C1D . HEM G 3 .   ? 14.500  -2.077  19.652  1.00 18.23 ? 601 HEM B C1D 1 
HETATM 8241 C  C2D . HEM G 3 .   ? 15.890  -1.646  19.600  1.00 18.45 ? 601 HEM B C2D 1 
HETATM 8242 C  C3D . HEM G 3 .   ? 16.042  -0.922  18.265  1.00 18.65 ? 601 HEM B C3D 1 
HETATM 8243 C  C4D . HEM G 3 .   ? 14.737  -0.985  17.638  1.00 17.45 ? 601 HEM B C4D 1 
HETATM 8244 C  CMD . HEM G 3 .   ? 17.010  -1.847  20.638  1.00 16.78 ? 601 HEM B CMD 1 
HETATM 8245 C  CAD . HEM G 3 .   ? 17.346  -0.289  17.733  1.00 21.58 ? 601 HEM B CAD 1 
HETATM 8246 C  CBD . HEM G 3 .   ? 18.225  -1.449  17.257  1.00 22.70 ? 601 HEM B CBD 1 
HETATM 8247 C  CGD . HEM G 3 .   ? 19.519  -0.987  16.636  1.00 25.66 ? 601 HEM B CGD 1 
HETATM 8248 O  O1D . HEM G 3 .   ? 20.463  -1.816  16.552  1.00 26.09 ? 601 HEM B O1D 1 
HETATM 8249 O  O2D . HEM G 3 .   ? 19.617  0.193   16.202  1.00 27.18 ? 601 HEM B O2D 1 
HETATM 8250 N  NA  . HEM G 3 .   ? 11.990  -0.882  16.254  1.00 17.19 ? 601 HEM B NA  1 
HETATM 8251 N  NB  . HEM G 3 .   ? 9.829   -2.162  17.513  1.00 17.84 ? 601 HEM B NB  1 
HETATM 8252 N  NC  . HEM G 3 .   ? 11.648  -2.966  19.749  1.00 18.66 ? 601 HEM B NC  1 
HETATM 8253 N  ND  . HEM G 3 .   ? 13.868  -1.680  18.473  1.00 17.62 ? 601 HEM B ND  1 
HETATM 8254 FE FE  . HEM G 3 .   ? 11.842  -1.987  17.952  1.00 19.10 ? 601 HEM B FE  1 
HETATM 8255 C  C1  . 2DC H 4 .   ? 10.815  9.416   16.210  1.00 11.98 ? 602 2DC B C1  1 
HETATM 8256 O  O1  . 2DC H 4 .   ? 12.006  12.355  14.132  1.00 14.44 ? 602 2DC B O1  1 
HETATM 8257 C  C2  . 2DC H 4 .   ? 10.678  10.610  15.272  1.00 12.41 ? 602 2DC B C2  1 
HETATM 8258 O  O2  . 2DC H 4 .   ? 11.348  1.233   18.524  1.00 14.48 ? 602 2DC B O2  1 
HETATM 8259 C  C3  . 2DC H 4 .   ? 12.067  11.118  14.885  1.00 14.93 ? 602 2DC B C3  1 
HETATM 8260 O  O3  . 2DC H 4 .   ? 11.919  0.265   20.759  1.00 22.16 ? 602 2DC B O3  1 
HETATM 8261 C  C4  . 2DC H 4 .   ? 12.772  10.003  14.101  1.00 13.26 ? 602 2DC B C4  1 
HETATM 8262 C  C5  . 2DC H 4 .   ? 12.801  8.730   14.935  1.00 12.02 ? 602 2DC B C5  1 
HETATM 8263 C  C6  . 2DC H 4 .   ? 13.976  8.091   15.070  1.00 11.59 ? 602 2DC B C6  1 
HETATM 8264 C  C7  . 2DC H 4 .   ? 14.201  6.919   16.007  1.00 13.33 ? 602 2DC B C7  1 
HETATM 8265 C  C8  . 2DC H 4 .   ? 12.896  6.174   16.273  1.00 12.97 ? 602 2DC B C8  1 
HETATM 8266 C  C9  . 2DC H 4 .   ? 11.784  7.162   16.657  1.00 11.59 ? 602 2DC B C9  1 
HETATM 8267 C  C10 . 2DC H 4 .   ? 11.518  8.224   15.564  1.00 12.22 ? 602 2DC B C10 1 
HETATM 8268 C  C11 . 2DC H 4 .   ? 10.515  6.397   17.085  1.00 10.50 ? 602 2DC B C11 1 
HETATM 8269 C  C12 . 2DC H 4 .   ? 10.794  5.353   18.181  1.00 11.67 ? 602 2DC B C12 1 
HETATM 8270 C  C13 . 2DC H 4 .   ? 11.823  4.317   17.712  1.00 12.15 ? 602 2DC B C13 1 
HETATM 8271 C  C14 . 2DC H 4 .   ? 13.080  5.087   17.345  1.00 13.14 ? 602 2DC B C14 1 
HETATM 8272 C  C15 . 2DC H 4 .   ? 14.144  4.004   17.127  1.00 14.26 ? 602 2DC B C15 1 
HETATM 8273 C  C16 . 2DC H 4 .   ? 13.837  3.039   18.270  1.00 12.79 ? 602 2DC B C16 1 
HETATM 8274 C  C17 . 2DC H 4 .   ? 12.462  3.454   18.821  1.00 13.69 ? 602 2DC B C17 1 
HETATM 8275 C  C18 . 2DC H 4 .   ? 11.295  3.490   16.529  1.00 10.52 ? 602 2DC B C18 1 
HETATM 8276 C  C19 . 2DC H 4 .   ? 10.673  7.621   14.426  1.00 11.99 ? 602 2DC B C19 1 
HETATM 8277 C  C20 . 2DC H 4 .   ? 11.669  2.278   19.461  1.00 16.74 ? 602 2DC B C20 1 
HETATM 8278 C  C21 . 2DC H 4 .   ? 10.370  2.747   20.125  1.00 14.33 ? 602 2DC B C21 1 
HETATM 8279 C  C22 . 2DC H 4 .   ? 12.545  1.534   20.478  1.00 19.12 ? 602 2DC B C22 1 
HETATM 8280 C  C23 . 2DC H 4 .   ? 12.784  2.320   21.768  1.00 19.26 ? 602 2DC B C23 1 
HETATM 8281 C  C24 . 2DC H 4 .   ? 14.101  1.914   22.426  1.00 21.02 ? 602 2DC B C24 1 
HETATM 8282 C  C25 . 2DC H 4 .   ? 14.435  2.771   23.652  1.00 20.48 ? 602 2DC B C25 1 
HETATM 8283 C  C26 . 2DC H 4 .   ? 15.596  2.165   24.438  1.00 18.50 ? 602 2DC B C26 1 
HETATM 8284 C  C27 . 2DC H 4 .   ? 13.210  2.916   24.549  1.00 20.88 ? 602 2DC B C27 1 
HETATM 8285 FE FE1 . FES I 5 .   ? -47.998 12.420  64.599  1.00 82.99 ? 150 FES C FE1 1 
HETATM 8286 FE FE2 . FES I 5 .   ? -49.334 15.109  63.850  1.00 84.27 ? 150 FES C FE2 1 
HETATM 8287 S  S1  . FES I 5 .   ? -48.569 13.390  62.707  1.00 83.72 ? 150 FES C S1  1 
HETATM 8288 S  S2  . FES I 5 .   ? -49.079 13.976  65.727  1.00 84.21 ? 150 FES C S2  1 
HETATM 8289 FE FE1 . FES J 5 .   ? 21.281  -12.373 7.793   1.00 85.56 ? 150 FES D FE1 1 
HETATM 8290 FE FE2 . FES J 5 .   ? 21.217  -14.908 6.003   1.00 87.03 ? 150 FES D FE2 1 
HETATM 8291 S  S1  . FES J 5 .   ? 19.729  -13.414 6.630   1.00 86.40 ? 150 FES D S1  1 
HETATM 8292 S  S2  . FES J 5 .   ? 22.810  -13.720 6.951   1.00 86.78 ? 150 FES D S2  1 
HETATM 8293 O  O   . HOH K 6 .   ? -35.807 -11.394 40.906  1.00 10.64 ? 2   HOH A O   1 
HETATM 8294 O  O   . HOH K 6 .   ? -17.864 0.380   50.131  1.00 17.81 ? 3   HOH A O   1 
HETATM 8295 O  O   . HOH K 6 .   ? -35.804 10.332  59.641  1.00 8.75  ? 7   HOH A O   1 
HETATM 8296 O  O   . HOH K 6 .   ? -16.191 6.135   47.472  1.00 22.49 ? 8   HOH A O   1 
HETATM 8297 O  O   . HOH K 6 .   ? -23.437 0.625   40.059  1.00 18.14 ? 9   HOH A O   1 
HETATM 8298 O  O   . HOH K 6 .   ? -39.427 -13.464 65.856  1.00 13.56 ? 10  HOH A O   1 
HETATM 8299 O  O   . HOH K 6 .   ? -18.302 -1.007  43.622  1.00 30.77 ? 11  HOH A O   1 
HETATM 8300 O  O   . HOH K 6 .   ? -39.187 -0.889  51.373  1.00 14.55 ? 12  HOH A O   1 
HETATM 8301 O  O   . HOH K 6 .   ? -28.367 -0.510  56.106  1.00 14.96 ? 13  HOH A O   1 
HETATM 8302 O  O   . HOH K 6 .   ? -32.943 -19.954 55.637  1.00 34.09 ? 14  HOH A O   1 
HETATM 8303 O  O   . HOH K 6 .   ? -22.407 1.464   31.307  1.00 16.01 ? 16  HOH A O   1 
HETATM 8304 O  O   . HOH K 6 .   ? -43.702 -9.330  48.912  1.00 19.61 ? 17  HOH A O   1 
HETATM 8305 O  O   . HOH K 6 .   ? -44.907 -16.900 52.010  1.00 19.80 ? 20  HOH A O   1 
HETATM 8306 O  O   . HOH K 6 .   ? -29.620 -1.336  43.697  1.00 19.67 ? 21  HOH A O   1 
HETATM 8307 O  O   . HOH K 6 .   ? -42.961 -4.063  59.198  1.00 14.99 ? 24  HOH A O   1 
HETATM 8308 O  O   . HOH K 6 .   ? -23.865 15.281  66.820  1.00 26.39 ? 25  HOH A O   1 
HETATM 8309 O  O   . HOH K 6 .   ? -41.869 -21.814 46.507  1.00 21.18 ? 32  HOH A O   1 
HETATM 8310 O  O   . HOH K 6 .   ? -36.114 23.015  33.136  1.00 18.90 ? 33  HOH A O   1 
HETATM 8311 O  O   . HOH K 6 .   ? -35.549 -7.553  64.198  1.00 12.44 ? 35  HOH A O   1 
HETATM 8312 O  O   . HOH K 6 .   ? -64.468 -9.098  55.101  1.00 29.12 ? 37  HOH A O   1 
HETATM 8313 O  O   . HOH K 6 .   ? -36.420 -5.164  43.645  1.00 3.65  ? 39  HOH A O   1 
HETATM 8314 O  O   . HOH K 6 .   ? -34.917 4.603   27.625  1.00 20.26 ? 40  HOH A O   1 
HETATM 8315 O  O   . HOH K 6 .   ? -41.584 -12.346 54.923  1.00 13.04 ? 42  HOH A O   1 
HETATM 8316 O  O   . HOH K 6 .   ? -22.322 -2.375  53.107  1.00 26.25 ? 515 HOH A O   1 
HETATM 8317 O  O   . HOH K 6 .   ? -46.912 2.034   62.941  1.00 18.76 ? 516 HOH A O   1 
HETATM 8318 O  O   . HOH K 6 .   ? -44.199 3.980   53.486  1.00 21.45 ? 517 HOH A O   1 
HETATM 8319 O  O   . HOH K 6 .   ? -20.016 18.062  58.831  1.00 33.90 ? 518 HOH A O   1 
HETATM 8320 O  O   . HOH K 6 .   ? -42.005 -14.988 54.172  1.00 6.91  ? 519 HOH A O   1 
HETATM 8321 O  O   . HOH K 6 .   ? -42.042 -28.567 65.297  1.00 34.89 ? 520 HOH A O   1 
HETATM 8322 O  O   . HOH K 6 .   ? -45.626 -20.557 45.722  1.00 30.73 ? 521 HOH A O   1 
HETATM 8323 O  O   . HOH K 6 .   ? -23.677 -2.914  41.324  1.00 23.47 ? 522 HOH A O   1 
HETATM 8324 O  O   . HOH K 6 .   ? -36.172 -7.494  52.518  1.00 9.81  ? 523 HOH A O   1 
HETATM 8325 O  O   . HOH K 6 .   ? -15.791 12.226  52.441  1.00 21.02 ? 524 HOH A O   1 
HETATM 8326 O  O   . HOH K 6 .   ? -17.640 -15.301 65.450  1.00 33.45 ? 525 HOH A O   1 
HETATM 8327 O  O   . HOH K 6 .   ? -27.171 6.973   54.647  1.00 14.83 ? 526 HOH A O   1 
HETATM 8328 O  O   . HOH K 6 .   ? -18.247 23.536  79.696  1.00 40.19 ? 527 HOH A O   1 
HETATM 8329 O  O   . HOH K 6 .   ? -40.754 18.909  45.905  1.00 21.14 ? 528 HOH A O   1 
HETATM 8330 O  O   . HOH K 6 .   ? -54.901 -8.986  50.073  1.00 25.42 ? 529 HOH A O   1 
HETATM 8331 O  O   . HOH K 6 .   ? -49.510 -22.914 56.830  1.00 18.61 ? 530 HOH A O   1 
HETATM 8332 O  O   . HOH K 6 .   ? -28.161 24.186  60.391  1.00 22.10 ? 531 HOH A O   1 
HETATM 8333 O  O   . HOH K 6 .   ? -40.365 8.884   50.070  1.00 23.00 ? 532 HOH A O   1 
HETATM 8334 O  O   . HOH K 6 .   ? -41.514 13.818  59.639  1.00 41.95 ? 533 HOH A O   1 
HETATM 8335 O  O   . HOH K 6 .   ? -42.728 -8.283  38.153  1.00 25.50 ? 534 HOH A O   1 
HETATM 8336 O  O   . HOH K 6 .   ? -40.116 11.006  48.033  1.00 16.54 ? 535 HOH A O   1 
HETATM 8337 O  O   . HOH K 6 .   ? -39.955 1.720   32.604  1.00 40.13 ? 536 HOH A O   1 
HETATM 8338 O  O   . HOH K 6 .   ? -47.155 -9.765  42.092  1.00 24.69 ? 537 HOH A O   1 
HETATM 8339 O  O   . HOH K 6 .   ? -18.256 18.523  54.643  1.00 31.17 ? 538 HOH A O   1 
HETATM 8340 O  O   . HOH K 6 .   ? -8.649  14.189  30.906  1.00 29.97 ? 539 HOH A O   1 
HETATM 8341 O  O   . HOH K 6 .   ? -18.802 19.503  50.231  1.00 28.18 ? 540 HOH A O   1 
HETATM 8342 O  O   . HOH K 6 .   ? -36.197 27.618  60.220  1.00 40.31 ? 541 HOH A O   1 
HETATM 8343 O  O   . HOH K 6 .   ? -52.571 2.351   41.283  1.00 30.54 ? 542 HOH A O   1 
HETATM 8344 O  O   . HOH K 6 .   ? -11.888 1.391   50.877  1.00 37.13 ? 543 HOH A O   1 
HETATM 8345 O  O   . HOH K 6 .   ? -58.534 -22.251 62.845  1.00 49.27 ? 544 HOH A O   1 
HETATM 8346 O  O   . HOH K 6 .   ? -20.306 19.432  43.261  1.00 32.64 ? 545 HOH A O   1 
HETATM 8347 O  O   . HOH K 6 .   ? -16.997 18.781  46.267  1.00 21.20 ? 546 HOH A O   1 
HETATM 8348 O  O   . HOH K 6 .   ? -16.525 -12.340 66.895  1.00 30.57 ? 547 HOH A O   1 
HETATM 8349 O  O   . HOH K 6 .   ? -31.202 25.549  52.255  1.00 28.58 ? 548 HOH A O   1 
HETATM 8350 O  O   . HOH K 6 .   ? -12.297 12.488  30.105  1.00 15.37 ? 549 HOH A O   1 
HETATM 8351 O  O   . HOH K 6 .   ? -44.221 -2.025  46.205  1.00 16.20 ? 550 HOH A O   1 
HETATM 8352 O  O   . HOH K 6 .   ? -48.663 -5.004  66.727  1.00 25.99 ? 551 HOH A O   1 
HETATM 8353 O  O   . HOH K 6 .   ? -24.263 -7.710  35.875  1.00 25.67 ? 552 HOH A O   1 
HETATM 8354 O  O   . HOH K 6 .   ? -47.850 -11.661 38.288  1.00 39.80 ? 553 HOH A O   1 
HETATM 8355 O  O   . HOH K 6 .   ? -16.925 10.330  67.024  1.00 29.11 ? 554 HOH A O   1 
HETATM 8356 O  O   . HOH K 6 .   ? -30.703 -10.636 37.550  1.00 39.77 ? 555 HOH A O   1 
HETATM 8357 O  O   . HOH K 6 .   ? -34.703 -22.106 70.064  1.00 27.41 ? 556 HOH A O   1 
HETATM 8358 O  O   . HOH K 6 .   ? -18.511 -5.608  39.010  1.00 24.65 ? 557 HOH A O   1 
HETATM 8359 O  O   . HOH K 6 .   ? -28.718 3.640   29.136  1.00 17.67 ? 558 HOH A O   1 
HETATM 8360 O  O   . HOH K 6 .   ? -11.484 6.843   36.224  1.00 17.34 ? 559 HOH A O   1 
HETATM 8361 O  O   . HOH K 6 .   ? -19.202 11.800  57.521  1.00 23.10 ? 560 HOH A O   1 
HETATM 8362 O  O   . HOH K 6 .   ? -13.680 -4.273  65.674  1.00 34.08 ? 561 HOH A O   1 
HETATM 8363 O  O   . HOH K 6 .   ? -34.099 -0.534  47.270  1.00 9.67  ? 562 HOH A O   1 
HETATM 8364 O  O   . HOH K 6 .   ? -14.324 -1.040  48.055  1.00 35.55 ? 563 HOH A O   1 
HETATM 8365 O  O   . HOH K 6 .   ? -33.087 -15.860 71.663  1.00 28.63 ? 564 HOH A O   1 
