data_3NA1
# 
_entry.id   3NA1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NA1         
RCSB  RCSB059568   
WWPDB D_1000059568 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3N9Y . unspecified 
PDB 3N9Z . unspecified 
PDB 3NA0 . unspecified 
# 
_pdbx_database_status.entry_id                        3NA1 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Strushkevich, N.V.'                   1  
'MacKenzie, F.'                        2  
'Tempel, W.'                           3  
'Botchkarev, A.'                       4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Bountra, C.'                          7  
'Weigelt, J.U.'                        8  
'Park, H.'                             9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                10139 
_citation.page_last                 10143 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21636783 
_citation.pdbx_database_id_DOI      10.1073/pnas.1019441108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Strushkevich, N.' 1 
primary 'Mackenzie, F.'    2 
primary 'Cherkesova, T.'   3 
primary 'Grabovec, I.'     4 
primary 'Usanov, S.'       5 
primary 'Park, H.W.'       6 
# 
_cell.entry_id           3NA1 
_cell.length_a           82.810 
_cell.length_b           115.149 
_cell.length_c           85.727 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NA1 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cholesterol side-chain cleavage enzyme, mitochondrial' 56885.066 2   1.14.15.6 ? 'UNP residues 41-521' ? 
2 polymer     man 'Adrenodoxin, mitochondrial'                            13488.032 2   ?         ? 'UNP residues 62-184' ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                       616.487   2   ?         ? ?                     ? 
4 non-polymer syn '(3alpha,8alpha)-cholest-5-ene-3,20-diol'               402.653   2   ?         ? ?                     ? 
5 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                            175.820   2   ?         ? ?                     ? 
6 water       nat water                                                   18.015    531 ?         ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cytochrome P450 11A1, CYPXIA1, Cytochrome P450(scc), Cholesterol desmolase' 
2 'Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin'                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
QHHHHHH
;
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
QHHHHHH
;
A,B ? 
2 'polypeptide(L)' no no 
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   THR n 
1 3   ARG n 
1 4   SER n 
1 5   PRO n 
1 6   ARG n 
1 7   PRO n 
1 8   PHE n 
1 9   ASN n 
1 10  GLU n 
1 11  ILE n 
1 12  PRO n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  ASP n 
1 17  ASN n 
1 18  GLY n 
1 19  TRP n 
1 20  LEU n 
1 21  ASN n 
1 22  LEU n 
1 23  TYR n 
1 24  HIS n 
1 25  PHE n 
1 26  TRP n 
1 27  ARG n 
1 28  GLU n 
1 29  THR n 
1 30  GLY n 
1 31  THR n 
1 32  HIS n 
1 33  LYS n 
1 34  VAL n 
1 35  HIS n 
1 36  LEU n 
1 37  HIS n 
1 38  HIS n 
1 39  VAL n 
1 40  GLN n 
1 41  ASN n 
1 42  PHE n 
1 43  GLN n 
1 44  LYS n 
1 45  TYR n 
1 46  GLY n 
1 47  PRO n 
1 48  ILE n 
1 49  TYR n 
1 50  ARG n 
1 51  GLU n 
1 52  LYS n 
1 53  LEU n 
1 54  GLY n 
1 55  ASN n 
1 56  VAL n 
1 57  GLU n 
1 58  SER n 
1 59  VAL n 
1 60  TYR n 
1 61  VAL n 
1 62  ILE n 
1 63  ASP n 
1 64  PRO n 
1 65  GLU n 
1 66  ASP n 
1 67  VAL n 
1 68  ALA n 
1 69  LEU n 
1 70  LEU n 
1 71  PHE n 
1 72  LYS n 
1 73  SER n 
1 74  GLU n 
1 75  GLY n 
1 76  PRO n 
1 77  ASN n 
1 78  PRO n 
1 79  GLU n 
1 80  ARG n 
1 81  PHE n 
1 82  LEU n 
1 83  ILE n 
1 84  PRO n 
1 85  PRO n 
1 86  TRP n 
1 87  VAL n 
1 88  ALA n 
1 89  TYR n 
1 90  HIS n 
1 91  GLN n 
1 92  TYR n 
1 93  TYR n 
1 94  GLN n 
1 95  ARG n 
1 96  PRO n 
1 97  ILE n 
1 98  GLY n 
1 99  VAL n 
1 100 LEU n 
1 101 LEU n 
1 102 LYS n 
1 103 LYS n 
1 104 SER n 
1 105 ALA n 
1 106 ALA n 
1 107 TRP n 
1 108 LYS n 
1 109 LYS n 
1 110 ASP n 
1 111 ARG n 
1 112 VAL n 
1 113 ALA n 
1 114 LEU n 
1 115 ASN n 
1 116 GLN n 
1 117 GLU n 
1 118 VAL n 
1 119 MET n 
1 120 ALA n 
1 121 PRO n 
1 122 GLU n 
1 123 ALA n 
1 124 THR n 
1 125 LYS n 
1 126 ASN n 
1 127 PHE n 
1 128 LEU n 
1 129 PRO n 
1 130 LEU n 
1 131 LEU n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 SER n 
1 136 ARG n 
1 137 ASP n 
1 138 PHE n 
1 139 VAL n 
1 140 SER n 
1 141 VAL n 
1 142 LEU n 
1 143 HIS n 
1 144 ARG n 
1 145 ARG n 
1 146 ILE n 
1 147 LYS n 
1 148 LYS n 
1 149 ALA n 
1 150 GLY n 
1 151 SER n 
1 152 GLY n 
1 153 ASN n 
1 154 TYR n 
1 155 SER n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 SER n 
1 160 ASP n 
1 161 ASP n 
1 162 LEU n 
1 163 PHE n 
1 164 ARG n 
1 165 PHE n 
1 166 ALA n 
1 167 PHE n 
1 168 GLU n 
1 169 SER n 
1 170 ILE n 
1 171 THR n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 PHE n 
1 176 GLY n 
1 177 GLU n 
1 178 ARG n 
1 179 GLN n 
1 180 GLY n 
1 181 MET n 
1 182 LEU n 
1 183 GLU n 
1 184 GLU n 
1 185 VAL n 
1 186 VAL n 
1 187 ASN n 
1 188 PRO n 
1 189 GLU n 
1 190 ALA n 
1 191 GLN n 
1 192 ARG n 
1 193 PHE n 
1 194 ILE n 
1 195 ASP n 
1 196 ALA n 
1 197 ILE n 
1 198 TYR n 
1 199 GLN n 
1 200 MET n 
1 201 PHE n 
1 202 HIS n 
1 203 THR n 
1 204 SER n 
1 205 VAL n 
1 206 PRO n 
1 207 MET n 
1 208 LEU n 
1 209 ASN n 
1 210 LEU n 
1 211 PRO n 
1 212 PRO n 
1 213 ASP n 
1 214 LEU n 
1 215 PHE n 
1 216 ARG n 
1 217 LEU n 
1 218 PHE n 
1 219 ARG n 
1 220 THR n 
1 221 LYS n 
1 222 THR n 
1 223 TRP n 
1 224 LYS n 
1 225 ASP n 
1 226 HIS n 
1 227 VAL n 
1 228 ALA n 
1 229 ALA n 
1 230 TRP n 
1 231 ASP n 
1 232 VAL n 
1 233 ILE n 
1 234 PHE n 
1 235 SER n 
1 236 LYS n 
1 237 ALA n 
1 238 ASP n 
1 239 ILE n 
1 240 TYR n 
1 241 THR n 
1 242 GLN n 
1 243 ASN n 
1 244 PHE n 
1 245 TYR n 
1 246 TRP n 
1 247 GLU n 
1 248 LEU n 
1 249 ARG n 
1 250 GLN n 
1 251 LYS n 
1 252 GLY n 
1 253 SER n 
1 254 VAL n 
1 255 HIS n 
1 256 HIS n 
1 257 ASP n 
1 258 TYR n 
1 259 ARG n 
1 260 GLY n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 ARG n 
1 265 LEU n 
1 266 LEU n 
1 267 GLY n 
1 268 ASP n 
1 269 SER n 
1 270 LYS n 
1 271 MET n 
1 272 SER n 
1 273 PHE n 
1 274 GLU n 
1 275 ASP n 
1 276 ILE n 
1 277 LYS n 
1 278 ALA n 
1 279 ASN n 
1 280 VAL n 
1 281 THR n 
1 282 GLU n 
1 283 MET n 
1 284 LEU n 
1 285 ALA n 
1 286 GLY n 
1 287 GLY n 
1 288 VAL n 
1 289 ASP n 
1 290 THR n 
1 291 THR n 
1 292 SER n 
1 293 MET n 
1 294 THR n 
1 295 LEU n 
1 296 GLN n 
1 297 TRP n 
1 298 HIS n 
1 299 LEU n 
1 300 TYR n 
1 301 GLU n 
1 302 MET n 
1 303 ALA n 
1 304 ARG n 
1 305 ASN n 
1 306 LEU n 
1 307 LYS n 
1 308 VAL n 
1 309 GLN n 
1 310 ASP n 
1 311 MET n 
1 312 LEU n 
1 313 ARG n 
1 314 ALA n 
1 315 GLU n 
1 316 VAL n 
1 317 LEU n 
1 318 ALA n 
1 319 ALA n 
1 320 ARG n 
1 321 HIS n 
1 322 GLN n 
1 323 ALA n 
1 324 GLN n 
1 325 GLY n 
1 326 ASP n 
1 327 MET n 
1 328 ALA n 
1 329 THR n 
1 330 MET n 
1 331 LEU n 
1 332 GLN n 
1 333 LEU n 
1 334 VAL n 
1 335 PRO n 
1 336 LEU n 
1 337 LEU n 
1 338 LYS n 
1 339 ALA n 
1 340 SER n 
1 341 ILE n 
1 342 LYS n 
1 343 GLU n 
1 344 THR n 
1 345 LEU n 
1 346 ARG n 
1 347 LEU n 
1 348 HIS n 
1 349 PRO n 
1 350 ILE n 
1 351 SER n 
1 352 VAL n 
1 353 THR n 
1 354 LEU n 
1 355 GLN n 
1 356 ARG n 
1 357 TYR n 
1 358 LEU n 
1 359 VAL n 
1 360 ASN n 
1 361 ASP n 
1 362 LEU n 
1 363 VAL n 
1 364 LEU n 
1 365 ARG n 
1 366 ASP n 
1 367 TYR n 
1 368 MET n 
1 369 ILE n 
1 370 PRO n 
1 371 ALA n 
1 372 LYS n 
1 373 THR n 
1 374 LEU n 
1 375 VAL n 
1 376 GLN n 
1 377 VAL n 
1 378 ALA n 
1 379 ILE n 
1 380 TYR n 
1 381 ALA n 
1 382 LEU n 
1 383 GLY n 
1 384 ARG n 
1 385 GLU n 
1 386 PRO n 
1 387 THR n 
1 388 PHE n 
1 389 PHE n 
1 390 PHE n 
1 391 ASP n 
1 392 PRO n 
1 393 GLU n 
1 394 ASN n 
1 395 PHE n 
1 396 ASP n 
1 397 PRO n 
1 398 THR n 
1 399 ARG n 
1 400 TRP n 
1 401 LEU n 
1 402 SER n 
1 403 LYS n 
1 404 ASP n 
1 405 LYS n 
1 406 ASN n 
1 407 ILE n 
1 408 THR n 
1 409 TYR n 
1 410 PHE n 
1 411 ARG n 
1 412 ASN n 
1 413 LEU n 
1 414 GLY n 
1 415 PHE n 
1 416 GLY n 
1 417 TRP n 
1 418 GLY n 
1 419 VAL n 
1 420 ARG n 
1 421 GLN n 
1 422 CYS n 
1 423 LEU n 
1 424 GLY n 
1 425 ARG n 
1 426 ARG n 
1 427 ILE n 
1 428 ALA n 
1 429 GLU n 
1 430 LEU n 
1 431 GLU n 
1 432 MET n 
1 433 THR n 
1 434 ILE n 
1 435 PHE n 
1 436 LEU n 
1 437 ILE n 
1 438 ASN n 
1 439 MET n 
1 440 LEU n 
1 441 GLU n 
1 442 ASN n 
1 443 PHE n 
1 444 ARG n 
1 445 VAL n 
1 446 GLU n 
1 447 ILE n 
1 448 GLN n 
1 449 HIS n 
1 450 LEU n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 GLY n 
1 455 THR n 
1 456 THR n 
1 457 PHE n 
1 458 ASN n 
1 459 LEU n 
1 460 ILE n 
1 461 LEU n 
1 462 MET n 
1 463 PRO n 
1 464 GLU n 
1 465 LYS n 
1 466 PRO n 
1 467 ILE n 
1 468 SER n 
1 469 PHE n 
1 470 THR n 
1 471 PHE n 
1 472 TRP n 
1 473 PRO n 
1 474 PHE n 
1 475 ASN n 
1 476 GLN n 
1 477 GLU n 
1 478 ALA n 
1 479 THR n 
1 480 GLN n 
1 481 GLN n 
1 482 HIS n 
1 483 HIS n 
1 484 HIS n 
1 485 HIS n 
1 486 HIS n 
1 487 HIS n 
2 1   SER n 
2 2   SER n 
2 3   GLU n 
2 4   ASP n 
2 5   LYS n 
2 6   ILE n 
2 7   THR n 
2 8   VAL n 
2 9   HIS n 
2 10  PHE n 
2 11  ILE n 
2 12  ASN n 
2 13  ARG n 
2 14  ASP n 
2 15  GLY n 
2 16  GLU n 
2 17  THR n 
2 18  LEU n 
2 19  THR n 
2 20  THR n 
2 21  LYS n 
2 22  GLY n 
2 23  LYS n 
2 24  VAL n 
2 25  GLY n 
2 26  ASP n 
2 27  SER n 
2 28  LEU n 
2 29  LEU n 
2 30  ASP n 
2 31  VAL n 
2 32  VAL n 
2 33  VAL n 
2 34  GLU n 
2 35  ASN n 
2 36  ASN n 
2 37  LEU n 
2 38  ASP n 
2 39  ILE n 
2 40  ASP n 
2 41  GLY n 
2 42  PHE n 
2 43  GLY n 
2 44  ALA n 
2 45  CYS n 
2 46  GLU n 
2 47  GLY n 
2 48  THR n 
2 49  LEU n 
2 50  ALA n 
2 51  CYS n 
2 52  SER n 
2 53  THR n 
2 54  CYS n 
2 55  HIS n 
2 56  LEU n 
2 57  ILE n 
2 58  PHE n 
2 59  GLU n 
2 60  ASP n 
2 61  HIS n 
2 62  ILE n 
2 63  TYR n 
2 64  GLU n 
2 65  LYS n 
2 66  LEU n 
2 67  ASP n 
2 68  ALA n 
2 69  ILE n 
2 70  THR n 
2 71  ASP n 
2 72  GLU n 
2 73  GLU n 
2 74  ASN n 
2 75  ASP n 
2 76  MET n 
2 77  LEU n 
2 78  ASP n 
2 79  LEU n 
2 80  ALA n 
2 81  TYR n 
2 82  GLY n 
2 83  LEU n 
2 84  THR n 
2 85  ASP n 
2 86  ARG n 
2 87  SER n 
2 88  ARG n 
2 89  LEU n 
2 90  GLY n 
2 91  CYS n 
2 92  GLN n 
2 93  ILE n 
2 94  CYS n 
2 95  LEU n 
2 96  THR n 
2 97  LYS n 
2 98  SER n 
2 99  MET n 
2 100 ASP n 
2 101 ASN n 
2 102 MET n 
2 103 THR n 
2 104 VAL n 
2 105 ARG n 
2 106 VAL n 
2 107 PRO n 
2 108 GLU n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ASP n 
2 113 ALA n 
2 114 ARG n 
2 115 GLN n 
2 116 SER n 
2 117 ILE n 
2 118 ASP n 
2 119 VAL n 
2 120 GLY n 
2 121 LYS n 
2 122 THR n 
2 123 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CYP11A, CYP11A1'        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
2 1 sample ? ? ? human ? 'adrenodoxin, ADX, FDX1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CP11A_HUMAN P05108 1 
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
Q
;
41 ? 
2 UNP ADX_HUMAN   P10109 2 
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
62 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NA1 A 1 ? 481 ? P05108 41 ? 521 ? 2 482 
2 1 3NA1 B 1 ? 481 ? P05108 41 ? 521 ? 2 482 
3 2 3NA1 C 1 ? 123 ? P10109 62 ? 184 ? 2 124 
4 2 3NA1 D 1 ? 123 ? P10109 62 ? 184 ? 2 124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NA1 HIS A 482 ? UNP P05108 ? ? 'EXPRESSION TAG' 483 1  
1 3NA1 HIS A 483 ? UNP P05108 ? ? 'EXPRESSION TAG' 484 2  
1 3NA1 HIS A 484 ? UNP P05108 ? ? 'EXPRESSION TAG' 485 3  
1 3NA1 HIS A 485 ? UNP P05108 ? ? 'EXPRESSION TAG' 486 4  
1 3NA1 HIS A 486 ? UNP P05108 ? ? 'EXPRESSION TAG' 487 5  
1 3NA1 HIS A 487 ? UNP P05108 ? ? 'EXPRESSION TAG' 488 6  
2 3NA1 HIS B 482 ? UNP P05108 ? ? 'EXPRESSION TAG' 483 7  
2 3NA1 HIS B 483 ? UNP P05108 ? ? 'EXPRESSION TAG' 484 8  
2 3NA1 HIS B 484 ? UNP P05108 ? ? 'EXPRESSION TAG' 485 9  
2 3NA1 HIS B 485 ? UNP P05108 ? ? 'EXPRESSION TAG' 486 10 
2 3NA1 HIS B 486 ? UNP P05108 ? ? 'EXPRESSION TAG' 487 11 
2 3NA1 HIS B 487 ? UNP P05108 ? ? 'EXPRESSION TAG' 488 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                      'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                      'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                      'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                      'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ?                      'C3 H7 N O2 S'     121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'              ?                      'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                      'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                      'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                      'C2 H5 N O2'       75.067  
HCD non-polymer         . '(3alpha,8alpha)-cholest-5-ene-3,20-diol' 20S-hydroxycholesterol 'C27 H46 O2'       402.653 
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'         HEME                   'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                                 ?                      'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                     ?                      'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                      'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                      'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                      'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                ?                      'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                      'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                      'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                    ?                      'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                 ?                      'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                      'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                      'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                    ?                      'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3NA1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Ca acetate, pH 7.5, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2009-11-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     3NA1 
_reflns.d_resolution_high            2.250 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   74265 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_netI_over_sigmaI        15.300 
_reflns.pdbx_chi_squared             1.987 
_reflns.pdbx_redundancy              4.500 
_reflns.percent_possible_obs         99.300 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.25 2.29  ? ? ? 0.223 ? ? 1.900 4.00 ? 3561 96.20  1  1 
2.29 2.33  ? ? ? 0.201 ? ? 1.746 4.10 ? 3620 97.20  2  1 
2.33 2.38  ? ? ? 0.193 ? ? 1.689 4.20 ? 3664 97.80  3  1 
2.38 2.42  ? ? ? 0.178 ? ? 1.757 4.30 ? 3638 98.40  4  1 
2.42 2.48  ? ? ? 0.170 ? ? 1.781 4.30 ? 3670 99.10  5  1 
2.48 2.53  ? ? ? 0.163 ? ? 1.868 4.40 ? 3704 99.20  6  1 
2.53 2.60  ? ? ? 0.153 ? ? 1.732 4.40 ? 3726 99.60  7  1 
2.60 2.67  ? ? ? 0.143 ? ? 1.757 4.50 ? 3745 99.90  8  1 
2.67 2.75  ? ? ? 0.131 ? ? 1.845 4.60 ? 3689 99.90  9  1 
2.75 2.83  ? ? ? 0.121 ? ? 1.818 4.60 ? 3740 100.00 10 1 
2.83 2.94  ? ? ? 0.108 ? ? 1.985 4.70 ? 3716 100.00 11 1 
2.94 3.05  ? ? ? 0.101 ? ? 2.077 4.70 ? 3762 100.00 12 1 
3.05 3.19  ? ? ? 0.088 ? ? 2.314 4.70 ? 3729 100.00 13 1 
3.19 3.36  ? ? ? 0.074 ? ? 2.254 4.70 ? 3716 100.00 14 1 
3.36 3.57  ? ? ? 0.061 ? ? 2.056 4.70 ? 3767 100.00 15 1 
3.57 3.85  ? ? ? 0.051 ? ? 2.036 4.70 ? 3718 100.00 16 1 
3.85 4.23  ? ? ? 0.051 ? ? 2.476 4.70 ? 3744 99.90  17 1 
4.23 4.85  ? ? ? 0.047 ? ? 2.651 4.70 ? 3753 99.80  18 1 
4.85 6.10  ? ? ? 0.041 ? ? 1.994 4.70 ? 3764 100.00 19 1 
6.10 50.00 ? ? ? 0.031 ? ? 1.788 4.60 ? 3839 99.70  20 1 
# 
_refine.entry_id                                 3NA1 
_refine.ls_d_res_high                            2.250 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.870 
_refine.ls_number_reflns_obs                     73875 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.232 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3714 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               25.989 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.620 
_refine.aniso_B[2][2]                            -1.250 
_refine.aniso_B[3][3]                            0.090 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.340 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.914 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.189 
_refine.overall_SU_ML                            0.124 
_refine.overall_SU_B                             4.887 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 3N9Y' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                110.59 
_refine.B_iso_min                                6.76 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8112 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         152 
_refine_hist.number_atoms_solvent             531 
_refine_hist.number_atoms_total               8795 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       8497  0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    11560 1.177  1.989  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 985   5.026  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 413   35.167 23.511 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 1415  14.473 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 60    17.102 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         1236  0.081  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   6468  0.005  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            4956  0.557  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           8021  1.097  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            3541  1.608  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           3535  2.706  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.250 
_refine_ls_shell.d_res_low                        2.308 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.760 
_refine_ls_shell.number_reflns_R_work             5015 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.219 
_refine_ls_shell.R_factor_R_free                  0.254 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             250 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                5265 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3NA1 
_struct.title                     'Crystal structure of human CYP11A1 in complex with 20-hydroxycholesterol' 
_struct.pdbx_descriptor           
'Cholesterol side-chain cleavage enzyme, mitochondrial (E.C.1.14.15.6), Adrenodoxin, mitochondrial' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NA1 
_struct_keywords.text            
;cytochrome P450, 20-hydroxycholesterol, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
;
_struct_keywords.pdbx_keywords   'Oxidoreductase, Electron transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 7   ? ILE A 11  ? PRO A 8   ILE A 12  5 ? 5  
HELX_P HELX_P2  2  ASN A 17  ? THR A 29  ? ASN A 18  THR A 30  1 ? 13 
HELX_P HELX_P3  3  GLY A 30  ? HIS A 32  ? GLY A 31  HIS A 33  5 ? 3  
HELX_P HELX_P4  4  LYS A 33  ? GLY A 46  ? LYS A 34  GLY A 47  1 ? 14 
HELX_P HELX_P5  5  ASP A 63  ? SER A 73  ? ASP A 64  SER A 74  1 ? 11 
HELX_P HELX_P6  6  ILE A 83  ? TYR A 93  ? ILE A 84  TYR A 94  1 ? 11 
HELX_P HELX_P7  7  LYS A 103 ? MET A 119 ? LYS A 104 MET A 120 1 ? 17 
HELX_P HELX_P8  8  ALA A 120 ? LYS A 125 ? ALA A 121 LYS A 126 1 ? 6  
HELX_P HELX_P9  9  ASN A 126 ? GLY A 150 ? ASN A 127 GLY A 151 1 ? 25 
HELX_P HELX_P10 10 ILE A 158 ? GLY A 176 ? ILE A 159 GLY A 177 1 ? 19 
HELX_P HELX_P11 11 ASN A 187 ? VAL A 205 ? ASN A 188 VAL A 206 1 ? 19 
HELX_P HELX_P12 12 PRO A 206 ? LEU A 208 ? PRO A 207 LEU A 209 5 ? 3  
HELX_P HELX_P13 13 PRO A 211 ? ARG A 219 ? PRO A 212 ARG A 220 1 ? 9  
HELX_P HELX_P14 14 ARG A 219 ? GLY A 252 ? ARG A 220 GLY A 253 1 ? 34 
HELX_P HELX_P15 15 GLY A 260 ? ASP A 268 ? GLY A 261 ASP A 269 1 ? 9  
HELX_P HELX_P16 16 SER A 272 ? GLY A 287 ? SER A 273 GLY A 288 1 ? 16 
HELX_P HELX_P17 17 VAL A 288 ? ASN A 305 ? VAL A 289 ASN A 306 1 ? 18 
HELX_P HELX_P18 18 ASN A 305 ? ALA A 323 ? ASN A 306 ALA A 324 1 ? 19 
HELX_P HELX_P19 19 ASP A 326 ? LEU A 331 ? ASP A 327 LEU A 332 1 ? 6  
HELX_P HELX_P20 20 VAL A 334 ? HIS A 348 ? VAL A 335 HIS A 349 1 ? 15 
HELX_P HELX_P21 21 ALA A 378 ? ARG A 384 ? ALA A 379 ARG A 385 1 ? 7  
HELX_P HELX_P22 22 ASP A 396 ? SER A 402 ? ASP A 397 SER A 403 5 ? 7  
HELX_P HELX_P23 23 TRP A 417 ? GLN A 421 ? TRP A 418 GLN A 422 5 ? 5  
HELX_P HELX_P24 24 GLY A 424 ? ASN A 442 ? GLY A 425 ASN A 443 1 ? 19 
HELX_P HELX_P25 25 PRO B 7   ? ILE B 11  ? PRO B 8   ILE B 12  5 ? 5  
HELX_P HELX_P26 26 ASN B 17  ? THR B 29  ? ASN B 18  THR B 30  1 ? 13 
HELX_P HELX_P27 27 GLY B 30  ? HIS B 32  ? GLY B 31  HIS B 33  5 ? 3  
HELX_P HELX_P28 28 LYS B 33  ? GLY B 46  ? LYS B 34  GLY B 47  1 ? 14 
HELX_P HELX_P29 29 ASP B 63  ? SER B 73  ? ASP B 64  SER B 74  1 ? 11 
HELX_P HELX_P30 30 ILE B 83  ? TYR B 93  ? ILE B 84  TYR B 94  1 ? 11 
HELX_P HELX_P31 31 LYS B 103 ? MET B 119 ? LYS B 104 MET B 120 1 ? 17 
HELX_P HELX_P32 32 ALA B 120 ? LYS B 125 ? ALA B 121 LYS B 126 1 ? 6  
HELX_P HELX_P33 33 ASN B 126 ? GLY B 150 ? ASN B 127 GLY B 151 1 ? 25 
HELX_P HELX_P34 34 ILE B 158 ? GLY B 176 ? ILE B 159 GLY B 177 1 ? 19 
HELX_P HELX_P35 35 ASN B 187 ? VAL B 205 ? ASN B 188 VAL B 206 1 ? 19 
HELX_P HELX_P36 36 PRO B 206 ? LEU B 208 ? PRO B 207 LEU B 209 5 ? 3  
HELX_P HELX_P37 37 PRO B 211 ? ARG B 219 ? PRO B 212 ARG B 220 1 ? 9  
HELX_P HELX_P38 38 ARG B 219 ? LYS B 251 ? ARG B 220 LYS B 252 1 ? 33 
HELX_P HELX_P39 39 GLY B 260 ? ASP B 268 ? GLY B 261 ASP B 269 1 ? 9  
HELX_P HELX_P40 40 SER B 272 ? GLY B 287 ? SER B 273 GLY B 288 1 ? 16 
HELX_P HELX_P41 41 VAL B 288 ? ASN B 305 ? VAL B 289 ASN B 306 1 ? 18 
HELX_P HELX_P42 42 ASN B 305 ? ALA B 323 ? ASN B 306 ALA B 324 1 ? 19 
HELX_P HELX_P43 43 ASP B 326 ? LEU B 331 ? ASP B 327 LEU B 332 1 ? 6  
HELX_P HELX_P44 44 VAL B 334 ? HIS B 348 ? VAL B 335 HIS B 349 1 ? 15 
HELX_P HELX_P45 45 ALA B 378 ? ARG B 384 ? ALA B 379 ARG B 385 1 ? 7  
HELX_P HELX_P46 46 ASP B 396 ? LEU B 401 ? ASP B 397 LEU B 402 5 ? 6  
HELX_P HELX_P47 47 ASP B 404 ? TYR B 409 ? ASP B 405 TYR B 410 1 ? 6  
HELX_P HELX_P48 48 TRP B 417 ? GLN B 421 ? TRP B 418 GLN B 422 5 ? 5  
HELX_P HELX_P49 49 GLY B 424 ? ASN B 442 ? GLY B 425 ASN B 443 1 ? 19 
HELX_P HELX_P50 50 ASP C 71  ? LEU C 79  ? ASP C 72  LEU C 80  1 ? 9  
HELX_P HELX_P51 51 GLU D 72  ? ASP D 78  ? GLU D 73  ASP D 79  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C CYS 45  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 46  C FES 150 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc2  metalc ? ? D CYS 54  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 55  D FES 151 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc3  metalc ? ? D CYS 45  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 46  D FES 151 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc4  metalc ? ? E HEM .   FE ? ? ? 1_555 K HOH . O   ? ? A HEM 601 A HOH 759 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc5  metalc ? ? G HEM .   FE ? ? ? 1_555 L HOH . O   ? ? B HEM 601 B HOH 755 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc6  metalc ? ? B CYS 422 SG ? ? ? 1_555 G HEM . FE  ? ? B CYS 423 B HEM 601 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc7  metalc ? ? A CYS 422 SG ? ? ? 1_555 E HEM . FE  ? ? A CYS 423 A HEM 601 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc8  metalc ? ? C CYS 54  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 55  C FES 150 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc9  metalc ? ? C CYS 91  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 92  C FES 150 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc10 metalc ? ? C CYS 51  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 52  C FES 150 1_555 ? ? ? ? ? ? ? 2.645 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 48  ? LEU A 53  ? ILE A 49  LEU A 54  
A 2 VAL A 56  ? VAL A 61  ? VAL A 57  VAL A 62  
A 3 LEU A 374 ? VAL A 377 ? LEU A 375 VAL A 378 
A 4 LEU A 354 ? TYR A 357 ? LEU A 355 TYR A 358 
B 1 TYR A 154 ? ASP A 157 ? TYR A 155 ASP A 158 
B 2 SER A 468 ? PRO A 473 ? SER A 469 PRO A 474 
B 3 PHE A 443 ? GLU A 446 ? PHE A 444 GLU A 447 
C 1 LEU A 362 ? LEU A 364 ? LEU A 363 LEU A 365 
C 2 TYR A 367 ? ILE A 369 ? TYR A 368 ILE A 370 
D 1 THR A 455 ? PHE A 457 ? THR A 456 PHE A 458 
D 2 LEU A 461 ? PRO A 463 ? LEU A 462 PRO A 464 
E 1 ILE B 48  ? LEU B 53  ? ILE B 49  LEU B 54  
E 2 VAL B 56  ? VAL B 61  ? VAL B 57  VAL B 62  
E 3 LEU B 374 ? VAL B 377 ? LEU B 375 VAL B 378 
E 4 LEU B 354 ? TYR B 357 ? LEU B 355 TYR B 358 
F 1 TYR B 154 ? GLY B 156 ? TYR B 155 GLY B 157 
F 2 PHE B 469 ? PRO B 473 ? PHE B 470 PRO B 474 
F 3 PHE B 443 ? ILE B 447 ? PHE B 444 ILE B 448 
G 1 LEU B 362 ? LEU B 364 ? LEU B 363 LEU B 365 
G 2 TYR B 367 ? ILE B 369 ? TYR B 368 ILE B 370 
H 1 THR B 455 ? PHE B 457 ? THR B 456 PHE B 458 
H 2 LEU B 461 ? PRO B 463 ? LEU B 462 PRO B 464 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 49  ? N TYR A 50  O TYR A 60  ? O TYR A 61  
A 2 3 N VAL A 59  ? N VAL A 60  O GLN A 376 ? O GLN A 377 
A 3 4 O VAL A 375 ? O VAL A 376 N ARG A 356 ? N ARG A 357 
B 1 2 N TYR A 154 ? N TYR A 155 O PHE A 471 ? O PHE A 472 
B 2 3 O THR A 470 ? O THR A 471 N GLU A 446 ? N GLU A 447 
C 1 2 N LEU A 362 ? N LEU A 363 O ILE A 369 ? O ILE A 370 
D 1 2 N THR A 456 ? N THR A 457 O MET A 462 ? O MET A 463 
E 1 2 N TYR B 49  ? N TYR B 50  O TYR B 60  ? O TYR B 61  
E 2 3 N VAL B 59  ? N VAL B 60  O GLN B 376 ? O GLN B 377 
E 3 4 O VAL B 375 ? O VAL B 376 N ARG B 356 ? N ARG B 357 
F 1 2 N TYR B 154 ? N TYR B 155 O PHE B 471 ? O PHE B 472 
F 2 3 O TRP B 472 ? O TRP B 473 N ARG B 444 ? N ARG B 445 
G 1 2 N LEU B 362 ? N LEU B 363 O ILE B 369 ? O ILE B 370 
H 1 2 N THR B 456 ? N THR B 457 O MET B 462 ? O MET B 463 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE HEM A 601' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HCD A 602' 
AC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE HEM B 601' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE HCD B 602' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FES C 150' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FES D 151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 ARG A 80  ? ARG A 81  . ? 1_555 ? 
2  AC1 24 VAL A 99  ? VAL A 100 . ? 1_555 ? 
3  AC1 24 TRP A 107 ? TRP A 108 . ? 1_555 ? 
4  AC1 24 ARG A 111 ? ARG A 112 . ? 1_555 ? 
5  AC1 24 MET A 283 ? MET A 284 . ? 1_555 ? 
6  AC1 24 GLY A 286 ? GLY A 287 . ? 1_555 ? 
7  AC1 24 GLY A 287 ? GLY A 288 . ? 1_555 ? 
8  AC1 24 THR A 290 ? THR A 291 . ? 1_555 ? 
9  AC1 24 THR A 291 ? THR A 292 . ? 1_555 ? 
10 AC1 24 THR A 294 ? THR A 295 . ? 1_555 ? 
11 AC1 24 LEU A 345 ? LEU A 346 . ? 1_555 ? 
12 AC1 24 ARG A 356 ? ARG A 357 . ? 1_555 ? 
13 AC1 24 GLY A 414 ? GLY A 415 . ? 1_555 ? 
14 AC1 24 PHE A 415 ? PHE A 416 . ? 1_555 ? 
15 AC1 24 GLY A 416 ? GLY A 417 . ? 1_555 ? 
16 AC1 24 TRP A 417 ? TRP A 418 . ? 1_555 ? 
17 AC1 24 ARG A 420 ? ARG A 421 . ? 1_555 ? 
18 AC1 24 GLN A 421 ? GLN A 422 . ? 1_555 ? 
19 AC1 24 CYS A 422 ? CYS A 423 . ? 1_555 ? 
20 AC1 24 GLY A 424 ? GLY A 425 . ? 1_555 ? 
21 AC1 24 MET A 432 ? MET A 433 . ? 1_555 ? 
22 AC1 24 HOH K .   ? HOH A 558 . ? 1_555 ? 
23 AC1 24 HCD F .   ? HCD A 602 . ? 1_555 ? 
24 AC1 24 HOH K .   ? HOH A 759 . ? 1_555 ? 
25 AC2 12 PHE A 81  ? PHE A 82  . ? 1_555 ? 
26 AC2 12 LEU A 100 ? LEU A 101 . ? 1_555 ? 
27 AC2 12 MET A 200 ? MET A 201 . ? 1_555 ? 
28 AC2 12 GLU A 282 ? GLU A 283 . ? 1_555 ? 
29 AC2 12 SER A 351 ? SER A 352 . ? 1_555 ? 
30 AC2 12 THR A 353 ? THR A 354 . ? 1_555 ? 
31 AC2 12 GLN A 355 ? GLN A 356 . ? 1_555 ? 
32 AC2 12 LEU A 459 ? LEU A 460 . ? 1_555 ? 
33 AC2 12 HOH K .   ? HOH A 516 . ? 1_555 ? 
34 AC2 12 HOH K .   ? HOH A 584 . ? 1_555 ? 
35 AC2 12 HEM E .   ? HEM A 601 . ? 1_555 ? 
36 AC2 12 HOH K .   ? HOH A 759 . ? 1_555 ? 
37 AC3 25 ARG B 80  ? ARG B 81  . ? 1_555 ? 
38 AC3 25 VAL B 99  ? VAL B 100 . ? 1_555 ? 
39 AC3 25 TRP B 107 ? TRP B 108 . ? 1_555 ? 
40 AC3 25 ARG B 111 ? ARG B 112 . ? 1_555 ? 
41 AC3 25 MET B 283 ? MET B 284 . ? 1_555 ? 
42 AC3 25 GLY B 286 ? GLY B 287 . ? 1_555 ? 
43 AC3 25 GLY B 287 ? GLY B 288 . ? 1_555 ? 
44 AC3 25 THR B 290 ? THR B 291 . ? 1_555 ? 
45 AC3 25 THR B 291 ? THR B 292 . ? 1_555 ? 
46 AC3 25 THR B 294 ? THR B 295 . ? 1_555 ? 
47 AC3 25 LEU B 345 ? LEU B 346 . ? 1_555 ? 
48 AC3 25 SER B 351 ? SER B 352 . ? 1_555 ? 
49 AC3 25 ARG B 356 ? ARG B 357 . ? 1_555 ? 
50 AC3 25 GLY B 414 ? GLY B 415 . ? 1_555 ? 
51 AC3 25 PHE B 415 ? PHE B 416 . ? 1_555 ? 
52 AC3 25 GLY B 416 ? GLY B 417 . ? 1_555 ? 
53 AC3 25 TRP B 417 ? TRP B 418 . ? 1_555 ? 
54 AC3 25 ARG B 420 ? ARG B 421 . ? 1_555 ? 
55 AC3 25 GLN B 421 ? GLN B 422 . ? 1_555 ? 
56 AC3 25 CYS B 422 ? CYS B 423 . ? 1_555 ? 
57 AC3 25 GLY B 424 ? GLY B 425 . ? 1_555 ? 
58 AC3 25 MET B 432 ? MET B 433 . ? 1_555 ? 
59 AC3 25 HOH L .   ? HOH B 521 . ? 1_555 ? 
60 AC3 25 HCD H .   ? HCD B 602 . ? 1_555 ? 
61 AC3 25 HOH L .   ? HOH B 755 . ? 1_555 ? 
62 AC4 9  PHE B 81  ? PHE B 82  . ? 1_555 ? 
63 AC4 9  SER B 351 ? SER B 352 . ? 1_555 ? 
64 AC4 9  THR B 353 ? THR B 354 . ? 1_555 ? 
65 AC4 9  GLN B 355 ? GLN B 356 . ? 1_555 ? 
66 AC4 9  LEU B 459 ? LEU B 460 . ? 1_555 ? 
67 AC4 9  HOH L .   ? HOH B 563 . ? 1_555 ? 
68 AC4 9  HEM G .   ? HEM B 601 . ? 1_555 ? 
69 AC4 9  HOH L .   ? HOH B 608 . ? 1_555 ? 
70 AC4 9  HOH L .   ? HOH B 755 . ? 1_555 ? 
71 AC5 5  CYS C 45  ? CYS C 46  . ? 1_555 ? 
72 AC5 5  GLY C 47  ? GLY C 48  . ? 1_555 ? 
73 AC5 5  CYS C 51  ? CYS C 52  . ? 1_555 ? 
74 AC5 5  CYS C 54  ? CYS C 55  . ? 1_555 ? 
75 AC5 5  CYS C 91  ? CYS C 92  . ? 1_555 ? 
76 AC6 5  CYS D 45  ? CYS D 46  . ? 1_555 ? 
77 AC6 5  GLY D 47  ? GLY D 48  . ? 1_555 ? 
78 AC6 5  CYS D 51  ? CYS D 52  . ? 1_555 ? 
79 AC6 5  CYS D 54  ? CYS D 55  . ? 1_555 ? 
80 AC6 5  CYS D 91  ? CYS D 92  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3NA1 
_atom_sites.fract_transf_matrix[1][1]   0.012076 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002446 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008684 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011902 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -71.284 -14.816 59.668  1.00 45.14  ? 5   SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -69.977 -14.566 60.348  1.00 45.16  ? 5   SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -68.802 -15.074 59.493  1.00 44.63  ? 5   SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -69.009 -15.898 58.596  1.00 44.61  ? 5   SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -69.963 -15.216 61.739  1.00 45.41  ? 5   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -69.799 -16.623 61.653  1.00 46.47  ? 5   SER A OG  1 
ATOM   7    N  N   . PRO A 1 5   ? -67.569 -14.582 59.771  1.00 43.99  ? 6   PRO A N   1 
ATOM   8    C  CA  . PRO A 1 5   ? -66.392 -14.925 58.962  1.00 42.99  ? 6   PRO A CA  1 
ATOM   9    C  C   . PRO A 1 5   ? -65.945 -16.372 59.117  1.00 41.82  ? 6   PRO A C   1 
ATOM   10   O  O   . PRO A 1 5   ? -66.208 -16.997 60.144  1.00 41.81  ? 6   PRO A O   1 
ATOM   11   C  CB  . PRO A 1 5   ? -65.307 -13.995 59.514  1.00 43.18  ? 6   PRO A CB  1 
ATOM   12   C  CG  . PRO A 1 5   ? -65.720 -13.728 60.921  1.00 43.80  ? 6   PRO A CG  1 
ATOM   13   C  CD  . PRO A 1 5   ? -67.219 -13.645 60.861  1.00 44.14  ? 6   PRO A CD  1 
ATOM   14   N  N   . ARG A 1 6   ? -65.264 -16.888 58.096  1.00 40.58  ? 7   ARG A N   1 
ATOM   15   C  CA  . ARG A 1 6   ? -64.710 -18.233 58.141  1.00 39.34  ? 7   ARG A CA  1 
ATOM   16   C  C   . ARG A 1 6   ? -63.553 -18.292 59.143  1.00 38.22  ? 7   ARG A C   1 
ATOM   17   O  O   . ARG A 1 6   ? -62.881 -17.285 59.369  1.00 37.95  ? 7   ARG A O   1 
ATOM   18   C  CB  . ARG A 1 6   ? -64.255 -18.695 56.752  1.00 39.49  ? 7   ARG A CB  1 
ATOM   19   C  CG  . ARG A 1 6   ? -65.327 -18.624 55.677  1.00 40.02  ? 7   ARG A CG  1 
ATOM   20   C  CD  . ARG A 1 6   ? -65.001 -17.536 54.665  1.00 41.33  ? 7   ARG A CD  1 
ATOM   21   N  NE  . ARG A 1 6   ? -64.485 -18.085 53.410  1.00 41.23  ? 7   ARG A NE  1 
ATOM   22   C  CZ  . ARG A 1 6   ? -63.827 -17.386 52.485  1.00 40.91  ? 7   ARG A CZ  1 
ATOM   23   N  NH1 . ARG A 1 6   ? -63.557 -16.098 52.664  1.00 39.72  ? 7   ARG A NH1 1 
ATOM   24   N  NH2 . ARG A 1 6   ? -63.420 -17.988 51.376  1.00 41.06  ? 7   ARG A NH2 1 
ATOM   25   N  N   . PRO A 1 7   ? -63.333 -19.469 59.760  1.00 37.11  ? 8   PRO A N   1 
ATOM   26   C  CA  . PRO A 1 7   ? -62.252 -19.612 60.732  1.00 36.23  ? 8   PRO A CA  1 
ATOM   27   C  C   . PRO A 1 7   ? -60.861 -19.545 60.095  1.00 35.39  ? 8   PRO A C   1 
ATOM   28   O  O   . PRO A 1 7   ? -60.723 -19.666 58.868  1.00 35.25  ? 8   PRO A O   1 
ATOM   29   C  CB  . PRO A 1 7   ? -62.502 -21.000 61.338  1.00 36.26  ? 8   PRO A CB  1 
ATOM   30   C  CG  . PRO A 1 7   ? -63.275 -21.744 60.302  1.00 36.80  ? 8   PRO A CG  1 
ATOM   31   C  CD  . PRO A 1 7   ? -64.115 -20.712 59.610  1.00 37.05  ? 8   PRO A CD  1 
ATOM   32   N  N   . PHE A 1 8   ? -59.852 -19.357 60.944  1.00 34.24  ? 9   PHE A N   1 
ATOM   33   C  CA  . PHE A 1 8   ? -58.451 -19.197 60.544  1.00 33.19  ? 9   PHE A CA  1 
ATOM   34   C  C   . PHE A 1 8   ? -57.914 -20.327 59.660  1.00 32.62  ? 9   PHE A C   1 
ATOM   35   O  O   . PHE A 1 8   ? -57.204 -20.077 58.679  1.00 32.22  ? 9   PHE A O   1 
ATOM   36   C  CB  . PHE A 1 8   ? -57.594 -19.054 61.806  1.00 33.16  ? 9   PHE A CB  1 
ATOM   37   C  CG  . PHE A 1 8   ? -56.124 -18.897 61.543  1.00 33.07  ? 9   PHE A CG  1 
ATOM   38   C  CD1 . PHE A 1 8   ? -55.596 -17.661 61.187  1.00 33.23  ? 9   PHE A CD1 1 
ATOM   39   C  CD2 . PHE A 1 8   ? -55.259 -19.983 61.683  1.00 33.05  ? 9   PHE A CD2 1 
ATOM   40   C  CE1 . PHE A 1 8   ? -54.231 -17.506 60.967  1.00 33.20  ? 9   PHE A CE1 1 
ATOM   41   C  CE2 . PHE A 1 8   ? -53.893 -19.839 61.457  1.00 33.62  ? 9   PHE A CE2 1 
ATOM   42   C  CZ  . PHE A 1 8   ? -53.380 -18.593 61.096  1.00 33.20  ? 9   PHE A CZ  1 
ATOM   43   N  N   . ASN A 1 9   ? -58.254 -21.564 60.014  1.00 31.88  ? 10  ASN A N   1 
ATOM   44   C  CA  . ASN A 1 9   ? -57.732 -22.744 59.327  1.00 31.30  ? 10  ASN A CA  1 
ATOM   45   C  C   . ASN A 1 9   ? -58.201 -22.876 57.876  1.00 30.44  ? 10  ASN A C   1 
ATOM   46   O  O   . ASN A 1 9   ? -57.638 -23.655 57.110  1.00 30.28  ? 10  ASN A O   1 
ATOM   47   C  CB  . ASN A 1 9   ? -58.037 -24.023 60.126  1.00 31.67  ? 10  ASN A CB  1 
ATOM   48   C  CG  . ASN A 1 9   ? -59.514 -24.176 60.450  1.00 33.23  ? 10  ASN A CG  1 
ATOM   49   O  OD1 . ASN A 1 9   ? -59.950 -23.891 61.570  1.00 35.93  ? 10  ASN A OD1 1 
ATOM   50   N  ND2 . ASN A 1 9   ? -60.294 -24.618 59.471  1.00 34.05  ? 10  ASN A ND2 1 
ATOM   51   N  N   . GLU A 1 10  ? -59.220 -22.104 57.503  1.00 29.56  ? 11  GLU A N   1 
ATOM   52   C  CA  . GLU A 1 10  ? -59.727 -22.116 56.131  1.00 28.71  ? 11  GLU A CA  1 
ATOM   53   C  C   . GLU A 1 10  ? -58.952 -21.188 55.191  1.00 27.44  ? 11  GLU A C   1 
ATOM   54   O  O   . GLU A 1 10  ? -59.077 -21.298 53.973  1.00 27.04  ? 11  GLU A O   1 
ATOM   55   C  CB  . GLU A 1 10  ? -61.241 -21.856 56.086  1.00 29.26  ? 11  GLU A CB  1 
ATOM   56   C  CG  . GLU A 1 10  ? -62.073 -23.110 56.427  1.00 31.33  ? 11  GLU A CG  1 
ATOM   57   C  CD  . GLU A 1 10  ? -63.577 -22.863 56.548  1.00 34.07  ? 11  GLU A CD  1 
ATOM   58   O  OE1 . GLU A 1 10  ? -64.108 -21.913 55.925  1.00 34.97  ? 11  GLU A OE1 1 
ATOM   59   O  OE2 . GLU A 1 10  ? -64.238 -23.646 57.268  1.00 35.63  ? 11  GLU A OE2 1 
ATOM   60   N  N   . ILE A 1 11  ? -58.143 -20.290 55.755  1.00 26.09  ? 12  ILE A N   1 
ATOM   61   C  CA  . ILE A 1 11  ? -57.219 -19.490 54.946  1.00 24.71  ? 12  ILE A CA  1 
ATOM   62   C  C   . ILE A 1 11  ? -56.338 -20.464 54.163  1.00 23.95  ? 12  ILE A C   1 
ATOM   63   O  O   . ILE A 1 11  ? -55.739 -21.356 54.762  1.00 24.09  ? 12  ILE A O   1 
ATOM   64   C  CB  . ILE A 1 11  ? -56.344 -18.551 55.804  1.00 24.20  ? 12  ILE A CB  1 
ATOM   65   C  CG1 . ILE A 1 11  ? -57.210 -17.528 56.538  1.00 24.17  ? 12  ILE A CG1 1 
ATOM   66   C  CG2 . ILE A 1 11  ? -55.303 -17.834 54.943  1.00 23.97  ? 12  ILE A CG2 1 
ATOM   67   C  CD1 . ILE A 1 11  ? -56.490 -16.762 57.626  1.00 23.17  ? 12  ILE A CD1 1 
ATOM   68   N  N   . PRO A 1 12  ? -56.277 -20.313 52.827  1.00 23.37  ? 13  PRO A N   1 
ATOM   69   C  CA  . PRO A 1 12  ? -55.454 -21.209 51.998  1.00 23.00  ? 13  PRO A CA  1 
ATOM   70   C  C   . PRO A 1 12  ? -53.984 -21.254 52.448  1.00 22.83  ? 13  PRO A C   1 
ATOM   71   O  O   . PRO A 1 12  ? -53.427 -20.230 52.845  1.00 21.80  ? 13  PRO A O   1 
ATOM   72   C  CB  . PRO A 1 12  ? -55.552 -20.596 50.593  1.00 22.67  ? 13  PRO A CB  1 
ATOM   73   C  CG  . PRO A 1 12  ? -56.757 -19.737 50.613  1.00 23.08  ? 13  PRO A CG  1 
ATOM   74   C  CD  . PRO A 1 12  ? -56.968 -19.283 52.025  1.00 23.30  ? 13  PRO A CD  1 
ATOM   75   N  N   . SER A 1 13  ? -53.391 -22.447 52.394  1.00 23.09  ? 14  SER A N   1 
ATOM   76   C  CA  . SER A 1 13  ? -51.971 -22.664 52.687  1.00 24.01  ? 14  SER A CA  1 
ATOM   77   C  C   . SER A 1 13  ? -51.412 -23.902 51.992  1.00 24.20  ? 14  SER A C   1 
ATOM   78   O  O   . SER A 1 13  ? -52.175 -24.771 51.559  1.00 23.98  ? 14  SER A O   1 
ATOM   79   C  CB  . SER A 1 13  ? -51.739 -22.799 54.195  1.00 23.98  ? 14  SER A CB  1 
ATOM   80   O  OG  . SER A 1 13  ? -52.873 -23.333 54.824  1.00 26.70  ? 14  SER A OG  1 
ATOM   81   N  N   . PRO A 1 14  ? -50.069 -24.000 51.908  1.00 24.57  ? 15  PRO A N   1 
ATOM   82   C  CA  . PRO A 1 14  ? -49.437 -25.232 51.436  1.00 24.70  ? 15  PRO A CA  1 
ATOM   83   C  C   . PRO A 1 14  ? -49.611 -26.404 52.402  1.00 24.77  ? 15  PRO A C   1 
ATOM   84   O  O   . PRO A 1 14  ? -49.388 -27.548 52.012  1.00 25.32  ? 15  PRO A O   1 
ATOM   85   C  CB  . PRO A 1 14  ? -47.956 -24.852 51.334  1.00 24.70  ? 15  PRO A CB  1 
ATOM   86   C  CG  . PRO A 1 14  ? -47.801 -23.694 52.265  1.00 24.91  ? 15  PRO A CG  1 
ATOM   87   C  CD  . PRO A 1 14  ? -49.076 -22.938 52.161  1.00 24.58  ? 15  PRO A CD  1 
ATOM   88   N  N   . GLY A 1 15  ? -50.007 -26.123 53.642  1.00 24.55  ? 16  GLY A N   1 
ATOM   89   C  CA  . GLY A 1 15  ? -50.152 -27.165 54.665  1.00 24.26  ? 16  GLY A CA  1 
ATOM   90   C  C   . GLY A 1 15  ? -49.646 -26.751 56.037  1.00 23.85  ? 16  GLY A C   1 
ATOM   91   O  O   . GLY A 1 15  ? -49.088 -25.667 56.199  1.00 23.69  ? 16  GLY A O   1 
ATOM   92   N  N   . ASP A 1 16  ? -49.827 -27.629 57.020  1.00 23.86  ? 17  ASP A N   1 
ATOM   93   C  CA  . ASP A 1 16  ? -49.571 -27.303 58.423  1.00 23.95  ? 17  ASP A CA  1 
ATOM   94   C  C   . ASP A 1 16  ? -48.184 -27.682 58.932  1.00 23.21  ? 17  ASP A C   1 
ATOM   95   O  O   . ASP A 1 16  ? -47.815 -27.307 60.041  1.00 23.26  ? 17  ASP A O   1 
ATOM   96   C  CB  . ASP A 1 16  ? -50.652 -27.907 59.331  1.00 24.72  ? 17  ASP A CB  1 
ATOM   97   C  CG  . ASP A 1 16  ? -52.021 -27.242 59.143  1.00 27.58  ? 17  ASP A CG  1 
ATOM   98   O  OD1 . ASP A 1 16  ? -52.932 -27.918 58.614  1.00 30.68  ? 17  ASP A OD1 1 
ATOM   99   O  OD2 . ASP A 1 16  ? -52.193 -26.055 59.519  1.00 29.61  ? 17  ASP A OD2 1 
ATOM   100  N  N   . ASN A 1 17  ? -47.414 -28.407 58.126  1.00 22.64  ? 18  ASN A N   1 
ATOM   101  C  CA  . ASN A 1 17  ? -46.068 -28.818 58.530  1.00 21.98  ? 18  ASN A CA  1 
ATOM   102  C  C   . ASN A 1 17  ? -45.019 -27.770 58.150  1.00 21.34  ? 18  ASN A C   1 
ATOM   103  O  O   . ASN A 1 17  ? -44.594 -27.682 56.996  1.00 21.05  ? 18  ASN A O   1 
ATOM   104  C  CB  . ASN A 1 17  ? -45.720 -30.202 57.961  1.00 22.05  ? 18  ASN A CB  1 
ATOM   105  C  CG  . ASN A 1 17  ? -44.464 -30.807 58.592  1.00 23.08  ? 18  ASN A CG  1 
ATOM   106  O  OD1 . ASN A 1 17  ? -43.525 -30.093 58.983  1.00 23.29  ? 18  ASN A OD1 1 
ATOM   107  N  ND2 . ASN A 1 17  ? -44.442 -32.130 58.692  1.00 22.97  ? 18  ASN A ND2 1 
ATOM   108  N  N   . GLY A 1 18  ? -44.609 -26.976 59.139  1.00 21.04  ? 19  GLY A N   1 
ATOM   109  C  CA  . GLY A 1 18  ? -43.633 -25.901 58.933  1.00 20.56  ? 19  GLY A CA  1 
ATOM   110  C  C   . GLY A 1 18  ? -42.329 -26.377 58.320  1.00 20.34  ? 19  GLY A C   1 
ATOM   111  O  O   . GLY A 1 18  ? -41.737 -25.686 57.487  1.00 19.93  ? 19  GLY A O   1 
ATOM   112  N  N   . TRP A 1 19  ? -41.899 -27.574 58.722  1.00 19.68  ? 20  TRP A N   1 
ATOM   113  C  CA  . TRP A 1 19  ? -40.636 -28.149 58.265  1.00 19.46  ? 20  TRP A CA  1 
ATOM   114  C  C   . TRP A 1 19  ? -40.738 -28.666 56.843  1.00 19.14  ? 20  TRP A C   1 
ATOM   115  O  O   . TRP A 1 19  ? -39.788 -28.541 56.067  1.00 18.94  ? 20  TRP A O   1 
ATOM   116  C  CB  . TRP A 1 19  ? -40.171 -29.258 59.225  1.00 19.47  ? 20  TRP A CB  1 
ATOM   117  C  CG  . TRP A 1 19  ? -40.201 -28.782 60.629  1.00 20.02  ? 20  TRP A CG  1 
ATOM   118  C  CD1 . TRP A 1 19  ? -41.067 -29.170 61.610  1.00 19.90  ? 20  TRP A CD1 1 
ATOM   119  C  CD2 . TRP A 1 19  ? -39.363 -27.771 61.206  1.00 20.37  ? 20  TRP A CD2 1 
ATOM   120  N  NE1 . TRP A 1 19  ? -40.805 -28.482 62.767  1.00 20.72  ? 20  TRP A NE1 1 
ATOM   121  C  CE2 . TRP A 1 19  ? -39.763 -27.617 62.547  1.00 20.68  ? 20  TRP A CE2 1 
ATOM   122  C  CE3 . TRP A 1 19  ? -38.305 -26.985 60.718  1.00 21.08  ? 20  TRP A CE3 1 
ATOM   123  C  CZ2 . TRP A 1 19  ? -39.147 -26.703 63.413  1.00 22.20  ? 20  TRP A CZ2 1 
ATOM   124  C  CZ3 . TRP A 1 19  ? -37.691 -26.077 61.577  1.00 20.07  ? 20  TRP A CZ3 1 
ATOM   125  C  CH2 . TRP A 1 19  ? -38.117 -25.941 62.907  1.00 20.62  ? 20  TRP A CH2 1 
ATOM   126  N  N   . LEU A 1 20  ? -41.890 -29.241 56.503  1.00 18.90  ? 21  LEU A N   1 
ATOM   127  C  CA  . LEU A 1 20  ? -42.140 -29.679 55.129  1.00 18.79  ? 21  LEU A CA  1 
ATOM   128  C  C   . LEU A 1 20  ? -42.270 -28.485 54.185  1.00 18.36  ? 21  LEU A C   1 
ATOM   129  O  O   . LEU A 1 20  ? -41.750 -28.521 53.069  1.00 18.36  ? 21  LEU A O   1 
ATOM   130  C  CB  . LEU A 1 20  ? -43.384 -30.573 55.036  1.00 18.54  ? 21  LEU A CB  1 
ATOM   131  C  CG  . LEU A 1 20  ? -43.666 -31.238 53.677  1.00 20.51  ? 21  LEU A CG  1 
ATOM   132  C  CD1 . LEU A 1 20  ? -42.492 -32.147 53.196  1.00 19.72  ? 21  LEU A CD1 1 
ATOM   133  C  CD2 . LEU A 1 20  ? -44.977 -32.045 53.716  1.00 21.47  ? 21  LEU A CD2 1 
ATOM   134  N  N   . ASN A 1 21  ? -42.970 -27.439 54.631  1.00 17.83  ? 22  ASN A N   1 
ATOM   135  C  CA  . ASN A 1 21  ? -43.103 -26.200 53.849  1.00 17.62  ? 22  ASN A CA  1 
ATOM   136  C  C   . ASN A 1 21  ? -41.738 -25.570 53.574  1.00 17.50  ? 22  ASN A C   1 
ATOM   137  O  O   . ASN A 1 21  ? -41.462 -25.081 52.463  1.00 16.91  ? 22  ASN A O   1 
ATOM   138  C  CB  . ASN A 1 21  ? -44.000 -25.193 54.588  1.00 17.85  ? 22  ASN A CB  1 
ATOM   139  C  CG  . ASN A 1 21  ? -45.439 -25.670 54.712  1.00 18.20  ? 22  ASN A CG  1 
ATOM   140  O  OD1 . ASN A 1 21  ? -45.876 -26.556 53.978  1.00 20.00  ? 22  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A 1 21  ? -46.179 -25.088 55.648  1.00 18.38  ? 22  ASN A ND2 1 
ATOM   142  N  N   . LEU A 1 22  ? -40.883 -25.610 54.594  1.00 17.30  ? 23  LEU A N   1 
ATOM   143  C  CA  . LEU A 1 22  ? -39.541 -25.048 54.506  1.00 17.82  ? 23  LEU A CA  1 
ATOM   144  C  C   . LEU A 1 22  ? -38.711 -25.840 53.496  1.00 17.88  ? 23  LEU A C   1 
ATOM   145  O  O   . LEU A 1 22  ? -38.030 -25.270 52.646  1.00 17.64  ? 23  LEU A O   1 
ATOM   146  C  CB  . LEU A 1 22  ? -38.881 -25.017 55.888  1.00 17.17  ? 23  LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 22  ? -37.633 -24.139 56.035  1.00 18.88  ? 23  LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 22  ? -37.912 -22.693 55.600  1.00 17.03  ? 23  LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 22  ? -37.091 -24.177 57.472  1.00 18.09  ? 23  LEU A CD2 1 
ATOM   150  N  N   . TYR A 1 23  ? -38.810 -27.158 53.577  1.00 18.94  ? 24  TYR A N   1 
ATOM   151  C  CA  . TYR A 1 23  ? -38.179 -28.045 52.611  1.00 20.12  ? 24  TYR A CA  1 
ATOM   152  C  C   . TYR A 1 23  ? -38.584 -27.703 51.178  1.00 20.31  ? 24  TYR A C   1 
ATOM   153  O  O   . TYR A 1 23  ? -37.725 -27.545 50.317  1.00 20.77  ? 24  TYR A O   1 
ATOM   154  C  CB  . TYR A 1 23  ? -38.513 -29.500 52.940  1.00 20.24  ? 24  TYR A CB  1 
ATOM   155  C  CG  . TYR A 1 23  ? -38.026 -30.481 51.910  1.00 22.31  ? 24  TYR A CG  1 
ATOM   156  C  CD1 . TYR A 1 23  ? -36.672 -30.767 51.782  1.00 25.36  ? 24  TYR A CD1 1 
ATOM   157  C  CD2 . TYR A 1 23  ? -38.922 -31.129 51.065  1.00 24.88  ? 24  TYR A CD2 1 
ATOM   158  C  CE1 . TYR A 1 23  ? -36.214 -31.681 50.827  1.00 27.34  ? 24  TYR A CE1 1 
ATOM   159  C  CE2 . TYR A 1 23  ? -38.485 -32.037 50.112  1.00 27.70  ? 24  TYR A CE2 1 
ATOM   160  C  CZ  . TYR A 1 23  ? -37.130 -32.313 50.003  1.00 28.66  ? 24  TYR A CZ  1 
ATOM   161  O  OH  . TYR A 1 23  ? -36.695 -33.206 49.058  1.00 31.43  ? 24  TYR A OH  1 
ATOM   162  N  N   . HIS A 1 24  ? -39.885 -27.575 50.927  1.00 20.73  ? 25  HIS A N   1 
ATOM   163  C  CA  . HIS A 1 24  ? -40.357 -27.252 49.577  1.00 21.40  ? 25  HIS A CA  1 
ATOM   164  C  C   . HIS A 1 24  ? -39.926 -25.844 49.124  1.00 21.24  ? 25  HIS A C   1 
ATOM   165  O  O   . HIS A 1 24  ? -39.557 -25.653 47.963  1.00 21.49  ? 25  HIS A O   1 
ATOM   166  C  CB  . HIS A 1 24  ? -41.878 -27.450 49.446  1.00 21.35  ? 25  HIS A CB  1 
ATOM   167  C  CG  . HIS A 1 24  ? -42.311 -28.887 49.479  1.00 22.66  ? 25  HIS A CG  1 
ATOM   168  N  ND1 . HIS A 1 24  ? -41.756 -29.854 48.665  1.00 24.12  ? 25  HIS A ND1 1 
ATOM   169  C  CD2 . HIS A 1 24  ? -43.270 -29.513 50.204  1.00 22.46  ? 25  HIS A CD2 1 
ATOM   170  C  CE1 . HIS A 1 24  ? -42.338 -31.017 48.907  1.00 23.66  ? 25  HIS A CE1 1 
ATOM   171  N  NE2 . HIS A 1 24  ? -43.260 -30.837 49.836  1.00 22.43  ? 25  HIS A NE2 1 
ATOM   172  N  N   . PHE A 1 25  ? -39.961 -24.872 50.037  1.00 21.00  ? 26  PHE A N   1 
ATOM   173  C  CA  . PHE A 1 25  ? -39.466 -23.520 49.743  1.00 21.31  ? 26  PHE A CA  1 
ATOM   174  C  C   . PHE A 1 25  ? -37.987 -23.562 49.316  1.00 21.88  ? 26  PHE A C   1 
ATOM   175  O  O   . PHE A 1 25  ? -37.629 -23.014 48.276  1.00 21.35  ? 26  PHE A O   1 
ATOM   176  C  CB  . PHE A 1 25  ? -39.711 -22.581 50.944  1.00 20.98  ? 26  PHE A CB  1 
ATOM   177  C  CG  . PHE A 1 25  ? -38.948 -21.276 50.894  1.00 21.74  ? 26  PHE A CG  1 
ATOM   178  C  CD1 . PHE A 1 25  ? -38.992 -20.451 49.766  1.00 21.97  ? 26  PHE A CD1 1 
ATOM   179  C  CD2 . PHE A 1 25  ? -38.214 -20.851 52.005  1.00 22.06  ? 26  PHE A CD2 1 
ATOM   180  C  CE1 . PHE A 1 25  ? -38.288 -19.252 49.731  1.00 21.64  ? 26  PHE A CE1 1 
ATOM   181  C  CE2 . PHE A 1 25  ? -37.510 -19.646 51.987  1.00 21.77  ? 26  PHE A CE2 1 
ATOM   182  C  CZ  . PHE A 1 25  ? -37.547 -18.845 50.851  1.00 22.64  ? 26  PHE A CZ  1 
ATOM   183  N  N   . TRP A 1 26  ? -37.145 -24.240 50.095  1.00 22.47  ? 27  TRP A N   1 
ATOM   184  C  CA  . TRP A 1 26  ? -35.718 -24.327 49.769  1.00 23.68  ? 27  TRP A CA  1 
ATOM   185  C  C   . TRP A 1 26  ? -35.451 -25.038 48.448  1.00 24.45  ? 27  TRP A C   1 
ATOM   186  O  O   . TRP A 1 26  ? -34.610 -24.602 47.669  1.00 24.05  ? 27  TRP A O   1 
ATOM   187  C  CB  . TRP A 1 26  ? -34.926 -25.005 50.889  1.00 23.22  ? 27  TRP A CB  1 
ATOM   188  C  CG  . TRP A 1 26  ? -34.808 -24.197 52.136  1.00 24.05  ? 27  TRP A CG  1 
ATOM   189  C  CD1 . TRP A 1 26  ? -35.236 -22.912 52.333  1.00 23.93  ? 27  TRP A CD1 1 
ATOM   190  C  CD2 . TRP A 1 26  ? -34.186 -24.604 53.358  1.00 24.51  ? 27  TRP A CD2 1 
ATOM   191  N  NE1 . TRP A 1 26  ? -34.931 -22.503 53.603  1.00 24.60  ? 27  TRP A NE1 1 
ATOM   192  C  CE2 . TRP A 1 26  ? -34.284 -23.519 54.257  1.00 24.95  ? 27  TRP A CE2 1 
ATOM   193  C  CE3 . TRP A 1 26  ? -33.557 -25.786 53.784  1.00 24.97  ? 27  TRP A CE3 1 
ATOM   194  C  CZ2 . TRP A 1 26  ? -33.779 -23.576 55.565  1.00 25.54  ? 27  TRP A CZ2 1 
ATOM   195  C  CZ3 . TRP A 1 26  ? -33.050 -25.842 55.078  1.00 26.05  ? 27  TRP A CZ3 1 
ATOM   196  C  CH2 . TRP A 1 26  ? -33.170 -24.743 55.956  1.00 26.07  ? 27  TRP A CH2 1 
ATOM   197  N  N   . ARG A 1 27  ? -36.180 -26.125 48.206  1.00 25.87  ? 28  ARG A N   1 
ATOM   198  C  CA  . ARG A 1 27  ? -35.971 -26.958 47.021  1.00 27.39  ? 28  ARG A CA  1 
ATOM   199  C  C   . ARG A 1 27  ? -36.477 -26.303 45.739  1.00 27.33  ? 28  ARG A C   1 
ATOM   200  O  O   . ARG A 1 27  ? -35.823 -26.375 44.703  1.00 27.61  ? 28  ARG A O   1 
ATOM   201  C  CB  . ARG A 1 27  ? -36.616 -28.343 47.206  1.00 27.73  ? 28  ARG A CB  1 
ATOM   202  C  CG  . ARG A 1 27  ? -35.869 -29.454 46.481  1.00 31.45  ? 28  ARG A CG  1 
ATOM   203  C  CD  . ARG A 1 27  ? -36.693 -30.729 46.346  1.00 36.32  ? 28  ARG A CD  1 
ATOM   204  N  NE  . ARG A 1 27  ? -37.488 -30.723 45.117  1.00 40.54  ? 28  ARG A NE  1 
ATOM   205  C  CZ  . ARG A 1 27  ? -38.810 -30.536 45.062  1.00 42.36  ? 28  ARG A CZ  1 
ATOM   206  N  NH1 . ARG A 1 27  ? -39.521 -30.351 46.173  1.00 41.55  ? 28  ARG A NH1 1 
ATOM   207  N  NH2 . ARG A 1 27  ? -39.428 -30.546 43.882  1.00 42.74  ? 28  ARG A NH2 1 
ATOM   208  N  N   . GLU A 1 28  ? -37.638 -25.664 45.811  1.00 27.75  ? 29  GLU A N   1 
ATOM   209  C  CA  . GLU A 1 28  ? -38.283 -25.107 44.621  1.00 28.25  ? 29  GLU A CA  1 
ATOM   210  C  C   . GLU A 1 28  ? -37.821 -23.693 44.263  1.00 27.92  ? 29  GLU A C   1 
ATOM   211  O  O   . GLU A 1 28  ? -37.696 -23.357 43.084  1.00 28.04  ? 29  GLU A O   1 
ATOM   212  C  CB  . GLU A 1 28  ? -39.807 -25.123 44.775  1.00 28.43  ? 29  GLU A CB  1 
ATOM   213  C  CG  . GLU A 1 28  ? -40.424 -26.519 44.658  1.00 31.35  ? 29  GLU A CG  1 
ATOM   214  C  CD  . GLU A 1 28  ? -41.892 -26.548 45.039  1.00 34.22  ? 29  GLU A CD  1 
ATOM   215  O  OE1 . GLU A 1 28  ? -42.701 -25.847 44.384  1.00 36.45  ? 29  GLU A OE1 1 
ATOM   216  O  OE2 . GLU A 1 28  ? -42.237 -27.280 45.993  1.00 35.84  ? 29  GLU A OE2 1 
ATOM   217  N  N   . THR A 1 29  ? -37.571 -22.870 45.275  1.00 27.27  ? 30  THR A N   1 
ATOM   218  C  CA  . THR A 1 29  ? -37.346 -21.449 45.050  1.00 26.91  ? 30  THR A CA  1 
ATOM   219  C  C   . THR A 1 29  ? -35.979 -21.003 45.574  1.00 26.15  ? 30  THR A C   1 
ATOM   220  O  O   . THR A 1 29  ? -35.235 -20.322 44.878  1.00 25.95  ? 30  THR A O   1 
ATOM   221  C  CB  . THR A 1 29  ? -38.490 -20.618 45.661  1.00 27.10  ? 30  THR A CB  1 
ATOM   222  O  OG1 . THR A 1 29  ? -39.747 -21.141 45.194  1.00 28.12  ? 30  THR A OG1 1 
ATOM   223  C  CG2 . THR A 1 29  ? -38.378 -19.145 45.267  1.00 27.09  ? 30  THR A CG2 1 
ATOM   224  N  N   . GLY A 1 30  ? -35.649 -21.413 46.789  1.00 25.43  ? 31  GLY A N   1 
ATOM   225  C  CA  . GLY A 1 30  ? -34.373 -21.068 47.379  1.00 24.66  ? 31  GLY A CA  1 
ATOM   226  C  C   . GLY A 1 30  ? -34.473 -19.901 48.344  1.00 24.22  ? 31  GLY A C   1 
ATOM   227  O  O   . GLY A 1 30  ? -35.302 -18.978 48.177  1.00 23.49  ? 31  GLY A O   1 
ATOM   228  N  N   . THR A 1 31  ? -33.596 -19.948 49.343  1.00 23.46  ? 32  THR A N   1 
ATOM   229  C  CA  . THR A 1 31  ? -33.540 -18.956 50.408  1.00 23.25  ? 32  THR A CA  1 
ATOM   230  C  C   . THR A 1 31  ? -33.394 -17.524 49.870  1.00 22.14  ? 32  THR A C   1 
ATOM   231  O  O   . THR A 1 31  ? -33.946 -16.597 50.444  1.00 22.14  ? 32  THR A O   1 
ATOM   232  C  CB  . THR A 1 31  ? -32.392 -19.282 51.404  1.00 23.35  ? 32  THR A CB  1 
ATOM   233  O  OG1 . THR A 1 31  ? -31.140 -19.187 50.728  1.00 24.25  ? 32  THR A OG1 1 
ATOM   234  C  CG2 . THR A 1 31  ? -32.519 -20.712 51.936  1.00 24.15  ? 32  THR A CG2 1 
ATOM   235  N  N   . HIS A 1 32  ? -32.678 -17.362 48.759  1.00 20.99  ? 33  HIS A N   1 
ATOM   236  C  CA  . HIS A 1 32  ? -32.372 -16.037 48.211  1.00 20.66  ? 33  HIS A CA  1 
ATOM   237  C  C   . HIS A 1 32  ? -33.416 -15.457 47.248  1.00 19.74  ? 33  HIS A C   1 
ATOM   238  O  O   . HIS A 1 32  ? -33.229 -14.364 46.705  1.00 19.44  ? 33  HIS A O   1 
ATOM   239  C  CB  . HIS A 1 32  ? -30.979 -16.037 47.576  1.00 20.93  ? 33  HIS A CB  1 
ATOM   240  C  CG  . HIS A 1 32  ? -29.885 -16.308 48.558  1.00 23.49  ? 33  HIS A CG  1 
ATOM   241  N  ND1 . HIS A 1 32  ? -29.475 -15.377 49.489  1.00 25.36  ? 33  HIS A ND1 1 
ATOM   242  C  CD2 . HIS A 1 32  ? -29.140 -17.416 48.781  1.00 25.67  ? 33  HIS A CD2 1 
ATOM   243  C  CE1 . HIS A 1 32  ? -28.513 -15.894 50.232  1.00 26.06  ? 33  HIS A CE1 1 
ATOM   244  N  NE2 . HIS A 1 32  ? -28.295 -17.132 49.827  1.00 27.29  ? 33  HIS A NE2 1 
ATOM   245  N  N   . LYS A 1 33  ? -34.520 -16.177 47.071  1.00 18.83  ? 34  LYS A N   1 
ATOM   246  C  CA  . LYS A 1 33  ? -35.598 -15.764 46.186  1.00 18.33  ? 34  LYS A CA  1 
ATOM   247  C  C   . LYS A 1 33  ? -36.941 -15.732 46.922  1.00 17.51  ? 34  LYS A C   1 
ATOM   248  O  O   . LYS A 1 33  ? -37.990 -16.041 46.354  1.00 16.73  ? 34  LYS A O   1 
ATOM   249  C  CB  . LYS A 1 33  ? -35.645 -16.676 44.937  1.00 18.58  ? 34  LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 33  ? -34.434 -16.518 43.974  1.00 20.76  ? 34  LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 33  ? -34.359 -15.083 43.374  1.00 25.09  ? 34  LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 33  ? -33.252 -14.885 42.318  1.00 25.59  ? 34  LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 33  ? -31.911 -14.725 42.947  1.00 27.04  ? 34  LYS A NZ  1 
ATOM   254  N  N   . VAL A 1 34  ? -36.906 -15.340 48.190  1.00 16.76  ? 35  VAL A N   1 
ATOM   255  C  CA  . VAL A 1 34  ? -38.124 -15.258 48.997  1.00 16.53  ? 35  VAL A CA  1 
ATOM   256  C  C   . VAL A 1 34  ? -39.190 -14.330 48.366  1.00 16.08  ? 35  VAL A C   1 
ATOM   257  O  O   . VAL A 1 34  ? -40.380 -14.632 48.408  1.00 15.14  ? 35  VAL A O   1 
ATOM   258  C  CB  . VAL A 1 34  ? -37.806 -14.848 50.468  1.00 17.17  ? 35  VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 34  ? -37.412 -13.406 50.548  1.00 17.18  ? 35  VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 34  ? -38.994 -15.095 51.369  1.00 17.67  ? 35  VAL A CG2 1 
ATOM   261  N  N   . HIS A 1 35  ? -38.755 -13.223 47.765  1.00 15.39  ? 36  HIS A N   1 
ATOM   262  C  CA  . HIS A 1 35  ? -39.668 -12.308 47.069  1.00 15.71  ? 36  HIS A CA  1 
ATOM   263  C  C   . HIS A 1 35  ? -40.473 -13.002 45.946  1.00 15.90  ? 36  HIS A C   1 
ATOM   264  O  O   . HIS A 1 35  ? -41.658 -12.717 45.765  1.00 15.76  ? 36  HIS A O   1 
ATOM   265  C  CB  . HIS A 1 35  ? -38.904 -11.088 46.521  1.00 15.51  ? 36  HIS A CB  1 
ATOM   266  C  CG  . HIS A 1 35  ? -37.714 -11.438 45.678  1.00 15.44  ? 36  HIS A CG  1 
ATOM   267  N  ND1 . HIS A 1 35  ? -36.640 -12.146 46.165  1.00 15.92  ? 36  HIS A ND1 1 
ATOM   268  C  CD2 . HIS A 1 35  ? -37.428 -11.171 44.380  1.00 15.59  ? 36  HIS A CD2 1 
ATOM   269  C  CE1 . HIS A 1 35  ? -35.738 -12.292 45.210  1.00 16.96  ? 36  HIS A CE1 1 
ATOM   270  N  NE2 . HIS A 1 35  ? -36.195 -11.715 44.114  1.00 15.39  ? 36  HIS A NE2 1 
ATOM   271  N  N   . LEU A 1 36  ? -39.831 -13.913 45.217  1.00 16.01  ? 37  LEU A N   1 
ATOM   272  C  CA  . LEU A 1 36  ? -40.495 -14.634 44.125  1.00 16.93  ? 37  LEU A CA  1 
ATOM   273  C  C   . LEU A 1 36  ? -41.406 -15.719 44.678  1.00 16.69  ? 37  LEU A C   1 
ATOM   274  O  O   . LEU A 1 36  ? -42.431 -16.043 44.097  1.00 17.08  ? 37  LEU A O   1 
ATOM   275  C  CB  . LEU A 1 36  ? -39.480 -15.220 43.129  1.00 16.67  ? 37  LEU A CB  1 
ATOM   276  C  CG  . LEU A 1 36  ? -38.516 -14.285 42.388  1.00 17.97  ? 37  LEU A CG  1 
ATOM   277  C  CD1 . LEU A 1 36  ? -37.694 -15.095 41.369  1.00 18.30  ? 37  LEU A CD1 1 
ATOM   278  C  CD2 . LEU A 1 36  ? -39.217 -13.102 41.684  1.00 18.01  ? 37  LEU A CD2 1 
ATOM   279  N  N   . HIS A 1 37  ? -41.033 -16.257 45.828  1.00 17.17  ? 38  HIS A N   1 
ATOM   280  C  CA  . HIS A 1 37  ? -41.884 -17.176 46.555  1.00 17.31  ? 38  HIS A CA  1 
ATOM   281  C  C   . HIS A 1 37  ? -43.247 -16.536 46.872  1.00 17.35  ? 38  HIS A C   1 
ATOM   282  O  O   . HIS A 1 37  ? -44.290 -17.164 46.662  1.00 17.35  ? 38  HIS A O   1 
ATOM   283  C  CB  . HIS A 1 37  ? -41.184 -17.630 47.837  1.00 17.44  ? 38  HIS A CB  1 
ATOM   284  C  CG  . HIS A 1 37  ? -41.907 -18.712 48.567  1.00 18.01  ? 38  HIS A CG  1 
ATOM   285  N  ND1 . HIS A 1 37  ? -42.396 -18.552 49.847  1.00 19.80  ? 38  HIS A ND1 1 
ATOM   286  C  CD2 . HIS A 1 37  ? -42.229 -19.972 48.195  1.00 18.01  ? 38  HIS A CD2 1 
ATOM   287  C  CE1 . HIS A 1 37  ? -42.978 -19.673 50.235  1.00 18.40  ? 38  HIS A CE1 1 
ATOM   288  N  NE2 . HIS A 1 37  ? -42.900 -20.546 49.245  1.00 18.36  ? 38  HIS A NE2 1 
ATOM   289  N  N   . HIS A 1 38  ? -43.236 -15.295 47.364  1.00 17.00  ? 39  HIS A N   1 
ATOM   290  C  CA  . HIS A 1 38  ? -44.483 -14.586 47.662  1.00 17.44  ? 39  HIS A CA  1 
ATOM   291  C  C   . HIS A 1 38  ? -45.343 -14.362 46.420  1.00 17.42  ? 39  HIS A C   1 
ATOM   292  O  O   . HIS A 1 38  ? -46.540 -14.608 46.457  1.00 17.38  ? 39  HIS A O   1 
ATOM   293  C  CB  . HIS A 1 38  ? -44.219 -13.250 48.349  1.00 17.13  ? 39  HIS A CB  1 
ATOM   294  C  CG  . HIS A 1 38  ? -43.500 -13.371 49.655  1.00 16.83  ? 39  HIS A CG  1 
ATOM   295  N  ND1 . HIS A 1 38  ? -42.715 -12.360 50.163  1.00 15.00  ? 39  HIS A ND1 1 
ATOM   296  C  CD2 . HIS A 1 38  ? -43.439 -14.384 50.553  1.00 16.56  ? 39  HIS A CD2 1 
ATOM   297  C  CE1 . HIS A 1 38  ? -42.209 -12.740 51.323  1.00 15.95  ? 39  HIS A CE1 1 
ATOM   298  N  NE2 . HIS A 1 38  ? -42.628 -13.967 51.579  1.00 17.23  ? 39  HIS A NE2 1 
ATOM   299  N  N   . VAL A 1 39  ? -44.717 -13.900 45.338  1.00 17.82  ? 40  VAL A N   1 
ATOM   300  C  CA  . VAL A 1 39  ? -45.387 -13.659 44.059  1.00 18.23  ? 40  VAL A CA  1 
ATOM   301  C  C   . VAL A 1 39  ? -46.107 -14.929 43.622  1.00 18.74  ? 40  VAL A C   1 
ATOM   302  O  O   . VAL A 1 39  ? -47.309 -14.906 43.362  1.00 19.08  ? 40  VAL A O   1 
ATOM   303  C  CB  . VAL A 1 39  ? -44.384 -13.198 42.957  1.00 18.10  ? 40  VAL A CB  1 
ATOM   304  C  CG1 . VAL A 1 39  ? -45.027 -13.234 41.559  1.00 17.65  ? 40  VAL A CG1 1 
ATOM   305  C  CG2 . VAL A 1 39  ? -43.854 -11.800 43.259  1.00 17.88  ? 40  VAL A CG2 1 
ATOM   306  N  N   . GLN A 1 40  ? -45.367 -16.037 43.597  1.00 19.05  ? 41  GLN A N   1 
ATOM   307  C  CA  . GLN A 1 40  ? -45.905 -17.339 43.222  1.00 19.57  ? 41  GLN A CA  1 
ATOM   308  C  C   . GLN A 1 40  ? -47.030 -17.786 44.143  1.00 19.14  ? 41  GLN A C   1 
ATOM   309  O  O   . GLN A 1 40  ? -48.012 -18.347 43.671  1.00 19.23  ? 41  GLN A O   1 
ATOM   310  C  CB  . GLN A 1 40  ? -44.802 -18.401 43.196  1.00 19.55  ? 41  GLN A CB  1 
ATOM   311  C  CG  . GLN A 1 40  ? -43.852 -18.294 42.000  1.00 22.50  ? 41  GLN A CG  1 
ATOM   312  C  CD  . GLN A 1 40  ? -42.497 -18.962 42.253  1.00 25.40  ? 41  GLN A CD  1 
ATOM   313  O  OE1 . GLN A 1 40  ? -42.358 -19.826 43.134  1.00 27.42  ? 41  GLN A OE1 1 
ATOM   314  N  NE2 . GLN A 1 40  ? -41.494 -18.559 41.483  1.00 25.96  ? 41  GLN A NE2 1 
ATOM   315  N  N   . ASN A 1 41  ? -46.878 -17.554 45.445  1.00 18.53  ? 42  ASN A N   1 
ATOM   316  C  CA  . ASN A 1 41  ? -47.897 -17.950 46.409  1.00 18.60  ? 42  ASN A CA  1 
ATOM   317  C  C   . ASN A 1 41  ? -49.234 -17.235 46.183  1.00 18.75  ? 42  ASN A C   1 
ATOM   318  O  O   . ASN A 1 41  ? -50.286 -17.874 46.202  1.00 18.67  ? 42  ASN A O   1 
ATOM   319  C  CB  . ASN A 1 41  ? -47.420 -17.738 47.852  1.00 18.46  ? 42  ASN A CB  1 
ATOM   320  C  CG  . ASN A 1 41  ? -46.494 -18.852 48.348  1.00 18.61  ? 42  ASN A CG  1 
ATOM   321  O  OD1 . ASN A 1 41  ? -46.364 -19.895 47.719  1.00 20.77  ? 42  ASN A OD1 1 
ATOM   322  N  ND2 . ASN A 1 41  ? -45.850 -18.622 49.481  1.00 16.38  ? 42  ASN A ND2 1 
ATOM   323  N  N   . PHE A 1 42  ? -49.201 -15.920 45.968  1.00 18.48  ? 43  PHE A N   1 
ATOM   324  C  CA  . PHE A 1 42  ? -50.440 -15.197 45.654  1.00 19.04  ? 43  PHE A CA  1 
ATOM   325  C  C   . PHE A 1 42  ? -51.102 -15.669 44.343  1.00 19.65  ? 43  PHE A C   1 
ATOM   326  O  O   . PHE A 1 42  ? -52.326 -15.700 44.255  1.00 19.69  ? 43  PHE A O   1 
ATOM   327  C  CB  . PHE A 1 42  ? -50.229 -13.679 45.661  1.00 18.20  ? 43  PHE A CB  1 
ATOM   328  C  CG  . PHE A 1 42  ? -49.941 -13.119 47.025  1.00 16.94  ? 43  PHE A CG  1 
ATOM   329  C  CD1 . PHE A 1 42  ? -48.677 -12.618 47.331  1.00 15.86  ? 43  PHE A CD1 1 
ATOM   330  C  CD2 . PHE A 1 42  ? -50.929 -13.096 48.006  1.00 14.92  ? 43  PHE A CD2 1 
ATOM   331  C  CE1 . PHE A 1 42  ? -48.405 -12.102 48.588  1.00 15.66  ? 43  PHE A CE1 1 
ATOM   332  C  CE2 . PHE A 1 42  ? -50.671 -12.585 49.266  1.00 15.88  ? 43  PHE A CE2 1 
ATOM   333  C  CZ  . PHE A 1 42  ? -49.402 -12.082 49.563  1.00 15.85  ? 43  PHE A CZ  1 
ATOM   334  N  N   . GLN A 1 43  ? -50.293 -16.045 43.351  1.00 20.95  ? 44  GLN A N   1 
ATOM   335  C  CA  . GLN A 1 43  ? -50.786 -16.644 42.101  1.00 22.52  ? 44  GLN A CA  1 
ATOM   336  C  C   . GLN A 1 43  ? -51.505 -17.972 42.344  1.00 22.85  ? 44  GLN A C   1 
ATOM   337  O  O   . GLN A 1 43  ? -52.496 -18.276 41.673  1.00 23.02  ? 44  GLN A O   1 
ATOM   338  C  CB  . GLN A 1 43  ? -49.645 -16.851 41.095  1.00 22.94  ? 44  GLN A CB  1 
ATOM   339  C  CG  . GLN A 1 43  ? -49.109 -15.558 40.469  1.00 26.73  ? 44  GLN A CG  1 
ATOM   340  C  CD  . GLN A 1 43  ? -47.905 -15.776 39.554  1.00 31.73  ? 44  GLN A CD  1 
ATOM   341  O  OE1 . GLN A 1 43  ? -47.274 -16.845 39.560  1.00 35.41  ? 44  GLN A OE1 1 
ATOM   342  N  NE2 . GLN A 1 43  ? -47.568 -14.751 38.772  1.00 32.76  ? 44  GLN A NE2 1 
ATOM   343  N  N   . LYS A 1 44  ? -51.010 -18.745 43.313  1.00 23.14  ? 45  LYS A N   1 
ATOM   344  C  CA  . LYS A 1 44  ? -51.576 -20.051 43.670  1.00 23.58  ? 45  LYS A CA  1 
ATOM   345  C  C   . LYS A 1 44  ? -52.822 -19.976 44.535  1.00 22.97  ? 45  LYS A C   1 
ATOM   346  O  O   . LYS A 1 44  ? -53.769 -20.718 44.304  1.00 22.78  ? 45  LYS A O   1 
ATOM   347  C  CB  . LYS A 1 44  ? -50.551 -20.899 44.435  1.00 24.31  ? 45  LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 44  ? -49.579 -21.668 43.579  1.00 26.99  ? 45  LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 44  ? -49.163 -22.953 44.290  1.00 31.39  ? 45  LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 44  ? -47.952 -22.744 45.184  1.00 32.61  ? 45  LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 44  ? -46.699 -22.575 44.372  1.00 35.36  ? 45  LYS A NZ  1 
ATOM   352  N  N   . TYR A 1 45  ? -52.800 -19.110 45.549  1.00 22.42  ? 46  TYR A N   1 
ATOM   353  C  CA  . TYR A 1 45  ? -53.817 -19.124 46.603  1.00 22.37  ? 46  TYR A CA  1 
ATOM   354  C  C   . TYR A 1 45  ? -54.819 -17.979 46.530  1.00 21.94  ? 46  TYR A C   1 
ATOM   355  O  O   . TYR A 1 45  ? -55.879 -18.034 47.169  1.00 21.71  ? 46  TYR A O   1 
ATOM   356  C  CB  . TYR A 1 45  ? -53.162 -19.156 48.001  1.00 22.50  ? 46  TYR A CB  1 
ATOM   357  C  CG  . TYR A 1 45  ? -52.200 -20.304 48.188  1.00 23.62  ? 46  TYR A CG  1 
ATOM   358  C  CD1 . TYR A 1 45  ? -50.844 -20.065 48.413  1.00 25.08  ? 46  TYR A CD1 1 
ATOM   359  C  CD2 . TYR A 1 45  ? -52.636 -21.633 48.111  1.00 24.77  ? 46  TYR A CD2 1 
ATOM   360  C  CE1 . TYR A 1 45  ? -49.945 -21.108 48.571  1.00 26.11  ? 46  TYR A CE1 1 
ATOM   361  C  CE2 . TYR A 1 45  ? -51.741 -22.692 48.274  1.00 26.24  ? 46  TYR A CE2 1 
ATOM   362  C  CZ  . TYR A 1 45  ? -50.394 -22.416 48.500  1.00 27.08  ? 46  TYR A CZ  1 
ATOM   363  O  OH  . TYR A 1 45  ? -49.490 -23.445 48.652  1.00 30.63  ? 46  TYR A OH  1 
ATOM   364  N  N   . GLY A 1 46  ? -54.486 -16.949 45.756  1.00 21.41  ? 47  GLY A N   1 
ATOM   365  C  CA  . GLY A 1 46  ? -55.282 -15.729 45.751  1.00 20.97  ? 47  GLY A CA  1 
ATOM   366  C  C   . GLY A 1 46  ? -54.709 -14.689 46.695  1.00 20.74  ? 47  GLY A C   1 
ATOM   367  O  O   . GLY A 1 46  ? -53.586 -14.845 47.179  1.00 20.80  ? 47  GLY A O   1 
ATOM   368  N  N   . PRO A 1 47  ? -55.488 -13.629 46.984  1.00 20.62  ? 48  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 47  ? -55.024 -12.406 47.665  1.00 20.32  ? 48  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 47  ? -54.667 -12.566 49.146  1.00 20.32  ? 48  PRO A C   1 
ATOM   371  O  O   . PRO A 1 47  ? -54.207 -11.607 49.769  1.00 20.53  ? 48  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 47  ? -56.230 -11.472 47.547  1.00 20.38  ? 48  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 47  ? -57.405 -12.400 47.529  1.00 20.32  ? 48  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 47  ? -56.945 -13.605 46.752  1.00 20.18  ? 48  PRO A CD  1 
ATOM   375  N  N   . ILE A 1 48  ? -54.892 -13.744 49.713  1.00 20.13  ? 49  ILE A N   1 
ATOM   376  C  CA  . ILE A 1 48  ? -54.544 -13.988 51.115  1.00 20.15  ? 49  ILE A CA  1 
ATOM   377  C  C   . ILE A 1 48  ? -54.208 -15.457 51.350  1.00 20.09  ? 49  ILE A C   1 
ATOM   378  O  O   . ILE A 1 48  ? -54.898 -16.355 50.861  1.00 20.09  ? 49  ILE A O   1 
ATOM   379  C  CB  . ILE A 1 48  ? -55.662 -13.515 52.096  1.00 20.30  ? 49  ILE A CB  1 
ATOM   380  C  CG1 . ILE A 1 48  ? -55.215 -13.693 53.556  1.00 19.91  ? 49  ILE A CG1 1 
ATOM   381  C  CG2 . ILE A 1 48  ? -56.990 -14.227 51.801  1.00 20.30  ? 49  ILE A CG2 1 
ATOM   382  C  CD1 . ILE A 1 48  ? -56.075 -12.957 54.572  1.00 20.50  ? 49  ILE A CD1 1 
ATOM   383  N  N   . TYR A 1 49  ? -53.121 -15.696 52.071  1.00 19.91  ? 50  TYR A N   1 
ATOM   384  C  CA  . TYR A 1 49  ? -52.754 -17.051 52.443  1.00 20.04  ? 50  TYR A CA  1 
ATOM   385  C  C   . TYR A 1 49  ? -52.002 -17.049 53.766  1.00 19.99  ? 50  TYR A C   1 
ATOM   386  O  O   . TYR A 1 49  ? -51.630 -15.992 54.275  1.00 20.00  ? 50  TYR A O   1 
ATOM   387  C  CB  . TYR A 1 49  ? -51.958 -17.749 51.323  1.00 19.94  ? 50  TYR A CB  1 
ATOM   388  C  CG  . TYR A 1 49  ? -50.568 -17.211 51.117  1.00 19.93  ? 50  TYR A CG  1 
ATOM   389  C  CD1 . TYR A 1 49  ? -49.471 -17.778 51.794  1.00 18.73  ? 50  TYR A CD1 1 
ATOM   390  C  CD2 . TYR A 1 49  ? -50.337 -16.135 50.254  1.00 19.58  ? 50  TYR A CD2 1 
ATOM   391  C  CE1 . TYR A 1 49  ? -48.179 -17.288 51.611  1.00 18.20  ? 50  TYR A CE1 1 
ATOM   392  C  CE2 . TYR A 1 49  ? -49.037 -15.631 50.068  1.00 19.40  ? 50  TYR A CE2 1 
ATOM   393  C  CZ  . TYR A 1 49  ? -47.969 -16.216 50.755  1.00 19.82  ? 50  TYR A CZ  1 
ATOM   394  O  OH  . TYR A 1 49  ? -46.690 -15.740 50.576  1.00 20.30  ? 50  TYR A OH  1 
ATOM   395  N  N   . ARG A 1 50  ? -51.826 -18.235 54.335  1.00 20.25  ? 51  ARG A N   1 
ATOM   396  C  CA  . ARG A 1 50  ? -51.044 -18.413 55.552  1.00 20.67  ? 51  ARG A CA  1 
ATOM   397  C  C   . ARG A 1 50  ? -49.988 -19.471 55.283  1.00 20.74  ? 51  ARG A C   1 
ATOM   398  O  O   . ARG A 1 50  ? -50.229 -20.430 54.544  1.00 20.49  ? 51  ARG A O   1 
ATOM   399  C  CB  . ARG A 1 50  ? -51.930 -18.819 56.738  1.00 20.88  ? 51  ARG A CB  1 
ATOM   400  C  CG  . ARG A 1 50  ? -52.559 -20.197 56.611  1.00 22.72  ? 51  ARG A CG  1 
ATOM   401  C  CD  . ARG A 1 50  ? -53.513 -20.502 57.756  1.00 25.61  ? 51  ARG A CD  1 
ATOM   402  N  NE  . ARG A 1 50  ? -54.293 -21.712 57.481  1.00 28.08  ? 51  ARG A NE  1 
ATOM   403  C  CZ  . ARG A 1 50  ? -53.907 -22.956 57.771  1.00 29.25  ? 51  ARG A CZ  1 
ATOM   404  N  NH1 . ARG A 1 50  ? -52.735 -23.189 58.362  1.00 28.49  ? 51  ARG A NH1 1 
ATOM   405  N  NH2 . ARG A 1 50  ? -54.706 -23.979 57.471  1.00 29.56  ? 51  ARG A NH2 1 
ATOM   406  N  N   . GLU A 1 51  ? -48.811 -19.281 55.855  1.00 20.74  ? 52  GLU A N   1 
ATOM   407  C  CA  . GLU A 1 51  ? -47.745 -20.243 55.682  1.00 21.35  ? 52  GLU A CA  1 
ATOM   408  C  C   . GLU A 1 51  ? -46.850 -20.302 56.905  1.00 21.35  ? 52  GLU A C   1 
ATOM   409  O  O   . GLU A 1 51  ? -46.284 -19.292 57.334  1.00 21.30  ? 52  GLU A O   1 
ATOM   410  C  CB  . GLU A 1 51  ? -46.923 -19.963 54.418  1.00 21.21  ? 52  GLU A CB  1 
ATOM   411  C  CG  . GLU A 1 51  ? -45.901 -21.072 54.124  1.00 22.29  ? 52  GLU A CG  1 
ATOM   412  C  CD  . GLU A 1 51  ? -45.061 -20.810 52.884  1.00 24.27  ? 52  GLU A CD  1 
ATOM   413  O  OE1 . GLU A 1 51  ? -44.628 -19.654 52.688  1.00 23.40  ? 52  GLU A OE1 1 
ATOM   414  O  OE2 . GLU A 1 51  ? -44.834 -21.772 52.108  1.00 26.50  ? 52  GLU A OE2 1 
ATOM   415  N  N   . LYS A 1 52  ? -46.758 -21.498 57.471  1.00 21.67  ? 53  LYS A N   1 
ATOM   416  C  CA  . LYS A 1 52  ? -45.811 -21.782 58.529  1.00 22.27  ? 53  LYS A CA  1 
ATOM   417  C  C   . LYS A 1 52  ? -44.480 -22.182 57.897  1.00 22.31  ? 53  LYS A C   1 
ATOM   418  O  O   . LYS A 1 52  ? -44.423 -23.118 57.093  1.00 21.75  ? 53  LYS A O   1 
ATOM   419  C  CB  . LYS A 1 52  ? -46.338 -22.905 59.420  1.00 22.41  ? 53  LYS A CB  1 
ATOM   420  C  CG  . LYS A 1 52  ? -45.637 -23.042 60.764  1.00 23.53  ? 53  LYS A CG  1 
ATOM   421  C  CD  . LYS A 1 52  ? -46.385 -24.048 61.652  1.00 27.09  ? 53  LYS A CD  1 
ATOM   422  C  CE  . LYS A 1 52  ? -45.933 -23.954 63.098  1.00 30.22  ? 53  LYS A CE  1 
ATOM   423  N  NZ  . LYS A 1 52  ? -46.218 -25.223 63.858  1.00 32.17  ? 53  LYS A NZ  1 
ATOM   424  N  N   . LEU A 1 53  ? -43.428 -21.446 58.246  1.00 22.68  ? 54  LEU A N   1 
ATOM   425  C  CA  . LEU A 1 53  ? -42.066 -21.791 57.850  1.00 23.62  ? 54  LEU A CA  1 
ATOM   426  C  C   . LEU A 1 53  ? -41.245 -22.046 59.107  1.00 24.13  ? 54  LEU A C   1 
ATOM   427  O  O   . LEU A 1 53  ? -41.023 -21.137 59.913  1.00 24.48  ? 54  LEU A O   1 
ATOM   428  C  CB  . LEU A 1 53  ? -41.437 -20.691 56.984  1.00 23.40  ? 54  LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 53  ? -41.987 -20.501 55.561  1.00 22.89  ? 54  LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 53  ? -41.379 -19.269 54.910  1.00 20.74  ? 54  LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 53  ? -41.755 -21.739 54.678  1.00 22.91  ? 54  LEU A CD2 1 
ATOM   432  N  N   . GLY A 1 54  ? -40.817 -23.295 59.279  1.00 24.69  ? 55  GLY A N   1 
ATOM   433  C  CA  . GLY A 1 54  ? -40.202 -23.728 60.530  1.00 25.16  ? 55  GLY A CA  1 
ATOM   434  C  C   . GLY A 1 54  ? -41.231 -23.680 61.639  1.00 25.53  ? 55  GLY A C   1 
ATOM   435  O  O   . GLY A 1 54  ? -42.266 -24.345 61.557  1.00 24.96  ? 55  GLY A O   1 
ATOM   436  N  N   . ASN A 1 55  ? -40.956 -22.881 62.670  1.00 26.21  ? 56  ASN A N   1 
ATOM   437  C  CA  . ASN A 1 55  ? -41.882 -22.730 63.804  1.00 27.02  ? 56  ASN A CA  1 
ATOM   438  C  C   . ASN A 1 55  ? -42.766 -21.482 63.742  1.00 26.75  ? 56  ASN A C   1 
ATOM   439  O  O   . ASN A 1 55  ? -43.649 -21.310 64.598  1.00 27.02  ? 56  ASN A O   1 
ATOM   440  C  CB  . ASN A 1 55  ? -41.129 -22.757 65.143  1.00 27.60  ? 56  ASN A CB  1 
ATOM   441  C  CG  . ASN A 1 55  ? -40.739 -24.172 65.579  1.00 30.31  ? 56  ASN A CG  1 
ATOM   442  O  OD1 . ASN A 1 55  ? -41.383 -25.169 65.205  1.00 33.52  ? 56  ASN A OD1 1 
ATOM   443  N  ND2 . ASN A 1 55  ? -39.682 -24.264 66.382  1.00 31.83  ? 56  ASN A ND2 1 
ATOM   444  N  N   . VAL A 1 56  ? -42.537 -20.622 62.746  1.00 26.00  ? 57  VAL A N   1 
ATOM   445  C  CA  . VAL A 1 56  ? -43.300 -19.365 62.614  1.00 25.38  ? 57  VAL A CA  1 
ATOM   446  C  C   . VAL A 1 56  ? -44.349 -19.393 61.489  1.00 24.63  ? 57  VAL A C   1 
ATOM   447  O  O   . VAL A 1 56  ? -44.033 -19.635 60.323  1.00 24.15  ? 57  VAL A O   1 
ATOM   448  C  CB  . VAL A 1 56  ? -42.366 -18.138 62.432  1.00 25.71  ? 57  VAL A CB  1 
ATOM   449  C  CG1 . VAL A 1 56  ? -43.174 -16.845 62.277  1.00 25.77  ? 57  VAL A CG1 1 
ATOM   450  C  CG2 . VAL A 1 56  ? -41.394 -18.020 63.617  1.00 26.22  ? 57  VAL A CG2 1 
ATOM   451  N  N   . GLU A 1 57  ? -45.597 -19.139 61.860  1.00 23.92  ? 58  GLU A N   1 
ATOM   452  C  CA  . GLU A 1 57  ? -46.666 -18.994 60.895  1.00 23.79  ? 58  GLU A CA  1 
ATOM   453  C  C   . GLU A 1 57  ? -47.038 -17.526 60.723  1.00 23.03  ? 58  GLU A C   1 
ATOM   454  O  O   . GLU A 1 57  ? -47.113 -16.768 61.701  1.00 23.15  ? 58  GLU A O   1 
ATOM   455  C  CB  . GLU A 1 57  ? -47.898 -19.800 61.313  1.00 24.32  ? 58  GLU A CB  1 
ATOM   456  C  CG  . GLU A 1 57  ? -48.957 -19.917 60.211  1.00 26.16  ? 58  GLU A CG  1 
ATOM   457  C  CD  . GLU A 1 57  ? -50.078 -20.896 60.545  1.00 30.21  ? 58  GLU A CD  1 
ATOM   458  O  OE1 . GLU A 1 57  ? -50.495 -20.960 61.725  1.00 33.09  ? 58  GLU A OE1 1 
ATOM   459  O  OE2 . GLU A 1 57  ? -50.552 -21.592 59.614  1.00 31.85  ? 58  GLU A OE2 1 
ATOM   460  N  N   . SER A 1 58  ? -47.266 -17.135 59.476  1.00 21.44  ? 59  SER A N   1 
ATOM   461  C  CA  . SER A 1 58  ? -47.735 -15.799 59.169  1.00 20.84  ? 59  SER A CA  1 
ATOM   462  C  C   . SER A 1 58  ? -48.942 -15.881 58.249  1.00 20.01  ? 59  SER A C   1 
ATOM   463  O  O   . SER A 1 58  ? -49.083 -16.829 57.481  1.00 20.03  ? 59  SER A O   1 
ATOM   464  C  CB  . SER A 1 58  ? -46.631 -14.985 58.481  1.00 20.71  ? 59  SER A CB  1 
ATOM   465  O  OG  . SER A 1 58  ? -45.495 -14.842 59.312  1.00 21.96  ? 59  SER A OG  1 
ATOM   466  N  N   . VAL A 1 59  ? -49.808 -14.884 58.337  1.00 19.36  ? 60  VAL A N   1 
ATOM   467  C  CA  . VAL A 1 59  ? -50.793 -14.637 57.295  1.00 18.87  ? 60  VAL A CA  1 
ATOM   468  C  C   . VAL A 1 59  ? -50.198 -13.583 56.363  1.00 18.55  ? 60  VAL A C   1 
ATOM   469  O  O   . VAL A 1 59  ? -49.739 -12.533 56.817  1.00 18.50  ? 60  VAL A O   1 
ATOM   470  C  CB  . VAL A 1 59  ? -52.142 -14.134 57.871  1.00 18.70  ? 60  VAL A CB  1 
ATOM   471  C  CG1 . VAL A 1 59  ? -53.052 -13.591 56.748  1.00 18.05  ? 60  VAL A CG1 1 
ATOM   472  C  CG2 . VAL A 1 59  ? -52.857 -15.258 58.638  1.00 19.02  ? 60  VAL A CG2 1 
ATOM   473  N  N   . TYR A 1 60  ? -50.204 -13.872 55.067  1.00 18.46  ? 61  TYR A N   1 
ATOM   474  C  CA  . TYR A 1 60  ? -49.674 -12.948 54.069  1.00 18.43  ? 61  TYR A CA  1 
ATOM   475  C  C   . TYR A 1 60  ? -50.803 -12.300 53.297  1.00 18.80  ? 61  TYR A C   1 
ATOM   476  O  O   . TYR A 1 60  ? -51.773 -12.965 52.897  1.00 18.22  ? 61  TYR A O   1 
ATOM   477  C  CB  . TYR A 1 60  ? -48.740 -13.647 53.097  1.00 18.19  ? 61  TYR A CB  1 
ATOM   478  C  CG  . TYR A 1 60  ? -47.506 -14.228 53.740  1.00 17.87  ? 61  TYR A CG  1 
ATOM   479  C  CD1 . TYR A 1 60  ? -47.568 -15.447 54.424  1.00 17.42  ? 61  TYR A CD1 1 
ATOM   480  C  CD2 . TYR A 1 60  ? -46.279 -13.574 53.658  1.00 15.27  ? 61  TYR A CD2 1 
ATOM   481  C  CE1 . TYR A 1 60  ? -46.437 -16.000 55.010  1.00 18.69  ? 61  TYR A CE1 1 
ATOM   482  C  CE2 . TYR A 1 60  ? -45.135 -14.122 54.257  1.00 17.39  ? 61  TYR A CE2 1 
ATOM   483  C  CZ  . TYR A 1 60  ? -45.225 -15.329 54.923  1.00 16.82  ? 61  TYR A CZ  1 
ATOM   484  O  OH  . TYR A 1 60  ? -44.125 -15.891 55.515  1.00 19.27  ? 61  TYR A OH  1 
ATOM   485  N  N   . VAL A 1 61  ? -50.642 -11.001 53.082  1.00 19.02  ? 62  VAL A N   1 
ATOM   486  C  CA  . VAL A 1 61  ? -51.660 -10.171 52.476  1.00 20.09  ? 62  VAL A CA  1 
ATOM   487  C  C   . VAL A 1 61  ? -50.992 -9.286  51.416  1.00 20.11  ? 62  VAL A C   1 
ATOM   488  O  O   . VAL A 1 61  ? -49.798 -8.980  51.518  1.00 19.43  ? 62  VAL A O   1 
ATOM   489  C  CB  . VAL A 1 61  ? -52.401 -9.400  53.598  1.00 20.32  ? 62  VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 61  ? -51.671 -8.111  53.984  1.00 20.04  ? 62  VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 61  ? -53.827 -9.151  53.229  1.00 23.34  ? 62  VAL A CG2 1 
ATOM   492  N  N   . ILE A 1 62  ? -51.738 -8.938  50.370  1.00 20.69  ? 63  ILE A N   1 
ATOM   493  C  CA  . ILE A 1 62  ? -51.203 -8.140  49.256  1.00 20.93  ? 63  ILE A CA  1 
ATOM   494  C  C   . ILE A 1 62  ? -52.052 -6.896  48.933  1.00 21.53  ? 63  ILE A C   1 
ATOM   495  O  O   . ILE A 1 62  ? -51.512 -5.873  48.514  1.00 21.31  ? 63  ILE A O   1 
ATOM   496  C  CB  . ILE A 1 62  ? -50.961 -8.999  47.974  1.00 20.80  ? 63  ILE A CB  1 
ATOM   497  C  CG1 . ILE A 1 62  ? -50.120 -8.220  46.944  1.00 20.27  ? 63  ILE A CG1 1 
ATOM   498  C  CG2 . ILE A 1 62  ? -52.292 -9.503  47.388  1.00 21.61  ? 63  ILE A CG2 1 
ATOM   499  C  CD1 . ILE A 1 62  ? -49.724 -9.007  45.683  1.00 20.13  ? 63  ILE A CD1 1 
ATOM   500  N  N   . ASP A 1 63  ? -53.365 -6.991  49.151  1.00 22.23  ? 64  ASP A N   1 
ATOM   501  C  CA  . ASP A 1 63  ? -54.316 -5.927  48.790  1.00 22.57  ? 64  ASP A CA  1 
ATOM   502  C  C   . ASP A 1 63  ? -54.193 -4.700  49.692  1.00 22.75  ? 64  ASP A C   1 
ATOM   503  O  O   . ASP A 1 63  ? -54.310 -4.807  50.908  1.00 22.90  ? 64  ASP A O   1 
ATOM   504  C  CB  . ASP A 1 63  ? -55.758 -6.464  48.801  1.00 22.65  ? 64  ASP A CB  1 
ATOM   505  C  CG  . ASP A 1 63  ? -56.755 -5.551  48.056  1.00 23.93  ? 64  ASP A CG  1 
ATOM   506  O  OD1 . ASP A 1 63  ? -56.751 -4.311  48.248  1.00 22.96  ? 64  ASP A OD1 1 
ATOM   507  O  OD2 . ASP A 1 63  ? -57.560 -6.093  47.272  1.00 25.17  ? 64  ASP A OD2 1 
ATOM   508  N  N   . PRO A 1 64  ? -53.956 -3.517  49.093  1.00 23.27  ? 65  PRO A N   1 
ATOM   509  C  CA  . PRO A 1 64  ? -53.899 -2.268  49.848  1.00 23.57  ? 65  PRO A CA  1 
ATOM   510  C  C   . PRO A 1 64  ? -55.100 -2.069  50.781  1.00 24.24  ? 65  PRO A C   1 
ATOM   511  O  O   . PRO A 1 64  ? -54.968 -1.456  51.843  1.00 24.20  ? 65  PRO A O   1 
ATOM   512  C  CB  . PRO A 1 64  ? -53.896 -1.210  48.745  1.00 23.39  ? 65  PRO A CB  1 
ATOM   513  C  CG  . PRO A 1 64  ? -53.164 -1.862  47.643  1.00 23.14  ? 65  PRO A CG  1 
ATOM   514  C  CD  . PRO A 1 64  ? -53.575 -3.314  47.683  1.00 22.87  ? 65  PRO A CD  1 
ATOM   515  N  N   . GLU A 1 65  ? -56.258 -2.585  50.385  1.00 24.81  ? 66  GLU A N   1 
ATOM   516  C  CA  . GLU A 1 65  ? -57.466 -2.452  51.188  1.00 25.96  ? 66  GLU A CA  1 
ATOM   517  C  C   . GLU A 1 65  ? -57.354 -3.238  52.501  1.00 25.32  ? 66  GLU A C   1 
ATOM   518  O  O   . GLU A 1 65  ? -57.813 -2.781  53.552  1.00 25.47  ? 66  GLU A O   1 
ATOM   519  C  CB  . GLU A 1 65  ? -58.684 -2.901  50.378  1.00 26.70  ? 66  GLU A CB  1 
ATOM   520  C  CG  . GLU A 1 65  ? -59.960 -2.166  50.728  1.00 31.15  ? 66  GLU A CG  1 
ATOM   521  C  CD  . GLU A 1 65  ? -60.098 -0.847  49.990  1.00 35.50  ? 66  GLU A CD  1 
ATOM   522  O  OE1 . GLU A 1 65  ? -60.335 -0.872  48.763  1.00 38.35  ? 66  GLU A OE1 1 
ATOM   523  O  OE2 . GLU A 1 65  ? -59.989 0.212   50.641  1.00 37.08  ? 66  GLU A OE2 1 
ATOM   524  N  N   . ASP A 1 66  ? -56.722 -4.409  52.432  1.00 24.84  ? 67  ASP A N   1 
ATOM   525  C  CA  . ASP A 1 66  ? -56.430 -5.225  53.612  1.00 24.14  ? 67  ASP A CA  1 
ATOM   526  C  C   . ASP A 1 66  ? -55.286 -4.628  54.415  1.00 23.39  ? 67  ASP A C   1 
ATOM   527  O  O   . ASP A 1 66  ? -55.291 -4.667  55.643  1.00 23.16  ? 67  ASP A O   1 
ATOM   528  C  CB  . ASP A 1 66  ? -56.115 -6.667  53.205  1.00 24.55  ? 67  ASP A CB  1 
ATOM   529  C  CG  . ASP A 1 66  ? -57.277 -7.340  52.490  1.00 25.34  ? 67  ASP A CG  1 
ATOM   530  O  OD1 . ASP A 1 66  ? -58.439 -7.038  52.836  1.00 27.15  ? 67  ASP A OD1 1 
ATOM   531  O  OD2 . ASP A 1 66  ? -57.038 -8.160  51.576  1.00 26.45  ? 67  ASP A OD2 1 
ATOM   532  N  N   . VAL A 1 67  ? -54.313 -4.052  53.719  1.00 23.11  ? 68  VAL A N   1 
ATOM   533  C  CA  . VAL A 1 67  ? -53.232 -3.325  54.380  1.00 22.82  ? 68  VAL A CA  1 
ATOM   534  C  C   . VAL A 1 67  ? -53.810 -2.219  55.267  1.00 23.26  ? 68  VAL A C   1 
ATOM   535  O  O   . VAL A 1 67  ? -53.409 -2.073  56.422  1.00 23.30  ? 68  VAL A O   1 
ATOM   536  C  CB  . VAL A 1 67  ? -52.228 -2.732  53.364  1.00 22.76  ? 68  VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1 67  ? -51.115 -1.966  54.075  1.00 22.12  ? 68  VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1 67  ? -51.650 -3.819  52.503  1.00 21.57  ? 68  VAL A CG2 1 
ATOM   539  N  N   . ALA A 1 68  ? -54.768 -1.467  54.726  1.00 23.83  ? 69  ALA A N   1 
ATOM   540  C  CA  . ALA A 1 68  ? -55.421 -0.379  55.453  1.00 24.67  ? 69  ALA A CA  1 
ATOM   541  C  C   . ALA A 1 68  ? -56.092 -0.837  56.754  1.00 25.29  ? 69  ALA A C   1 
ATOM   542  O  O   . ALA A 1 68  ? -55.962 -0.182  57.793  1.00 25.06  ? 69  ALA A O   1 
ATOM   543  C  CB  . ALA A 1 68  ? -56.429 0.334   54.548  1.00 24.62  ? 69  ALA A CB  1 
ATOM   544  N  N   . LEU A 1 69  ? -56.789 -1.969  56.699  1.00 26.34  ? 70  LEU A N   1 
ATOM   545  C  CA  . LEU A 1 69  ? -57.452 -2.503  57.885  1.00 27.48  ? 70  LEU A CA  1 
ATOM   546  C  C   . LEU A 1 69  ? -56.426 -2.903  58.932  1.00 28.04  ? 70  LEU A C   1 
ATOM   547  O  O   . LEU A 1 69  ? -56.611 -2.635  60.122  1.00 28.39  ? 70  LEU A O   1 
ATOM   548  C  CB  . LEU A 1 69  ? -58.361 -3.682  57.531  1.00 27.33  ? 70  LEU A CB  1 
ATOM   549  C  CG  . LEU A 1 69  ? -59.653 -3.341  56.776  1.00 29.00  ? 70  LEU A CG  1 
ATOM   550  C  CD1 . LEU A 1 69  ? -60.303 -4.586  56.169  1.00 28.42  ? 70  LEU A CD1 1 
ATOM   551  C  CD2 . LEU A 1 69  ? -60.646 -2.589  57.672  1.00 29.11  ? 70  LEU A CD2 1 
ATOM   552  N  N   . LEU A 1 70  ? -55.337 -3.521  58.480  1.00 28.75  ? 71  LEU A N   1 
ATOM   553  C  CA  . LEU A 1 70  ? -54.275 -3.958  59.381  1.00 29.67  ? 71  LEU A CA  1 
ATOM   554  C  C   . LEU A 1 70  ? -53.666 -2.788  60.148  1.00 30.76  ? 71  LEU A C   1 
ATOM   555  O  O   . LEU A 1 70  ? -53.540 -2.833  61.369  1.00 30.94  ? 71  LEU A O   1 
ATOM   556  C  CB  . LEU A 1 70  ? -53.182 -4.711  58.614  1.00 29.11  ? 71  LEU A CB  1 
ATOM   557  C  CG  . LEU A 1 70  ? -51.952 -5.093  59.442  1.00 28.56  ? 71  LEU A CG  1 
ATOM   558  C  CD1 . LEU A 1 70  ? -52.315 -6.176  60.457  1.00 26.36  ? 71  LEU A CD1 1 
ATOM   559  C  CD2 . LEU A 1 70  ? -50.787 -5.527  58.556  1.00 26.85  ? 71  LEU A CD2 1 
ATOM   560  N  N   . PHE A 1 71  ? -53.298 -1.736  59.427  1.00 32.31  ? 72  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 71  ? -52.656 -0.592  60.059  1.00 33.87  ? 72  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 71  ? -53.628 0.300   60.840  1.00 34.78  ? 72  PHE A C   1 
ATOM   563  O  O   . PHE A 1 71  ? -53.211 1.021   61.744  1.00 35.08  ? 72  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 71  ? -51.838 0.202   59.039  1.00 33.83  ? 72  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 71  ? -50.513 -0.434  58.705  1.00 34.39  ? 72  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 71  ? -50.275 -0.948  57.438  1.00 35.12  ? 72  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 71  ? -49.506 -0.531  59.666  1.00 34.41  ? 72  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 71  ? -49.050 -1.543  57.122  1.00 35.52  ? 72  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 71  ? -48.287 -1.121  59.360  1.00 34.76  ? 72  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 71  ? -48.062 -1.634  58.083  1.00 35.04  ? 72  PHE A CZ  1 
ATOM   571  N  N   . LYS A 1 72  ? -54.915 0.236   60.501  1.00 35.92  ? 73  LYS A N   1 
ATOM   572  C  CA  . LYS A 1 72  ? -55.952 0.932   61.268  1.00 36.88  ? 73  LYS A CA  1 
ATOM   573  C  C   . LYS A 1 72  ? -56.173 0.275   62.636  1.00 36.98  ? 73  LYS A C   1 
ATOM   574  O  O   . LYS A 1 72  ? -56.481 0.958   63.617  1.00 37.27  ? 73  LYS A O   1 
ATOM   575  C  CB  . LYS A 1 72  ? -57.277 0.999   60.490  1.00 37.36  ? 73  LYS A CB  1 
ATOM   576  C  CG  . LYS A 1 72  ? -58.299 1.975   61.088  1.00 39.16  ? 73  LYS A CG  1 
ATOM   577  C  CD  . LYS A 1 72  ? -59.695 1.791   60.508  1.00 42.30  ? 73  LYS A CD  1 
ATOM   578  C  CE  . LYS A 1 72  ? -60.702 2.700   61.220  1.00 43.56  ? 73  LYS A CE  1 
ATOM   579  N  NZ  . LYS A 1 72  ? -62.093 2.167   61.114  1.00 45.24  ? 73  LYS A NZ  1 
ATOM   580  N  N   . SER A 1 73  ? -56.001 -1.044  62.700  1.00 36.89  ? 74  SER A N   1 
ATOM   581  C  CA  . SER A 1 73  ? -56.211 -1.787  63.946  1.00 36.92  ? 74  SER A CA  1 
ATOM   582  C  C   . SER A 1 73  ? -54.945 -1.856  64.800  1.00 36.70  ? 74  SER A C   1 
ATOM   583  O  O   . SER A 1 73  ? -54.897 -2.569  65.809  1.00 36.65  ? 74  SER A O   1 
ATOM   584  C  CB  . SER A 1 73  ? -56.721 -3.200  63.648  1.00 36.88  ? 74  SER A CB  1 
ATOM   585  O  OG  . SER A 1 73  ? -55.659 -4.028  63.213  1.00 37.74  ? 74  SER A OG  1 
ATOM   586  N  N   . GLU A 1 74  ? -53.928 -1.108  64.390  1.00 36.40  ? 75  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 74  ? -52.656 -1.058  65.089  1.00 36.05  ? 75  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 74  ? -52.779 -0.376  66.454  1.00 35.99  ? 75  GLU A C   1 
ATOM   589  O  O   . GLU A 1 74  ? -53.461 0.645   66.594  1.00 36.03  ? 75  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 74  ? -51.641 -0.317  64.232  1.00 36.12  ? 75  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 74  ? -50.210 -0.586  64.606  1.00 36.45  ? 75  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 74  ? -49.242 -0.009  63.609  1.00 35.89  ? 75  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 74  ? -49.055 1.229   63.587  1.00 36.70  ? 75  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 74  ? -48.668 -0.804  62.851  1.00 35.02  ? 75  GLU A OE2 1 
ATOM   595  N  N   . GLY A 1 75  ? -52.114 -0.950  67.454  1.00 35.43  ? 76  GLY A N   1 
ATOM   596  C  CA  . GLY A 1 75  ? -52.078 -0.382  68.799  1.00 34.79  ? 76  GLY A CA  1 
ATOM   597  C  C   . GLY A 1 75  ? -50.990 0.664   68.969  1.00 33.97  ? 76  GLY A C   1 
ATOM   598  O  O   . GLY A 1 75  ? -50.269 0.962   68.022  1.00 34.16  ? 76  GLY A O   1 
ATOM   599  N  N   . PRO A 1 76  ? -50.865 1.231   70.185  1.00 33.42  ? 77  PRO A N   1 
ATOM   600  C  CA  . PRO A 1 76  ? -49.897 2.306   70.434  1.00 32.65  ? 77  PRO A CA  1 
ATOM   601  C  C   . PRO A 1 76  ? -48.425 1.870   70.378  1.00 31.85  ? 77  PRO A C   1 
ATOM   602  O  O   . PRO A 1 76  ? -47.558 2.705   70.094  1.00 31.85  ? 77  PRO A O   1 
ATOM   603  C  CB  . PRO A 1 76  ? -50.266 2.793   71.845  1.00 32.79  ? 77  PRO A CB  1 
ATOM   604  C  CG  . PRO A 1 76  ? -50.960 1.645   72.483  1.00 33.22  ? 77  PRO A CG  1 
ATOM   605  C  CD  . PRO A 1 76  ? -51.694 0.948   71.375  1.00 33.38  ? 77  PRO A CD  1 
ATOM   606  N  N   . ASN A 1 77  ? -48.151 0.591   70.654  1.00 30.51  ? 78  ASN A N   1 
ATOM   607  C  CA  . ASN A 1 77  ? -46.786 0.048   70.596  1.00 29.18  ? 78  ASN A CA  1 
ATOM   608  C  C   . ASN A 1 77  ? -46.666 -1.172  69.662  1.00 27.99  ? 78  ASN A C   1 
ATOM   609  O  O   . ASN A 1 77  ? -46.630 -2.320  70.128  1.00 27.69  ? 78  ASN A O   1 
ATOM   610  C  CB  . ASN A 1 77  ? -46.278 -0.320  71.996  1.00 29.34  ? 78  ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 77  ? -46.332 0.845   72.976  1.00 29.80  ? 78  ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 77  ? -45.762 1.918   72.738  1.00 29.78  ? 78  ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 77  ? -47.012 0.628   74.097  1.00 29.02  ? 78  ASN A ND2 1 
ATOM   614  N  N   . PRO A 1 78  ? -46.576 -0.923  68.342  1.00 26.75  ? 79  PRO A N   1 
ATOM   615  C  CA  . PRO A 1 78  ? -46.580 -1.992  67.348  1.00 25.90  ? 79  PRO A CA  1 
ATOM   616  C  C   . PRO A 1 78  ? -45.340 -2.872  67.421  1.00 24.96  ? 79  PRO A C   1 
ATOM   617  O  O   . PRO A 1 78  ? -44.244 -2.398  67.750  1.00 24.98  ? 79  PRO A O   1 
ATOM   618  C  CB  . PRO A 1 78  ? -46.599 -1.235  66.007  1.00 25.90  ? 79  PRO A CB  1 
ATOM   619  C  CG  . PRO A 1 78  ? -46.912 0.165   66.344  1.00 26.07  ? 79  PRO A CG  1 
ATOM   620  C  CD  . PRO A 1 78  ? -46.396 0.392   67.712  1.00 26.53  ? 79  PRO A CD  1 
ATOM   621  N  N   . GLU A 1 79  ? -45.525 -4.151  67.123  1.00 23.82  ? 80  GLU A N   1 
ATOM   622  C  CA  . GLU A 1 79  ? -44.414 -5.087  67.022  1.00 23.11  ? 80  GLU A CA  1 
ATOM   623  C  C   . GLU A 1 79  ? -44.374 -5.681  65.623  1.00 21.61  ? 80  GLU A C   1 
ATOM   624  O  O   . GLU A 1 79  ? -45.402 -6.098  65.105  1.00 21.35  ? 80  GLU A O   1 
ATOM   625  C  CB  . GLU A 1 79  ? -44.555 -6.201  68.060  1.00 23.49  ? 80  GLU A CB  1 
ATOM   626  C  CG  . GLU A 1 79  ? -44.575 -5.708  69.499  1.00 26.00  ? 80  GLU A CG  1 
ATOM   627  C  CD  . GLU A 1 79  ? -44.873 -6.823  70.480  1.00 29.83  ? 80  GLU A CD  1 
ATOM   628  O  OE1 . GLU A 1 79  ? -43.948 -7.608  70.794  1.00 31.09  ? 80  GLU A OE1 1 
ATOM   629  O  OE2 . GLU A 1 79  ? -46.040 -6.914  70.934  1.00 32.55  ? 80  GLU A OE2 1 
ATOM   630  N  N   . ARG A 1 80  ? -43.192 -5.677  65.013  1.00 20.25  ? 81  ARG A N   1 
ATOM   631  C  CA  . ARG A 1 80  ? -42.943 -6.365  63.741  1.00 18.78  ? 81  ARG A CA  1 
ATOM   632  C  C   . ARG A 1 80  ? -42.198 -7.657  64.046  1.00 18.06  ? 81  ARG A C   1 
ATOM   633  O  O   . ARG A 1 80  ? -41.930 -7.952  65.211  1.00 17.84  ? 81  ARG A O   1 