HETATM 8366 O  O   . HOH K 6 .   ? -23.173 19.320  42.598  1.00 45.69 ? 565 HOH A O   1 
HETATM 8367 O  O   . HOH K 6 .   ? -34.088 10.827  25.601  1.00 32.36 ? 566 HOH A O   1 
HETATM 8368 O  O   . HOH K 6 .   ? -41.868 -1.544  78.192  1.00 35.16 ? 567 HOH A O   1 
HETATM 8369 O  O   . HOH K 6 .   ? -17.785 14.183  27.401  1.00 25.70 ? 568 HOH A O   1 
HETATM 8370 O  O   . HOH K 6 .   ? -23.318 22.050  58.959  1.00 30.75 ? 569 HOH A O   1 
HETATM 8371 O  O   . HOH K 6 .   ? -31.607 16.669  65.416  1.00 24.88 ? 570 HOH A O   1 
HETATM 8372 O  O   . HOH K 6 .   ? -20.156 20.564  40.059  1.00 39.73 ? 571 HOH A O   1 
HETATM 8373 O  O   . HOH K 6 .   ? -19.328 22.113  47.704  1.00 27.75 ? 572 HOH A O   1 
HETATM 8374 O  O   . HOH K 6 .   ? -12.738 -2.021  49.880  1.00 41.36 ? 573 HOH A O   1 
HETATM 8375 O  O   . HOH K 6 .   ? -40.037 -16.091 65.658  1.00 21.63 ? 574 HOH A O   1 
HETATM 8376 O  O   . HOH K 6 .   ? -36.841 -16.393 68.533  1.00 19.88 ? 575 HOH A O   1 
HETATM 8377 O  O   . HOH K 6 .   ? -35.209 -4.600  35.915  1.00 37.88 ? 576 HOH A O   1 
HETATM 8378 O  O   . HOH K 6 .   ? -11.612 11.777  73.047  1.00 44.99 ? 577 HOH A O   1 
HETATM 8379 O  O   . HOH K 6 .   ? -52.757 -17.100 65.279  1.00 30.03 ? 578 HOH A O   1 
HETATM 8380 O  O   . HOH K 6 .   ? -23.818 -5.345  43.582  1.00 26.92 ? 579 HOH A O   1 
HETATM 8381 O  O   . HOH K 6 .   ? -21.138 20.844  60.779  1.00 26.44 ? 580 HOH A O   1 
HETATM 8382 O  O   . HOH K 6 .   ? -36.627 2.733   76.239  1.00 34.58 ? 581 HOH A O   1 
HETATM 8383 O  O   . HOH K 6 .   ? -46.061 -27.996 51.713  1.00 30.93 ? 582 HOH A O   1 
HETATM 8384 O  O   . HOH K 6 .   ? -30.729 25.562  37.091  1.00 28.28 ? 583 HOH A O   1 
HETATM 8385 O  O   . HOH K 6 .   ? -26.321 22.009  35.489  1.00 37.57 ? 584 HOH A O   1 
HETATM 8386 O  O   . HOH K 6 .   ? -21.252 -5.010  42.694  1.00 25.00 ? 585 HOH A O   1 
HETATM 8387 O  O   . HOH K 6 .   ? -42.256 -16.092 58.762  1.00 30.87 ? 586 HOH A O   1 
HETATM 8388 O  O   . HOH K 6 .   ? -42.030 -4.761  43.676  1.00 10.22 ? 587 HOH A O   1 
HETATM 8389 O  O   . HOH K 6 .   ? -56.220 -14.931 69.860  1.00 39.90 ? 588 HOH A O   1 
HETATM 8390 O  O   . HOH K 6 .   ? -44.064 -15.271 65.500  1.00 30.24 ? 589 HOH A O   1 
HETATM 8391 O  O   . HOH K 6 .   ? -33.282 -2.889  46.723  1.00 11.83 ? 590 HOH A O   1 
HETATM 8392 O  O   . HOH K 6 .   ? -38.682 -4.544  65.194  1.00 20.95 ? 591 HOH A O   1 
HETATM 8393 O  O   . HOH K 6 .   ? -44.392 -17.069 57.950  1.00 24.85 ? 592 HOH A O   1 
HETATM 8394 O  O   . HOH K 6 .   ? -26.048 21.057  45.753  1.00 20.17 ? 593 HOH A O   1 
HETATM 8395 O  O   . HOH K 6 .   ? -32.431 16.179  29.850  1.00 25.81 ? 594 HOH A O   1 
HETATM 8396 O  O   . HOH K 6 .   ? -38.733 -17.619 62.261  1.00 33.33 ? 595 HOH A O   1 
HETATM 8397 O  O   . HOH K 6 .   ? -37.429 -17.875 66.401  1.00 31.93 ? 596 HOH A O   1 
HETATM 8398 O  O   . HOH K 6 .   ? -20.260 18.836  56.186  1.00 10.24 ? 597 HOH A O   1 
HETATM 8399 O  O   . HOH K 6 .   ? -22.111 21.012  56.107  1.00 24.53 ? 598 HOH A O   1 
HETATM 8400 O  O   . HOH K 6 .   ? -41.122 -13.594 58.337  1.00 39.24 ? 599 HOH A O   1 
HETATM 8401 O  O   . HOH K 6 .   ? -14.379 4.778   32.533  1.00 10.73 ? 600 HOH A O   1 
HETATM 8402 O  O   . HOH K 6 .   ? -38.963 -21.097 63.360  1.00 34.97 ? 603 HOH A O   1 
HETATM 8403 O  O   . HOH K 6 .   ? -37.644 6.830   28.103  1.00 34.18 ? 604 HOH A O   1 
HETATM 8404 O  O   . HOH K 6 .   ? -38.850 14.463  54.376  1.00 33.43 ? 605 HOH A O   1 
HETATM 8405 O  O   . HOH K 6 .   ? -33.737 -3.265  31.782  1.00 42.81 ? 606 HOH A O   1 
HETATM 8406 O  O   . HOH K 6 .   ? -35.281 -4.361  45.876  1.00 9.55  ? 607 HOH A O   1 
HETATM 8407 O  O   . HOH K 6 .   ? -29.008 23.453  38.417  1.00 32.25 ? 608 HOH A O   1 
HETATM 8408 O  O   . HOH K 6 .   ? -48.119 6.844   58.043  1.00 50.07 ? 609 HOH A O   1 
HETATM 8409 O  O   . HOH K 6 .   ? -45.064 -27.473 61.738  1.00 23.44 ? 610 HOH A O   1 
HETATM 8410 O  O   . HOH K 6 .   ? -47.716 -28.683 55.215  1.00 26.24 ? 611 HOH A O   1 
HETATM 8411 O  O   . HOH K 6 .   ? -26.778 -15.866 52.753  1.00 42.86 ? 612 HOH A O   1 
HETATM 8412 O  O   . HOH K 6 .   ? -37.790 -6.351  63.224  1.00 15.81 ? 613 HOH A O   1 
HETATM 8413 O  O   . HOH K 6 .   ? -60.661 -7.479  53.947  1.00 35.74 ? 614 HOH A O   1 
HETATM 8414 O  O   . HOH K 6 .   ? -18.442 -3.282  71.971  1.00 28.71 ? 615 HOH A O   1 
HETATM 8415 O  O   . HOH K 6 .   ? -35.093 13.621  72.452  1.00 35.56 ? 616 HOH A O   1 
HETATM 8416 O  O   . HOH K 6 .   ? -24.130 24.497  61.912  1.00 35.36 ? 617 HOH A O   1 
HETATM 8417 O  O   . HOH K 6 .   ? -15.827 -6.291  58.222  1.00 22.69 ? 618 HOH A O   1 
HETATM 8418 O  O   . HOH K 6 .   ? -31.028 -21.856 54.445  1.00 31.40 ? 619 HOH A O   1 
HETATM 8419 O  O   . HOH K 6 .   ? -43.886 -23.752 50.818  1.00 20.86 ? 620 HOH A O   1 
HETATM 8420 O  O   . HOH K 6 .   ? -41.211 -11.664 66.440  1.00 19.01 ? 621 HOH A O   1 
HETATM 8421 O  O   . HOH K 6 .   ? -46.871 -18.643 64.420  1.00 30.02 ? 622 HOH A O   1 
HETATM 8422 O  O   . HOH K 6 .   ? -26.651 22.322  59.701  1.00 21.80 ? 623 HOH A O   1 
HETATM 8423 O  O   . HOH K 6 .   ? -18.623 -5.462  70.209  1.00 32.34 ? 624 HOH A O   1 
HETATM 8424 O  O   . HOH K 6 .   ? -24.888 -3.690  44.401  1.00 29.95 ? 625 HOH A O   1 
HETATM 8425 O  O   . HOH K 6 .   ? -14.470 1.117   35.596  1.00 19.79 ? 626 HOH A O   1 
HETATM 8426 O  O   . HOH K 6 .   ? -54.442 12.392  37.224  1.00 40.92 ? 627 HOH A O   1 
HETATM 8427 O  O   . HOH K 6 .   ? -31.769 -18.381 46.072  1.00 36.94 ? 628 HOH A O   1 
HETATM 8428 O  O   . HOH K 6 .   ? -26.218 6.550   82.831  1.00 29.57 ? 629 HOH A O   1 
HETATM 8429 O  O   . HOH K 6 .   ? -34.944 -16.497 52.795  1.00 32.78 ? 630 HOH A O   1 
HETATM 8430 O  O   . HOH K 6 .   ? -45.619 -25.474 49.826  1.00 27.37 ? 631 HOH A O   1 
HETATM 8431 O  O   . HOH K 6 .   ? -27.704 8.285   81.534  1.00 26.93 ? 632 HOH A O   1 
HETATM 8432 O  O   . HOH K 6 .   ? -43.121 7.945   64.875  1.00 38.39 ? 633 HOH A O   1 
HETATM 8433 O  O   . HOH K 6 .   ? -16.337 15.551  34.427  1.00 35.31 ? 634 HOH A O   1 
HETATM 8434 O  O   . HOH K 6 .   ? -37.510 14.813  50.579  1.00 22.82 ? 635 HOH A O   1 
HETATM 8435 O  O   . HOH K 6 .   ? -18.554 0.406   74.772  1.00 35.12 ? 636 HOH A O   1 
HETATM 8436 O  O   . HOH K 6 .   ? -32.952 2.900   28.161  1.00 26.88 ? 637 HOH A O   1 
HETATM 8437 O  O   . HOH K 6 .   ? -37.041 19.884  57.200  1.00 35.72 ? 638 HOH A O   1 
HETATM 8438 O  O   . HOH K 6 .   ? -46.392 6.071   55.437  1.00 31.18 ? 639 HOH A O   1 
HETATM 8439 O  O   . HOH K 6 .   ? -35.589 -20.125 54.927  1.00 32.82 ? 640 HOH A O   1 
HETATM 8440 O  O   . HOH K 6 .   ? -36.565 13.272  75.132  1.00 38.62 ? 641 HOH A O   1 
HETATM 8441 O  O   . HOH K 6 .   ? -34.120 -19.973 57.915  1.00 27.15 ? 642 HOH A O   1 
HETATM 8442 O  O   . HOH K 6 .   ? -40.520 -16.452 55.611  1.00 38.50 ? 643 HOH A O   1 
HETATM 8443 O  O   . HOH K 6 .   ? -27.179 23.570  47.406  1.00 31.68 ? 644 HOH A O   1 
HETATM 8444 O  O   . HOH K 6 .   ? -27.910 21.759  68.325  1.00 40.75 ? 645 HOH A O   1 
HETATM 8445 O  O   . HOH L 6 .   ? 12.254  28.614  5.713   1.00 17.07 ? 1   HOH B O   1 
HETATM 8446 O  O   . HOH L 6 .   ? -4.504  11.525  13.493  1.00 14.90 ? 4   HOH B O   1 
HETATM 8447 O  O   . HOH L 6 .   ? -0.318  4.769   8.155   1.00 11.34 ? 5   HOH B O   1 
HETATM 8448 O  O   . HOH L 6 .   ? 4.130   2.556   29.759  1.00 16.00 ? 6   HOH B O   1 
HETATM 8449 O  O   . HOH L 6 .   ? 8.331   16.401  -4.958  1.00 16.60 ? 15  HOH B O   1 
HETATM 8450 O  O   . HOH L 6 .   ? 23.731  2.777   5.241   1.00 26.11 ? 18  HOH B O   1 
HETATM 8451 O  O   . HOH L 6 .   ? 7.264   -11.908 33.906  1.00 25.38 ? 19  HOH B O   1 
HETATM 8452 O  O   . HOH L 6 .   ? 9.377   -14.547 14.149  1.00 27.68 ? 22  HOH B O   1 
HETATM 8453 O  O   . HOH L 6 .   ? 13.568  -10.185 18.425  1.00 18.29 ? 23  HOH B O   1 
HETATM 8454 O  O   . HOH L 6 .   ? 6.426   0.951   12.786  1.00 15.69 ? 26  HOH B O   1 
HETATM 8455 O  O   . HOH L 6 .   ? 14.879  4.070   11.349  1.00 15.85 ? 27  HOH B O   1 
HETATM 8456 O  O   . HOH L 6 .   ? -11.721 1.455   31.627  1.00 19.06 ? 28  HOH B O   1 
HETATM 8457 O  O   . HOH L 6 .   ? 17.989  27.531  9.635   1.00 20.36 ? 29  HOH B O   1 
HETATM 8458 O  O   . HOH L 6 .   ? -8.194  -0.436  25.332  1.00 19.20 ? 30  HOH B O   1 
HETATM 8459 O  O   . HOH L 6 .   ? -9.109  -27.622 11.324  1.00 36.79 ? 31  HOH B O   1 
HETATM 8460 O  O   . HOH L 6 .   ? -6.252  0.810   31.385  1.00 23.10 ? 34  HOH B O   1 
HETATM 8461 O  O   . HOH L 6 .   ? -3.341  1.454   20.063  1.00 16.87 ? 36  HOH B O   1 
HETATM 8462 O  O   . HOH L 6 .   ? 5.206   9.405   7.894   1.00 19.18 ? 38  HOH B O   1 
HETATM 8463 O  O   . HOH L 6 .   ? 8.508   28.073  6.447   1.00 31.93 ? 41  HOH B O   1 
HETATM 8464 O  O   . HOH L 6 .   ? 3.272   29.508  5.817   1.00 42.38 ? 43  HOH B O   1 
HETATM 8465 O  O   . HOH L 6 .   ? 9.323   9.056   -2.683  1.00 20.00 ? 515 HOH B O   1 
HETATM 8466 O  O   . HOH L 6 .   ? -6.937  3.105   25.324  1.00 17.57 ? 516 HOH B O   1 
HETATM 8467 O  O   . HOH L 6 .   ? 17.655  -15.400 31.736  1.00 25.27 ? 517 HOH B O   1 
HETATM 8468 O  O   . HOH L 6 .   ? -16.898 -1.130  24.211  1.00 37.57 ? 518 HOH B O   1 
HETATM 8469 O  O   . HOH L 6 .   ? 9.925   -3.941  8.759   1.00 15.24 ? 519 HOH B O   1 
HETATM 8470 O  O   . HOH L 6 .   ? -0.114  -2.486  -2.494  1.00 29.28 ? 520 HOH B O   1 
HETATM 8471 O  O   . HOH L 6 .   ? -20.693 -12.556 33.579  1.00 21.78 ? 521 HOH B O   1 
HETATM 8472 O  O   . HOH L 6 .   ? 16.054  -10.249 38.374  1.00 28.17 ? 522 HOH B O   1 
HETATM 8473 O  O   . HOH L 6 .   ? 6.801   7.443   15.867  1.00 15.07 ? 523 HOH B O   1 
HETATM 8474 O  O   . HOH L 6 .   ? 0.093   -0.321  33.227  1.00 17.41 ? 524 HOH B O   1 
HETATM 8475 O  O   . HOH L 6 .   ? 3.039   20.416  5.703   1.00 32.50 ? 525 HOH B O   1 
HETATM 8476 O  O   . HOH L 6 .   ? -16.149 -16.085 14.701  1.00 18.25 ? 526 HOH B O   1 
HETATM 8477 O  O   . HOH L 6 .   ? 19.637  -1.982  8.438   1.00 18.26 ? 527 HOH B O   1 
HETATM 8478 O  O   . HOH L 6 .   ? 1.533   -12.251 36.104  1.00 23.43 ? 528 HOH B O   1 
HETATM 8479 O  O   . HOH L 6 .   ? -12.141 -23.077 11.550  1.00 27.01 ? 529 HOH B O   1 
HETATM 8480 O  O   . HOH L 6 .   ? 30.365  -9.452  18.739  1.00 35.77 ? 530 HOH B O   1 
HETATM 8481 O  O   . HOH L 6 .   ? 2.850   -29.840 21.692  1.00 39.91 ? 531 HOH B O   1 
HETATM 8482 O  O   . HOH L 6 .   ? 16.157  9.318   -10.712 1.00 36.40 ? 532 HOH B O   1 
HETATM 8483 O  O   . HOH L 6 .   ? -17.602 -4.566  11.006  1.00 15.35 ? 533 HOH B O   1 
HETATM 8484 O  O   . HOH L 6 .   ? -9.145  -25.446 17.552  1.00 31.58 ? 534 HOH B O   1 
HETATM 8485 O  O   . HOH L 6 .   ? -0.579  9.837   2.806   1.00 25.47 ? 535 HOH B O   1 
HETATM 8486 O  O   . HOH L 6 .   ? 10.705  12.417  11.688  1.00 20.24 ? 536 HOH B O   1 
HETATM 8487 O  O   . HOH L 6 .   ? 4.255   -8.458  41.089  1.00 28.91 ? 537 HOH B O   1 
HETATM 8488 O  O   . HOH L 6 .   ? 14.907  15.074  37.214  1.00 33.10 ? 538 HOH B O   1 
HETATM 8489 O  O   . HOH L 6 .   ? 21.343  15.320  11.649  1.00 30.29 ? 539 HOH B O   1 
HETATM 8490 O  O   . HOH L 6 .   ? -2.206  -21.044 24.154  1.00 25.86 ? 540 HOH B O   1 
HETATM 8491 O  O   . HOH L 6 .   ? 0.319   -19.216 32.288  1.00 21.86 ? 541 HOH B O   1 