ATOM   634  C  CB  . ARG A 1 80  ? -42.108 -5.493  62.792  1.00 18.36  ? 81  ARG A CB  1 
ATOM   635  C  CG  . ARG A 1 80  ? -40.639 -5.327  63.195  1.00 17.33  ? 81  ARG A CG  1 
ATOM   636  C  CD  . ARG A 1 80  ? -39.825 -4.596  62.121  1.00 15.98  ? 81  ARG A CD  1 
ATOM   637  N  NE  . ARG A 1 80  ? -40.176 -3.182  62.011  1.00 14.64  ? 81  ARG A NE  1 
ATOM   638  C  CZ  . ARG A 1 80  ? -39.648 -2.207  62.755  1.00 15.27  ? 81  ARG A CZ  1 
ATOM   639  N  NH1 . ARG A 1 80  ? -38.736 -2.469  63.694  1.00 12.81  ? 81  ARG A NH1 1 
ATOM   640  N  NH2 . ARG A 1 80  ? -40.045 -0.957  62.567  1.00 14.60  ? 81  ARG A NH2 1 
ATOM   641  N  N   . PHE A 1 81  ? -41.841 -8.409  63.008  1.00 16.91  ? 82  PHE A N   1 
ATOM   642  C  CA  . PHE A 1 81  ? -41.078 -9.636  63.190  1.00 15.97  ? 82  PHE A CA  1 
ATOM   643  C  C   . PHE A 1 81  ? -39.639 -9.330  63.550  1.00 15.73  ? 82  PHE A C   1 
ATOM   644  O  O   . PHE A 1 81  ? -38.975 -8.549  62.865  1.00 15.53  ? 82  PHE A O   1 
ATOM   645  C  CB  . PHE A 1 81  ? -41.110 -10.503 61.926  1.00 16.11  ? 82  PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 81  ? -40.451 -11.858 62.100  1.00 15.70  ? 82  PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 81  ? -41.041 -12.839 62.905  1.00 14.02  ? 82  PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 81  ? -39.254 -12.151 61.458  1.00 15.78  ? 82  PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 81  ? -40.445 -14.090 63.070  1.00 14.52  ? 82  PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 81  ? -38.634 -13.420 61.617  1.00 16.55  ? 82  PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 81  ? -39.236 -14.384 62.430  1.00 14.51  ? 82  PHE A CZ  1 
ATOM   652  N  N   . LEU A 1 82  ? -39.168 -9.962  64.623  1.00 15.38  ? 83  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 82  ? -37.787 -9.844  65.060  1.00 15.33  ? 83  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 82  ? -36.966 -10.935 64.393  1.00 15.28  ? 83  LEU A C   1 
ATOM   655  O  O   . LEU A 1 82  ? -37.401 -12.094 64.320  1.00 15.58  ? 83  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 82  ? -37.682 -9.968  66.587  1.00 15.35  ? 83  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 82  ? -38.387 -8.912  67.454  1.00 15.70  ? 83  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 82  ? -38.407 -9.355  68.930  1.00 16.16  ? 83  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 82  ? -37.745 -7.531  67.309  1.00 15.08  ? 83  LEU A CD2 1 
ATOM   660  N  N   . ILE A 1 83  ? -35.783 -10.566 63.915  1.00 14.66  ? 84  ILE A N   1 
ATOM   661  C  CA  . ILE A 1 83  ? -34.889 -11.512 63.243  1.00 14.59  ? 84  ILE A CA  1 
ATOM   662  C  C   . ILE A 1 83  ? -34.191 -12.383 64.307  1.00 14.84  ? 84  ILE A C   1 
ATOM   663  O  O   . ILE A 1 83  ? -33.449 -11.866 65.141  1.00 14.60  ? 84  ILE A O   1 
ATOM   664  C  CB  . ILE A 1 83  ? -33.856 -10.768 62.341  1.00 14.21  ? 84  ILE A CB  1 
ATOM   665  C  CG1 . ILE A 1 83  ? -34.562 -9.805  61.374  1.00 13.16  ? 84  ILE A CG1 1 
ATOM   666  C  CG2 . ILE A 1 83  ? -32.979 -11.755 61.563  1.00 14.43  ? 84  ILE A CG2 1 
ATOM   667  C  CD1 . ILE A 1 83  ? -35.323 -10.488 60.230  1.00 11.21  ? 84  ILE A CD1 1 
ATOM   668  N  N   . PRO A 1 84  ? -34.451 -13.702 64.298  1.00 15.44  ? 85  PRO A N   1 
ATOM   669  C  CA  . PRO A 1 84  ? -33.985 -14.527 65.433  1.00 15.80  ? 85  PRO A CA  1 
ATOM   670  C  C   . PRO A 1 84  ? -32.460 -14.564 65.661  1.00 16.06  ? 85  PRO A C   1 
ATOM   671  O  O   . PRO A 1 84  ? -32.045 -14.472 66.810  1.00 16.28  ? 85  PRO A O   1 
ATOM   672  C  CB  . PRO A 1 84  ? -34.576 -15.916 65.136  1.00 16.15  ? 85  PRO A CB  1 
ATOM   673  C  CG  . PRO A 1 84  ? -35.788 -15.617 64.270  1.00 15.91  ? 85  PRO A CG  1 
ATOM   674  C  CD  . PRO A 1 84  ? -35.306 -14.480 63.379  1.00 15.24  ? 85  PRO A CD  1 
ATOM   675  N  N   . PRO A 1 85  ? -31.631 -14.648 64.592  1.00 16.10  ? 86  PRO A N   1 
ATOM   676  C  CA  . PRO A 1 85  ? -30.197 -14.550 64.886  1.00 16.17  ? 86  PRO A CA  1 
ATOM   677  C  C   . PRO A 1 85  ? -29.749 -13.206 65.484  1.00 16.02  ? 86  PRO A C   1 
ATOM   678  O  O   . PRO A 1 85  ? -28.741 -13.169 66.218  1.00 15.99  ? 86  PRO A O   1 
ATOM   679  C  CB  . PRO A 1 85  ? -29.522 -14.773 63.521  1.00 16.22  ? 86  PRO A CB  1 
ATOM   680  C  CG  . PRO A 1 85  ? -30.574 -14.509 62.504  1.00 16.56  ? 86  PRO A CG  1 
ATOM   681  C  CD  . PRO A 1 85  ? -31.880 -14.880 63.156  1.00 16.15  ? 86  PRO A CD  1 
ATOM   682  N  N   . TRP A 1 86  ? -30.462 -12.122 65.176  1.00 15.03  ? 87  TRP A N   1 
ATOM   683  C  CA  . TRP A 1 86  ? -30.124 -10.823 65.775  1.00 14.73  ? 87  TRP A CA  1 
ATOM   684  C  C   . TRP A 1 86  ? -30.463 -10.798 67.258  1.00 14.38  ? 87  TRP A C   1 
ATOM   685  O  O   . TRP A 1 86  ? -29.665 -10.336 68.070  1.00 14.49  ? 87  TRP A O   1 
ATOM   686  C  CB  . TRP A 1 86  ? -30.785 -9.635  65.047  1.00 13.63  ? 87  TRP A CB  1 
ATOM   687  C  CG  . TRP A 1 86  ? -30.500 -9.558  63.570  1.00 13.29  ? 87  TRP A CG  1 
ATOM   688  C  CD1 . TRP A 1 86  ? -29.663 -10.363 62.842  1.00 13.04  ? 87  TRP A CD1 1 
ATOM   689  C  CD2 . TRP A 1 86  ? -31.042 -8.608  62.644  1.00 11.82  ? 87  TRP A CD2 1 
ATOM   690  N  NE1 . TRP A 1 86  ? -29.663 -9.978  61.523  1.00 12.76  ? 87  TRP A NE1 1 
ATOM   691  C  CE2 . TRP A 1 86  ? -30.501 -8.903  61.376  1.00 11.70  ? 87  TRP A CE2 1 
ATOM   692  C  CE3 . TRP A 1 86  ? -31.937 -7.539  62.765  1.00 12.69  ? 87  TRP A CE3 1 
ATOM   693  C  CZ2 . TRP A 1 86  ? -30.821 -8.171  60.237  1.00 11.21  ? 87  TRP A CZ2 1 
ATOM   694  C  CZ3 . TRP A 1 86  ? -32.262 -6.804  61.616  1.00 13.70  ? 87  TRP A CZ3 1 
ATOM   695  C  CH2 . TRP A 1 86  ? -31.703 -7.134  60.371  1.00 11.71  ? 87  TRP A CH2 1 
ATOM   696  N  N   . VAL A 1 87  ? -31.650 -11.290 67.593  1.00 14.75  ? 88  VAL A N   1 
ATOM   697  C  CA  . VAL A 1 87  ? -32.095 -11.411 68.980  1.00 15.79  ? 88  VAL A CA  1 
ATOM   698  C  C   . VAL A 1 87  ? -31.097 -12.293 69.750  1.00 15.93  ? 88  VAL A C   1 
ATOM   699  O  O   . VAL A 1 87  ? -30.557 -11.879 70.772  1.00 16.31  ? 88  VAL A O   1 
ATOM   700  C  CB  . VAL A 1 87  ? -33.540 -11.969 69.049  1.00 16.16  ? 88  VAL A CB  1 
ATOM   701  C  CG1 . VAL A 1 87  ? -33.920 -12.396 70.471  1.00 16.77  ? 88  VAL A CG1 1 
ATOM   702  C  CG2 . VAL A 1 87  ? -34.536 -10.944 68.506  1.00 16.19  ? 88  VAL A CG2 1 
ATOM   703  N  N   . ALA A 1 88  ? -30.804 -13.474 69.216  1.00 16.10  ? 89  ALA A N   1 
ATOM   704  C  CA  . ALA A 1 88  ? -29.906 -14.410 69.891  1.00 16.67  ? 89  ALA A CA  1 
ATOM   705  C  C   . ALA A 1 88  ? -28.509 -13.829 70.114  1.00 17.27  ? 89  ALA A C   1 
ATOM   706  O  O   . ALA A 1 88  ? -27.913 -14.045 71.174  1.00 17.38  ? 89  ALA A O   1 
ATOM   707  C  CB  . ALA A 1 88  ? -29.830 -15.735 69.137  1.00 16.03  ? 89  ALA A CB  1 
ATOM   708  N  N   . TYR A 1 89  ? -27.986 -13.099 69.127  1.00 17.54  ? 90  TYR A N   1 
ATOM   709  C  CA  . TYR A 1 89  ? -26.687 -12.453 69.292  1.00 18.36  ? 90  TYR A CA  1 
ATOM   710  C  C   . TYR A 1 89  ? -26.683 -11.430 70.443  1.00 19.14  ? 90  TYR A C   1 
ATOM   711  O  O   . TYR A 1 89  ? -25.753 -11.409 71.251  1.00 18.97  ? 90  TYR A O   1 
ATOM   712  C  CB  . TYR A 1 89  ? -26.194 -11.782 68.004  1.00 17.79  ? 90  TYR A CB  1 
ATOM   713  C  CG  . TYR A 1 89  ? -25.002 -10.891 68.267  1.00 18.11  ? 90  TYR A CG  1 
ATOM   714  C  CD1 . TYR A 1 89  ? -23.709 -11.420 68.317  1.00 17.93  ? 90  TYR A CD1 1 
ATOM   715  C  CD2 . TYR A 1 89  ? -25.168 -9.530  68.526  1.00 18.48  ? 90  TYR A CD2 1 
ATOM   716  C  CE1 . TYR A 1 89  ? -22.610 -10.606 68.586  1.00 18.49  ? 90  TYR A CE1 1 
ATOM   717  C  CE2 . TYR A 1 89  ? -24.079 -8.707  68.802  1.00 18.28  ? 90  TYR A CE2 1 
ATOM   718  C  CZ  . TYR A 1 89  ? -22.807 -9.250  68.833  1.00 19.05  ? 90  TYR A CZ  1 
ATOM   719  O  OH  . TYR A 1 89  ? -21.729 -8.434  69.094  1.00 19.35  ? 90  TYR A OH  1 
ATOM   720  N  N   . HIS A 1 90  ? -27.711 -10.585 70.503  1.00 20.15  ? 91  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 90  ? -27.789 -9.563  71.548  1.00 21.81  ? 91  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 90  ? -27.951 -10.189 72.932  1.00 23.04  ? 91  HIS A C   1 
ATOM   723  O  O   . HIS A 1 90  ? -27.318 -9.745  73.880  1.00 22.91  ? 91  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 90  ? -28.898 -8.542  71.270  1.00 21.16  ? 91  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 90  ? -28.575 -7.599  70.156  1.00 20.87  ? 91  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 90  ? -28.599 -7.980  68.832  1.00 21.35  ? 91  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 90  ? -28.204 -6.297  70.165  1.00 20.29  ? 91  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 90  ? -28.264 -6.950  68.075  1.00 22.23  ? 91  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 90  ? -28.017 -5.918  68.859  1.00 20.48  ? 91  HIS A NE2 1 
ATOM   730  N  N   . GLN A 1 91  ? -28.781 -11.226 73.023  1.00 24.74  ? 92  GLN A N   1 
ATOM   731  C  CA  . GLN A 1 91  ? -29.008 -11.947 74.283  1.00 26.60  ? 92  GLN A CA  1 
ATOM   732  C  C   . GLN A 1 91  ? -27.763 -12.685 74.785  1.00 27.09  ? 92  GLN A C   1 
ATOM   733  O  O   . GLN A 1 91  ? -27.336 -12.471 75.924  1.00 27.21  ? 92  GLN A O   1 
ATOM   734  C  CB  . GLN A 1 91  ? -30.211 -12.896 74.169  1.00 26.78  ? 92  GLN A CB  1 
ATOM   735  C  CG  . GLN A 1 91  ? -31.507 -12.304 74.733  1.00 29.87  ? 92  GLN A CG  1 
ATOM   736  C  CD  . GLN A 1 91  ? -32.779 -12.832 74.065  1.00 33.43  ? 92  GLN A CD  1 
ATOM   737  O  OE1 . GLN A 1 91  ? -32.791 -13.928 73.483  1.00 36.08  ? 92  GLN A OE1 1 
ATOM   738  N  NE2 . GLN A 1 91  ? -33.863 -12.051 74.154  1.00 32.94  ? 92  GLN A NE2 1 
ATOM   739  N  N   . TYR A 1 92  ? -27.165 -13.520 73.938  1.00 27.84  ? 93  TYR A N   1 
ATOM   740  C  CA  . TYR A 1 92  ? -26.024 -14.341 74.363  1.00 29.09  ? 93  TYR A CA  1 
ATOM   741  C  C   . TYR A 1 92  ? -24.757 -13.530 74.667  1.00 28.95  ? 93  TYR A C   1 
ATOM   742  O  O   . TYR A 1 92  ? -24.020 -13.852 75.599  1.00 28.85  ? 93  TYR A O   1 
ATOM   743  C  CB  . TYR A 1 92  ? -25.711 -15.446 73.348  1.00 29.51  ? 93  TYR A CB  1 
ATOM   744  C  CG  . TYR A 1 92  ? -24.794 -16.520 73.905  1.00 33.49  ? 93  TYR A CG  1 
ATOM   745  C  CD1 . TYR A 1 92  ? -25.320 -17.649 74.549  1.00 35.99  ? 93  TYR A CD1 1 
ATOM   746  C  CD2 . TYR A 1 92  ? -23.397 -16.406 73.805  1.00 36.48  ? 93  TYR A CD2 1 
ATOM   747  C  CE1 . TYR A 1 92  ? -24.486 -18.637 75.072  1.00 37.03  ? 93  TYR A CE1 1 
ATOM   748  C  CE2 . TYR A 1 92  ? -22.554 -17.387 74.330  1.00 37.94  ? 93  TYR A CE2 1 
ATOM   749  C  CZ  . TYR A 1 92  ? -23.110 -18.501 74.959  1.00 38.56  ? 93  TYR A CZ  1 
ATOM   750  O  OH  . TYR A 1 92  ? -22.290 -19.479 75.476  1.00 40.17  ? 93  TYR A OH  1 
ATOM   751  N  N   . TYR A 1 93  ? -24.507 -12.484 73.887  1.00 28.70  ? 94  TYR A N   1 
ATOM   752  C  CA  . TYR A 1 93  ? -23.308 -11.678 74.081  1.00 28.68  ? 94  TYR A CA  1 
ATOM   753  C  C   . TYR A 1 93  ? -23.604 -10.395 74.871  1.00 29.17  ? 94  TYR A C   1 
ATOM   754  O  O   . TYR A 1 93  ? -22.777 -9.473  74.933  1.00 29.26  ? 94  TYR A O   1 
ATOM   755  C  CB  . TYR A 1 93  ? -22.618 -11.432 72.733  1.00 28.46  ? 94  TYR A CB  1 
ATOM   756  C  CG  . TYR A 1 93  ? -22.075 -12.717 72.137  1.00 27.63  ? 94  TYR A CG  1 
ATOM   757  C  CD1 . TYR A 1 93  ? -22.816 -13.454 71.206  1.00 26.36  ? 94  TYR A CD1 1 
ATOM   758  C  CD2 . TYR A 1 93  ? -20.837 -13.224 72.542  1.00 27.90  ? 94  TYR A CD2 1 
ATOM   759  C  CE1 . TYR A 1 93  ? -22.319 -14.651 70.675  1.00 25.44  ? 94  TYR A CE1 1 
ATOM   760  C  CE2 . TYR A 1 93  ? -20.331 -14.415 72.014  1.00 25.91  ? 94  TYR A CE2 1 
ATOM   761  C  CZ  . TYR A 1 93  ? -21.075 -15.120 71.085  1.00 25.50  ? 94  TYR A CZ  1 
ATOM   762  O  OH  . TYR A 1 93  ? -20.571 -16.296 70.581  1.00 25.29  ? 94  TYR A OH  1 
ATOM   763  N  N   . GLN A 1 94  ? -24.786 -10.375 75.492  1.00 29.38  ? 95  GLN A N   1 
ATOM   764  C  CA  . GLN A 1 94  ? -25.228 -9.295  76.387  1.00 30.16  ? 95  GLN A CA  1 
ATOM   765  C  C   . GLN A 1 94  ? -24.923 -7.907  75.815  1.00 29.93  ? 95  GLN A C   1 
ATOM   766  O  O   . GLN A 1 94  ? -24.275 -7.062  76.446  1.00 30.30  ? 95  GLN A O   1 
ATOM   767  C  CB  . GLN A 1 94  ? -24.648 -9.473  77.795  1.00 30.52  ? 95  GLN A CB  1 
ATOM   768  C  CG  . GLN A 1 94  ? -24.958 -10.839 78.437  1.00 32.52  ? 95  GLN A CG  1 
ATOM   769  C  CD  . GLN A 1 94  ? -24.129 -11.099 79.699  1.00 35.52  ? 95  GLN A CD  1 
ATOM   770  O  OE1 . GLN A 1 94  ? -23.972 -10.216 80.550  1.00 36.39  ? 95  GLN A OE1 1 
ATOM   771  N  NE2 . GLN A 1 94  ? -23.597 -12.315 79.821  1.00 35.46  ? 95  GLN A NE2 1 
ATOM   772  N  N   . ARG A 1 95  ? -25.405 -7.699  74.600  1.00 29.34  ? 96  ARG A N   1 
ATOM   773  C  CA  . ARG A 1 95  ? -25.235 -6.458  73.886  1.00 28.91  ? 96  ARG A CA  1 
ATOM   774  C  C   . ARG A 1 95  ? -26.447 -5.577  74.127  1.00 28.39  ? 96  ARG A C   1 
ATOM   775  O  O   . ARG A 1 95  ? -27.580 -6.022  73.967  1.00 28.52  ? 96  ARG A O   1 
ATOM   776  C  CB  . ARG A 1 95  ? -25.065 -6.757  72.397  1.00 29.32  ? 96  ARG A CB  1 
ATOM   777  C  CG  . ARG A 1 95  ? -23.704 -6.435  71.834  1.00 30.69  ? 96  ARG A CG  1 
ATOM   778  C  CD  . ARG A 1 95  ? -22.608 -7.355  72.293  1.00 34.16  ? 96  ARG A CD  1 
ATOM   779  N  NE  . ARG A 1 95  ? -21.347 -6.914  71.711  1.00 37.20  ? 96  ARG A NE  1 
ATOM   780  C  CZ  . ARG A 1 95  ? -20.157 -7.034  72.290  1.00 40.61  ? 96  ARG A CZ  1 
ATOM   781  N  NH1 . ARG A 1 95  ? -20.040 -7.598  73.494  1.00 40.96  ? 96  ARG A NH1 1 
ATOM   782  N  NH2 . ARG A 1 95  ? -19.076 -6.579  71.661  1.00 41.56  ? 96  ARG A NH2 1 
ATOM   783  N  N   . PRO A 1 96  ? -26.220 -4.324  74.543  1.00 27.84  ? 97  PRO A N   1 
ATOM   784  C  CA  . PRO A 1 96  ? -27.346 -3.429  74.788  1.00 27.16  ? 97  PRO A CA  1 
ATOM   785  C  C   . PRO A 1 96  ? -28.141 -3.166  73.507  1.00 26.40  ? 97  PRO A C   1 
ATOM   786  O  O   . PRO A 1 96  ? -27.557 -2.940  72.441  1.00 25.78  ? 97  PRO A O   1 
ATOM   787  C  CB  . PRO A 1 96  ? -26.676 -2.146  75.298  1.00 27.29  ? 97  PRO A CB  1 
ATOM   788  C  CG  . PRO A 1 96  ? -25.270 -2.244  74.844  1.00 28.02  ? 97  PRO A CG  1 
ATOM   789  C  CD  . PRO A 1 96  ? -24.928 -3.687  74.848  1.00 27.76  ? 97  PRO A CD  1 
ATOM   790  N  N   . ILE A 1 97  ? -29.463 -3.213  73.629  1.00 25.48  ? 98  ILE A N   1 
ATOM   791  C  CA  . ILE A 1 97  ? -30.350 -3.142  72.486  1.00 24.62  ? 98  ILE A CA  1 
ATOM   792  C  C   . ILE A 1 97  ? -30.904 -1.743  72.306  1.00 24.32  ? 98  ILE A C   1 
ATOM   793  O  O   . ILE A 1 97  ? -31.100 -1.005  73.271  1.00 24.19  ? 98  ILE A O   1 
ATOM   794  C  CB  . ILE A 1 97  ? -31.532 -4.160  72.596  1.00 24.92  ? 98  ILE A CB  1 
ATOM   795  C  CG1 . ILE A 1 97  ? -32.408 -3.862  73.819  1.00 23.83  ? 98  ILE A CG1 1 
ATOM   796  C  CG2 . ILE A 1 97  ? -31.007 -5.609  72.614  1.00 24.27  ? 98  ILE A CG2 1 
ATOM   797  C  CD1 . ILE A 1 97  ? -33.633 -4.750  73.936  1.00 24.52  ? 98  ILE A CD1 1 
ATOM   798  N  N   . GLY A 1 98  ? -31.161 -1.385  71.056  1.00 23.79  ? 99  GLY A N   1 
ATOM   799  C  CA  . GLY A 1 98  ? -31.823 -0.133  70.755  1.00 22.48  ? 99  GLY A CA  1 
ATOM   800  C  C   . GLY A 1 98  ? -33.270 -0.346  70.369  1.00 22.15  ? 99  GLY A C   1 
ATOM   801  O  O   . GLY A 1 98  ? -33.848 -1.423  70.569  1.00 21.37  ? 99  GLY A O   1 
ATOM   802  N  N   . VAL A 1 99  ? -33.834 0.700   69.784  1.00 21.68  ? 100 VAL A N   1 
ATOM   803  C  CA  . VAL A 1 99  ? -35.236 0.772   69.415  1.00 21.20  ? 100 VAL A CA  1 
ATOM   804  C  C   . VAL A 1 99  ? -35.711 -0.419  68.547  1.00 21.16  ? 100 VAL A C   1 
ATOM   805  O  O   . VAL A 1 99  ? -36.851 -0.888  68.690  1.00 21.46  ? 100 VAL A O   1 
ATOM   806  C  CB  . VAL A 1 99  ? -35.512 2.165   68.778  1.00 21.43  ? 100 VAL A CB  1 
ATOM   807  C  CG1 . VAL A 1 99  ? -35.066 2.224   67.309  1.00 20.61  ? 100 VAL A CG1 1 
ATOM   808  C  CG2 . VAL A 1 99  ? -36.948 2.585   68.964  1.00 22.22  ? 100 VAL A CG2 1 
ATOM   809  N  N   . LEU A 1 100 ? -34.834 -0.932  67.685  1.00 20.32  ? 101 LEU A N   1 
ATOM   810  C  CA  . LEU A 1 100 ? -35.187 -2.052  66.813  1.00 20.08  ? 101 LEU A CA  1 
ATOM   811  C  C   . LEU A 1 100 ? -35.656 -3.295  67.586  1.00 20.12  ? 101 LEU A C   1 
ATOM   812  O  O   . LEU A 1 100 ? -36.650 -3.924  67.207  1.00 19.28  ? 101 LEU A O   1 
ATOM   813  C  CB  . LEU A 1 100 ? -34.017 -2.418  65.890  1.00 19.56  ? 101 LEU A CB  1 
ATOM   814  C  CG  . LEU A 1 100 ? -34.227 -3.602  64.939  1.00 20.05  ? 101 LEU A CG  1 
ATOM   815  C  CD1 . LEU A 1 100 ? -35.243 -3.274  63.858  1.00 20.39  ? 101 LEU A CD1 1 
ATOM   816  C  CD2 . LEU A 1 100 ? -32.923 -4.065  64.320  1.00 18.24  ? 101 LEU A CD2 1 
ATOM   817  N  N   . LEU A 1 101 ? -34.949 -3.624  68.664  1.00 20.18  ? 102 LEU A N   1 
ATOM   818  C  CA  . LEU A 1 101 ? -35.203 -4.864  69.396  1.00 21.34  ? 102 LEU A CA  1 
ATOM   819  C  C   . LEU A 1 101 ? -36.038 -4.729  70.666  1.00 21.96  ? 102 LEU A C   1 
ATOM   820  O  O   . LEU A 1 101 ? -36.310 -5.731  71.335  1.00 22.93  ? 102 LEU A O   1 
ATOM   821  C  CB  . LEU A 1 101 ? -33.891 -5.586  69.702  1.00 21.07  ? 102 LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 101 ? -33.068 -6.008  68.486  1.00 21.50  ? 102 LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 101 ? -31.870 -6.811  68.936  1.00 22.35  ? 102 LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 101 ? -33.909 -6.792  67.489  1.00 21.75  ? 102 LEU A CD2 1 
ATOM   825  N  N   . LYS A 1 102 ? -36.443 -3.500  70.982  1.00 22.23  ? 103 LYS A N   1 
ATOM   826  C  CA  . LYS A 1 102 ? -37.274 -3.218  72.145  1.00 22.63  ? 103 LYS A CA  1 
ATOM   827  C  C   . LYS A 1 102 ? -38.762 -3.337  71.812  1.00 23.27  ? 103 LYS A C   1 
ATOM   828  O  O   . LYS A 1 102 ? -39.146 -3.366  70.640  1.00 23.56  ? 103 LYS A O   1 
ATOM   829  C  CB  . LYS A 1 102 ? -36.975 -1.815  72.696  1.00 22.34  ? 103 LYS A CB  1 
ATOM   830  C  CG  . LYS A 1 102 ? -35.551 -1.630  73.211  1.00 21.62  ? 103 LYS A CG  1 
ATOM   831  C  CD  . LYS A 1 102 ? -35.370 -0.275  73.880  1.00 20.99  ? 103 LYS A CD  1 
ATOM   832  C  CE  . LYS A 1 102 ? -34.047 -0.224  74.640  1.00 21.70  ? 103 LYS A CE  1 
ATOM   833  N  NZ  . LYS A 1 102 ? -33.758 1.107   75.234  1.00 20.04  ? 103 LYS A NZ  1 
ATOM   834  N  N   . LYS A 1 103 ? -39.590 -3.412  72.853  1.00 23.84  ? 104 LYS A N   1 
ATOM   835  C  CA  . LYS A 1 103 ? -41.046 -3.428  72.700  1.00 24.80  ? 104 LYS A CA  1 
ATOM   836  C  C   . LYS A 1 103 ? -41.720 -2.565  73.761  1.00 24.89  ? 104 LYS A C   1 
ATOM   837  O  O   . LYS A 1 103 ? -41.056 -2.060  74.671  1.00 24.67  ? 104 LYS A O   1 
ATOM   838  C  CB  . LYS A 1 103 ? -41.600 -4.857  72.748  1.00 24.91  ? 104 LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 103 ? -41.215 -5.665  73.977  1.00 26.99  ? 104 LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 103 ? -42.053 -6.938  74.048  1.00 30.42  ? 104 LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 103 ? -41.418 -7.974  74.957  1.00 33.13  ? 104 LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 103 ? -41.869 -9.370  74.596  1.00 35.45  ? 104 LYS A NZ  1 
ATOM   843  N  N   . SER A 1 104 ? -43.038 -2.421  73.623  1.00 25.43  ? 105 SER A N   1 
ATOM   844  C  CA  . SER A 1 104 ? -43.893 -1.641  74.523  1.00 25.93  ? 105 SER A CA  1 
ATOM   845  C  C   . SER A 1 104 ? -43.249 -0.358  75.047  1.00 25.81  ? 105 SER A C   1 
ATOM   846  O  O   . SER A 1 104 ? -42.602 0.372   74.286  1.00 25.70  ? 105 SER A O   1 
ATOM   847  C  CB  . SER A 1 104 ? -44.464 -2.505  75.671  1.00 26.35  ? 105 SER A CB  1 
ATOM   848  O  OG  . SER A 1 104 ? -43.497 -3.414  76.174  1.00 28.17  ? 105 SER A OG  1 
ATOM   849  N  N   . ALA A 1 105 ? -43.433 -0.098  76.341  1.00 25.43  ? 106 ALA A N   1 
ATOM   850  C  CA  . ALA A 1 105 ? -43.025 1.160   76.961  1.00 25.01  ? 106 ALA A CA  1 
ATOM   851  C  C   . ALA A 1 105 ? -41.545 1.485   76.736  1.00 24.54  ? 106 ALA A C   1 
ATOM   852  O  O   . ALA A 1 105 ? -41.203 2.636   76.452  1.00 24.59  ? 106 ALA A O   1 
ATOM   853  C  CB  . ALA A 1 105 ? -43.367 1.160   78.460  1.00 25.02  ? 106 ALA A CB  1 
ATOM   854  N  N   . ALA A 1 106 ? -40.676 0.480   76.847  1.00 23.49  ? 107 ALA A N   1 
ATOM   855  C  CA  . ALA A 1 106 ? -39.257 0.698   76.610  1.00 23.18  ? 107 ALA A CA  1 
ATOM   856  C  C   . ALA A 1 106 ? -38.967 1.158   75.163  1.00 23.10  ? 107 ALA A C   1 
ATOM   857  O  O   . ALA A 1 106 ? -38.083 1.986   74.945  1.00 22.65  ? 107 ALA A O   1 
ATOM   858  C  CB  . ALA A 1 106 ? -38.456 -0.535  76.970  1.00 23.16  ? 107 ALA A CB  1 
ATOM   859  N  N   . TRP A 1 107 ? -39.716 0.627   74.193  1.00 22.96  ? 108 TRP A N   1 
ATOM   860  C  CA  . TRP A 1 107 ? -39.577 1.041   72.798  1.00 22.97  ? 108 TRP A CA  1 
ATOM   861  C  C   . TRP A 1 107 ? -40.053 2.473   72.627  1.00 23.41  ? 108 TRP A C   1 
ATOM   862  O  O   . TRP A 1 107 ? -39.359 3.295   72.026  1.00 23.04  ? 108 TRP A O   1 
ATOM   863  C  CB  . TRP A 1 107 ? -40.355 0.127   71.830  1.00 22.56  ? 108 TRP A CB  1 
ATOM   864  C  CG  . TRP A 1 107 ? -40.475 0.758   70.465  1.00 21.91  ? 108 TRP A CG  1 
ATOM   865  C  CD1 . TRP A 1 107 ? -39.518 0.775   69.484  1.00 21.14  ? 108 TRP A CD1 1 
ATOM   866  C  CD2 . TRP A 1 107 ? -41.584 1.511   69.955  1.00 20.75  ? 108 TRP A CD2 1 
ATOM   867  N  NE1 . TRP A 1 107 ? -39.966 1.476   68.395  1.00 21.22  ? 108 TRP A NE1 1 
ATOM   868  C  CE2 . TRP A 1 107 ? -41.230 1.943   68.653  1.00 21.28  ? 108 TRP A CE2 1 
ATOM   869  C  CE3 . TRP A 1 107 ? -42.842 1.859   70.466  1.00 19.93  ? 108 TRP A CE3 1 
ATOM   870  C  CZ2 . TRP A 1 107 ? -42.092 2.708   67.852  1.00 19.43  ? 108 TRP A CZ2 1 
ATOM   871  C  CZ3 . TRP A 1 107 ? -43.700 2.616   69.673  1.00 19.52  ? 108 TRP A CZ3 1 
ATOM   872  C  CH2 . TRP A 1 107 ? -43.317 3.034   68.377  1.00 20.12  ? 108 TRP A CH2 1 
ATOM   873  N  N   . LYS A 1 108 ? -41.247 2.751   73.153  1.00 23.81  ? 109 LYS A N   1 
ATOM   874  C  CA  . LYS A 1 108 ? -41.874 4.058   73.038  1.00 24.72  ? 109 LYS A CA  1 
ATOM   875  C  C   . LYS A 1 108 ? -40.978 5.173   73.574  1.00 24.72  ? 109 LYS A C   1 
ATOM   876  O  O   . LYS A 1 108 ? -40.852 6.228   72.946  1.00 24.80  ? 109 LYS A O   1 
ATOM   877  C  CB  . LYS A 1 108 ? -43.229 4.057   73.760  1.00 25.11  ? 109 LYS A CB  1 
ATOM   878  C  CG  . LYS A 1 108 ? -44.049 5.330   73.585  1.00 27.02  ? 109 LYS A CG  1 
ATOM   879  C  CD  . LYS A 1 108 ? -44.447 5.549   72.131  1.00 29.22  ? 109 LYS A CD  1 
ATOM   880  C  CE  . LYS A 1 108 ? -45.455 6.677   72.008  1.00 31.34  ? 109 LYS A CE  1 
ATOM   881  N  NZ  . LYS A 1 108 ? -45.962 6.787   70.601  1.00 32.23  ? 109 LYS A NZ  1 
ATOM   882  N  N   . LYS A 1 109 ? -40.349 4.918   74.720  1.00 24.92  ? 110 LYS A N   1 
ATOM   883  C  CA  . LYS A 1 109 ? -39.465 5.881   75.374  1.00 25.31  ? 110 LYS A CA  1 
ATOM   884  C  C   . LYS A 1 109 ? -38.277 6.281   74.491  1.00 24.87  ? 110 LYS A C   1 
ATOM   885  O  O   . LYS A 1 109 ? -38.004 7.465   74.339  1.00 25.00  ? 110 LYS A O   1 
ATOM   886  C  CB  . LYS A 1 109 ? -38.991 5.345   76.729  1.00 25.75  ? 110 LYS A CB  1 
ATOM   887  C  CG  . LYS A 1 109 ? -38.054 6.285   77.500  1.00 27.85  ? 110 LYS A CG  1 
ATOM   888  C  CD  . LYS A 1 109 ? -37.759 5.761   78.916  1.00 31.22  ? 110 LYS A CD  1 
ATOM   889  C  CE  . LYS A 1 109 ? -36.687 6.601   79.593  1.00 34.02  ? 110 LYS A CE  1 
ATOM   890  N  NZ  . LYS A 1 109 ? -36.672 6.425   81.082  1.00 36.12  ? 110 LYS A NZ  1 
ATOM   891  N  N   . ASP A 1 110 ? -37.580 5.298   73.922  1.00 24.27  ? 111 ASP A N   1 
ATOM   892  C  CA  . ASP A 1 110 ? -36.491 5.571   72.973  1.00 23.75  ? 111 ASP A CA  1 
ATOM   893  C  C   . ASP A 1 110 ? -37.010 6.252   71.701  1.00 23.27  ? 111 ASP A C   1 
ATOM   894  O  O   . ASP A 1 110 ? -36.447 7.251   71.253  1.00 23.46  ? 111 ASP A O   1 
ATOM   895  C  CB  . ASP A 1 110 ? -35.732 4.285   72.612  1.00 23.51  ? 111 ASP A CB  1 
ATOM   896  C  CG  . ASP A 1 110 ? -34.713 3.870   73.675  1.00 24.41  ? 111 ASP A CG  1 
ATOM   897  O  OD1 . ASP A 1 110 ? -34.773 4.356   74.837  1.00 25.06  ? 111 ASP A OD1 1 
ATOM   898  O  OD2 . ASP A 1 110 ? -33.835 3.045   73.340  1.00 24.55  ? 111 ASP A OD2 1 
ATOM   899  N  N   . ARG A 1 111 ? -38.090 5.721   71.133  1.00 22.84  ? 112 ARG A N   1 
ATOM   900  C  CA  . ARG A 1 111 ? -38.643 6.256   69.885  1.00 22.53  ? 112 ARG A CA  1 
ATOM   901  C  C   . ARG A 1 111 ? -38.988 7.738   69.977  1.00 22.81  ? 112 ARG A C   1 
ATOM   902  O  O   . ARG A 1 111 ? -38.634 8.510   69.081  1.00 23.12  ? 112 ARG A O   1 
ATOM   903  C  CB  . ARG A 1 111 ? -39.869 5.458   69.422  1.00 22.15  ? 112 ARG A CB  1 
ATOM   904  C  CG  . ARG A 1 111 ? -40.332 5.794   67.996  1.00 20.58  ? 112 ARG A CG  1 
ATOM   905  C  CD  . ARG A 1 111 ? -39.243 5.551   66.942  1.00 17.29  ? 112 ARG A CD  1 
ATOM   906  N  NE  . ARG A 1 111 ? -39.620 6.148   65.663  1.00 16.48  ? 112 ARG A NE  1 
ATOM   907  C  CZ  . ARG A 1 111 ? -39.838 5.477   64.531  1.00 15.79  ? 112 ARG A CZ  1 
ATOM   908  N  NH1 . ARG A 1 111 ? -39.677 4.161   64.473  1.00 14.97  ? 112 ARG A NH1 1 
ATOM   909  N  NH2 . ARG A 1 111 ? -40.199 6.132   63.436  1.00 13.22  ? 112 ARG A NH2 1 
ATOM   910  N  N   . VAL A 1 112 ? -39.667 8.126   71.058  1.00 22.87  ? 113 VAL A N   1 
ATOM   911  C  CA  . VAL A 1 112 ? -40.041 9.525   71.295  1.00 22.92  ? 113 VAL A CA  1 
ATOM   912  C  C   . VAL A 1 112 ? -38.803 10.423  71.406  1.00 22.41  ? 113 VAL A C   1 
ATOM   913  O  O   . VAL A 1 112 ? -38.720 11.458  70.748  1.00 22.29  ? 113 VAL A O   1 
ATOM   914  C  CB  . VAL A 1 112 ? -40.979 9.674   72.531  1.00 23.18  ? 113 VAL A CB  1 
ATOM   915  C  CG1 . VAL A 1 112 ? -41.059 11.132  73.004  1.00 25.07  ? 113 VAL A CG1 1 
ATOM   916  C  CG2 . VAL A 1 112 ? -42.372 9.159   72.194  1.00 23.52  ? 113 VAL A CG2 1 
ATOM   917  N  N   . ALA A 1 113 ? -37.831 10.016  72.211  1.00 21.93  ? 114 ALA A N   1 
ATOM   918  C  CA  . ALA A 1 113 ? -36.604 10.796  72.333  1.00 21.83  ? 114 ALA A CA  1 
ATOM   919  C  C   . ALA A 1 113 ? -35.886 10.921  70.981  1.00 21.86  ? 114 ALA A C   1 
ATOM   920  O  O   . ALA A 1 113 ? -35.394 11.994  70.635  1.00 21.46  ? 114 ALA A O   1 
ATOM   921  C  CB  . ALA A 1 113 ? -35.694 10.192  73.372  1.00 21.73  ? 114 ALA A CB  1 
ATOM   922  N  N   . LEU A 1 114 ? -35.856 9.828   70.214  1.00 21.56  ? 115 LEU A N   1 
ATOM   923  C  CA  . LEU A 1 114 ? -35.185 9.821   68.910  1.00 21.28  ? 115 LEU A CA  1 
ATOM   924  C  C   . LEU A 1 114 ? -35.941 10.614  67.829  1.00 21.33  ? 115 LEU A C   1 
ATOM   925  O  O   . LEU A 1 114 ? -35.316 11.279  67.017  1.00 21.15  ? 115 LEU A O   1 
ATOM   926  C  CB  . LEU A 1 114 ? -34.892 8.389   68.439  1.00 20.71  ? 115 LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 114 ? -33.933 7.568   69.307  1.00 20.43  ? 115 LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 114 ? -34.074 6.099   68.967  1.00 21.16  ? 115 LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 114 ? -32.482 8.027   69.178  1.00 18.83  ? 115 LEU A CD2 1 
ATOM   930  N  N   . ASN A 1 115 ? -37.269 10.529  67.817  1.00 21.79  ? 116 ASN A N   1 
ATOM   931  C  CA  . ASN A 1 115 ? -38.092 11.320  66.886  1.00 22.17  ? 116 ASN A CA  1 
ATOM   932  C  C   . ASN A 1 115 ? -37.824 12.832  66.981  1.00 22.58  ? 116 ASN A C   1 
ATOM   933  O  O   . ASN A 1 115 ? -37.770 13.526  65.965  1.00 22.56  ? 116 ASN A O   1 
ATOM   934  C  CB  . ASN A 1 115 ? -39.585 11.031  67.085  1.00 21.81  ? 116 ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 115 ? -40.018 9.683   66.502  1.00 22.60  ? 116 ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 115 ? -39.299 9.059   65.721  1.00 21.52  ? 116 ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 115 ? -41.205 9.231   66.889  1.00 22.96  ? 116 ASN A ND2 1 
ATOM   938  N  N   . GLN A 1 116 ? -37.640 13.333  68.199  1.00 23.12  ? 117 GLN A N   1 
ATOM   939  C  CA  . GLN A 1 116 ? -37.302 14.746  68.402  1.00 23.97  ? 117 GLN A CA  1 
ATOM   940  C  C   . GLN A 1 116 ? -36.048 15.167  67.629  1.00 23.40  ? 117 GLN A C   1 
ATOM   941  O  O   . GLN A 1 116 ? -35.965 16.287  67.138  1.00 23.08  ? 117 GLN A O   1 
ATOM   942  C  CB  . GLN A 1 116 ? -37.132 15.065  69.893  1.00 24.18  ? 117 GLN A CB  1 
ATOM   943  C  CG  . GLN A 1 116 ? -38.447 15.229  70.651  1.00 28.24  ? 117 GLN A CG  1 
ATOM   944  C  CD  . GLN A 1 116 ? -38.259 15.720  72.096  1.00 32.98  ? 117 GLN A CD  1 
ATOM   945  O  OE1 . GLN A 1 116 ? -37.368 16.533  72.394  1.00 33.51  ? 117 GLN A OE1 1 
ATOM   946  N  NE2 . GLN A 1 116 ? -39.110 15.229  72.995  1.00 34.15  ? 117 GLN A NE2 1 
ATOM   947  N  N   . GLU A 1 117 ? -35.091 14.253  67.502  1.00 23.08  ? 118 GLU A N   1 
ATOM   948  C  CA  . GLU A 1 117 ? -33.792 14.589  66.922  1.00 22.72  ? 118 GLU A CA  1 
ATOM   949  C  C   . GLU A 1 117 ? -33.561 14.108  65.489  1.00 22.31  ? 118 GLU A C   1 
ATOM   950  O  O   . GLU A 1 117 ? -32.669 14.616  64.815  1.00 21.99  ? 118 GLU A O   1 
ATOM   951  C  CB  . GLU A 1 117 ? -32.660 14.108  67.841  1.00 22.93  ? 118 GLU A CB  1 
ATOM   952  C  CG  . GLU A 1 117 ? -32.595 14.846  69.193  1.00 24.57  ? 118 GLU A CG  1 
ATOM   953  C  CD  . GLU A 1 117 ? -32.647 16.378  69.053  1.00 25.92  ? 118 GLU A CD  1 
ATOM   954  O  OE1 . GLU A 1 117 ? -32.384 16.905  67.946  1.00 26.64  ? 118 GLU A OE1 1 
ATOM   955  O  OE2 . GLU A 1 117 ? -32.956 17.053  70.056  1.00 26.22  ? 118 GLU A OE2 1 
ATOM   956  N  N   . VAL A 1 118 ? -34.348 13.136  65.025  1.00 21.93  ? 119 VAL A N   1 
ATOM   957  C  CA  . VAL A 1 118 ? -34.119 12.552  63.695  1.00 21.95  ? 119 VAL A CA  1 
ATOM   958  C  C   . VAL A 1 118 ? -35.321 12.631  62.748  1.00 22.20  ? 119 VAL A C   1 
ATOM   959  O  O   . VAL A 1 118 ? -35.145 12.495  61.537  1.00 21.88  ? 119 VAL A O   1 
ATOM   960  C  CB  . VAL A 1 118 ? -33.556 11.089  63.759  1.00 22.02  ? 119 VAL A CB  1 
ATOM   961  C  CG1 . VAL A 1 118 ? -32.442 10.967  64.821  1.00 22.31  ? 119 VAL A CG1 1 
ATOM   962  C  CG2 . VAL A 1 118 ? -34.661 10.086  64.027  1.00 20.95  ? 119 VAL A CG2 1 
ATOM   963  N  N   . MET A 1 119 ? -36.528 12.824  63.293  1.00 22.62  ? 120 MET A N   1 
ATOM   964  C  CA  . MET A 1 119 ? -37.748 12.906  62.475  1.00 23.48  ? 120 MET A CA  1 
ATOM   965  C  C   . MET A 1 119 ? -38.354 14.315  62.409  1.00 23.49  ? 120 MET A C   1 
ATOM   966  O  O   . MET A 1 119 ? -38.888 14.707  61.369  1.00 23.23  ? 120 MET A O   1 
ATOM   967  C  CB  . MET A 1 119 ? -38.823 11.901  62.939  1.00 23.76  ? 120 MET A CB  1 
ATOM   968  C  CG  . MET A 1 119 ? -38.528 10.397  62.664  1.00 26.62  ? 120 MET A CG  1 
ATOM   969  S  SD  . MET A 1 119 ? -38.665 9.844   60.931  1.00 33.83  ? 120 MET A SD  1 
ATOM   970  C  CE  . MET A 1 119 ? -40.430 9.754   60.665  1.00 32.25  ? 120 MET A CE  1 
ATOM   971  N  N   . ALA A 1 120 ? -38.279 15.064  63.510  1.00 23.79  ? 121 ALA A N   1 
ATOM   972  C  CA  . ALA A 1 120 ? -38.958 16.373  63.623  1.00 24.51  ? 121 ALA A CA  1 
ATOM   973  C  C   . ALA A 1 120 ? -38.362 17.415  62.670  1.00 24.71  ? 121 ALA A C   1 
ATOM   974  O  O   . ALA A 1 120 ? -37.139 17.484  62.535  1.00 24.76  ? 121 ALA A O   1 
ATOM   975  C  CB  . ALA A 1 120 ? -38.919 16.883  65.082  1.00 24.11  ? 121 ALA A CB  1 
ATOM   976  N  N   . PRO A 1 121 ? -39.222 18.225  62.009  1.00 25.24  ? 122 PRO A N   1 
ATOM   977  C  CA  . PRO A 1 121 ? -38.754 19.222  61.021  1.00 25.57  ? 122 PRO A CA  1 
ATOM   978  C  C   . PRO A 1 121 ? -37.769 20.227  61.603  1.00 25.95  ? 122 PRO A C   1 
ATOM   979  O  O   . PRO A 1 121 ? -36.832 20.636  60.919  1.00 25.87  ? 122 PRO A O   1 
ATOM   980  C  CB  . PRO A 1 121 ? -40.047 19.926  60.582  1.00 25.43  ? 122 PRO A CB  1 
ATOM   981  C  CG  . PRO A 1 121 ? -41.124 18.895  60.808  1.00 25.64  ? 122 PRO A CG  1 
ATOM   982  C  CD  . PRO A 1 121 ? -40.697 18.167  62.065  1.00 25.42  ? 122 PRO A CD  1 
ATOM   983  N  N   . GLU A 1 122 ? -37.977 20.603  62.863  1.00 26.56  ? 123 GLU A N   1 
ATOM   984  C  CA  . GLU A 1 122 ? -37.083 21.512  63.572  1.00 27.17  ? 123 GLU A CA  1 
ATOM   985  C  C   . GLU A 1 122 ? -35.675 20.945  63.648  1.00 26.41  ? 123 GLU A C   1 
ATOM   986  O  O   . GLU A 1 122 ? -34.699 21.694  63.616  1.00 26.30  ? 123 GLU A O   1 
ATOM   987  C  CB  . GLU A 1 122 ? -37.608 21.796  64.983  1.00 28.00  ? 123 GLU A CB  1 
ATOM   988  C  CG  . GLU A 1 122 ? -38.937 22.567  65.017  1.00 32.05  ? 123 GLU A CG  1 
ATOM   989  C  CD  . GLU A 1 122 ? -40.158 21.712  64.663  1.00 36.93  ? 123 GLU A CD  1 
ATOM   990  O  OE1 . GLU A 1 122 ? -40.088 20.453  64.771  1.00 37.76  ? 123 GLU A OE1 1 
ATOM   991  O  OE2 . GLU A 1 122 ? -41.198 22.313  64.283  1.00 39.21  ? 123 GLU A OE2 1 
ATOM   992  N  N   . ALA A 1 123 ? -35.576 19.622  63.753  1.00 25.54  ? 124 ALA A N   1 
ATOM   993  C  CA  . ALA A 1 123 ? -34.277 18.952  63.783  1.00 24.66  ? 124 ALA A CA  1 
ATOM   994  C  C   . ALA A 1 123 ? -33.729 18.684  62.377  1.00 23.97  ? 124 ALA A C   1 
ATOM   995  O  O   . ALA A 1 123 ? -32.580 19.011  62.091  1.00 24.29  ? 124 ALA A O   1 
ATOM   996  C  CB  . ALA A 1 123 ? -34.358 17.664  64.593  1.00 24.52  ? 124 ALA A CB  1 
ATOM   997  N  N   . THR A 1 124 ? -34.557 18.124  61.498  1.00 23.21  ? 125 THR A N   1 
ATOM   998  C  CA  . THR A 1 124 ? -34.088 17.669  60.186  1.00 22.90  ? 125 THR A CA  1 
ATOM   999  C  C   . THR A 1 124 ? -33.655 18.798  59.237  1.00 22.79  ? 125 THR A C   1 
ATOM   1000 O  O   . THR A 1 124 ? -32.809 18.580  58.369  1.00 22.25  ? 125 THR A O   1 
ATOM   1001 C  CB  . THR A 1 124 ? -35.120 16.760  59.463  1.00 22.99  ? 125 THR A CB  1 
ATOM   1002 O  OG1 . THR A 1 124 ? -36.257 17.537  59.077  1.00 23.00  ? 125 THR A OG1 1 
ATOM   1003 C  CG2 . THR A 1 124 ? -35.557 15.572  60.352  1.00 22.02  ? 125 THR A CG2 1 
ATOM   1004 N  N   . LYS A 1 125 ? -34.229 19.991  59.395  1.00 22.52  ? 126 LYS A N   1 
ATOM   1005 C  CA  . LYS A 1 125 ? -33.777 21.151  58.620  1.00 22.94  ? 126 LYS A CA  1 
ATOM   1006 C  C   . LYS A 1 125 ? -32.256 21.357  58.756  1.00 21.97  ? 126 LYS A C   1 
ATOM   1007 O  O   . LYS A 1 125 ? -31.625 21.879  57.853  1.00 22.01  ? 126 LYS A O   1 
ATOM   1008 C  CB  . LYS A 1 125 ? -34.542 22.427  59.010  1.00 23.47  ? 126 LYS A CB  1 
ATOM   1009 C  CG  . LYS A 1 125 ? -34.455 22.760  60.492  1.00 26.21  ? 126 LYS A CG  1 
ATOM   1010 C  CD  . LYS A 1 125 ? -34.890 24.175  60.817  1.00 30.86  ? 126 LYS A CD  1 
ATOM   1011 C  CE  . LYS A 1 125 ? -34.297 24.615  62.168  1.00 31.99  ? 126 LYS A CE  1 
ATOM   1012 N  NZ  . LYS A 1 125 ? -34.224 26.110  62.254  1.00 35.20  ? 126 LYS A NZ  1 
ATOM   1013 N  N   . ASN A 1 126 ? -31.676 20.916  59.872  1.00 21.52  ? 127 ASN A N   1 
ATOM   1014 C  CA  . ASN A 1 126 ? -30.227 21.023  60.093  1.00 20.92  ? 127 ASN A CA  1 
ATOM   1015 C  C   . ASN A 1 126 ? -29.402 20.007  59.293  1.00 20.47  ? 127 ASN A C   1 
ATOM   1016 O  O   . ASN A 1 126 ? -28.190 20.176  59.131  1.00 20.13  ? 127 ASN A O   1 
ATOM   1017 C  CB  . ASN A 1 126 ? -29.889 20.873  61.578  1.00 21.14  ? 127 ASN A CB  1 
ATOM   1018 C  CG  . ASN A 1 126 ? -30.395 22.031  62.420  1.00 21.54  ? 127 ASN A CG  1 
ATOM   1019 O  OD1 . ASN A 1 126 ? -29.927 23.152  62.291  1.00 22.78  ? 127 ASN A OD1 1 
ATOM   1020 N  ND2 . ASN A 1 126 ? -31.350 21.755  63.293  1.00 21.33  ? 127 ASN A ND2 1 
ATOM   1021 N  N   . PHE A 1 127 ? -30.053 18.955  58.801  1.00 19.67  ? 128 PHE A N   1 
ATOM   1022 C  CA  . PHE A 1 127 ? -29.340 17.916  58.070  1.00 19.37  ? 128 PHE A CA  1 
ATOM   1023 C  C   . PHE A 1 127 ? -28.883 18.385  56.686  1.00 19.35  ? 128 PHE A C   1 
ATOM   1024 O  O   . PHE A 1 127 ? -27.893 17.873  56.165  1.00 19.74  ? 128 PHE A O   1 
ATOM   1025 C  CB  . PHE A 1 127 ? -30.167 16.623  57.941  1.00 19.29  ? 128 PHE A CB  1 
ATOM   1026 C  CG  . PHE A 1 127 ? -30.567 15.984  59.271  1.00 18.89  ? 128 PHE A CG  1 
ATOM   1027 C  CD1 . PHE A 1 127 ? -29.905 16.289  60.462  1.00 19.58  ? 128 PHE A CD1 1 
ATOM   1028 C  CD2 . PHE A 1 127 ? -31.591 15.054  59.311  1.00 17.77  ? 128 PHE A CD2 1 
ATOM   1029 C  CE1 . PHE A 1 127 ? -30.282 15.690  61.669  1.00 18.75  ? 128 PHE A CE1 1 
ATOM   1030 C  CE2 . PHE A 1 127 ? -31.974 14.452  60.519  1.00 18.82  ? 128 PHE A CE2 1 
ATOM   1031 C  CZ  . PHE A 1 127 ? -31.316 14.771  61.694  1.00 17.08  ? 128 PHE A CZ  1 
ATOM   1032 N  N   . LEU A 1 128 ? -29.590 19.357  56.104  1.00 19.02  ? 129 LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 128 ? -29.395 19.718  54.688  1.00 19.02  ? 129 LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 128 ? -27.943 20.006  54.288  1.00 18.83  ? 129 LEU A C   1 
ATOM   1035 O  O   . LEU A 1 128 ? -27.437 19.373  53.364  1.00 18.54  ? 129 LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 128 ? -30.351 20.842  54.228  1.00 19.09  ? 129 LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 128 ? -31.848 20.673  54.530  1.00 20.04  ? 129 LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 128 ? -32.663 21.665  53.716  1.00 21.41  ? 129 LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 128 ? -32.336 19.272  54.268  1.00 21.02  ? 129 LEU A CD2 1 
ATOM   1040 N  N   . PRO A 1 129 ? -27.269 20.953  54.980  1.00 18.67  ? 130 PRO A N   1 
ATOM   1041 C  CA  . PRO A 1 129 ? -25.885 21.252  54.584  1.00 18.53  ? 130 PRO A CA  1 
ATOM   1042 C  C   . PRO A 1 129 ? -24.924 20.086  54.831  1.00 18.48  ? 130 PRO A C   1 
ATOM   1043 O  O   . PRO A 1 129 ? -23.964 19.900  54.073  1.00 18.43  ? 130 PRO A O   1 
ATOM   1044 C  CB  . PRO A 1 129 ? -25.501 22.460  55.461  1.00 18.73  ? 130 PRO A CB  1 
ATOM   1045 C  CG  . PRO A 1 129 ? -26.507 22.498  56.569  1.00 19.09  ? 130 PRO A CG  1 
ATOM   1046 C  CD  . PRO A 1 129 ? -27.760 21.863  56.037  1.00 18.56  ? 130 PRO A CD  1 
ATOM   1047 N  N   . LEU A 1 130 ? -25.190 19.305  55.876  1.00 17.98  ? 131 LEU A N   1 
ATOM   1048 C  CA  . LEU A 1 130 ? -24.355 18.154  56.208  1.00 17.40  ? 131 LEU A CA  1 
ATOM   1049 C  C   . LEU A 1 130 ? -24.461 17.078  55.137  1.00 17.27  ? 131 LEU A C   1 
ATOM   1050 O  O   . LEU A 1 130 ? -23.475 16.413  54.826  1.00 17.25  ? 131 LEU A O   1 
ATOM   1051 C  CB  . LEU A 1 130 ? -24.742 17.576  57.573  1.00 17.00  ? 131 LEU A CB  1 
ATOM   1052 C  CG  . LEU A 1 130 ? -24.464 18.431  58.814  1.00 17.34  ? 131 LEU A CG  1 
ATOM   1053 C  CD1 . LEU A 1 130 ? -25.044 17.758  60.070  1.00 16.48  ? 131 LEU A CD1 1 
ATOM   1054 C  CD2 . LEU A 1 130 ? -22.970 18.685  58.985  1.00 16.98  ? 131 LEU A CD2 1 
ATOM   1055 N  N   . LEU A 1 131 ? -25.661 16.903  54.582  1.00 16.82  ? 132 LEU A N   1 
ATOM   1056 C  CA  . LEU A 1 131 ? -25.871 15.885  53.561  1.00 16.65  ? 132 LEU A CA  1 
ATOM   1057 C  C   . LEU A 1 131 ? -25.424 16.407  52.190  1.00 16.78  ? 132 LEU A C   1 
ATOM   1058 O  O   . LEU A 1 131 ? -24.769 15.686  51.439  1.00 16.71  ? 132 LEU A O   1 
ATOM   1059 C  CB  . LEU A 1 131 ? -27.334 15.416  53.531  1.00 16.40  ? 132 LEU A CB  1 
ATOM   1060 C  CG  . LEU A 1 131 ? -27.871 14.629  54.739  1.00 15.30  ? 132 LEU A CG  1 
ATOM   1061 C  CD1 . LEU A 1 131 ? -29.402 14.613  54.720  1.00 12.85  ? 132 LEU A CD1 1 
ATOM   1062 C  CD2 . LEU A 1 131 ? -27.322 13.221  54.785  1.00 12.16  ? 132 LEU A CD2 1 
ATOM   1063 N  N   . ASP A 1 132 ? -25.751 17.668  51.893  1.00 16.67  ? 133 ASP A N   1 
ATOM   1064 C  CA  . ASP A 1 132 ? -25.339 18.318  50.643  1.00 17.02  ? 133 ASP A CA  1 
ATOM   1065 C  C   . ASP A 1 132 ? -23.820 18.312  50.447  1.00 17.09  ? 133 ASP A C   1 
ATOM   1066 O  O   . ASP A 1 132 ? -23.342 18.038  49.352  1.00 17.20  ? 133 ASP A O   1 
ATOM   1067 C  CB  . ASP A 1 132 ? -25.876 19.747  50.585  1.00 17.46  ? 133 ASP A CB  1 
ATOM   1068 C  CG  . ASP A 1 132 ? -25.880 20.322  49.181  1.00 19.16  ? 133 ASP A CG  1 
ATOM   1069 O  OD1 . ASP A 1 132 ? -26.022 21.555  49.062  1.00 22.21  ? 133 ASP A OD1 1 
ATOM   1070 O  OD2 . ASP A 1 132 ? -25.765 19.558  48.196  1.00 20.11  ? 133 ASP A OD2 1 
ATOM   1071 N  N   . ALA A 1 133 ? -23.076 18.604  51.514  1.00 16.76  ? 134 ALA A N   1 
ATOM   1072 C  CA  . ALA A 1 133 ? -21.613 18.508  51.514  1.00 16.67  ? 134 ALA A CA  1 
ATOM   1073 C  C   . ALA A 1 133 ? -21.090 17.137  51.061  1.00 16.30  ? 134 ALA A C   1 
ATOM   1074 O  O   . ALA A 1 133 ? -20.136 17.056  50.283  1.00 16.89  ? 134 ALA A O   1 
ATOM   1075 C  CB  . ALA A 1 133 ? -21.047 18.869  52.907  1.00 16.42  ? 134 ALA A CB  1 
ATOM   1076 N  N   . VAL A 1 134 ? -21.709 16.064  51.543  1.00 15.65  ? 135 VAL A N   1 
ATOM   1077 C  CA  . VAL A 1 134 ? -21.276 14.715  51.167  1.00 14.89  ? 135 VAL A CA  1 
ATOM   1078 C  C   . VAL A 1 134 ? -21.616 14.420  49.696  1.00 14.85  ? 135 VAL A C   1 
ATOM   1079 O  O   . VAL A 1 134 ? -20.788 13.884  48.970  1.00 14.01  ? 135 VAL A O   1 
ATOM   1080 C  CB  . VAL A 1 134 ? -21.844 13.641  52.125  1.00 14.83  ? 135 VAL A CB  1 
ATOM   1081 C  CG1 . VAL A 1 134 ? -21.359 12.253  51.751  1.00 12.79  ? 135 VAL A CG1 1 
ATOM   1082 C  CG2 . VAL A 1 134 ? -21.460 13.972  53.573  1.00 14.43  ? 135 VAL A CG2 1 
ATOM   1083 N  N   . SER A 1 135 ? -22.811 14.815  49.258  1.00 15.50  ? 136 SER A N   1 
ATOM   1084 C  CA  . SER A 1 135 ? -23.232 14.615  47.870  1.00 16.54  ? 136 SER A CA  1 
ATOM   1085 C  C   . SER A 1 135 ? -22.351 15.389  46.887  1.00 17.24  ? 136 SER A C   1 
ATOM   1086 O  O   . SER A 1 135 ? -21.974 14.871  45.824  1.00 16.92  ? 136 SER A O   1 
ATOM   1087 C  CB  . SER A 1 135 ? -24.690 15.022  47.676  1.00 16.67  ? 136 SER A CB  1 
ATOM   1088 O  OG  . SER A 1 135 ? -25.544 14.095  48.286  1.00 16.58  ? 136 SER A OG  1 
ATOM   1089 N  N   . ARG A 1 136 ? -22.022 16.626  47.249  1.00 17.68  ? 137 ARG A N   1 
ATOM   1090 C  CA  . ARG A 1 136 ? -21.139 17.443  46.427  1.00 18.40  ? 137 ARG A CA  1 
ATOM   1091 C  C   . ARG A 1 136 ? -19.768 16.788  46.280  1.00 18.22  ? 137 ARG A C   1 
ATOM   1092 O  O   . ARG A 1 136 ? -19.190 16.803  45.195  1.00 18.24  ? 137 ARG A O   1 
ATOM   1093 C  CB  . ARG A 1 136 ? -21.035 18.856  46.996  1.00 18.67  ? 137 ARG A CB  1 
ATOM   1094 C  CG  . ARG A 1 136 ? -22.339 19.643  46.830  1.00 21.19  ? 137 ARG A CG  1 
ATOM   1095 C  CD  . ARG A 1 136 ? -22.277 20.977  47.540  1.00 26.05  ? 137 ARG A CD  1 
ATOM   1096 N  NE  . ARG A 1 136 ? -21.409 21.906  46.832  1.00 30.97  ? 137 ARG A NE  1 
ATOM   1097 C  CZ  . ARG A 1 136 ? -21.824 22.816  45.952  1.00 33.57  ? 137 ARG A CZ  1 
ATOM   1098 N  NH1 . ARG A 1 136 ? -23.117 22.944  45.664  1.00 34.86  ? 137 ARG A NH1 1 
ATOM   1099 N  NH2 . ARG A 1 136 ? -20.937 23.614  45.367  1.00 34.65  ? 137 ARG A NH2 1 
ATOM   1100 N  N   . ASP A 1 137 ? -19.272 16.193  47.365  1.00 18.04  ? 138 ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 137 ? -18.031 15.414  47.326  1.00 18.39  ? 138 ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 137 ? -18.128 14.173  46.437  1.00 18.28  ? 138 ASP A C   1 
ATOM   1103 O  O   . ASP A 1 137 ? -17.168 13.844  45.741  1.00 18.59  ? 138 ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 137 ? -17.558 15.034  48.741  1.00 18.45  ? 138 ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 137 ? -16.908 16.204  49.475  1.00 20.04  ? 138 ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 137 ? -16.610 17.238  48.830  1.00 18.93  ? 138 ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 137 ? -16.694 16.091  50.701  1.00 22.33  ? 138 ASP A OD2 1 
ATOM   1108 N  N   . PHE A 1 138 ? -19.274 13.493  46.459  1.00 17.97  ? 139 PHE A N   1 
ATOM   1109 C  CA  . PHE A 1 138 ? -19.487 12.338  45.577  1.00 18.20  ? 139 PHE A CA  1 
ATOM   1110 C  C   . PHE A 1 138 ? -19.395 12.742  44.100  1.00 18.31  ? 139 PHE A C   1 
ATOM   1111 O  O   . PHE A 1 138 ? -18.770 12.042  43.303  1.00 18.40  ? 139 PHE A O   1 
ATOM   1112 C  CB  . PHE A 1 138 ? -20.828 11.636  45.863  1.00 17.63  ? 139 PHE A CB  1 
ATOM   1113 C  CG  . PHE A 1 138 ? -20.951 10.287  45.202  1.00 17.75  ? 139 PHE A CG  1 
ATOM   1114 C  CD1 . PHE A 1 138 ? -20.488 9.143   45.837  1.00 17.54  ? 139 PHE A CD1 1 
ATOM   1115 C  CD2 . PHE A 1 138 ? -21.510 10.161  43.931  1.00 17.65  ? 139 PHE A CD2 1 
ATOM   1116 C  CE1 . PHE A 1 138 ? -20.590 7.889   45.223  1.00 17.33  ? 139 PHE A CE1 1 
ATOM   1117 C  CE2 . PHE A 1 138 ? -21.608 8.909   43.307  1.00 16.15  ? 139 PHE A CE2 1 
ATOM   1118 C  CZ  . PHE A 1 138 ? -21.152 7.780   43.952  1.00 16.08  ? 139 PHE A CZ  1 
ATOM   1119 N  N   . VAL A 1 139 ? -20.021 13.864  43.747  1.00 18.47  ? 140 VAL A N   1 
ATOM   1120 C  CA  . VAL A 1 139 ? -19.928 14.417  42.392  1.00 19.04  ? 140 VAL A CA  1 
ATOM   1121 C  C   . VAL A 1 139 ? -18.465 14.676  41.987  1.00 19.35  ? 140 VAL A C   1 
ATOM   1122 O  O   . VAL A 1 139 ? -18.054 14.309  40.884  1.00 19.44  ? 140 VAL A O   1 
ATOM   1123 C  CB  . VAL A 1 139 ? -20.800 15.701  42.229  1.00 19.18  ? 140 VAL A CB  1 
ATOM   1124 C  CG1 . VAL A 1 139 ? -20.408 16.481  40.972  1.00 19.40  ? 140 VAL A CG1 1 
ATOM   1125 C  CG2 . VAL A 1 139 ? -22.287 15.344  42.192  1.00 18.49  ? 140 VAL A CG2 1 
ATOM   1126 N  N   . SER A 1 140 ? -17.691 15.285  42.890  1.00 19.56  ? 141 SER A N   1 
ATOM   1127 C  CA  . SER A 1 140 ? -16.259 15.528  42.676  1.00 20.14  ? 141 SER A CA  1 
ATOM   1128 C  C   . SER A 1 140 ? -15.465 14.248  42.442  1.00 20.12  ? 141 SER A C   1 
ATOM   1129 O  O   . SER A 1 140 ? -14.521 14.251  41.660  1.00 19.97  ? 141 SER A O   1 
ATOM   1130 C  CB  . SER A 1 140 ? -15.639 16.294  43.857  1.00 20.14  ? 141 SER A CB  1 
ATOM   1131 O  OG  . SER A 1 140 ? -16.226 17.586  43.978  1.00 21.57  ? 141 SER A OG  1 
ATOM   1132 N  N   . VAL A 1 141 ? -15.835 13.172  43.137  1.00 20.09  ? 142 VAL A N   1 
ATOM   1133 C  CA  . VAL A 1 141 ? -15.224 11.861  42.910  1.00 20.39  ? 142 VAL A CA  1 
ATOM   1134 C  C   . VAL A 1 141 ? -15.405 11.425  41.448  1.00 20.08  ? 142 VAL A C   1 
ATOM   1135 O  O   . VAL A 1 141 ? -14.435 11.043  40.774  1.00 19.80  ? 142 VAL A O   1 
ATOM   1136 C  CB  . VAL A 1 141 ? -15.789 10.777  43.870  1.00 20.48  ? 142 VAL A CB  1 
ATOM   1137 C  CG1 . VAL A 1 141 ? -15.305 9.393   43.476  1.00 20.48  ? 142 VAL A CG1 1 
ATOM   1138 C  CG2 . VAL A 1 141 ? -15.378 11.087  45.311  1.00 21.58  ? 142 VAL A CG2 1 
ATOM   1139 N  N   . LEU A 1 142 ? -16.640 11.509  40.960  1.00 19.54  ? 143 LEU A N   1 
ATOM   1140 C  CA  . LEU A 1 142 ? -16.938 11.086  39.596  1.00 19.59  ? 143 LEU A CA  1 
ATOM   1141 C  C   . LEU A 1 142 ? -16.239 11.968  38.544  1.00 19.72  ? 143 LEU A C   1 
ATOM   1142 O  O   . LEU A 1 142 ? -15.666 11.441  37.603  1.00 19.57  ? 143 LEU A O   1 
ATOM   1143 C  CB  . LEU A 1 142 ? -18.449 10.994  39.357  1.00 19.26  ? 143 LEU A CB  1 
ATOM   1144 C  CG  . LEU A 1 142 ? -19.269 10.000  40.175  1.00 19.25  ? 143 LEU A CG  1 
ATOM   1145 C  CD1 . LEU A 1 142 ? -20.738 10.114  39.787  1.00 19.79  ? 143 LEU A CD1 1 
ATOM   1146 C  CD2 . LEU A 1 142 ? -18.783 8.568   40.004  1.00 19.03  ? 143 LEU A CD2 1 
ATOM   1147 N  N   . HIS A 1 143 ? -16.253 13.289  38.726  1.00 20.29  ? 144 HIS A N   1 
ATOM   1148 C  CA  . HIS A 1 143 ? -15.548 14.206  37.806  1.00 21.60  ? 144 HIS A CA  1 
ATOM   1149 C  C   . HIS A 1 143 ? -14.064 13.871  37.712  1.00 22.26  ? 144 HIS A C   1 
ATOM   1150 O  O   . HIS A 1 143 ? -13.465 13.949  36.643  1.00 22.62  ? 144 HIS A O   1 
ATOM   1151 C  CB  . HIS A 1 143 ? -15.707 15.685  38.216  1.00 21.39  ? 144 HIS A CB  1 
ATOM   1152 C  CG  . HIS A 1 143 ? -17.008 16.301  37.798  1.00 21.56  ? 144 HIS A CG  1 
ATOM   1153 N  ND1 . HIS A 1 143 ? -17.489 16.232  36.506  1.00 22.22  ? 144 HIS A ND1 1 
ATOM   1154 C  CD2 . HIS A 1 143 ? -17.919 17.017  38.499  1.00 21.26  ? 144 HIS A CD2 1 
ATOM   1155 C  CE1 . HIS A 1 143 ? -18.647 16.866  36.433  1.00 21.69  ? 144 HIS A CE1 1 
ATOM   1156 N  NE2 . HIS A 1 143 ? -18.930 17.352  37.628  1.00 21.79  ? 144 HIS A NE2 1 
ATOM   1157 N  N   . ARG A 1 144 ? -13.488 13.507  38.850  1.00 23.33  ? 145 ARG A N   1 
ATOM   1158 C  CA  . ARG A 1 144 ? -12.099 13.076  38.951  1.00 24.45  ? 145 ARG A CA  1 
ATOM   1159 C  C   . ARG A 1 144 ? -11.860 11.787  38.155  1.00 24.42  ? 145 ARG A C   1 
ATOM   1160 O  O   . ARG A 1 144 ? -10.876 11.671  37.415  1.00 24.76  ? 145 ARG A O   1 
ATOM   1161 C  CB  . ARG A 1 144 ? -11.766 12.872  40.429  1.00 24.89  ? 145 ARG A CB  1 
ATOM   1162 C  CG  . ARG A 1 144 ? -10.315 12.637  40.778  1.00 28.13  ? 145 ARG A CG  1 
ATOM   1163 C  CD  . ARG A 1 144 ? -10.120 12.831  42.292  1.00 33.30  ? 145 ARG A CD  1 
ATOM   1164 N  NE  . ARG A 1 144 ? -10.708 11.754  43.108  1.00 36.34  ? 145 ARG A NE  1 
ATOM   1165 C  CZ  . ARG A 1 144 ? -11.365 11.946  44.256  1.00 38.14  ? 145 ARG A CZ  1 
ATOM   1166 N  NH1 . ARG A 1 144 ? -11.559 13.179  44.726  1.00 38.55  ? 145 ARG A NH1 1 
ATOM   1167 N  NH2 . ARG A 1 144 ? -11.850 10.906  44.932  1.00 38.51  ? 145 ARG A NH2 1 
ATOM   1168 N  N   . ARG A 1 145 ? -12.769 10.825  38.290  1.00 24.02  ? 146 ARG A N   1 
ATOM   1169 C  CA  . ARG A 1 145 ? -12.628 9.566   37.570  1.00 23.98  ? 146 ARG A CA  1 
ATOM   1170 C  C   . ARG A 1 145 ? -12.815 9.751   36.061  1.00 23.88  ? 146 ARG A C   1 
ATOM   1171 O  O   . ARG A 1 145 ? -12.229 9.014   35.271  1.00 23.56  ? 146 ARG A O   1 
ATOM   1172 C  CB  . ARG A 1 145 ? -13.586 8.511   38.117  1.00 23.89  ? 146 ARG A CB  1 
ATOM   1173 C  CG  . ARG A 1 145 ? -13.273 8.111   39.532  1.00 24.14  ? 146 ARG A CG  1 
ATOM   1174 C  CD  . ARG A 1 145 ? -13.997 6.840   39.915  1.00 24.46  ? 146 ARG A CD  1 
ATOM   1175 N  NE  . ARG A 1 145 ? -13.733 6.507   41.310  1.00 25.76  ? 146 ARG A NE  1 
ATOM   1176 C  CZ  . ARG A 1 145 ? -14.494 5.714   42.053  1.00 25.43  ? 146 ARG A CZ  1 
ATOM   1177 N  NH1 . ARG A 1 145 ? -15.576 5.141   41.537  1.00 25.04  ? 146 ARG A NH1 1 
ATOM   1178 N  NH2 . ARG A 1 145 ? -14.171 5.497   43.319  1.00 24.66  ? 146 ARG A NH2 1 
ATOM   1179 N  N   . ILE A 1 146 ? -13.626 10.736  35.679  1.00 24.10  ? 147 ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 146 ? -13.846 11.071  34.271  1.00 24.48  ? 147 ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 146 ? -12.547 11.603  33.630  1.00 24.97  ? 147 ILE A C   1 
ATOM   1182 O  O   . ILE A 1 146 ? -12.121 11.115  32.569  1.00 24.37  ? 147 ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 146 ? -15.045 12.058  34.085  1.00 24.34  ? 147 ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 146 ? -16.372 11.344  34.409  1.00 24.20  ? 147 ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 146 ? -15.066 12.639  32.668  1.00 23.75  ? 147 ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 146 ? -17.595 12.246  34.543  1.00 23.17  ? 147 ILE A CD1 1 
ATOM   1187 N  N   . LYS A 1 147 ? -11.920 12.576  34.295  1.00 25.32  ? 148 LYS A N   1 
ATOM   1188 C  CA  . LYS A 1 147 ? -10.659 13.169  33.838  1.00 26.00  ? 148 LYS A CA  1 
ATOM   1189 C  C   . LYS A 1 147 ? -9.568  12.111  33.717  1.00 26.00  ? 148 LYS A C   1 
ATOM   1190 O  O   . LYS A 1 147 ? -8.836  12.075  32.724  1.00 25.92  ? 148 LYS A O   1 
ATOM   1191 C  CB  . LYS A 1 147 ? -10.205 14.286  34.797  1.00 26.63  ? 148 LYS A CB  1 
ATOM   1192 C  CG  . LYS A 1 147 ? -8.981  15.069  34.326  1.00 28.22  ? 148 LYS A CG  1 
ATOM   1193 C  CD  . LYS A 1 147 ? -8.367  15.906  35.446  1.00 31.78  ? 148 LYS A CD  1 
ATOM   1194 C  CE  . LYS A 1 147 ? -7.194  16.740  34.917  1.00 32.94  ? 148 LYS A CE  1 
ATOM   1195 N  NZ  . LYS A 1 147 ? -6.640  17.676  35.945  1.00 35.03  ? 148 LYS A NZ  1 
ATOM   1196 N  N   . LYS A 1 148 ? -9.468  11.254  34.734  1.00 26.02  ? 149 LYS A N   1 
ATOM   1197 C  CA  . LYS A 1 148 ? -8.483  10.181  34.757  1.00 25.95  ? 149 LYS A CA  1 
ATOM   1198 C  C   . LYS A 1 148 ? -8.670  9.201   33.588  1.00 25.28  ? 149 LYS A C   1 
ATOM   1199 O  O   . LYS A 1 148 ? -7.683  8.763   32.976  1.00 24.93  ? 149 LYS A O   1 
ATOM   1200 C  CB  . LYS A 1 148 ? -8.524  9.443   36.092  1.00 26.47  ? 149 LYS A CB  1 
ATOM   1201 C  CG  . LYS A 1 148 ? -7.496  8.326   36.185  1.00 29.36  ? 149 LYS A CG  1 
ATOM   1202 C  CD  . LYS A 1 148 ? -7.620  7.512   37.457  1.00 33.42  ? 149 LYS A CD  1 
ATOM   1203 C  CE  . LYS A 1 148 ? -6.522  6.451   37.503  1.00 36.22  ? 149 LYS A CE  1 
ATOM   1204 N  NZ  . LYS A 1 148 ? -6.507  5.713   38.804  1.00 38.35  ? 149 LYS A NZ  1 
ATOM   1205 N  N   . ALA A 1 149 ? -9.932  8.887   33.279  1.00 24.45  ? 150 ALA A N   1 
ATOM   1206 C  CA  . ALA A 1 149 ? -10.294 7.990   32.170  1.00 23.97  ? 150 ALA A CA  1 
ATOM   1207 C  C   . ALA A 1 149 ? -9.810  8.499   30.805  1.00 23.92  ? 150 ALA A C   1 
ATOM   1208 O  O   . ALA A 1 149 ? -9.461  7.703   29.931  1.00 23.77  ? 150 ALA A O   1 
ATOM   1209 C  CB  . ALA A 1 149 ? -11.802 7.770   32.135  1.00 23.53  ? 150 ALA A CB  1 
ATOM   1210 N  N   . GLY A 1 150 ? -9.819  9.821   30.631  1.00 23.78  ? 151 GLY A N   1 
ATOM   1211 C  CA  . GLY A 1 150 ? -9.351  10.461  29.403  1.00 23.87  ? 151 GLY A CA  1 
ATOM   1212 C  C   . GLY A 1 150 ? -10.332 10.339  28.254  1.00 23.70  ? 151 GLY A C   1 
ATOM   1213 O  O   . GLY A 1 150 ? -10.051 10.789  27.142  1.00 23.89  ? 151 GLY A O   1 
ATOM   1214 N  N   . SER A 1 151 ? -11.487 9.741   28.529  1.00 23.36  ? 152 SER A N   1 
ATOM   1215 C  CA  . SER A 1 151 ? -12.469 9.417   27.495  1.00 23.00  ? 152 SER A CA  1 
ATOM   1216 C  C   . SER A 1 151 ? -13.652 10.382  27.449  1.00 22.78  ? 152 SER A C   1 
ATOM   1217 O  O   . SER A 1 151 ? -14.534 10.237  26.610  1.00 22.80  ? 152 SER A O   1 
ATOM   1218 C  CB  . SER A 1 151 ? -12.988 7.997   27.720  1.00 22.76  ? 152 SER A CB  1 
ATOM   1219 O  OG  . SER A 1 151 ? -13.508 7.857   29.035  1.00 23.02  ? 152 SER A OG  1 
ATOM   1220 N  N   . GLY A 1 152 ? -13.694 11.345  28.364  1.00 22.58  ? 153 GLY A N   1 
ATOM   1221 C  CA  . GLY A 1 152 ? -14.850 12.239  28.459  1.00 21.95  ? 153 GLY A CA  1 
ATOM   1222 C  C   . GLY A 1 152 ? -16.049 11.590  29.138  1.00 21.59  ? 153 GLY A C   1 
ATOM   1223 O  O   . GLY A 1 152 ? -17.174 12.094  29.049  1.00 21.75  ? 153 GLY A O   1 
ATOM   1224 N  N   . ASN A 1 153 ? -15.815 10.458  29.800  1.00 20.77  ? 154 ASN A N   1 
ATOM   1225 C  CA  . ASN A 1 153 ? -16.848 9.764   30.557  1.00 19.88  ? 154 ASN A CA  1 
ATOM   1226 C  C   . ASN A 1 153 ? -16.224 8.802   31.560  1.00 19.32  ? 154 ASN A C   1 
ATOM   1227 O  O   . ASN A 1 153 ? -15.007 8.658   31.598  1.00 19.07  ? 154 ASN A O   1 
ATOM   1228 C  CB  . ASN A 1 153 ? -17.856 9.059   29.631  1.00 20.03  ? 154 ASN A CB  1 
ATOM   1229 C  CG  . ASN A 1 153 ? -17.249 7.903   28.841  1.00 21.48  ? 154 ASN A CG  1 
ATOM   1230 O  OD1 . ASN A 1 153 ? -16.556 7.043   29.380  1.00 25.25  ? 154 ASN A OD1 1 
ATOM   1231 N  ND2 . ASN A 1 153 ? -17.552 7.859   27.564  1.00 23.28  ? 154 ASN A ND2 1 
ATOM   1232 N  N   . TYR A 1 154 ? -17.052 8.157   32.376  1.00 18.79  ? 155 TYR A N   1 
ATOM   1233 C  CA  . TYR A 1 154 ? -16.565 7.134   33.294  1.00 18.38  ? 155 TYR A CA  1 
ATOM   1234 C  C   . TYR A 1 154 ? -17.552 5.968   33.402  1.00 18.11  ? 155 TYR A C   1 
ATOM   1235 O  O   . TYR A 1 154 ? -18.745 6.168   33.654  1.00 17.92  ? 155 TYR A O   1 
ATOM   1236 C  CB  . TYR A 1 154 ? -16.251 7.729   34.679  1.00 18.62  ? 155 TYR A CB  1 
ATOM   1237 C  CG  . TYR A 1 154 ? -16.053 6.692   35.761  1.00 18.48  ? 155 TYR A CG  1 
ATOM   1238 C  CD1 . TYR A 1 154 ? -14.926 5.870   35.767  1.00 19.60  ? 155 TYR A CD1 1 
ATOM   1239 C  CD2 . TYR A 1 154 ? -17.003 6.526   36.777  1.00 18.98  ? 155 TYR A CD2 1 
ATOM   1240 C  CE1 . TYR A 1 154 ? -14.745 4.901   36.759  1.00 20.85  ? 155 TYR A CE1 1 
ATOM   1241 C  CE2 . TYR A 1 154 ? -16.835 5.566   37.775  1.00 19.52  ? 155 TYR A CE2 1 
ATOM   1242 C  CZ  . TYR A 1 154 ? -15.707 4.759   37.759  1.00 21.10  ? 155 TYR A CZ  1 
ATOM   1243 O  OH  . TYR A 1 154 ? -15.534 3.805   38.740  1.00 24.83  ? 155 TYR A OH  1 
ATOM   1244 N  N   . SER A 1 155 ? -17.035 4.759   33.198  1.00 17.18  ? 156 SER A N   1 
ATOM   1245 C  CA  . SER A 1 155 ? -17.818 3.544   33.308  1.00 16.60  ? 156 SER A CA  1 
ATOM   1246 C  C   . SER A 1 155 ? -17.324 2.718   34.474  1.00 16.73  ? 156 SER A C   1 
ATOM   1247 O  O   . SER A 1 155 ? -16.119 2.492   34.615  1.00 16.21  ? 156 SER A O   1 
ATOM   1248 C  CB  . SER A 1 155 ? -17.720 2.718   32.023  1.00 16.21  ? 156 SER A CB  1 
ATOM   1249 O  OG  . SER A 1 155 ? -18.398 3.368   30.974  1.00 15.91  ? 156 SER A OG  1 
ATOM   1250 N  N   . GLY A 1 156 ? -18.260 2.266   35.309  1.00 16.77  ? 157 GLY A N   1 
ATOM   1251 C  CA  . GLY A 1 156 ? -17.916 1.445   36.453  1.00 16.53  ? 157 GLY A CA  1 
ATOM   1252 C  C   . GLY A 1 156 ? -19.088 1.016   37.306  1.00 16.41  ? 157 GLY A C   1 
ATOM   1253 O  O   . GLY A 1 156 ? -20.156 1.638   37.297  1.00 16.13  ? 157 GLY A O   1 
ATOM   1254 N  N   . ASP A 1 157 ? -18.871 -0.083  38.018  1.00 16.24  ? 158 ASP A N   1 
ATOM   1255 C  CA  . ASP A 1 157 ? -19.719 -0.532  39.108  1.00 16.50  ? 158 ASP A CA  1 
ATOM   1256 C  C   . ASP A 1 157 ? -19.350 0.353   40.297  1.00 16.40  ? 158 ASP A C   1 
ATOM   1257 O  O   . ASP A 1 157 ? -18.221 0.288   40.789  1.00 16.44  ? 158 ASP A O   1 
ATOM   1258 C  CB  . ASP A 1 157 ? -19.393 -2.001  39.397  1.00 16.65  ? 158 ASP A CB  1 
ATOM   1259 C  CG  . ASP A 1 157 ? -20.128 -2.562  40.604  1.00 17.81  ? 158 ASP A CG  1 
ATOM   1260 O  OD1 . ASP A 1 157 ? -20.789 -1.808  41.351  1.00 16.83  ? 158 ASP A OD1 1 
ATOM   1261 O  OD2 . ASP A 1 157 ? -20.022 -3.797  40.801  1.00 20.46  ? 158 ASP A OD2 1 
ATOM   1262 N  N   . ILE A 1 158 ? -20.291 1.179   40.745  1.00 16.37  ? 159 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 158 ? -20.040 2.118   41.843  1.00 16.44  ? 159 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 158 ? -20.733 1.737   43.155  1.00 16.39  ? 159 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 158 ? -20.925 2.597   44.036  1.00 16.20  ? 159 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 158 ? -20.456 3.572   41.461  1.00 16.69  ? 159 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 158 ? -21.949 3.628   41.098  1.00 16.68  ? 159 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 158 ? -19.542 4.118   40.353  1.00 16.77  ? 159 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 158 ? -22.580 4.986   41.244  1.00 16.66  ? 159 ILE A CD1 1 
ATOM   1270 N  N   . SER A 1 159 ? -21.115 0.463   43.288  1.00 16.22  ? 160 SER A N   1 
ATOM   1271 C  CA  . SER A 1 159 ? -21.789 -0.005  44.502  1.00 16.37  ? 160 SER A CA  1 
ATOM   1272 C  C   . SER A 1 159 ? -20.950 0.261   45.758  1.00 16.15  ? 160 SER A C   1 
ATOM   1273 O  O   . SER A 1 159 ? -21.471 0.763   46.744  1.00 16.06  ? 160 SER A O   1 
ATOM   1274 C  CB  . SER A 1 159 ? -22.180 -1.489  44.414  1.00 15.97  ? 160 SER A CB  1 
ATOM   1275 O  OG  . SER A 1 159 ? -21.084 -2.288  44.003  1.00 16.73  ? 160 SER A OG  1 
ATOM   1276 N  N   . ASP A 1 160 ? -19.658 -0.052  45.712  1.00 16.51  ? 161 ASP A N   1 
ATOM   1277 C  CA  . ASP A 1 160 ? -18.767 0.207   46.854  1.00 17.12  ? 161 ASP A CA  1 
ATOM   1278 C  C   . ASP A 1 160 ? -18.711 1.683   47.217  1.00 16.66  ? 161 ASP A C   1 
ATOM   1279 O  O   . ASP A 1 160 ? -18.692 2.037   48.394  1.00 16.74  ? 161 ASP A O   1 
ATOM   1280 C  CB  . ASP A 1 160 ? -17.355 -0.318  46.590  1.00 17.61  ? 161 ASP A CB  1 
ATOM   1281 C  CG  . ASP A 1 160 ? -17.293 -1.842  46.531  1.00 20.14  ? 161 ASP A CG  1 
ATOM   1282 O  OD1 . ASP A 1 160 ? -18.258 -2.516  46.952  1.00 22.12  ? 161 ASP A OD1 1 
ATOM   1283 O  OD2 . ASP A 1 160 ? -16.266 -2.371  46.059  1.00 23.95  ? 161 ASP A OD2 1 
ATOM   1284 N  N   . ASP A 1 161 ? -18.695 2.535   46.195  1.00 16.31  ? 162 ASP A N   1 
ATOM   1285 C  CA  . ASP A 1 161 ? -18.706 3.973   46.386  1.00 16.24  ? 162 ASP A CA  1 
ATOM   1286 C  C   . ASP A 1 161 ? -20.017 4.445   46.985  1.00 15.48  ? 162 ASP A C   1 
ATOM   1287 O  O   . ASP A 1 161 ? -20.016 5.355   47.795  1.00 15.18  ? 162 ASP A O   1 
ATOM   1288 C  CB  . ASP A 1 161 ? -18.419 4.690   45.069  1.00 16.64  ? 162 ASP A CB  1 
ATOM   1289 C  CG  . ASP A 1 161 ? -17.135 4.216   44.427  1.00 18.53  ? 162 ASP A CG  1 
ATOM   1290 O  OD1 . ASP A 1 161 ? -16.049 4.430   45.014  1.00 20.32  ? 162 ASP A OD1 1 
ATOM   1291 O  OD2 . ASP A 1 161 ? -17.214 3.614   43.339  1.00 21.30  ? 162 ASP A OD2 1 
ATOM   1292 N  N   . LEU A 1 162 ? -21.124 3.809   46.598  1.00 15.24  ? 163 LEU A N   1 
ATOM   1293 C  CA  . LEU A 1 162 ? -22.433 4.137   47.154  1.00 15.07  ? 163 LEU A CA  1 
ATOM   1294 C  C   . LEU A 1 162 ? -22.512 3.766   48.634  1.00 15.33  ? 163 LEU A C   1 
ATOM   1295 O  O   . LEU A 1 162 ? -23.070 4.530   49.433  1.00 14.95  ? 163 LEU A O   1 
ATOM   1296 C  CB  . LEU A 1 162 ? -23.569 3.487   46.346  1.00 14.80  ? 163 LEU A CB  1 
ATOM   1297 C  CG  . LEU A 1 162 ? -23.755 4.085   44.939  1.00 14.66  ? 163 LEU A CG  1 
ATOM   1298 C  CD1 . LEU A 1 162 ? -24.691 3.243   44.110  1.00 14.14  ? 163 LEU A CD1 1 
ATOM   1299 C  CD2 . LEU A 1 162 ? -24.268 5.523   45.013  1.00 13.84  ? 163 LEU A CD2 1 
ATOM   1300 N  N   . PHE A 1 163 ? -21.935 2.617   48.999  1.00 15.00  ? 164 PHE A N   1 
ATOM   1301 C  CA  . PHE A 1 163 ? -21.839 2.222   50.414  1.00 15.64  ? 164 PHE A CA  1 
ATOM   1302 C  C   . PHE A 1 163 ? -21.031 3.231   51.233  1.00 14.91  ? 164 PHE A C   1 
ATOM   1303 O  O   . PHE A 1 163 ? -21.435 3.617   52.335  1.00 14.61  ? 164 PHE A O   1 
ATOM   1304 C  CB  . PHE A 1 163 ? -21.232 0.819   50.579  1.00 15.95  ? 164 PHE A CB  1 
ATOM   1305 C  CG  . PHE A 1 163 ? -22.163 -0.296  50.203  1.00 18.29  ? 164 PHE A CG  1 
ATOM   1306 C  CD1 . PHE A 1 163 ? -21.908 -1.087  49.087  1.00 21.55  ? 164 PHE A CD1 1 
ATOM   1307 C  CD2 . PHE A 1 163 ? -23.290 -0.564  50.960  1.00 21.20  ? 164 PHE A CD2 1 
ATOM   1308 C  CE1 . PHE A 1 163 ? -22.768 -2.128  48.728  1.00 21.87  ? 164 PHE A CE1 1 
ATOM   1309 C  CE2 . PHE A 1 163 ? -24.161 -1.610  50.606  1.00 22.38  ? 164 PHE A CE2 1 
ATOM   1310 C  CZ  . PHE A 1 163 ? -23.899 -2.381  49.497  1.00 21.92  ? 164 PHE A CZ  1 
ATOM   1311 N  N   . ARG A 1 164 ? -19.895 3.655   50.684  1.00 14.50  ? 165 ARG A N   1 
ATOM   1312 C  CA  . ARG A 1 164 ? -19.071 4.682   51.322  1.00 14.26  ? 165 ARG A CA  1 
ATOM   1313 C  C   . ARG A 1 164 ? -19.831 6.006   51.398  1.00 14.34  ? 165 ARG A C   1 
ATOM   1314 O  O   . ARG A 1 164 ? -19.777 6.699   52.421  1.00 14.59  ? 165 ARG A O   1 
ATOM   1315 C  CB  . ARG A 1 164 ? -17.728 4.839   50.603  1.00 14.04  ? 165 ARG A CB  1 
ATOM   1316 C  CG  . ARG A 1 164 ? -16.718 3.746   50.964  1.00 14.08  ? 165 ARG A CG  1 
ATOM   1317 C  CD  . ARG A 1 164 ? -15.350 3.957   50.299  1.00 14.39  ? 165 ARG A CD  1 
ATOM   1318 N  NE  . ARG A 1 164 ? -15.380 3.733   48.843  1.00 14.60  ? 165 ARG A NE  1 
ATOM   1319 C  CZ  . ARG A 1 164 ? -15.088 2.578   48.248  1.00 13.93  ? 165 ARG A CZ  1 
ATOM   1320 N  NH1 . ARG A 1 164 ? -14.743 1.516   48.969  1.00 13.24  ? 165 ARG A NH1 1 
ATOM   1321 N  NH2 . ARG A 1 164 ? -15.145 2.479   46.924  1.00 13.06  ? 165 ARG A NH2 1 
ATOM   1322 N  N   . PHE A 1 165 ? -20.576 6.337   50.340  1.00 13.85  ? 166 PHE A N   1 
ATOM   1323 C  CA  . PHE A 1 165 ? -21.397 7.550   50.361  1.00 13.42  ? 166 PHE A CA  1 
ATOM   1324 C  C   . PHE A 1 165 ? -22.445 7.511   51.472  1.00 13.39  ? 166 PHE A C   1 
ATOM   1325 O  O   . PHE A 1 165 ? -22.639 8.498   52.194  1.00 13.58  ? 166 PHE A O   1 
ATOM   1326 C  CB  . PHE A 1 165 ? -22.096 7.797   49.018  1.00 13.34  ? 166 PHE A CB  1 
ATOM   1327 C  CG  . PHE A 1 165 ? -23.195 8.804   49.117  1.00 12.96  ? 166 PHE A CG  1 
ATOM   1328 C  CD1 . PHE A 1 165 ? -22.900 10.171  49.147  1.00 12.91  ? 166 PHE A CD1 1 
ATOM   1329 C  CD2 . PHE A 1 165 ? -24.525 8.393   49.266  1.00 11.96  ? 166 PHE A CD2 1 
ATOM   1330 C  CE1 . PHE A 1 165 ? -23.918 11.121  49.285  1.00 13.45  ? 166 PHE A CE1 1 
ATOM   1331 C  CE2 . PHE A 1 165 ? -25.547 9.330   49.409  1.00 11.07  ? 166 PHE A CE2 1 
ATOM   1332 C  CZ  . PHE A 1 165 ? -25.248 10.697  49.425  1.00 12.80  ? 166 PHE A CZ  1 
ATOM   1333 N  N   . ALA A 1 166 ? -23.142 6.384   51.591  1.00 12.94  ? 167 ALA A N   1 
ATOM   1334 C  CA  . ALA A 1 166 ? -24.176 6.239   52.609  1.00 13.11  ? 167 ALA A CA  1 
ATOM   1335 C  C   . ALA A 1 166 ? -23.597 6.315   54.023  1.00 13.13  ? 167 ALA A C   1 
ATOM   1336 O  O   . ALA A 1 166 ? -24.191 6.918   54.922  1.00 13.44  ? 167 ALA A O   1 
ATOM   1337 C  CB  . ALA A 1 166 ? -24.965 4.951   52.398  1.00 12.85  ? 167 ALA A CB  1 
ATOM   1338 N  N   . PHE A 1 167 ? -22.422 5.730   54.205  1.00 13.67  ? 168 PHE A N   1 
ATOM   1339 C  CA  . PHE A 1 167 ? -21.704 5.800   55.475  1.00 14.14  ? 168 PHE A CA  1 
ATOM   1340 C  C   . PHE A 1 167 ? -21.284 7.230   55.844  1.00 14.67  ? 168 PHE A C   1 
ATOM   1341 O  O   . PHE A 1 167 ? -21.521 7.663   56.981  1.00 14.35  ? 168 PHE A O   1 
ATOM   1342 C  CB  . PHE A 1 167 ? -20.500 4.861   55.454  1.00 14.19  ? 168 PHE A CB  1 
ATOM   1343 C  CG  . PHE A 1 167 ? -19.653 4.914   56.708  1.00 15.40  ? 168 PHE A CG  1 
ATOM   1344 C  CD1 . PHE A 1 167 ? -19.967 4.135   57.806  1.00 14.98  ? 168 PHE A CD1 1 
ATOM   1345 C  CD2 . PHE A 1 167 ? -18.533 5.734   56.770  1.00 15.08  ? 168 PHE A CD2 1 
ATOM   1346 C  CE1 . PHE A 1 167 ? -19.177 4.174   58.957  1.00 18.01  ? 168 PHE A CE1 1 
ATOM   1347 C  CE2 . PHE A 1 167 ? -17.738 5.780   57.914  1.00 17.03  ? 168 PHE A CE2 1 
ATOM   1348 C  CZ  . PHE A 1 167 ? -18.055 4.998   59.009  1.00 15.99  ? 168 PHE A CZ  1 
ATOM   1349 N  N   . GLU A 1 168 ? -20.677 7.956   54.897  1.00 14.89  ? 169 GLU A N   1 
ATOM   1350 C  CA  . GLU A 1 168 ? -20.298 9.346   55.130  1.00 15.74  ? 169 GLU A CA  1 
ATOM   1351 C  C   . GLU A 1 168 ? -21.497 10.171  55.525  1.00 15.11  ? 169 GLU A C   1 
ATOM   1352 O  O   . GLU A 1 168 ? -21.392 11.029  56.397  1.00 15.06  ? 169 GLU A O   1 
ATOM   1353 C  CB  . GLU A 1 168 ? -19.702 10.016  53.884  1.00 16.06  ? 169 GLU A CB  1 
ATOM   1354 C  CG  . GLU A 1 168 ? -18.258 9.773   53.640  1.00 19.77  ? 169 GLU A CG  1 
ATOM   1355 C  CD  . GLU A 1 168 ? -17.331 10.358  54.688  1.00 20.25  ? 169 GLU A CD  1 
ATOM   1356 O  OE1 . GLU A 1 168 ? -17.194 11.596  54.831  1.00 21.26  ? 169 GLU A OE1 1 
ATOM   1357 O  OE2 . GLU A 1 168 ? -16.674 9.540   55.331  1.00 21.52  ? 169 GLU A OE2 1 
ATOM   1358 N  N   . SER A 1 169 ? -22.621 9.928   54.851  1.00 14.92  ? 170 SER A N   1 
ATOM   1359 C  CA  . SER A 1 169 ? -23.834 10.694  55.083  1.00 14.93  ? 170 SER A CA  1 
ATOM   1360 C  C   . SER A 1 169 ? -24.383 10.462  56.487  1.00 15.35  ? 170 SER A C   1 
ATOM   1361 O  O   . SER A 1 169 ? -24.602 11.418  57.231  1.00 15.69  ? 170 SER A O   1 
ATOM   1362 C  CB  . SER A 1 169 ? -24.885 10.413  54.006  1.00 14.94  ? 170 SER A CB  1 
ATOM   1363 O  OG  . SER A 1 169 ? -24.377 10.689  52.704  1.00 14.42  ? 170 SER A OG  1 
ATOM   1364 N  N   . ILE A 1 170 ? -24.571 9.198   56.864  1.00 15.57  ? 171 ILE A N   1 
ATOM   1365 C  CA  . ILE A 1 170 ? -25.136 8.879   58.170  1.00 15.38  ? 171 ILE A CA  1 
ATOM   1366 C  C   . ILE A 1 170 ? -24.220 9.311   59.330  1.00 15.86  ? 171 ILE A C   1 
ATOM   1367 O  O   . ILE A 1 170 ? -24.709 9.802   60.344  1.00 15.76  ? 171 ILE A O   1 
ATOM   1368 C  CB  . ILE A 1 170 ? -25.581 7.384   58.277  1.00 15.31  ? 171 ILE A CB  1 
ATOM   1369 C  CG1 . ILE A 1 170 ? -26.406 7.128   59.550  1.00 15.21  ? 171 ILE A CG1 1 
ATOM   1370 C  CG2 . ILE A 1 170 ? -24.383 6.430   58.197  1.00 14.90  ? 171 ILE A CG2 1 
ATOM   1371 C  CD1 . ILE A 1 170 ? -27.602 8.076   59.768  1.00 12.43  ? 171 ILE A CD1 1 
ATOM   1372 N  N   . THR A 1 171 ? -22.905 9.158   59.163  1.00 16.17  ? 172 THR A N   1 
ATOM   1373 C  CA  . THR A 1 171 ? -21.946 9.580   60.184  1.00 16.53  ? 172 THR A CA  1 
ATOM   1374 C  C   . THR A 1 171 ? -21.887 11.108  60.275  1.00 16.51  ? 172 THR A C   1 
ATOM   1375 O  O   . THR A 1 171 ? -21.743 11.664  61.359  1.00 16.33  ? 172 THR A O   1 
ATOM   1376 C  CB  . THR A 1 171 ? -20.506 9.008   59.951  1.00 16.52  ? 172 THR A CB  1 
ATOM   1377 O  OG1 . THR A 1 171 ? -20.088 9.253   58.602  1.00 16.70  ? 172 THR A OG1 1 
ATOM   1378 C  CG2 . THR A 1 171 ? -20.454 7.517   60.208  1.00 16.05  ? 172 THR A CG2 1 
ATOM   1379 N  N   . ASN A 1 172 ? -22.009 11.784  59.138  1.00 16.85  ? 173 ASN A N   1 
ATOM   1380 C  CA  . ASN A 1 172 ? -21.975 13.241  59.145  1.00 16.82  ? 173 ASN A CA  1 
ATOM   1381 C  C   . ASN A 1 172 ? -23.123 13.833  59.940  1.00 17.02  ? 173 ASN A C   1 
ATOM   1382 O  O   . ASN A 1 172 ? -22.906 14.770  60.717  1.00 17.07  ? 173 ASN A O   1 
ATOM   1383 C  CB  . ASN A 1 172 ? -21.904 13.847  57.734  1.00 16.61  ? 173 ASN A CB  1 
ATOM   1384 C  CG  . ASN A 1 172 ? -21.150 15.194  57.704  1.00 16.64  ? 173 ASN A CG  1 
ATOM   1385 O  OD1 . ASN A 1 172 ? -20.391 15.524  58.623  1.00 15.66  ? 173 ASN A OD1 1 
ATOM   1386 N  ND2 . ASN A 1 172 ? -21.357 15.967  56.639  1.00 14.80  ? 173 ASN A ND2 1 
ATOM   1387 N  N   . VAL A 1 173 ? -24.332 13.288  59.780  1.00 16.85  ? 174 VAL A N   1 
ATOM   1388 C  CA  . VAL A 1 173 ? -25.474 13.834  60.521  1.00 16.88  ? 174 VAL A CA  1 
ATOM   1389 C  C   . VAL A 1 173 ? -25.479 13.394  61.994  1.00 17.24  ? 174 VAL A C   1 
ATOM   1390 O  O   . VAL A 1 173 ? -25.953 14.135  62.860  1.00 17.24  ? 174 VAL A O   1 
ATOM   1391 C  CB  . VAL A 1 173 ? -26.862 13.571  59.848  1.00 16.93  ? 174 VAL A CB  1 
ATOM   1392 C  CG1 . VAL A 1 173 ? -26.927 14.236  58.487  1.00 16.55  ? 174 VAL A CG1 1 
ATOM   1393 C  CG2 . VAL A 1 173 ? -27.172 12.071  59.752  1.00 17.20  ? 174 VAL A CG2 1 
ATOM   1394 N  N   . ILE A 1 174 ? -24.942 12.207  62.275  1.00 16.90  ? 175 ILE A N   1 
ATOM   1395 C  CA  . ILE A 1 174 ? -24.868 11.731  63.649  1.00 17.21  ? 175 ILE A CA  1 
ATOM   1396 C  C   . ILE A 1 174 ? -23.747 12.444  64.413  1.00 17.75  ? 175 ILE A C   1 
ATOM   1397 O  O   . ILE A 1 174 ? -23.988 12.997  65.485  1.00 17.67  ? 175 ILE A O   1 
ATOM   1398 C  CB  . ILE A 1 174 ? -24.719 10.182  63.738  1.00 17.21  ? 175 ILE A CB  1 
ATOM   1399 C  CG1 . ILE A 1 174 ? -26.033 9.495   63.340  1.00 16.81  ? 175 ILE A CG1 1 
ATOM   1400 C  CG2 . ILE A 1 174 ? -24.293 9.743   65.149  1.00 16.35  ? 175 ILE A CG2 1 
ATOM   1401 C  CD1 . ILE A 1 174 ? -25.951 7.990   63.281  1.00 17.26  ? 175 ILE A CD1 1 
ATOM   1402 N  N   . PHE A 1 175 ? -22.546 12.457  63.837  1.00 18.07  ? 176 PHE A N   1 
ATOM   1403 C  CA  . PHE A 1 175 ? -21.368 12.988  64.514  1.00 18.55  ? 176 PHE A CA  1 
ATOM   1404 C  C   . PHE A 1 175 ? -21.007 14.440  64.176  1.00 19.08  ? 176 PHE A C   1 
ATOM   1405 O  O   . PHE A 1 175 ? -20.221 15.059  64.888  1.00 18.90  ? 176 PHE A O   1 
ATOM   1406 C  CB  . PHE A 1 175 ? -20.170 12.059  64.279  1.00 18.24  ? 176 PHE A CB  1 
ATOM   1407 C  CG  . PHE A 1 175 ? -20.378 10.670  64.819  1.00 18.93  ? 176 PHE A CG  1 
ATOM   1408 C  CD1 . PHE A 1 175 ? -20.600 9.601   63.962  1.00 18.73  ? 176 PHE A CD1 1 
ATOM   1409 C  CD2 . PHE A 1 175 ? -20.381 10.437  66.191  1.00 19.56  ? 176 PHE A CD2 1 
ATOM   1410 C  CE1 . PHE A 1 175 ? -20.805 8.312   64.463  1.00 20.05  ? 176 PHE A CE1 1 
ATOM   1411 C  CE2 . PHE A 1 175 ? -20.588 9.156   66.703  1.00 20.52  ? 176 PHE A CE2 1 
ATOM   1412 C  CZ  . PHE A 1 175 ? -20.804 8.091   65.834  1.00 20.96  ? 176 PHE A CZ  1 
ATOM   1413 N  N   . GLY A 1 176 ? -21.578 14.985  63.104  1.00 19.40  ? 177 GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 176 ? -21.184 16.309  62.623  1.00 20.24  ? 177 GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 176 ? -19.725 16.357  62.201  1.00 20.98  ? 177 GLY A C   1 
ATOM   1416 O  O   . GLY A 1 176 ? -19.106 17.419  62.243  1.00 21.34  ? 177 GLY A O   1 
ATOM   1417 N  N   . GLU A 1 177 ? -19.174 15.205  61.816  1.00 21.28  ? 178 GLU A N   1 
ATOM   1418 C  CA  . GLU A 1 177 ? -17.779 15.101  61.389  1.00 22.23  ? 178 GLU A CA  1 
ATOM   1419 C  C   . GLU A 1 177 ? -17.649 14.205  60.167  1.00 21.63  ? 178 GLU A C   1 
ATOM   1420 O  O   . GLU A 1 177 ? -18.283 13.154  60.088  1.00 21.29  ? 178 GLU A O   1 
ATOM   1421 C  CB  . GLU A 1 177 ? -16.892 14.516  62.489  1.00 22.70  ? 178 GLU A CB  1 
ATOM   1422 C  CG  . GLU A 1 177 ? -16.856 15.312  63.771  1.00 27.44  ? 178 GLU A CG  1 
ATOM   1423 C  CD  . GLU A 1 177 ? -16.207 14.552  64.915  1.00 32.24  ? 178 GLU A CD  1 
ATOM   1424 O  OE1 . GLU A 1 177 ? -15.474 13.563  64.663  1.00 35.21  ? 178 GLU A OE1 1 
ATOM   1425 O  OE2 . GLU A 1 177 ? -16.428 14.955  66.073  1.00 34.77  ? 178 GLU A OE2 1 
ATOM   1426 N  N   . ARG A 1 178 ? -16.797 14.632  59.239  1.00 21.18  ? 179 ARG A N   1 
ATOM   1427 C  CA  . ARG A 1 178 ? -16.497 13.889  58.033  1.00 20.76  ? 179 ARG A CA  1 
ATOM   1428 C  C   . ARG A 1 178 ? -15.531 12.750  58.327  1.00 21.19  ? 179 ARG A C   1 
ATOM   1429 O  O   . ARG A 1 178 ? -14.479 12.959  58.934  1.00 21.82  ? 179 ARG A O   1 
ATOM   1430 C  CB  . ARG A 1 178 ? -15.929 14.836  56.961  1.00 20.07  ? 179 ARG A CB  1 
ATOM   1431 C  CG  . ARG A 1 178 ? -16.955 15.884  56.465  1.00 18.20  ? 179 ARG A CG  1 
ATOM   1432 C  CD  . ARG A 1 178 ? -18.155 15.220  55.758  1.00 15.76  ? 179 ARG A CD  1 
ATOM   1433 N  NE  . ARG A 1 178 ? -17.749 14.463  54.573  1.00 13.32  ? 179 ARG A NE  1 
ATOM   1434 C  CZ  . ARG A 1 178 ? -17.665 14.984  53.349  1.00 14.56  ? 179 ARG A CZ  1 
ATOM   1435 N  NH1 . ARG A 1 178 ? -17.961 16.268  53.140  1.00 14.07  ? 179 ARG A NH1 1 
ATOM   1436 N  NH2 . ARG A 1 178 ? -17.269 14.231  52.332  1.00 13.73  ? 179 ARG A NH2 1 
ATOM   1437 N  N   . GLN A 1 179 ? -15.888 11.545  57.894  1.00 21.30  ? 180 GLN A N   1 
ATOM   1438 C  CA  . GLN A 1 179 ? -15.029 10.384  58.097  1.00 21.42  ? 180 GLN A CA  1 
ATOM   1439 C  C   . GLN A 1 179 ? -14.009 10.219  56.970  1.00 21.21  ? 180 GLN A C   1 
ATOM   1440 O  O   . GLN A 1 179 ? -13.077 9.422   57.081  1.00 21.09  ? 180 GLN A O   1 
ATOM   1441 C  CB  . GLN A 1 179 ? -15.871 9.118   58.281  1.00 21.96  ? 180 GLN A CB  1 
ATOM   1442 C  CG  . GLN A 1 179 ? -16.980 9.246   59.332  1.00 22.98  ? 180 GLN A CG  1 
ATOM   1443 C  CD  . GLN A 1 179 ? -16.458 9.516   60.738  1.00 26.70  ? 180 GLN A CD  1 
ATOM   1444 O  OE1 . GLN A 1 179 ? -15.555 8.831   61.220  1.00 26.75  ? 180 GLN A OE1 1 
ATOM   1445 N  NE2 . GLN A 1 179 ? -17.036 10.525  61.407  1.00 27.49  ? 180 GLN A NE2 1 
ATOM   1446 N  N   . GLY A 1 180 ? -14.180 10.989  55.896  1.00 21.00  ? 181 GLY A N   1 
ATOM   1447 C  CA  . GLY A 1 180 ? -13.247 10.978  54.764  1.00 20.97  ? 181 GLY A CA  1 
ATOM   1448 C  C   . GLY A 1 180 ? -13.315 9.755   53.858  1.00 21.12  ? 181 GLY A C   1 
ATOM   1449 O  O   . GLY A 1 180 ? -12.329 9.415   53.189  1.00 20.64  ? 181 GLY A O   1 
ATOM   1450 N  N   . MET A 1 181 ? -14.474 9.099   53.807  1.00 21.26  ? 182 MET A N   1 
ATOM   1451 C  CA  . MET A 1 181 ? -14.628 7.896   52.976  1.00 21.46  ? 182 MET A CA  1 
ATOM   1452 C  C   . MET A 1 181 ? -14.763 8.198   51.481  1.00 21.89  ? 182 MET A C   1 
ATOM   1453 O  O   . MET A 1 181 ? -14.735 7.285   50.656  1.00 22.09  ? 182 MET A O   1 
ATOM   1454 C  CB  . MET A 1 181 ? -15.796 7.026   53.467  1.00 21.68  ? 182 MET A CB  1 
ATOM   1455 C  CG  . MET A 1 181 ? -15.682 6.574   54.916  1.00 21.34  ? 182 MET A CG  1 
ATOM   1456 S  SD  . MET A 1 181 ? -14.098 5.783   55.243  1.00 24.51  ? 182 MET A SD  1 
ATOM   1457 C  CE  . MET A 1 181 ? -14.454 4.130   54.603  1.00 21.13  ? 182 MET A CE  1 
ATOM   1458 N  N   . LEU A 1 182 ? -14.911 9.472   51.124  1.00 22.68  ? 183 LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 182 ? -14.957 9.854   49.707  1.00 23.74  ? 183 LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 182 ? -13.601 10.330  49.164  1.00 24.99  ? 183 LEU A C   1 
ATOM   1461 O  O   . LEU A 1 182 ? -13.470 10.638  47.977  1.00 24.63  ? 183 LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 182 ? -16.101 10.832  49.410  1.00 23.27  ? 183 LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 182 ? -17.521 10.275  49.609  1.00 22.24  ? 183 LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 182 ? -18.578 11.288  49.171  1.00 21.25  ? 183 LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 182 ? -17.729 8.932   48.900  1.00 19.99  ? 183 LEU A CD2 1 
ATOM   1466 N  N   . GLU A 1 183 ? -12.598 10.361  50.041  1.00 26.67  ? 184 GLU A N   1 
ATOM   1467 C  CA  . GLU A 1 183 ? -11.209 10.623  49.651  1.00 28.82  ? 184 GLU A CA  1 
ATOM   1468 C  C   . GLU A 1 183 ? -10.581 9.484   48.843  1.00 29.40  ? 184 GLU A C   1 
ATOM   1469 O  O   . GLU A 1 183 ? -11.063 8.349   48.866  1.00 29.24  ? 184 GLU A O   1 
ATOM   1470 C  CB  . GLU A 1 183 ? -10.359 10.862  50.894  1.00 29.22  ? 184 GLU A CB  1 
ATOM   1471 C  CG  . GLU A 1 183 ? -9.831  12.260  51.019  1.00 32.84  ? 184 GLU A CG  1 
ATOM   1472 C  CD  . GLU A 1 183 ? -10.861 13.242  51.498  1.00 36.65  ? 184 GLU A CD  1 
ATOM   1473 O  OE1 . GLU A 1 183 ? -11.246 13.160  52.688  1.00 38.96  ? 184 GLU A OE1 1 
ATOM   1474 O  OE2 . GLU A 1 183 ? -11.260 14.113  50.694  1.00 38.13  ? 184 GLU A OE2 1 
ATOM   1475 N  N   . GLU A 1 184 ? -9.488  9.796   48.148  1.00 30.70  ? 185 GLU A N   1 
ATOM   1476 C  CA  . GLU A 1 184 ? -8.724  8.796   47.402  1.00 31.89  ? 185 GLU A CA  1 
ATOM   1477 C  C   . GLU A 1 184 ? -8.135  7.726   48.312  1.00 32.14  ? 185 GLU A C   1 
ATOM   1478 O  O   . GLU A 1 184 ? -8.167  6.540   47.975  1.00 32.43  ? 185 GLU A O   1 
ATOM   1479 C  CB  . GLU A 1 184 ? -7.617  9.457   46.579  1.00 32.25  ? 185 GLU A CB  1 
ATOM   1480 C  CG  . GLU A 1 184 ? -8.071  9.913   45.204  1.00 35.14  ? 185 GLU A CG  1 
ATOM   1481 C  CD  . GLU A 1 184 ? -6.909  10.356  44.323  1.00 39.44  ? 185 GLU A CD  1 
ATOM   1482 O  OE1 . GLU A 1 184 ? -6.465  11.527  44.453  1.00 41.35  ? 185 GLU A OE1 1 
ATOM   1483 O  OE2 . GLU A 1 184 ? -6.445  9.532   43.500  1.00 40.21  ? 185 GLU A OE2 1 
ATOM   1484 N  N   . VAL A 1 185 ? -7.600  8.149   49.458  1.00 32.37  ? 186 VAL A N   1 
ATOM   1485 C  CA  . VAL A 1 185 ? -7.052  7.227   50.455  1.00 32.69  ? 186 VAL A CA  1 
ATOM   1486 C  C   . VAL A 1 185 ? -8.033  7.148   51.617  1.00 32.62  ? 186 VAL A C   1 
ATOM   1487 O  O   . VAL A 1 185 ? -8.311  8.147   52.283  1.00 32.87  ? 186 VAL A O   1 
ATOM   1488 C  CB  . VAL A 1 185 ? -5.639  7.664   50.949  1.00 33.02  ? 186 VAL A CB  1 
ATOM   1489 C  CG1 . VAL A 1 185 ? -5.229  6.894   52.205  1.00 33.34  ? 186 VAL A CG1 1 
ATOM   1490 C  CG2 . VAL A 1 185 ? -4.593  7.485   49.838  1.00 33.11  ? 186 VAL A CG2 1 
ATOM   1491 N  N   . VAL A 1 186 ? -8.554  5.950   51.845  1.00 32.24  ? 187 VAL A N   1 
ATOM   1492 C  CA  . VAL A 1 186 ? -9.681  5.745   52.742  1.00 31.93  ? 187 VAL A CA  1 
ATOM   1493 C  C   . VAL A 1 186 ? -9.198  5.183   54.078  1.00 31.45  ? 187 VAL A C   1 
ATOM   1494 O  O   . VAL A 1 186 ? -8.136  4.571   54.147  1.00 31.51  ? 187 VAL A O   1 
ATOM   1495 C  CB  . VAL A 1 186 ? -10.749 4.825   52.048  1.00 32.13  ? 187 VAL A CB  1 
ATOM   1496 C  CG1 . VAL A 1 186 ? -11.526 3.988   53.031  1.00 32.36  ? 187 VAL A CG1 1 
ATOM   1497 C  CG2 . VAL A 1 186 ? -11.691 5.658   51.169  1.00 32.27  ? 187 VAL A CG2 1 
ATOM   1498 N  N   . ASN A 1 187 ? -9.968  5.434   55.134  1.00 30.60  ? 188 ASN A N   1 
ATOM   1499 C  CA  . ASN A 1 187 ? -9.746  4.814   56.427  1.00 30.01  ? 188 ASN A CA  1 
ATOM   1500 C  C   . ASN A 1 187 ? -10.098 3.317   56.356  1.00 29.19  ? 188 ASN A C   1 
ATOM   1501 O  O   . ASN A 1 187 ? -11.272 2.954   56.202  1.00 28.81  ? 188 ASN A O   1 
ATOM   1502 C  CB  . ASN A 1 187 ? -10.571 5.534   57.501  1.00 30.15  ? 188 ASN A CB  1 
ATOM   1503 C  CG  . ASN A 1 187 ? -10.337 4.979   58.904  1.00 32.24  ? 188 ASN A CG  1 
ATOM   1504 O  OD1 . ASN A 1 187 ? -9.310  4.355   59.190  1.00 34.90  ? 188 ASN A OD1 1 
ATOM   1505 N  ND2 . ASN A 1 187 ? -11.294 5.213   59.789  1.00 34.57  ? 188 ASN A ND2 1 
ATOM   1506 N  N   . PRO A 1 188 ? -9.080  2.440   56.461  1.00 28.47  ? 189 PRO A N   1 
ATOM   1507 C  CA  . PRO A 1 188 ? -9.348  1.003   56.329  1.00 27.52  ? 189 PRO A CA  1 
ATOM   1508 C  C   . PRO A 1 188 ? -10.230 0.422   57.452  1.00 26.62  ? 189 PRO A C   1 
ATOM   1509 O  O   . PRO A 1 188 ? -10.916 -0.582  57.236  1.00 26.30  ? 189 PRO A O   1 
ATOM   1510 C  CB  . PRO A 1 188 ? -7.945  0.383   56.338  1.00 27.66  ? 189 PRO A CB  1 
ATOM   1511 C  CG  . PRO A 1 188 ? -7.109  1.364   57.113  1.00 28.45  ? 189 PRO A CG  1 
ATOM   1512 C  CD  . PRO A 1 188 ? -7.659  2.717   56.762  1.00 28.36  ? 189 PRO A CD  1 
ATOM   1513 N  N   . GLU A 1 189 ? -10.222 1.046   58.627  1.00 25.50  ? 190 GLU A N   1 
ATOM   1514 C  CA  . GLU A 1 189 ? -11.037 0.569   59.749  1.00 24.75  ? 190 GLU A CA  1 
ATOM   1515 C  C   . GLU A 1 189 ? -12.508 0.926   59.574  1.00 23.30  ? 190 GLU A C   1 
ATOM   1516 O  O   . GLU A 1 189 ? -13.392 0.153   59.949  1.00 22.78  ? 190 GLU A O   1 
ATOM   1517 C  CB  . GLU A 1 189 ? -10.506 1.075   61.095  1.00 25.27  ? 190 GLU A CB  1 
ATOM   1518 C  CG  . GLU A 1 189 ? -9.178  0.427   61.523  1.00 27.91  ? 190 GLU A CG  1 
ATOM   1519 C  CD  . GLU A 1 189 ? -9.276  -1.092  61.714  1.00 31.83  ? 190 GLU A CD  1 
ATOM   1520 O  OE1 . GLU A 1 189 ? -10.228 -1.570  62.374  1.00 33.30  ? 190 GLU A OE1 1 
ATOM   1521 O  OE2 . GLU A 1 189 ? -8.394  -1.815  61.208  1.00 33.64  ? 190 GLU A OE2 1 
ATOM   1522 N  N   . ALA A 1 190 ? -12.760 2.098   59.000  1.00 22.06  ? 191 ALA A N   1 
ATOM   1523 C  CA  . ALA A 1 190 ? -14.109 2.494   58.615  1.00 20.83  ? 191 ALA A CA  1 
ATOM   1524 C  C   . ALA A 1 190 ? -14.635 1.610   57.474  1.00 20.23  ? 191 ALA A C   1 
ATOM   1525 O  O   . ALA A 1 190 ? -15.812 1.225   57.472  1.00 19.96  ? 191 ALA A O   1 
ATOM   1526 C  CB  . ALA A 1 190 ? -14.150 3.954   58.238  1.00 20.34  ? 191 ALA A CB  1 
ATOM   1527 N  N   . GLN A 1 191 ? -13.765 1.259   56.530  1.00 19.47  ? 192 GLN A N   1 
ATOM   1528 C  CA  . GLN A 1 191 ? -14.144 0.323   55.462  1.00 19.42  ? 192 GLN A CA  1 
ATOM   1529 C  C   . GLN A 1 191 ? -14.544 -1.040  56.042  1.00 19.59  ? 192 GLN A C   1 
ATOM   1530 O  O   . GLN A 1 191 ? -15.523 -1.660  55.603  1.00 19.15  ? 192 GLN A O   1 
ATOM   1531 C  CB  . GLN A 1 191 ? -13.028 0.172   54.424  1.00 19.06  ? 192 GLN A CB  1 
ATOM   1532 C  CG  . GLN A 1 191 ? -13.440 -0.614  53.174  1.00 18.81  ? 192 GLN A CG  1 
ATOM   1533 C  CD  . GLN A 1 191 ? -14.550 0.079   52.384  1.00 18.15  ? 192 GLN A CD  1 
ATOM   1534 O  OE1 . GLN A 1 191 ? -14.345 1.161   51.838  1.00 19.63  ? 192 GLN A OE1 1 
ATOM   1535 N  NE2 . GLN A 1 191 ? -15.723 -0.548  52.316  1.00 14.30  ? 192 GLN A NE2 1 
ATOM   1536 N  N   . ARG A 1 192 ? -13.789 -1.484  57.047  1.00 19.72  ? 193 ARG A N   1 
ATOM   1537 C  CA  . ARG A 1 192 ? -14.060 -2.736  57.744  1.00 20.05  ? 193 ARG A CA  1 
ATOM   1538 C  C   . ARG A 1 192 ? -15.443 -2.703  58.425  1.00 19.29  ? 193 ARG A C   1 
ATOM   1539 O  O   . ARG A 1 192 ? -16.138 -3.723  58.490  1.00 18.93  ? 193 ARG A O   1 
ATOM   1540 C  CB  . ARG A 1 192 ? -12.957 -2.991  58.772  1.00 20.64  ? 193 ARG A CB  1 
ATOM   1541 C  CG  . ARG A 1 192 ? -12.317 -4.370  58.690  1.00 24.31  ? 193 ARG A CG  1 
ATOM   1542 C  CD  . ARG A 1 192 ? -11.055 -4.487  59.580  1.00 28.66  ? 193 ARG A CD  1 
ATOM   1543 N  NE  . ARG A 1 192 ? -11.328 -4.191  60.994  1.00 32.38  ? 193 ARG A NE  1 
ATOM   1544 C  CZ  . ARG A 1 192 ? -11.801 -5.061  61.893  1.00 33.91  ? 193 ARG A CZ  1 
ATOM   1545 N  NH1 . ARG A 1 192 ? -12.070 -6.318  61.562  1.00 34.50  ? 193 ARG A NH1 1 
ATOM   1546 N  NH2 . ARG A 1 192 ? -12.005 -4.668  63.142  1.00 35.19  ? 193 ARG A NH2 1 
ATOM   1547 N  N   . PHE A 1 193 ? -15.836 -1.528  58.918  1.00 18.48  ? 194 PHE A N   1 
ATOM   1548 C  CA  . PHE A 1 193 ? -17.156 -1.349  59.513  1.00 18.32  ? 194 PHE A CA  1 
ATOM   1549 C  C   . PHE A 1 193 ? -18.278 -1.510  58.466  1.00 17.59  ? 194 PHE A C   1 
ATOM   1550 O  O   . PHE A 1 193 ? -19.271 -2.204  58.708  1.00 16.95  ? 194 PHE A O   1 
ATOM   1551 C  CB  . PHE A 1 193 ? -17.262 0.012   60.217  1.00 18.47  ? 194 PHE A CB  1 
ATOM   1552 C  CG  . PHE A 1 193 ? -18.598 0.253   60.871  1.00 20.60  ? 194 PHE A CG  1 
ATOM   1553 C  CD1 . PHE A 1 193 ? -18.884 -0.285  62.113  1.00 22.19  ? 194 PHE A CD1 1 
ATOM   1554 C  CD2 . PHE A 1 193 ? -19.575 1.010   60.234  1.00 24.17  ? 194 PHE A CD2 1 
ATOM   1555 C  CE1 . PHE A 1 193 ? -20.109 -0.066  62.721  1.00 23.45  ? 194 PHE A CE1 1 
ATOM   1556 C  CE2 . PHE A 1 193 ? -20.814 1.231   60.842  1.00 24.60  ? 194 PHE A CE2 1 
ATOM   1557 C  CZ  . PHE A 1 193 ? -21.072 0.686   62.095  1.00 23.91  ? 194 PHE A CZ  1 
ATOM   1558 N  N   . ILE A 1 194 ? -18.105 -0.858  57.322  1.00 16.94  ? 195 ILE A N   1 
ATOM   1559 C  CA  . ILE A 1 194 ? -19.038 -0.960  56.200  1.00 16.92  ? 195 ILE A CA  1 
ATOM   1560 C  C   . ILE A 1 194 ? -19.199 -2.414  55.748  1.00 17.09  ? 195 ILE A C   1 
ATOM   1561 O  O   . ILE A 1 194 ? -20.319 -2.883  55.566  1.00 17.18  ? 195 ILE A O   1 
ATOM   1562 C  CB  . ILE A 1 194 ? -18.582 -0.085  55.009  1.00 16.78  ? 195 ILE A CB  1 
ATOM   1563 C  CG1 . ILE A 1 194 ? -18.594 1.400   55.403  1.00 16.58  ? 195 ILE A CG1 1 
ATOM   1564 C  CG2 . ILE A 1 194 ? -19.448 -0.347  53.760  1.00 16.43  ? 195 ILE A CG2 1 
ATOM   1565 C  CD1 . ILE A 1 194 ? -17.907 2.339   54.382  1.00 15.20  ? 195 ILE A CD1 1 
ATOM   1566 N  N   . ASP A 1 195 ? -18.080 -3.119  55.578  1.00 17.03  ? 196 ASP A N   1 
ATOM   1567 C  CA  . ASP A 1 195 ? -18.095 -4.513  55.136  1.00 17.28  ? 196 ASP A CA  1 
ATOM   1568 C  C   . ASP A 1 195 ? -18.802 -5.439  56.126  1.00 16.76  ? 196 ASP A C   1 
ATOM   1569 O  O   . ASP A 1 195 ? -19.483 -6.369  55.715  1.00 16.84  ? 196 ASP A O   1 
ATOM   1570 C  CB  . ASP A 1 195 ? -16.672 -5.026  54.870  1.00 17.23  ? 196 ASP A CB  1 
ATOM   1571 C  CG  . ASP A 1 195 ? -15.949 -4.236  53.778  1.00 19.45  ? 196 ASP A CG  1 
ATOM   1572 O  OD1 . ASP A 1 195 ? -16.601 -3.620  52.902  1.00 21.29  ? 196 ASP A OD1 1 
ATOM   1573 O  OD2 . ASP A 1 195 ? -14.701 -4.229  53.792  1.00 23.43  ? 196 ASP A OD2 1 
ATOM   1574 N  N   . ALA A 1 196 ? -18.644 -5.174  57.418  1.00 16.14  ? 197 ALA A N   1 
ATOM   1575 C  CA  . ALA A 1 196 ? -19.266 -5.998  58.446  1.00 16.23  ? 197 ALA A CA  1 
ATOM   1576 C  C   . ALA A 1 196 ? -20.787 -5.863  58.451  1.00 16.42  ? 197 ALA A C   1 
ATOM   1577 O  O   . ALA A 1 196 ? -21.493 -6.824  58.771  1.00 16.07  ? 197 ALA A O   1 
ATOM   1578 C  CB  . ALA A 1 196 ? -18.706 -5.664  59.803  1.00 15.81  ? 197 ALA A CB  1 
ATOM   1579 N  N   . ILE A 1 197 ? -21.285 -4.676  58.098  1.00 16.56  ? 198 ILE A N   1 
ATOM   1580 C  CA  . ILE A 1 197 ? -22.725 -4.461  58.020  1.00 16.94  ? 198 ILE A CA  1 
ATOM   1581 C  C   . ILE A 1 197 ? -23.318 -5.355  56.936  1.00 17.71  ? 198 ILE A C   1 
ATOM   1582 O  O   . ILE A 1 197 ? -24.323 -6.034  57.167  1.00 17.58  ? 198 ILE A O   1 
ATOM   1583 C  CB  . ILE A 1 197 ? -23.088 -2.975  57.780  1.00 16.96  ? 198 ILE A CB  1 
ATOM   1584 C  CG1 . ILE A 1 197 ? -22.790 -2.152  59.037  1.00 15.65  ? 198 ILE A CG1 1 
ATOM   1585 C  CG2 . ILE A 1 197 ? -24.561 -2.830  57.391  1.00 15.82  ? 198 ILE A CG2 1 
ATOM   1586 C  CD1 . ILE A 1 197 ? -22.780 -0.676  58.786  1.00 16.97  ? 198 ILE A CD1 1 
ATOM   1587 N  N   . TYR A 1 198 ? -22.680 -5.372  55.767  1.00 18.51  ? 199 TYR A N   1 
ATOM   1588 C  CA  . TYR A 1 198 ? -23.150 -6.214  54.673  1.00 19.35  ? 199 TYR A CA  1 
ATOM   1589 C  C   . TYR A 1 198 ? -23.053 -7.707  55.039  1.00 18.85  ? 199 TYR A C   1 
ATOM   1590 O  O   . TYR A 1 198 ? -23.964 -8.497  54.758  1.00 18.38  ? 199 TYR A O   1 
ATOM   1591 C  CB  . TYR A 1 198 ? -22.378 -5.913  53.377  1.00 20.24  ? 199 TYR A CB  1 
ATOM   1592 C  CG  . TYR A 1 198 ? -22.738 -6.875  52.277  1.00 24.33  ? 199 TYR A CG  1 
ATOM   1593 C  CD1 . TYR A 1 198 ? -23.907 -6.708  51.540  1.00 29.17  ? 199 TYR A CD1 1 
ATOM   1594 C  CD2 . TYR A 1 198 ? -21.939 -7.988  52.012  1.00 27.32  ? 199 TYR A CD2 1 
ATOM   1595 C  CE1 . TYR A 1 198 ? -24.259 -7.622  50.541  1.00 32.39  ? 199 TYR A CE1 1 
ATOM   1596 C  CE2 . TYR A 1 198 ? -22.278 -8.895  51.023  1.00 31.07  ? 199 TYR A CE2 1 
ATOM   1597 C  CZ  . TYR A 1 198 ? -23.436 -8.705  50.291  1.00 32.91  ? 199 TYR A CZ  1 
ATOM   1598 O  OH  . TYR A 1 198 ? -23.767 -9.606  49.308  1.00 37.76  ? 199 TYR A OH  1 
ATOM   1599 N  N   . GLN A 1 199 ? -21.939 -8.073  55.670  1.00 18.26  ? 200 GLN A N   1 
ATOM   1600 C  CA  . GLN A 1 199 ? -21.691 -9.441  56.108  1.00 18.02  ? 200 GLN A CA  1 
ATOM   1601 C  C   . GLN A 1 199 ? -22.738 -9.890  57.131  1.00 17.13  ? 200 GLN A C   1 