HETATM 8492 O  O   . HOH L 6 .   ? 8.965   11.985  34.902  1.00 18.58 ? 542 HOH B O   1 
HETATM 8493 O  O   . HOH L 6 .   ? 8.800   -17.169 37.464  1.00 32.50 ? 543 HOH B O   1 
HETATM 8494 O  O   . HOH L 6 .   ? 7.031   -6.871  25.276  1.00 22.88 ? 544 HOH B O   1 
HETATM 8495 O  O   . HOH L 6 .   ? -8.437  2.262   11.050  1.00 20.60 ? 545 HOH B O   1 
HETATM 8496 O  O   . HOH L 6 .   ? 16.896  17.757  15.963  1.00 28.30 ? 546 HOH B O   1 
HETATM 8497 O  O   . HOH L 6 .   ? -21.728 -5.097  35.206  1.00 22.21 ? 547 HOH B O   1 
HETATM 8498 O  O   . HOH L 6 .   ? 1.698   -18.771 9.844   1.00 30.42 ? 548 HOH B O   1 
HETATM 8499 O  O   . HOH L 6 .   ? 19.742  4.666   16.843  1.00 18.01 ? 549 HOH B O   1 
HETATM 8500 O  O   . HOH L 6 .   ? 8.470   0.416   24.620  1.00 25.63 ? 550 HOH B O   1 
HETATM 8501 O  O   . HOH L 6 .   ? 4.952   -25.596 21.061  1.00 21.36 ? 551 HOH B O   1 
HETATM 8502 O  O   . HOH L 6 .   ? 27.010  -14.019 37.174  1.00 31.05 ? 552 HOH B O   1 
HETATM 8503 O  O   . HOH L 6 .   ? 23.186  17.272  3.094   1.00 32.93 ? 553 HOH B O   1 
HETATM 8504 O  O   . HOH L 6 .   ? 1.327   -14.502 6.168   1.00 22.04 ? 554 HOH B O   1 
HETATM 8505 O  O   . HOH L 6 .   ? -3.306  4.147   29.200  1.00 34.95 ? 555 HOH B O   1 
HETATM 8506 O  O   . HOH L 6 .   ? 32.738  -12.469 16.206  1.00 37.75 ? 556 HOH B O   1 
HETATM 8507 O  O   . HOH L 6 .   ? -19.888 -16.855 20.693  1.00 38.98 ? 557 HOH B O   1 
HETATM 8508 O  O   . HOH L 6 .   ? -11.436 -6.334  5.014   1.00 37.41 ? 558 HOH B O   1 
HETATM 8509 O  O   . HOH L 6 .   ? 7.241   23.643  8.256   1.00 18.26 ? 559 HOH B O   1 
HETATM 8510 O  O   . HOH L 6 .   ? 16.032  12.064  38.728  1.00 29.98 ? 560 HOH B O   1 
HETATM 8511 O  O   . HOH L 6 .   ? -22.000 -13.969 27.375  1.00 28.19 ? 561 HOH B O   1 
HETATM 8512 O  O   . HOH L 6 .   ? 7.582   21.965  21.526  1.00 27.67 ? 562 HOH B O   1 
HETATM 8513 O  O   . HOH L 6 .   ? 24.039  5.432   1.585   1.00 36.12 ? 563 HOH B O   1 
HETATM 8514 O  O   . HOH L 6 .   ? 7.775   27.413  22.510  1.00 33.57 ? 564 HOH B O   1 
HETATM 8515 O  O   . HOH L 6 .   ? 3.069   -13.720 41.805  1.00 53.33 ? 565 HOH B O   1 
HETATM 8516 O  O   . HOH L 6 .   ? 3.634   -10.798 11.091  1.00 23.30 ? 566 HOH B O   1 
HETATM 8517 O  O   . HOH L 6 .   ? 6.955   16.671  17.397  1.00 28.26 ? 567 HOH B O   1 
HETATM 8518 O  O   . HOH L 6 .   ? -2.585  5.612   32.498  1.00 41.08 ? 568 HOH B O   1 
HETATM 8519 O  O   . HOH L 6 .   ? 2.178   -14.285 37.744  1.00 27.00 ? 569 HOH B O   1 
HETATM 8520 O  O   . HOH L 6 .   ? 8.517   17.009  7.751   1.00 17.32 ? 570 HOH B O   1 
HETATM 8521 O  O   . HOH L 6 .   ? 5.585   20.212  22.350  1.00 28.34 ? 571 HOH B O   1 
HETATM 8522 O  O   . HOH L 6 .   ? 14.627  29.558  1.478   1.00 38.30 ? 572 HOH B O   1 
HETATM 8523 O  O   . HOH L 6 .   ? 23.486  5.022   7.544   1.00 39.43 ? 573 HOH B O   1 
HETATM 8524 O  O   . HOH L 6 .   ? 14.164  17.034  9.306   1.00 25.56 ? 574 HOH B O   1 
HETATM 8525 O  O   . HOH L 6 .   ? 2.565   21.806  9.147   1.00 32.71 ? 575 HOH B O   1 
HETATM 8526 O  O   . HOH L 6 .   ? 13.965  23.120  4.438   1.00 16.68 ? 576 HOH B O   1 
HETATM 8527 O  O   . HOH L 6 .   ? 14.440  15.986  11.994  1.00 21.14 ? 577 HOH B O   1 
HETATM 8528 O  O   . HOH L 6 .   ? 21.414  11.782  14.792  1.00 21.43 ? 578 HOH B O   1 
HETATM 8529 O  O   . HOH L 6 .   ? -17.409 -3.697  17.271  1.00 20.84 ? 579 HOH B O   1 
HETATM 8530 O  O   . HOH L 6 .   ? 9.807   15.088  10.729  1.00 15.33 ? 580 HOH B O   1 
HETATM 8531 O  O   . HOH L 6 .   ? 24.567  8.354   21.133  1.00 23.34 ? 581 HOH B O   1 
HETATM 8532 O  O   . HOH L 6 .   ? 5.499   -8.764  11.126  1.00 15.39 ? 582 HOH B O   1 
HETATM 8533 O  O   . HOH L 6 .   ? 9.426   16.496  15.071  1.00 24.97 ? 583 HOH B O   1 
HETATM 8534 O  O   . HOH L 6 .   ? 13.651  13.741  12.695  1.00 20.77 ? 584 HOH B O   1 
HETATM 8535 O  O   . HOH L 6 .   ? -13.952 -12.554 39.006  1.00 36.98 ? 585 HOH B O   1 
HETATM 8536 O  O   . HOH L 6 .   ? 15.016  18.759  14.043  1.00 39.18 ? 586 HOH B O   1 
HETATM 8537 O  O   . HOH L 6 .   ? -6.009  5.122   28.303  1.00 23.74 ? 587 HOH B O   1 
HETATM 8538 O  O   . HOH L 6 .   ? -3.979  4.072   25.342  1.00 30.28 ? 588 HOH B O   1 
HETATM 8539 O  O   . HOH L 6 .   ? 20.443  13.369  16.590  1.00 12.55 ? 589 HOH B O   1 
HETATM 8540 O  O   . HOH L 6 .   ? -1.836  5.187   13.747  1.00 6.99  ? 590 HOH B O   1 
HETATM 8541 O  O   . HOH L 6 .   ? 1.299   0.459   16.684  1.00 16.93 ? 591 HOH B O   1 
HETATM 8542 O  O   . HOH L 6 .   ? 23.552  23.282  27.774  1.00 30.55 ? 592 HOH B O   1 
HETATM 8543 O  O   . HOH L 6 .   ? -3.148  -6.135  34.078  1.00 21.55 ? 593 HOH B O   1 
HETATM 8544 O  O   . HOH L 6 .   ? 17.680  21.507  15.804  1.00 30.63 ? 594 HOH B O   1 
HETATM 8545 O  O   . HOH L 6 .   ? 26.754  -21.845 43.435  1.00 32.76 ? 595 HOH B O   1 
HETATM 8546 O  O   . HOH L 6 .   ? 20.300  -7.553  12.473  1.00 41.26 ? 596 HOH B O   1 
HETATM 8547 O  O   . HOH L 6 .   ? -4.727  5.027   31.241  1.00 41.62 ? 597 HOH B O   1 
HETATM 8548 O  O   . HOH L 6 .   ? -21.226 -8.335  32.456  1.00 31.58 ? 598 HOH B O   1 
HETATM 8549 O  O   . HOH L 6 .   ? 15.236  -6.582  5.815   1.00 42.38 ? 599 HOH B O   1 
HETATM 8550 O  O   . HOH L 6 .   ? -15.192 1.606   29.161  1.00 36.16 ? 600 HOH B O   1 
HETATM 8551 O  O   . HOH L 6 .   ? 3.409   7.516   32.990  1.00 37.10 ? 603 HOH B O   1 
HETATM 8552 O  O   . HOH L 6 .   ? -10.119 5.194   29.624  1.00 17.75 ? 604 HOH B O   1 
HETATM 8553 O  O   . HOH L 6 .   ? -5.970  -9.740  37.721  1.00 52.69 ? 605 HOH B O   1 
HETATM 8554 O  O   . HOH L 6 .   ? 17.547  6.280   17.302  1.00 13.60 ? 606 HOH B O   1 
HETATM 8555 O  O   . HOH L 6 .   ? 25.494  -20.154 47.116  1.00 36.33 ? 607 HOH B O   1 
HETATM 8556 O  O   . HOH L 6 .   ? 6.594   20.592  -5.615  1.00 36.88 ? 608 HOH B O   1 
HETATM 8557 O  O   . HOH L 6 .   ? -4.845  -20.469 6.556   1.00 26.56 ? 609 HOH B O   1 
HETATM 8558 O  O   . HOH L 6 .   ? 21.283  5.559   14.746  1.00 24.92 ? 610 HOH B O   1 
HETATM 8559 O  O   . HOH L 6 .   ? 21.469  1.261   28.735  1.00 31.39 ? 611 HOH B O   1 
HETATM 8560 O  O   . HOH L 6 .   ? 15.878  17.679  19.923  1.00 33.57 ? 612 HOH B O   1 
HETATM 8561 O  O   . HOH L 6 .   ? 20.335  -21.545 27.947  1.00 29.24 ? 613 HOH B O   1 
HETATM 8562 O  O   . HOH L 6 .   ? 4.002   22.194  -5.498  1.00 38.49 ? 614 HOH B O   1 
HETATM 8563 O  O   . HOH L 6 .   ? -3.838  13.184  22.483  1.00 23.93 ? 615 HOH B O   1 
HETATM 8564 O  O   . HOH L 6 .   ? 23.514  22.113  21.839  1.00 28.72 ? 616 HOH B O   1 
HETATM 8565 O  O   . HOH L 6 .   ? 18.736  6.557   40.580  1.00 35.99 ? 617 HOH B O   1 
HETATM 8566 O  O   . HOH L 6 .   ? 0.059   -18.216 36.531  1.00 35.27 ? 618 HOH B O   1 
HETATM 8567 O  O   . HOH L 6 .   ? 13.792  -11.479 37.824  1.00 35.44 ? 619 HOH B O   1 
HETATM 8568 O  O   . HOH L 6 .   ? -15.898 -15.733 30.986  1.00 37.08 ? 620 HOH B O   1 
HETATM 8569 O  O   . HOH L 6 .   ? 3.409   -22.956 25.143  1.00 35.20 ? 621 HOH B O   1 
HETATM 8570 O  O   . HOH L 6 .   ? -14.990 -17.357 12.900  1.00 37.76 ? 622 HOH B O   1 
HETATM 8571 O  O   . HOH L 6 .   ? 13.482  23.967  -3.725  1.00 32.26 ? 623 HOH B O   1 
HETATM 8572 O  O   . HOH L 6 .   ? 0.096   4.548   15.224  1.00 10.28 ? 624 HOH B O   1 
HETATM 8573 O  O   . HOH L 6 .   ? 5.008   -18.588 33.547  1.00 31.03 ? 625 HOH B O   1 
HETATM 8574 O  O   . HOH L 6 .   ? 0.558   2.871   17.487  1.00 16.05 ? 626 HOH B O   1 
HETATM 8575 O  O   . HOH L 6 .   ? -8.384  -27.803 18.150  1.00 33.61 ? 627 HOH B O   1 
HETATM 8576 O  O   . HOH L 6 .   ? 27.572  -20.338 41.295  1.00 43.31 ? 628 HOH B O   1 
HETATM 8577 O  O   . HOH L 6 .   ? -13.957 3.857   23.270  1.00 26.33 ? 629 HOH B O   1 
HETATM 8578 O  O   . HOH L 6 .   ? -5.979  -19.363 29.577  1.00 33.03 ? 630 HOH B O   1 
HETATM 8579 O  O   . HOH L 6 .   ? 12.010  26.570  30.245  1.00 42.29 ? 631 HOH B O   1 
HETATM 8580 O  O   . HOH L 6 .   ? 29.454  3.629   19.319  1.00 27.48 ? 632 HOH B O   1 
HETATM 8581 O  O   . HOH L 6 .   ? -4.569  8.417   12.271  1.00 36.14 ? 633 HOH B O   1 
HETATM 8582 O  O   . HOH L 6 .   ? -13.152 4.785   20.846  1.00 30.68 ? 634 HOH B O   1 
HETATM 8583 O  O   . HOH M 6 .   ? 9.868   -23.332 4.253   1.00 41.04 ? 289 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   44  ?   ?   ?   A . n 
A 1 2   PRO 2   45  45  PRO PRO A . n 
A 1 3   ARG 3   46  46  ARG ARG A . n 
A 1 4   PRO 4   47  47  PRO PRO A . n 
A 1 5   PHE 5   48  48  PHE PHE A . n 
A 1 6   ASN 6   49  49  ASN ASN A . n 
A 1 7   GLU 7   50  50  GLU GLU A . n 
A 1 8   ILE 8   51  51  ILE ILE A . n 
A 1 9   PRO 9   52  52  PRO PRO A . n 
A 1 10  SER 10  53  53  SER SER A . n 
A 1 11  PRO 11  54  54  PRO PRO A . n 
A 1 12  GLY 12  55  55  GLY GLY A . n 
A 1 13  ASP 13  56  56  ASP ASP A . n 
A 1 14  ASN 14  57  57  ASN ASN A . n 
A 1 15  GLY 15  58  58  GLY GLY A . n 
A 1 16  TRP 16  59  59  TRP TRP A . n 
A 1 17  LEU 17  60  60  LEU LEU A . n 
A 1 18  ASN 18  61  61  ASN ASN A . n 
A 1 19  LEU 19  62  62  LEU LEU A . n 
A 1 20  TYR 20  63  63  TYR TYR A . n 
A 1 21  HIS 21  64  64  HIS HIS A . n 
A 1 22  PHE 22  65  65  PHE PHE A . n 
A 1 23  TRP 23  66  66  TRP TRP A . n 
A 1 24  ARG 24  67  67  ARG ARG A . n 
A 1 25  GLU 25  68  68  GLU GLU A . n 
A 1 26  THR 26  69  69  THR THR A . n 
A 1 27  GLY 27  70  70  GLY GLY A . n 
A 1 28  THR 28  71  71  THR THR A . n 
A 1 29  HIS 29  72  72  HIS HIS A . n 
A 1 30  LYS 30  73  73  LYS LYS A . n 
A 1 31  VAL 31  74  74  VAL VAL A . n 
A 1 32  HIS 32  75  75  HIS HIS A . n 
A 1 33  LEU 33  76  76  LEU LEU A . n 
A 1 34  HIS 34  77  77  HIS HIS A . n 
A 1 35  HIS 35  78  78  HIS HIS A . n 
A 1 36  VAL 36  79  79  VAL VAL A . n 
A 1 37  GLN 37  80  80  GLN GLN A . n 
A 1 38  ASN 38  81  81  ASN ASN A . n 
A 1 39  PHE 39  82  82  PHE PHE A . n 
A 1 40  GLN 40  83  83  GLN GLN A . n 
A 1 41  LYS 41  84  84  LYS LYS A . n 
A 1 42  TYR 42  85  85  TYR TYR A . n 
A 1 43  GLY 43  86  86  GLY GLY A . n 
A 1 44  PRO 44  87  87  PRO PRO A . n 
A 1 45  ILE 45  88  88  ILE ILE A . n 
A 1 46  TYR 46  89  89  TYR TYR A . n 
A 1 47  ARG 47  90  90  ARG ARG A . n 
A 1 48  GLU 48  91  91  GLU GLU A . n 
A 1 49  LYS 49  92  92  LYS LYS A . n 
A 1 50  LEU 50  93  93  LEU LEU A . n 
A 1 51  GLY 51  94  94  GLY GLY A . n 
A 1 52  ASN 52  95  95  ASN ASN A . n 
A 1 53  VAL 53  96  96  VAL VAL A . n 
A 1 54  GLU 54  97  97  GLU GLU A . n 
A 1 55  SER 55  98  98  SER SER A . n 
A 1 56  VAL 56  99  99  VAL VAL A . n 
A 1 57  TYR 57  100 100 TYR TYR A . n 
A 1 58  VAL 58  101 101 VAL VAL A . n 
A 1 59  ILE 59  102 102 ILE ILE A . n 
A 1 60  ASP 60  103 103 ASP ASP A . n 
A 1 61  PRO 61  104 104 PRO PRO A . n 
A 1 62  GLU 62  105 105 GLU GLU A . n 
A 1 63  ASP 63  106 106 ASP ASP A . n 
A 1 64  VAL 64  107 107 VAL VAL A . n 
A 1 65  ALA 65  108 108 ALA ALA A . n 
A 1 66  LEU 66  109 109 LEU LEU A . n 
A 1 67  LEU 67  110 110 LEU LEU A . n 
A 1 68  PHE 68  111 111 PHE PHE A . n 
A 1 69  LYS 69  112 112 LYS LYS A . n 
A 1 70  SER 70  113 113 SER SER A . n 
A 1 71  GLU 71  114 114 GLU GLU A . n 
A 1 72  GLY 72  115 115 GLY GLY A . n 
A 1 73  PRO 73  116 116 PRO PRO A . n 
A 1 74  ASN 74  117 117 ASN ASN A . n 
A 1 75  PRO 75  118 118 PRO PRO A . n 
A 1 76  GLU 76  119 119 GLU GLU A . n 
A 1 77  ARG 77  120 120 ARG ARG A . n 
A 1 78  PHE 78  121 121 PHE PHE A . n 