ATOM   1602 O  O   . GLN A 1 199 ? -23.225 -11.012 57.072  1.00 17.12  ? 200 GLN A O   1 
ATOM   1603 C  CB  . GLN A 1 199 ? -20.255 -9.563  56.643  1.00 18.19  ? 200 GLN A CB  1 
ATOM   1604 C  CG  . GLN A 1 199 ? -19.906 -10.917 57.241  1.00 20.98  ? 200 GLN A CG  1 
ATOM   1605 C  CD  . GLN A 1 199 ? -19.601 -12.004 56.198  1.00 24.11  ? 200 GLN A CD  1 
ATOM   1606 O  OE1 . GLN A 1 199 ? -19.951 -11.881 55.010  1.00 23.81  ? 200 GLN A OE1 1 
ATOM   1607 N  NE2 . GLN A 1 199 ? -18.936 -13.077 56.649  1.00 23.32  ? 200 GLN A NE2 1 
ATOM   1608 N  N   . MET A 1 200 ? -23.111 -8.989  58.035  1.00 16.26  ? 201 MET A N   1 
ATOM   1609 C  CA  . MET A 1 200 ? -24.173 -9.246  59.009  1.00 15.42  ? 201 MET A CA  1 
ATOM   1610 C  C   . MET A 1 200 ? -25.517 -9.580  58.334  1.00 15.19  ? 201 MET A C   1 
ATOM   1611 O  O   . MET A 1 200 ? -26.185 -10.551 58.715  1.00 14.83  ? 201 MET A O   1 
ATOM   1612 C  CB  . MET A 1 200 ? -24.325 -8.042  59.943  1.00 15.29  ? 201 MET A CB  1 
ATOM   1613 C  CG  . MET A 1 200 ? -25.321 -8.240  61.087  1.00 15.14  ? 201 MET A CG  1 
ATOM   1614 S  SD  . MET A 1 200 ? -27.050 -8.036  60.607  1.00 15.96  ? 201 MET A SD  1 
ATOM   1615 C  CE  . MET A 1 200 ? -27.109 -6.294  60.238  1.00 15.16  ? 201 MET A CE  1 
ATOM   1616 N  N   . PHE A 1 201 ? -25.915 -8.768  57.355  1.00 14.55  ? 202 PHE A N   1 
ATOM   1617 C  CA  . PHE A 1 201 ? -27.109 -9.062  56.566  1.00 14.36  ? 202 PHE A CA  1 
ATOM   1618 C  C   . PHE A 1 201 ? -26.992 -10.395 55.811  1.00 14.36  ? 202 PHE A C   1 
ATOM   1619 O  O   . PHE A 1 201 ? -27.871 -11.254 55.913  1.00 14.32  ? 202 PHE A O   1 
ATOM   1620 C  CB  . PHE A 1 201 ? -27.402 -7.925  55.579  1.00 14.07  ? 202 PHE A CB  1 
ATOM   1621 C  CG  . PHE A 1 201 ? -27.966 -6.693  56.224  1.00 13.15  ? 202 PHE A CG  1 
ATOM   1622 C  CD1 . PHE A 1 201 ? -27.389 -5.449  55.999  1.00 13.34  ? 202 PHE A CD1 1 
ATOM   1623 C  CD2 . PHE A 1 201 ? -29.081 -6.777  57.058  1.00 12.27  ? 202 PHE A CD2 1 
ATOM   1624 C  CE1 . PHE A 1 201 ? -27.921 -4.292  56.599  1.00 13.67  ? 202 PHE A CE1 1 
ATOM   1625 C  CE2 . PHE A 1 201 ? -29.623 -5.639  57.659  1.00 12.97  ? 202 PHE A CE2 1 
ATOM   1626 C  CZ  . PHE A 1 201 ? -29.040 -4.394  57.435  1.00 12.99  ? 202 PHE A CZ  1 
ATOM   1627 N  N   . HIS A 1 202 ? -25.898 -10.552 55.069  1.00 14.63  ? 203 HIS A N   1 
ATOM   1628 C  CA  . HIS A 1 202 ? -25.667 -11.740 54.244  1.00 15.11  ? 203 HIS A CA  1 
ATOM   1629 C  C   . HIS A 1 202 ? -25.680 -13.022 55.084  1.00 14.76  ? 203 HIS A C   1 
ATOM   1630 O  O   . HIS A 1 202 ? -26.370 -13.981 54.739  1.00 14.57  ? 203 HIS A O   1 
ATOM   1631 C  CB  . HIS A 1 202 ? -24.367 -11.598 53.440  1.00 15.59  ? 203 HIS A CB  1 
ATOM   1632 C  CG  . HIS A 1 202 ? -24.223 -12.598 52.335  1.00 17.99  ? 203 HIS A CG  1 
ATOM   1633 N  ND1 . HIS A 1 202 ? -23.446 -13.732 52.453  1.00 21.32  ? 203 HIS A ND1 1 
ATOM   1634 C  CD2 . HIS A 1 202 ? -24.748 -12.634 51.088  1.00 21.60  ? 203 HIS A CD2 1 
ATOM   1635 C  CE1 . HIS A 1 202 ? -23.514 -14.433 51.334  1.00 21.40  ? 203 HIS A CE1 1 
ATOM   1636 N  NE2 . HIS A 1 202 ? -24.298 -13.788 50.488  1.00 22.33  ? 203 HIS A NE2 1 
ATOM   1637 N  N   . THR A 1 203 ? -24.958 -13.031 56.203  1.00 14.32  ? 204 THR A N   1 
ATOM   1638 C  CA  . THR A 1 203 ? -24.918 -14.226 57.049  1.00 13.84  ? 204 THR A CA  1 
ATOM   1639 C  C   . THR A 1 203 ? -26.231 -14.471 57.797  1.00 14.11  ? 204 THR A C   1 
ATOM   1640 O  O   . THR A 1 203 ? -26.410 -15.524 58.391  1.00 14.01  ? 204 THR A O   1 
ATOM   1641 C  CB  . THR A 1 203 ? -23.747 -14.201 58.076  1.00 13.71  ? 204 THR A CB  1 
ATOM   1642 O  OG1 . THR A 1 203 ? -23.879 -13.053 58.926  1.00 13.40  ? 204 THR A OG1 1 
ATOM   1643 C  CG2 . THR A 1 203 ? -22.410 -14.172 57.366  1.00 12.83  ? 204 THR A CG2 1 
ATOM   1644 N  N   . SER A 1 204 ? -27.152 -13.512 57.778  1.00 14.23  ? 205 SER A N   1 
ATOM   1645 C  CA  . SER A 1 204 ? -28.420 -13.708 58.491  1.00 14.28  ? 205 SER A CA  1 
ATOM   1646 C  C   . SER A 1 204 ? -29.277 -14.747 57.767  1.00 14.22  ? 205 SER A C   1 
ATOM   1647 O  O   . SER A 1 204 ? -30.024 -15.506 58.394  1.00 13.64  ? 205 SER A O   1 
ATOM   1648 C  CB  . SER A 1 204 ? -29.206 -12.400 58.586  1.00 14.01  ? 205 SER A CB  1 
ATOM   1649 O  OG  . SER A 1 204 ? -28.517 -11.432 59.352  1.00 15.50  ? 205 SER A OG  1 
ATOM   1650 N  N   . VAL A 1 205 ? -29.152 -14.768 56.443  1.00 13.99  ? 206 VAL A N   1 
ATOM   1651 C  CA  . VAL A 1 205 ? -30.064 -15.523 55.582  1.00 14.43  ? 206 VAL A CA  1 
ATOM   1652 C  C   . VAL A 1 205 ? -30.150 -17.039 55.885  1.00 14.55  ? 206 VAL A C   1 
ATOM   1653 O  O   . VAL A 1 205 ? -31.257 -17.551 56.030  1.00 14.26  ? 206 VAL A O   1 
ATOM   1654 C  CB  . VAL A 1 205 ? -29.793 -15.234 54.070  1.00 14.54  ? 206 VAL A CB  1 
ATOM   1655 C  CG1 . VAL A 1 205 ? -30.689 -16.090 53.168  1.00 14.07  ? 206 VAL A CG1 1 
ATOM   1656 C  CG2 . VAL A 1 205 ? -30.005 -13.741 53.782  1.00 13.58  ? 206 VAL A CG2 1 
ATOM   1657 N  N   . PRO A 1 206 ? -28.998 -17.741 56.013  1.00 14.81  ? 207 PRO A N   1 
ATOM   1658 C  CA  . PRO A 1 206 ? -29.089 -19.187 56.255  1.00 15.66  ? 207 PRO A CA  1 
ATOM   1659 C  C   . PRO A 1 206 ? -29.696 -19.572 57.609  1.00 16.67  ? 207 PRO A C   1 
ATOM   1660 O  O   . PRO A 1 206 ? -29.938 -20.753 57.845  1.00 17.22  ? 207 PRO A O   1 
ATOM   1661 C  CB  . PRO A 1 206 ? -27.623 -19.656 56.172  1.00 15.54  ? 207 PRO A CB  1 
ATOM   1662 C  CG  . PRO A 1 206 ? -26.923 -18.593 55.351  1.00 15.05  ? 207 PRO A CG  1 
ATOM   1663 C  CD  . PRO A 1 206 ? -27.597 -17.321 55.800  1.00 15.03  ? 207 PRO A CD  1 
ATOM   1664 N  N   . MET A 1 207 ? -29.957 -18.597 58.478  1.00 17.19  ? 208 MET A N   1 
ATOM   1665 C  CA  . MET A 1 207 ? -30.516 -18.897 59.790  1.00 18.60  ? 208 MET A CA  1 
ATOM   1666 C  C   . MET A 1 207 ? -31.981 -18.485 59.944  1.00 19.25  ? 208 MET A C   1 
ATOM   1667 O  O   . MET A 1 207 ? -32.614 -18.821 60.946  1.00 19.19  ? 208 MET A O   1 
ATOM   1668 C  CB  . MET A 1 207 ? -29.662 -18.281 60.915  1.00 18.00  ? 208 MET A CB  1 
ATOM   1669 C  CG  . MET A 1 207 ? -28.226 -18.772 60.929  1.00 17.45  ? 208 MET A CG  1 
ATOM   1670 S  SD  . MET A 1 207 ? -27.245 -18.018 62.239  1.00 16.88  ? 208 MET A SD  1 
ATOM   1671 C  CE  . MET A 1 207 ? -26.864 -16.394 61.558  1.00 15.06  ? 208 MET A CE  1 
ATOM   1672 N  N   . LEU A 1 208 ? -32.522 -17.831 58.920  1.00 20.46  ? 209 LEU A N   1 
ATOM   1673 C  CA  . LEU A 1 208 ? -33.787 -17.072 59.013  1.00 21.78  ? 209 LEU A CA  1 
ATOM   1674 C  C   . LEU A 1 208 ? -35.052 -17.755 59.562  1.00 22.07  ? 209 LEU A C   1 
ATOM   1675 O  O   . LEU A 1 208 ? -35.783 -17.158 60.391  1.00 23.16  ? 209 LEU A O   1 
ATOM   1676 C  CB  . LEU A 1 208 ? -34.109 -16.422 57.669  1.00 22.30  ? 209 LEU A CB  1 
ATOM   1677 C  CG  . LEU A 1 208 ? -35.009 -15.194 57.811  1.00 24.52  ? 209 LEU A CG  1 
ATOM   1678 C  CD1 . LEU A 1 208 ? -34.315 -14.133 58.642  1.00 24.62  ? 209 LEU A CD1 1 
ATOM   1679 C  CD2 . LEU A 1 208 ? -35.446 -14.646 56.441  1.00 25.37  ? 209 LEU A CD2 1 
ATOM   1680 N  N   . ASN A 1 209 ? -35.322 -18.971 59.112  1.00 21.46  ? 210 ASN A N   1 
ATOM   1681 C  CA  . ASN A 1 209 ? -36.565 -19.648 59.481  1.00 21.26  ? 210 ASN A CA  1 
ATOM   1682 C  C   . ASN A 1 209 ? -36.349 -20.751 60.523  1.00 21.27  ? 210 ASN A C   1 
ATOM   1683 O  O   . ASN A 1 209 ? -37.077 -21.753 60.556  1.00 21.34  ? 210 ASN A O   1 
ATOM   1684 C  CB  . ASN A 1 209 ? -37.247 -20.198 58.222  1.00 20.78  ? 210 ASN A CB  1 
ATOM   1685 C  CG  . ASN A 1 209 ? -37.745 -19.090 57.301  1.00 21.79  ? 210 ASN A CG  1 
ATOM   1686 O  OD1 . ASN A 1 209 ? -38.801 -18.484 57.544  1.00 22.71  ? 210 ASN A OD1 1 
ATOM   1687 N  ND2 . ASN A 1 209 ? -36.990 -18.813 56.251  1.00 19.79  ? 210 ASN A ND2 1 
ATOM   1688 N  N   . LEU A 1 210 ? -35.351 -20.551 61.380  1.00 20.94  ? 211 LEU A N   1 
ATOM   1689 C  CA  . LEU A 1 210 ? -34.971 -21.561 62.364  1.00 20.99  ? 211 LEU A CA  1 
ATOM   1690 C  C   . LEU A 1 210 ? -34.960 -20.991 63.774  1.00 20.67  ? 211 LEU A C   1 
ATOM   1691 O  O   . LEU A 1 210 ? -34.557 -19.842 63.975  1.00 20.37  ? 211 LEU A O   1 
ATOM   1692 C  CB  . LEU A 1 210 ? -33.583 -22.129 62.044  1.00 21.22  ? 211 LEU A CB  1 
ATOM   1693 C  CG  . LEU A 1 210 ? -33.336 -22.728 60.654  1.00 21.77  ? 211 LEU A CG  1 
ATOM   1694 C  CD1 . LEU A 1 210 ? -31.868 -23.092 60.510  1.00 21.45  ? 211 LEU A CD1 1 
ATOM   1695 C  CD2 . LEU A 1 210 ? -34.236 -23.937 60.413  1.00 22.34  ? 211 LEU A CD2 1 
ATOM   1696 N  N   . PRO A 1 211 ? -35.398 -21.792 64.759  1.00 20.37  ? 212 PRO A N   1 
ATOM   1697 C  CA  . PRO A 1 211 ? -35.191 -21.390 66.156  1.00 20.38  ? 212 PRO A CA  1 
ATOM   1698 C  C   . PRO A 1 211 ? -33.689 -21.390 66.502  1.00 20.12  ? 212 PRO A C   1 
ATOM   1699 O  O   . PRO A 1 211 ? -32.923 -22.123 65.873  1.00 19.39  ? 212 PRO A O   1 
ATOM   1700 C  CB  . PRO A 1 211 ? -35.934 -22.472 66.947  1.00 20.51  ? 212 PRO A CB  1 
ATOM   1701 C  CG  . PRO A 1 211 ? -35.910 -23.674 66.039  1.00 20.65  ? 212 PRO A CG  1 
ATOM   1702 C  CD  . PRO A 1 211 ? -36.019 -23.124 64.645  1.00 20.37  ? 212 PRO A CD  1 
ATOM   1703 N  N   . PRO A 1 212 ? -33.267 -20.560 67.474  1.00 20.57  ? 213 PRO A N   1 
ATOM   1704 C  CA  . PRO A 1 212 ? -31.830 -20.481 67.771  1.00 21.29  ? 213 PRO A CA  1 
ATOM   1705 C  C   . PRO A 1 212 ? -31.181 -21.813 68.169  1.00 21.78  ? 213 PRO A C   1 
ATOM   1706 O  O   . PRO A 1 212 ? -30.009 -22.001 67.877  1.00 22.06  ? 213 PRO A O   1 
ATOM   1707 C  CB  . PRO A 1 212 ? -31.734 -19.436 68.901  1.00 21.10  ? 213 PRO A CB  1 
ATOM   1708 C  CG  . PRO A 1 212 ? -33.134 -19.239 69.393  1.00 21.18  ? 213 PRO A CG  1 
ATOM   1709 C  CD  . PRO A 1 212 ? -34.052 -19.589 68.264  1.00 20.54  ? 213 PRO A CD  1 
ATOM   1710 N  N   . ASP A 1 213 ? -31.939 -22.726 68.784  1.00 22.41  ? 214 ASP A N   1 
ATOM   1711 C  CA  . ASP A 1 213 ? -31.446 -24.078 69.117  1.00 23.57  ? 214 ASP A CA  1 
ATOM   1712 C  C   . ASP A 1 213 ? -30.930 -24.849 67.905  1.00 24.10  ? 214 ASP A C   1 
ATOM   1713 O  O   . ASP A 1 213 ? -30.072 -25.719 68.045  1.00 23.82  ? 214 ASP A O   1 
ATOM   1714 C  CB  . ASP A 1 213 ? -32.536 -24.930 69.790  1.00 23.73  ? 214 ASP A CB  1 
ATOM   1715 C  CG  . ASP A 1 213 ? -32.682 -24.652 71.285  1.00 24.45  ? 214 ASP A CG  1 
ATOM   1716 O  OD1 . ASP A 1 213 ? -31.793 -24.020 71.893  1.00 27.39  ? 214 ASP A OD1 1 
ATOM   1717 O  OD2 . ASP A 1 213 ? -33.711 -25.064 71.854  1.00 25.13  ? 214 ASP A OD2 1 
ATOM   1718 N  N   . LEU A 1 214 ? -31.472 -24.557 66.722  1.00 24.69  ? 215 LEU A N   1 
ATOM   1719 C  CA  . LEU A 1 214 ? -31.006 -25.225 65.502  1.00 25.32  ? 215 LEU A CA  1 
ATOM   1720 C  C   . LEU A 1 214 ? -29.862 -24.506 64.765  1.00 26.11  ? 215 LEU A C   1 
ATOM   1721 O  O   . LEU A 1 214 ? -29.149 -25.158 63.998  1.00 25.89  ? 215 LEU A O   1 
ATOM   1722 C  CB  . LEU A 1 214 ? -32.174 -25.567 64.562  1.00 25.14  ? 215 LEU A CB  1 
ATOM   1723 C  CG  . LEU A 1 214 ? -33.306 -26.420 65.148  1.00 24.66  ? 215 LEU A CG  1 
ATOM   1724 C  CD1 . LEU A 1 214 ? -34.328 -26.743 64.087  1.00 24.31  ? 215 LEU A CD1 1 
ATOM   1725 C  CD2 . LEU A 1 214 ? -32.802 -27.719 65.801  1.00 23.24  ? 215 LEU A CD2 1 
ATOM   1726 N  N   . PHE A 1 215 ? -29.671 -23.197 65.028  1.00 27.03  ? 216 PHE A N   1 
ATOM   1727 C  CA  . PHE A 1 215 ? -28.573 -22.384 64.435  1.00 27.24  ? 216 PHE A CA  1 
ATOM   1728 C  C   . PHE A 1 215 ? -27.268 -23.079 64.569  1.00 27.71  ? 216 PHE A C   1 
ATOM   1729 O  O   . PHE A 1 215 ? -26.607 -23.387 63.579  1.00 28.13  ? 216 PHE A O   1 
ATOM   1730 C  CB  . PHE A 1 215 ? -28.296 -21.063 65.183  1.00 27.39  ? 216 PHE A CB  1 
ATOM   1731 C  CG  . PHE A 1 215 ? -29.367 -20.041 65.089  1.00 25.36  ? 216 PHE A CG  1 
ATOM   1732 C  CD1 . PHE A 1 215 ? -29.304 -18.913 65.910  1.00 24.15  ? 216 PHE A CD1 1 
ATOM   1733 C  CD2 . PHE A 1 215 ? -30.435 -20.191 64.222  1.00 23.25  ? 216 PHE A CD2 1 
ATOM   1734 C  CE1 . PHE A 1 215 ? -30.291 -17.950 65.867  1.00 23.32  ? 216 PHE A CE1 1 
ATOM   1735 C  CE2 . PHE A 1 215 ? -31.431 -19.235 64.178  1.00 23.41  ? 216 PHE A CE2 1 
ATOM   1736 C  CZ  . PHE A 1 215 ? -31.358 -18.109 64.996  1.00 23.29  ? 216 PHE A CZ  1 
ATOM   1737 N  N   . ARG A 1 216 ? -26.886 -23.274 65.832  1.00 28.11  ? 217 ARG A N   1 
ATOM   1738 C  CA  . ARG A 1 216 ? -25.593 -23.828 66.193  1.00 28.25  ? 217 ARG A CA  1 
ATOM   1739 C  C   . ARG A 1 216 ? -25.429 -25.268 65.767  1.00 27.53  ? 217 ARG A C   1 
ATOM   1740 O  O   . ARG A 1 216 ? -24.302 -25.736 65.592  1.00 28.10  ? 217 ARG A O   1 
ATOM   1741 C  CB  . ARG A 1 216 ? -25.328 -23.679 67.701  1.00 29.47  ? 217 ARG A CB  1 
ATOM   1742 C  CG  . ARG A 1 216 ? -26.562 -23.737 68.597  1.00 31.53  ? 217 ARG A CG  1 
ATOM   1743 C  CD  . ARG A 1 216 ? -26.163 -23.813 70.088  1.00 35.73  ? 217 ARG A CD  1 
ATOM   1744 N  NE  . ARG A 1 216 ? -27.250 -24.370 70.893  1.00 38.02  ? 217 ARG A NE  1 
ATOM   1745 C  CZ  . ARG A 1 216 ? -28.198 -23.655 71.497  1.00 39.53  ? 217 ARG A CZ  1 
ATOM   1746 N  NH1 . ARG A 1 216 ? -28.204 -22.325 71.425  1.00 40.13  ? 217 ARG A NH1 1 
ATOM   1747 N  NH2 . ARG A 1 216 ? -29.144 -24.279 72.187  1.00 39.80  ? 217 ARG A NH2 1 
ATOM   1748 N  N   . LEU A 1 217 ? -26.542 -25.975 65.596  1.00 26.52  ? 218 LEU A N   1 
ATOM   1749 C  CA  . LEU A 1 217 ? -26.478 -27.367 65.176  1.00 25.32  ? 218 LEU A CA  1 
ATOM   1750 C  C   . LEU A 1 217 ? -26.214 -27.485 63.686  1.00 24.41  ? 218 LEU A C   1 
ATOM   1751 O  O   . LEU A 1 217 ? -25.349 -28.250 63.267  1.00 24.50  ? 218 LEU A O   1 
ATOM   1752 C  CB  . LEU A 1 217 ? -27.756 -28.126 65.564  1.00 25.41  ? 218 LEU A CB  1 
ATOM   1753 C  CG  . LEU A 1 217 ? -27.798 -28.784 66.945  1.00 25.52  ? 218 LEU A CG  1 
ATOM   1754 C  CD1 . LEU A 1 217 ? -29.049 -29.605 67.068  1.00 25.17  ? 218 LEU A CD1 1 
ATOM   1755 C  CD2 . LEU A 1 217 ? -26.572 -29.665 67.181  1.00 23.75  ? 218 LEU A CD2 1 
ATOM   1756 N  N   . PHE A 1 218 ? -26.940 -26.705 62.891  1.00 23.21  ? 219 PHE A N   1 
ATOM   1757 C  CA  . PHE A 1 218 ? -26.906 -26.873 61.444  1.00 22.33  ? 219 PHE A CA  1 
ATOM   1758 C  C   . PHE A 1 218 ? -26.270 -25.734 60.645  1.00 21.68  ? 219 PHE A C   1 
ATOM   1759 O  O   . PHE A 1 218 ? -26.011 -25.879 59.453  1.00 21.41  ? 219 PHE A O   1 
ATOM   1760 C  CB  . PHE A 1 218 ? -28.308 -27.181 60.935  1.00 22.01  ? 219 PHE A CB  1 
ATOM   1761 C  CG  . PHE A 1 218 ? -28.905 -28.403 61.551  1.00 22.03  ? 219 PHE A CG  1 
ATOM   1762 C  CD1 . PHE A 1 218 ? -29.995 -28.300 62.407  1.00 22.21  ? 219 PHE A CD1 1 
ATOM   1763 C  CD2 . PHE A 1 218 ? -28.354 -29.665 61.308  1.00 21.84  ? 219 PHE A CD2 1 
ATOM   1764 C  CE1 . PHE A 1 218 ? -30.554 -29.442 62.999  1.00 22.33  ? 219 PHE A CE1 1 
ATOM   1765 C  CE2 . PHE A 1 218 ? -28.904 -30.810 61.896  1.00 21.12  ? 219 PHE A CE2 1 
ATOM   1766 C  CZ  . PHE A 1 218 ? -30.007 -30.694 62.743  1.00 21.05  ? 219 PHE A CZ  1 
ATOM   1767 N  N   . ARG A 1 219 ? -26.010 -24.612 61.307  1.00 21.20  ? 220 ARG A N   1 
ATOM   1768 C  CA  . ARG A 1 219 ? -25.465 -23.425 60.642  1.00 21.05  ? 220 ARG A CA  1 
ATOM   1769 C  C   . ARG A 1 219 ? -24.290 -22.869 61.442  1.00 21.10  ? 220 ARG A C   1 
ATOM   1770 O  O   . ARG A 1 219 ? -24.126 -21.645 61.558  1.00 20.82  ? 220 ARG A O   1 
ATOM   1771 C  CB  . ARG A 1 219 ? -26.565 -22.357 60.489  1.00 20.85  ? 220 ARG A CB  1 
ATOM   1772 C  CG  . ARG A 1 219 ? -27.771 -22.793 59.650  1.00 20.86  ? 220 ARG A CG  1 
ATOM   1773 C  CD  . ARG A 1 219 ? -27.385 -22.904 58.193  1.00 20.91  ? 220 ARG A CD  1 
ATOM   1774 N  NE  . ARG A 1 219 ? -28.499 -23.219 57.296  1.00 21.14  ? 220 ARG A NE  1 
ATOM   1775 C  CZ  . ARG A 1 219 ? -28.764 -24.435 56.820  1.00 21.43  ? 220 ARG A CZ  1 
ATOM   1776 N  NH1 . ARG A 1 219 ? -28.015 -25.479 57.166  1.00 21.02  ? 220 ARG A NH1 1 
ATOM   1777 N  NH2 . ARG A 1 219 ? -29.784 -24.610 55.994  1.00 22.88  ? 220 ARG A NH2 1 
ATOM   1778 N  N   . THR A 1 220 ? -23.477 -23.772 61.994  1.00 21.10  ? 221 THR A N   1 
ATOM   1779 C  CA  . THR A 1 220 ? -22.415 -23.397 62.936  1.00 21.48  ? 221 THR A CA  1 
ATOM   1780 C  C   . THR A 1 220 ? -21.487 -22.366 62.345  1.00 21.08  ? 221 THR A C   1 
ATOM   1781 O  O   . THR A 1 220 ? -21.224 -21.345 62.983  1.00 21.04  ? 221 THR A O   1 
ATOM   1782 C  CB  . THR A 1 220 ? -21.589 -24.621 63.448  1.00 21.80  ? 221 THR A CB  1 
ATOM   1783 O  OG1 . THR A 1 220 ? -22.472 -25.577 64.048  1.00 22.93  ? 221 THR A OG1 1 
ATOM   1784 C  CG2 . THR A 1 220 ? -20.566 -24.189 64.495  1.00 22.31  ? 221 THR A CG2 1 
ATOM   1785 N  N   . LYS A 1 221 ? -20.999 -22.623 61.133  1.00 20.88  ? 222 LYS A N   1 
ATOM   1786 C  CA  . LYS A 1 221 ? -20.096 -21.686 60.479  1.00 21.31  ? 222 LYS A CA  1 
ATOM   1787 C  C   . LYS A 1 221 ? -20.743 -20.312 60.227  1.00 20.48  ? 222 LYS A C   1 
ATOM   1788 O  O   . LYS A 1 221 ? -20.119 -19.275 60.463  1.00 20.26  ? 222 LYS A O   1 
ATOM   1789 C  CB  . LYS A 1 221 ? -19.552 -22.254 59.168  1.00 21.92  ? 222 LYS A CB  1 
ATOM   1790 C  CG  . LYS A 1 221 ? -18.354 -21.454 58.651  1.00 24.99  ? 222 LYS A CG  1 
ATOM   1791 C  CD  . LYS A 1 221 ? -18.212 -21.565 57.153  1.00 30.13  ? 222 LYS A CD  1 
ATOM   1792 C  CE  . LYS A 1 221 ? -17.580 -20.292 56.584  1.00 33.56  ? 222 LYS A CE  1 
ATOM   1793 N  NZ  . LYS A 1 221 ? -17.503 -20.388 55.092  1.00 36.91  ? 222 LYS A NZ  1 
ATOM   1794 N  N   . THR A 1 222 ? -21.985 -20.322 59.739  1.00 19.54  ? 223 THR A N   1 
ATOM   1795 C  CA  . THR A 1 222 ? -22.720 -19.086 59.448  1.00 18.60  ? 223 THR A CA  1 
ATOM   1796 C  C   . THR A 1 222 ? -22.953 -18.256 60.719  1.00 17.83  ? 223 THR A C   1 
ATOM   1797 O  O   . THR A 1 222 ? -22.776 -17.038 60.712  1.00 16.87  ? 223 THR A O   1 
ATOM   1798 C  CB  . THR A 1 222 ? -24.062 -19.375 58.725  1.00 18.37  ? 223 THR A CB  1 
ATOM   1799 O  OG1 . THR A 1 222 ? -23.791 -19.898 57.416  1.00 19.28  ? 223 THR A OG1 1 
ATOM   1800 C  CG2 . THR A 1 222 ? -24.871 -18.109 58.575  1.00 17.33  ? 223 THR A CG2 1 
ATOM   1801 N  N   . TRP A 1 223 ? -23.333 -18.935 61.799  1.00 17.51  ? 224 TRP A N   1 
ATOM   1802 C  CA  . TRP A 1 223 ? -23.550 -18.295 63.083  1.00 18.10  ? 224 TRP A CA  1 
ATOM   1803 C  C   . TRP A 1 223 ? -22.253 -17.661 63.584  1.00 18.56  ? 224 TRP A C   1 
ATOM   1804 O  O   . TRP A 1 223 ? -22.257 -16.510 64.033  1.00 18.30  ? 224 TRP A O   1 
ATOM   1805 C  CB  . TRP A 1 223 ? -24.115 -19.285 64.110  1.00 17.89  ? 224 TRP A CB  1 
ATOM   1806 C  CG  . TRP A 1 223 ? -24.141 -18.750 65.520  1.00 18.28  ? 224 TRP A CG  1 
ATOM   1807 C  CD1 . TRP A 1 223 ? -23.359 -19.160 66.563  1.00 18.55  ? 224 TRP A CD1 1 
ATOM   1808 C  CD2 . TRP A 1 223 ? -24.975 -17.699 66.036  1.00 17.10  ? 224 TRP A CD2 1 
ATOM   1809 N  NE1 . TRP A 1 223 ? -23.661 -18.439 67.692  1.00 18.15  ? 224 TRP A NE1 1 
ATOM   1810 C  CE2 . TRP A 1 223 ? -24.646 -17.535 67.397  1.00 18.02  ? 224 TRP A CE2 1 
ATOM   1811 C  CE3 . TRP A 1 223 ? -25.966 -16.887 65.481  1.00 16.71  ? 224 TRP A CE3 1 
ATOM   1812 C  CZ2 . TRP A 1 223 ? -25.275 -16.584 68.217  1.00 18.23  ? 224 TRP A CZ2 1 
ATOM   1813 C  CZ3 . TRP A 1 223 ? -26.592 -15.945 66.295  1.00 17.16  ? 224 TRP A CZ3 1 
ATOM   1814 C  CH2 . TRP A 1 223 ? -26.246 -15.804 67.646  1.00 17.01  ? 224 TRP A CH2 1 
ATOM   1815 N  N   . LYS A 1 224 ? -21.151 -18.400 63.473  1.00 18.85  ? 225 LYS A N   1 
ATOM   1816 C  CA  . LYS A 1 224 ? -19.846 -17.881 63.863  1.00 19.91  ? 225 LYS A CA  1 
ATOM   1817 C  C   . LYS A 1 224 ? -19.489 -16.626 63.050  1.00 19.35  ? 225 LYS A C   1 
ATOM   1818 O  O   . LYS A 1 224 ? -19.063 -15.625 63.625  1.00 19.04  ? 225 LYS A O   1 
ATOM   1819 C  CB  . LYS A 1 224 ? -18.765 -18.969 63.752  1.00 20.49  ? 225 LYS A CB  1 
ATOM   1820 C  CG  . LYS A 1 224 ? -17.328 -18.444 63.703  1.00 24.28  ? 225 LYS A CG  1 
ATOM   1821 C  CD  . LYS A 1 224 ? -16.282 -19.565 63.849  1.00 28.95  ? 225 LYS A CD  1 
ATOM   1822 C  CE  . LYS A 1 224 ? -14.885 -18.960 64.048  1.00 32.05  ? 225 LYS A CE  1 
ATOM   1823 N  NZ  . LYS A 1 224 ? -13.919 -19.930 64.652  1.00 34.38  ? 225 LYS A NZ  1 
ATOM   1824 N  N   . ASP A 1 225 ? -19.670 -16.677 61.728  1.00 18.82  ? 226 ASP A N   1 
ATOM   1825 C  CA  . ASP A 1 225 ? -19.398 -15.508 60.871  1.00 18.51  ? 226 ASP A CA  1 
ATOM   1826 C  C   . ASP A 1 225 ? -20.279 -14.305 61.225  1.00 17.96  ? 226 ASP A C   1 
ATOM   1827 O  O   . ASP A 1 225 ? -19.819 -13.158 61.207  1.00 18.64  ? 226 ASP A O   1 
ATOM   1828 C  CB  . ASP A 1 225 ? -19.600 -15.854 59.393  1.00 18.97  ? 226 ASP A CB  1 
ATOM   1829 C  CG  . ASP A 1 225 ? -18.527 -16.796 58.849  1.00 19.25  ? 226 ASP A CG  1 
ATOM   1830 O  OD1 . ASP A 1 225 ? -17.470 -16.962 59.483  1.00 21.87  ? 226 ASP A OD1 1 
ATOM   1831 O  OD2 . ASP A 1 225 ? -18.740 -17.360 57.766  1.00 20.21  ? 226 ASP A OD2 1 
ATOM   1832 N  N   . HIS A 1 226 ? -21.533 -14.588 61.555  1.00 16.84  ? 227 HIS A N   1 
ATOM   1833 C  CA  . HIS A 1 226 ? -22.532 -13.588 61.894  1.00 16.42  ? 227 HIS A CA  1 
ATOM   1834 C  C   . HIS A 1 226 ? -22.169 -12.877 63.205  1.00 16.29  ? 227 HIS A C   1 
ATOM   1835 O  O   . HIS A 1 226 ? -22.236 -11.649 63.285  1.00 16.05  ? 227 HIS A O   1 
ATOM   1836 C  CB  . HIS A 1 226 ? -23.892 -14.280 62.027  1.00 15.57  ? 227 HIS A CB  1 
ATOM   1837 C  CG  . HIS A 1 226 ? -25.040 -13.348 62.251  1.00 15.31  ? 227 HIS A CG  1 
ATOM   1838 N  ND1 . HIS A 1 226 ? -25.518 -12.504 61.269  1.00 14.36  ? 227 HIS A ND1 1 
ATOM   1839 C  CD2 . HIS A 1 226 ? -25.841 -13.163 63.329  1.00 13.27  ? 227 HIS A CD2 1 
ATOM   1840 C  CE1 . HIS A 1 226 ? -26.540 -11.816 61.745  1.00 13.12  ? 227 HIS A CE1 1 
ATOM   1841 N  NE2 . HIS A 1 226 ? -26.759 -12.203 62.988  1.00 13.51  ? 227 HIS A NE2 1 
ATOM   1842 N  N   . VAL A 1 227 ? -21.806 -13.666 64.220  1.00 16.00  ? 228 VAL A N   1 
ATOM   1843 C  CA  . VAL A 1 227 ? -21.284 -13.153 65.494  1.00 15.94  ? 228 VAL A CA  1 
ATOM   1844 C  C   . VAL A 1 227 ? -20.101 -12.222 65.260  1.00 15.74  ? 228 VAL A C   1 
ATOM   1845 O  O   . VAL A 1 227 ? -20.054 -11.138 65.823  1.00 15.98  ? 228 VAL A O   1 
ATOM   1846 C  CB  . VAL A 1 227 ? -20.888 -14.305 66.485  1.00 16.21  ? 228 VAL A CB  1 
ATOM   1847 C  CG1 . VAL A 1 227 ? -20.166 -13.755 67.739  1.00 15.20  ? 228 VAL A CG1 1 
ATOM   1848 C  CG2 . VAL A 1 227 ? -22.116 -15.078 66.920  1.00 16.53  ? 228 VAL A CG2 1 
ATOM   1849 N  N   . ALA A 1 228 ? -19.164 -12.629 64.410  1.00 15.69  ? 229 ALA A N   1 
ATOM   1850 C  CA  . ALA A 1 228 ? -17.982 -11.805 64.143  1.00 15.98  ? 229 ALA A CA  1 
ATOM   1851 C  C   . ALA A 1 228 ? -18.336 -10.482 63.454  1.00 16.05  ? 229 ALA A C   1 
ATOM   1852 O  O   . ALA A 1 228 ? -17.721 -9.459  63.739  1.00 16.46  ? 229 ALA A O   1 
ATOM   1853 C  CB  . ALA A 1 228 ? -16.946 -12.579 63.325  1.00 15.95  ? 229 ALA A CB  1 
ATOM   1854 N  N   . ALA A 1 229 ? -19.326 -10.507 62.557  1.00 15.80  ? 230 ALA A N   1 
ATOM   1855 C  CA  . ALA A 1 229 ? -19.795 -9.292  61.884  1.00 14.88  ? 230 ALA A CA  1 
ATOM   1856 C  C   . ALA A 1 229 ? -20.389 -8.287  62.872  1.00 14.67  ? 230 ALA A C   1 
ATOM   1857 O  O   . ALA A 1 229 ? -20.024 -7.108  62.850  1.00 14.59  ? 230 ALA A O   1 
ATOM   1858 C  CB  . ALA A 1 229 ? -20.805 -9.627  60.778  1.00 14.42  ? 230 ALA A CB  1 
ATOM   1859 N  N   . TRP A 1 230 ? -21.306 -8.744  63.722  1.00 14.35  ? 231 TRP A N   1 
ATOM   1860 C  CA  . TRP A 1 230 ? -21.890 -7.875  64.757  1.00 14.74  ? 231 TRP A CA  1 
ATOM   1861 C  C   . TRP A 1 230 ? -20.819 -7.314  65.712  1.00 15.45  ? 231 TRP A C   1 
ATOM   1862 O  O   . TRP A 1 230 ? -20.909 -6.153  66.117  1.00 15.24  ? 231 TRP A O   1 
ATOM   1863 C  CB  . TRP A 1 230 ? -22.944 -8.619  65.579  1.00 14.37  ? 231 TRP A CB  1 
ATOM   1864 C  CG  . TRP A 1 230 ? -24.334 -8.648  65.020  1.00 12.89  ? 231 TRP A CG  1 
ATOM   1865 C  CD1 . TRP A 1 230 ? -24.991 -9.737  64.523  1.00 11.74  ? 231 TRP A CD1 1 
ATOM   1866 C  CD2 . TRP A 1 230 ? -25.256 -7.550  64.935  1.00 12.36  ? 231 TRP A CD2 1 
ATOM   1867 N  NE1 . TRP A 1 230 ? -26.259 -9.383  64.119  1.00 12.07  ? 231 TRP A NE1 1 
ATOM   1868 C  CE2 . TRP A 1 230 ? -26.446 -8.048  64.357  1.00 11.27  ? 231 TRP A CE2 1 
ATOM   1869 C  CE3 . TRP A 1 230 ? -25.188 -6.190  65.278  1.00 11.65  ? 231 TRP A CE3 1 
ATOM   1870 C  CZ2 . TRP A 1 230 ? -27.553 -7.241  64.118  1.00 11.08  ? 231 TRP A CZ2 1 
ATOM   1871 C  CZ3 . TRP A 1 230 ? -26.293 -5.391  65.056  1.00 9.79   ? 231 TRP A CZ3 1 
ATOM   1872 C  CH2 . TRP A 1 230 ? -27.461 -5.917  64.475  1.00 10.81  ? 231 TRP A CH2 1 
ATOM   1873 N  N   . ASP A 1 231 ? -19.818 -8.134  66.062  1.00 16.13  ? 232 ASP A N   1 
ATOM   1874 C  CA  . ASP A 1 231 ? -18.725 -7.688  66.948  1.00 17.42  ? 232 ASP A CA  1 
ATOM   1875 C  C   . ASP A 1 231 ? -17.970 -6.493  66.377  1.00 17.40  ? 232 ASP A C   1 
ATOM   1876 O  O   . ASP A 1 231 ? -17.643 -5.572  67.114  1.00 17.51  ? 232 ASP A O   1 
ATOM   1877 C  CB  . ASP A 1 231 ? -17.751 -8.823  67.303  1.00 17.35  ? 232 ASP A CB  1 
ATOM   1878 C  CG  . ASP A 1 231 ? -18.326 -9.797  68.333  1.00 19.37  ? 232 ASP A CG  1 
ATOM   1879 O  OD1 . ASP A 1 231 ? -19.284 -9.446  69.059  1.00 21.31  ? 232 ASP A OD1 1 
ATOM   1880 O  OD2 . ASP A 1 231 ? -17.821 -10.935 68.412  1.00 22.91  ? 232 ASP A OD2 1 
ATOM   1881 N  N   . VAL A 1 232 ? -17.729 -6.505  65.067  1.00 17.81  ? 233 VAL A N   1 
ATOM   1882 C  CA  . VAL A 1 232 ? -17.122 -5.369  64.375  1.00 17.98  ? 233 VAL A CA  1 
ATOM   1883 C  C   . VAL A 1 232 ? -18.059 -4.172  64.469  1.00 18.44  ? 233 VAL A C   1 
ATOM   1884 O  O   . VAL A 1 232 ? -17.638 -3.085  64.874  1.00 18.68  ? 233 VAL A O   1 
ATOM   1885 C  CB  . VAL A 1 232 ? -16.812 -5.686  62.891  1.00 18.31  ? 233 VAL A CB  1 
ATOM   1886 C  CG1 . VAL A 1 232 ? -16.275 -4.455  62.169  1.00 17.20  ? 233 VAL A CG1 1 
ATOM   1887 C  CG2 . VAL A 1 232 ? -15.818 -6.852  62.779  1.00 17.89  ? 233 VAL A CG2 1 
ATOM   1888 N  N   . ILE A 1 233 ? -19.334 -4.380  64.131  1.00 18.73  ? 234 ILE A N   1 
ATOM   1889 C  CA  . ILE A 1 233 ? -20.335 -3.315  64.221  1.00 18.91  ? 234 ILE A CA  1 
ATOM   1890 C  C   . ILE A 1 233 ? -20.304 -2.637  65.595  1.00 19.86  ? 234 ILE A C   1 
ATOM   1891 O  O   . ILE A 1 233 ? -20.157 -1.411  65.685  1.00 19.80  ? 234 ILE A O   1 
ATOM   1892 C  CB  . ILE A 1 233 ? -21.776 -3.815  63.846  1.00 18.84  ? 234 ILE A CB  1 
ATOM   1893 C  CG1 . ILE A 1 233 ? -21.843 -4.140  62.342  1.00 17.88  ? 234 ILE A CG1 1 
ATOM   1894 C  CG2 . ILE A 1 233 ? -22.851 -2.773  64.239  1.00 17.43  ? 234 ILE A CG2 1 
ATOM   1895 C  CD1 . ILE A 1 233 ? -23.076 -4.872  61.898  1.00 13.16  ? 234 ILE A CD1 1 
ATOM   1896 N  N   . PHE A 1 234 ? -20.421 -3.438  66.654  1.00 20.79  ? 235 PHE A N   1 
ATOM   1897 C  CA  . PHE A 1 234 ? -20.445 -2.923  68.019  1.00 21.97  ? 235 PHE A CA  1 
ATOM   1898 C  C   . PHE A 1 234 ? -19.131 -2.306  68.472  1.00 22.75  ? 235 PHE A C   1 
ATOM   1899 O  O   . PHE A 1 234 ? -19.138 -1.226  69.058  1.00 23.12  ? 235 PHE A O   1 
ATOM   1900 C  CB  . PHE A 1 234 ? -20.908 -3.994  69.013  1.00 22.12  ? 235 PHE A CB  1 
ATOM   1901 C  CG  . PHE A 1 234 ? -22.397 -4.017  69.213  1.00 22.36  ? 235 PHE A CG  1 
ATOM   1902 C  CD1 . PHE A 1 234 ? -23.202 -4.855  68.445  1.00 22.84  ? 235 PHE A CD1 1 
ATOM   1903 C  CD2 . PHE A 1 234 ? -22.998 -3.178  70.151  1.00 22.43  ? 235 PHE A CD2 1 
ATOM   1904 C  CE1 . PHE A 1 234 ? -24.596 -4.866  68.608  1.00 22.23  ? 235 PHE A CE1 1 
ATOM   1905 C  CE2 . PHE A 1 234 ? -24.384 -3.183  70.326  1.00 23.42  ? 235 PHE A CE2 1 
ATOM   1906 C  CZ  . PHE A 1 234 ? -25.185 -4.039  69.550  1.00 22.74  ? 235 PHE A CZ  1 
ATOM   1907 N  N   . SER A 1 235 ? -18.007 -2.954  68.187  1.00 23.67  ? 236 SER A N   1 
ATOM   1908 C  CA  . SER A 1 235 ? -16.740 -2.452  68.710  1.00 24.86  ? 236 SER A CA  1 
ATOM   1909 C  C   . SER A 1 235 ? -16.420 -1.072  68.135  1.00 25.03  ? 236 SER A C   1 
ATOM   1910 O  O   . SER A 1 235 ? -16.016 -0.169  68.872  1.00 24.99  ? 236 SER A O   1 
ATOM   1911 C  CB  . SER A 1 235 ? -15.599 -3.455  68.522  1.00 24.92  ? 236 SER A CB  1 
ATOM   1912 O  OG  . SER A 1 235 ? -15.181 -3.524  67.171  1.00 28.82  ? 236 SER A OG  1 
ATOM   1913 N  N   . LYS A 1 236 ? -16.678 -0.895  66.841  1.00 24.96  ? 237 LYS A N   1 
ATOM   1914 C  CA  . LYS A 1 236 ? -16.432 0.379   66.186  1.00 25.22  ? 237 LYS A CA  1 
ATOM   1915 C  C   . LYS A 1 236 ? -17.467 1.458   66.510  1.00 25.18  ? 237 LYS A C   1 
ATOM   1916 O  O   . LYS A 1 236 ? -17.099 2.616   66.729  1.00 24.78  ? 237 LYS A O   1 
ATOM   1917 C  CB  . LYS A 1 236 ? -16.260 0.184   64.683  1.00 25.53  ? 237 LYS A CB  1 
ATOM   1918 C  CG  . LYS A 1 236 ? -15.163 -0.835  64.389  1.00 26.46  ? 237 LYS A CG  1 
ATOM   1919 C  CD  . LYS A 1 236 ? -14.627 -0.740  62.992  1.00 27.81  ? 237 LYS A CD  1 
ATOM   1920 C  CE  . LYS A 1 236 ? -13.271 -1.409  62.923  1.00 27.81  ? 237 LYS A CE  1 
ATOM   1921 N  NZ  . LYS A 1 236 ? -12.292 -0.698  63.794  1.00 29.15  ? 237 LYS A NZ  1 
ATOM   1922 N  N   . ALA A 1 237 ? -18.747 1.093   66.568  1.00 24.95  ? 238 ALA A N   1 
ATOM   1923 C  CA  . ALA A 1 237 ? -19.766 2.076   66.952  1.00 25.11  ? 238 ALA A CA  1 
ATOM   1924 C  C   . ALA A 1 237 ? -19.553 2.562   68.393  1.00 24.95  ? 238 ALA A C   1 
ATOM   1925 O  O   . ALA A 1 237 ? -19.765 3.731   68.687  1.00 24.82  ? 238 ALA A O   1 
ATOM   1926 C  CB  . ALA A 1 237 ? -21.168 1.527   66.769  1.00 24.84  ? 238 ALA A CB  1 
ATOM   1927 N  N   . ASP A 1 238 ? -19.139 1.653   69.273  1.00 25.16  ? 239 ASP A N   1 
ATOM   1928 C  CA  . ASP A 1 238 ? -18.778 1.989   70.648  1.00 25.90  ? 239 ASP A CA  1 
ATOM   1929 C  C   . ASP A 1 238 ? -17.651 3.028   70.689  1.00 25.75  ? 239 ASP A C   1 
ATOM   1930 O  O   . ASP A 1 238 ? -17.749 4.025   71.391  1.00 25.66  ? 239 ASP A O   1 
ATOM   1931 C  CB  . ASP A 1 238 ? -18.324 0.737   71.406  1.00 26.33  ? 239 ASP A CB  1 
ATOM   1932 C  CG  . ASP A 1 238 ? -19.481 -0.100  71.942  1.00 29.27  ? 239 ASP A CG  1 
ATOM   1933 O  OD1 . ASP A 1 238 ? -20.598 -0.081  71.373  1.00 31.93  ? 239 ASP A OD1 1 
ATOM   1934 O  OD2 . ASP A 1 238 ? -19.257 -0.806  72.952  1.00 33.88  ? 239 ASP A OD2 1 
ATOM   1935 N  N   . ILE A 1 239 ? -16.584 2.775   69.938  1.00 25.66  ? 240 ILE A N   1 
ATOM   1936 C  CA  . ILE A 1 239 ? -15.427 3.671   69.887  1.00 25.93  ? 240 ILE A CA  1 
ATOM   1937 C  C   . ILE A 1 239 ? -15.811 5.077   69.402  1.00 25.85  ? 240 ILE A C   1 
ATOM   1938 O  O   . ILE A 1 239 ? -15.455 6.077   70.050  1.00 25.72  ? 240 ILE A O   1 
ATOM   1939 C  CB  . ILE A 1 239 ? -14.268 3.070   69.035  1.00 26.06  ? 240 ILE A CB  1 
ATOM   1940 C  CG1 . ILE A 1 239 ? -13.700 1.820   69.720  1.00 26.50  ? 240 ILE A CG1 1 
ATOM   1941 C  CG2 . ILE A 1 239 ? -13.152 4.094   68.822  1.00 26.67  ? 240 ILE A CG2 1 
ATOM   1942 C  CD1 . ILE A 1 239 ? -12.844 0.920   68.805  1.00 29.34  ? 240 ILE A CD1 1 
ATOM   1943 N  N   . TYR A 1 240 ? -16.554 5.151   68.294  1.00 25.31  ? 241 TYR A N   1 
ATOM   1944 C  CA  . TYR A 1 240 ? -17.015 6.440   67.770  1.00 25.15  ? 241 TYR A CA  1 
ATOM   1945 C  C   . TYR A 1 240 ? -17.750 7.234   68.842  1.00 24.04  ? 241 TYR A C   1 
ATOM   1946 O  O   . TYR A 1 240 ? -17.430 8.390   69.092  1.00 23.34  ? 241 TYR A O   1 
ATOM   1947 C  CB  . TYR A 1 240 ? -17.944 6.271   66.566  1.00 25.61  ? 241 TYR A CB  1 
ATOM   1948 C  CG  . TYR A 1 240 ? -17.305 5.769   65.290  1.00 27.91  ? 241 TYR A CG  1 
ATOM   1949 C  CD1 . TYR A 1 240 ? -18.047 5.016   64.380  1.00 29.47  ? 241 TYR A CD1 1 
ATOM   1950 C  CD2 . TYR A 1 240 ? -15.971 6.050   64.979  1.00 31.06  ? 241 TYR A CD2 1 
ATOM   1951 C  CE1 . TYR A 1 240 ? -17.485 4.544   63.198  1.00 30.50  ? 241 TYR A CE1 1 
ATOM   1952 C  CE2 . TYR A 1 240 ? -15.393 5.576   63.791  1.00 32.19  ? 241 TYR A CE2 1 
ATOM   1953 C  CZ  . TYR A 1 240 ? -16.167 4.825   62.909  1.00 31.87  ? 241 TYR A CZ  1 
ATOM   1954 O  OH  . TYR A 1 240 ? -15.631 4.355   61.735  1.00 32.61  ? 241 TYR A OH  1 
ATOM   1955 N  N   . THR A 1 241 ? -18.732 6.595   69.466  1.00 23.26  ? 242 THR A N   1 
ATOM   1956 C  CA  . THR A 1 241 ? -19.557 7.239   70.477  1.00 22.93  ? 242 THR A CA  1 
ATOM   1957 C  C   . THR A 1 241 ? -18.739 7.651   71.705  1.00 22.80  ? 242 THR A C   1 
ATOM   1958 O  O   . THR A 1 241 ? -18.915 8.750   72.218  1.00 22.36  ? 242 THR A O   1 
ATOM   1959 C  CB  . THR A 1 241 ? -20.743 6.342   70.878  1.00 22.71  ? 242 THR A CB  1 
ATOM   1960 O  OG1 . THR A 1 241 ? -21.516 6.063   69.708  1.00 23.91  ? 242 THR A OG1 1 
ATOM   1961 C  CG2 . THR A 1 241 ? -21.650 7.029   71.913  1.00 21.30  ? 242 THR A CG2 1 
ATOM   1962 N  N   . GLN A 1 242 ? -17.837 6.777   72.141  1.00 22.86  ? 243 GLN A N   1 
ATOM   1963 C  CA  . GLN A 1 242 ? -17.045 7.021   73.340  1.00 23.71  ? 243 GLN A CA  1 
ATOM   1964 C  C   . GLN A 1 242 ? -16.024 8.139   73.117  1.00 23.05  ? 243 GLN A C   1 
ATOM   1965 O  O   . GLN A 1 242 ? -15.868 9.006   73.986  1.00 22.71  ? 243 GLN A O   1 
ATOM   1966 C  CB  . GLN A 1 242 ? -16.365 5.729   73.827  1.00 24.22  ? 243 GLN A CB  1 
ATOM   1967 C  CG  . GLN A 1 242 ? -15.784 5.817   75.238  1.00 27.69  ? 243 GLN A CG  1 
ATOM   1968 C  CD  . GLN A 1 242 ? -15.086 4.535   75.669  1.00 32.49  ? 243 GLN A CD  1 
ATOM   1969 O  OE1 . GLN A 1 242 ? -15.641 3.433   75.539  1.00 34.22  ? 243 GLN A OE1 1 
ATOM   1970 N  NE2 . GLN A 1 242 ? -13.857 4.669   76.173  1.00 32.75  ? 243 GLN A NE2 1 
ATOM   1971 N  N   . ASN A 1 243 ? -15.347 8.120   71.962  1.00 22.32  ? 244 ASN A N   1 
ATOM   1972 C  CA  . ASN A 1 243 ? -14.433 9.199   71.581  1.00 21.94  ? 244 ASN A CA  1 
ATOM   1973 C  C   . ASN A 1 243 ? -15.149 10.547  71.537  1.00 21.70  ? 244 ASN A C   1 
ATOM   1974 O  O   . ASN A 1 243 ? -14.615 11.541  72.018  1.00 22.03  ? 244 ASN A O   1 
ATOM   1975 C  CB  . ASN A 1 243 ? -13.760 8.940   70.228  1.00 21.96  ? 244 ASN A CB  1 
ATOM   1976 C  CG  . ASN A 1 243 ? -12.746 7.806   70.277  1.00 22.54  ? 244 ASN A CG  1 
ATOM   1977 O  OD1 . ASN A 1 243 ? -12.334 7.371   71.346  1.00 22.21  ? 244 ASN A OD1 1 
ATOM   1978 N  ND2 . ASN A 1 243 ? -12.345 7.320   69.105  1.00 22.96  ? 244 ASN A ND2 1 
ATOM   1979 N  N   . PHE A 1 244 ? -16.360 10.561  70.978  1.00 20.67  ? 245 PHE A N   1 
ATOM   1980 C  CA  . PHE A 1 244 ? -17.150 11.780  70.831  1.00 19.85  ? 245 PHE A CA  1 
ATOM   1981 C  C   . PHE A 1 244 ? -17.560 12.330  72.192  1.00 19.72  ? 245 PHE A C   1 
ATOM   1982 O  O   . PHE A 1 244 ? -17.539 13.546  72.425  1.00 18.95  ? 245 PHE A O   1 
ATOM   1983 C  CB  . PHE A 1 244 ? -18.402 11.502  69.990  1.00 19.24  ? 245 PHE A CB  1 
ATOM   1984 C  CG  . PHE A 1 244 ? -19.200 12.729  69.661  1.00 19.03  ? 245 PHE A CG  1 
ATOM   1985 C  CD1 . PHE A 1 244 ? -18.977 13.422  68.478  1.00 19.51  ? 245 PHE A CD1 1 
ATOM   1986 C  CD2 . PHE A 1 244 ? -20.189 13.187  70.524  1.00 18.40  ? 245 PHE A CD2 1 
ATOM   1987 C  CE1 . PHE A 1 244 ? -19.708 14.559  68.174  1.00 18.95  ? 245 PHE A CE1 1 
ATOM   1988 C  CE2 . PHE A 1 244 ? -20.927 14.314  70.225  1.00 17.89  ? 245 PHE A CE2 1 
ATOM   1989 C  CZ  . PHE A 1 244 ? -20.686 15.002  69.046  1.00 18.58  ? 245 PHE A CZ  1 
ATOM   1990 N  N   . TYR A 1 245 ? -17.970 11.419  73.072  1.00 19.65  ? 246 TYR A N   1 
ATOM   1991 C  CA  . TYR A 1 245 ? -18.366 11.765  74.433  1.00 19.69  ? 246 TYR A CA  1 
ATOM   1992 C  C   . TYR A 1 245 ? -17.241 12.495  75.161  1.00 19.53  ? 246 TYR A C   1 
ATOM   1993 O  O   . TYR A 1 245 ? -17.475 13.538  75.760  1.00 19.28  ? 246 TYR A O   1 
ATOM   1994 C  CB  . TYR A 1 245 ? -18.781 10.493  75.165  1.00 19.77  ? 246 TYR A CB  1 
ATOM   1995 C  CG  . TYR A 1 245 ? -19.100 10.603  76.641  1.00 19.62  ? 246 TYR A CG  1 
ATOM   1996 C  CD1 . TYR A 1 245 ? -20.423 10.639  77.086  1.00 20.40  ? 246 TYR A CD1 1 
ATOM   1997 C  CD2 . TYR A 1 245 ? -18.086 10.611  77.592  1.00 19.95  ? 246 TYR A CD2 1 
ATOM   1998 C  CE1 . TYR A 1 245 ? -20.729 10.697  78.448  1.00 20.95  ? 246 TYR A CE1 1 
ATOM   1999 C  CE2 . TYR A 1 245 ? -18.378 10.658  78.961  1.00 21.31  ? 246 TYR A CE2 1 
ATOM   2000 C  CZ  . TYR A 1 245 ? -19.697 10.698  79.376  1.00 22.06  ? 246 TYR A CZ  1 
ATOM   2001 O  OH  . TYR A 1 245 ? -19.977 10.750  80.719  1.00 25.28  ? 246 TYR A OH  1 
ATOM   2002 N  N   . TRP A 1 246 ? -16.023 11.964  75.072  1.00 20.20  ? 247 TRP A N   1 
ATOM   2003 C  CA  . TRP A 1 246 ? -14.873 12.554  75.757  1.00 21.24  ? 247 TRP A CA  1 
ATOM   2004 C  C   . TRP A 1 246 ? -14.331 13.819  75.100  1.00 22.68  ? 247 TRP A C   1 
ATOM   2005 O  O   . TRP A 1 246 ? -13.948 14.763  75.803  1.00 22.37  ? 247 TRP A O   1 
ATOM   2006 C  CB  . TRP A 1 246 ? -13.780 11.516  76.014  1.00 20.59  ? 247 TRP A CB  1 
ATOM   2007 C  CG  . TRP A 1 246 ? -14.160 10.621  77.147  1.00 20.91  ? 247 TRP A CG  1 
ATOM   2008 C  CD1 . TRP A 1 246 ? -14.533 9.305   77.074  1.00 20.15  ? 247 TRP A CD1 1 
ATOM   2009 C  CD2 . TRP A 1 246 ? -14.270 10.992  78.529  1.00 21.01  ? 247 TRP A CD2 1 
ATOM   2010 N  NE1 . TRP A 1 246 ? -14.837 8.830   78.325  1.00 19.79  ? 247 TRP A NE1 1 
ATOM   2011 C  CE2 . TRP A 1 246 ? -14.687 9.842   79.238  1.00 20.39  ? 247 TRP A CE2 1 
ATOM   2012 C  CE3 . TRP A 1 246 ? -14.044 12.184  79.241  1.00 19.53  ? 247 TRP A CE3 1 
ATOM   2013 C  CZ2 . TRP A 1 246 ? -14.888 9.847   80.625  1.00 19.53  ? 247 TRP A CZ2 1 
ATOM   2014 C  CZ3 . TRP A 1 246 ? -14.235 12.184  80.624  1.00 20.18  ? 247 TRP A CZ3 1 
ATOM   2015 C  CH2 . TRP A 1 246 ? -14.660 11.021  81.298  1.00 19.13  ? 247 TRP A CH2 1 
ATOM   2016 N  N   . GLU A 1 247 ? -14.316 13.845  73.768  1.00 23.93  ? 248 GLU A N   1 
ATOM   2017 C  CA  . GLU A 1 247 ? -13.938 15.048  73.021  1.00 25.99  ? 248 GLU A CA  1 
ATOM   2018 C  C   . GLU A 1 247 ? -14.885 16.210  73.310  1.00 26.52  ? 248 GLU A C   1 
ATOM   2019 O  O   . GLU A 1 247 ? -14.478 17.369  73.299  1.00 26.40  ? 248 GLU A O   1 
ATOM   2020 C  CB  . GLU A 1 247 ? -13.916 14.776  71.523  1.00 25.96  ? 248 GLU A CB  1 
ATOM   2021 C  CG  . GLU A 1 247 ? -12.750 13.937  71.054  1.00 29.06  ? 248 GLU A CG  1 
ATOM   2022 C  CD  . GLU A 1 247 ? -12.927 13.454  69.624  1.00 32.97  ? 248 GLU A CD  1 
ATOM   2023 O  OE1 . GLU A 1 247 ? -13.544 14.188  68.810  1.00 35.05  ? 248 GLU A OE1 1 
ATOM   2024 O  OE2 . GLU A 1 247 ? -12.448 12.340  69.312  1.00 34.76  ? 248 GLU A OE2 1 
ATOM   2025 N  N   . LEU A 1 248 ? -16.143 15.890  73.585  1.00 27.75  ? 249 LEU A N   1 
ATOM   2026 C  CA  . LEU A 1 248 ? -17.136 16.904  73.912  1.00 29.53  ? 249 LEU A CA  1 
ATOM   2027 C  C   . LEU A 1 248 ? -16.777 17.619  75.220  1.00 30.71  ? 249 LEU A C   1 
ATOM   2028 O  O   . LEU A 1 248 ? -17.038 18.812  75.385  1.00 31.00  ? 249 LEU A O   1 
ATOM   2029 C  CB  . LEU A 1 248 ? -18.509 16.257  74.024  1.00 29.58  ? 249 LEU A CB  1 
ATOM   2030 C  CG  . LEU A 1 248 ? -19.716 17.173  73.936  1.00 30.75  ? 249 LEU A CG  1 
ATOM   2031 C  CD1 . LEU A 1 248 ? -19.776 17.776  72.533  1.00 31.55  ? 249 LEU A CD1 1 
ATOM   2032 C  CD2 . LEU A 1 248 ? -20.981 16.395  74.271  1.00 30.37  ? 249 LEU A CD2 1 
ATOM   2033 N  N   . ARG A 1 249 ? -16.170 16.877  76.141  1.00 31.91  ? 250 ARG A N   1 
ATOM   2034 C  CA  . ARG A 1 249 ? -15.759 17.422  77.421  1.00 33.43  ? 250 ARG A CA  1 
ATOM   2035 C  C   . ARG A 1 249 ? -14.419 18.150  77.322  1.00 34.44  ? 250 ARG A C   1 
ATOM   2036 O  O   . ARG A 1 249 ? -14.180 19.103  78.063  1.00 34.44  ? 250 ARG A O   1 
ATOM   2037 C  CB  . ARG A 1 249 ? -15.727 16.316  78.474  1.00 33.38  ? 250 ARG A CB  1 
ATOM   2038 C  CG  . ARG A 1 249 ? -17.113 15.798  78.815  1.00 33.87  ? 250 ARG A CG  1 
ATOM   2039 C  CD  . ARG A 1 249 ? -17.063 14.447  79.467  1.00 35.90  ? 250 ARG A CD  1 
ATOM   2040 N  NE  . ARG A 1 249 ? -18.272 14.218  80.249  1.00 39.28  ? 250 ARG A NE  1 
ATOM   2041 C  CZ  . ARG A 1 249 ? -18.319 13.535  81.392  1.00 41.75  ? 250 ARG A CZ  1 
ATOM   2042 N  NH1 . ARG A 1 249 ? -17.219 12.992  81.906  1.00 42.22  ? 250 ARG A NH1 1 
ATOM   2043 N  NH2 . ARG A 1 249 ? -19.476 13.401  82.034  1.00 42.23  ? 250 ARG A NH2 1 
ATOM   2044 N  N   . GLN A 1 250 ? -13.567 17.719  76.391  1.00 35.90  ? 251 GLN A N   1 
ATOM   2045 C  CA  . GLN A 1 250 ? -12.276 18.372  76.150  1.00 37.56  ? 251 GLN A CA  1 
ATOM   2046 C  C   . GLN A 1 250 ? -12.424 19.754  75.504  1.00 38.69  ? 251 GLN A C   1 
ATOM   2047 O  O   . GLN A 1 250 ? -11.605 20.637  75.748  1.00 39.02  ? 251 GLN A O   1 
ATOM   2048 C  CB  . GLN A 1 250 ? -11.361 17.505  75.282  1.00 37.47  ? 251 GLN A CB  1 
ATOM   2049 C  CG  . GLN A 1 250 ? -10.929 16.175  75.898  1.00 38.37  ? 251 GLN A CG  1 
ATOM   2050 C  CD  . GLN A 1 250 ? -10.203 15.271  74.896  1.00 39.47  ? 251 GLN A CD  1 
ATOM   2051 O  OE1 . GLN A 1 250 ? -9.407  15.743  74.083  1.00 39.94  ? 251 GLN A OE1 1 
ATOM   2052 N  NE2 . GLN A 1 250 ? -10.479 13.969  74.953  1.00 39.17  ? 251 GLN A NE2 1 
ATOM   2053 N  N   . LYS A 1 251 ? -13.468 19.934  74.696  1.00 39.94  ? 252 LYS A N   1 
ATOM   2054 C  CA  . LYS A 1 251 ? -13.670 21.166  73.918  1.00 41.40  ? 252 LYS A CA  1 
ATOM   2055 C  C   . LYS A 1 251 ? -14.699 22.133  74.513  1.00 42.18  ? 252 LYS A C   1 
ATOM   2056 O  O   . LYS A 1 251 ? -14.691 23.325  74.197  1.00 42.45  ? 252 LYS A O   1 
ATOM   2057 C  CB  . LYS A 1 251 ? -14.068 20.825  72.480  1.00 41.38  ? 252 LYS A CB  1 
ATOM   2058 C  CG  . LYS A 1 251 ? -12.987 20.084  71.710  1.00 42.68  ? 252 LYS A CG  1 
ATOM   2059 C  CD  . LYS A 1 251 ? -13.510 19.545  70.386  1.00 44.42  ? 252 LYS A CD  1 
ATOM   2060 C  CE  . LYS A 1 251 ? -12.403 18.819  69.624  1.00 44.97  ? 252 LYS A CE  1 
ATOM   2061 N  NZ  . LYS A 1 251 ? -12.822 18.474  68.241  1.00 44.88  ? 252 LYS A NZ  1 
ATOM   2062 N  N   . GLY A 1 252 ? -15.579 21.618  75.368  1.00 43.04  ? 253 GLY A N   1 
ATOM   2063 C  CA  . GLY A 1 252 ? -16.697 22.396  75.891  1.00 43.98  ? 253 GLY A CA  1 
ATOM   2064 C  C   . GLY A 1 252 ? -17.990 22.102  75.145  1.00 44.66  ? 253 GLY A C   1 
ATOM   2065 O  O   . GLY A 1 252 ? -17.976 21.568  74.024  1.00 44.59  ? 253 GLY A O   1 
ATOM   2066 N  N   . SER A 1 253 ? -19.110 22.446  75.781  1.00 45.17  ? 254 SER A N   1 
ATOM   2067 C  CA  . SER A 1 253 ? -20.444 22.181  75.236  1.00 45.48  ? 254 SER A CA  1 
ATOM   2068 C  C   . SER A 1 253 ? -21.222 23.494  75.055  1.00 45.46  ? 254 SER A C   1 
ATOM   2069 O  O   . SER A 1 253 ? -22.424 23.576  75.348  1.00 45.56  ? 254 SER A O   1 
ATOM   2070 C  CB  . SER A 1 253 ? -21.202 21.201  76.142  1.00 45.62  ? 254 SER A CB  1 
ATOM   2071 O  OG  . SER A 1 253 ? -22.425 20.793  75.552  1.00 46.61  ? 254 SER A OG  1 
ATOM   2072 N  N   . VAL A 1 254 ? -20.509 24.511  74.566  1.00 45.20  ? 255 VAL A N   1 
ATOM   2073 C  CA  . VAL A 1 254 ? -21.053 25.839  74.306  1.00 44.81  ? 255 VAL A CA  1 
ATOM   2074 C  C   . VAL A 1 254 ? -20.957 26.109  72.801  1.00 44.33  ? 255 VAL A C   1 
ATOM   2075 O  O   . VAL A 1 254 ? -19.942 26.607  72.308  1.00 44.24  ? 255 VAL A O   1 
ATOM   2076 C  CB  . VAL A 1 254 ? -20.285 26.931  75.109  1.00 44.93  ? 255 VAL A CB  1 
ATOM   2077 C  CG1 . VAL A 1 254 ? -20.852 28.328  74.830  1.00 45.08  ? 255 VAL A CG1 1 
ATOM   2078 C  CG2 . VAL A 1 254 ? -20.316 26.627  76.612  1.00 45.30  ? 255 VAL A CG2 1 
ATOM   2079 N  N   . HIS A 1 255 ? -22.011 25.747  72.074  1.00 43.87  ? 256 HIS A N   1 
ATOM   2080 C  CA  . HIS A 1 255 ? -22.036 25.878  70.616  1.00 43.34  ? 256 HIS A CA  1 
ATOM   2081 C  C   . HIS A 1 255 ? -23.386 26.360  70.132  1.00 42.49  ? 256 HIS A C   1 
ATOM   2082 O  O   . HIS A 1 255 ? -24.423 25.786  70.477  1.00 42.16  ? 256 HIS A O   1 
ATOM   2083 C  CB  . HIS A 1 255 ? -21.687 24.551  69.934  1.00 43.69  ? 256 HIS A CB  1 
ATOM   2084 C  CG  . HIS A 1 255 ? -20.216 24.290  69.841  1.00 45.22  ? 256 HIS A CG  1 
ATOM   2085 N  ND1 . HIS A 1 255 ? -19.529 24.325  68.645  1.00 47.27  ? 256 HIS A ND1 1 
ATOM   2086 C  CD2 . HIS A 1 255 ? -19.298 23.999  70.794  1.00 46.61  ? 256 HIS A CD2 1 
ATOM   2087 C  CE1 . HIS A 1 255 ? -18.253 24.059  68.865  1.00 47.60  ? 256 HIS A CE1 1 
ATOM   2088 N  NE2 . HIS A 1 255 ? -18.085 23.864  70.162  1.00 47.40  ? 256 HIS A NE2 1 
ATOM   2089 N  N   . HIS A 1 256 ? -23.361 27.423  69.336  1.00 41.51  ? 257 HIS A N   1 
ATOM   2090 C  CA  . HIS A 1 256 ? -24.578 27.977  68.757  1.00 40.73  ? 257 HIS A CA  1 
ATOM   2091 C  C   . HIS A 1 256 ? -24.895 27.317  67.412  1.00 39.36  ? 257 HIS A C   1 
ATOM   2092 O  O   . HIS A 1 256 ? -26.057 27.228  67.024  1.00 38.99  ? 257 HIS A O   1 
ATOM   2093 C  CB  . HIS A 1 256 ? -24.477 29.501  68.634  1.00 41.27  ? 257 HIS A CB  1 
ATOM   2094 C  CG  . HIS A 1 256 ? -24.327 30.204  69.953  1.00 43.57  ? 257 HIS A CG  1 
ATOM   2095 N  ND1 . HIS A 1 256 ? -25.260 31.098  70.432  1.00 45.49  ? 257 HIS A ND1 1 
ATOM   2096 C  CD2 . HIS A 1 256 ? -23.353 30.137  70.897  1.00 45.47  ? 257 HIS A CD2 1 
ATOM   2097 C  CE1 . HIS A 1 256 ? -24.870 31.552  71.611  1.00 46.48  ? 257 HIS A CE1 1 
ATOM   2098 N  NE2 . HIS A 1 256 ? -23.716 30.983  71.917  1.00 46.45  ? 257 HIS A NE2 1 
ATOM   2099 N  N   . ASP A 1 257 ? -23.861 26.838  66.722  1.00 37.90  ? 258 ASP A N   1 
ATOM   2100 C  CA  . ASP A 1 257 ? -24.040 26.108  65.463  1.00 36.68  ? 258 ASP A CA  1 
ATOM   2101 C  C   . ASP A 1 257 ? -24.483 24.668  65.719  1.00 35.47  ? 258 ASP A C   1 
ATOM   2102 O  O   . ASP A 1 257 ? -24.221 24.115  66.789  1.00 35.47  ? 258 ASP A O   1 
ATOM   2103 C  CB  . ASP A 1 257 ? -22.763 26.147  64.606  1.00 36.74  ? 258 ASP A CB  1 
ATOM   2104 C  CG  . ASP A 1 257 ? -21.543 25.577  65.322  1.00 37.29  ? 258 ASP A CG  1 
ATOM   2105 O  OD1 . ASP A 1 257 ? -21.353 25.867  66.527  1.00 38.11  ? 258 ASP A OD1 1 
ATOM   2106 O  OD2 . ASP A 1 257 ? -20.758 24.847  64.671  1.00 37.67  ? 258 ASP A OD2 1 
ATOM   2107 N  N   . TYR A 1 258 ? -25.159 24.076  64.737  1.00 34.03  ? 259 TYR A N   1 
ATOM   2108 C  CA  . TYR A 1 258 ? -25.567 22.669  64.800  1.00 32.73  ? 259 TYR A CA  1 
ATOM   2109 C  C   . TYR A 1 258 ? -24.380 21.707  64.723  1.00 31.81  ? 259 TYR A C   1 
ATOM   2110 O  O   . TYR A 1 258 ? -23.546 21.809  63.821  1.00 31.75  ? 259 TYR A O   1 
ATOM   2111 C  CB  . TYR A 1 258 ? -26.575 22.346  63.699  1.00 32.44  ? 259 TYR A CB  1 
ATOM   2112 C  CG  . TYR A 1 258 ? -27.182 20.969  63.829  1.00 31.80  ? 259 TYR A CG  1 
ATOM   2113 C  CD1 . TYR A 1 258 ? -28.125 20.691  64.826  1.00 31.23  ? 259 TYR A CD1 1 
ATOM   2114 C  CD2 . TYR A 1 258 ? -26.820 19.945  62.958  1.00 31.29  ? 259 TYR A CD2 1 
ATOM   2115 C  CE1 . TYR A 1 258 ? -28.688 19.427  64.946  1.00 31.14  ? 259 TYR A CE1 1 
ATOM   2116 C  CE2 . TYR A 1 258 ? -27.384 18.676  63.066  1.00 31.00  ? 259 TYR A CE2 1 
ATOM   2117 C  CZ  . TYR A 1 258 ? -28.308 18.426  64.061  1.00 31.13  ? 259 TYR A CZ  1 
ATOM   2118 O  OH  . TYR A 1 258 ? -28.854 17.174  64.171  1.00 30.76  ? 259 TYR A OH  1 
ATOM   2119 N  N   . ARG A 1 259 ? -24.322 20.772  65.665  1.00 30.89  ? 260 ARG A N   1 
ATOM   2120 C  CA  . ARG A 1 259 ? -23.180 19.862  65.788  1.00 30.28  ? 260 ARG A CA  1 
ATOM   2121 C  C   . ARG A 1 259 ? -23.520 18.400  65.488  1.00 29.01  ? 260 ARG A C   1 
ATOM   2122 O  O   . ARG A 1 259 ? -22.655 17.533  65.627  1.00 29.35  ? 260 ARG A O   1 
ATOM   2123 C  CB  . ARG A 1 259 ? -22.570 19.930  67.195  1.00 30.72  ? 260 ARG A CB  1 
ATOM   2124 C  CG  . ARG A 1 259 ? -22.399 21.316  67.810  1.00 32.97  ? 260 ARG A CG  1 
ATOM   2125 C  CD  . ARG A 1 259 ? -21.339 22.144  67.097  1.00 36.83  ? 260 ARG A CD  1 
ATOM   2126 N  NE  . ARG A 1 259 ? -20.081 21.430  66.878  1.00 38.07  ? 260 ARG A NE  1 
ATOM   2127 C  CZ  . ARG A 1 259 ? -19.015 21.976  66.295  1.00 40.52  ? 260 ARG A CZ  1 
ATOM   2128 N  NH1 . ARG A 1 259 ? -19.056 23.241  65.891  1.00 41.55  ? 260 ARG A NH1 1 
ATOM   2129 N  NH2 . ARG A 1 259 ? -17.902 21.268  66.118  1.00 41.15  ? 260 ARG A NH2 1 
ATOM   2130 N  N   . GLY A 1 260 ? -24.763 18.117  65.102  1.00 27.36  ? 261 GLY A N   1 
ATOM   2131 C  CA  . GLY A 1 260 ? -25.167 16.742  64.791  1.00 25.15  ? 261 GLY A CA  1 
ATOM   2132 C  C   . GLY A 1 260 ? -26.122 16.125  65.800  1.00 23.72  ? 261 GLY A C   1 
ATOM   2133 O  O   . GLY A 1 260 ? -26.380 16.699  66.866  1.00 23.62  ? 261 GLY A O   1 
ATOM   2134 N  N   . ILE A 1 261 ? -26.640 14.944  65.466  1.00 22.05  ? 262 ILE A N   1 
ATOM   2135 C  CA  . ILE A 1 261 ? -27.628 14.262  66.303  1.00 20.42  ? 262 ILE A CA  1 
ATOM   2136 C  C   . ILE A 1 261 ? -27.088 13.850  67.689  1.00 20.11  ? 262 ILE A C   1 
ATOM   2137 O  O   . ILE A 1 261 ? -27.779 14.008  68.695  1.00 19.23  ? 262 ILE A O   1 
ATOM   2138 C  CB  . ILE A 1 261 ? -28.220 13.022  65.599  1.00 19.75  ? 262 ILE A CB  1 
ATOM   2139 C  CG1 . ILE A 1 261 ? -28.915 13.412  64.288  1.00 19.00  ? 262 ILE A CG1 1 
ATOM   2140 C  CG2 . ILE A 1 261 ? -29.169 12.281  66.527  1.00 17.95  ? 262 ILE A CG2 1 
ATOM   2141 C  CD1 . ILE A 1 261 ? -29.106 12.238  63.323  1.00 16.37  ? 262 ILE A CD1 1 
ATOM   2142 N  N   . LEU A 1 262 ? -25.874 13.307  67.721  1.00 19.95  ? 263 LEU A N   1 
ATOM   2143 C  CA  . LEU A 1 262 ? -25.301 12.806  68.968  1.00 20.31  ? 263 LEU A CA  1 
ATOM   2144 C  C   . LEU A 1 262 ? -25.127 13.924  70.010  1.00 20.90  ? 263 LEU A C   1 
ATOM   2145 O  O   . LEU A 1 262 ? -25.505 13.760  71.177  1.00 20.52  ? 263 LEU A O   1 
ATOM   2146 C  CB  . LEU A 1 262 ? -23.987 12.045  68.716  1.00 19.34  ? 263 LEU A CB  1 
ATOM   2147 C  CG  . LEU A 1 262 ? -23.352 11.352  69.938  1.00 19.03  ? 263 LEU A CG  1 
ATOM   2148 C  CD1 . LEU A 1 262 ? -24.372 10.536  70.745  1.00 17.21  ? 263 LEU A CD1 1 
ATOM   2149 C  CD2 . LEU A 1 262 ? -22.170 10.481  69.550  1.00 16.91  ? 263 LEU A CD2 1 
ATOM   2150 N  N   . TYR A 1 263 ? -24.574 15.051  69.562  1.00 21.73  ? 264 TYR A N   1 
ATOM   2151 C  CA  . TYR A 1 263 ? -24.406 16.249  70.386  1.00 22.88  ? 264 TYR A CA  1 
ATOM   2152 C  C   . TYR A 1 263 ? -25.705 16.600  71.091  1.00 23.18  ? 264 TYR A C   1 
ATOM   2153 O  O   . TYR A 1 263 ? -25.703 16.854  72.289  1.00 23.37  ? 264 TYR A O   1 
ATOM   2154 C  CB  . TYR A 1 263 ? -23.957 17.435  69.523  1.00 22.97  ? 264 TYR A CB  1 
ATOM   2155 C  CG  . TYR A 1 263 ? -23.638 18.705  70.287  1.00 24.44  ? 264 TYR A CG  1 
ATOM   2156 C  CD1 . TYR A 1 263 ? -22.322 19.010  70.649  1.00 25.44  ? 264 TYR A CD1 1 
ATOM   2157 C  CD2 . TYR A 1 263 ? -24.644 19.615  70.627  1.00 25.47  ? 264 TYR A CD2 1 
ATOM   2158 C  CE1 . TYR A 1 263 ? -22.018 20.180  71.342  1.00 26.71  ? 264 TYR A CE1 1 
ATOM   2159 C  CE2 . TYR A 1 263 ? -24.352 20.784  71.320  1.00 26.31  ? 264 TYR A CE2 1 
ATOM   2160 C  CZ  . TYR A 1 263 ? -23.038 21.059  71.676  1.00 27.29  ? 264 TYR A CZ  1 
ATOM   2161 O  OH  . TYR A 1 263 ? -22.741 22.217  72.359  1.00 28.63  ? 264 TYR A OH  1 
ATOM   2162 N  N   . ARG A 1 264 ? -26.800 16.614  70.332  1.00 23.62  ? 265 ARG A N   1 
ATOM   2163 C  CA  . ARG A 1 264 ? -28.119 16.946  70.851  1.00 24.30  ? 265 ARG A CA  1 
ATOM   2164 C  C   . ARG A 1 264 ? -28.587 15.923  71.894  1.00 24.90  ? 265 ARG A C   1 
ATOM   2165 O  O   . ARG A 1 264 ? -29.117 16.295  72.947  1.00 24.92  ? 265 ARG A O   1 
ATOM   2166 C  CB  . ARG A 1 264 ? -29.126 17.008  69.704  1.00 24.34  ? 265 ARG A CB  1 
ATOM   2167 C  CG  . ARG A 1 264 ? -29.049 18.265  68.847  1.00 24.93  ? 265 ARG A CG  1 
ATOM   2168 C  CD  . ARG A 1 264 ? -30.007 19.323  69.374  1.00 26.40  ? 265 ARG A CD  1 
ATOM   2169 N  NE  . ARG A 1 264 ? -30.084 20.481  68.483  1.00 27.21  ? 265 ARG A NE  1 
ATOM   2170 C  CZ  . ARG A 1 264 ? -31.062 20.698  67.605  1.00 26.47  ? 265 ARG A CZ  1 
ATOM   2171 N  NH1 . ARG A 1 264 ? -32.066 19.835  67.482  1.00 25.51  ? 265 ARG A NH1 1 
ATOM   2172 N  NH2 . ARG A 1 264 ? -31.031 21.786  66.848  1.00 25.88  ? 265 ARG A NH2 1 
ATOM   2173 N  N   . LEU A 1 265 ? -28.390 14.639  71.599  1.00 24.93  ? 266 LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 265 ? -28.861 13.596  72.488  1.00 25.70  ? 266 LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 265 ? -28.078 13.608  73.801  1.00 26.29  ? 266 LEU A C   1 
ATOM   2176 O  O   . LEU A 1 265 ? -28.677 13.548  74.867  1.00 26.15  ? 266 LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 265 ? -28.809 12.222  71.812  1.00 25.44  ? 266 LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 265 ? -29.788 11.950  70.662  1.00 25.18  ? 266 LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 265 ? -29.429 10.628  69.974  1.00 24.69  ? 266 LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 265 ? -31.232 11.925  71.147  1.00 24.69  ? 266 LEU A CD2 1 
ATOM   2181 N  N   . LEU A 1 266 ? -26.752 13.712  73.706  1.00 27.18  ? 267 LEU A N   1 
ATOM   2182 C  CA  . LEU A 1 266 ? -25.880 13.791  74.875  1.00 28.52  ? 267 LEU A CA  1 
ATOM   2183 C  C   . LEU A 1 266 ? -26.105 15.062  75.689  1.00 29.91  ? 267 LEU A C   1 
ATOM   2184 O  O   . LEU A 1 266 ? -25.983 15.046  76.911  1.00 30.20  ? 267 LEU A O   1 
ATOM   2185 C  CB  . LEU A 1 266 ? -24.411 13.724  74.459  1.00 28.00  ? 267 LEU A CB  1 
ATOM   2186 C  CG  . LEU A 1 266 ? -23.869 12.373  73.995  1.00 27.40  ? 267 LEU A CG  1 
ATOM   2187 C  CD1 . LEU A 1 266 ? -22.431 12.529  73.527  1.00 24.73  ? 267 LEU A CD1 1 
ATOM   2188 C  CD2 . LEU A 1 266 ? -23.993 11.318  75.097  1.00 25.88  ? 267 LEU A CD2 1 
ATOM   2189 N  N   . GLY A 1 267 ? -26.432 16.149  74.995  1.00 31.30  ? 268 GLY A N   1 
ATOM   2190 C  CA  . GLY A 1 267 ? -26.617 17.454  75.613  1.00 33.11  ? 268 GLY A CA  1 
ATOM   2191 C  C   . GLY A 1 267 ? -27.955 17.668  76.290  1.00 34.31  ? 268 GLY A C   1 
ATOM   2192 O  O   . GLY A 1 267 ? -28.024 18.356  77.301  1.00 34.48  ? 268 GLY A O   1 
ATOM   2193 N  N   . ASP A 1 268 ? -29.016 17.079  75.742  1.00 35.62  ? 269 ASP A N   1 
ATOM   2194 C  CA  . ASP A 1 268 ? -30.376 17.333  76.231  1.00 36.98  ? 269 ASP A CA  1 
ATOM   2195 C  C   . ASP A 1 268 ? -31.415 16.305  75.750  1.00 36.94  ? 269 ASP A C   1 
ATOM   2196 O  O   . ASP A 1 268 ? -32.149 16.554  74.790  1.00 37.21  ? 269 ASP A O   1 
ATOM   2197 C  CB  . ASP A 1 268 ? -30.811 18.773  75.867  1.00 37.60  ? 269 ASP A CB  1 
ATOM   2198 C  CG  . ASP A 1 268 ? -32.308 19.024  76.083  1.00 39.80  ? 269 ASP A CG  1 
ATOM   2199 O  OD1 . ASP A 1 268 ? -32.777 18.947  77.245  1.00 41.01  ? 269 ASP A OD1 1 
ATOM   2200 O  OD2 . ASP A 1 268 ? -33.010 19.298  75.078  1.00 42.61  ? 269 ASP A OD2 1 
ATOM   2201 N  N   . SER A 1 269 ? -31.484 15.162  76.429  1.00 36.85  ? 270 SER A N   1 
ATOM   2202 C  CA  . SER A 1 269 ? -32.541 14.189  76.170  1.00 36.55  ? 270 SER A CA  1 
ATOM   2203 C  C   . SER A 1 269 ? -32.851 13.327  77.390  1.00 36.44  ? 270 SER A C   1 
ATOM   2204 O  O   . SER A 1 269 ? -32.058 13.256  78.330  1.00 36.73  ? 270 SER A O   1 
ATOM   2205 C  CB  . SER A 1 269 ? -32.181 13.297  74.976  1.00 36.63  ? 270 SER A CB  1 
ATOM   2206 O  OG  . SER A 1 269 ? -31.178 12.373  75.323  1.00 35.99  ? 270 SER A OG  1 
ATOM   2207 N  N   . LYS A 1 270 ? -33.998 12.656  77.353  1.00 36.00  ? 271 LYS A N   1 
ATOM   2208 C  CA  . LYS A 1 270 ? -34.410 11.767  78.433  1.00 35.91  ? 271 LYS A CA  1 
ATOM   2209 C  C   . LYS A 1 270 ? -33.702 10.409  78.392  1.00 35.32  ? 271 LYS A C   1 
ATOM   2210 O  O   . LYS A 1 270 ? -33.911 9.571   79.271  1.00 35.27  ? 271 LYS A O   1 
ATOM   2211 C  CB  . LYS A 1 270 ? -35.933 11.579  78.422  1.00 36.14  ? 271 LYS A CB  1 
ATOM   2212 C  CG  . LYS A 1 270 ? -36.708 12.821  78.839  1.00 37.68  ? 271 LYS A CG  1 
ATOM   2213 C  CD  . LYS A 1 270 ? -38.210 12.646  78.654  1.00 39.47  ? 271 LYS A CD  1 
ATOM   2214 C  CE  . LYS A 1 270 ? -38.952 13.908  79.071  1.00 40.37  ? 271 LYS A CE  1 
ATOM   2215 N  NZ  . LYS A 1 270 ? -40.418 13.784  78.842  1.00 41.60  ? 271 LYS A NZ  1 
ATOM   2216 N  N   . MET A 1 271 ? -32.866 10.198  77.376  1.00 34.59  ? 272 MET A N   1 
ATOM   2217 C  CA  . MET A 1 271 ? -32.157 8.928   77.214  1.00 33.42  ? 272 MET A CA  1 
ATOM   2218 C  C   . MET A 1 271 ? -30.904 8.860   78.078  1.00 32.34  ? 272 MET A C   1 
ATOM   2219 O  O   . MET A 1 271 ? -30.151 9.834   78.194  1.00 32.24  ? 272 MET A O   1 
ATOM   2220 C  CB  . MET A 1 271 ? -31.760 8.690   75.750  1.00 33.56  ? 272 MET A CB  1 
ATOM   2221 C  CG  . MET A 1 271 ? -32.900 8.578   74.760  1.00 34.63  ? 272 MET A CG  1 
ATOM   2222 S  SD  . MET A 1 271 ? -32.349 8.078   73.098  1.00 37.21  ? 272 MET A SD  1 
ATOM   2223 C  CE  . MET A 1 271 ? -32.379 6.324   73.274  1.00 33.71  ? 272 MET A CE  1 
ATOM   2224 N  N   . SER A 1 272 ? -30.673 7.692   78.662  1.00 31.00  ? 273 SER A N   1 
ATOM   2225 C  CA  . SER A 1 272 ? -29.391 7.405   79.289  1.00 30.07  ? 273 SER A CA  1 
ATOM   2226 C  C   . SER A 1 272 ? -28.312 7.275   78.213  1.00 29.21  ? 273 SER A C   1 
ATOM   2227 O  O   . SER A 1 272 ? -28.622 7.069   77.030  1.00 28.94  ? 273 SER A O   1 
ATOM   2228 C  CB  . SER A 1 272 ? -29.483 6.121   80.107  1.00 30.08  ? 273 SER A CB  1 
ATOM   2229 O  OG  . SER A 1 272 ? -30.001 5.071   79.314  1.00 30.65  ? 273 SER A OG  1 
ATOM   2230 N  N   . PHE A 1 273 ? -27.052 7.403   78.620  1.00 28.22  ? 274 PHE A N   1 
ATOM   2231 C  CA  . PHE A 1 273 ? -25.931 7.187   77.716  1.00 27.31  ? 274 PHE A CA  1 
ATOM   2232 C  C   . PHE A 1 273 ? -26.003 5.803   77.072  1.00 27.09  ? 274 PHE A C   1 
ATOM   2233 O  O   . PHE A 1 273 ? -25.681 5.641   75.893  1.00 26.68  ? 274 PHE A O   1 
ATOM   2234 C  CB  . PHE A 1 273 ? -24.589 7.355   78.433  1.00 26.91  ? 274 PHE A CB  1 
ATOM   2235 C  CG  . PHE A 1 273 ? -23.401 7.112   77.540  1.00 25.80  ? 274 PHE A CG  1 
ATOM   2236 C  CD1 . PHE A 1 273 ? -23.024 8.063   76.597  1.00 24.34  ? 274 PHE A CD1 1 
ATOM   2237 C  CD2 . PHE A 1 273 ? -22.678 5.923   77.621  1.00 24.56  ? 274 PHE A CD2 1 
ATOM   2238 C  CE1 . PHE A 1 273 ? -21.936 7.846   75.756  1.00 23.65  ? 274 PHE A CE1 1 
ATOM   2239 C  CE2 . PHE A 1 273 ? -21.590 5.692   76.782  1.00 23.90  ? 274 PHE A CE2 1 
ATOM   2240 C  CZ  . PHE A 1 273 ? -21.217 6.658   75.848  1.00 23.44  ? 274 PHE A CZ  1 
ATOM   2241 N  N   . GLU A 1 274 ? -26.426 4.824   77.870  1.00 26.92  ? 275 GLU A N   1 
ATOM   2242 C  CA  . GLU A 1 274 ? -26.563 3.426   77.451  1.00 26.74  ? 275 GLU A CA  1 
ATOM   2243 C  C   . GLU A 1 274 ? -27.529 3.270   76.267  1.00 25.86  ? 275 GLU A C   1 
ATOM   2244 O  O   . GLU A 1 274 ? -27.222 2.579   75.294  1.00 25.59  ? 275 GLU A O   1 
ATOM   2245 C  CB  . GLU A 1 274 ? -27.031 2.569   78.638  1.00 26.97  ? 275 GLU A CB  1 
ATOM   2246 C  CG  . GLU A 1 274 ? -25.923 2.152   79.633  1.00 28.59  ? 275 GLU A CG  1 
ATOM   2247 C  CD  . GLU A 1 274 ? -25.310 3.302   80.458  1.00 30.26  ? 275 GLU A CD  1 
ATOM   2248 O  OE1 . GLU A 1 274 ? -26.051 4.239   80.849  1.00 29.91  ? 275 GLU A OE1 1 
ATOM   2249 O  OE2 . GLU A 1 274 ? -24.079 3.245   80.724  1.00 29.62  ? 275 GLU A OE2 1 
ATOM   2250 N  N   . ASP A 1 275 ? -28.689 3.916   76.368  1.00 25.13  ? 276 ASP A N   1 
ATOM   2251 C  CA  . ASP A 1 275 ? -29.702 3.899   75.316  1.00 24.59  ? 276 ASP A CA  1 
ATOM   2252 C  C   . ASP A 1 275 ? -29.254 4.677   74.074  1.00 23.53  ? 276 ASP A C   1 
ATOM   2253 O  O   . ASP A 1 275 ? -29.562 4.293   72.944  1.00 23.24  ? 276 ASP A O   1 
ATOM   2254 C  CB  . ASP A 1 275 ? -31.018 4.491   75.829  1.00 25.16  ? 276 ASP A CB  1 
ATOM   2255 C  CG  . ASP A 1 275 ? -31.684 3.638   76.911  1.00 27.01  ? 276 ASP A CG  1 
ATOM   2256 O  OD1 . ASP A 1 275 ? -31.538 2.395   76.902  1.00 28.31  ? 276 ASP A OD1 1 
ATOM   2257 O  OD2 . ASP A 1 275 ? -32.388 4.232   77.757  1.00 28.83  ? 276 ASP A OD2 1 
ATOM   2258 N  N   . ILE A 1 276 ? -28.528 5.767   74.290  1.00 22.36  ? 277 ILE A N   1 
ATOM   2259 C  CA  . ILE A 1 276 ? -28.060 6.610   73.196  1.00 21.46  ? 277 ILE A CA  1 
ATOM   2260 C  C   . ILE A 1 276 ? -27.076 5.833   72.328  1.00 21.04  ? 277 ILE A C   1 
ATOM   2261 O  O   . ILE A 1 276 ? -27.228 5.758   71.108  1.00 20.64  ? 277 ILE A O   1 
ATOM   2262 C  CB  . ILE A 1 276 ? -27.420 7.920   73.721  1.00 21.17  ? 277 ILE A CB  1 
ATOM   2263 C  CG1 . ILE A 1 276 ? -28.517 8.850   74.247  1.00 21.49  ? 277 ILE A CG1 1 
ATOM   2264 C  CG2 . ILE A 1 276 ? -26.599 8.602   72.624  1.00 20.48  ? 277 ILE A CG2 1 
ATOM   2265 C  CD1 . ILE A 1 276 ? -28.016 10.079  75.004  1.00 21.80  ? 277 ILE A CD1 1 
ATOM   2266 N  N   . LYS A 1 277 ? -26.078 5.252   72.984  1.00 20.73  ? 278 LYS A N   1 
ATOM   2267 C  CA  . LYS A 1 277 ? -25.027 4.482   72.336  1.00 20.18  ? 278 LYS A CA  1 
ATOM   2268 C  C   . LYS A 1 277 ? -25.589 3.268   71.589  1.00 19.48  ? 278 LYS A C   1 
ATOM   2269 O  O   . LYS A 1 277 ? -25.132 2.946   70.486  1.00 19.12  ? 278 LYS A O   1 
ATOM   2270 C  CB  . LYS A 1 277 ? -24.015 4.054   73.392  1.00 20.55  ? 278 LYS A CB  1 
ATOM   2271 C  CG  . LYS A 1 277 ? -22.887 3.138   72.938  1.00 22.12  ? 278 LYS A CG  1 
ATOM   2272 C  CD  . LYS A 1 277 ? -21.960 2.895   74.137  1.00 24.60  ? 278 LYS A CD  1 
ATOM   2273 C  CE  . LYS A 1 277 ? -21.360 1.526   74.115  1.00 27.08  ? 278 LYS A CE  1 
ATOM   2274 N  NZ  . LYS A 1 277 ? -20.461 1.287   75.278  1.00 29.68  ? 278 LYS A NZ  1 
ATOM   2275 N  N   . ALA A 1 278 ? -26.582 2.608   72.180  1.00 18.61  ? 279 ALA A N   1 
ATOM   2276 C  CA  . ALA A 1 278 ? -27.213 1.456   71.531  1.00 18.57  ? 279 ALA A CA  1 
ATOM   2277 C  C   . ALA A 1 278 ? -27.926 1.886   70.250  1.00 18.15  ? 279 ALA A C   1 
ATOM   2278 O  O   . ALA A 1 278 ? -27.840 1.209   69.227  1.00 18.33  ? 279 ALA A O   1 
ATOM   2279 C  CB  . ALA A 1 278 ? -28.184 0.749   72.481  1.00 18.51  ? 279 ALA A CB  1 
ATOM   2280 N  N   . ASN A 1 279 ? -28.610 3.025   70.312  1.00 17.69  ? 280 ASN A N   1 
ATOM   2281 C  CA  . ASN A 1 279 ? -29.326 3.546   69.153  1.00 17.33  ? 280 ASN A CA  1 
ATOM   2282 C  C   . ASN A 1 279 ? -28.448 4.144   68.064  1.00 17.31  ? 280 ASN A C   1 
ATOM   2283 O  O   . ASN A 1 279 ? -28.800 4.089   66.883  1.00 17.47  ? 280 ASN A O   1 
ATOM   2284 C  CB  . ASN A 1 279 ? -30.437 4.485   69.584  1.00 16.82  ? 280 ASN A CB  1 
ATOM   2285 C  CG  . ASN A 1 279 ? -31.609 3.735   70.145  1.00 16.87  ? 280 ASN A CG  1 
ATOM   2286 O  OD1 . ASN A 1 279 ? -32.253 2.965   69.435  1.00 16.76  ? 280 ASN A OD1 1 
ATOM   2287 N  ND2 . ASN A 1 279 ? -31.886 3.928   71.435  1.00 16.50  ? 280 ASN A ND2 1 
ATOM   2288 N  N   . VAL A 1 280 ? -27.304 4.699   68.455  1.00 16.85  ? 281 VAL A N   1 
ATOM   2289 C  CA  . VAL A 1 280 ? -26.332 5.178   67.484  1.00 16.57  ? 281 VAL A CA  1 
ATOM   2290 C  C   . VAL A 1 280 ? -25.847 4.007   66.639  1.00 16.86  ? 281 VAL A C   1 
ATOM   2291 O  O   . VAL A 1 280 ? -25.790 4.100   65.413  1.00 16.72  ? 281 VAL A O   1 
ATOM   2292 C  CB  . VAL A 1 280 ? -25.147 5.904   68.159  1.00 16.37  ? 281 VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1 280 ? -23.995 6.068   67.200  1.00 15.08  ? 281 VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1 280 ? -25.595 7.269   68.668  1.00 16.62  ? 281 VAL A CG2 1 
ATOM   2295 N  N   . THR A 1 281 ? -25.512 2.904   67.305  1.00 17.07  ? 282 THR A N   1 
ATOM   2296 C  CA  . THR A 1 281 ? -25.101 1.684   66.630  1.00 17.53  ? 282 THR A CA  1 
ATOM   2297 C  C   . THR A 1 281 ? -26.144 1.237   65.599  1.00 17.60  ? 282 THR A C   1 
ATOM   2298 O  O   . THR A 1 281 ? -25.792 0.938   64.448  1.00 17.49  ? 282 THR A O   1 
ATOM   2299 C  CB  . THR A 1 281 ? -24.843 0.564   67.650  1.00 17.94  ? 282 THR A CB  1 
ATOM   2300 O  OG1 . THR A 1 281 ? -23.904 1.040   68.620  1.00 18.84  ? 282 THR A OG1 1 
ATOM   2301 C  CG2 . THR A 1 281 ? -24.281 -0.688  66.970  1.00 17.30  ? 282 THR A CG2 1 
ATOM   2302 N  N   . GLU A 1 282 ? -27.415 1.220   66.005  1.00 17.24  ? 283 GLU A N   1 
ATOM   2303 C  CA  . GLU A 1 282 ? -28.489 0.782   65.117  1.00 17.62  ? 283 GLU A CA  1 
ATOM   2304 C  C   . GLU A 1 282 ? -28.747 1.756   63.969  1.00 17.60  ? 283 GLU A C   1 
ATOM   2305 O  O   . GLU A 1 282 ? -29.043 1.330   62.855  1.00 17.90  ? 283 GLU A O   1 
ATOM   2306 C  CB  . GLU A 1 282 ? -29.774 0.471   65.893  1.00 17.25  ? 283 GLU A CB  1 
ATOM   2307 C  CG  . GLU A 1 282 ? -29.595 -0.707  66.849  1.00 18.69  ? 283 GLU A CG  1 
ATOM   2308 C  CD  . GLU A 1 282 ? -30.869 -1.135  67.559  1.00 18.99  ? 283 GLU A CD  1 
ATOM   2309 O  OE1 . GLU A 1 282 ? -31.891 -0.434  67.475  1.00 20.47  ? 283 GLU A OE1 1 
ATOM   2310 O  OE2 . GLU A 1 282 ? -30.842 -2.188  68.222  1.00 21.42  ? 283 GLU A OE2 1 
ATOM   2311 N  N   . MET A 1 283 ? -28.633 3.054   64.232  1.00 17.69  ? 284 MET A N   1 
ATOM   2312 C  CA  . MET A 1 283 ? -28.795 4.048   63.168  1.00 18.65  ? 284 MET A CA  1 
ATOM   2313 C  C   . MET A 1 283 ? -27.669 3.963   62.137  1.00 18.62  ? 284 MET A C   1 
ATOM   2314 O  O   . MET A 1 283 ? -27.918 4.035   60.934  1.00 18.84  ? 284 MET A O   1 
ATOM   2315 C  CB  . MET A 1 283 ? -28.942 5.461   63.730  1.00 18.57  ? 284 MET A CB  1 
ATOM   2316 C  CG  . MET A 1 283 ? -30.310 5.715   64.371  1.00 20.34  ? 284 MET A CG  1 
ATOM   2317 S  SD  . MET A 1 283 ? -30.503 7.379   65.063  1.00 24.70  ? 284 MET A SD  1 
ATOM   2318 C  CE  . MET A 1 283 ? -29.938 8.395   63.698  1.00 24.90  ? 284 MET A CE  1 
ATOM   2319 N  N   . LEU A 1 284 ? -26.442 3.792   62.615  1.00 18.59  ? 285 LEU A N   1 
ATOM   2320 C  CA  . LEU A 1 284 ? -25.290 3.604   61.742  1.00 18.68  ? 285 LEU A CA  1 
ATOM   2321 C  C   . LEU A 1 284 ? -25.431 2.373   60.850  1.00 18.73  ? 285 LEU A C   1 
ATOM   2322 O  O   . LEU A 1 284 ? -25.202 2.459   59.644  1.00 19.58  ? 285 LEU A O   1 
ATOM   2323 C  CB  . LEU A 1 284 ? -24.003 3.500   62.558  1.00 18.53  ? 285 LEU A CB  1 
ATOM   2324 C  CG  . LEU A 1 284 ? -23.433 4.776   63.179  1.00 19.21  ? 285 LEU A CG  1 
ATOM   2325 C  CD1 . LEU A 1 284 ? -22.311 4.408   64.139  1.00 18.50  ? 285 LEU A CD1 1 
ATOM   2326 C  CD2 . LEU A 1 284 ? -22.935 5.735   62.106  1.00 18.17  ? 285 LEU A CD2 1 
ATOM   2327 N  N   . ALA A 1 285 ? -25.812 1.240   61.437  1.00 18.12  ? 286 ALA A N   1 
ATOM   2328 C  CA  . ALA A 1 285 ? -25.896 -0.015  60.699  1.00 18.05  ? 286 ALA A CA  1 
ATOM   2329 C  C   . ALA A 1 285 ? -27.113 -0.077  59.770  1.00 18.29  ? 286 ALA A C   1 
ATOM   2330 O  O   . ALA A 1 285 ? -27.083 -0.781  58.747  1.00 19.01  ? 286 ALA A O   1 
ATOM   2331 C  CB  . ALA A 1 285 ? -25.897 -1.196  61.653  1.00 17.68  ? 286 ALA A CB  1 
ATOM   2332 N  N   . GLY A 1 286 ? -28.179 0.637   60.138  1.00 17.66  ? 287 GLY A N   1 
ATOM   2333 C  CA  . GLY A 1 286 ? -29.411 0.647   59.364  1.00 17.66  ? 287 GLY A CA  1 
ATOM   2334 C  C   . GLY A 1 286 ? -29.373 1.586   58.168  1.00 17.98  ? 287 GLY A C   1 
ATOM   2335 O  O   . GLY A 1 286 ? -30.265 1.550   57.323  1.00 18.09  ? 287 GLY A O   1 
ATOM   2336 N  N   . GLY A 1 287 ? -28.337 2.416   58.088  1.00 17.92  ? 288 GLY A N   1 
ATOM   2337 C  CA  . GLY A 1 287 ? -28.278 3.474   57.085  1.00 18.41  ? 288 GLY A CA  1 
ATOM   2338 C  C   . GLY A 1 287 ? -27.259 3.342   55.963  1.00 18.45  ? 288 GLY A C   1 
ATOM   2339 O  O   . GLY A 1 287 ? -27.181 4.211   55.099  1.00 19.05  ? 288 GLY A O   1 
ATOM   2340 N  N   . VAL A 1 288 ? -26.488 2.264   55.955  1.00 17.98  ? 289 VAL A N   1 
ATOM   2341 C  CA  . VAL A 1 288 ? -25.435 2.114   54.963  1.00 18.06  ? 289 VAL A CA  1 
ATOM   2342 C  C   . VAL A 1 288 ? -25.933 1.342   53.732  1.00 18.29  ? 289 VAL A C   1 
ATOM   2343 O  O   . VAL A 1 288 ? -25.799 1.828   52.609  1.00 18.78  ? 289 VAL A O   1 
ATOM   2344 C  CB  . VAL A 1 288 ? -24.152 1.499   55.577  1.00 18.13  ? 289 VAL A CB  1 
ATOM   2345 C  CG1 . VAL A 1 288 ? -23.037 1.418   54.548  1.00 17.74  ? 289 VAL A CG1 1 
ATOM   2346 C  CG2 . VAL A 1 288 ? -23.693 2.341   56.757  1.00 17.67  ? 289 VAL A CG2 1 
ATOM   2347 N  N   . ASP A 1 289 ? -26.532 0.169   53.950  1.00 17.55  ? 290 ASP A N   1 
ATOM   2348 C  CA  . ASP A 1 289 ? -26.939 -0.707  52.855  1.00 17.27  ? 290 ASP A CA  1 
ATOM   2349 C  C   . ASP A 1 289 ? -28.281 -0.282  52.250  1.00 16.76  ? 290 ASP A C   1 
ATOM   2350 O  O   . ASP A 1 289 ? -28.593 -0.615  51.109  1.00 16.61  ? 290 ASP A O   1 
ATOM   2351 C  CB  . ASP A 1 289 ? -27.011 -2.155  53.347  1.00 17.79  ? 290 ASP A CB  1 
ATOM   2352 C  CG  . ASP A 1 289 ? -25.640 -2.755  53.616  1.00 19.06  ? 290 ASP A CG  1 
ATOM   2353 O  OD1 . ASP A 1 289 ? -24.695 -1.994  53.903  1.00 22.37  ? 290 ASP A OD1 1 
ATOM   2354 O  OD2 . ASP A 1 289 ? -25.499 -3.992  53.528  1.00 20.48  ? 290 ASP A OD2 1 
ATOM   2355 N  N   . THR A 1 290 ? -29.045 0.488   53.017  1.00 16.08  ? 291 THR A N   1 
ATOM   2356 C  CA  . THR A 1 290 ? -30.394 0.873   52.654  1.00 15.44  ? 291 THR A CA  1 
ATOM   2357 C  C   . THR A 1 290 ? -30.436 1.941   51.569  1.00 15.21  ? 291 THR A C   1 
ATOM   2358 O  O   . THR A 1 290 ? -30.935 1.684   50.473  1.00 14.35  ? 291 THR A O   1 
ATOM   2359 C  CB  . THR A 1 290 ? -31.191 1.319   53.888  1.00 15.43  ? 291 THR A CB  1 
ATOM   2360 O  OG1 . THR A 1 290 ? -30.392 2.212   54.682  1.00 15.46  ? 291 THR A OG1 1 
ATOM   2361 C  CG2 . THR A 1 290 ? -31.587 0.103   54.711  1.00 14.28  ? 291 THR A CG2 1 
ATOM   2362 N  N   . THR A 1 291 ? -29.903 3.123   51.871  1.00 15.05  ? 292 THR A N   1 
ATOM   2363 C  CA  . THR A 1 291 ? -29.965 4.250   50.947  1.00 15.91  ? 292 THR A CA  1 
ATOM   2364 C  C   . THR A 1 291 ? -29.091 4.017   49.719  1.00 15.48  ? 292 THR A C   1 
ATOM   2365 O  O   . THR A 1 291 ? -29.444 4.431   48.618  1.00 15.53  ? 292 THR A O   1 
ATOM   2366 C  CB  . THR A 1 291 ? -29.522 5.565   51.615  1.00 16.10  ? 292 THR A CB  1 
ATOM   2367 O  OG1 . THR A 1 291 ? -28.307 5.331   52.333  1.00 18.64  ? 292 THR A OG1 1 
ATOM   2368 C  CG2 . THR A 1 291 ? -30.553 6.040   52.581  1.00 16.54  ? 292 THR A CG2 1 
ATOM   2369 N  N   . SER A 1 292 ? -27.962 3.343   49.915  1.00 15.20  ? 293 SER A N   1 
ATOM   2370 C  CA  . SER A 1 292 ? -27.040 3.042   48.825  1.00 15.36  ? 293 SER A CA  1 
ATOM   2371 C  C   . SER A 1 292 ? -27.636 2.105   47.759  1.00 14.95  ? 293 SER A C   1 
ATOM   2372 O  O   . SER A 1 292 ? -27.519 2.379   46.571  1.00 15.16  ? 293 SER A O   1 
ATOM   2373 C  CB  . SER A 1 292 ? -25.718 2.489   49.361  1.00 14.60  ? 293 SER A CB  1 
ATOM   2374 O  OG  . SER A 1 292 ? -25.950 1.353   50.166  1.00 16.31  ? 293 SER A OG  1 
ATOM   2375 N  N   . MET A 1 293 ? -28.266 1.010   48.174  1.00 14.95  ? 294 MET A N   1 
ATOM   2376 C  CA  . MET A 1 293 ? -28.906 0.098   47.216  1.00 14.59  ? 294 MET A CA  1 
ATOM   2377 C  C   . MET A 1 293 ? -30.118 0.750   46.555  1.00 14.06  ? 294 MET A C   1 
ATOM   2378 O  O   . MET A 1 293 ? -30.392 0.527   45.367  1.00 12.98  ? 294 MET A O   1 
ATOM   2379 C  CB  . MET A 1 293 ? -29.312 -1.219  47.884  1.00 15.37  ? 294 MET A CB  1 
ATOM   2380 C  CG  . MET A 1 293 ? -28.124 -2.109  48.296  1.00 17.27  ? 294 MET A CG  1 
ATOM   2381 S  SD  . MET A 1 293 ? -27.037 -2.519  46.917  1.00 20.87  ? 294 MET A SD  1 
ATOM   2382 C  CE  . MET A 1 293 ? -25.916 -1.114  46.851  1.00 20.14  ? 294 MET A CE  1 
ATOM   2383 N  N   . THR A 1 294 ? -30.831 1.563   47.332  1.00 13.45  ? 295 THR A N   1 
ATOM   2384 C  CA  . THR A 1 294 ? -32.000 2.263   46.831  1.00 13.67  ? 295 THR A CA  1 
ATOM   2385 C  C   . THR A 1 294 ? -31.590 3.273   45.751  1.00 13.86  ? 295 THR A C   1 
ATOM   2386 O  O   . THR A 1 294 ? -32.217 3.331   44.690  1.00 13.55  ? 295 THR A O   1 
ATOM   2387 C  CB  . THR A 1 294 ? -32.795 2.931   47.977  1.00 14.16  ? 295 THR A CB  1 
ATOM   2388 O  OG1 . THR A 1 294 ? -33.253 1.917   48.888  1.00 13.29  ? 295 THR A OG1 1 
ATOM   2389 C  CG2 . THR A 1 294 ? -33.998 3.695   47.429  1.00 13.60  ? 295 THR A CG2 1 
ATOM   2390 N  N   . LEU A 1 295 ? -30.522 4.029   46.018  1.00 13.55  ? 296 LEU A N   1 
ATOM   2391 C  CA  . LEU A 1 295 ? -29.979 4.980   45.051  1.00 13.69  ? 296 LEU A CA  1 
ATOM   2392 C  C   . LEU A 1 295 ? -29.412 4.294   43.817  1.00 13.54  ? 296 LEU A C   1 
ATOM   2393 O  O   . LEU A 1 295 ? -29.573 4.791   42.712  1.00 14.12  ? 296 LEU A O   1 
ATOM   2394 C  CB  . LEU A 1 295 ? -28.906 5.879   45.685  1.00 13.59  ? 296 LEU A CB  1 
ATOM   2395 C  CG  . LEU A 1 295 ? -29.388 6.993   46.616  1.00 13.51  ? 296 LEU A CG  1 
ATOM   2396 C  CD1 . LEU A 1 295 ? -28.200 7.628   47.365  1.00 12.39  ? 296 LEU A CD1 1 
ATOM   2397 C  CD2 . LEU A 1 295 ? -30.190 8.033   45.825  1.00 11.72  ? 296 LEU A CD2 1 
ATOM   2398 N  N   . GLN A 1 296 ? -28.749 3.158   43.998  1.00 13.39  ? 297 GLN A N   1 
ATOM   2399 C  CA  . GLN A 1 296 ? -28.291 2.382   42.851  1.00 13.35  ? 297 GLN A CA  1 
ATOM   2400 C  C   . GLN A 1 296 ? -29.460 1.959   41.939  1.00 13.54  ? 297 GLN A C   1 
ATOM   2401 O  O   . GLN A 1 296 ? -29.348 2.012   40.709  1.00 13.57  ? 297 GLN A O   1 
ATOM   2402 C  CB  . GLN A 1 296 ? -27.507 1.153   43.295  1.00 13.02  ? 297 GLN A CB  1 
ATOM   2403 C  CG  . GLN A 1 296 ? -26.841 0.433   42.134  1.00 13.03  ? 297 GLN A CG  1 
ATOM   2404 C  CD  . GLN A 1 296 ? -25.937 -0.684  42.573  1.00 13.93  ? 297 GLN A CD  1 
ATOM   2405 O  OE1 . GLN A 1 296 ? -24.771 -0.725  42.196  1.00 14.22  ? 297 GLN A OE1 1 
ATOM   2406 N  NE2 . GLN A 1 296 ? -26.472 -1.608  43.378  1.00 14.54  ? 297 GLN A NE2 1 
ATOM   2407 N  N   . TRP A 1 297 ? -30.565 1.530   42.545  1.00 13.48  ? 298 TRP A N   1 
ATOM   2408 C  CA  . TRP A 1 297 ? -31.773 1.178   41.790  1.00 13.68  ? 298 TRP A CA  1 
ATOM   2409 C  C   . TRP A 1 297 ? -32.357 2.396   41.071  1.00 13.88  ? 298 TRP A C   1 
ATOM   2410 O  O   . TRP A 1 297 ? -32.822 2.288   39.941  1.00 14.11  ? 298 TRP A O   1 
ATOM   2411 C  CB  . TRP A 1 297 ? -32.826 0.580   42.710  1.00 13.80  ? 298 TRP A CB  1 
ATOM   2412 C  CG  . TRP A 1 297 ? -32.689 -0.895  43.023  1.00 13.50  ? 298 TRP A CG  1 
ATOM   2413 C  CD1 . TRP A 1 297 ? -32.644 -1.456  44.259  1.00 12.30  ? 298 TRP A CD1 1 
ATOM   2414 C  CD2 . TRP A 1 297 ? -32.633 -1.989  42.084  1.00 14.25  ? 298 TRP A CD2 1 
ATOM   2415 N  NE1 . TRP A 1 297 ? -32.552 -2.817  44.160  1.00 13.05  ? 298 TRP A NE1 1 
ATOM   2416 C  CE2 . TRP A 1 297 ? -32.544 -3.176  42.838  1.00 13.45  ? 298 TRP A CE2 1 
ATOM   2417 C  CE3 . TRP A 1 297 ? -32.644 -2.076  40.679  1.00 14.94  ? 298 TRP A CE3 1 
ATOM   2418 C  CZ2 . TRP A 1 297 ? -32.470 -4.449  42.242  1.00 14.67  ? 298 TRP A CZ2 1 
ATOM   2419 C  CZ3 . TRP A 1 297 ? -32.567 -3.346  40.081  1.00 14.32  ? 298 TRP A CZ3 1 
ATOM   2420 C  CH2 . TRP A 1 297 ? -32.481 -4.512  40.866  1.00 13.70  ? 298 TRP A CH2 1 
ATOM   2421 N  N   . HIS A 1 298 ? -32.314 3.556   41.726  1.00 13.94  ? 299 HIS A N   1 
ATOM   2422 C  CA  . HIS A 1 298 ? -32.827 4.785   41.128  1.00 13.88  ? 299 HIS A CA  1 
ATOM   2423 C  C   . HIS A 1 298 ? -32.032 5.162   39.888  1.00 13.70  ? 299 HIS A C   1 
ATOM   2424 O  O   . HIS A 1 298 ? -32.622 5.480   38.841  1.00 13.29  ? 299 HIS A O   1 
ATOM   2425 C  CB  . HIS A 1 298 ? -32.824 5.948   42.124  1.00 13.90  ? 299 HIS A CB  1 
ATOM   2426 C  CG  . HIS A 1 298 ? -33.598 7.139   41.652  1.00 14.05  ? 299 HIS A CG  1 
ATOM   2427 N  ND1 . HIS A 1 298 ? -33.161 7.950   40.624  1.00 15.19  ? 299 HIS A ND1 1 
ATOM   2428 C  CD2 . HIS A 1 298 ? -34.786 7.651   42.057  1.00 13.62  ? 299 HIS A CD2 1 
ATOM   2429 C  CE1 . HIS A 1 298 ? -34.047 8.908   40.415  1.00 14.34  ? 299 HIS A CE1 1 
ATOM   2430 N  NE2 . HIS A 1 298 ? -35.038 8.754   41.276  1.00 15.14  ? 299 HIS A NE2 1 
ATOM   2431 N  N   . LEU A 1 299 ? -30.701 5.110   40.005  1.00 13.72  ? 300 LEU A N   1 
ATOM   2432 C  CA  . LEU A 1 299 ? -29.817 5.394   38.881  1.00 14.09  ? 300 LEU A CA  1 
ATOM   2433 C  C   . LEU A 1 299 ? -30.071 4.409   37.756  1.00 14.30  ? 300 LEU A C   1 
ATOM   2434 O  O   . LEU A 1 299 ? -30.071 4.789   36.584  1.00 14.23  ? 300 LEU A O   1 
ATOM   2435 C  CB  . LEU A 1 299 ? -28.343 5.368   39.297  1.00 13.96  ? 300 LEU A CB  1 
ATOM   2436 C  CG  . LEU A 1 299 ? -27.879 6.486   40.239  1.00 15.12  ? 300 LEU A CG  1 
ATOM   2437 C  CD1 . LEU A 1 299 ? -26.555 6.104   40.890  1.00 15.85  ? 300 LEU A CD1 1 
ATOM   2438 C  CD2 . LEU A 1 299 ? -27.774 7.831   39.520  1.00 14.93  ? 300 LEU A CD2 1 
ATOM   2439 N  N   . TYR A 1 300 ? -30.281 3.145   38.124  1.00 14.58  ? 301 TYR A N   1 
ATOM   2440 C  CA  . TYR A 1 300 ? -30.587 2.093   37.164  1.00 15.26  ? 301 TYR A CA  1 
ATOM   2441 C  C   . TYR A 1 300 ? -31.899 2.372   36.411  1.00 15.77  ? 301 TYR A C   1 
ATOM   2442 O  O   . TYR A 1 300 ? -31.953 2.218   35.194  1.00 15.99  ? 301 TYR A O   1 
ATOM   2443 C  CB  . TYR A 1 300 ? -30.619 0.721   37.854  1.00 15.12  ? 301 TYR A CB  1 
ATOM   2444 C  CG  . TYR A 1 300 ? -31.258 -0.389  37.037  1.00 15.12  ? 301 TYR A CG  1 
ATOM   2445 C  CD1 . TYR A 1 300 ? -30.518 -1.115  36.102  1.00 16.82  ? 301 TYR A CD1 1 
ATOM   2446 C  CD2 . TYR A 1 300 ? -32.595 -0.720  37.211  1.00 15.43  ? 301 TYR A CD2 1 
ATOM   2447 C  CE1 . TYR A 1 300 ? -31.109 -2.141  35.349  1.00 17.21  ? 301 TYR A CE1 1 
ATOM   2448 C  CE2 . TYR A 1 300 ? -33.190 -1.735  36.480  1.00 15.76  ? 301 TYR A CE2 1 
ATOM   2449 C  CZ  . TYR A 1 300 ? -32.452 -2.439  35.551  1.00 17.50  ? 301 TYR A CZ  1 
ATOM   2450 O  OH  . TYR A 1 300 ? -33.062 -3.448  34.837  1.00 18.69  ? 301 TYR A OH  1 
ATOM   2451 N  N   . GLU A 1 301 ? -32.938 2.800   37.126  1.00 16.15  ? 302 GLU A N   1 
ATOM   2452 C  CA  . GLU A 1 301 ? -34.230 3.097   36.485  1.00 16.88  ? 302 GLU A CA  1 
ATOM   2453 C  C   . GLU A 1 301 ? -34.147 4.319   35.553  1.00 17.36  ? 302 GLU A C   1 
ATOM   2454 O  O   . GLU A 1 301 ? -34.834 4.375   34.525  1.00 17.56  ? 302 GLU A O   1 
ATOM   2455 C  CB  . GLU A 1 301 ? -35.352 3.260   37.519  1.00 16.28  ? 302 GLU A CB  1 
ATOM   2456 C  CG  . GLU A 1 301 ? -35.646 1.998   38.360  1.00 17.53  ? 302 GLU A CG  1 
ATOM   2457 C  CD  . GLU A 1 301 ? -36.216 0.828   37.547  1.00 19.19  ? 302 GLU A CD  1 
ATOM   2458 O  OE1 . GLU A 1 301 ? -36.328 -0.289  38.096  1.00 18.14  ? 302 GLU A OE1 1 
ATOM   2459 O  OE2 . GLU A 1 301 ? -36.551 1.019   36.354  1.00 21.04  ? 302 GLU A OE2 1 
ATOM   2460 N  N   . MET A 1 302 ? -33.293 5.279   35.905  1.00 17.41  ? 303 MET A N   1 
ATOM   2461 C  CA  . MET A 1 302 ? -33.073 6.459   35.061  1.00 17.64  ? 303 MET A CA  1 
ATOM   2462 C  C   . MET A 1 302 ? -32.341 6.108   33.764  1.00 17.68  ? 303 MET A C   1 
ATOM   2463 O  O   . MET A 1 302 ? -32.672 6.634   32.699  1.00 17.04  ? 303 MET A O   1 
ATOM   2464 C  CB  . MET A 1 302 ? -32.336 7.562   35.828  1.00 17.39  ? 303 MET A CB  1 
ATOM   2465 C  CG  . MET A 1 302 ? -33.200 8.217   36.896  1.00 17.46  ? 303 MET A CG  1 
ATOM   2466 S  SD  . MET A 1 302 ? -32.656 9.877   37.333  1.00 20.46  ? 303 MET A SD  1 
ATOM   2467 C  CE  . MET A 1 302 ? -31.042 9.551   38.041  1.00 19.03  ? 303 MET A CE  1 
ATOM   2468 N  N   . ALA A 1 303 ? -31.362 5.209   33.864  1.00 17.50  ? 304 ALA A N   1 
ATOM   2469 C  CA  . ALA A 1 303 ? -30.652 4.705   32.693  1.00 17.99  ? 304 ALA A CA  1 
ATOM   2470 C  C   . ALA A 1 303 ? -31.553 3.834   31.812  1.00 18.61  ? 304 ALA A C   1 
ATOM   2471 O  O   . ALA A 1 303 ? -31.347 3.750   30.588  1.00 18.77  ? 304 ALA A O   1 
ATOM   2472 C  CB  . ALA A 1 303 ? -29.419 3.927   33.114  1.00 17.32  ? 304 ALA A CB  1 
ATOM   2473 N  N   . ARG A 1 304 ? -32.527 3.176   32.443  1.00 18.96  ? 305 ARG A N   1 
ATOM   2474 C  CA  . ARG A 1 304 ? -33.447 2.272   31.754  1.00 19.61  ? 305 ARG A CA  1 
ATOM   2475 C  C   . ARG A 1 304 ? -34.599 3.048   31.091  1.00 19.49  ? 305 ARG A C   1 
ATOM   2476 O  O   . ARG A 1 304 ? -35.244 2.551   30.178  1.00 18.92  ? 305 ARG A O   1 
ATOM   2477 C  CB  . ARG A 1 304 ? -33.981 1.201   32.727  1.00 19.70  ? 305 ARG A CB  1 
ATOM   2478 C  CG  . ARG A 1 304 ? -34.635 -0.032  32.043  1.00 21.99  ? 305 ARG A CG  1 
ATOM   2479 C  CD  . ARG A 1 304 ? -35.021 -1.146  33.035  1.00 23.23  ? 305 ARG A CD  1 
ATOM   2480 N  NE  . ARG A 1 304 ? -36.138 -0.746  33.892  1.00 25.43  ? 305 ARG A NE  1 
ATOM   2481 C  CZ  . ARG A 1 304 ? -37.418 -1.017  33.642  1.00 26.61  ? 305 ARG A CZ  1 
ATOM   2482 N  NH1 . ARG A 1 304 ? -37.755 -1.714  32.559  1.00 26.09  ? 305 ARG A NH1 1 
ATOM   2483 N  NH2 . ARG A 1 304 ? -38.364 -0.599  34.482  1.00 24.94  ? 305 ARG A NH2 1 
ATOM   2484 N  N   . ASN A 1 305 ? -34.844 4.265   31.573  1.00 19.85  ? 306 ASN A N   1 
ATOM   2485 C  CA  . ASN A 1 305 ? -35.885 5.129   31.042  1.00 20.20  ? 306 ASN A CA  1 
ATOM   2486 C  C   . ASN A 1 305 ? -35.361 6.552   30.857  1.00 20.04  ? 306 ASN A C   1 
ATOM   2487 O  O   . ASN A 1 305 ? -35.562 7.427   31.709  1.00 19.97  ? 306 ASN A O   1 
ATOM   2488 C  CB  . ASN A 1 305 ? -37.115 5.113   31.948  1.00 20.55  ? 306 ASN A CB  1 
ATOM   2489 C  CG  . ASN A 1 305 ? -38.364 5.614   31.241  1.00 22.83  ? 306 ASN A CG  1 
ATOM   2490 O  OD1 . ASN A 1 305 ? -38.315 6.587   30.483  1.00 24.55  ? 306 ASN A OD1 1 
ATOM   2491 N  ND2 . ASN A 1 305 ? -39.497 4.939   31.477  1.00 25.01  ? 306 ASN A ND2 1 
ATOM   2492 N  N   . LEU A 1 306 ? -34.698 6.780   29.729  1.00 20.01  ? 307 LEU A N   1 
ATOM   2493 C  CA  . LEU A 1 306 ? -34.020 8.051   29.481  1.00 20.35  ? 307 LEU A CA  1 
ATOM   2494 C  C   . LEU A 1 306 ? -34.963 9.261   29.418  1.00 20.13  ? 307 LEU A C   1 
ATOM   2495 O  O   . LEU A 1 306 ? -34.582 10.360  29.821  1.00 20.18  ? 307 LEU A O   1 
ATOM   2496 C  CB  . LEU A 1 306 ? -33.128 7.958   28.234  1.00 20.56  ? 307 LEU A CB  1 
ATOM   2497 C  CG  . LEU A 1 306 ? -32.043 6.873   28.273  1.00 21.21  ? 307 LEU A CG  1 
ATOM   2498 C  CD1 . LEU A 1 306 ? -31.372 6.690   26.898  1.00 21.84  ? 307 LEU A CD1 1 
ATOM   2499 C  CD2 . LEU A 1 306 ? -30.995 7.161   29.357  1.00 21.03  ? 307 LEU A CD2 1 
ATOM   2500 N  N   . LYS A 1 307 ? -36.192 9.051   28.953  1.00 20.19  ? 308 LYS A N   1 
ATOM   2501 C  CA  . LYS A 1 307 ? -37.207 10.113  28.937  1.00 20.78  ? 308 LYS A CA  1 
ATOM   2502 C  C   . LYS A 1 307 ? -37.531 10.608  30.347  1.00 20.13  ? 308 LYS A C   1 
ATOM   2503 O  O   . LYS A 1 307 ? -37.644 11.814  30.573  1.00 19.70  ? 308 LYS A O   1 
ATOM   2504 C  CB  . LYS A 1 307 ? -38.495 9.651   28.233  1.00 21.26  ? 308 LYS A CB  1 
ATOM   2505 C  CG  . LYS A 1 307 ? -38.351 9.436   26.711  1.00 24.62  ? 308 LYS A CG  1 
ATOM   2506 C  CD  . LYS A 1 307 ? -39.685 9.028   26.053  1.00 29.74  ? 308 LYS A CD  1 
ATOM   2507 C  CE  . LYS A 1 307 ? -39.939 7.509   26.119  1.00 32.34  ? 308 LYS A CE  1 
ATOM   2508 N  NZ  . LYS A 1 307 ? -39.092 6.741   25.141  1.00 34.47  ? 308 LYS A NZ  1 
ATOM   2509 N  N   . VAL A 1 308 ? -37.687 9.675   31.288  1.00 19.70  ? 309 VAL A N   1 
ATOM   2510 C  CA  . VAL A 1 308 ? -37.929 10.031  32.691  1.00 19.35  ? 309 VAL A CA  1 
ATOM   2511 C  C   . VAL A 1 308 ? -36.714 10.767  33.268  1.00 18.99  ? 309 VAL A C   1 
ATOM   2512 O  O   . VAL A 1 308 ? -36.866 11.759  33.991  1.00 19.11  ? 309 VAL A O   1 
ATOM   2513 C  CB  . VAL A 1 308 ? -38.367 8.798   33.549  1.00 19.35  ? 309 VAL A CB  1 
ATOM   2514 C  CG1 . VAL A 1 308 ? -38.308 9.087   35.057  1.00 19.07  ? 309 VAL A CG1 1 
ATOM   2515 C  CG2 . VAL A 1 308 ? -39.771 8.356   33.156  1.00 19.58  ? 309 VAL A CG2 1 
ATOM   2516 N  N   . GLN A 1 309 ? -35.518 10.320  32.910  1.00 19.07  ? 310 GLN A N   1 
ATOM   2517 C  CA  . GLN A 1 309 ? -34.296 10.990  33.353  1.00 19.62  ? 310 GLN A CA  1 
ATOM   2518 C  C   . GLN A 1 309 ? -34.267 12.460  32.897  1.00 20.23  ? 310 GLN A C   1 
ATOM   2519 O  O   . GLN A 1 309 ? -33.987 13.361  33.700  1.00 20.11  ? 310 GLN A O   1 
ATOM   2520 C  CB  . GLN A 1 309 ? -33.047 10.236  32.880  1.00 19.37  ? 310 GLN A CB  1 
ATOM   2521 C  CG  . GLN A 1 309 ? -31.754 10.701  33.563  1.00 18.26  ? 310 GLN A CG  1 
ATOM   2522 C  CD  . GLN A 1 309 ? -30.509 10.022  33.013  1.00 17.69  ? 310 GLN A CD  1 
ATOM   2523 O  OE1 . GLN A 1 309 ? -30.544 8.864   32.576  1.00 18.76  ? 310 GLN A OE1 1 
ATOM   2524 N  NE2 . GLN A 1 309 ? -29.401 10.736  33.035  1.00 14.34  ? 310 GLN A NE2 1 
ATOM   2525 N  N   . ASP A 1 310 ? -34.583 12.692  31.621  1.00 21.03  ? 311 ASP A N   1 
ATOM   2526 C  CA  . ASP A 1 310 ? -34.700 14.056  31.075  1.00 21.78  ? 311 ASP A CA  1 
ATOM   2527 C  C   . ASP A 1 310 ? -35.699 14.916  31.846  1.00 21.78  ? 311 ASP A C   1 
ATOM   2528 O  O   . ASP A 1 310 ? -35.407 16.074  32.158  1.00 21.88  ? 311 ASP A O   1 
ATOM   2529 C  CB  . ASP A 1 310 ? -35.080 14.029  29.586  1.00 22.02  ? 311 ASP A CB  1 
ATOM   2530 C  CG  . ASP A 1 310 ? -33.983 13.430  28.704  1.00 22.93  ? 311 ASP A CG  1 
ATOM   2531 O  OD1 . ASP A 1 310 ? -32.795 13.508  29.071  1.00 26.04  ? 311 ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A 1 310 ? -34.307 12.887  27.631  1.00 24.10  ? 311 ASP A OD2 1 
ATOM   2533 N  N   . MET A 1 311 ? -36.869 14.349  32.146  1.00 21.79  ? 312 MET A N   1 
ATOM   2534 C  CA  . MET A 1 311 ? -37.924 15.065  32.875  1.00 22.13  ? 312 MET A CA  1 
ATOM   2535 C  C   . MET A 1 311 ? -37.449 15.461  34.267  1.00 21.62  ? 312 MET A C   1 
ATOM   2536 O  O   . MET A 1 311 ? -37.714 16.577  34.728  1.00 21.72  ? 312 MET A O   1 
ATOM   2537 C  CB  . MET A 1 311 ? -39.183 14.202  33.021  1.00 22.25  ? 312 MET A CB  1 
ATOM   2538 C  CG  . MET A 1 311 ? -40.098 14.146  31.802  1.00 25.74  ? 312 MET A CG  1 
ATOM   2539 S  SD  . MET A 1 311 ? -41.294 12.764  31.910  1.00 33.34  ? 312 MET A SD  1 
ATOM   2540 C  CE  . MET A 1 311 ? -42.245 13.226  33.375  1.00 29.72  ? 312 MET A CE  1 
ATOM   2541 N  N   . LEU A 1 312 ? -36.755 14.535  34.933  1.00 20.83  ? 313 LEU A N   1 
ATOM   2542 C  CA  . LEU A 1 312 ? -36.265 14.768  36.283  1.00 19.90  ? 313 LEU A CA  1 
ATOM   2543 C  C   . LEU A 1 312 ? -35.169 15.835  36.295  1.00 19.64  ? 313 LEU A C   1 
ATOM   2544 O  O   . LEU A 1 312 ? -35.163 16.705  37.164  1.00 19.13  ? 313 LEU A O   1 
ATOM   2545 C  CB  . LEU A 1 312 ? -35.804 13.455  36.943  1.00 19.34  ? 313 LEU A CB  1 
ATOM   2546 C  CG  . LEU A 1 312 ? -36.906 12.434  37.310  1.00 18.85  ? 313 LEU A CG  1 
ATOM   2547 C  CD1 . LEU A 1 312 ? -36.328 11.091  37.712  1.00 16.57  ? 313 LEU A CD1 1 
ATOM   2548 C  CD2 . LEU A 1 312 ? -37.824 12.941  38.413  1.00 18.34  ? 313 LEU A CD2 1 
ATOM   2549 N  N   . ARG A 1 313 ? -34.252 15.770  35.333  1.00 19.83  ? 314 ARG A N   1 
ATOM   2550 C  CA  . ARG A 1 313 ? -33.187 16.776  35.230  1.00 20.55  ? 314 ARG A CA  1 
ATOM   2551 C  C   . ARG A 1 313 ? -33.760 18.174  34.977  1.00 20.85  ? 314 ARG A C   1 
ATOM   2552 O  O   . ARG A 1 313 ? -33.349 19.143  35.624  1.00 20.54  ? 314 ARG A O   1 
ATOM   2553 C  CB  . ARG A 1 313 ? -32.180 16.417  34.132  1.00 20.39  ? 314 ARG A CB  1 
ATOM   2554 C  CG  . ARG A 1 313 ? -31.082 17.461  33.933  1.00 21.12  ? 314 ARG A CG  1 
ATOM   2555 C  CD  . ARG A 1 313 ? -29.949 16.939  33.057  1.00 21.23  ? 314 ARG A CD  1 
ATOM   2556 N  NE  . ARG A 1 313 ? -29.386 15.713  33.622  1.00 24.21  ? 314 ARG A NE  1 
ATOM   2557 C  CZ  . ARG A 1 313 ? -29.572 14.488  33.128  1.00 24.87  ? 314 ARG A CZ  1 
ATOM   2558 N  NH1 . ARG A 1 313 ? -30.293 14.295  32.022  1.00 24.77  ? 314 ARG A NH1 1 
ATOM   2559 N  NH2 . ARG A 1 313 ? -29.028 13.450  33.744  1.00 23.57  ? 314 ARG A NH2 1 
ATOM   2560 N  N   . ALA A 1 314 ? -34.712 18.265  34.043  1.00 21.14  ? 315 ALA A N   1 
ATOM   2561 C  CA  . ALA A 1 314 ? -35.357 19.546  33.725  1.00 21.66  ? 315 ALA A CA  1 
ATOM   2562 C  C   . ALA A 1 314 ? -36.051 20.111  34.960  1.00 22.25  ? 315 ALA A C   1 
ATOM   2563 O  O   . ALA A 1 314 ? -35.999 21.328  35.209  1.00 22.19  ? 315 ALA A O   1 
ATOM   2564 C  CB  . ALA A 1 314 ? -36.351 19.392  32.566  1.00 21.26  ? 315 ALA A CB  1 
ATOM   2565 N  N   . GLU A 1 315 ? -36.685 19.229  35.739  1.00 22.56  ? 316 GLU A N   1 
ATOM   2566 C  CA  . GLU A 1 315 ? -37.335 19.655  36.979  1.00 23.41  ? 316 GLU A CA  1 
ATOM   2567 C  C   . GLU A 1 315 ? -36.334 20.208  37.993  1.00 23.05  ? 316 GLU A C   1 
ATOM   2568 O  O   . GLU A 1 315 ? -36.616 21.206  38.657  1.00 23.15  ? 316 GLU A O   1 
ATOM   2569 C  CB  . GLU A 1 315 ? -38.166 18.542  37.619  1.00 23.67  ? 316 GLU A CB  1 
ATOM   2570 C  CG  . GLU A 1 315 ? -39.019 19.070  38.779  1.00 26.13  ? 316 GLU A CG  1 
ATOM   2571 C  CD  . GLU A 1 315 ? -39.686 17.980  39.602  1.00 29.04  ? 316 GLU A CD  1 
ATOM   2572 O  OE1 . GLU A 1 315 ? -38.969 17.115  40.163  1.00 30.26  ? 316 GLU A OE1 1 
ATOM   2573 O  OE2 . GLU A 1 315 ? -40.934 18.005  39.702  1.00 29.55  ? 316 GLU A OE2 1 
ATOM   2574 N  N   . VAL A 1 316 ? -35.176 19.559  38.099  1.00 22.72  ? 317 VAL A N   1 
ATOM   2575 C  CA  . VAL A 1 316 ? -34.128 19.978  39.034  1.00 22.76  ? 317 VAL A CA  1 
ATOM   2576 C  C   . VAL A 1 316 ? -33.497 21.316  38.631  1.00 22.97  ? 317 VAL A C   1 