A 1 79  LEU 79  122 122 LEU LEU A . n 
A 1 80  ILE 80  123 123 ILE ILE A . n 
A 1 81  PRO 81  124 124 PRO PRO A . n 
A 1 82  PRO 82  125 125 PRO PRO A . n 
A 1 83  TRP 83  126 126 TRP TRP A . n 
A 1 84  VAL 84  127 127 VAL VAL A . n 
A 1 85  ALA 85  128 128 ALA ALA A . n 
A 1 86  TYR 86  129 129 TYR TYR A . n 
A 1 87  HIS 87  130 130 HIS HIS A . n 
A 1 88  GLN 88  131 131 GLN GLN A . n 
A 1 89  TYR 89  132 132 TYR TYR A . n 
A 1 90  TYR 90  133 133 TYR TYR A . n 
A 1 91  GLN 91  134 134 GLN GLN A . n 
A 1 92  ARG 92  135 135 ARG ARG A . n 
A 1 93  PRO 93  136 136 PRO PRO A . n 
A 1 94  ILE 94  137 137 ILE ILE A . n 
A 1 95  GLY 95  138 138 GLY GLY A . n 
A 1 96  VAL 96  139 139 VAL VAL A . n 
A 1 97  LEU 97  140 140 LEU LEU A . n 
A 1 98  LEU 98  141 141 LEU LEU A . n 
A 1 99  LYS 99  142 142 LYS LYS A . n 
A 1 100 LYS 100 143 143 LYS LYS A . n 
A 1 101 SER 101 144 144 SER SER A . n 
A 1 102 ALA 102 145 145 ALA ALA A . n 
A 1 103 ALA 103 146 146 ALA ALA A . n 
A 1 104 TRP 104 147 147 TRP TRP A . n 
A 1 105 LYS 105 148 148 LYS LYS A . n 
A 1 106 LYS 106 149 149 LYS LYS A . n 
A 1 107 ASP 107 150 150 ASP ASP A . n 
A 1 108 ARG 108 151 151 ARG ARG A . n 
A 1 109 VAL 109 152 152 VAL VAL A . n 
A 1 110 ALA 110 153 153 ALA ALA A . n 
A 1 111 LEU 111 154 154 LEU LEU A . n 
A 1 112 ASN 112 155 155 ASN ASN A . n 
A 1 113 GLN 113 156 156 GLN GLN A . n 
A 1 114 GLU 114 157 157 GLU GLU A . n 
A 1 115 VAL 115 158 158 VAL VAL A . n 
A 1 116 MET 116 159 159 MET MET A . n 
A 1 117 ALA 117 160 160 ALA ALA A . n 
A 1 118 PRO 118 161 161 PRO PRO A . n 
A 1 119 GLU 119 162 162 GLU GLU A . n 
A 1 120 ALA 120 163 163 ALA ALA A . n 
A 1 121 THR 121 164 164 THR THR A . n 
A 1 122 LYS 122 165 165 LYS LYS A . n 
A 1 123 ASN 123 166 166 ASN ASN A . n 
A 1 124 PHE 124 167 167 PHE PHE A . n 
A 1 125 LEU 125 168 168 LEU LEU A . n 
A 1 126 PRO 126 169 169 PRO PRO A . n 
A 1 127 LEU 127 170 170 LEU LEU A . n 
A 1 128 LEU 128 171 171 LEU LEU A . n 
A 1 129 ASP 129 172 172 ASP ASP A . n 
A 1 130 ALA 130 173 173 ALA ALA A . n 
A 1 131 VAL 131 174 174 VAL VAL A . n 
A 1 132 SER 132 175 175 SER SER A . n 
A 1 133 ARG 133 176 176 ARG ARG A . n 
A 1 134 ASP 134 177 177 ASP ASP A . n 
A 1 135 PHE 135 178 178 PHE PHE A . n 
A 1 136 VAL 136 179 179 VAL VAL A . n 
A 1 137 SER 137 180 180 SER SER A . n 
A 1 138 VAL 138 181 181 VAL VAL A . n 
A 1 139 LEU 139 182 182 LEU LEU A . n 
A 1 140 HIS 140 183 183 HIS HIS A . n 
A 1 141 ARG 141 184 184 ARG ARG A . n 
A 1 142 ARG 142 185 185 ARG ARG A . n 
A 1 143 ILE 143 186 186 ILE ILE A . n 
A 1 144 LYS 144 187 187 LYS LYS A . n 
A 1 145 LYS 145 188 188 LYS LYS A . n 
A 1 146 ALA 146 189 189 ALA ALA A . n 
A 1 147 GLY 147 190 190 GLY GLY A . n 
A 1 148 SER 148 191 191 SER SER A . n 
A 1 149 GLY 149 192 192 GLY GLY A . n 
A 1 150 ASN 150 193 193 ASN ASN A . n 
A 1 151 TYR 151 194 194 TYR TYR A . n 
A 1 152 SER 152 195 195 SER SER A . n 
A 1 153 GLY 153 196 196 GLY GLY A . n 
A 1 154 ASP 154 197 197 ASP ASP A . n 
A 1 155 ILE 155 198 198 ILE ILE A . n 
A 1 156 SER 156 199 199 SER SER A . n 
A 1 157 ASP 157 200 200 ASP ASP A . n 
A 1 158 ASP 158 201 201 ASP ASP A . n 
A 1 159 LEU 159 202 202 LEU LEU A . n 
A 1 160 PHE 160 203 203 PHE PHE A . n 
A 1 161 ARG 161 204 204 ARG ARG A . n 
A 1 162 PHE 162 205 205 PHE PHE A . n 
A 1 163 ALA 163 206 206 ALA ALA A . n 
A 1 164 PHE 164 207 207 PHE PHE A . n 
A 1 165 GLU 165 208 208 GLU GLU A . n 
A 1 166 SER 166 209 209 SER SER A . n 
A 1 167 ILE 167 210 210 ILE ILE A . n 
A 1 168 THR 168 211 211 THR THR A . n 
A 1 169 ASN 169 212 212 ASN ASN A . n 
A 1 170 VAL 170 213 213 VAL VAL A . n 
A 1 171 ILE 171 214 214 ILE ILE A . n 
A 1 172 PHE 172 215 215 PHE PHE A . n 
A 1 173 GLY 173 216 216 GLY GLY A . n 
A 1 174 GLU 174 217 217 GLU GLU A . n 
A 1 175 ARG 175 218 218 ARG ARG A . n 
A 1 176 GLN 176 219 219 GLN GLN A . n 
A 1 177 GLY 177 220 220 GLY GLY A . n 
A 1 178 MET 178 221 221 MET MET A . n 
A 1 179 LEU 179 222 222 LEU LEU A . n 
A 1 180 GLU 180 223 223 GLU GLU A . n 
A 1 181 GLU 181 224 224 GLU GLU A . n 
A 1 182 VAL 182 225 225 VAL VAL A . n 
A 1 183 VAL 183 226 226 VAL VAL A . n 
A 1 184 ASN 184 227 227 ASN ASN A . n 
A 1 185 PRO 185 228 228 PRO PRO A . n 
A 1 186 GLU 186 229 229 GLU GLU A . n 
A 1 187 ALA 187 230 230 ALA ALA A . n 
A 1 188 GLN 188 231 231 GLN GLN A . n 
A 1 189 ARG 189 232 232 ARG ARG A . n 
A 1 190 PHE 190 233 233 PHE PHE A . n 
A 1 191 ILE 191 234 234 ILE ILE A . n 
A 1 192 ASP 192 235 235 ASP ASP A . n 
A 1 193 ALA 193 236 236 ALA ALA A . n 
A 1 194 ILE 194 237 237 ILE ILE A . n 
A 1 195 TYR 195 238 238 TYR TYR A . n 
A 1 196 GLN 196 239 239 GLN GLN A . n 
A 1 197 MET 197 240 240 MET MET A . n 
A 1 198 PHE 198 241 241 PHE PHE A . n 
A 1 199 HIS 199 242 242 HIS HIS A . n 
A 1 200 THR 200 243 243 THR THR A . n 
A 1 201 SER 201 244 244 SER SER A . n 
A 1 202 VAL 202 245 245 VAL VAL A . n 
A 1 203 PRO 203 246 246 PRO PRO A . n 
A 1 204 MET 204 247 247 MET MET A . n 
A 1 205 LEU 205 248 248 LEU LEU A . n 
A 1 206 ASN 206 249 249 ASN ASN A . n 
A 1 207 LEU 207 250 250 LEU LEU A . n 
A 1 208 PRO 208 251 251 PRO PRO A . n 
A 1 209 PRO 209 252 252 PRO PRO A . n 
A 1 210 ASP 210 253 253 ASP ASP A . n 
A 1 211 LEU 211 254 254 LEU LEU A . n 
A 1 212 PHE 212 255 255 PHE PHE A . n 
A 1 213 ARG 213 256 256 ARG ARG A . n 
A 1 214 LEU 214 257 257 LEU LEU A . n 
A 1 215 PHE 215 258 258 PHE PHE A . n 
A 1 216 ARG 216 259 259 ARG ARG A . n 
A 1 217 THR 217 260 260 THR THR A . n 
A 1 218 LYS 218 261 261 LYS LYS A . n 
A 1 219 THR 219 262 262 THR THR A . n 
A 1 220 TRP 220 263 263 TRP TRP A . n 
A 1 221 LYS 221 264 264 LYS LYS A . n 
A 1 222 ASP 222 265 265 ASP ASP A . n 
A 1 223 HIS 223 266 266 HIS HIS A . n 
A 1 224 VAL 224 267 267 VAL VAL A . n 
A 1 225 ALA 225 268 268 ALA ALA A . n 
A 1 226 ALA 226 269 269 ALA ALA A . n 
A 1 227 TRP 227 270 270 TRP TRP A . n 
A 1 228 ASP 228 271 271 ASP ASP A . n 
A 1 229 VAL 229 272 272 VAL VAL A . n 
A 1 230 ILE 230 273 273 ILE ILE A . n 
A 1 231 PHE 231 274 274 PHE PHE A . n 
A 1 232 SER 232 275 275 SER SER A . n 
A 1 233 LYS 233 276 276 LYS LYS A . n 
A 1 234 ALA 234 277 277 ALA ALA A . n 
A 1 235 ASP 235 278 278 ASP ASP A . n 
A 1 236 ILE 236 279 279 ILE ILE A . n 
A 1 237 TYR 237 280 280 TYR TYR A . n 
A 1 238 THR 238 281 281 THR THR A . n 
A 1 239 GLN 239 282 282 GLN GLN A . n 
A 1 240 ASN 240 283 283 ASN ASN A . n 
A 1 241 PHE 241 284 284 PHE PHE A . n 
A 1 242 TYR 242 285 285 TYR TYR A . n 
A 1 243 TRP 243 286 286 TRP TRP A . n 
A 1 244 GLU 244 287 287 GLU GLU A . n 
A 1 245 LEU 245 288 288 LEU LEU A . n 
A 1 246 ARG 246 289 289 ARG ARG A . n 
A 1 247 GLN 247 290 290 GLN GLN A . n 
A 1 248 LYS 248 291 291 LYS LYS A . n 
A 1 249 GLY 249 292 292 GLY GLY A . n 
A 1 250 SER 250 293 293 SER SER A . n 
A 1 251 VAL 251 294 294 VAL VAL A . n 
A 1 252 HIS 252 295 295 HIS HIS A . n 
A 1 253 HIS 253 296 296 HIS HIS A . n 
A 1 254 ASP 254 297 297 ASP ASP A . n 
A 1 255 TYR 255 298 298 TYR TYR A . n 
A 1 256 ARG 256 299 299 ARG ARG A . n 
A 1 257 GLY 257 300 300 GLY GLY A . n 
A 1 258 ILE 258 301 301 ILE ILE A . n 
A 1 259 LEU 259 302 302 LEU LEU A . n 
A 1 260 TYR 260 303 303 TYR TYR A . n 
A 1 261 ARG 261 304 304 ARG ARG A . n 
A 1 262 LEU 262 305 305 LEU LEU A . n 
A 1 263 LEU 263 306 306 LEU LEU A . n 
A 1 264 GLY 264 307 307 GLY GLY A . n 
A 1 265 ASP 265 308 308 ASP ASP A . n 
A 1 266 SER 266 309 309 SER SER A . n 
A 1 267 LYS 267 310 310 LYS LYS A . n 
A 1 268 MET 268 311 311 MET MET A . n 
A 1 269 SER 269 312 312 SER SER A . n 
A 1 270 PHE 270 313 313 PHE PHE A . n 
A 1 271 GLU 271 314 314 GLU GLU A . n 
A 1 272 ASP 272 315 315 ASP ASP A . n 
A 1 273 ILE 273 316 316 ILE ILE A . n 
A 1 274 LYS 274 317 317 LYS LYS A . n 
A 1 275 ALA 275 318 318 ALA ALA A . n 
A 1 276 ASN 276 319 319 ASN ASN A . n 
A 1 277 VAL 277 320 320 VAL VAL A . n 
A 1 278 THR 278 321 321 THR THR A . n 
A 1 279 GLU 279 322 322 GLU GLU A . n 
A 1 280 MET 280 323 323 MET MET A . n 
A 1 281 LEU 281 324 324 LEU LEU A . n 
A 1 282 ALA 282 325 325 ALA ALA A . n 
A 1 283 GLY 283 326 326 GLY GLY A . n 
A 1 284 GLY 284 327 327 GLY GLY A . n 
A 1 285 VAL 285 328 328 VAL VAL A . n 
A 1 286 ASP 286 329 329 ASP ASP A . n 
A 1 287 THR 287 330 330 THR THR A . n 
A 1 288 THR 288 331 331 THR THR A . n 
A 1 289 SER 289 332 332 SER SER A . n 
A 1 290 MET 290 333 333 MET MET A . n 
A 1 291 THR 291 334 334 THR THR A . n 
A 1 292 LEU 292 335 335 LEU LEU A . n 
A 1 293 GLN 293 336 336 GLN GLN A . n 
A 1 294 TRP 294 337 337 TRP TRP A . n 
A 1 295 HIS 295 338 338 HIS HIS A . n 
A 1 296 LEU 296 339 339 LEU LEU A . n 
A 1 297 TYR 297 340 340 TYR TYR A . n 
A 1 298 GLU 298 341 341 GLU GLU A . n 
A 1 299 MET 299 342 342 MET MET A . n 
A 1 300 ALA 300 343 343 ALA ALA A . n 
A 1 301 ARG 301 344 344 ARG ARG A . n 
A 1 302 ASN 302 345 345 ASN ASN A . n 
A 1 303 LEU 303 346 346 LEU LEU A . n 
A 1 304 LYS 304 347 347 LYS LYS A . n 
A 1 305 VAL 305 348 348 VAL VAL A . n 
A 1 306 GLN 306 349 349 GLN GLN A . n 
A 1 307 ASP 307 350 350 ASP ASP A . n 
A 1 308 MET 308 351 351 MET MET A . n 
A 1 309 LEU 309 352 352 LEU LEU A . n 
A 1 310 ARG 310 353 353 ARG ARG A . n 
A 1 311 ALA 311 354 354 ALA ALA A . n 
A 1 312 GLU 312 355 355 GLU GLU A . n 
A 1 313 VAL 313 356 356 VAL VAL A . n 
A 1 314 LEU 314 357 357 LEU LEU A . n 
A 1 315 ALA 315 358 358 ALA ALA A . n 
A 1 316 ALA 316 359 359 ALA ALA A . n 
A 1 317 ARG 317 360 360 ARG ARG A . n 
A 1 318 HIS 318 361 361 HIS HIS A . n 
A 1 319 GLN 319 362 362 GLN GLN A . n 
A 1 320 ALA 320 363 363 ALA ALA A . n 
A 1 321 GLN 321 364 364 GLN GLN A . n 
A 1 322 GLY 322 365 365 GLY GLY A . n 
A 1 323 ASP 323 366 366 ASP ASP A . n 
A 1 324 MET 324 367 367 MET MET A . n 
A 1 325 ALA 325 368 368 ALA ALA A . n 
A 1 326 THR 326 369 369 THR THR A . n 
A 1 327 MET 327 370 370 MET MET A . n 
A 1 328 LEU 328 371 371 LEU LEU A . n 
A 1 329 GLN 329 372 372 GLN GLN A . n 
A 1 330 LEU 330 373 373 LEU LEU A . n 
A 1 331 VAL 331 374 374 VAL VAL A . n 
A 1 332 PRO 332 375 375 PRO PRO A . n 
A 1 333 LEU 333 376 376 LEU LEU A . n 
A 1 334 LEU 334 377 377 LEU LEU A . n 
A 1 335 LYS 335 378 378 LYS LYS A . n 
A 1 336 ALA 336 379 379 ALA ALA A . n 
A 1 337 SER 337 380 380 SER SER A . n 
A 1 338 ILE 338 381 381 ILE ILE A . n 
A 1 339 LYS 339 382 382 LYS LYS A . n 
A 1 340 GLU 340 383 383 GLU GLU A . n 
A 1 341 THR 341 384 384 THR THR A . n 
A 1 342 LEU 342 385 385 LEU LEU A . n 
A 1 343 ARG 343 386 386 ARG ARG A . n 
A 1 344 LEU 344 387 387 LEU LEU A . n 
A 1 345 HIS 345 388 388 HIS HIS A . n 
A 1 346 PRO 346 389 389 PRO PRO A . n 
A 1 347 ILE 347 390 390 ILE ILE A . n 
A 1 348 SER 348 391 391 SER SER A . n 
A 1 349 VAL 349 392 392 VAL VAL A . n 
A 1 350 THR 350 393 393 THR THR A . n 
A 1 351 LEU 351 394 394 LEU LEU A . n 
A 1 352 GLN 352 395 395 GLN GLN A . n 
A 1 353 ARG 353 396 396 ARG ARG A . n 
A 1 354 TYR 354 397 397 TYR TYR A . n 
A 1 355 LEU 355 398 398 LEU LEU A . n 
A 1 356 VAL 356 399 399 VAL VAL A . n 
A 1 357 ASN 357 400 400 ASN ASN A . n 
A 1 358 ASP 358 401 401 ASP ASP A . n 
A 1 359 LEU 359 402 402 LEU LEU A . n 
A 1 360 VAL 360 403 403 VAL VAL A . n 
A 1 361 LEU 361 404 404 LEU LEU A . n 
A 1 362 ARG 362 405 405 ARG ARG A . n 
A 1 363 ASP 363 406 406 ASP ASP A . n 
A 1 364 TYR 364 407 407 TYR TYR A . n 
A 1 365 MET 365 408 408 MET MET A . n 
A 1 366 ILE 366 409 409 ILE ILE A . n 