ATOM   2577 O  O   . VAL A 1 316 ? -33.336 22.206  39.473  1.00 22.94  ? 317 VAL A O   1 
ATOM   2578 C  CB  . VAL A 1 316 ? -33.039 18.893  39.191  1.00 22.44  ? 317 VAL A CB  1 
ATOM   2579 C  CG1 . VAL A 1 316 ? -31.824 19.441  39.936  1.00 22.30  ? 317 VAL A CG1 1 
ATOM   2580 C  CG2 . VAL A 1 316 ? -33.603 17.685  39.921  1.00 22.40  ? 317 VAL A CG2 1 
ATOM   2581 N  N   . LEU A 1 317 ? -33.146 21.446  37.352  1.00 23.13  ? 318 LEU A N   1 
ATOM   2582 C  CA  . LEU A 1 317 ? -32.563 22.677  36.825  1.00 23.87  ? 318 LEU A CA  1 
ATOM   2583 C  C   . LEU A 1 317 ? -33.483 23.878  37.059  1.00 24.04  ? 318 LEU A C   1 
ATOM   2584 O  O   . LEU A 1 317 ? -33.023 24.942  37.480  1.00 23.95  ? 318 LEU A O   1 
ATOM   2585 C  CB  . LEU A 1 317 ? -32.218 22.530  35.338  1.00 23.81  ? 318 LEU A CB  1 
ATOM   2586 C  CG  . LEU A 1 317 ? -31.103 21.534  34.967  1.00 24.85  ? 318 LEU A CG  1 
ATOM   2587 C  CD1 . LEU A 1 317 ? -31.026 21.359  33.450  1.00 25.23  ? 318 LEU A CD1 1 
ATOM   2588 C  CD2 . LEU A 1 317 ? -29.729 21.931  35.529  1.00 23.89  ? 318 LEU A CD2 1 
ATOM   2589 N  N   . ALA A 1 318 ? -34.781 23.685  36.827  1.00 24.42  ? 319 ALA A N   1 
ATOM   2590 C  CA  . ALA A 1 318 ? -35.772 24.735  37.060  1.00 25.00  ? 319 ALA A CA  1 
ATOM   2591 C  C   . ALA A 1 318 ? -35.916 25.032  38.544  1.00 25.42  ? 319 ALA A C   1 
ATOM   2592 O  O   . ALA A 1 318 ? -36.149 26.184  38.928  1.00 25.31  ? 319 ALA A O   1 
ATOM   2593 C  CB  . ALA A 1 318 ? -37.125 24.367  36.451  1.00 24.81  ? 319 ALA A CB  1 
ATOM   2594 N  N   . ALA A 1 319 ? -35.779 24.000  39.375  1.00 25.67  ? 320 ALA A N   1 
ATOM   2595 C  CA  . ALA A 1 319 ? -35.881 24.191  40.822  1.00 26.48  ? 320 ALA A CA  1 
ATOM   2596 C  C   . ALA A 1 319 ? -34.688 24.982  41.362  1.00 27.03  ? 320 ALA A C   1 
ATOM   2597 O  O   . ALA A 1 319 ? -34.868 25.888  42.176  1.00 26.88  ? 320 ALA A O   1 
ATOM   2598 C  CB  . ALA A 1 319 ? -36.022 22.859  41.546  1.00 26.39  ? 320 ALA A CB  1 
ATOM   2599 N  N   . ARG A 1 320 ? -33.483 24.649  40.899  1.00 27.92  ? 321 ARG A N   1 
ATOM   2600 C  CA  . ARG A 1 320 ? -32.264 25.359  41.319  1.00 29.04  ? 321 ARG A CA  1 
ATOM   2601 C  C   . ARG A 1 320 ? -32.299 26.832  40.903  1.00 30.07  ? 321 ARG A C   1 
ATOM   2602 O  O   . ARG A 1 320 ? -31.775 27.697  41.615  1.00 30.31  ? 321 ARG A O   1 
ATOM   2603 C  CB  . ARG A 1 320 ? -31.001 24.680  40.764  1.00 28.60  ? 321 ARG A CB  1 
ATOM   2604 C  CG  . ARG A 1 320 ? -29.682 25.329  41.199  1.00 28.22  ? 321 ARG A CG  1 
ATOM   2605 C  CD  . ARG A 1 320 ? -29.318 24.990  42.648  1.00 28.66  ? 321 ARG A CD  1 
ATOM   2606 N  NE  . ARG A 1 320 ? -28.697 23.667  42.765  1.00 27.82  ? 321 ARG A NE  1 
ATOM   2607 C  CZ  . ARG A 1 320 ? -28.121 23.183  43.866  1.00 28.03  ? 321 ARG A CZ  1 
ATOM   2608 N  NH1 . ARG A 1 320 ? -28.076 23.901  44.985  1.00 27.02  ? 321 ARG A NH1 1 
ATOM   2609 N  NH2 . ARG A 1 320 ? -27.577 21.974  43.845  1.00 25.89  ? 321 ARG A NH2 1 
ATOM   2610 N  N   . HIS A 1 321 ? -32.906 27.104  39.750  1.00 31.26  ? 322 HIS A N   1 
ATOM   2611 C  CA  . HIS A 1 321 ? -33.028 28.469  39.247  1.00 32.41  ? 322 HIS A CA  1 
ATOM   2612 C  C   . HIS A 1 321 ? -34.048 29.279  40.043  1.00 32.87  ? 322 HIS A C   1 
ATOM   2613 O  O   . HIS A 1 321 ? -33.750 30.389  40.483  1.00 32.88  ? 322 HIS A O   1 
ATOM   2614 C  CB  . HIS A 1 321 ? -33.372 28.489  37.752  1.00 32.56  ? 322 HIS A CB  1 
ATOM   2615 C  CG  . HIS A 1 321 ? -33.627 29.865  37.215  1.00 34.12  ? 322 HIS A CG  1 
ATOM   2616 N  ND1 . HIS A 1 321 ? -32.628 30.805  37.071  1.00 35.57  ? 322 HIS A ND1 1 
ATOM   2617 C  CD2 . HIS A 1 321 ? -34.769 30.464  36.800  1.00 35.26  ? 322 HIS A CD2 1 
ATOM   2618 C  CE1 . HIS A 1 321 ? -33.143 31.921  36.584  1.00 36.58  ? 322 HIS A CE1 1 
ATOM   2619 N  NE2 . HIS A 1 321 ? -34.440 31.738  36.407  1.00 36.40  ? 322 HIS A NE2 1 
ATOM   2620 N  N   . GLN A 1 322 ? -35.245 28.728  40.226  1.00 33.62  ? 323 GLN A N   1 
ATOM   2621 C  CA  . GLN A 1 322 ? -36.290 29.430  40.963  1.00 34.50  ? 323 GLN A CA  1 
ATOM   2622 C  C   . GLN A 1 322 ? -35.896 29.670  42.419  1.00 34.65  ? 323 GLN A C   1 
ATOM   2623 O  O   . GLN A 1 322 ? -36.200 30.726  42.982  1.00 34.96  ? 323 GLN A O   1 
ATOM   2624 C  CB  . GLN A 1 322 ? -37.615 28.674  40.891  1.00 34.85  ? 323 GLN A CB  1 
ATOM   2625 C  CG  . GLN A 1 322 ? -38.786 29.444  41.499  1.00 37.59  ? 323 GLN A CG  1 
ATOM   2626 C  CD  . GLN A 1 322 ? -40.061 28.625  41.577  1.00 41.26  ? 323 GLN A CD  1 
ATOM   2627 O  OE1 . GLN A 1 322 ? -40.371 27.842  40.674  1.00 43.56  ? 323 GLN A OE1 1 
ATOM   2628 N  NE2 . GLN A 1 322 ? -40.818 28.811  42.658  1.00 42.27  ? 323 GLN A NE2 1 
ATOM   2629 N  N   . ALA A 1 323 ? -35.216 28.693  43.021  1.00 34.38  ? 324 ALA A N   1 
ATOM   2630 C  CA  . ALA A 1 323 ? -34.790 28.789  44.417  1.00 34.17  ? 324 ALA A CA  1 
ATOM   2631 C  C   . ALA A 1 323 ? -33.582 29.709  44.572  1.00 34.17  ? 324 ALA A C   1 
ATOM   2632 O  O   . ALA A 1 323 ? -33.132 29.974  45.695  1.00 33.88  ? 324 ALA A O   1 
ATOM   2633 C  CB  . ALA A 1 323 ? -34.471 27.403  44.971  1.00 34.18  ? 324 ALA A CB  1 
ATOM   2634 N  N   . GLN A 1 324 ? -33.069 30.193  43.438  1.00 33.98  ? 325 GLN A N   1 
ATOM   2635 C  CA  . GLN A 1 324 ? -31.848 30.988  43.393  1.00 33.77  ? 325 GLN A CA  1 
ATOM   2636 C  C   . GLN A 1 324 ? -30.739 30.285  44.170  1.00 33.20  ? 325 GLN A C   1 
ATOM   2637 O  O   . GLN A 1 324 ? -30.006 30.911  44.940  1.00 33.25  ? 325 GLN A O   1 
ATOM   2638 C  CB  . GLN A 1 324 ? -32.096 32.426  43.900  1.00 34.30  ? 325 GLN A CB  1 
ATOM   2639 C  CG  . GLN A 1 324 ? -32.941 33.288  42.948  1.00 35.94  ? 325 GLN A CG  1 
ATOM   2640 C  CD  . GLN A 1 324 ? -33.399 34.611  43.575  1.00 38.67  ? 325 GLN A CD  1 
ATOM   2641 O  OE1 . GLN A 1 324 ? -32.581 35.462  43.943  1.00 38.72  ? 325 GLN A OE1 1 
ATOM   2642 N  NE2 . GLN A 1 324 ? -34.719 34.789  43.686  1.00 38.96  ? 325 GLN A NE2 1 
ATOM   2643 N  N   . GLY A 1 325 ? -30.641 28.970  43.972  1.00 32.51  ? 326 GLY A N   1 
ATOM   2644 C  CA  . GLY A 1 325 ? -29.552 28.168  44.527  1.00 31.37  ? 326 GLY A CA  1 
ATOM   2645 C  C   . GLY A 1 325 ? -29.754 27.595  45.923  1.00 30.66  ? 326 GLY A C   1 
ATOM   2646 O  O   . GLY A 1 325 ? -28.999 26.709  46.336  1.00 30.57  ? 326 GLY A O   1 
ATOM   2647 N  N   . ASP A 1 326 ? -30.746 28.097  46.663  1.00 29.61  ? 327 ASP A N   1 
ATOM   2648 C  CA  . ASP A 1 326 ? -30.989 27.621  48.033  1.00 28.98  ? 327 ASP A CA  1 
ATOM   2649 C  C   . ASP A 1 326 ? -31.536 26.177  48.064  1.00 28.19  ? 327 ASP A C   1 
ATOM   2650 O  O   . ASP A 1 326 ? -32.580 25.887  47.468  1.00 27.65  ? 327 ASP A O   1 
ATOM   2651 C  CB  . ASP A 1 326 ? -31.932 28.563  48.795  1.00 28.94  ? 327 ASP A CB  1 
ATOM   2652 C  CG  . ASP A 1 326 ? -32.070 28.185  50.268  1.00 29.65  ? 327 ASP A CG  1 
ATOM   2653 O  OD1 . ASP A 1 326 ? -31.031 28.141  50.962  1.00 31.11  ? 327 ASP A OD1 1 
ATOM   2654 O  OD2 . ASP A 1 326 ? -33.206 27.933  50.736  1.00 29.07  ? 327 ASP A OD2 1 
ATOM   2655 N  N   . MET A 1 327 ? -30.831 25.289  48.769  1.00 27.41  ? 328 MET A N   1 
ATOM   2656 C  CA  . MET A 1 327 ? -31.202 23.868  48.818  1.00 26.73  ? 328 MET A CA  1 
ATOM   2657 C  C   . MET A 1 327 ? -32.547 23.650  49.494  1.00 26.26  ? 328 MET A C   1 
ATOM   2658 O  O   . MET A 1 327 ? -33.395 22.946  48.960  1.00 26.33  ? 328 MET A O   1 
ATOM   2659 C  CB  . MET A 1 327 ? -30.115 23.011  49.485  1.00 26.60  ? 328 MET A CB  1 
ATOM   2660 C  CG  . MET A 1 327 ? -30.453 21.504  49.565  1.00 25.94  ? 328 MET A CG  1 
ATOM   2661 S  SD  . MET A 1 327 ? -30.831 20.720  47.971  1.00 24.13  ? 328 MET A SD  1 
ATOM   2662 C  CE  . MET A 1 327 ? -29.213 20.735  47.196  1.00 22.51  ? 328 MET A CE  1 
ATOM   2663 N  N   . ALA A 1 328 ? -32.744 24.267  50.655  1.00 25.79  ? 329 ALA A N   1 
ATOM   2664 C  CA  . ALA A 1 328 ? -34.015 24.171  51.376  1.00 25.56  ? 329 ALA A CA  1 
ATOM   2665 C  C   . ALA A 1 328 ? -35.216 24.560  50.506  1.00 25.53  ? 329 ALA A C   1 
ATOM   2666 O  O   . ALA A 1 328 ? -36.266 23.909  50.548  1.00 24.93  ? 329 ALA A O   1 
ATOM   2667 C  CB  . ALA A 1 328 ? -33.972 25.027  52.634  1.00 25.20  ? 329 ALA A CB  1 
ATOM   2668 N  N   . THR A 1 329 ? -35.056 25.629  49.727  1.00 25.49  ? 330 THR A N   1 
ATOM   2669 C  CA  . THR A 1 329 ? -36.124 26.090  48.844  1.00 25.76  ? 330 THR A CA  1 
ATOM   2670 C  C   . THR A 1 329 ? -36.317 25.133  47.649  1.00 25.76  ? 330 THR A C   1 
ATOM   2671 O  O   . THR A 1 329 ? -37.449 24.873  47.246  1.00 25.65  ? 330 THR A O   1 
ATOM   2672 C  CB  . THR A 1 329 ? -35.899 27.560  48.392  1.00 25.73  ? 330 THR A CB  1 
ATOM   2673 O  OG1 . THR A 1 329 ? -35.721 28.392  49.549  1.00 25.68  ? 330 THR A OG1 1 
ATOM   2674 C  CG2 . THR A 1 329 ? -37.098 28.072  47.583  1.00 25.42  ? 330 THR A CG2 1 
ATOM   2675 N  N   . MET A 1 330 ? -35.213 24.605  47.119  1.00 26.06  ? 331 MET A N   1 
ATOM   2676 C  CA  . MET A 1 330 ? -35.230 23.625  46.026  1.00 26.83  ? 331 MET A CA  1 
ATOM   2677 C  C   . MET A 1 330 ? -36.062 22.386  46.334  1.00 26.68  ? 331 MET A C   1 
ATOM   2678 O  O   . MET A 1 330 ? -36.826 21.914  45.485  1.00 26.25  ? 331 MET A O   1 
ATOM   2679 C  CB  . MET A 1 330 ? -33.818 23.141  45.729  1.00 27.34  ? 331 MET A CB  1 
ATOM   2680 C  CG  . MET A 1 330 ? -33.083 23.924  44.694  1.00 29.50  ? 331 MET A CG  1 
ATOM   2681 S  SD  . MET A 1 330 ? -31.728 22.888  44.156  1.00 34.80  ? 331 MET A SD  1 
ATOM   2682 C  CE  . MET A 1 330 ? -32.602 21.794  43.020  1.00 32.36  ? 331 MET A CE  1 
ATOM   2683 N  N   . LEU A 1 331 ? -35.895 21.871  47.552  1.00 26.56  ? 332 LEU A N   1 
ATOM   2684 C  CA  . LEU A 1 331 ? -36.542 20.632  47.991  1.00 26.87  ? 332 LEU A CA  1 
ATOM   2685 C  C   . LEU A 1 331 ? -38.065 20.732  48.022  1.00 27.05  ? 332 LEU A C   1 
ATOM   2686 O  O   . LEU A 1 331 ? -38.755 19.731  48.206  1.00 27.52  ? 332 LEU A O   1 
ATOM   2687 C  CB  . LEU A 1 331 ? -35.993 20.198  49.356  1.00 26.48  ? 332 LEU A CB  1 
ATOM   2688 C  CG  . LEU A 1 331 ? -34.525 19.754  49.351  1.00 26.76  ? 332 LEU A CG  1 
ATOM   2689 C  CD1 . LEU A 1 331 ? -33.982 19.613  50.756  1.00 27.34  ? 332 LEU A CD1 1 
ATOM   2690 C  CD2 . LEU A 1 331 ? -34.349 18.449  48.584  1.00 26.41  ? 332 LEU A CD2 1 
ATOM   2691 N  N   . GLN A 1 332 ? -38.573 21.946  47.836  1.00 27.28  ? 333 GLN A N   1 
ATOM   2692 C  CA  . GLN A 1 332 ? -40.007 22.200  47.771  1.00 27.59  ? 333 GLN A CA  1 
ATOM   2693 C  C   . GLN A 1 332 ? -40.516 22.313  46.332  1.00 26.69  ? 333 GLN A C   1 
ATOM   2694 O  O   . GLN A 1 332 ? -41.726 22.382  46.097  1.00 26.42  ? 333 GLN A O   1 
ATOM   2695 C  CB  . GLN A 1 332 ? -40.351 23.466  48.563  1.00 27.91  ? 333 GLN A CB  1 
ATOM   2696 C  CG  . GLN A 1 332 ? -40.372 23.254  50.066  1.00 31.15  ? 333 GLN A CG  1 
ATOM   2697 C  CD  . GLN A 1 332 ? -41.485 22.306  50.506  1.00 35.90  ? 333 GLN A CD  1 
ATOM   2698 O  OE1 . GLN A 1 332 ? -41.246 21.118  50.753  1.00 37.21  ? 333 GLN A OE1 1 
ATOM   2699 N  NE2 . GLN A 1 332 ? -42.714 22.829  50.598  1.00 37.93  ? 333 GLN A NE2 1 
ATOM   2700 N  N   . LEU A 1 333 ? -39.585 22.317  45.384  1.00 26.16  ? 334 LEU A N   1 
ATOM   2701 C  CA  . LEU A 1 333 ? -39.886 22.549  43.974  1.00 25.75  ? 334 LEU A CA  1 
ATOM   2702 C  C   . LEU A 1 333 ? -39.522 21.355  43.111  1.00 25.39  ? 334 LEU A C   1 
ATOM   2703 O  O   . LEU A 1 333 ? -39.294 21.492  41.897  1.00 24.87  ? 334 LEU A O   1 
ATOM   2704 C  CB  . LEU A 1 333 ? -39.103 23.773  43.475  1.00 26.14  ? 334 LEU A CB  1 
ATOM   2705 C  CG  . LEU A 1 333 ? -39.317 25.104  44.193  1.00 26.37  ? 334 LEU A CG  1 
ATOM   2706 C  CD1 . LEU A 1 333 ? -38.289 26.118  43.705  1.00 27.67  ? 334 LEU A CD1 1 
ATOM   2707 C  CD2 . LEU A 1 333 ? -40.735 25.597  43.953  1.00 27.63  ? 334 LEU A CD2 1 
ATOM   2708 N  N   . VAL A 1 334 ? -39.467 20.179  43.729  1.00 24.75  ? 335 VAL A N   1 
ATOM   2709 C  CA  . VAL A 1 334 ? -38.991 19.005  43.023  1.00 24.48  ? 335 VAL A CA  1 
ATOM   2710 C  C   . VAL A 1 334 ? -39.915 17.774  43.249  1.00 24.18  ? 335 VAL A C   1 
ATOM   2711 O  O   . VAL A 1 334 ? -39.452 16.668  43.552  1.00 24.19  ? 335 VAL A O   1 
ATOM   2712 C  CB  . VAL A 1 334 ? -37.453 18.828  43.302  1.00 24.56  ? 335 VAL A CB  1 
ATOM   2713 C  CG1 . VAL A 1 334 ? -37.159 17.954  44.542  1.00 23.85  ? 335 VAL A CG1 1 
ATOM   2714 C  CG2 . VAL A 1 334 ? -36.736 18.350  42.063  1.00 26.08  ? 335 VAL A CG2 1 
ATOM   2715 N  N   . PRO A 1 335 ? -41.243 17.969  43.075  1.00 23.86  ? 336 PRO A N   1 
ATOM   2716 C  CA  . PRO A 1 335 ? -42.221 16.920  43.383  1.00 23.29  ? 336 PRO A CA  1 
ATOM   2717 C  C   . PRO A 1 335 ? -42.094 15.653  42.520  1.00 22.78  ? 336 PRO A C   1 
ATOM   2718 O  O   . PRO A 1 335 ? -42.342 14.550  43.013  1.00 22.52  ? 336 PRO A O   1 
ATOM   2719 C  CB  . PRO A 1 335 ? -43.573 17.618  43.155  1.00 23.09  ? 336 PRO A CB  1 
ATOM   2720 C  CG  . PRO A 1 335 ? -43.285 18.710  42.197  1.00 23.89  ? 336 PRO A CG  1 
ATOM   2721 C  CD  . PRO A 1 335 ? -41.905 19.184  42.547  1.00 23.92  ? 336 PRO A CD  1 
ATOM   2722 N  N   . LEU A 1 336 ? -41.706 15.802  41.258  1.00 22.35  ? 337 LEU A N   1 
ATOM   2723 C  CA  . LEU A 1 336 ? -41.484 14.637  40.404  1.00 21.98  ? 337 LEU A CA  1 
ATOM   2724 C  C   . LEU A 1 336 ? -40.285 13.791  40.866  1.00 21.54  ? 337 LEU A C   1 
ATOM   2725 O  O   . LEU A 1 336 ? -40.320 12.572  40.760  1.00 21.17  ? 337 LEU A O   1 
ATOM   2726 C  CB  . LEU A 1 336 ? -41.334 15.045  38.936  1.00 22.08  ? 337 LEU A CB  1 
ATOM   2727 C  CG  . LEU A 1 336 ? -41.345 13.931  37.877  1.00 22.87  ? 337 LEU A CG  1 
ATOM   2728 C  CD1 . LEU A 1 336 ? -42.726 13.297  37.742  1.00 22.23  ? 337 LEU A CD1 1 
ATOM   2729 C  CD2 . LEU A 1 336 ? -40.885 14.483  36.535  1.00 23.89  ? 337 LEU A CD2 1 
ATOM   2730 N  N   . LEU A 1 337 ? -39.233 14.438  41.373  1.00 21.02  ? 338 LEU A N   1 
ATOM   2731 C  CA  . LEU A 1 337 ? -38.080 13.712  41.924  1.00 20.68  ? 338 LEU A CA  1 
ATOM   2732 C  C   . LEU A 1 337 ? -38.468 12.935  43.178  1.00 20.28  ? 338 LEU A C   1 
ATOM   2733 O  O   . LEU A 1 337 ? -38.114 11.768  43.324  1.00 20.49  ? 338 LEU A O   1 
ATOM   2734 C  CB  . LEU A 1 337 ? -36.903 14.653  42.216  1.00 20.52  ? 338 LEU A CB  1 
ATOM   2735 C  CG  . LEU A 1 337 ? -35.565 14.033  42.648  1.00 20.84  ? 338 LEU A CG  1 
ATOM   2736 C  CD1 . LEU A 1 337 ? -35.033 13.039  41.609  1.00 18.78  ? 338 LEU A CD1 1 
ATOM   2737 C  CD2 . LEU A 1 337 ? -34.519 15.123  42.939  1.00 19.11  ? 338 LEU A CD2 1 
ATOM   2738 N  N   . LYS A 1 338 ? -39.207 13.584  44.068  1.00 19.78  ? 339 LYS A N   1 
ATOM   2739 C  CA  . LYS A 1 338 ? -39.706 12.932  45.273  1.00 19.94  ? 339 LYS A CA  1 
ATOM   2740 C  C   . LYS A 1 338 ? -40.590 11.737  44.939  1.00 19.48  ? 339 LYS A C   1 
ATOM   2741 O  O   . LYS A 1 338 ? -40.461 10.673  45.557  1.00 18.96  ? 339 LYS A O   1 
ATOM   2742 C  CB  . LYS A 1 338 ? -40.452 13.927  46.165  1.00 20.00  ? 339 LYS A CB  1 
ATOM   2743 C  CG  . LYS A 1 338 ? -39.534 14.972  46.771  1.00 20.97  ? 339 LYS A CG  1 
ATOM   2744 C  CD  . LYS A 1 338 ? -40.237 15.775  47.848  1.00 23.35  ? 339 LYS A CD  1 
ATOM   2745 C  CE  . LYS A 1 338 ? -39.223 16.548  48.671  1.00 26.54  ? 339 LYS A CE  1 
ATOM   2746 N  NZ  . LYS A 1 338 ? -39.854 17.217  49.842  1.00 28.73  ? 339 LYS A NZ  1 
ATOM   2747 N  N   . ALA A 1 339 ? -41.468 11.921  43.950  1.00 18.86  ? 340 ALA A N   1 
ATOM   2748 C  CA  . ALA A 1 339 ? -42.324 10.839  43.440  1.00 18.63  ? 340 ALA A CA  1 
ATOM   2749 C  C   . ALA A 1 339 ? -41.502 9.705   42.837  1.00 18.12  ? 340 ALA A C   1 
ATOM   2750 O  O   . ALA A 1 339 ? -41.919 8.551   42.890  1.00 18.65  ? 340 ALA A O   1 
ATOM   2751 C  CB  . ALA A 1 339 ? -43.329 11.364  42.416  1.00 17.79  ? 340 ALA A CB  1 
ATOM   2752 N  N   . SER A 1 340 ? -40.347 10.039  42.272  1.00 17.33  ? 341 SER A N   1 
ATOM   2753 C  CA  . SER A 1 340 ? -39.473 9.050   41.637  1.00 17.46  ? 341 SER A CA  1 
ATOM   2754 C  C   . SER A 1 340 ? -38.766 8.171   42.680  1.00 17.17  ? 341 SER A C   1 
ATOM   2755 O  O   . SER A 1 340 ? -38.408 7.031   42.391  1.00 17.34  ? 341 SER A O   1 
ATOM   2756 C  CB  . SER A 1 340 ? -38.444 9.730   40.705  1.00 17.25  ? 341 SER A CB  1 
ATOM   2757 O  OG  . SER A 1 340 ? -37.399 10.355  41.448  1.00 17.46  ? 341 SER A OG  1 
ATOM   2758 N  N   . ILE A 1 341 ? -38.560 8.719   43.879  1.00 16.86  ? 342 ILE A N   1 
ATOM   2759 C  CA  . ILE A 1 341 ? -38.074 7.946   45.018  1.00 16.72  ? 342 ILE A CA  1 
ATOM   2760 C  C   . ILE A 1 341 ? -39.136 6.937   45.493  1.00 16.95  ? 342 ILE A C   1 
ATOM   2761 O  O   . ILE A 1 341 ? -38.821 5.765   45.727  1.00 17.06  ? 342 ILE A O   1 
ATOM   2762 C  CB  . ILE A 1 341 ? -37.570 8.860   46.171  1.00 16.81  ? 342 ILE A CB  1 
ATOM   2763 C  CG1 . ILE A 1 341 ? -36.300 9.597   45.725  1.00 17.00  ? 342 ILE A CG1 1 
ATOM   2764 C  CG2 . ILE A 1 341 ? -37.293 8.040   47.440  1.00 15.67  ? 342 ILE A CG2 1 
ATOM   2765 C  CD1 . ILE A 1 341 ? -35.837 10.698  46.666  1.00 17.78  ? 342 ILE A CD1 1 
ATOM   2766 N  N   . LYS A 1 342 ? -40.389 7.379   45.597  1.00 16.83  ? 343 LYS A N   1 
ATOM   2767 C  CA  . LYS A 1 342 ? -41.512 6.474   45.900  1.00 16.53  ? 343 LYS A CA  1 
ATOM   2768 C  C   . LYS A 1 342 ? -41.623 5.362   44.858  1.00 16.30  ? 343 LYS A C   1 
ATOM   2769 O  O   . LYS A 1 342 ? -41.829 4.184   45.197  1.00 16.15  ? 343 LYS A O   1 
ATOM   2770 C  CB  . LYS A 1 342 ? -42.834 7.243   45.953  1.00 16.66  ? 343 LYS A CB  1 
ATOM   2771 C  CG  . LYS A 1 342 ? -42.907 8.271   47.048  1.00 17.48  ? 343 LYS A CG  1 
ATOM   2772 C  CD  . LYS A 1 342 ? -44.204 9.058   46.958  1.00 19.90  ? 343 LYS A CD  1 
ATOM   2773 C  CE  . LYS A 1 342 ? -44.161 10.250  47.911  1.00 20.84  ? 343 LYS A CE  1 
ATOM   2774 N  NZ  . LYS A 1 342 ? -45.440 11.001  47.858  1.00 23.68  ? 343 LYS A NZ  1 
ATOM   2775 N  N   . GLU A 1 343 ? -41.483 5.747   43.593  1.00 15.43  ? 344 GLU A N   1 
ATOM   2776 C  CA  . GLU A 1 343 ? -41.504 4.805   42.485  1.00 14.84  ? 344 GLU A CA  1 
ATOM   2777 C  C   . GLU A 1 343 ? -40.351 3.797   42.552  1.00 14.74  ? 344 GLU A C   1 
ATOM   2778 O  O   . GLU A 1 343 ? -40.536 2.628   42.229  1.00 15.07  ? 344 GLU A O   1 
ATOM   2779 C  CB  . GLU A 1 343 ? -41.462 5.570   41.162  1.00 14.80  ? 344 GLU A CB  1 
ATOM   2780 C  CG  . GLU A 1 343 ? -41.745 4.728   39.914  1.00 14.33  ? 344 GLU A CG  1 
ATOM   2781 C  CD  . GLU A 1 343 ? -43.190 4.221   39.814  1.00 13.34  ? 344 GLU A CD  1 
ATOM   2782 O  OE1 . GLU A 1 343 ? -43.940 4.246   40.825  1.00 13.67  ? 344 GLU A OE1 1 
ATOM   2783 O  OE2 . GLU A 1 343 ? -43.567 3.763   38.720  1.00 11.18  ? 344 GLU A OE2 1 
ATOM   2784 N  N   . THR A 1 344 ? -39.167 4.247   42.965  1.00 14.26  ? 345 THR A N   1 
ATOM   2785 C  CA  . THR A 1 344 ? -38.027 3.349   43.118  1.00 13.75  ? 345 THR A CA  1 
ATOM   2786 C  C   . THR A 1 344 ? -38.309 2.316   44.213  1.00 13.72  ? 345 THR A C   1 
ATOM   2787 O  O   . THR A 1 344 ? -38.089 1.123   44.017  1.00 13.69  ? 345 THR A O   1 
ATOM   2788 C  CB  . THR A 1 344 ? -36.736 4.130   43.413  1.00 13.58  ? 345 THR A CB  1 
ATOM   2789 O  OG1 . THR A 1 344 ? -36.457 4.987   42.303  1.00 14.33  ? 345 THR A OG1 1 
ATOM   2790 C  CG2 . THR A 1 344 ? -35.550 3.192   43.642  1.00 12.04  ? 345 THR A CG2 1 
ATOM   2791 N  N   . LEU A 1 345 ? -38.836 2.779   45.341  1.00 13.80  ? 346 LEU A N   1 
ATOM   2792 C  CA  . LEU A 1 345 ? -39.161 1.894   46.452  1.00 14.68  ? 346 LEU A CA  1 
ATOM   2793 C  C   . LEU A 1 345 ? -40.333 0.940   46.198  1.00 14.90  ? 346 LEU A C   1 
ATOM   2794 O  O   . LEU A 1 345 ? -40.374 -0.150  46.765  1.00 15.27  ? 346 LEU A O   1 
ATOM   2795 C  CB  . LEU A 1 345 ? -39.356 2.699   47.738  1.00 14.89  ? 346 LEU A CB  1 
ATOM   2796 C  CG  . LEU A 1 345 ? -38.034 3.221   48.326  1.00 15.94  ? 346 LEU A CG  1 
ATOM   2797 C  CD1 . LEU A 1 345 ? -38.334 4.162   49.435  1.00 15.93  ? 346 LEU A CD1 1 
ATOM   2798 C  CD2 . LEU A 1 345 ? -37.157 2.071   48.833  1.00 16.64  ? 346 LEU A CD2 1 
ATOM   2799 N  N   . ARG A 1 346 ? -41.271 1.325   45.337  1.00 15.29  ? 347 ARG A N   1 
ATOM   2800 C  CA  . ARG A 1 346 ? -42.368 0.426   44.971  1.00 15.67  ? 347 ARG A CA  1 
ATOM   2801 C  C   . ARG A 1 346 ? -41.833 -0.797  44.219  1.00 15.38  ? 347 ARG A C   1 
ATOM   2802 O  O   . ARG A 1 346 ? -42.200 -1.929  44.524  1.00 15.47  ? 347 ARG A O   1 
ATOM   2803 C  CB  . ARG A 1 346 ? -43.445 1.166   44.157  1.00 16.22  ? 347 ARG A CB  1 
ATOM   2804 C  CG  . ARG A 1 346 ? -44.329 0.268   43.286  1.00 17.66  ? 347 ARG A CG  1 
ATOM   2805 C  CD  . ARG A 1 346 ? -45.209 1.114   42.361  1.00 20.72  ? 347 ARG A CD  1 
ATOM   2806 N  NE  . ARG A 1 346 ? -45.121 0.670   40.974  1.00 23.09  ? 347 ARG A NE  1 
ATOM   2807 C  CZ  . ARG A 1 346 ? -44.141 1.022   40.158  1.00 24.99  ? 347 ARG A CZ  1 
ATOM   2808 N  NH1 . ARG A 1 346 ? -43.187 1.802   40.617  1.00 31.30  ? 347 ARG A NH1 1 
ATOM   2809 N  NH2 . ARG A 1 346 ? -44.084 0.594   38.909  1.00 24.50  ? 347 ARG A NH2 1 
ATOM   2810 N  N   . LEU A 1 347 ? -40.954 -0.556  43.253  1.00 15.30  ? 348 LEU A N   1 
ATOM   2811 C  CA  . LEU A 1 347 ? -40.340 -1.625  42.473  1.00 15.12  ? 348 LEU A CA  1 
ATOM   2812 C  C   . LEU A 1 347 ? -39.236 -2.342  43.235  1.00 14.88  ? 348 LEU A C   1 
ATOM   2813 O  O   . LEU A 1 347 ? -39.021 -3.540  43.056  1.00 15.30  ? 348 LEU A O   1 
ATOM   2814 C  CB  . LEU A 1 347 ? -39.741 -1.064  41.182  1.00 15.15  ? 348 LEU A CB  1 
ATOM   2815 C  CG  . LEU A 1 347 ? -40.667 -0.795  39.993  1.00 16.47  ? 348 LEU A CG  1 
ATOM   2816 C  CD1 . LEU A 1 347 ? -39.932 0.102   38.994  1.00 16.61  ? 348 LEU A CD1 1 
ATOM   2817 C  CD2 . LEU A 1 347 ? -41.105 -2.106  39.328  1.00 14.27  ? 348 LEU A CD2 1 
ATOM   2818 N  N   . HIS A 1 348 ? -38.522 -1.600  44.070  1.00 14.51  ? 349 HIS A N   1 
ATOM   2819 C  CA  . HIS A 1 348 ? -37.334 -2.128  44.726  1.00 14.25  ? 349 HIS A CA  1 
ATOM   2820 C  C   . HIS A 1 348 ? -37.360 -1.828  46.215  1.00 13.98  ? 349 HIS A C   1 
ATOM   2821 O  O   . HIS A 1 348 ? -36.544 -1.051  46.701  1.00 14.10  ? 349 HIS A O   1 
ATOM   2822 C  CB  . HIS A 1 348 ? -36.075 -1.545  44.076  1.00 14.11  ? 349 HIS A CB  1 
ATOM   2823 C  CG  . HIS A 1 348 ? -36.036 -1.713  42.590  1.00 14.06  ? 349 HIS A CG  1 
ATOM   2824 N  ND1 . HIS A 1 348 ? -35.886 -2.944  41.986  1.00 14.81  ? 349 HIS A ND1 1 
ATOM   2825 C  CD2 . HIS A 1 348 ? -36.146 -0.811  41.583  1.00 14.30  ? 349 HIS A CD2 1 
ATOM   2826 C  CE1 . HIS A 1 348 ? -35.898 -2.793  40.671  1.00 15.23  ? 349 HIS A CE1 1 
ATOM   2827 N  NE2 . HIS A 1 348 ? -36.046 -1.507  40.400  1.00 14.83  ? 349 HIS A NE2 1 
ATOM   2828 N  N   . PRO A 1 349 ? -38.313 -2.433  46.944  1.00 13.85  ? 350 PRO A N   1 
ATOM   2829 C  CA  . PRO A 1 349 ? -38.314 -2.215  48.378  1.00 13.85  ? 350 PRO A CA  1 
ATOM   2830 C  C   . PRO A 1 349 ? -37.066 -2.855  48.982  1.00 14.15  ? 350 PRO A C   1 
ATOM   2831 O  O   . PRO A 1 349 ? -36.544 -3.834  48.443  1.00 13.76  ? 350 PRO A O   1 
ATOM   2832 C  CB  . PRO A 1 349 ? -39.567 -2.954  48.844  1.00 13.69  ? 350 PRO A CB  1 
ATOM   2833 C  CG  . PRO A 1 349 ? -39.763 -4.029  47.829  1.00 13.54  ? 350 PRO A CG  1 
ATOM   2834 C  CD  . PRO A 1 349 ? -39.294 -3.461  46.534  1.00 13.59  ? 350 PRO A CD  1 
ATOM   2835 N  N   . ILE A 1 350 ? -36.580 -2.274  50.067  1.00 14.63  ? 351 ILE A N   1 
ATOM   2836 C  CA  . ILE A 1 350 ? -35.450 -2.841  50.800  1.00 15.77  ? 351 ILE A CA  1 
ATOM   2837 C  C   . ILE A 1 350 ? -35.974 -4.034  51.620  1.00 15.24  ? 351 ILE A C   1 
ATOM   2838 O  O   . ILE A 1 350 ? -35.311 -5.063  51.756  1.00 15.59  ? 351 ILE A O   1 
ATOM   2839 C  CB  . ILE A 1 350 ? -34.744 -1.746  51.671  1.00 15.72  ? 351 ILE A CB  1 
ATOM   2840 C  CG1 . ILE A 1 350 ? -33.232 -1.790  51.486  1.00 18.82  ? 351 ILE A CG1 1 
ATOM   2841 C  CG2 . ILE A 1 350 ? -35.090 -1.870  53.143  1.00 17.69  ? 351 ILE A CG2 1 
ATOM   2842 C  CD1 . ILE A 1 350 ? -32.751 -1.120  50.242  1.00 19.39  ? 351 ILE A CD1 1 
ATOM   2843 N  N   . SER A 1 351 ? -37.208 -3.895  52.085  1.00 14.90  ? 352 SER A N   1 
ATOM   2844 C  CA  . SER A 1 351 ? -37.881 -4.852  52.949  1.00 15.36  ? 352 SER A CA  1 
ATOM   2845 C  C   . SER A 1 351 ? -38.893 -5.687  52.127  1.00 15.11  ? 352 SER A C   1 
ATOM   2846 O  O   . SER A 1 351 ? -39.852 -5.118  51.594  1.00 14.23  ? 352 SER A O   1 
ATOM   2847 C  CB  . SER A 1 351 ? -38.626 -4.033  54.009  1.00 15.29  ? 352 SER A CB  1 
ATOM   2848 O  OG  . SER A 1 351 ? -39.100 -4.827  55.069  1.00 17.92  ? 352 SER A OG  1 
ATOM   2849 N  N   . VAL A 1 352 ? -38.691 -7.007  52.010  1.00 15.02  ? 353 VAL A N   1 
ATOM   2850 C  CA  . VAL A 1 352 ? -39.629 -7.844  51.239  1.00 15.51  ? 353 VAL A CA  1 
ATOM   2851 C  C   . VAL A 1 352 ? -41.064 -7.703  51.721  1.00 15.26  ? 353 VAL A C   1 
ATOM   2852 O  O   . VAL A 1 352 ? -41.988 -7.765  50.926  1.00 15.26  ? 353 VAL A O   1 
ATOM   2853 C  CB  . VAL A 1 352 ? -39.334 -9.372  51.254  1.00 15.95  ? 353 VAL A CB  1 
ATOM   2854 C  CG1 . VAL A 1 352 ? -38.558 -9.780  50.056  1.00 18.63  ? 353 VAL A CG1 1 
ATOM   2855 C  CG2 . VAL A 1 352 ? -38.702 -9.850  52.567  1.00 14.61  ? 353 VAL A CG2 1 
ATOM   2856 N  N   . THR A 1 353 ? -41.230 -7.544  53.029  1.00 15.15  ? 354 THR A N   1 
ATOM   2857 C  CA  . THR A 1 353 ? -42.533 -7.428  53.652  1.00 14.88  ? 354 THR A CA  1 
ATOM   2858 C  C   . THR A 1 353 ? -42.477 -6.368  54.747  1.00 15.11  ? 354 THR A C   1 
ATOM   2859 O  O   . THR A 1 353 ? -41.398 -5.983  55.194  1.00 14.89  ? 354 THR A O   1 
ATOM   2860 C  CB  . THR A 1 353 ? -42.972 -8.750  54.357  1.00 14.84  ? 354 THR A CB  1 
ATOM   2861 O  OG1 . THR A 1 353 ? -42.112 -9.011  55.475  1.00 14.96  ? 354 THR A OG1 1 
ATOM   2862 C  CG2 . THR A 1 353 ? -42.952 -9.954  53.413  1.00 14.81  ? 354 THR A CG2 1 
ATOM   2863 N  N   . LEU A 1 354 ? -43.658 -5.922  55.170  1.00 15.21  ? 355 LEU A N   1 
ATOM   2864 C  CA  . LEU A 1 354 ? -43.856 -5.299  56.465  1.00 15.46  ? 355 LEU A CA  1 
ATOM   2865 C  C   . LEU A 1 354 ? -44.588 -6.334  57.325  1.00 15.69  ? 355 LEU A C   1 
ATOM   2866 O  O   . LEU A 1 354 ? -45.349 -7.152  56.802  1.00 15.56  ? 355 LEU A O   1 
ATOM   2867 C  CB  . LEU A 1 354 ? -44.717 -4.047  56.330  1.00 15.47  ? 355 LEU A CB  1 
ATOM   2868 C  CG  . LEU A 1 354 ? -44.263 -2.922  55.396  1.00 15.90  ? 355 LEU A CG  1 
ATOM   2869 C  CD1 . LEU A 1 354 ? -45.378 -1.897  55.266  1.00 15.27  ? 355 LEU A CD1 1 
ATOM   2870 C  CD2 . LEU A 1 354 ? -42.961 -2.261  55.889  1.00 16.47  ? 355 LEU A CD2 1 
ATOM   2871 N  N   . GLN A 1 355 ? -44.370 -6.308  58.631  1.00 15.69  ? 356 GLN A N   1 
ATOM   2872 C  CA  . GLN A 1 355 ? -45.094 -7.232  59.511  1.00 16.10  ? 356 GLN A CA  1 
ATOM   2873 C  C   . GLN A 1 355 ? -45.630 -6.524  60.758  1.00 16.30  ? 356 GLN A C   1 
ATOM   2874 O  O   . GLN A 1 355 ? -45.001 -5.603  61.284  1.00 16.28  ? 356 GLN A O   1 
ATOM   2875 C  CB  . GLN A 1 355 ? -44.226 -8.435  59.928  1.00 15.56  ? 356 GLN A CB  1 
ATOM   2876 C  CG  . GLN A 1 355 ? -43.093 -8.820  58.983  1.00 15.12  ? 356 GLN A CG  1 
ATOM   2877 C  CD  . GLN A 1 355 ? -41.905 -7.880  59.084  1.00 16.46  ? 356 GLN A CD  1 
ATOM   2878 O  OE1 . GLN A 1 355 ? -41.533 -7.445  60.182  1.00 16.54  ? 356 GLN A OE1 1 
ATOM   2879 N  NE2 . GLN A 1 355 ? -41.308 -7.546  57.933  1.00 13.47  ? 356 GLN A NE2 1 
ATOM   2880 N  N   . ARG A 1 356 ? -46.801 -6.958  61.209  1.00 16.78  ? 357 ARG A N   1 
ATOM   2881 C  CA  . ARG A 1 356 ? -47.338 -6.566  62.503  1.00 17.21  ? 357 ARG A CA  1 
ATOM   2882 C  C   . ARG A 1 356 ? -47.950 -7.792  63.184  1.00 18.12  ? 357 ARG A C   1 
ATOM   2883 O  O   . ARG A 1 356 ? -48.611 -8.610  62.523  1.00 18.17  ? 357 ARG A O   1 
ATOM   2884 C  CB  . ARG A 1 356 ? -48.390 -5.453  62.353  1.00 16.98  ? 357 ARG A CB  1 
ATOM   2885 C  CG  . ARG A 1 356 ? -47.858 -4.057  61.923  1.00 17.05  ? 357 ARG A CG  1 
ATOM   2886 C  CD  . ARG A 1 356 ? -46.837 -3.498  62.919  1.00 15.41  ? 357 ARG A CD  1 
ATOM   2887 N  NE  . ARG A 1 356 ? -46.363 -2.159  62.563  1.00 15.40  ? 357 ARG A NE  1 
ATOM   2888 C  CZ  . ARG A 1 356 ? -45.278 -1.890  61.830  1.00 15.12  ? 357 ARG A CZ  1 
ATOM   2889 N  NH1 . ARG A 1 356 ? -44.527 -2.865  61.316  1.00 12.31  ? 357 ARG A NH1 1 
ATOM   2890 N  NH2 . ARG A 1 356 ? -44.956 -0.626  61.585  1.00 16.13  ? 357 ARG A NH2 1 
ATOM   2891 N  N   . TYR A 1 357 ? -47.714 -7.938  64.487  1.00 18.77  ? 358 TYR A N   1 
ATOM   2892 C  CA  . TYR A 1 357 ? -48.482 -8.885  65.286  1.00 20.19  ? 358 TYR A CA  1 
ATOM   2893 C  C   . TYR A 1 357 ? -49.795 -8.202  65.675  1.00 21.46  ? 358 TYR A C   1 
ATOM   2894 O  O   . TYR A 1 357 ? -49.782 -7.050  66.113  1.00 21.79  ? 358 TYR A O   1 
ATOM   2895 C  CB  . TYR A 1 357 ? -47.725 -9.309  66.547  1.00 19.58  ? 358 TYR A CB  1 
ATOM   2896 C  CG  . TYR A 1 357 ? -46.535 -10.209 66.287  1.00 19.77  ? 358 TYR A CG  1 
ATOM   2897 C  CD1 . TYR A 1 357 ? -45.262 -9.667  66.096  1.00 18.50  ? 358 TYR A CD1 1 
ATOM   2898 C  CD2 . TYR A 1 357 ? -46.674 -11.605 66.251  1.00 17.97  ? 358 TYR A CD2 1 
ATOM   2899 C  CE1 . TYR A 1 357 ? -44.161 -10.480 65.874  1.00 18.55  ? 358 TYR A CE1 1 
ATOM   2900 C  CE2 . TYR A 1 357 ? -45.568 -12.431 66.016  1.00 17.90  ? 358 TYR A CE2 1 
ATOM   2901 C  CZ  . TYR A 1 357 ? -44.315 -11.852 65.828  1.00 18.13  ? 358 TYR A CZ  1 
ATOM   2902 O  OH  . TYR A 1 357 ? -43.206 -12.634 65.599  1.00 18.63  ? 358 TYR A OH  1 
ATOM   2903 N  N   . LEU A 1 358 ? -50.917 -8.901  65.499  1.00 22.56  ? 359 LEU A N   1 
ATOM   2904 C  CA  . LEU A 1 358 ? -52.232 -8.361  65.858  1.00 24.25  ? 359 LEU A CA  1 
ATOM   2905 C  C   . LEU A 1 358 ? -52.381 -8.230  67.369  1.00 25.61  ? 359 LEU A C   1 
ATOM   2906 O  O   . LEU A 1 358 ? -51.938 -9.098  68.127  1.00 25.95  ? 359 LEU A O   1 
ATOM   2907 C  CB  . LEU A 1 358 ? -53.359 -9.244  65.309  1.00 23.99  ? 359 LEU A CB  1 
ATOM   2908 C  CG  . LEU A 1 358 ? -53.536 -9.365  63.795  1.00 23.62  ? 359 LEU A CG  1 
ATOM   2909 C  CD1 . LEU A 1 358 ? -54.688 -10.291 63.466  1.00 21.87  ? 359 LEU A CD1 1 
ATOM   2910 C  CD2 . LEU A 1 358 ? -53.777 -8.005  63.171  1.00 23.46  ? 359 LEU A CD2 1 
ATOM   2911 N  N   . VAL A 1 359 ? -53.002 -7.136  67.798  1.00 27.29  ? 360 VAL A N   1 
ATOM   2912 C  CA  . VAL A 1 359 ? -53.289 -6.890  69.219  1.00 28.82  ? 360 VAL A CA  1 
ATOM   2913 C  C   . VAL A 1 359 ? -54.705 -7.394  69.560  1.00 29.58  ? 360 VAL A C   1 
ATOM   2914 O  O   . VAL A 1 359 ? -54.951 -7.866  70.673  1.00 30.31  ? 360 VAL A O   1 
ATOM   2915 C  CB  . VAL A 1 359 ? -53.083 -5.381  69.589  1.00 28.73  ? 360 VAL A CB  1 
ATOM   2916 C  CG1 . VAL A 1 359 ? -53.459 -5.097  71.044  1.00 30.01  ? 360 VAL A CG1 1 
ATOM   2917 C  CG2 . VAL A 1 359 ? -51.629 -4.978  69.356  1.00 29.21  ? 360 VAL A CG2 1 
ATOM   2918 N  N   . ASN A 1 360 ? -55.616 -7.299  68.591  1.00 30.33  ? 361 ASN A N   1 
ATOM   2919 C  CA  . ASN A 1 360 ? -56.960 -7.873  68.691  1.00 31.18  ? 361 ASN A CA  1 
ATOM   2920 C  C   . ASN A 1 360 ? -57.279 -8.736  67.478  1.00 31.59  ? 361 ASN A C   1 
ATOM   2921 O  O   . ASN A 1 360 ? -56.630 -8.608  66.427  1.00 31.51  ? 361 ASN A O   1 
ATOM   2922 C  CB  . ASN A 1 360 ? -58.016 -6.772  68.771  1.00 31.63  ? 361 ASN A CB  1 
ATOM   2923 C  CG  . ASN A 1 360 ? -57.841 -5.883  69.969  1.00 32.61  ? 361 ASN A CG  1 
ATOM   2924 O  OD1 . ASN A 1 360 ? -57.698 -6.359  71.098  1.00 34.37  ? 361 ASN A OD1 1 
ATOM   2925 N  ND2 . ASN A 1 360 ? -57.852 -4.577  69.736  1.00 33.08  ? 361 ASN A ND2 1 
ATOM   2926 N  N   . ASP A 1 361 ? -58.289 -9.596  67.626  1.00 31.58  ? 362 ASP A N   1 
ATOM   2927 C  CA  . ASP A 1 361 ? -58.843 -10.353 66.508  1.00 31.82  ? 362 ASP A CA  1 
ATOM   2928 C  C   . ASP A 1 361 ? -59.192 -9.385  65.385  1.00 31.61  ? 362 ASP A C   1 
ATOM   2929 O  O   . ASP A 1 361 ? -59.612 -8.262  65.640  1.00 32.05  ? 362 ASP A O   1 
ATOM   2930 C  CB  . ASP A 1 361 ? -60.098 -11.140 66.929  1.00 31.82  ? 362 ASP A CB  1 
ATOM   2931 C  CG  . ASP A 1 361 ? -59.834 -12.141 68.059  1.00 32.81  ? 362 ASP A CG  1 
ATOM   2932 O  OD1 . ASP A 1 361 ? -58.696 -12.644 68.213  1.00 32.85  ? 362 ASP A OD1 1 
ATOM   2933 O  OD2 . ASP A 1 361 ? -60.790 -12.429 68.810  1.00 35.79  ? 362 ASP A OD2 1 
ATOM   2934 N  N   . LEU A 1 362 ? -58.996 -9.810  64.145  1.00 31.55  ? 363 LEU A N   1 
ATOM   2935 C  CA  . LEU A 1 362 ? -59.300 -8.965  62.995  1.00 31.29  ? 363 LEU A CA  1 
ATOM   2936 C  C   . LEU A 1 362 ? -59.785 -9.797  61.826  1.00 31.17  ? 363 LEU A C   1 
ATOM   2937 O  O   . LEU A 1 362 ? -59.193 -10.827 61.500  1.00 31.46  ? 363 LEU A O   1 
ATOM   2938 C  CB  . LEU A 1 362 ? -58.070 -8.141  62.583  1.00 31.29  ? 363 LEU A CB  1 
ATOM   2939 C  CG  . LEU A 1 362 ? -58.122 -7.438  61.216  1.00 31.25  ? 363 LEU A CG  1 
ATOM   2940 C  CD1 . LEU A 1 362 ? -59.090 -6.246  61.233  1.00 31.41  ? 363 LEU A CD1 1 
ATOM   2941 C  CD2 . LEU A 1 362 ? -56.724 -7.004  60.775  1.00 30.92  ? 363 LEU A CD2 1 
ATOM   2942 N  N   . VAL A 1 363 ? -60.858 -9.345  61.188  1.00 31.03  ? 364 VAL A N   1 
ATOM   2943 C  CA  . VAL A 1 363 ? -61.368 -10.020 60.001  1.00 31.02  ? 364 VAL A CA  1 
ATOM   2944 C  C   . VAL A 1 363 ? -60.724 -9.411  58.755  1.00 30.96  ? 364 VAL A C   1 
ATOM   2945 O  O   . VAL A 1 363 ? -60.693 -8.193  58.611  1.00 31.08  ? 364 VAL A O   1 
ATOM   2946 C  CB  . VAL A 1 363 ? -62.920 -9.945  59.926  1.00 31.33  ? 364 VAL A CB  1 
ATOM   2947 C  CG1 . VAL A 1 363 ? -63.444 -10.640 58.678  1.00 30.92  ? 364 VAL A CG1 1 
ATOM   2948 C  CG2 . VAL A 1 363 ? -63.553 -10.548 61.192  1.00 30.50  ? 364 VAL A CG2 1 
ATOM   2949 N  N   . LEU A 1 364 ? -60.179 -10.265 57.888  1.00 30.77  ? 365 LEU A N   1 
ATOM   2950 C  CA  . LEU A 1 364 ? -59.685 -9.865  56.565  1.00 30.84  ? 365 LEU A CA  1 
ATOM   2951 C  C   . LEU A 1 364 ? -60.148 -10.874 55.523  1.00 30.94  ? 365 LEU A C   1 
ATOM   2952 O  O   . LEU A 1 364 ? -59.958 -12.080 55.692  1.00 30.62  ? 365 LEU A O   1 
ATOM   2953 C  CB  . LEU A 1 364 ? -58.150 -9.773  56.529  1.00 30.63  ? 365 LEU A CB  1 
ATOM   2954 C  CG  . LEU A 1 364 ? -57.403 -8.730  57.365  1.00 30.67  ? 365 LEU A CG  1 
ATOM   2955 C  CD1 . LEU A 1 364 ? -55.899 -9.020  57.360  1.00 30.26  ? 365 LEU A CD1 1 
ATOM   2956 C  CD2 . LEU A 1 364 ? -57.673 -7.310  56.879  1.00 29.90  ? 365 LEU A CD2 1 
ATOM   2957 N  N   . ARG A 1 365 ? -60.759 -10.378 54.447  1.00 31.58  ? 366 ARG A N   1 
ATOM   2958 C  CA  . ARG A 1 365 ? -61.254 -11.234 53.361  1.00 32.28  ? 366 ARG A CA  1 
ATOM   2959 C  C   . ARG A 1 365 ? -62.251 -12.272 53.887  1.00 32.53  ? 366 ARG A C   1 
ATOM   2960 O  O   . ARG A 1 365 ? -62.278 -13.413 53.412  1.00 32.76  ? 366 ARG A O   1 
ATOM   2961 C  CB  . ARG A 1 365 ? -60.084 -11.939 52.659  1.00 32.42  ? 366 ARG A CB  1 
ATOM   2962 C  CG  . ARG A 1 365 ? -59.135 -11.019 51.910  1.00 33.67  ? 366 ARG A CG  1 
ATOM   2963 C  CD  . ARG A 1 365 ? -59.390 -11.105 50.428  1.00 35.99  ? 366 ARG A CD  1 
ATOM   2964 N  NE  . ARG A 1 365 ? -58.844 -9.953  49.727  1.00 37.93  ? 366 ARG A NE  1 
ATOM   2965 C  CZ  . ARG A 1 365 ? -59.240 -9.547  48.525  1.00 38.34  ? 366 ARG A CZ  1 
ATOM   2966 N  NH1 . ARG A 1 365 ? -60.191 -10.200 47.874  1.00 39.27  ? 366 ARG A NH1 1 
ATOM   2967 N  NH2 . ARG A 1 365 ? -58.678 -8.483  47.973  1.00 39.46  ? 366 ARG A NH2 1 
ATOM   2968 N  N   . ASP A 1 366 ? -63.059 -11.861 54.867  1.00 32.65  ? 367 ASP A N   1 
ATOM   2969 C  CA  . ASP A 1 366 ? -64.019 -12.733 55.572  1.00 33.09  ? 367 ASP A CA  1 
ATOM   2970 C  C   . ASP A 1 366 ? -63.376 -13.939 56.283  1.00 32.61  ? 367 ASP A C   1 
ATOM   2971 O  O   . ASP A 1 366 ? -64.019 -14.969 56.506  1.00 32.59  ? 367 ASP A O   1 
ATOM   2972 C  CB  . ASP A 1 366 ? -65.191 -13.164 54.658  1.00 33.60  ? 367 ASP A CB  1 
ATOM   2973 C  CG  . ASP A 1 366 ? -66.453 -13.534 55.449  1.00 35.20  ? 367 ASP A CG  1 
ATOM   2974 O  OD1 . ASP A 1 366 ? -66.869 -12.748 56.329  1.00 38.06  ? 367 ASP A OD1 1 
ATOM   2975 O  OD2 . ASP A 1 366 ? -67.030 -14.614 55.192  1.00 37.01  ? 367 ASP A OD2 1 
ATOM   2976 N  N   . TYR A 1 367 ? -62.104 -13.800 56.648  1.00 31.98  ? 368 TYR A N   1 
ATOM   2977 C  CA  . TYR A 1 367 ? -61.443 -14.784 57.490  1.00 30.87  ? 368 TYR A CA  1 
ATOM   2978 C  C   . TYR A 1 367 ? -61.141 -14.144 58.832  1.00 31.04  ? 368 TYR A C   1 
ATOM   2979 O  O   . TYR A 1 367 ? -60.682 -13.000 58.890  1.00 30.78  ? 368 TYR A O   1 
ATOM   2980 C  CB  . TYR A 1 367 ? -60.142 -15.254 56.860  1.00 30.39  ? 368 TYR A CB  1 
ATOM   2981 C  CG  . TYR A 1 367 ? -60.264 -16.025 55.566  1.00 28.70  ? 368 TYR A CG  1 
ATOM   2982 C  CD1 . TYR A 1 367 ? -60.022 -15.405 54.349  1.00 26.49  ? 368 TYR A CD1 1 
ATOM   2983 C  CD2 . TYR A 1 367 ? -60.570 -17.389 55.565  1.00 27.83  ? 368 TYR A CD2 1 
ATOM   2984 C  CE1 . TYR A 1 367 ? -60.099 -16.103 53.159  1.00 26.33  ? 368 TYR A CE1 1 
ATOM   2985 C  CE2 . TYR A 1 367 ? -60.652 -18.107 54.373  1.00 27.00  ? 368 TYR A CE2 1 
ATOM   2986 C  CZ  . TYR A 1 367 ? -60.415 -17.454 53.176  1.00 26.82  ? 368 TYR A CZ  1 
ATOM   2987 O  OH  . TYR A 1 367 ? -60.493 -18.143 51.992  1.00 27.06  ? 368 TYR A OH  1 
ATOM   2988 N  N   . MET A 1 368 ? -61.396 -14.887 59.902  1.00 30.88  ? 369 MET A N   1 
ATOM   2989 C  CA  . MET A 1 368 ? -61.103 -14.429 61.249  1.00 31.51  ? 369 MET A CA  1 
ATOM   2990 C  C   . MET A 1 368 ? -59.626 -14.665 61.543  1.00 31.14  ? 369 MET A C   1 
ATOM   2991 O  O   . MET A 1 368 ? -59.162 -15.809 61.530  1.00 31.37  ? 369 MET A O   1 
ATOM   2992 C  CB  . MET A 1 368 ? -61.951 -15.205 62.262  1.00 32.09  ? 369 MET A CB  1 
ATOM   2993 C  CG  . MET A 1 368 ? -62.729 -14.352 63.254  1.00 33.97  ? 369 MET A CG  1 
ATOM   2994 S  SD  . MET A 1 368 ? -61.720 -13.253 64.268  1.00 39.27  ? 369 MET A SD  1 
ATOM   2995 C  CE  . MET A 1 368 ? -60.575 -14.412 65.019  1.00 37.13  ? 369 MET A CE  1 
ATOM   2996 N  N   . ILE A 1 369 ? -58.887 -13.592 61.801  1.00 30.43  ? 370 ILE A N   1 
ATOM   2997 C  CA  . ILE A 1 369 ? -57.482 -13.721 62.167  1.00 30.11  ? 370 ILE A CA  1 
ATOM   2998 C  C   . ILE A 1 369 ? -57.302 -13.365 63.641  1.00 29.83  ? 370 ILE A C   1 
ATOM   2999 O  O   . ILE A 1 369 ? -57.519 -12.219 64.036  1.00 29.93  ? 370 ILE A O   1 
ATOM   3000 C  CB  . ILE A 1 369 ? -56.548 -12.901 61.248  1.00 30.06  ? 370 ILE A CB  1 
ATOM   3001 C  CG1 . ILE A 1 369 ? -56.852 -13.217 59.784  1.00 30.38  ? 370 ILE A CG1 1 
ATOM   3002 C  CG2 . ILE A 1 369 ? -55.088 -13.236 61.539  1.00 30.04  ? 370 ILE A CG2 1 
ATOM   3003 C  CD1 . ILE A 1 369 ? -56.250 -12.250 58.802  1.00 31.27  ? 370 ILE A CD1 1 
ATOM   3004 N  N   . PRO A 1 370 ? -56.925 -14.363 64.462  1.00 29.54  ? 371 PRO A N   1 
ATOM   3005 C  CA  . PRO A 1 370 ? -56.876 -14.180 65.914  1.00 29.23  ? 371 PRO A CA  1 
ATOM   3006 C  C   . PRO A 1 370 ? -55.765 -13.254 66.401  1.00 28.79  ? 371 PRO A C   1 
ATOM   3007 O  O   . PRO A 1 370 ? -54.772 -13.044 65.706  1.00 29.03  ? 371 PRO A O   1 
ATOM   3008 C  CB  . PRO A 1 370 ? -56.672 -15.607 66.453  1.00 29.17  ? 371 PRO A CB  1 
ATOM   3009 C  CG  . PRO A 1 370 ? -56.187 -16.405 65.316  1.00 29.68  ? 371 PRO A CG  1 
ATOM   3010 C  CD  . PRO A 1 370 ? -56.702 -15.767 64.068  1.00 29.48  ? 371 PRO A CD  1 
ATOM   3011 N  N   . ALA A 1 371 ? -55.948 -12.713 67.601  1.00 28.03  ? 372 ALA A N   1 
ATOM   3012 C  CA  . ALA A 1 371 ? -54.960 -11.848 68.236  1.00 27.12  ? 372 ALA A CA  1 
ATOM   3013 C  C   . ALA A 1 371 ? -53.625 -12.569 68.395  1.00 26.75  ? 372 ALA A C   1 
ATOM   3014 O  O   . ALA A 1 371 ? -53.589 -13.778 68.664  1.00 26.79  ? 372 ALA A O   1 
ATOM   3015 C  CB  . ALA A 1 371 ? -55.476 -11.370 69.588  1.00 27.17  ? 372 ALA A CB  1 
ATOM   3016 N  N   . LYS A 1 372 ? -52.537 -11.818 68.215  1.00 25.93  ? 373 LYS A N   1 
ATOM   3017 C  CA  . LYS A 1 372 ? -51.161 -12.330 68.318  1.00 25.34  ? 373 LYS A CA  1 
ATOM   3018 C  C   . LYS A 1 372 ? -50.669 -13.063 67.060  1.00 23.97  ? 373 LYS A C   1 
ATOM   3019 O  O   . LYS A 1 372 ? -49.543 -13.563 67.036  1.00 24.03  ? 373 LYS A O   1 
ATOM   3020 C  CB  . LYS A 1 372 ? -50.971 -13.197 69.578  1.00 25.94  ? 373 LYS A CB  1 
ATOM   3021 C  CG  . LYS A 1 372 ? -51.046 -12.416 70.889  1.00 28.83  ? 373 LYS A CG  1 
ATOM   3022 C  CD  . LYS A 1 372 ? -50.977 -13.353 72.098  1.00 33.46  ? 373 LYS A CD  1 
ATOM   3023 C  CE  . LYS A 1 372 ? -51.015 -12.570 73.411  1.00 35.54  ? 373 LYS A CE  1 
ATOM   3024 N  NZ  . LYS A 1 372 ? -51.568 -13.408 74.527  1.00 38.25  ? 373 LYS A NZ  1 
ATOM   3025 N  N   . THR A 1 373 ? -51.508 -13.123 66.027  1.00 22.39  ? 374 THR A N   1 
ATOM   3026 C  CA  . THR A 1 373 ? -51.097 -13.665 64.737  1.00 21.10  ? 374 THR A CA  1 
ATOM   3027 C  C   . THR A 1 373 ? -50.143 -12.674 64.057  1.00 20.23  ? 374 THR A C   1 
ATOM   3028 O  O   . THR A 1 373 ? -50.373 -11.462 64.078  1.00 19.48  ? 374 THR A O   1 
ATOM   3029 C  CB  . THR A 1 373 ? -52.306 -13.904 63.789  1.00 21.33  ? 374 THR A CB  1 
ATOM   3030 O  OG1 . THR A 1 373 ? -53.287 -14.720 64.439  1.00 21.71  ? 374 THR A OG1 1 
ATOM   3031 C  CG2 . THR A 1 373 ? -51.865 -14.586 62.510  1.00 20.20  ? 374 THR A CG2 1 
ATOM   3032 N  N   . LEU A 1 374 ? -49.071 -13.197 63.468  1.00 18.87  ? 375 LEU A N   1 
ATOM   3033 C  CA  . LEU A 1 374 ? -48.190 -12.375 62.669  1.00 17.98  ? 375 LEU A CA  1 
ATOM   3034 C  C   . LEU A 1 374 ? -48.830 -12.174 61.298  1.00 17.42  ? 375 LEU A C   1 
ATOM   3035 O  O   . LEU A 1 374 ? -49.200 -13.144 60.631  1.00 17.46  ? 375 LEU A O   1 
ATOM   3036 C  CB  . LEU A 1 374 ? -46.812 -13.031 62.533  1.00 17.75  ? 375 LEU A CB  1 
ATOM   3037 C  CG  . LEU A 1 374 ? -45.735 -12.212 61.814  1.00 17.50  ? 375 LEU A CG  1 
ATOM   3038 C  CD1 . LEU A 1 374 ? -45.582 -10.830 62.462  1.00 16.86  ? 375 LEU A CD1 1 
ATOM   3039 C  CD2 . LEU A 1 374 ? -44.404 -12.972 61.788  1.00 15.97  ? 375 LEU A CD2 1 
ATOM   3040 N  N   . VAL A 1 375 ? -48.992 -10.918 60.901  1.00 16.60  ? 376 VAL A N   1 
ATOM   3041 C  CA  . VAL A 1 375 ? -49.490 -10.603 59.563  1.00 16.15  ? 376 VAL A CA  1 
ATOM   3042 C  C   . VAL A 1 375 ? -48.403 -9.884  58.769  1.00 15.54  ? 376 VAL A C   1 
ATOM   3043 O  O   . VAL A 1 375 ? -47.801 -8.925  59.264  1.00 15.12  ? 376 VAL A O   1 
ATOM   3044 C  CB  . VAL A 1 375 ? -50.785 -9.739  59.598  1.00 16.35  ? 376 VAL A CB  1 
ATOM   3045 C  CG1 . VAL A 1 375 ? -51.300 -9.487  58.170  1.00 16.46  ? 376 VAL A CG1 1 
ATOM   3046 C  CG2 . VAL A 1 375 ? -51.876 -10.415 60.438  1.00 16.82  ? 376 VAL A CG2 1 
ATOM   3047 N  N   . GLN A 1 376 ? -48.160 -10.356 57.545  1.00 15.23  ? 377 GLN A N   1 
ATOM   3048 C  CA  . GLN A 1 376 ? -47.148 -9.766  56.668  1.00 15.00  ? 377 GLN A CA  1 
ATOM   3049 C  C   . GLN A 1 376 ? -47.767 -9.196  55.394  1.00 14.96  ? 377 GLN A C   1 
ATOM   3050 O  O   . GLN A 1 376 ? -48.581 -9.843  54.726  1.00 14.92  ? 377 GLN A O   1 
ATOM   3051 C  CB  . GLN A 1 376 ? -46.028 -10.774 56.330  1.00 14.87  ? 377 GLN A CB  1 
ATOM   3052 C  CG  . GLN A 1 376 ? -45.253 -11.254 57.574  1.00 15.63  ? 377 GLN A CG  1 
ATOM   3053 C  CD  . GLN A 1 376 ? -43.932 -11.958 57.263  1.00 15.75  ? 377 GLN A CD  1 
ATOM   3054 O  OE1 . GLN A 1 376 ? -43.133 -11.484 56.456  1.00 14.63  ? 377 GLN A OE1 1 
ATOM   3055 N  NE2 . GLN A 1 376 ? -43.687 -13.082 57.938  1.00 14.40  ? 377 GLN A NE2 1 
ATOM   3056 N  N   . VAL A 1 377 ? -47.372 -7.976  55.070  1.00 14.48  ? 378 VAL A N   1 
ATOM   3057 C  CA  . VAL A 1 377 ? -47.777 -7.344  53.832  1.00 14.32  ? 378 VAL A CA  1 
ATOM   3058 C  C   . VAL A 1 377 ? -46.658 -7.574  52.829  1.00 14.28  ? 378 VAL A C   1 
ATOM   3059 O  O   . VAL A 1 377 ? -45.544 -7.086  53.030  1.00 13.91  ? 378 VAL A O   1 
ATOM   3060 C  CB  . VAL A 1 377 ? -47.981 -5.829  54.036  1.00 14.63  ? 378 VAL A CB  1 
ATOM   3061 C  CG1 . VAL A 1 377 ? -48.350 -5.161  52.726  1.00 14.40  ? 378 VAL A CG1 1 
ATOM   3062 C  CG2 . VAL A 1 377 ? -49.049 -5.560  55.136  1.00 14.21  ? 378 VAL A CG2 1 
ATOM   3063 N  N   . ALA A 1 378 ? -46.955 -8.332  51.772  1.00 13.88  ? 379 ALA A N   1 
ATOM   3064 C  CA  . ALA A 1 378 ? -45.980 -8.651  50.742  1.00 14.35  ? 379 ALA A CA  1 