A 1 367 PRO 367 410 410 PRO PRO A . n 
A 1 368 ALA 368 411 411 ALA ALA A . n 
A 1 369 LYS 369 412 412 LYS LYS A . n 
A 1 370 THR 370 413 413 THR THR A . n 
A 1 371 LEU 371 414 414 LEU LEU A . n 
A 1 372 VAL 372 415 415 VAL VAL A . n 
A 1 373 GLN 373 416 416 GLN GLN A . n 
A 1 374 VAL 374 417 417 VAL VAL A . n 
A 1 375 ALA 375 418 418 ALA ALA A . n 
A 1 376 ILE 376 419 419 ILE ILE A . n 
A 1 377 TYR 377 420 420 TYR TYR A . n 
A 1 378 ALA 378 421 421 ALA ALA A . n 
A 1 379 LEU 379 422 422 LEU LEU A . n 
A 1 380 GLY 380 423 423 GLY GLY A . n 
A 1 381 ARG 381 424 424 ARG ARG A . n 
A 1 382 GLU 382 425 425 GLU GLU A . n 
A 1 383 PRO 383 426 426 PRO PRO A . n 
A 1 384 THR 384 427 427 THR THR A . n 
A 1 385 PHE 385 428 428 PHE PHE A . n 
A 1 386 PHE 386 429 429 PHE PHE A . n 
A 1 387 PHE 387 430 430 PHE PHE A . n 
A 1 388 ASP 388 431 431 ASP ASP A . n 
A 1 389 PRO 389 432 432 PRO PRO A . n 
A 1 390 GLU 390 433 433 GLU GLU A . n 
A 1 391 ASN 391 434 434 ASN ASN A . n 
A 1 392 PHE 392 435 435 PHE PHE A . n 
A 1 393 ASP 393 436 436 ASP ASP A . n 
A 1 394 PRO 394 437 437 PRO PRO A . n 
A 1 395 THR 395 438 438 THR THR A . n 
A 1 396 ARG 396 439 439 ARG ARG A . n 
A 1 397 TRP 397 440 440 TRP TRP A . n 
A 1 398 LEU 398 441 441 LEU LEU A . n 
A 1 399 SER 399 442 442 SER SER A . n 
A 1 400 LYS 400 443 443 LYS LYS A . n 
A 1 401 ASP 401 444 444 ASP ASP A . n 
A 1 402 LYS 402 445 445 LYS LYS A . n 
A 1 403 ASN 403 446 446 ASN ASN A . n 
A 1 404 ILE 404 447 447 ILE ILE A . n 
A 1 405 THR 405 448 448 THR THR A . n 
A 1 406 TYR 406 449 449 TYR TYR A . n 
A 1 407 PHE 407 450 450 PHE PHE A . n 
A 1 408 ARG 408 451 451 ARG ARG A . n 
A 1 409 ASN 409 452 452 ASN ASN A . n 
A 1 410 LEU 410 453 453 LEU LEU A . n 
A 1 411 GLY 411 454 454 GLY GLY A . n 
A 1 412 PHE 412 455 455 PHE PHE A . n 
A 1 413 GLY 413 456 456 GLY GLY A . n 
A 1 414 TRP 414 457 457 TRP TRP A . n 
A 1 415 GLY 415 458 458 GLY GLY A . n 
A 1 416 VAL 416 459 459 VAL VAL A . n 
A 1 417 ARG 417 460 460 ARG ARG A . n 
A 1 418 GLN 418 461 461 GLN GLN A . n 
A 1 419 CYS 419 462 462 CYS CYS A . n 
A 1 420 LEU 420 463 463 LEU LEU A . n 
A 1 421 GLY 421 464 464 GLY GLY A . n 
A 1 422 ARG 422 465 465 ARG ARG A . n 
A 1 423 ARG 423 466 466 ARG ARG A . n 
A 1 424 ILE 424 467 467 ILE ILE A . n 
A 1 425 ALA 425 468 468 ALA ALA A . n 
A 1 426 GLU 426 469 469 GLU GLU A . n 
A 1 427 LEU 427 470 470 LEU LEU A . n 
A 1 428 GLU 428 471 471 GLU GLU A . n 
A 1 429 MET 429 472 472 MET MET A . n 
A 1 430 THR 430 473 473 THR THR A . n 
A 1 431 ILE 431 474 474 ILE ILE A . n 
A 1 432 PHE 432 475 475 PHE PHE A . n 
A 1 433 LEU 433 476 476 LEU LEU A . n 
A 1 434 ILE 434 477 477 ILE ILE A . n 
A 1 435 ASN 435 478 478 ASN ASN A . n 
A 1 436 MET 436 479 479 MET MET A . n 
A 1 437 LEU 437 480 480 LEU LEU A . n 
A 1 438 GLU 438 481 481 GLU GLU A . n 
A 1 439 ASN 439 482 482 ASN ASN A . n 
A 1 440 PHE 440 483 483 PHE PHE A . n 
A 1 441 ARG 441 484 484 ARG ARG A . n 
A 1 442 VAL 442 485 485 VAL VAL A . n 
A 1 443 GLU 443 486 486 GLU GLU A . n 
A 1 444 ILE 444 487 487 ILE ILE A . n 
A 1 445 GLN 445 488 488 GLN GLN A . n 
A 1 446 HIS 446 489 489 HIS HIS A . n 
A 1 447 LEU 447 490 490 LEU LEU A . n 
A 1 448 SER 448 491 491 SER SER A . n 
A 1 449 ASP 449 492 492 ASP ASP A . n 
A 1 450 VAL 450 493 493 VAL VAL A . n 
A 1 451 GLY 451 494 494 GLY GLY A . n 
A 1 452 THR 452 495 495 THR THR A . n 
A 1 453 THR 453 496 496 THR THR A . n 
A 1 454 PHE 454 497 497 PHE PHE A . n 
A 1 455 ASN 455 498 498 ASN ASN A . n 
A 1 456 LEU 456 499 499 LEU LEU A . n 
A 1 457 ILE 457 500 500 ILE ILE A . n 
A 1 458 LEU 458 501 501 LEU LEU A . n 
A 1 459 MET 459 502 502 MET MET A . n 
A 1 460 PRO 460 503 503 PRO PRO A . n 
A 1 461 GLU 461 504 504 GLU GLU A . n 
A 1 462 LYS 462 505 505 LYS LYS A . n 
A 1 463 PRO 463 506 506 PRO PRO A . n 
A 1 464 ILE 464 507 507 ILE ILE A . n 
A 1 465 SER 465 508 508 SER SER A . n 
A 1 466 PHE 466 509 509 PHE PHE A . n 
A 1 467 THR 467 510 510 THR THR A . n 
A 1 468 PHE 468 511 511 PHE PHE A . n 
A 1 469 TRP 469 512 512 TRP TRP A . n 
A 1 470 PRO 470 513 513 PRO PRO A . n 
A 1 471 PHE 471 514 514 PHE PHE A . n 
B 1 1   SER 1   44  ?   ?   ?   B . n 
B 1 2   PRO 2   45  45  PRO PRO B . n 
B 1 3   ARG 3   46  46  ARG ARG B . n 
B 1 4   PRO 4   47  47  PRO PRO B . n 
B 1 5   PHE 5   48  48  PHE PHE B . n 
B 1 6   ASN 6   49  49  ASN ASN B . n 
B 1 7   GLU 7   50  50  GLU GLU B . n 
B 1 8   ILE 8   51  51  ILE ILE B . n 
B 1 9   PRO 9   52  52  PRO PRO B . n 
B 1 10  SER 10  53  53  SER SER B . n 
B 1 11  PRO 11  54  54  PRO PRO B . n 
B 1 12  GLY 12  55  55  GLY GLY B . n 
B 1 13  ASP 13  56  56  ASP ASP B . n 
B 1 14  ASN 14  57  57  ASN ASN B . n 
B 1 15  GLY 15  58  58  GLY GLY B . n 
B 1 16  TRP 16  59  59  TRP TRP B . n 
B 1 17  LEU 17  60  60  LEU LEU B . n 
B 1 18  ASN 18  61  61  ASN ASN B . n 
B 1 19  LEU 19  62  62  LEU LEU B . n 
B 1 20  TYR 20  63  63  TYR TYR B . n 
B 1 21  HIS 21  64  64  HIS HIS B . n 
B 1 22  PHE 22  65  65  PHE PHE B . n 
B 1 23  TRP 23  66  66  TRP TRP B . n 
B 1 24  ARG 24  67  67  ARG ARG B . n 
B 1 25  GLU 25  68  68  GLU GLU B . n 
B 1 26  THR 26  69  69  THR THR B . n 
B 1 27  GLY 27  70  70  GLY GLY B . n 
B 1 28  THR 28  71  71  THR THR B . n 
B 1 29  HIS 29  72  72  HIS HIS B . n 
B 1 30  LYS 30  73  73  LYS LYS B . n 
B 1 31  VAL 31  74  74  VAL VAL B . n 
B 1 32  HIS 32  75  75  HIS HIS B . n 
B 1 33  LEU 33  76  76  LEU LEU B . n 
B 1 34  HIS 34  77  77  HIS HIS B . n 
B 1 35  HIS 35  78  78  HIS HIS B . n 
B 1 36  VAL 36  79  79  VAL VAL B . n 
B 1 37  GLN 37  80  80  GLN GLN B . n 
B 1 38  ASN 38  81  81  ASN ASN B . n 
B 1 39  PHE 39  82  82  PHE PHE B . n 
B 1 40  GLN 40  83  83  GLN GLN B . n 
B 1 41  LYS 41  84  84  LYS LYS B . n 
B 1 42  TYR 42  85  85  TYR TYR B . n 
B 1 43  GLY 43  86  86  GLY GLY B . n 
B 1 44  PRO 44  87  87  PRO PRO B . n 
B 1 45  ILE 45  88  88  ILE ILE B . n 
B 1 46  TYR 46  89  89  TYR TYR B . n 
B 1 47  ARG 47  90  90  ARG ARG B . n 
B 1 48  GLU 48  91  91  GLU GLU B . n 
B 1 49  LYS 49  92  92  LYS LYS B . n 
B 1 50  LEU 50  93  93  LEU LEU B . n 
B 1 51  GLY 51  94  94  GLY GLY B . n 
B 1 52  ASN 52  95  95  ASN ASN B . n 
B 1 53  VAL 53  96  96  VAL VAL B . n 
B 1 54  GLU 54  97  97  GLU GLU B . n 
B 1 55  SER 55  98  98  SER SER B . n 
B 1 56  VAL 56  99  99  VAL VAL B . n 
B 1 57  TYR 57  100 100 TYR TYR B . n 
B 1 58  VAL 58  101 101 VAL VAL B . n 
B 1 59  ILE 59  102 102 ILE ILE B . n 
B 1 60  ASP 60  103 103 ASP ASP B . n 
B 1 61  PRO 61  104 104 PRO PRO B . n 
B 1 62  GLU 62  105 105 GLU GLU B . n 
B 1 63  ASP 63  106 106 ASP ASP B . n 
B 1 64  VAL 64  107 107 VAL VAL B . n 
B 1 65  ALA 65  108 108 ALA ALA B . n 
B 1 66  LEU 66  109 109 LEU LEU B . n 
B 1 67  LEU 67  110 110 LEU LEU B . n 
B 1 68  PHE 68  111 111 PHE PHE B . n 
B 1 69  LYS 69  112 112 LYS LYS B . n 
B 1 70  SER 70  113 113 SER SER B . n 
B 1 71  GLU 71  114 114 GLU GLU B . n 
B 1 72  GLY 72  115 115 GLY GLY B . n 
B 1 73  PRO 73  116 116 PRO PRO B . n 
B 1 74  ASN 74  117 117 ASN ASN B . n 
B 1 75  PRO 75  118 118 PRO PRO B . n 
B 1 76  GLU 76  119 119 GLU GLU B . n 
B 1 77  ARG 77  120 120 ARG ARG B . n 
B 1 78  PHE 78  121 121 PHE PHE B . n 
B 1 79  LEU 79  122 122 LEU LEU B . n 
B 1 80  ILE 80  123 123 ILE ILE B . n 
B 1 81  PRO 81  124 124 PRO PRO B . n 
B 1 82  PRO 82  125 125 PRO PRO B . n 
B 1 83  TRP 83  126 126 TRP TRP B . n 
B 1 84  VAL 84  127 127 VAL VAL B . n 
B 1 85  ALA 85  128 128 ALA ALA B . n 
B 1 86  TYR 86  129 129 TYR TYR B . n 
B 1 87  HIS 87  130 130 HIS HIS B . n 
B 1 88  GLN 88  131 131 GLN GLN B . n 
B 1 89  TYR 89  132 132 TYR TYR B . n 
B 1 90  TYR 90  133 133 TYR TYR B . n 
B 1 91  GLN 91  134 134 GLN GLN B . n 
B 1 92  ARG 92  135 135 ARG ARG B . n 
B 1 93  PRO 93  136 136 PRO PRO B . n 
B 1 94  ILE 94  137 137 ILE ILE B . n 
B 1 95  GLY 95  138 138 GLY GLY B . n 
B 1 96  VAL 96  139 139 VAL VAL B . n 
B 1 97  LEU 97  140 140 LEU LEU B . n 
B 1 98  LEU 98  141 141 LEU LEU B . n 
B 1 99  LYS 99  142 142 LYS LYS B . n 
B 1 100 LYS 100 143 143 LYS LYS B . n 
B 1 101 SER 101 144 144 SER SER B . n 
B 1 102 ALA 102 145 145 ALA ALA B . n 
B 1 103 ALA 103 146 146 ALA ALA B . n 
B 1 104 TRP 104 147 147 TRP TRP B . n 
B 1 105 LYS 105 148 148 LYS LYS B . n 
B 1 106 LYS 106 149 149 LYS LYS B . n 
B 1 107 ASP 107 150 150 ASP ASP B . n 
B 1 108 ARG 108 151 151 ARG ARG B . n 
B 1 109 VAL 109 152 152 VAL VAL B . n 
B 1 110 ALA 110 153 153 ALA ALA B . n 
B 1 111 LEU 111 154 154 LEU LEU B . n 
B 1 112 ASN 112 155 155 ASN ASN B . n 
B 1 113 GLN 113 156 156 GLN GLN B . n 
B 1 114 GLU 114 157 157 GLU GLU B . n 
B 1 115 VAL 115 158 158 VAL VAL B . n 
B 1 116 MET 116 159 159 MET MET B . n 
B 1 117 ALA 117 160 160 ALA ALA B . n 
B 1 118 PRO 118 161 161 PRO PRO B . n 
B 1 119 GLU 119 162 162 GLU GLU B . n 
B 1 120 ALA 120 163 163 ALA ALA B . n 
B 1 121 THR 121 164 164 THR THR B . n 
B 1 122 LYS 122 165 165 LYS LYS B . n 
B 1 123 ASN 123 166 166 ASN ASN B . n 
B 1 124 PHE 124 167 167 PHE PHE B . n 
B 1 125 LEU 125 168 168 LEU LEU B . n 
B 1 126 PRO 126 169 169 PRO PRO B . n 
B 1 127 LEU 127 170 170 LEU LEU B . n 
B 1 128 LEU 128 171 171 LEU LEU B . n 
B 1 129 ASP 129 172 172 ASP ASP B . n 
B 1 130 ALA 130 173 173 ALA ALA B . n 
B 1 131 VAL 131 174 174 VAL VAL B . n 
B 1 132 SER 132 175 175 SER SER B . n 
B 1 133 ARG 133 176 176 ARG ARG B . n 
B 1 134 ASP 134 177 177 ASP ASP B . n 
B 1 135 PHE 135 178 178 PHE PHE B . n 
B 1 136 VAL 136 179 179 VAL VAL B . n 
B 1 137 SER 137 180 180 SER SER B . n 
B 1 138 VAL 138 181 181 VAL VAL B . n 
B 1 139 LEU 139 182 182 LEU LEU B . n 
B 1 140 HIS 140 183 183 HIS HIS B . n 
B 1 141 ARG 141 184 184 ARG ARG B . n 
B 1 142 ARG 142 185 185 ARG ARG B . n 
B 1 143 ILE 143 186 186 ILE ILE B . n 
B 1 144 LYS 144 187 187 LYS LYS B . n 
B 1 145 LYS 145 188 188 LYS LYS B . n 
B 1 146 ALA 146 189 189 ALA ALA B . n 
B 1 147 GLY 147 190 190 GLY GLY B . n 
B 1 148 SER 148 191 191 SER SER B . n 
B 1 149 GLY 149 192 192 GLY GLY B . n 
B 1 150 ASN 150 193 193 ASN ASN B . n 
B 1 151 TYR 151 194 194 TYR TYR B . n 
B 1 152 SER 152 195 195 SER SER B . n 
B 1 153 GLY 153 196 196 GLY GLY B . n 
B 1 154 ASP 154 197 197 ASP ASP B . n 
B 1 155 ILE 155 198 198 ILE ILE B . n 
B 1 156 SER 156 199 199 SER SER B . n 
B 1 157 ASP 157 200 200 ASP ASP B . n 
B 1 158 ASP 158 201 201 ASP ASP B . n 
B 1 159 LEU 159 202 202 LEU LEU B . n 
B 1 160 PHE 160 203 203 PHE PHE B . n 
B 1 161 ARG 161 204 204 ARG ARG B . n 
B 1 162 PHE 162 205 205 PHE PHE B . n 
B 1 163 ALA 163 206 206 ALA ALA B . n 
B 1 164 PHE 164 207 207 PHE PHE B . n 
B 1 165 GLU 165 208 208 GLU GLU B . n 
B 1 166 SER 166 209 209 SER SER B . n 
B 1 167 ILE 167 210 210 ILE ILE B . n 
B 1 168 THR 168 211 211 THR THR B . n 
B 1 169 ASN 169 212 212 ASN ASN B . n 
B 1 170 VAL 170 213 213 VAL VAL B . n 
B 1 171 ILE 171 214 214 ILE ILE B . n 
B 1 172 PHE 172 215 215 PHE PHE B . n 
B 1 173 GLY 173 216 216 GLY GLY B . n 
B 1 174 GLU 174 217 217 GLU GLU B . n 
B 1 175 ARG 175 218 218 ARG ARG B . n 
B 1 176 GLN 176 219 219 GLN GLN B . n 
B 1 177 GLY 177 220 220 GLY GLY B . n 
B 1 178 MET 178 221 221 MET MET B . n 
B 1 179 LEU 179 222 222 LEU LEU B . n 
B 1 180 GLU 180 223 223 GLU GLU B . n 
B 1 181 GLU 181 224 224 GLU GLU B . n 
B 1 182 VAL 182 225 225 VAL VAL B . n 
B 1 183 VAL 183 226 226 VAL VAL B . n 
B 1 184 ASN 184 227 227 ASN ASN B . n 
B 1 185 PRO 185 228 228 PRO PRO B . n 
B 1 186 GLU 186 229 229 GLU GLU B . n 
B 1 187 ALA 187 230 230 ALA ALA B . n 
B 1 188 GLN 188 231 231 GLN GLN B . n 
B 1 189 ARG 189 232 232 ARG ARG B . n 
B 1 190 PHE 190 233 233 PHE PHE B . n 
B 1 191 ILE 191 234 234 ILE ILE B . n 
B 1 192 ASP 192 235 235 ASP ASP B . n 
B 1 193 ALA 193 236 236 ALA ALA B . n 
B 1 194 ILE 194 237 237 ILE ILE B . n 
B 1 195 TYR 195 238 238 TYR TYR B . n 
B 1 196 GLN 196 239 239 GLN GLN B . n 
B 1 197 MET 197 240 240 MET MET B . n 
B 1 198 PHE 198 241 241 PHE PHE B . n 
B 1 199 HIS 199 242 242 HIS HIS B . n 
B 1 200 THR 200 243 243 THR THR B . n 
B 1 201 SER 201 244 244 SER SER B . n 
B 1 202 VAL 202 245 245 VAL VAL B . n 
B 1 203 PRO 203 246 246 PRO PRO B . n 
B 1 204 MET 204 247 247 MET MET B . n 
B 1 205 LEU 205 248 248 LEU LEU B . n 
B 1 206 ASN 206 249 249 ASN ASN B . n 
B 1 207 LEU 207 250 250 LEU LEU B . n 
B 1 208 PRO 208 251 251 PRO PRO B . n 
B 1 209 PRO 209 252 252 PRO PRO B . n 
B 1 210 ASP 210 253 253 ASP ASP B . n 
B 1 211 LEU 211 254 254 LEU LEU B . n 
B 1 212 PHE 212 255 255 PHE PHE B . n 
B 1 213 ARG 213 256 256 ARG ARG B . n 
B 1 214 LEU 214 257 257 LEU LEU B . n 
B 1 215 PHE 215 258 258 PHE PHE B . n 
B 1 216 ARG 216 259 259 ARG ARG B . n 
B 1 217 THR 217 260 260 THR THR B . n 
B 1 218 LYS 218 261 261 LYS LYS B . n 
B 1 219 THR 219 262 262 THR THR B . n 
B 1 220 TRP 220 263 263 TRP TRP B . n 
B 1 221 LYS 221 264 264 LYS LYS B . n 
B 1 222 ASP 222 265 265 ASP ASP B . n 
B 1 223 HIS 223 266 266 HIS HIS B . n 
B 1 224 VAL 224 267 267 VAL VAL B . n 
B 1 225 ALA 225 268 268 ALA ALA B . n 
B 1 226 ALA 226 269 269 ALA ALA B . n 
B 1 227 TRP 227 270 270 TRP TRP B . n 
B 1 228 ASP 228 271 271 ASP ASP B . n 
B 1 229 VAL 229 272 272 VAL VAL B . n 
B 1 230 ILE 230 273 273 ILE ILE B . n 
B 1 231 PHE 231 274 274 PHE PHE B . n 
B 1 232 SER 232 275 275 SER SER B . n 
B 1 233 LYS 233 276 276 LYS LYS B . n 
B 1 234 ALA 234 277 277 ALA ALA B . n 
B 1 235 ASP 235 278 278 ASP ASP B . n 
B 1 236 ILE 236 279 279 ILE ILE B . n 
B 1 237 TYR 237 280 280 TYR TYR B . n 
B 1 238 THR 238 281 281 THR THR B . n 
B 1 239 GLN 239 282 282 GLN GLN B . n 
B 1 240 ASN 240 283 283 ASN ASN B . n 
B 1 241 PHE 241 284 284 PHE PHE B . n 
B 1 242 TYR 242 285 285 TYR TYR B . n 
B 1 243 TRP 243 286 286 TRP TRP B . n 
B 1 244 GLU 244 287 287 GLU GLU B . n 
B 1 245 LEU 245 288 288 LEU LEU B . n 
B 1 246 ARG 246 289 289 ARG ARG B . n 
B 1 247 GLN 247 290 290 GLN GLN B . n 
B 1 248 LYS 248 291 291 LYS LYS B . n 
B 1 249 GLY 249 292 292 GLY GLY B . n 
B 1 250 SER 250 293 293 SER SER B . n 
B 1 251 VAL 251 294 294 VAL VAL B . n 
B 1 252 HIS 252 295 295 HIS HIS B . n 
B 1 253 HIS 253 296 296 HIS HIS B . n 
B 1 254 ASP 254 297 297 ASP ASP B . n 
B 1 255 TYR 255 298 298 TYR TYR B . n 
B 1 256 ARG 256 299 299 ARG ARG B . n 
B 1 257 GLY 257 300 300 GLY GLY B . n 
B 1 258 ILE 258 301 301 ILE ILE B . n 
B 1 259 LEU 259 302 302 LEU LEU B . n 
B 1 260 TYR 260 303 303 TYR TYR B . n 
B 1 261 ARG 261 304 304 ARG ARG B . n 
B 1 262 LEU 262 305 305 LEU LEU B . n 
B 1 263 LEU 263 306 306 LEU LEU B . n 
B 1 264 GLY 264 307 307 GLY GLY B . n 
B 1 265 ASP 265 308 308 ASP ASP B . n 
B 1 266 SER 266 309 309 SER SER B . n 
B 1 267 LYS 267 310 310 LYS LYS B . n 
B 1 268 MET 268 311 311 MET MET B . n 
B 1 269 SER 269 312 312 SER SER B . n 
B 1 270 PHE 270 313 313 PHE PHE B . n 
B 1 271 GLU 271 314 314 GLU GLU B . n 
B 1 272 ASP 272 315 315 ASP ASP B . n 
B 1 273 ILE 273 316 316 ILE ILE B . n 
B 1 274 LYS 274 317 317 LYS LYS B . n 
B 1 275 ALA 275 318 318 ALA ALA B . n 
B 1 276 ASN 276 319 319 ASN ASN B . n 
B 1 277 VAL 277 320 320 VAL VAL B . n 
B 1 278 THR 278 321 321 THR THR B . n 
B 1 279 GLU 279 322 322 GLU GLU B . n 
B 1 280 MET 280 323 323 MET MET B . n 
B 1 281 LEU 281 324 324 LEU LEU B . n 
B 1 282 ALA 282 325 325 ALA ALA B . n 
B 1 283 GLY 283 326 326 GLY GLY B . n 
B 1 284 GLY 284 327 327 GLY GLY B . n 
B 1 285 VAL 285 328 328 VAL VAL B . n 
B 1 286 ASP 286 329 329 ASP ASP B . n 
B 1 287 THR 287 330 330 THR THR B . n 
B 1 288 THR 288 331 331 THR THR B . n 
B 1 289 SER 289 332 332 SER SER B . n 
B 1 290 MET 290 333 333 MET MET B . n 
B 1 291 THR 291 334 334 THR THR B . n 
B 1 292 LEU 292 335 335 LEU LEU B . n 
B 1 293 GLN 293 336 336 GLN GLN B . n 
B 1 294 TRP 294 337 337 TRP TRP B . n 
B 1 295 HIS 295 338 338 HIS HIS B . n 
B 1 296 LEU 296 339 339 LEU LEU B . n 
B 1 297 TYR 297 340 340 TYR TYR B . n 
B 1 298 GLU 298 341 341 GLU GLU B . n 
B 1 299 MET 299 342 342 MET MET B . n 
B 1 300 ALA 300 343 343 ALA ALA B . n 
B 1 301 ARG 301 344 344 ARG ARG B . n 
B 1 302 ASN 302 345 345 ASN ASN B . n 
B 1 303 LEU 303 346 346 LEU LEU B . n 
B 1 304 LYS 304 347 347 LYS LYS B . n 
B 1 305 VAL 305 348 348 VAL VAL B . n 
B 1 306 GLN 306 349 349 GLN GLN B . n 
B 1 307 ASP 307 350 350 ASP ASP B . n 
B 1 308 MET 308 351 351 MET MET B . n 
B 1 309 LEU 309 352 352 LEU LEU B . n 
B 1 310 ARG 310 353 353 ARG ARG B . n 
B 1 311 ALA 311 354 354 ALA ALA B . n 
B 1 312 GLU 312 355 355 GLU GLU B . n 
B 1 313 VAL 313 356 356 VAL VAL B . n 
B 1 314 LEU 314 357 357 LEU LEU B . n 
B 1 315 ALA 315 358 358 ALA ALA B . n 
B 1 316 ALA 316 359 359 ALA ALA B . n 
B 1 317 ARG 317 360 360 ARG ARG B . n 
B 1 318 HIS 318 361 361 HIS HIS B . n 
B 1 319 GLN 319 362 362 GLN GLN B . n 
B 1 320 ALA 320 363 363 ALA ALA B . n 
B 1 321 GLN 321 364 364 GLN GLN B . n 
B 1 322 GLY 322 365 365 GLY GLY B . n 
B 1 323 ASP 323 366 366 ASP ASP B . n 
B 1 324 MET 324 367 367 MET MET B . n 
B 1 325 ALA 325 368 368 ALA ALA B . n 
B 1 326 THR 326 369 369 THR THR B . n 
B 1 327 MET 327 370 370 MET MET B . n 
B 1 328 LEU 328 371 371 LEU LEU B . n 
B 1 329 GLN 329 372 372 GLN GLN B . n 
B 1 330 LEU 330 373 373 LEU LEU B . n 
B 1 331 VAL 331 374 374 VAL VAL B . n 
B 1 332 PRO 332 375 375 PRO PRO B . n 
B 1 333 LEU 333 376 376 LEU LEU B . n 
B 1 334 LEU 334 377 377 LEU LEU B . n 
B 1 335 LYS 335 378 378 LYS LYS B . n 
B 1 336 ALA 336 379 379 ALA ALA B . n 
B 1 337 SER 337 380 380 SER SER B . n 
B 1 338 ILE 338 381 381 ILE ILE B . n 
B 1 339 LYS 339 382 382 LYS LYS B . n 
B 1 340 GLU 340 383 383 GLU GLU B . n 
B 1 341 THR 341 384 384 THR THR B . n 
B 1 342 LEU 342 385 385 LEU LEU B . n 
B 1 343 ARG 343 386 386 ARG ARG B . n 
B 1 344 LEU 344 387 387 LEU LEU B . n 
B 1 345 HIS 345 388 388 HIS HIS B . n 
B 1 346 PRO 346 389 389 PRO PRO B . n 
B 1 347 ILE 347 390 390 ILE ILE B . n 
B 1 348 SER 348 391 391 SER SER B . n 
B 1 349 VAL 349 392 392 VAL VAL B . n 
B 1 350 THR 350 393 393 THR THR B . n 
B 1 351 LEU 351 394 394 LEU LEU B . n 
B 1 352 GLN 352 395 395 GLN GLN B . n 
B 1 353 ARG 353 396 396 ARG ARG B . n 
B 1 354 TYR 354 397 397 TYR TYR B . n 
B 1 355 LEU 355 398 398 LEU LEU B . n 
B 1 356 VAL 356 399 399 VAL VAL B . n 
B 1 357 ASN 357 400 400 ASN ASN B . n 
B 1 358 ASP 358 401 401 ASP ASP B . n 
B 1 359 LEU 359 402 402 LEU LEU B . n 
B 1 360 VAL 360 403 403 VAL VAL B . n 
B 1 361 LEU 361 404 404 LEU LEU B . n 
B 1 362 ARG 362 405 405 ARG ARG B . n 
B 1 363 ASP 363 406 406 ASP ASP B . n 
B 1 364 TYR 364 407 407 TYR TYR B . n 
B 1 365 MET 365 408 408 MET MET B . n 
B 1 366 ILE 366 409 409 ILE ILE B . n 
B 1 367 PRO 367 410 410 PRO PRO B . n 
B 1 368 ALA 368 411 411 ALA ALA B . n 
B 1 369 LYS 369 412 412 LYS LYS B . n 
B 1 370 THR 370 413 413 THR THR B . n 
B 1 371 LEU 371 414 414 LEU LEU B . n 
B 1 372 VAL 372 415 415 VAL VAL B . n 
B 1 373 GLN 373 416 416 GLN GLN B . n 
B 1 374 VAL 374 417 417 VAL VAL B . n 
B 1 375 ALA 375 418 418 ALA ALA B . n 
B 1 376 ILE 376 419 419 ILE ILE B . n 
B 1 377 TYR 377 420 420 TYR TYR B . n 
B 1 378 ALA 378 421 421 ALA ALA B . n 
B 1 379 LEU 379 422 422 LEU LEU B . n 
B 1 380 GLY 380 423 423 GLY GLY B . n 
B 1 381 ARG 381 424 424 ARG ARG B . n 
B 1 382 GLU 382 425 425 GLU GLU B . n 
B 1 383 PRO 383 426 426 PRO PRO B . n 
B 1 384 THR 384 427 427 THR THR B . n 
B 1 385 PHE 385 428 428 PHE PHE B . n 
B 1 386 PHE 386 429 429 PHE PHE B . n 
B 1 387 PHE 387 430 430 PHE PHE B . n 
B 1 388 ASP 388 431 431 ASP ASP B . n 
B 1 389 PRO 389 432 432 PRO PRO B . n 
B 1 390 GLU 390 433 433 GLU GLU B . n 
B 1 391 ASN 391 434 434 ASN ASN B . n 
B 1 392 PHE 392 435 435 PHE PHE B . n 
B 1 393 ASP 393 436 436 ASP ASP B . n 
B 1 394 PRO 394 437 437 PRO PRO B . n 
B 1 395 THR 395 438 438 THR THR B . n 
B 1 396 ARG 396 439 439 ARG ARG B . n 
B 1 397 TRP 397 440 440 TRP TRP B . n 
B 1 398 LEU 398 441 441 LEU LEU B . n 
B 1 399 SER 399 442 442 SER SER B . n 
B 1 400 LYS 400 443 443 LYS LYS B . n 
B 1 401 ASP 401 444 444 ASP ASP B . n 
B 1 402 LYS 402 445 445 LYS LYS B . n 
B 1 403 ASN 403 446 446 ASN ASN B . n 
B 1 404 ILE 404 447 447 ILE ILE B . n 
B 1 405 THR 405 448 448 THR THR B . n 
B 1 406 TYR 406 449 449 TYR TYR B . n 
B 1 407 PHE 407 450 450 PHE PHE B . n 
B 1 408 ARG 408 451 451 ARG ARG B . n 
B 1 409 ASN 409 452 452 ASN ASN B . n 
B 1 410 LEU 410 453 453 LEU LEU B . n 
B 1 411 GLY 411 454 454 GLY GLY B . n 
B 1 412 PHE 412 455 455 PHE PHE B . n 
B 1 413 GLY 413 456 456 GLY GLY B . n 
B 1 414 TRP 414 457 457 TRP TRP B . n 
B 1 415 GLY 415 458 458 GLY GLY B . n 
B 1 416 VAL 416 459 459 VAL VAL B . n 
B 1 417 ARG 417 460 460 ARG ARG B . n 
B 1 418 GLN 418 461 461 GLN GLN B . n 
B 1 419 CYS 419 462 462 CYS CYS B . n 
B 1 420 LEU 420 463 463 LEU LEU B . n 
B 1 421 GLY 421 464 464 GLY GLY B . n 
B 1 422 ARG 422 465 465 ARG ARG B . n 
B 1 423 ARG 423 466 466 ARG ARG B . n 
B 1 424 ILE 424 467 467 ILE ILE B . n 
B 1 425 ALA 425 468 468 ALA ALA B . n 
B 1 426 GLU 426 469 469 GLU GLU B . n 
B 1 427 LEU 427 470 470 LEU LEU B . n 
B 1 428 GLU 428 471 471 GLU GLU B . n 
B 1 429 MET 429 472 472 MET MET B . n 
B 1 430 THR 430 473 473 THR THR B . n 
B 1 431 ILE 431 474 474 ILE ILE B . n 
B 1 432 PHE 432 475 475 PHE PHE B . n 
B 1 433 LEU 433 476 476 LEU LEU B . n 
B 1 434 ILE 434 477 477 ILE ILE B . n 
B 1 435 ASN 435 478 478 ASN ASN B . n 
B 1 436 MET 436 479 479 MET MET B . n 
B 1 437 LEU 437 480 480 LEU LEU B . n 
B 1 438 GLU 438 481 481 GLU GLU B . n 
B 1 439 ASN 439 482 482 ASN ASN B . n 
B 1 440 PHE 440 483 483 PHE PHE B . n 
B 1 441 ARG 441 484 484 ARG ARG B . n 
B 1 442 VAL 442 485 485 VAL VAL B . n 
B 1 443 GLU 443 486 486 GLU GLU B . n 
B 1 444 ILE 444 487 487 ILE ILE B . n 
B 1 445 GLN 445 488 488 GLN GLN B . n 
B 1 446 HIS 446 489 489 HIS HIS B . n 
B 1 447 LEU 447 490 490 LEU LEU B . n 
B 1 448 SER 448 491 491 SER SER B . n 
B 1 449 ASP 449 492 492 ASP ASP B . n 
B 1 450 VAL 450 493 493 VAL VAL B . n 
B 1 451 GLY 451 494 494 GLY GLY B . n 
B 1 452 THR 452 495 495 THR THR B . n 
B 1 453 THR 453 496 496 THR THR B . n 
B 1 454 PHE 454 497 497 PHE PHE B . n 
B 1 455 ASN 455 498 498 ASN ASN B . n 
B 1 456 LEU 456 499 499 LEU LEU B . n 
B 1 457 ILE 457 500 500 ILE ILE B . n 
B 1 458 LEU 458 501 501 LEU LEU B . n 
B 1 459 MET 459 502 502 MET MET B . n 
B 1 460 PRO 460 503 503 PRO PRO B . n 
B 1 461 GLU 461 504 504 GLU GLU B . n 
B 1 462 LYS 462 505 505 LYS LYS B . n 
B 1 463 PRO 463 506 506 PRO PRO B . n 
B 1 464 ILE 464 507 507 ILE ILE B . n 
B 1 465 SER 465 508 508 SER SER B . n 
B 1 466 PHE 466 509 509 PHE PHE B . n 
B 1 467 THR 467 510 510 THR THR B . n 
B 1 468 PHE 468 511 511 PHE PHE B . n 
B 1 469 TRP 469 512 512 TRP TRP B . n 
B 1 470 PRO 470 513 513 PRO PRO B . n 
B 1 471 PHE 471 514 514 PHE PHE B . n 
C 2 1   SER 1   28  ?   ?   ?   C . n 
C 2 2   LEU 2   29  ?   ?   ?   C . n 
C 2 3   LEU 3   30  ?   ?   ?   C . n 
C 2 4   ASP 4   31  ?   ?   ?   C . n 
C 2 5   VAL 5   32  ?   ?   ?   C . n 
C 2 6   VAL 6   33  ?   ?   ?   C . n 
C 2 7   VAL 7   34  ?   ?   ?   C . n 
C 2 8   GLU 8   35  ?   ?   ?   C . n 
C 2 9   ASN 9   36  ?   ?   ?   C . n 
C 2 10  ASN 10  37  ?   ?   ?   C . n 
C 2 11  LEU 11  38  ?   ?   ?   C . n 
C 2 12  ASP 12  39  ?   ?   ?   C . n 
C 2 13  ILE 13  40  ?   ?   ?   C . n 
C 2 14  ASP 14  41  ?   ?   ?   C . n 
C 2 15  GLY 15  42  ?   ?   ?   C . n 
C 2 16  PHE 16  43  43  PHE PHE C . n 
C 2 17  GLY 17  44  44  GLY GLY C . n 
C 2 18  ALA 18  45  45  ALA ALA C . n 
C 2 19  CYS 19  46  46  CYS CYS C . n 
C 2 20  GLU 20  47  47  GLU GLU C . n 
C 2 21  GLY 21  48  48  GLY GLY C . n 
C 2 22  THR 22  49  49  THR THR C . n 
C 2 23  LEU 23  50  50  LEU LEU C . n 
C 2 24  ALA 24  51  51  ALA ALA C . n 
C 2 25  CYS 25  52  52  CYS CYS C . n 
C 2 26  SER 26  53  53  SER SER C . n 
C 2 27  THR 27  54  54  THR THR C . n 
C 2 28  CYS 28  55  55  CYS CYS C . n 
C 2 29  HIS 29  56  ?   ?   ?   C . n 
C 2 30  LEU 30  57  ?   ?   ?   C . n 
C 2 31  ILE 31  58  ?   ?   ?   C . n 
C 2 32  PHE 32  59  ?   ?   ?   C . n 
C 2 33  GLU 33  60  ?   ?   ?   C . n 
C 2 34  ASP 34  61  ?   ?   ?   C . n 
C 2 35  HIS 35  62  ?   ?   ?   C . n 
C 2 36  ILE 36  63  ?   ?   ?   C . n 
C 2 37  TYR 37  64  ?   ?   ?   C . n 
C 2 38  GLU 38  65  ?   ?   ?   C . n 
C 2 39  LYS 39  66  ?   ?   ?   C . n 
C 2 40  LEU 40  67  ?   ?   ?   C . n 
C 2 41  ASP 41  68  ?   ?   ?   C . n 
C 2 42  ALA 42  69  ?   ?   ?   C . n 
C 2 43  ILE 43  70  ?   ?   ?   C . n 
C 2 44  THR 44  71  71  THR THR C . n 
C 2 45  ASP 45  72  72  ASP ASP C . n 
C 2 46  GLU 46  73  73  GLU GLU C . n 
C 2 47  GLU 47  74  74  GLU GLU C . n 
C 2 48  ASN 48  75  75  ASN ASN C . n 
C 2 49  ASP 49  76  76  ASP ASP C . n 
C 2 50  MET 50  77  77  MET MET C . n 
C 2 51  LEU 51  78  78  LEU LEU C . n 
C 2 52  ASP 52  79  79  ASP ASP C . n 
C 2 53  LEU 53  80  80  LEU LEU C . n 
C 2 54  ALA 54  81  81  ALA ALA C . n 
C 2 55  TYR 55  82  ?   ?   ?   C . n 
C 2 56  GLY 56  83  ?   ?   ?   C . n 
C 2 57  LEU 57  84  ?   ?   ?   C . n 
C 2 58  THR 58  85  ?   ?   ?   C . n 
C 2 59  ASP 59  86  ?   ?   ?   C . n 
C 2 60  ARG 60  87  ?   ?   ?   C . n 
C 2 61  SER 61  88  ?   ?   ?   C . n 
C 2 62  ARG 62  89  ?   ?   ?   C . n 
C 2 63  LEU 63  90  90  LEU LEU C . n 
C 2 64  GLY 64  91  91  GLY GLY C . n 
C 2 65  CYS 65  92  92  CYS CYS C . n 
C 2 66  GLN 66  93  93  GLN GLN C . n 
C 2 67  ILE 67  94  ?   ?   ?   C . n 
C 2 68  CYS 68  95  ?   ?   ?   C . n 
D 2 1   SER 1   28  ?   ?   ?   D . n 
D 2 2   LEU 2   29  ?   ?   ?   D . n 
D 2 3   LEU 3   30  ?   ?   ?   D . n 
D 2 4   ASP 4   31  ?   ?   ?   D . n 
D 2 5   VAL 5   32  ?   ?   ?   D . n 
D 2 6   VAL 6   33  ?   ?   ?   D . n 
D 2 7   VAL 7   34  ?   ?   ?   D . n 
D 2 8   GLU 8   35  ?   ?   ?   D . n 
D 2 9   ASN 9   36  ?   ?   ?   D . n 
D 2 10  ASN 10  37  ?   ?   ?   D . n 
D 2 11  LEU 11  38  ?   ?   ?   D . n 
D 2 12  ASP 12  39  ?   ?   ?   D . n 
D 2 13  ILE 13  40  ?   ?   ?   D . n 
D 2 14  ASP 14  41  ?   ?   ?   D . n 
D 2 15  GLY 15  42  ?   ?   ?   D . n 
D 2 16  PHE 16  43  43  PHE PHE D . n 
D 2 17  GLY 17  44  44  GLY GLY D . n 
D 2 18  ALA 18  45  45  ALA ALA D . n 
D 2 19  CYS 19  46  46  CYS CYS D . n 
D 2 20  GLU 20  47  47  GLU GLU D . n 
D 2 21  GLY 21  48  48  GLY GLY D . n 
D 2 22  THR 22  49  49  THR THR D . n 
D 2 23  LEU 23  50  50  LEU LEU D . n 
D 2 24  ALA 24  51  51  ALA ALA D . n 
D 2 25  CYS 25  52  52  CYS CYS D . n 
D 2 26  SER 26  53  53  SER SER D . n 
D 2 27  THR 27  54  54  THR THR D . n 
D 2 28  CYS 28  55  55  CYS CYS D . n 
D 2 29  HIS 29  56  ?   ?   ?   D . n 
D 2 30  LEU 30  57  ?   ?   ?   D . n 
D 2 31  ILE 31  58  ?   ?   ?   D . n 
D 2 32  PHE 32  59  ?   ?   ?   D . n 
D 2 33  GLU 33  60  ?   ?   ?   D . n 
D 2 34  ASP 34  61  ?   ?   ?   D . n 
D 2 35  HIS 35  62  ?   ?   ?   D . n 
D 2 36  ILE 36  63  ?   ?   ?   D . n 
D 2 37  TYR 37  64  ?   ?   ?   D . n 
D 2 38  GLU 38  65  ?   ?   ?   D . n 
D 2 39  LYS 39  66  ?   ?   ?   D . n 
D 2 40  LEU 40  67  ?   ?   ?   D . n 
D 2 41  ASP 41  68  ?   ?   ?   D . n 
D 2 42  ALA 42  69  ?   ?   ?   D . n 
D 2 43  ILE 43  70  ?   ?   ?   D . n 
D 2 44  THR 44  71  71  THR THR D . n 
D 2 45  ASP 45  72  72  ASP ASP D . n 
D 2 46  GLU 46  73  73  GLU GLU D . n 
D 2 47  GLU 47  74  74  GLU GLU D . n 
D 2 48  ASN 48  75  75  ASN ASN D . n 
D 2 49  ASP 49  76  76  ASP ASP D . n 
D 2 50  MET 50  77  77  MET MET D . n 
D 2 51  LEU 51  78  78  LEU LEU D . n 
D 2 52  ASP 52  79  79  ASP ASP D . n 
D 2 53  LEU 53  80  80  LEU LEU D . n 
D 2 54  ALA 54  81  81  ALA ALA D . n 
D 2 55  TYR 55  82  ?   ?   ?   D . n 
D 2 56  GLY 56  83  ?   ?   ?   D . n 
D 2 57  LEU 57  84  ?   ?   ?   D . n 
D 2 58  THR 58  85  ?   ?   ?   D . n 
D 2 59  ASP 59  86  ?   ?   ?   D . n 
D 2 60  ARG 60  87  ?   ?   ?   D . n 
D 2 61  SER 61  88  ?   ?   ?   D . n 
D 2 62  ARG 62  89  ?   ?   ?   D . n 
D 2 63  LEU 63  90  90  LEU LEU D . n 
D 2 64  GLY 64  91  91  GLY GLY D . n 
D 2 65  CYS 65  92  92  CYS CYS D . n 
D 2 66  GLN 66  93  93  GLN GLN D . n 
D 2 67  ILE 67  94  ?   ?   ?   D . n 
D 2 68  CYS 68  95  ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HEM 1   601 601 HEM HEM A . 
F 4 2DC 1   602 602 2DC 2DC A . 
G 3 HEM 1   601 601 HEM HEM B . 
H 4 2DC 1   602 602 2DC 2DC B . 
I 5 FES 1   150 150 FES FES C . 
J 5 FES 1   150 150 FES FES D . 
K 6 HOH 1   2   2   HOH HOH A . 
K 6 HOH 2   3   3   HOH HOH A . 
K 6 HOH 3   7   7   HOH HOH A . 
K 6 HOH 4   8   8   HOH HOH A . 
K 6 HOH 5   9   9   HOH HOH A . 
K 6 HOH 6   10  10  HOH HOH A . 
K 6 HOH 7   11  11  HOH HOH A . 
K 6 HOH 8   12  12  HOH HOH A . 
K 6 HOH 9   13  13  HOH HOH A . 
K 6 HOH 10  14  14  HOH HOH A . 
K 6 HOH 11  16  16  HOH HOH A . 
K 6 HOH 12  17  17  HOH HOH A . 
K 6 HOH 13  20  20  HOH HOH A . 
K 6 HOH 14  21  21  HOH HOH A . 
K 6 HOH 15  24  24  HOH HOH A . 
K 6 HOH 16  25  25  HOH HOH A . 
K 6 HOH 17  32  32  HOH HOH A . 
K 6 HOH 18  33  33  HOH HOH A . 
K 6 HOH 19  35  35  HOH HOH A . 
K 6 HOH 20  37  37  HOH HOH A . 
K 6 HOH 21  39  39  HOH HOH A . 
K 6 HOH 22  40  40  HOH HOH A . 
K 6 HOH 23  42  42  HOH HOH A . 
K 6 HOH 24  515 44  HOH HOH A . 
K 6 HOH 25  516 45  HOH HOH A . 
K 6 HOH 26  517 46  HOH HOH A . 
K 6 HOH 27  518 51  HOH HOH A . 
K 6 HOH 28  519 52  HOH HOH A . 
K 6 HOH 29  520 54  HOH HOH A . 
K 6 HOH 30  521 55  HOH HOH A . 
K 6 HOH 31  522 56  HOH HOH A . 
K 6 HOH 32  523 57  HOH HOH A . 
K 6 HOH 33  524 58  HOH HOH A . 
K 6 HOH 34  525 62  HOH HOH A . 
K 6 HOH 35  526 64  HOH HOH A . 
K 6 HOH 36  527 65  HOH HOH A . 
K 6 HOH 37  528 68  HOH HOH A . 
K 6 HOH 38  529 71  HOH HOH A . 
K 6 HOH 39  530 74  HOH HOH A . 
K 6 HOH 40  531 75  HOH HOH A . 
K 6 HOH 41  532 76  HOH HOH A . 
K 6 HOH 42  533 79  HOH HOH A . 
K 6 HOH 43  534 80  HOH HOH A . 
K 6 HOH 44  535 81  HOH HOH A . 
K 6 HOH 45  536 82  HOH HOH A . 
K 6 HOH 46  537 83  HOH HOH A . 
K 6 HOH 47  538 84  HOH HOH A . 
K 6 HOH 48  539 85  HOH HOH A . 
K 6 HOH 49  540 86  HOH HOH A . 
K 6 HOH 50  541 89  HOH HOH A . 
K 6 HOH 51  542 90  HOH HOH A . 
K 6 HOH 52  543 93  HOH HOH A . 
K 6 HOH 53  544 94  HOH HOH A . 
K 6 HOH 54  545 95  HOH HOH A . 
K 6 HOH 55  546 96  HOH HOH A . 
K 6 HOH 56  547 97  HOH HOH A . 
K 6 HOH 57  548 100 HOH HOH A . 
K 6 HOH 58  549 104 HOH HOH A . 
K 6 HOH 59  550 105 HOH HOH A . 
K 6 HOH 60  551 107 HOH HOH A . 
K 6 HOH 61  552 108 HOH HOH A . 
K 6 HOH 62  553 109 HOH HOH A . 
K 6 HOH 63  554 112 HOH HOH A . 
K 6 HOH 64  555 113 HOH HOH A . 
K 6 HOH 65  556 114 HOH HOH A . 
K 6 HOH 66  557 115 HOH HOH A . 
K 6 HOH 67  558 116 HOH HOH A . 
K 6 HOH 68  559 127 HOH HOH A . 
K 6 HOH 69  560 130 HOH HOH A . 
K 6 HOH 70  561 131 HOH HOH A . 
K 6 HOH 71  562 132 HOH HOH A . 
K 6 HOH 72  563 134 HOH HOH A . 
K 6 HOH 73  564 138 HOH HOH A . 
K 6 HOH 74  565 141 HOH HOH A . 
K 6 HOH 75  566 146 HOH HOH A . 
K 6 HOH 76  567 148 HOH HOH A . 
K 6 HOH 77  568 153 HOH HOH A . 
K 6 HOH 78  569 154 HOH HOH A . 
K 6 HOH 79  570 156 HOH HOH A . 
K 6 HOH 80  571 158 HOH HOH A . 
K 6 HOH 81  572 159 HOH HOH A . 
K 6 HOH 82  573 160 HOH HOH A . 
K 6 HOH 83  574 164 HOH HOH A . 
K 6 HOH 84  575 165 HOH HOH A . 
K 6 HOH 85  576 170 HOH HOH A . 
K 6 HOH 86  577 171 HOH HOH A . 
K 6 HOH 87  578 173 HOH HOH A . 
K 6 HOH 88  579 174 HOH HOH A . 
K 6 HOH 89  580 175 HOH HOH A . 
K 6 HOH 90  581 177 HOH HOH A . 
K 6 HOH 91  582 179 HOH HOH A . 
K 6 HOH 92  583 180 HOH HOH A . 
K 6 HOH 93  584 181 HOH HOH A . 
K 6 HOH 94  585 182 HOH HOH A . 
K 6 HOH 95  586 183 HOH HOH A . 
K 6 HOH 96  587 184 HOH HOH A . 
K 6 HOH 97  588 187 HOH HOH A . 
K 6 HOH 98  589 188 HOH HOH A . 
K 6 HOH 99  590 190 HOH HOH A . 
K 6 HOH 100 591 191 HOH HOH A . 
K 6 HOH 101 592 192 HOH HOH A . 
K 6 HOH 102 593 193 HOH HOH A . 
K 6 HOH 103 594 197 HOH HOH A . 
K 6 HOH 104 595 198 HOH HOH A . 
K 6 HOH 105 596 199 HOH HOH A . 
K 6 HOH 106 597 200 HOH HOH A . 
K 6 HOH 107 598 201 HOH HOH A . 
K 6 HOH 108 599 203 HOH HOH A . 
K 6 HOH 109 600 205 HOH HOH A . 
K 6 HOH 110 603 207 HOH HOH A . 
K 6 HOH 111 604 208 HOH HOH A . 
K 6 HOH 112 605 209 HOH HOH A . 
K 6 HOH 113 606 210 HOH HOH A . 
K 6 HOH 114 607 212 HOH HOH A . 
K 6 HOH 115 608 216 HOH HOH A . 
K 6 HOH 116 609 217 HOH HOH A . 
K 6 HOH 117 610 218 HOH HOH A . 
K 6 HOH 118 611 220 HOH HOH A . 
K 6 HOH 119 612 222 HOH HOH A . 
K 6 HOH 120 613 226 HOH HOH A . 
K 6 HOH 121 614 229 HOH HOH A . 
K 6 HOH 122 615 232 HOH HOH A . 
K 6 HOH 123 616 237 HOH HOH A . 
K 6 HOH 124 617 240 HOH HOH A . 
K 6 HOH 125 618 241 HOH HOH A . 
K 6 HOH 126 619 243 HOH HOH A . 
K 6 HOH 127 620 245 HOH HOH A . 
K 6 HOH 128 621 248 HOH HOH A . 
K 6 HOH 129 622 249 HOH HOH A . 
K 6 HOH 130 623 250 HOH HOH A . 
K 6 HOH 131 624 251 HOH HOH A . 
K 6 HOH 132 625 255 HOH HOH A . 
K 6 HOH 133 626 256 HOH HOH A . 
K 6 HOH 134 627 257 HOH HOH A . 
K 6 HOH 135 628 259 HOH HOH A . 
K 6 HOH 136 629 263 HOH HOH A . 
K 6 HOH 137 630 264 HOH HOH A . 
K 6 HOH 138 631 265 HOH HOH A . 
K 6 HOH 139 632 266 HOH HOH A . 
K 6 HOH 140 633 270 HOH HOH A . 
K 6 HOH 141 634 272 HOH HOH A . 
K 6 HOH 142 635 273 HOH HOH A . 
K 6 HOH 143 636 274 HOH HOH A . 
K 6 HOH 144 637 276 HOH HOH A . 
K 6 HOH 145 638 277 HOH HOH A . 
K 6 HOH 146 639 279 HOH HOH A . 
K 6 HOH 147 640 280 HOH HOH A . 
K 6 HOH 148 641 281 HOH HOH A . 
K 6 HOH 149 642 282 HOH HOH A . 
K 6 HOH 150 643 284 HOH HOH A . 
K 6 HOH 151 644 286 HOH HOH A . 
K 6 HOH 152 645 287 HOH HOH A . 
L 6 HOH 1   1   1   HOH HOH B . 
L 6 HOH 2   4   4   HOH HOH B . 
L 6 HOH 3   5   5   HOH HOH B . 
L 6 HOH 4   6   6   HOH HOH B . 
L 6 HOH 5   15  15  HOH HOH B . 
L 6 HOH 6   18  18  HOH HOH B . 
L 6 HOH 7   19  19  HOH HOH B . 
L 6 HOH 8   22  22  HOH HOH B . 
L 6 HOH 9   23  23  HOH HOH B . 
L 6 HOH 10  26  26  HOH HOH B . 
L 6 HOH 11  27  27  HOH HOH B . 
L 6 HOH 12  28  28  HOH HOH B . 
L 6 HOH 13  29  29  HOH HOH B . 
L 6 HOH 14  30  30  HOH HOH B . 
L 6 HOH 15  31  31  HOH HOH B . 
L 6 HOH 16  34  34  HOH HOH B . 
L 6 HOH 17  36  36  HOH HOH B . 
L 6 HOH 18  38  38  HOH HOH B . 
L 6 HOH 19  41  41  HOH HOH B . 
L 6 HOH 20  43  43  HOH HOH B . 
L 6 HOH 21  515 47  HOH HOH B . 
L 6 HOH 22  516 48  HOH HOH B . 
L 6 HOH 23  517 49  HOH HOH B . 
L 6 HOH 24  518 50  HOH HOH B . 
L 6 HOH 25  519 53  HOH HOH B . 
L 6 HOH 26  520 59  HOH HOH B . 
L 6 HOH 27  521 60  HOH HOH B . 
L 6 HOH 28  522 61  HOH HOH B . 
L 6 HOH 29  523 63  HOH HOH B . 
L 6 HOH 30  524 66  HOH HOH B . 
L 6 HOH 31  525 67  HOH HOH B . 
L 6 HOH 32  526 69  HOH HOH B . 
L 6 HOH 33  527 70  HOH HOH B . 
L 6 HOH 34  528 72  HOH HOH B . 
L 6 HOH 35  529 73  HOH HOH B . 
L 6 HOH 36  530 77  HOH HOH B . 
L 6 HOH 37  531 78  HOH HOH B . 
L 6 HOH 38  532 87  HOH HOH B . 
L 6 HOH 39  533 88  HOH HOH B . 
L 6 HOH 40  534 91  HOH HOH B . 
L 6 HOH 41  535 92  HOH HOH B . 
L 6 HOH 42  536 98  HOH HOH B . 
L 6 HOH 43  537 99  HOH HOH B . 
L 6 HOH 44  538 101 HOH HOH B . 
L 6 HOH 45  539 102 HOH HOH B . 
L 6 HOH 46  540 103 HOH HOH B . 
L 6 HOH 47  541 106 HOH HOH B . 
L 6 HOH 48  542 110 HOH HOH B . 
L 6 HOH 49  543 111 HOH HOH B . 
L 6 HOH 50  544 117 HOH HOH B . 
L 6 HOH 51  545 118 HOH HOH B . 
L 6 HOH 52  546 119 HOH HOH B . 
L 6 HOH 53  547 120 HOH HOH B . 
L 6 HOH 54  548 121 HOH HOH B . 
L 6 HOH 55  549 122 HOH HOH B . 
L 6 HOH 56  550 123 HOH HOH B . 
L 6 HOH 57  551 124 HOH HOH B . 
L 6 HOH 58  552 125 HOH HOH B . 
L 6 HOH 59  553 126 HOH HOH B . 
L 6 HOH 60  554 128 HOH HOH B . 
L 6 HOH 61  555 129 HOH HOH B . 
L 6 HOH 62  556 133 HOH HOH B . 
L 6 HOH 63  557 135 HOH HOH B . 
L 6 HOH 64  558 136 HOH HOH B . 
L 6 HOH 65  559 137 HOH HOH B . 
L 6 HOH 66  560 139 HOH HOH B . 
L 6 HOH 67  561 140 HOH HOH B . 
L 6 HOH 68  562 142 HOH HOH B . 
L 6 HOH 69  563 143 HOH HOH B . 
L 6 HOH 70  564 144 HOH HOH B . 
L 6 HOH 71  565 145 HOH HOH B . 
L 6 HOH 72  566 147 HOH HOH B . 
L 6 HOH 73  567 149 HOH HOH B . 
L 6 HOH 74  568 150 HOH HOH B . 
L 6 HOH 75  569 151 HOH HOH B . 
L 6 HOH 76  570 152 HOH HOH B . 
L 6 HOH 77  571 155 HOH HOH B . 
L 6 HOH 78  572 157 HOH HOH B . 
L 6 HOH 79  573 161 HOH HOH B . 
L 6 HOH 80  574 162 HOH HOH B . 
L 6 HOH 81  575 163 HOH HOH B . 
L 6 HOH 82  576 166 HOH HOH B . 
L 6 HOH 83  577 167 HOH HOH B . 
L 6 HOH 84  578 168 HOH HOH B . 
L 6 HOH 85  579 169 HOH HOH B . 
L 6 HOH 86  580 172 HOH HOH B . 
L 6 HOH 87  581 176 HOH HOH B . 
L 6 HOH 88  582 178 HOH HOH B . 
L 6 HOH 89  583 185 HOH HOH B . 
L 6 HOH 90  584 186 HOH HOH B . 
L 6 HOH 91  585 189 HOH HOH B . 
L 6 HOH 92  586 194 HOH HOH B . 
L 6 HOH 93  587 195 HOH HOH B . 
L 6 HOH 94  588 196 HOH HOH B . 
L 6 HOH 95  589 202 HOH HOH B . 
L 6 HOH 96  590 204 HOH HOH B . 
L 6 HOH 97  591 206 HOH HOH B . 
L 6 HOH 98  592 211 HOH HOH B . 
L 6 HOH 99  593 213 HOH HOH B . 
L 6 HOH 100 594 214 HOH HOH B . 
L 6 HOH 101 595 215 HOH HOH B . 
L 6 HOH 102 596 219 HOH HOH B . 
L 6 HOH 103 597 221 HOH HOH B . 
L 6 HOH 104 598 223 HOH HOH B . 
L 6 HOH 105 599 224 HOH HOH B . 
L 6 HOH 106 600 225 HOH HOH B . 
L 6 HOH 107 603 227 HOH HOH B . 
L 6 HOH 108 604 228 HOH HOH B . 
L 6 HOH 109 605 230 HOH HOH B . 
L 6 HOH 110 606 231 HOH HOH B . 
L 6 HOH 111 607 233 HOH HOH B . 
L 6 HOH 112 608 234 HOH HOH B . 
L 6 HOH 113 609 235 HOH HOH B . 
L 6 HOH 114 610 236 HOH HOH B . 
L 6 HOH 115 611 238 HOH HOH B . 
L 6 HOH 116 612 239 HOH HOH B . 
L 6 HOH 117 613 242 HOH HOH B . 
L 6 HOH 118 614 244 HOH HOH B . 
L 6 HOH 119 615 246 HOH HOH B . 
L 6 HOH 120 616 247 HOH HOH B . 
L 6 HOH 121 617 252 HOH HOH B . 
L 6 HOH 122 618 253 HOH HOH B . 
L 6 HOH 123 619 254 HOH HOH B . 
L 6 HOH 124 620 258 HOH HOH B . 
L 6 HOH 125 621 260 HOH HOH B . 
L 6 HOH 126 622 261 HOH HOH B . 
L 6 HOH 127 623 262 HOH HOH B . 
L 6 HOH 128 624 267 HOH HOH B . 
L 6 HOH 129 625 268 HOH HOH B . 
L 6 HOH 130 626 269 HOH HOH B . 
L 6 HOH 131 627 271 HOH HOH B . 
L 6 HOH 132 628 275 HOH HOH B . 
L 6 HOH 133 629 278 HOH HOH B . 
L 6 HOH 134 630 283 HOH HOH B . 
L 6 HOH 135 631 285 HOH HOH B . 
L 6 HOH 136 632 288 HOH HOH B . 
L 6 HOH 137 633 290 HOH HOH B . 
L 6 HOH 138 634 291 HOH HOH B . 
M 6 HOH 1   289 289 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,I,K   
2 1 B,D,G,H,J,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? C CYS 19  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .  ? C FES 150 ? 1_555 124.7 ? 
2  SG ? C CYS 19  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 116.9 ? 
3  S1 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 90.1  ? 
4  SG ? C CYS 19  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 25 ? C CYS 52  ? 1_555 108.8 ? 
5  S1 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 25 ? C CYS 52  ? 1_555 100.1 ? 
6  S2 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 25 ? C CYS 52  ? 1_555 114.6 ? 
7  SG ? D CYS 19  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 150 ? 1_555 S1 ? J FES .  ? D FES 150 ? 1_555 138.1 ? 
8  SG ? D CYS 19  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 150 ? 1_555 S2 ? J FES .  ? D FES 150 ? 1_555 109.4 ? 
9  S1 ? J FES .   ? D FES 150 ? 1_555 FE1 ? J FES . ? D FES 150 ? 1_555 S2 ? J FES .  ? D FES 150 ? 1_555 89.9  ? 
10 SG ? D CYS 19  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 150 ? 1_555 SG ? D CYS 25 ? D CYS 52  ? 1_555 101.9 ? 
11 S1 ? J FES .   ? D FES 150 ? 1_555 FE1 ? J FES . ? D FES 150 ? 1_555 SG ? D CYS 25 ? D CYS 52  ? 1_555 109.2 ? 
12 S2 ? J FES .   ? D FES 150 ? 1_555 FE1 ? J FES . ? D FES 150 ? 1_555 SG ? D CYS 25 ? D CYS 52  ? 1_555 103.7 ? 
13 SG ? C CYS 65  ? C CYS 92  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .  ? C FES 150 ? 1_555 125.6 ? 
14 SG ? C CYS 65  ? C CYS 92  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 112.1 ? 
15 S1 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 90.0  ? 
16 SG ? C CYS 65  ? C CYS 92  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 28 ? C CYS 55  ? 1_555 118.3 ? 
17 S1 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 28 ? C CYS 55  ? 1_555 103.5 ? 
18 S2 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 28 ? C CYS 55  ? 1_555 101.7 ? 
19 SG ? A CYS 419 ? A CYS 462 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NA ? E HEM .  ? A HEM 601 ? 1_555 94.8  ? 
20 SG ? A CYS 419 ? A CYS 462 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .  ? A HEM 601 ? 1_555 84.8  ? 
21 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .  ? A HEM 601 ? 1_555 88.7  ? 
22 SG ? A CYS 419 ? A CYS 462 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 88.4  ? 
23 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 176.7 ? 
24 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 91.0  ? 
25 SG ? A CYS 419 ? A CYS 462 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 98.2  ? 
26 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 91.7  ? 
27 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 177.0 ? 
28 NC ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 88.5  ? 
29 SG ? D CYS 65  ? D CYS 92  ? 1_555 FE2 ? J FES . ? D FES 150 ? 1_555 S1 ? J FES .  ? D FES 150 ? 1_555 115.3 ? 
30 SG ? D CYS 65  ? D CYS 92  ? 1_555 FE2 ? J FES . ? D FES 150 ? 1_555 S2 ? J FES .  ? D FES 150 ? 1_555 111.6 ? 
31 S1 ? J FES .   ? D FES 150 ? 1_555 FE2 ? J FES . ? D FES 150 ? 1_555 S2 ? J FES .  ? D FES 150 ? 1_555 90.0  ? 
32 SG ? D CYS 65  ? D CYS 92  ? 1_555 FE2 ? J FES . ? D FES 150 ? 1_555 SG ? D CYS 28 ? D CYS 55  ? 1_555 112.0 ? 
33 S1 ? J FES .   ? D FES 150 ? 1_555 FE2 ? J FES . ? D FES 150 ? 1_555 SG ? D CYS 28 ? D CYS 55  ? 1_555 108.8 ? 
34 S2 ? J FES .   ? D FES 150 ? 1_555 FE2 ? J FES . ? D FES 150 ? 1_555 SG ? D CYS 28 ? D CYS 55  ? 1_555 117.5 ? 
35 SG ? B CYS 419 ? B CYS 462 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NA ? G HEM .  ? B HEM 601 ? 1_555 94.7  ? 
36 SG ? B CYS 419 ? B CYS 462 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .  ? B HEM 601 ? 1_555 86.7  ? 
37 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .  ? B HEM 601 ? 1_555 86.5  ? 
38 SG ? B CYS 419 ? B CYS 462 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 89.9  ? 
39 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 175.4 ? 
40 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 93.1  ? 
41 SG ? B CYS 419 ? B CYS 462 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 97.4  ? 
42 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 93.3  ? 
43 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 175.9 ? 
44 NC ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 86.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-09-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.5.0102 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.100    'May. 21, 2010' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    579 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    625 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 144 ? ? 34.94   -136.70 
2  1 ASN A 193 ? ? -177.19 141.83  
3  1 ASP A 308 ? ? -161.35 68.07   
4  1 GLN A 364 ? ? 37.88   56.71   
5  1 LYS A 412 ? ? 86.24   -4.63   
6  1 ARG A 439 ? ? -37.49  -37.04  
7  1 LYS A 445 ? ? -80.37  38.10   
8  1 CYS A 462 ? ? -38.06  127.51  
9  1 LEU A 499 ? ? 71.77   -56.78  
10 1 ILE B 102 ? ? -132.59 -38.37  
11 1 SER B 113 ? ? -100.63 56.79   
12 1 SER B 144 ? ? 59.84   -146.32 
13 1 ASN B 193 ? ? -170.72 132.99  
14 1 ASP B 308 ? ? -153.35 56.90   
15 1 LYS B 412 ? ? 82.54   1.41    
16 1 SER B 442 ? ? -33.11  143.26  
17 1 GLN B 488 ? ? -68.68  -138.26 
18 1 HIS B 489 ? ? -21.38  -37.40  
19 1 LEU B 490 ? ? 70.12   46.87   
20 1 ASN B 498 ? ? -115.85 51.11   
21 1 LEU B 499 ? ? 70.62   -59.66  
22 1 GLU C 47  ? ? 74.51   53.86   
23 1 CYS C 52  ? ? -167.41 -166.74 
24 1 SER C 53  ? ? -146.02 50.46   
25 1 ASP C 79  ? ? -65.76  5.04    
26 1 GLU D 47  ? ? 72.61   50.26   
27 1 ALA D 51  ? ? -140.44 26.16   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    192 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    193 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -147.75 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 44 ? A SER 1  
2  1 Y 1 B SER 44 ? B SER 1  
3  1 Y 1 C SER 28 ? C SER 1  
4  1 Y 1 C LEU 29 ? C LEU 2  
5  1 Y 1 C LEU 30 ? C LEU 3  
6  1 Y 1 C ASP 31 ? C ASP 4  
7  1 Y 1 C VAL 32 ? C VAL 5  
8  1 Y 1 C VAL 33 ? C VAL 6  
9  1 Y 1 C VAL 34 ? C VAL 7  
10 1 Y 1 C GLU 35 ? C GLU 8  
11 1 Y 1 C ASN 36 ? C ASN 9  
12 1 Y 1 C ASN 37 ? C ASN 10 
13 1 Y 1 C LEU 38 ? C LEU 11 
14 1 Y 1 C ASP 39 ? C ASP 12 
15 1 Y 1 C ILE 40 ? C ILE 13 
16 1 Y 1 C ASP 41 ? C ASP 14 
17 1 Y 1 C GLY 42 ? C GLY 15 
18 1 Y 1 C HIS 56 ? C HIS 29 
19 1 Y 1 C LEU 57 ? C LEU 30 
20 1 Y 1 C ILE 58 ? C ILE 31 
21 1 Y 1 C PHE 59 ? C PHE 32 
22 1 Y 1 C GLU 60 ? C GLU 33 
23 1 Y 1 C ASP 61 ? C ASP 34 
24 1 Y 1 C HIS 62 ? C HIS 35 
25 1 Y 1 C ILE 63 ? C ILE 36 
26 1 Y 1 C TYR 64 ? C TYR 37 
27 1 Y 1 C GLU 65 ? C GLU 38 
28 1 Y 1 C LYS 66 ? C LYS 39 
29 1 Y 1 C LEU 67 ? C LEU 40 
30 1 Y 1 C ASP 68 ? C ASP 41 
31 1 Y 1 C ALA 69 ? C ALA 42 
32 1 Y 1 C ILE 70 ? C ILE 43 
33 1 Y 1 C TYR 82 ? C TYR 55 
34 1 Y 1 C GLY 83 ? C GLY 56 
35 1 Y 1 C LEU 84 ? C LEU 57 
36 1 Y 1 C THR 85 ? C THR 58 
37 1 Y 1 C ASP 86 ? C ASP 59 
38 1 Y 1 C ARG 87 ? C ARG 60 
39 1 Y 1 C SER 88 ? C SER 61 
40 1 Y 1 C ARG 89 ? C ARG 62 
41 1 Y 1 C ILE 94 ? C ILE 67 
42 1 Y 1 C CYS 95 ? C CYS 68 
43 1 Y 1 D SER 28 ? D SER 1  
44 1 Y 1 D LEU 29 ? D LEU 2  
45 1 Y 1 D LEU 30 ? D LEU 3  
46 1 Y 1 D ASP 31 ? D ASP 4  
47 1 Y 1 D VAL 32 ? D VAL 5  
48 1 Y 1 D VAL 33 ? D VAL 6  
49 1 Y 1 D VAL 34 ? D VAL 7  
50 1 Y 1 D GLU 35 ? D GLU 8  
51 1 Y 1 D ASN 36 ? D ASN 9  
52 1 Y 1 D ASN 37 ? D ASN 10 
53 1 Y 1 D LEU 38 ? D LEU 11 
54 1 Y 1 D ASP 39 ? D ASP 12 
55 1 Y 1 D ILE 40 ? D ILE 13 
56 1 Y 1 D ASP 41 ? D ASP 14 
57 1 Y 1 D GLY 42 ? D GLY 15 
58 1 Y 1 D HIS 56 ? D HIS 29 
59 1 Y 1 D LEU 57 ? D LEU 30 
60 1 Y 1 D ILE 58 ? D ILE 31 
61 1 Y 1 D PHE 59 ? D PHE 32 
62 1 Y 1 D GLU 60 ? D GLU 33 
63 1 Y 1 D ASP 61 ? D ASP 34 
64 1 Y 1 D HIS 62 ? D HIS 35 
65 1 Y 1 D ILE 63 ? D ILE 36 
66 1 Y 1 D TYR 64 ? D TYR 37 
67 1 Y 1 D GLU 65 ? D GLU 38 
68 1 Y 1 D LYS 66 ? D LYS 39 
69 1 Y 1 D LEU 67 ? D LEU 40 
70 1 Y 1 D ASP 68 ? D ASP 41 
71 1 Y 1 D ALA 69 ? D ALA 42 
72 1 Y 1 D ILE 70 ? D ILE 43 
73 1 Y 1 D TYR 82 ? D TYR 55 
74 1 Y 1 D GLY 83 ? D GLY 56 
75 1 Y 1 D LEU 84 ? D LEU 57 
76 1 Y 1 D THR 85 ? D THR 58 
77 1 Y 1 D ASP 86 ? D ASP 59 
78 1 Y 1 D ARG 87 ? D ARG 60 
79 1 Y 1 D SER 88 ? D SER 61 
80 1 Y 1 D ARG 89 ? D ARG 62 
81 1 Y 1 D ILE 94 ? D ILE 67 
82 1 Y 1 D CYS 95 ? D CYS 68 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE'                 HEM 
4 '(3alpha,8alpha,22R)-cholest-5-ene-3,20,22-triol' 2DC 
5 'FE2/S2 (INORGANIC) CLUSTER'                      FES 
6 water                                             HOH 
#