ATOM   3065 C  C   . ALA A 1 378 ? -45.744 -7.453  49.820  1.00 14.72  ? 379 ALA A C   1 
ATOM   3066 O  O   . ALA A 1 378 ? -46.292 -7.363  48.715  1.00 15.36  ? 379 ALA A O   1 
ATOM   3067 C  CB  . ALA A 1 378 ? -46.412 -9.870  49.950  1.00 14.00  ? 379 ALA A CB  1 
ATOM   3068 N  N   . ILE A 1 379 ? -44.907 -6.547  50.293  1.00 14.49  ? 380 ILE A N   1 
ATOM   3069 C  CA  . ILE A 1 379 ? -44.688 -5.271  49.648  1.00 14.87  ? 380 ILE A CA  1 
ATOM   3070 C  C   . ILE A 1 379 ? -44.004 -5.391  48.277  1.00 14.22  ? 380 ILE A C   1 
ATOM   3071 O  O   . ILE A 1 379 ? -44.337 -4.662  47.339  1.00 13.01  ? 380 ILE A O   1 
ATOM   3072 C  CB  . ILE A 1 379 ? -43.955 -4.321  50.640  1.00 15.57  ? 380 ILE A CB  1 
ATOM   3073 C  CG1 . ILE A 1 379 ? -44.769 -3.067  50.831  1.00 15.82  ? 380 ILE A CG1 1 
ATOM   3074 C  CG2 . ILE A 1 379 ? -42.490 -4.101  50.310  1.00 15.73  ? 380 ILE A CG2 1 
ATOM   3075 C  CD1 . ILE A 1 379 ? -45.712 -3.243  51.954  1.00 15.58  ? 380 ILE A CD1 1 
ATOM   3076 N  N   . TYR A 1 380 ? -43.073 -6.336  48.160  1.00 14.09  ? 381 TYR A N   1 
ATOM   3077 C  CA  . TYR A 1 380 ? -42.441 -6.597  46.878  1.00 13.82  ? 381 TYR A CA  1 
ATOM   3078 C  C   . TYR A 1 380 ? -43.480 -7.075  45.864  1.00 14.31  ? 381 TYR A C   1 
ATOM   3079 O  O   . TYR A 1 380 ? -43.555 -6.544  44.745  1.00 14.02  ? 381 TYR A O   1 
ATOM   3080 C  CB  . TYR A 1 380 ? -41.298 -7.611  46.992  1.00 13.44  ? 381 TYR A CB  1 
ATOM   3081 C  CG  . TYR A 1 380 ? -40.704 -7.924  45.638  1.00 13.39  ? 381 TYR A CG  1 
ATOM   3082 C  CD1 . TYR A 1 380 ? -39.622 -7.197  45.151  1.00 12.38  ? 381 TYR A CD1 1 
ATOM   3083 C  CD2 . TYR A 1 380 ? -41.266 -8.913  44.816  1.00 11.98  ? 381 TYR A CD2 1 
ATOM   3084 C  CE1 . TYR A 1 380 ? -39.090 -7.462  43.898  1.00 13.43  ? 381 TYR A CE1 1 
ATOM   3085 C  CE2 . TYR A 1 380 ? -40.750 -9.176  43.549  1.00 12.44  ? 381 TYR A CE2 1 
ATOM   3086 C  CZ  . TYR A 1 380 ? -39.663 -8.446  43.103  1.00 12.96  ? 381 TYR A CZ  1 
ATOM   3087 O  OH  . TYR A 1 380 ? -39.131 -8.699  41.870  1.00 16.30  ? 381 TYR A OH  1 
ATOM   3088 N  N   . ALA A 1 381 ? -44.268 -8.078  46.260  1.00 14.68  ? 382 ALA A N   1 
ATOM   3089 C  CA  . ALA A 1 381 ? -45.276 -8.665  45.376  1.00 15.34  ? 382 ALA A CA  1 
ATOM   3090 C  C   . ALA A 1 381 ? -46.314 -7.636  44.969  1.00 15.46  ? 382 ALA A C   1 
ATOM   3091 O  O   . ALA A 1 381 ? -46.783 -7.637  43.822  1.00 15.64  ? 382 ALA A O   1 
ATOM   3092 C  CB  . ALA A 1 381 ? -45.960 -9.857  46.041  1.00 15.16  ? 382 ALA A CB  1 
ATOM   3093 N  N   . LEU A 1 382 ? -46.689 -6.792  45.929  1.00 15.75  ? 383 LEU A N   1 
ATOM   3094 C  CA  . LEU A 1 382 ? -47.654 -5.731  45.707  1.00 16.53  ? 383 LEU A CA  1 
ATOM   3095 C  C   . LEU A 1 382 ? -47.182 -4.757  44.621  1.00 17.22  ? 383 LEU A C   1 
ATOM   3096 O  O   . LEU A 1 382 ? -47.955 -4.381  43.741  1.00 17.98  ? 383 LEU A O   1 
ATOM   3097 C  CB  . LEU A 1 382 ? -47.949 -5.004  47.018  1.00 16.49  ? 383 LEU A CB  1 
ATOM   3098 C  CG  . LEU A 1 382 ? -48.579 -3.605  46.990  1.00 17.84  ? 383 LEU A CG  1 
ATOM   3099 C  CD1 . LEU A 1 382 ? -49.942 -3.586  46.288  1.00 17.05  ? 383 LEU A CD1 1 
ATOM   3100 C  CD2 . LEU A 1 382 ? -48.715 -3.088  48.413  1.00 19.75  ? 383 LEU A CD2 1 
ATOM   3101 N  N   . GLY A 1 383 ? -45.911 -4.377  44.677  1.00 17.36  ? 384 GLY A N   1 
ATOM   3102 C  CA  . GLY A 1 383 ? -45.333 -3.465  43.717  1.00 17.71  ? 384 GLY A CA  1 
ATOM   3103 C  C   . GLY A 1 383 ? -45.276 -3.981  42.299  1.00 18.16  ? 384 GLY A C   1 
ATOM   3104 O  O   . GLY A 1 383 ? -45.240 -3.183  41.368  1.00 18.54  ? 384 GLY A O   1 
ATOM   3105 N  N   . ARG A 1 384 ? -45.257 -5.303  42.117  1.00 18.42  ? 385 ARG A N   1 
ATOM   3106 C  CA  . ARG A 1 384 ? -45.227 -5.878  40.764  1.00 18.59  ? 385 ARG A CA  1 
ATOM   3107 C  C   . ARG A 1 384 ? -46.604 -6.320  40.265  1.00 18.81  ? 385 ARG A C   1 
ATOM   3108 O  O   . ARG A 1 384 ? -46.717 -6.867  39.173  1.00 18.71  ? 385 ARG A O   1 
ATOM   3109 C  CB  . ARG A 1 384 ? -44.243 -7.062  40.660  1.00 18.49  ? 385 ARG A CB  1 
ATOM   3110 C  CG  . ARG A 1 384 ? -42.824 -6.803  41.162  1.00 17.84  ? 385 ARG A CG  1 
ATOM   3111 C  CD  . ARG A 1 384 ? -42.243 -5.538  40.571  1.00 17.30  ? 385 ARG A CD  1 
ATOM   3112 N  NE  . ARG A 1 384 ? -40.901 -5.273  41.084  1.00 17.32  ? 385 ARG A NE  1 
ATOM   3113 C  CZ  . ARG A 1 384 ? -39.786 -5.722  40.520  1.00 17.32  ? 385 ARG A CZ  1 
ATOM   3114 N  NH1 . ARG A 1 384 ? -39.858 -6.463  39.421  1.00 16.99  ? 385 ARG A NH1 1 
ATOM   3115 N  NH2 . ARG A 1 384 ? -38.597 -5.426  41.050  1.00 15.27  ? 385 ARG A NH2 1 
ATOM   3116 N  N   . GLU A 1 385 ? -47.636 -6.083  41.064  1.00 19.26  ? 386 GLU A N   1 
ATOM   3117 C  CA  . GLU A 1 385 ? -48.954 -6.670  40.828  1.00 20.62  ? 386 GLU A CA  1 
ATOM   3118 C  C   . GLU A 1 385 ? -49.813 -5.767  39.914  1.00 20.91  ? 386 GLU A C   1 
ATOM   3119 O  O   . GLU A 1 385 ? -50.173 -4.660  40.300  1.00 21.25  ? 386 GLU A O   1 
ATOM   3120 C  CB  . GLU A 1 385 ? -49.607 -6.971  42.180  1.00 20.45  ? 386 GLU A CB  1 
ATOM   3121 C  CG  . GLU A 1 385 ? -51.053 -7.439  42.187  1.00 23.46  ? 386 GLU A CG  1 
ATOM   3122 C  CD  . GLU A 1 385 ? -51.391 -8.489  41.140  1.00 24.55  ? 386 GLU A CD  1 
ATOM   3123 O  OE1 . GLU A 1 385 ? -50.703 -9.520  41.055  1.00 25.65  ? 386 GLU A OE1 1 
ATOM   3124 O  OE2 . GLU A 1 385 ? -52.375 -8.275  40.416  1.00 24.57  ? 386 GLU A OE2 1 
ATOM   3125 N  N   . PRO A 1 386 ? -50.128 -6.239  38.688  1.00 21.48  ? 387 PRO A N   1 
ATOM   3126 C  CA  . PRO A 1 386 ? -50.799 -5.352  37.716  1.00 21.86  ? 387 PRO A CA  1 
ATOM   3127 C  C   . PRO A 1 386 ? -52.227 -4.918  38.068  1.00 22.39  ? 387 PRO A C   1 
ATOM   3128 O  O   . PRO A 1 386 ? -52.755 -4.017  37.416  1.00 22.83  ? 387 PRO A O   1 
ATOM   3129 C  CB  . PRO A 1 386 ? -50.754 -6.146  36.396  1.00 21.71  ? 387 PRO A CB  1 
ATOM   3130 C  CG  . PRO A 1 386 ? -50.500 -7.560  36.794  1.00 22.19  ? 387 PRO A CG  1 
ATOM   3131 C  CD  . PRO A 1 386 ? -49.757 -7.542  38.099  1.00 21.11  ? 387 PRO A CD  1 
ATOM   3132 N  N   . THR A 1 387 ? -52.835 -5.525  39.092  1.00 22.82  ? 388 THR A N   1 
ATOM   3133 C  CA  . THR A 1 387 ? -54.173 -5.119  39.545  1.00 22.86  ? 388 THR A CA  1 
ATOM   3134 C  C   . THR A 1 387 ? -54.117 -4.006  40.581  1.00 23.01  ? 388 THR A C   1 
ATOM   3135 O  O   . THR A 1 387 ? -55.137 -3.407  40.916  1.00 23.64  ? 388 THR A O   1 
ATOM   3136 C  CB  . THR A 1 387 ? -55.017 -6.303  40.111  1.00 23.19  ? 388 THR A CB  1 
ATOM   3137 O  OG1 . THR A 1 387 ? -54.429 -6.820  41.317  1.00 23.93  ? 388 THR A OG1 1 
ATOM   3138 C  CG2 . THR A 1 387 ? -55.142 -7.422  39.086  1.00 22.67  ? 388 THR A CG2 1 
ATOM   3139 N  N   . PHE A 1 388 ? -52.932 -3.726  41.108  1.00 22.79  ? 389 PHE A N   1 
ATOM   3140 C  CA  . PHE A 1 388 ? -52.814 -2.643  42.078  1.00 22.50  ? 389 PHE A CA  1 
ATOM   3141 C  C   . PHE A 1 388 ? -52.022 -1.460  41.520  1.00 22.23  ? 389 PHE A C   1 
ATOM   3142 O  O   . PHE A 1 388 ? -52.093 -0.357  42.052  1.00 21.55  ? 389 PHE A O   1 
ATOM   3143 C  CB  . PHE A 1 388 ? -52.253 -3.157  43.407  1.00 22.19  ? 389 PHE A CB  1 
ATOM   3144 C  CG  . PHE A 1 388 ? -53.113 -4.219  44.054  1.00 22.97  ? 389 PHE A CG  1 
ATOM   3145 C  CD1 . PHE A 1 388 ? -52.574 -5.440  44.426  1.00 22.45  ? 389 PHE A CD1 1 
ATOM   3146 C  CD2 . PHE A 1 388 ? -54.469 -4.001  44.272  1.00 23.03  ? 389 PHE A CD2 1 
ATOM   3147 C  CE1 . PHE A 1 388 ? -53.365 -6.418  45.021  1.00 22.18  ? 389 PHE A CE1 1 
ATOM   3148 C  CE2 . PHE A 1 388 ? -55.262 -4.973  44.860  1.00 22.97  ? 389 PHE A CE2 1 
ATOM   3149 C  CZ  . PHE A 1 388 ? -54.706 -6.186  45.236  1.00 22.14  ? 389 PHE A CZ  1 
ATOM   3150 N  N   . PHE A 1 389 ? -51.278 -1.707  40.445  1.00 22.23  ? 390 PHE A N   1 
ATOM   3151 C  CA  . PHE A 1 389 ? -50.553 -0.662  39.742  1.00 23.05  ? 390 PHE A CA  1 
ATOM   3152 C  C   . PHE A 1 389 ? -50.668 -0.884  38.237  1.00 23.94  ? 390 PHE A C   1 
ATOM   3153 O  O   . PHE A 1 389 ? -50.436 -1.989  37.743  1.00 23.77  ? 390 PHE A O   1 
ATOM   3154 C  CB  . PHE A 1 389 ? -49.068 -0.631  40.147  1.00 22.57  ? 390 PHE A CB  1 
ATOM   3155 C  CG  . PHE A 1 389 ? -48.827 -0.224  41.583  1.00 21.44  ? 390 PHE A CG  1 
ATOM   3156 C  CD1 . PHE A 1 389 ? -48.553 -1.185  42.558  1.00 19.78  ? 390 PHE A CD1 1 
ATOM   3157 C  CD2 . PHE A 1 389 ? -48.854 1.117   41.953  1.00 19.96  ? 390 PHE A CD2 1 
ATOM   3158 C  CE1 . PHE A 1 389 ? -48.321 -0.815  43.880  1.00 19.85  ? 390 PHE A CE1 1 
ATOM   3159 C  CE2 . PHE A 1 389 ? -48.623 1.503   43.276  1.00 19.79  ? 390 PHE A CE2 1 
ATOM   3160 C  CZ  . PHE A 1 389 ? -48.352 0.531   44.244  1.00 19.45  ? 390 PHE A CZ  1 
ATOM   3161 N  N   . PHE A 1 390 ? -51.022 0.181   37.519  1.00 25.21  ? 391 PHE A N   1 
ATOM   3162 C  CA  . PHE A 1 390 ? -51.057 0.172   36.063  1.00 25.93  ? 391 PHE A CA  1 
ATOM   3163 C  C   . PHE A 1 390 ? -49.654 -0.021  35.492  1.00 25.98  ? 391 PHE A C   1 
ATOM   3164 O  O   . PHE A 1 390 ? -48.738 0.743   35.806  1.00 26.15  ? 391 PHE A O   1 
ATOM   3165 C  CB  . PHE A 1 390 ? -51.661 1.487   35.546  1.00 26.49  ? 391 PHE A CB  1 
ATOM   3166 C  CG  . PHE A 1 390 ? -51.680 1.592   34.040  1.00 28.66  ? 391 PHE A CG  1 
ATOM   3167 C  CD1 . PHE A 1 390 ? -52.753 1.089   33.309  1.00 30.23  ? 391 PHE A CD1 1 
ATOM   3168 C  CD2 . PHE A 1 390 ? -50.616 2.177   33.354  1.00 30.51  ? 391 PHE A CD2 1 
ATOM   3169 C  CE1 . PHE A 1 390 ? -52.773 1.170   31.917  1.00 31.25  ? 391 PHE A CE1 1 
ATOM   3170 C  CE2 . PHE A 1 390 ? -50.626 2.262   31.957  1.00 31.94  ? 391 PHE A CE2 1 
ATOM   3171 C  CZ  . PHE A 1 390 ? -51.707 1.757   31.240  1.00 31.51  ? 391 PHE A CZ  1 
ATOM   3172 N  N   . ASP A 1 391 ? -49.498 -1.031  34.642  1.00 26.04  ? 392 ASP A N   1 
ATOM   3173 C  CA  . ASP A 1 391 ? -48.220 -1.317  33.975  1.00 26.43  ? 392 ASP A CA  1 
ATOM   3174 C  C   . ASP A 1 391 ? -47.033 -1.362  34.971  1.00 25.81  ? 392 ASP A C   1 
ATOM   3175 O  O   . ASP A 1 391 ? -46.041 -0.634  34.808  1.00 25.92  ? 392 ASP A O   1 
ATOM   3176 C  CB  . ASP A 1 391 ? -47.982 -0.301  32.840  1.00 26.83  ? 392 ASP A CB  1 
ATOM   3177 C  CG  . ASP A 1 391 ? -46.884 -0.727  31.870  1.00 28.99  ? 392 ASP A CG  1 
ATOM   3178 O  OD1 . ASP A 1 391 ? -46.433 -1.897  31.902  1.00 30.35  ? 392 ASP A OD1 1 
ATOM   3179 O  OD2 . ASP A 1 391 ? -46.458 0.132   31.063  1.00 32.39  ? 392 ASP A OD2 1 
ATOM   3180 N  N   . PRO A 1 392 ? -47.117 -2.249  35.987  1.00 25.19  ? 393 PRO A N   1 
ATOM   3181 C  CA  . PRO A 1 392 ? -46.186 -2.207  37.132  1.00 24.63  ? 393 PRO A CA  1 
ATOM   3182 C  C   . PRO A 1 392 ? -44.687 -2.303  36.785  1.00 24.29  ? 393 PRO A C   1 
ATOM   3183 O  O   . PRO A 1 392 ? -43.857 -1.796  37.535  1.00 23.56  ? 393 PRO A O   1 
ATOM   3184 C  CB  . PRO A 1 392 ? -46.631 -3.393  37.998  1.00 24.25  ? 393 PRO A CB  1 
ATOM   3185 C  CG  . PRO A 1 392 ? -47.319 -4.317  37.054  1.00 24.80  ? 393 PRO A CG  1 
ATOM   3186 C  CD  . PRO A 1 392 ? -47.987 -3.442  36.033  1.00 25.13  ? 393 PRO A CD  1 
ATOM   3187 N  N   . GLU A 1 393 ? -44.343 -2.918  35.658  1.00 24.37  ? 394 GLU A N   1 
ATOM   3188 C  CA  . GLU A 1 393 ? -42.935 -3.020  35.267  1.00 25.05  ? 394 GLU A CA  1 
ATOM   3189 C  C   . GLU A 1 393 ? -42.335 -1.701  34.754  1.00 25.08  ? 394 GLU A C   1 
ATOM   3190 O  O   . GLU A 1 393 ? -41.117 -1.561  34.664  1.00 25.23  ? 394 GLU A O   1 
ATOM   3191 C  CB  . GLU A 1 393 ? -42.705 -4.160  34.272  1.00 25.13  ? 394 GLU A CB  1 
ATOM   3192 C  CG  . GLU A 1 393 ? -43.029 -5.566  34.826  1.00 27.24  ? 394 GLU A CG  1 
ATOM   3193 C  CD  . GLU A 1 393 ? -42.305 -5.893  36.141  1.00 30.22  ? 394 GLU A CD  1 
ATOM   3194 O  OE1 . GLU A 1 393 ? -41.134 -5.491  36.316  1.00 30.34  ? 394 GLU A OE1 1 
ATOM   3195 O  OE2 . GLU A 1 393 ? -42.914 -6.565  37.004  1.00 31.59  ? 394 GLU A OE2 1 
ATOM   3196 N  N   . ASN A 1 394 ? -43.197 -0.740  34.444  1.00 25.16  ? 395 ASN A N   1 
ATOM   3197 C  CA  . ASN A 1 394 ? -42.771 0.545   33.918  1.00 25.19  ? 395 ASN A CA  1 
ATOM   3198 C  C   . ASN A 1 394 ? -42.455 1.533   35.046  1.00 24.57  ? 395 ASN A C   1 
ATOM   3199 O  O   . ASN A 1 394 ? -43.219 1.667   35.995  1.00 24.51  ? 395 ASN A O   1 
ATOM   3200 C  CB  . ASN A 1 394 ? -43.863 1.110   32.996  1.00 25.56  ? 395 ASN A CB  1 
ATOM   3201 C  CG  . ASN A 1 394 ? -43.509 2.475   32.429  1.00 27.07  ? 395 ASN A CG  1 
ATOM   3202 O  OD1 . ASN A 1 394 ? -42.511 2.633   31.721  1.00 28.76  ? 395 ASN A OD1 1 
ATOM   3203 N  ND2 . ASN A 1 394 ? -44.333 3.468   32.733  1.00 29.07  ? 395 ASN A ND2 1 
ATOM   3204 N  N   . PHE A 1 395 ? -41.321 2.219   34.936  1.00 24.13  ? 396 PHE A N   1 
ATOM   3205 C  CA  . PHE A 1 395 ? -40.920 3.212   35.927  1.00 23.38  ? 396 PHE A CA  1 
ATOM   3206 C  C   . PHE A 1 395 ? -41.633 4.527   35.611  1.00 23.10  ? 396 PHE A C   1 
ATOM   3207 O  O   . PHE A 1 395 ? -41.255 5.227   34.669  1.00 22.92  ? 396 PHE A O   1 
ATOM   3208 C  CB  . PHE A 1 395 ? -39.392 3.380   35.894  1.00 23.22  ? 396 PHE A CB  1 
ATOM   3209 C  CG  . PHE A 1 395 ? -38.843 4.292   36.962  1.00 22.44  ? 396 PHE A CG  1 
ATOM   3210 C  CD1 . PHE A 1 395 ? -38.756 3.868   38.287  1.00 21.84  ? 396 PHE A CD1 1 
ATOM   3211 C  CD2 . PHE A 1 395 ? -38.382 5.563   36.638  1.00 21.70  ? 396 PHE A CD2 1 
ATOM   3212 C  CE1 . PHE A 1 395 ? -38.239 4.698   39.279  1.00 20.77  ? 396 PHE A CE1 1 
ATOM   3213 C  CE2 . PHE A 1 395 ? -37.854 6.408   37.630  1.00 22.42  ? 396 PHE A CE2 1 
ATOM   3214 C  CZ  . PHE A 1 395 ? -37.789 5.972   38.952  1.00 21.59  ? 396 PHE A CZ  1 
ATOM   3215 N  N   . ASP A 1 396 ? -42.677 4.847   36.379  1.00 23.03  ? 397 ASP A N   1 
ATOM   3216 C  CA  . ASP A 1 396 ? -43.472 6.060   36.138  1.00 23.05  ? 397 ASP A CA  1 
ATOM   3217 C  C   . ASP A 1 396 ? -43.744 6.865   37.417  1.00 22.95  ? 397 ASP A C   1 
ATOM   3218 O  O   . ASP A 1 396 ? -44.713 6.613   38.128  1.00 22.24  ? 397 ASP A O   1 
ATOM   3219 C  CB  . ASP A 1 396 ? -44.778 5.729   35.400  1.00 23.40  ? 397 ASP A CB  1 
ATOM   3220 C  CG  . ASP A 1 396 ? -45.632 6.968   35.104  1.00 24.86  ? 397 ASP A CG  1 
ATOM   3221 O  OD1 . ASP A 1 396 ? -45.120 8.108   35.135  1.00 26.28  ? 397 ASP A OD1 1 
ATOM   3222 O  OD2 . ASP A 1 396 ? -46.837 6.798   34.833  1.00 27.94  ? 397 ASP A OD2 1 
ATOM   3223 N  N   . PRO A 1 397 ? -42.892 7.865   37.692  1.00 23.01  ? 398 PRO A N   1 
ATOM   3224 C  CA  . PRO A 1 397 ? -43.060 8.721   38.865  1.00 23.12  ? 398 PRO A CA  1 
ATOM   3225 C  C   . PRO A 1 397 ? -44.371 9.503   38.887  1.00 23.27  ? 398 PRO A C   1 
ATOM   3226 O  O   . PRO A 1 397 ? -44.880 9.754   39.970  1.00 23.19  ? 398 PRO A O   1 
ATOM   3227 C  CB  . PRO A 1 397 ? -41.878 9.696   38.767  1.00 22.91  ? 398 PRO A CB  1 
ATOM   3228 C  CG  . PRO A 1 397 ? -40.877 8.989   37.920  1.00 23.60  ? 398 PRO A CG  1 
ATOM   3229 C  CD  . PRO A 1 397 ? -41.675 8.201   36.933  1.00 22.83  ? 398 PRO A CD  1 
ATOM   3230 N  N   . THR A 1 398 ? -44.900 9.898   37.721  1.00 23.53  ? 399 THR A N   1 
ATOM   3231 C  CA  . THR A 1 398 ? -46.153 10.693  37.671  1.00 24.36  ? 399 THR A CA  1 
ATOM   3232 C  C   . THR A 1 398 ? -47.334 9.957   38.318  1.00 24.53  ? 399 THR A C   1 
ATOM   3233 O  O   . THR A 1 398 ? -48.290 10.574  38.780  1.00 24.83  ? 399 THR A O   1 
ATOM   3234 C  CB  . THR A 1 398 ? -46.548 11.141  36.229  1.00 24.29  ? 399 THR A CB  1 
ATOM   3235 O  OG1 . THR A 1 398 ? -46.966 10.004  35.463  1.00 25.32  ? 399 THR A OG1 1 
ATOM   3236 C  CG2 . THR A 1 398 ? -45.376 11.822  35.516  1.00 24.31  ? 399 THR A CG2 1 
ATOM   3237 N  N   . ARG A 1 399 ? -47.240 8.633   38.340  1.00 24.73  ? 400 ARG A N   1 
ATOM   3238 C  CA  . ARG A 1 399 ? -48.136 7.754   39.077  1.00 25.57  ? 400 ARG A CA  1 
ATOM   3239 C  C   . ARG A 1 399 ? -48.485 8.287   40.482  1.00 26.13  ? 400 ARG A C   1 
ATOM   3240 O  O   . ARG A 1 399 ? -49.638 8.222   40.901  1.00 25.71  ? 400 ARG A O   1 
ATOM   3241 C  CB  . ARG A 1 399 ? -47.454 6.387   39.161  1.00 25.74  ? 400 ARG A CB  1 
ATOM   3242 C  CG  . ARG A 1 399 ? -48.154 5.303   39.910  1.00 25.41  ? 400 ARG A CG  1 
ATOM   3243 C  CD  . ARG A 1 399 ? -47.208 4.114   40.162  1.00 22.22  ? 400 ARG A CD  1 
ATOM   3244 N  NE  . ARG A 1 399 ? -46.540 3.561   38.970  1.00 20.25  ? 400 ARG A NE  1 
ATOM   3245 C  CZ  . ARG A 1 399 ? -47.131 2.860   37.997  1.00 20.48  ? 400 ARG A CZ  1 
ATOM   3246 N  NH1 . ARG A 1 399 ? -48.441 2.638   38.002  1.00 19.93  ? 400 ARG A NH1 1 
ATOM   3247 N  NH2 . ARG A 1 399 ? -46.406 2.386   36.991  1.00 21.05  ? 400 ARG A NH2 1 
ATOM   3248 N  N   . TRP A 1 400 ? -47.496 8.829   41.191  1.00 26.60  ? 401 TRP A N   1 
ATOM   3249 C  CA  . TRP A 1 400 ? -47.699 9.306   42.566  1.00 27.78  ? 401 TRP A CA  1 
ATOM   3250 C  C   . TRP A 1 400 ? -48.295 10.714  42.654  1.00 29.38  ? 401 TRP A C   1 
ATOM   3251 O  O   . TRP A 1 400 ? -48.614 11.195  43.743  1.00 29.47  ? 401 TRP A O   1 
ATOM   3252 C  CB  . TRP A 1 400 ? -46.393 9.185   43.375  1.00 26.92  ? 401 TRP A CB  1 
ATOM   3253 C  CG  . TRP A 1 400 ? -45.906 7.769   43.381  1.00 24.91  ? 401 TRP A CG  1 
ATOM   3254 C  CD1 . TRP A 1 400 ? -45.024 7.199   42.505  1.00 22.29  ? 401 TRP A CD1 1 
ATOM   3255 C  CD2 . TRP A 1 400 ? -46.332 6.723   44.259  1.00 21.86  ? 401 TRP A CD2 1 
ATOM   3256 N  NE1 . TRP A 1 400 ? -44.862 5.869   42.800  1.00 21.40  ? 401 TRP A NE1 1 
ATOM   3257 C  CE2 . TRP A 1 400 ? -45.651 5.551   43.874  1.00 22.07  ? 401 TRP A CE2 1 
ATOM   3258 C  CE3 . TRP A 1 400 ? -47.209 6.667   45.348  1.00 22.00  ? 401 TRP A CE3 1 
ATOM   3259 C  CZ2 . TRP A 1 400 ? -45.820 4.328   44.544  1.00 21.18  ? 401 TRP A CZ2 1 
ATOM   3260 C  CZ3 . TRP A 1 400 ? -47.379 5.449   46.009  1.00 21.40  ? 401 TRP A CZ3 1 
ATOM   3261 C  CH2 . TRP A 1 400 ? -46.683 4.301   45.602  1.00 19.99  ? 401 TRP A CH2 1 
ATOM   3262 N  N   . LEU A 1 401 ? -48.453 11.358  41.500  1.00 31.51  ? 402 LEU A N   1 
ATOM   3263 C  CA  . LEU A 1 401 ? -49.000 12.707  41.425  1.00 33.82  ? 402 LEU A CA  1 
ATOM   3264 C  C   . LEU A 1 401 ? -50.490 12.749  41.086  1.00 35.59  ? 402 LEU A C   1 
ATOM   3265 O  O   . LEU A 1 401 ? -51.107 13.812  41.162  1.00 36.25  ? 402 LEU A O   1 
ATOM   3266 C  CB  . LEU A 1 401 ? -48.201 13.561  40.431  1.00 33.62  ? 402 LEU A CB  1 
ATOM   3267 C  CG  . LEU A 1 401 ? -46.759 13.917  40.818  1.00 33.77  ? 402 LEU A CG  1 
ATOM   3268 C  CD1 . LEU A 1 401 ? -46.059 14.589  39.658  1.00 33.54  ? 402 LEU A CD1 1 
ATOM   3269 C  CD2 . LEU A 1 401 ? -46.696 14.788  42.077  1.00 33.71  ? 402 LEU A CD2 1 
ATOM   3270 N  N   . SER A 1 402 ? -51.067 11.605  40.719  1.00 37.80  ? 403 SER A N   1 
ATOM   3271 C  CA  . SER A 1 402 ? -52.503 11.525  40.424  1.00 39.91  ? 403 SER A CA  1 
ATOM   3272 C  C   . SER A 1 402 ? -53.364 12.164  41.503  1.00 41.12  ? 403 SER A C   1 
ATOM   3273 O  O   . SER A 1 402 ? -53.137 11.976  42.704  1.00 41.18  ? 403 SER A O   1 
ATOM   3274 C  CB  . SER A 1 402 ? -52.955 10.078  40.220  1.00 39.96  ? 403 SER A CB  1 
ATOM   3275 O  OG  . SER A 1 402 ? -53.188 9.804   38.850  1.00 41.71  ? 403 SER A OG  1 
ATOM   3276 N  N   . LYS A 1 403 ? -54.346 12.934  41.044  1.00 42.82  ? 404 LYS A N   1 
ATOM   3277 C  CA  . LYS A 1 403 ? -55.410 13.479  41.887  1.00 44.33  ? 404 LYS A CA  1 
ATOM   3278 C  C   . LYS A 1 403 ? -56.423 12.375  42.241  1.00 44.67  ? 404 LYS A C   1 
ATOM   3279 O  O   . LYS A 1 403 ? -57.205 12.508  43.190  1.00 45.09  ? 404 LYS A O   1 
ATOM   3280 C  CB  . LYS A 1 403 ? -56.090 14.652  41.167  1.00 44.75  ? 404 LYS A CB  1 
ATOM   3281 C  CG  . LYS A 1 403 ? -56.296 14.405  39.660  1.00 46.83  ? 404 LYS A CG  1 
ATOM   3282 C  CD  . LYS A 1 403 ? -56.180 15.690  38.839  1.00 49.28  ? 404 LYS A CD  1 
ATOM   3283 C  CE  . LYS A 1 403 ? -56.103 15.374  37.344  1.00 50.72  ? 404 LYS A CE  1 
ATOM   3284 N  NZ  . LYS A 1 403 ? -55.906 16.606  36.519  1.00 51.97  ? 404 LYS A NZ  1 
ATOM   3285 N  N   . ASP A 1 404 ? -56.392 11.292  41.466  1.00 44.93  ? 405 ASP A N   1 
ATOM   3286 C  CA  . ASP A 1 404 ? -57.167 10.084  41.734  1.00 45.11  ? 405 ASP A CA  1 
ATOM   3287 C  C   . ASP A 1 404 ? -56.567 9.366   42.953  1.00 45.06  ? 405 ASP A C   1 
ATOM   3288 O  O   . ASP A 1 404 ? -55.697 8.499   42.815  1.00 44.93  ? 405 ASP A O   1 
ATOM   3289 C  CB  . ASP A 1 404 ? -57.151 9.191   40.484  1.00 45.11  ? 405 ASP A CB  1 
ATOM   3290 C  CG  . ASP A 1 404 ? -58.048 7.966   40.602  1.00 45.94  ? 405 ASP A CG  1 
ATOM   3291 O  OD1 . ASP A 1 404 ? -58.727 7.781   41.640  1.00 46.87  ? 405 ASP A OD1 1 
ATOM   3292 O  OD2 . ASP A 1 404 ? -58.069 7.174   39.632  1.00 46.35  ? 405 ASP A OD2 1 
ATOM   3293 N  N   . LYS A 1 405 ? -57.041 9.738   44.142  1.00 45.08  ? 406 LYS A N   1 
ATOM   3294 C  CA  . LYS A 1 405 ? -56.481 9.252   45.409  1.00 45.07  ? 406 LYS A CA  1 
ATOM   3295 C  C   . LYS A 1 405 ? -56.617 7.740   45.601  1.00 44.50  ? 406 LYS A C   1 
ATOM   3296 O  O   . LYS A 1 405 ? -56.033 7.165   46.529  1.00 44.60  ? 406 LYS A O   1 
ATOM   3297 C  CB  . LYS A 1 405 ? -57.083 10.004  46.607  1.00 45.51  ? 406 LYS A CB  1 
ATOM   3298 C  CG  . LYS A 1 405 ? -56.868 11.528  46.593  1.00 47.16  ? 406 LYS A CG  1 
ATOM   3299 C  CD  . LYS A 1 405 ? -55.384 11.924  46.522  1.00 48.89  ? 406 LYS A CD  1 
ATOM   3300 C  CE  . LYS A 1 405 ? -55.197 13.446  46.511  1.00 50.11  ? 406 LYS A CE  1 
ATOM   3301 N  NZ  . LYS A 1 405 ? -55.834 14.109  45.329  1.00 50.73  ? 406 LYS A NZ  1 
ATOM   3302 N  N   . ASN A 1 406 ? -57.382 7.109   44.716  1.00 43.47  ? 407 ASN A N   1 
ATOM   3303 C  CA  . ASN A 1 406 ? -57.526 5.660   44.680  1.00 42.53  ? 407 ASN A CA  1 
ATOM   3304 C  C   . ASN A 1 406 ? -56.255 4.968   44.174  1.00 41.43  ? 407 ASN A C   1 
ATOM   3305 O  O   . ASN A 1 406 ? -55.929 3.856   44.601  1.00 41.32  ? 407 ASN A O   1 
ATOM   3306 C  CB  . ASN A 1 406 ? -58.728 5.288   43.801  1.00 42.91  ? 407 ASN A CB  1 
ATOM   3307 C  CG  . ASN A 1 406 ? -58.861 3.787   43.581  1.00 44.15  ? 407 ASN A CG  1 
ATOM   3308 O  OD1 . ASN A 1 406 ? -58.788 2.998   44.525  1.00 46.21  ? 407 ASN A OD1 1 
ATOM   3309 N  ND2 . ASN A 1 406 ? -59.074 3.389   42.328  1.00 44.86  ? 407 ASN A ND2 1 
ATOM   3310 N  N   . ILE A 1 407 ? -55.545 5.637   43.267  1.00 39.74  ? 408 ILE A N   1 
ATOM   3311 C  CA  . ILE A 1 407 ? -54.336 5.096   42.646  1.00 38.06  ? 408 ILE A CA  1 
ATOM   3312 C  C   . ILE A 1 407 ? -53.156 4.944   43.621  1.00 36.56  ? 408 ILE A C   1 
ATOM   3313 O  O   . ILE A 1 407 ? -52.256 4.129   43.386  1.00 36.18  ? 408 ILE A O   1 
ATOM   3314 C  CB  . ILE A 1 407 ? -53.929 5.937   41.410  1.00 38.41  ? 408 ILE A CB  1 
ATOM   3315 C  CG1 . ILE A 1 407 ? -54.851 5.612   40.230  1.00 39.07  ? 408 ILE A CG1 1 
ATOM   3316 C  CG2 . ILE A 1 407 ? -52.455 5.712   41.025  1.00 38.34  ? 408 ILE A CG2 1 
ATOM   3317 C  CD1 . ILE A 1 407 ? -54.733 6.582   39.060  1.00 41.01  ? 408 ILE A CD1 1 
ATOM   3318 N  N   . THR A 1 408 ? -53.163 5.718   44.706  1.00 34.49  ? 409 THR A N   1 
ATOM   3319 C  CA  . THR A 1 408 ? -52.043 5.712   45.655  1.00 32.94  ? 409 THR A CA  1 
ATOM   3320 C  C   . THR A 1 408 ? -52.428 5.267   47.073  1.00 31.55  ? 409 THR A C   1 
ATOM   3321 O  O   . THR A 1 408 ? -51.596 5.307   47.984  1.00 31.25  ? 409 THR A O   1 
ATOM   3322 C  CB  . THR A 1 408 ? -51.342 7.093   45.742  1.00 32.99  ? 409 THR A CB  1 
ATOM   3323 O  OG1 . THR A 1 408 ? -52.256 8.063   46.267  1.00 33.86  ? 409 THR A OG1 1 
ATOM   3324 C  CG2 . THR A 1 408 ? -50.844 7.542   44.380  1.00 32.81  ? 409 THR A CG2 1 
ATOM   3325 N  N   . TYR A 1 409 ? -53.679 4.844   47.253  1.00 29.86  ? 410 TYR A N   1 
ATOM   3326 C  CA  . TYR A 1 409 ? -54.187 4.441   48.568  1.00 28.55  ? 410 TYR A CA  1 
ATOM   3327 C  C   . TYR A 1 409 ? -53.364 3.278   49.140  1.00 27.25  ? 410 TYR A C   1 
ATOM   3328 O  O   . TYR A 1 409 ? -53.266 2.217   48.518  1.00 26.59  ? 410 TYR A O   1 
ATOM   3329 C  CB  . TYR A 1 409 ? -55.671 4.070   48.478  1.00 28.53  ? 410 TYR A CB  1 
ATOM   3330 C  CG  . TYR A 1 409 ? -56.328 3.829   49.818  1.00 29.63  ? 410 TYR A CG  1 
ATOM   3331 C  CD1 . TYR A 1 409 ? -56.405 4.849   50.779  1.00 30.42  ? 410 TYR A CD1 1 
ATOM   3332 C  CD2 . TYR A 1 409 ? -56.885 2.586   50.127  1.00 29.82  ? 410 TYR A CD2 1 
ATOM   3333 C  CE1 . TYR A 1 409 ? -57.020 4.629   52.016  1.00 31.12  ? 410 TYR A CE1 1 
ATOM   3334 C  CE2 . TYR A 1 409 ? -57.503 2.359   51.356  1.00 29.90  ? 410 TYR A CE2 1 
ATOM   3335 C  CZ  . TYR A 1 409 ? -57.569 3.381   52.295  1.00 30.98  ? 410 TYR A CZ  1 
ATOM   3336 O  OH  . TYR A 1 409 ? -58.178 3.153   53.515  1.00 31.70  ? 410 TYR A OH  1 
ATOM   3337 N  N   . PHE A 1 410 ? -52.758 3.515   50.303  1.00 25.64  ? 411 PHE A N   1 
ATOM   3338 C  CA  . PHE A 1 410 ? -51.847 2.567   50.959  1.00 24.80  ? 411 PHE A CA  1 
ATOM   3339 C  C   . PHE A 1 410 ? -50.882 1.846   50.010  1.00 23.83  ? 411 PHE A C   1 
ATOM   3340 O  O   . PHE A 1 410 ? -50.719 0.627   50.092  1.00 22.93  ? 411 PHE A O   1 
ATOM   3341 C  CB  . PHE A 1 410 ? -52.625 1.574   51.842  1.00 24.76  ? 411 PHE A CB  1 
ATOM   3342 C  CG  . PHE A 1 410 ? -52.982 2.127   53.188  1.00 25.28  ? 411 PHE A CG  1 
ATOM   3343 C  CD1 . PHE A 1 410 ? -54.073 2.983   53.337  1.00 25.15  ? 411 PHE A CD1 1 
ATOM   3344 C  CD2 . PHE A 1 410 ? -52.213 1.817   54.307  1.00 25.75  ? 411 PHE A CD2 1 
ATOM   3345 C  CE1 . PHE A 1 410 ? -54.396 3.516   54.577  1.00 24.83  ? 411 PHE A CE1 1 
ATOM   3346 C  CE2 . PHE A 1 410 ? -52.528 2.347   55.558  1.00 25.34  ? 411 PHE A CE2 1 
ATOM   3347 C  CZ  . PHE A 1 410 ? -53.623 3.198   55.692  1.00 25.51  ? 411 PHE A CZ  1 
ATOM   3348 N  N   . ARG A 1 411 ? -50.260 2.613   49.114  1.00 23.35  ? 412 ARG A N   1 
ATOM   3349 C  CA  . ARG A 1 411 ? -49.276 2.079   48.159  1.00 23.54  ? 412 ARG A CA  1 
ATOM   3350 C  C   . ARG A 1 411 ? -47.864 2.492   48.501  1.00 22.65  ? 412 ARG A C   1 
ATOM   3351 O  O   . ARG A 1 411 ? -46.932 1.850   48.045  1.00 22.35  ? 412 ARG A O   1 
ATOM   3352 C  CB  . ARG A 1 411 ? -49.524 2.568   46.728  1.00 23.95  ? 412 ARG A CB  1 
ATOM   3353 C  CG  . ARG A 1 411 ? -50.921 2.440   46.181  1.00 25.96  ? 412 ARG A CG  1 
ATOM   3354 C  CD  . ARG A 1 411 ? -51.333 1.038   45.904  1.00 27.88  ? 412 ARG A CD  1 
ATOM   3355 N  NE  . ARG A 1 411 ? -52.760 0.952   46.171  1.00 31.15  ? 412 ARG A NE  1 
ATOM   3356 C  CZ  . ARG A 1 411 ? -53.700 0.776   45.261  1.00 28.33  ? 412 ARG A CZ  1 
ATOM   3357 N  NH1 . ARG A 1 411 ? -53.395 0.623   43.985  1.00 29.07  ? 412 ARG A NH1 1 
ATOM   3358 N  NH2 . ARG A 1 411 ? -54.947 0.723   45.654  1.00 28.38  ? 412 ARG A NH2 1 
ATOM   3359 N  N   . ASN A 1 412 ? -47.712 3.593   49.247  1.00 22.09  ? 413 ASN A N   1 
ATOM   3360 C  CA  . ASN A 1 412 ? -46.389 4.163   49.566  1.00 21.58  ? 413 ASN A CA  1 
ATOM   3361 C  C   . ASN A 1 412 ? -45.838 3.542   50.851  1.00 20.63  ? 413 ASN A C   1 
ATOM   3362 O  O   . ASN A 1 412 ? -45.855 4.166   51.902  1.00 20.57  ? 413 ASN A O   1 
ATOM   3363 C  CB  . ASN A 1 412 ? -46.473 5.697   49.706  1.00 21.93  ? 413 ASN A CB  1 
ATOM   3364 C  CG  . ASN A 1 412 ? -45.093 6.367   49.917  1.00 23.77  ? 413 ASN A CG  1 
ATOM   3365 O  OD1 . ASN A 1 412 ? -44.039 5.787   49.633  1.00 25.54  ? 413 ASN A OD1 1 
ATOM   3366 N  ND2 . ASN A 1 412 ? -45.112 7.603   50.396  1.00 24.78  ? 413 ASN A ND2 1 
ATOM   3367 N  N   . LEU A 1 413 ? -45.342 2.314   50.756  1.00 19.74  ? 414 LEU A N   1 
ATOM   3368 C  CA  . LEU A 1 413 ? -45.054 1.517   51.951  1.00 19.00  ? 414 LEU A CA  1 
ATOM   3369 C  C   . LEU A 1 413 ? -43.571 1.176   52.174  1.00 18.67  ? 414 LEU A C   1 
ATOM   3370 O  O   . LEU A 1 413 ? -43.234 0.445   53.112  1.00 18.33  ? 414 LEU A O   1 
ATOM   3371 C  CB  . LEU A 1 413 ? -45.906 0.242   51.925  1.00 18.70  ? 414 LEU A CB  1 
ATOM   3372 C  CG  . LEU A 1 413 ? -47.430 0.439   51.886  1.00 18.63  ? 414 LEU A CG  1 
ATOM   3373 C  CD1 . LEU A 1 413 ? -48.134 -0.819  51.406  1.00 19.73  ? 414 LEU A CD1 1 
ATOM   3374 C  CD2 . LEU A 1 413 ? -47.953 0.843   53.240  1.00 18.43  ? 414 LEU A CD2 1 
ATOM   3375 N  N   . GLY A 1 414 ? -42.699 1.727   51.327  1.00 18.31  ? 415 GLY A N   1 
ATOM   3376 C  CA  . GLY A 1 414 ? -41.266 1.440   51.346  1.00 18.19  ? 415 GLY A CA  1 
ATOM   3377 C  C   . GLY A 1 414 ? -40.520 1.777   52.632  1.00 18.38  ? 415 GLY A C   1 
ATOM   3378 O  O   . GLY A 1 414 ? -39.455 1.205   52.902  1.00 18.22  ? 415 GLY A O   1 
ATOM   3379 N  N   . PHE A 1 415 ? -41.076 2.701   53.417  1.00 17.66  ? 416 PHE A N   1 
ATOM   3380 C  CA  . PHE A 1 415 ? -40.528 3.064   54.724  1.00 17.41  ? 416 PHE A CA  1 
ATOM   3381 C  C   . PHE A 1 415 ? -41.437 2.576   55.857  1.00 17.67  ? 416 PHE A C   1 
ATOM   3382 O  O   . PHE A 1 415 ? -41.246 2.952   57.010  1.00 17.72  ? 416 PHE A O   1 
ATOM   3383 C  CB  . PHE A 1 415 ? -40.346 4.587   54.851  1.00 16.76  ? 416 PHE A CB  1 
ATOM   3384 C  CG  . PHE A 1 415 ? -39.234 5.159   54.003  1.00 15.49  ? 416 PHE A CG  1 
ATOM   3385 C  CD1 . PHE A 1 415 ? -39.520 5.810   52.800  1.00 14.10  ? 416 PHE A CD1 1 
ATOM   3386 C  CD2 . PHE A 1 415 ? -37.908 5.076   54.421  1.00 13.58  ? 416 PHE A CD2 1 
ATOM   3387 C  CE1 . PHE A 1 415 ? -38.502 6.358   52.020  1.00 14.23  ? 416 PHE A CE1 1 
ATOM   3388 C  CE2 . PHE A 1 415 ? -36.878 5.615   53.653  1.00 13.48  ? 416 PHE A CE2 1 
ATOM   3389 C  CZ  . PHE A 1 415 ? -37.171 6.260   52.445  1.00 14.54  ? 416 PHE A CZ  1 
ATOM   3390 N  N   . GLY A 1 416 ? -42.432 1.758   55.520  1.00 17.72  ? 417 GLY A N   1 
ATOM   3391 C  CA  . GLY A 1 416 ? -43.428 1.315   56.485  1.00 18.29  ? 417 GLY A CA  1 
ATOM   3392 C  C   . GLY A 1 416 ? -44.532 2.327   56.755  1.00 18.98  ? 417 GLY A C   1 
ATOM   3393 O  O   . GLY A 1 416 ? -44.780 3.221   55.949  1.00 18.56  ? 417 GLY A O   1 
ATOM   3394 N  N   . TRP A 1 417 ? -45.188 2.184   57.902  1.00 19.64  ? 418 TRP A N   1 
ATOM   3395 C  CA  . TRP A 1 417 ? -46.361 2.983   58.230  1.00 20.85  ? 418 TRP A CA  1 
ATOM   3396 C  C   . TRP A 1 417 ? -46.421 3.261   59.727  1.00 20.33  ? 418 TRP A C   1 
ATOM   3397 O  O   . TRP A 1 417 ? -45.968 2.439   60.528  1.00 20.70  ? 418 TRP A O   1 
ATOM   3398 C  CB  . TRP A 1 417 ? -47.630 2.225   57.800  1.00 21.77  ? 418 TRP A CB  1 
ATOM   3399 C  CG  . TRP A 1 417 ? -48.887 3.048   57.891  1.00 25.44  ? 418 TRP A CG  1 
ATOM   3400 C  CD1 . TRP A 1 417 ? -49.417 3.837   56.911  1.00 27.99  ? 418 TRP A CD1 1 
ATOM   3401 C  CD2 . TRP A 1 417 ? -49.764 3.175   59.026  1.00 29.14  ? 418 TRP A CD2 1 
ATOM   3402 N  NE1 . TRP A 1 417 ? -50.568 4.447   57.361  1.00 30.31  ? 418 TRP A NE1 1 
ATOM   3403 C  CE2 . TRP A 1 417 ? -50.807 4.057   58.653  1.00 30.40  ? 418 TRP A CE2 1 
ATOM   3404 C  CE3 . TRP A 1 417 ? -49.767 2.634   60.322  1.00 31.33  ? 418 TRP A CE3 1 
ATOM   3405 C  CZ2 . TRP A 1 417 ? -51.848 4.411   59.527  1.00 31.71  ? 418 TRP A CZ2 1 
ATOM   3406 C  CZ3 . TRP A 1 417 ? -50.806 2.985   61.196  1.00 32.38  ? 418 TRP A CZ3 1 
ATOM   3407 C  CH2 . TRP A 1 417 ? -51.831 3.865   60.790  1.00 33.29  ? 418 TRP A CH2 1 
ATOM   3408 N  N   . GLY A 1 418 ? -46.982 4.410   60.102  1.00 19.75  ? 419 GLY A N   1 
ATOM   3409 C  CA  . GLY A 1 418 ? -47.346 4.681   61.499  1.00 19.33  ? 419 GLY A CA  1 
ATOM   3410 C  C   . GLY A 1 418 ? -46.195 4.964   62.433  1.00 19.22  ? 419 GLY A C   1 
ATOM   3411 O  O   . GLY A 1 418 ? -45.125 5.377   61.981  1.00 19.32  ? 419 GLY A O   1 
ATOM   3412 N  N   . VAL A 1 419 ? -46.419 4.758   63.735  1.00 18.97  ? 420 VAL A N   1 
ATOM   3413 C  CA  . VAL A 1 419 ? -45.444 5.142   64.776  1.00 18.50  ? 420 VAL A CA  1 
ATOM   3414 C  C   . VAL A 1 419 ? -44.126 4.367   64.743  1.00 18.12  ? 420 VAL A C   1 
ATOM   3415 O  O   . VAL A 1 419 ? -43.098 4.879   65.202  1.00 17.53  ? 420 VAL A O   1 
ATOM   3416 C  CB  . VAL A 1 419 ? -46.016 5.054   66.230  1.00 19.13  ? 420 VAL A CB  1 
ATOM   3417 C  CG1 . VAL A 1 419 ? -46.892 6.241   66.531  1.00 19.22  ? 420 VAL A CG1 1 
ATOM   3418 C  CG2 . VAL A 1 419 ? -46.764 3.741   66.474  1.00 18.65  ? 420 VAL A CG2 1 
ATOM   3419 N  N   . ARG A 1 420 ? -44.163 3.135   64.222  1.00 17.63  ? 421 ARG A N   1 
ATOM   3420 C  CA  . ARG A 1 420 ? -42.962 2.310   64.148  1.00 17.00  ? 421 ARG A CA  1 
ATOM   3421 C  C   . ARG A 1 420 ? -42.439 2.162   62.713  1.00 16.90  ? 421 ARG A C   1 
ATOM   3422 O  O   . ARG A 1 420 ? -41.747 1.193   62.370  1.00 16.86  ? 421 ARG A O   1 
ATOM   3423 C  CB  . ARG A 1 420 ? -43.158 0.956   64.856  1.00 17.01  ? 421 ARG A CB  1 
ATOM   3424 C  CG  . ARG A 1 420 ? -41.841 0.247   65.143  1.00 16.22  ? 421 ARG A CG  1 
ATOM   3425 C  CD  . ARG A 1 420 ? -41.939 -0.776  66.247  1.00 16.31  ? 421 ARG A CD  1 
ATOM   3426 N  NE  . ARG A 1 420 ? -40.610 -1.216  66.646  1.00 16.16  ? 421 ARG A NE  1 
ATOM   3427 C  CZ  . ARG A 1 420 ? -40.357 -2.150  67.553  1.00 17.22  ? 421 ARG A CZ  1 
ATOM   3428 N  NH1 . ARG A 1 420 ? -41.347 -2.774  68.174  1.00 18.11  ? 421 ARG A NH1 1 
ATOM   3429 N  NH2 . ARG A 1 420 ? -39.103 -2.472  67.830  1.00 17.59  ? 421 ARG A NH2 1 
ATOM   3430 N  N   . GLN A 1 421 ? -42.768 3.143   61.877  1.00 16.59  ? 422 GLN A N   1 
ATOM   3431 C  CA  . GLN A 1 421 ? -42.209 3.231   60.536  1.00 16.24  ? 422 GLN A CA  1 
ATOM   3432 C  C   . GLN A 1 421 ? -40.701 3.464   60.651  1.00 15.75  ? 422 GLN A C   1 
ATOM   3433 O  O   . GLN A 1 421 ? -40.199 3.731   61.745  1.00 15.40  ? 422 GLN A O   1 
ATOM   3434 C  CB  . GLN A 1 421 ? -42.868 4.376   59.760  1.00 16.39  ? 422 GLN A CB  1 
ATOM   3435 C  CG  . GLN A 1 421 ? -42.341 5.765   60.120  1.00 18.30  ? 422 GLN A CG  1 
ATOM   3436 C  CD  . GLN A 1 421 ? -43.148 6.879   59.484  1.00 21.90  ? 422 GLN A CD  1 
ATOM   3437 O  OE1 . GLN A 1 421 ? -44.227 7.230   59.957  1.00 24.64  ? 422 GLN A OE1 1 
ATOM   3438 N  NE2 . GLN A 1 421 ? -42.628 7.439   58.410  1.00 22.32  ? 422 GLN A NE2 1 
ATOM   3439 N  N   . CYS A 1 422 ? -39.992 3.376   59.524  1.00 15.15  ? 423 CYS A N   1 
ATOM   3440 C  CA  . CYS A 1 422 ? -38.561 3.630   59.487  1.00 14.89  ? 423 CYS A CA  1 
ATOM   3441 C  C   . CYS A 1 422 ? -38.181 4.853   60.329  1.00 15.00  ? 423 CYS A C   1 
ATOM   3442 O  O   . CYS A 1 422 ? -38.695 5.938   60.100  1.00 14.42  ? 423 CYS A O   1 
ATOM   3443 C  CB  . CYS A 1 422 ? -38.097 3.855   58.049  1.00 14.54  ? 423 CYS A CB  1 
ATOM   3444 S  SG  . CYS A 1 422 ? -36.314 4.202   57.914  1.00 14.05  ? 423 CYS A SG  1 
ATOM   3445 N  N   . LEU A 1 423 ? -37.278 4.669   61.292  1.00 15.16  ? 424 LEU A N   1 
ATOM   3446 C  CA  . LEU A 1 423 ? -36.790 5.784   62.104  1.00 15.25  ? 424 LEU A CA  1 
ATOM   3447 C  C   . LEU A 1 423 ? -35.945 6.731   61.256  1.00 15.46  ? 424 LEU A C   1 
ATOM   3448 O  O   . LEU A 1 423 ? -35.931 7.943   61.496  1.00 15.69  ? 424 LEU A O   1 
ATOM   3449 C  CB  . LEU A 1 423 ? -35.968 5.285   63.298  1.00 14.92  ? 424 LEU A CB  1 
ATOM   3450 C  CG  . LEU A 1 423 ? -35.356 6.343   64.230  1.00 15.52  ? 424 LEU A CG  1 
ATOM   3451 C  CD1 . LEU A 1 423 ? -36.444 7.196   64.921  1.00 16.55  ? 424 LEU A CD1 1 
ATOM   3452 C  CD2 . LEU A 1 423 ? -34.435 5.711   65.264  1.00 14.87  ? 424 LEU A CD2 1 
ATOM   3453 N  N   . GLY A 1 424 ? -35.233 6.167   60.279  1.00 15.06  ? 425 GLY A N   1 
ATOM   3454 C  CA  . GLY A 1 424 ? -34.353 6.942   59.418  1.00 14.91  ? 425 GLY A CA  1 
ATOM   3455 C  C   . GLY A 1 424 ? -35.007 7.555   58.193  1.00 14.61  ? 425 GLY A C   1 
ATOM   3456 O  O   . GLY A 1 424 ? -34.317 8.079   57.327  1.00 14.42  ? 425 GLY A O   1 
ATOM   3457 N  N   . ARG A 1 425 ? -36.334 7.527   58.129  1.00 15.04  ? 426 ARG A N   1 
ATOM   3458 C  CA  . ARG A 1 425 ? -37.044 7.946   56.918  1.00 15.65  ? 426 ARG A CA  1 
ATOM   3459 C  C   . ARG A 1 425 ? -36.675 9.357   56.431  1.00 15.80  ? 426 ARG A C   1 
ATOM   3460 O  O   . ARG A 1 425 ? -36.413 9.551   55.235  1.00 15.46  ? 426 ARG A O   1 
ATOM   3461 C  CB  . ARG A 1 425 ? -38.559 7.819   57.085  1.00 15.92  ? 426 ARG A CB  1 
ATOM   3462 C  CG  . ARG A 1 425 ? -39.333 8.233   55.827  1.00 16.86  ? 426 ARG A CG  1 
ATOM   3463 C  CD  . ARG A 1 425 ? -40.831 8.246   56.071  1.00 18.96  ? 426 ARG A CD  1 
ATOM   3464 N  NE  . ARG A 1 425 ? -41.571 8.247   54.811  1.00 20.55  ? 426 ARG A NE  1 
ATOM   3465 C  CZ  . ARG A 1 425 ? -42.802 7.772   54.662  1.00 21.39  ? 426 ARG A CZ  1 
ATOM   3466 N  NH1 . ARG A 1 425 ? -43.442 7.244   55.693  1.00 23.24  ? 426 ARG A NH1 1 
ATOM   3467 N  NH2 . ARG A 1 425 ? -43.389 7.807   53.479  1.00 21.23  ? 426 ARG A NH2 1 
ATOM   3468 N  N   . ARG A 1 426 ? -36.643 10.325  57.346  1.00 16.10  ? 427 ARG A N   1 
ATOM   3469 C  CA  . ARG A 1 426 ? -36.337 11.709  56.968  1.00 16.58  ? 427 ARG A CA  1 
ATOM   3470 C  C   . ARG A 1 426 ? -34.892 11.861  56.540  1.00 16.52  ? 427 ARG A C   1 
ATOM   3471 O  O   . ARG A 1 426 ? -34.604 12.543  55.560  1.00 16.62  ? 427 ARG A O   1 
ATOM   3472 C  CB  . ARG A 1 426 ? -36.678 12.704  58.077  1.00 16.91  ? 427 ARG A CB  1 
ATOM   3473 C  CG  . ARG A 1 426 ? -38.146 12.755  58.453  1.00 18.68  ? 427 ARG A CG  1 
ATOM   3474 C  CD  . ARG A 1 426 ? -39.069 12.984  57.246  1.00 24.11  ? 427 ARG A CD  1 
ATOM   3475 N  NE  . ARG A 1 426 ? -40.465 12.892  57.676  1.00 29.50  ? 427 ARG A NE  1 
ATOM   3476 C  CZ  . ARG A 1 426 ? -41.462 12.323  56.995  1.00 32.48  ? 427 ARG A CZ  1 
ATOM   3477 N  NH1 . ARG A 1 426 ? -41.262 11.759  55.802  1.00 32.86  ? 427 ARG A NH1 1 
ATOM   3478 N  NH2 . ARG A 1 426 ? -42.682 12.322  57.524  1.00 34.55  ? 427 ARG A NH2 1 
ATOM   3479 N  N   . ILE A 1 427 ? -33.984 11.217  57.268  1.00 16.01  ? 428 ILE A N   1 
ATOM   3480 C  CA  . ILE A 1 427 ? -32.587 11.199  56.881  1.00 15.20  ? 428 ILE A CA  1 
ATOM   3481 C  C   . ILE A 1 427 ? -32.453 10.590  55.478  1.00 15.26  ? 428 ILE A C   1 
ATOM   3482 O  O   . ILE A 1 427 ? -31.719 11.111  54.624  1.00 15.21  ? 428 ILE A O   1 
ATOM   3483 C  CB  . ILE A 1 427 ? -31.738 10.403  57.904  1.00 14.89  ? 428 ILE A CB  1 
ATOM   3484 C  CG1 . ILE A 1 427 ? -31.667 11.168  59.227  1.00 15.80  ? 428 ILE A CG1 1 
ATOM   3485 C  CG2 . ILE A 1 427 ? -30.342 10.140  57.359  1.00 14.48  ? 428 ILE A CG2 1 
ATOM   3486 C  CD1 . ILE A 1 427 ? -31.147 10.381  60.398  1.00 14.93  ? 428 ILE A CD1 1 
ATOM   3487 N  N   . ALA A 1 428 ? -33.177 9.496   55.246  1.00 14.82  ? 429 ALA A N   1 
ATOM   3488 C  CA  . ALA A 1 428 ? -33.053 8.745   54.009  1.00 14.58  ? 429 ALA A CA  1 
ATOM   3489 C  C   . ALA A 1 428 ? -33.583 9.562   52.831  1.00 14.39  ? 429 ALA A C   1 
ATOM   3490 O  O   . ALA A 1 428 ? -32.907 9.687   51.815  1.00 13.97  ? 429 ALA A O   1 
ATOM   3491 C  CB  . ALA A 1 428 ? -33.768 7.395   54.123  1.00 14.30  ? 429 ALA A CB  1 
ATOM   3492 N  N   . GLU A 1 429 ? -34.777 10.126  52.992  1.00 14.70  ? 430 GLU A N   1 
ATOM   3493 C  CA  . GLU A 1 429 ? -35.427 10.946  51.955  1.00 15.15  ? 430 GLU A CA  1 
ATOM   3494 C  C   . GLU A 1 429 ? -34.566 12.148  51.591  1.00 15.13  ? 430 GLU A C   1 
ATOM   3495 O  O   . GLU A 1 429 ? -34.276 12.374  50.421  1.00 15.66  ? 430 GLU A O   1 
ATOM   3496 C  CB  . GLU A 1 429 ? -36.815 11.406  52.409  1.00 14.84  ? 430 GLU A CB  1 
ATOM   3497 C  CG  . GLU A 1 429 ? -37.794 10.261  52.588  1.00 16.26  ? 430 GLU A CG  1 
ATOM   3498 C  CD  . GLU A 1 429 ? -39.180 10.692  53.080  1.00 18.40  ? 430 GLU A CD  1 
ATOM   3499 O  OE1 . GLU A 1 429 ? -39.297 11.692  53.827  1.00 17.44  ? 430 GLU A OE1 1 
ATOM   3500 O  OE2 . GLU A 1 429 ? -40.151 9.990   52.724  1.00 18.29  ? 430 GLU A OE2 1 
ATOM   3501 N  N   . LEU A 1 430 ? -34.131 12.884  52.608  1.00 14.84  ? 431 LEU A N   1 
ATOM   3502 C  CA  . LEU A 1 430 ? -33.249 14.022  52.421  1.00 15.09  ? 431 LEU A CA  1 
ATOM   3503 C  C   . LEU A 1 430 ? -31.934 13.632  51.732  1.00 15.05  ? 431 LEU A C   1 
ATOM   3504 O  O   . LEU A 1 430 ? -31.526 14.279  50.766  1.00 15.16  ? 431 LEU A O   1 
ATOM   3505 C  CB  . LEU A 1 430 ? -33.001 14.735  53.762  1.00 14.69  ? 431 LEU A CB  1 
ATOM   3506 C  CG  . LEU A 1 430 ? -34.236 15.438  54.346  1.00 15.09  ? 431 LEU A CG  1 
ATOM   3507 C  CD1 . LEU A 1 430 ? -33.972 15.951  55.755  1.00 14.75  ? 431 LEU A CD1 1 
ATOM   3508 C  CD2 . LEU A 1 430 ? -34.710 16.576  53.425  1.00 14.58  ? 431 LEU A CD2 1 
ATOM   3509 N  N   . GLU A 1 431 ? -31.290 12.574  52.223  1.00 14.55  ? 432 GLU A N   1 
ATOM   3510 C  CA  . GLU A 1 431 ? -30.040 12.095  51.644  1.00 14.69  ? 432 GLU A CA  1 
ATOM   3511 C  C   . GLU A 1 431 ? -30.204 11.718  50.168  1.00 14.40  ? 432 GLU A C   1 
ATOM   3512 O  O   . GLU A 1 431 ? -29.376 12.080  49.341  1.00 14.45  ? 432 GLU A O   1 
ATOM   3513 C  CB  . GLU A 1 431 ? -29.514 10.893  52.431  1.00 14.62  ? 432 GLU A CB  1 
ATOM   3514 C  CG  . GLU A 1 431 ? -28.138 10.405  52.000  1.00 15.75  ? 432 GLU A CG  1 
ATOM   3515 C  CD  . GLU A 1 431 ? -27.776 9.090   52.664  1.00 18.54  ? 432 GLU A CD  1 
ATOM   3516 O  OE1 . GLU A 1 431 ? -28.140 8.896   53.856  1.00 19.48  ? 432 GLU A OE1 1 
ATOM   3517 O  OE2 . GLU A 1 431 ? -27.151 8.245   51.988  1.00 17.75  ? 432 GLU A OE2 1 
ATOM   3518 N  N   . MET A 1 432 ? -31.279 11.011  49.840  1.00 13.84  ? 433 MET A N   1 
ATOM   3519 C  CA  . MET A 1 432 ? -31.474 10.560  48.464  1.00 13.81  ? 433 MET A CA  1 
ATOM   3520 C  C   . MET A 1 432 ? -31.880 11.692  47.522  1.00 13.74  ? 433 MET A C   1 
ATOM   3521 O  O   . MET A 1 432 ? -31.386 11.760  46.399  1.00 13.26  ? 433 MET A O   1 
ATOM   3522 C  CB  . MET A 1 432 ? -32.471 9.404   48.411  1.00 13.53  ? 433 MET A CB  1 
ATOM   3523 C  CG  . MET A 1 432 ? -31.900 8.135   49.057  1.00 14.00  ? 433 MET A CG  1 
ATOM   3524 S  SD  . MET A 1 432 ? -32.922 6.693   48.779  1.00 14.98  ? 433 MET A SD  1 
ATOM   3525 C  CE  . MET A 1 432 ? -34.371 7.107   49.750  1.00 12.54  ? 433 MET A CE  1 
ATOM   3526 N  N   . THR A 1 433 ? -32.757 12.579  47.997  1.00 13.52  ? 434 THR A N   1 
ATOM   3527 C  CA  . THR A 1 433 ? -33.219 13.706  47.198  1.00 14.30  ? 434 THR A CA  1 
ATOM   3528 C  C   . THR A 1 433 ? -32.060 14.652  46.879  1.00 14.29  ? 434 THR A C   1 
ATOM   3529 O  O   . THR A 1 433 ? -31.874 15.028  45.734  1.00 15.06  ? 434 THR A O   1 
ATOM   3530 C  CB  . THR A 1 433 ? -34.412 14.444  47.873  1.00 14.00  ? 434 THR A CB  1 
ATOM   3531 O  OG1 . THR A 1 433 ? -35.423 13.481  48.205  1.00 14.81  ? 434 THR A OG1 1 
ATOM   3532 C  CG2 . THR A 1 433 ? -35.023 15.454  46.931  1.00 13.23  ? 434 THR A CG2 1 
ATOM   3533 N  N   . ILE A 1 434 ? -31.264 14.992  47.886  1.00 14.45  ? 435 ILE A N   1 
ATOM   3534 C  CA  . ILE A 1 434 ? -30.113 15.864  47.692  1.00 14.42  ? 435 ILE A CA  1 
ATOM   3535 C  C   . ILE A 1 434 ? -29.066 15.200  46.792  1.00 14.52  ? 435 ILE A C   1 
ATOM   3536 O  O   . ILE A 1 434 ? -28.489 15.851  45.913  1.00 15.12  ? 435 ILE A O   1 
ATOM   3537 C  CB  . ILE A 1 434 ? -29.493 16.315  49.049  1.00 14.27  ? 435 ILE A CB  1 
ATOM   3538 C  CG1 . ILE A 1 434 ? -30.504 17.145  49.842  1.00 14.26  ? 435 ILE A CG1 1 
ATOM   3539 C  CG2 . ILE A 1 434 ? -28.230 17.135  48.825  1.00 14.28  ? 435 ILE A CG2 1 
ATOM   3540 C  CD1 . ILE A 1 434 ? -30.127 17.376  51.323  1.00 14.06  ? 435 ILE A CD1 1 
ATOM   3541 N  N   . PHE A 1 435 ? -28.834 13.906  46.998  1.00 13.90  ? 436 PHE A N   1 
ATOM   3542 C  CA  . PHE A 1 435 ? -27.889 13.168  46.167  1.00 13.74  ? 436 PHE A CA  1 
ATOM   3543 C  C   . PHE A 1 435 ? -28.281 13.226  44.698  1.00 13.23  ? 436 PHE A C   1 
ATOM   3544 O  O   . PHE A 1 435 ? -27.436 13.411  43.828  1.00 12.49  ? 436 PHE A O   1 
ATOM   3545 C  CB  . PHE A 1 435 ? -27.801 11.710  46.630  1.00 13.40  ? 436 PHE A CB  1 
ATOM   3546 C  CG  . PHE A 1 435 ? -26.991 10.824  45.724  1.00 14.26  ? 436 PHE A CG  1 
ATOM   3547 C  CD1 . PHE A 1 435 ? -25.626 10.670  45.921  1.00 13.62  ? 436 PHE A CD1 1 
ATOM   3548 C  CD2 . PHE A 1 435 ? -27.603 10.114  44.693  1.00 13.69  ? 436 PHE A CD2 1 
ATOM   3549 C  CE1 . PHE A 1 435 ? -24.881 9.834   45.096  1.00 15.02  ? 436 PHE A CE1 1 
ATOM   3550 C  CE2 . PHE A 1 435 ? -26.864 9.280   43.872  1.00 14.77  ? 436 PHE A CE2 1 
ATOM   3551 C  CZ  . PHE A 1 435 ? -25.497 9.140   44.075  1.00 14.28  ? 436 PHE A CZ  1 
ATOM   3552 N  N   . LEU A 1 436 ? -29.569 13.043  44.438  1.00 13.67  ? 437 LEU A N   1 
ATOM   3553 C  CA  . LEU A 1 436 ? -30.076 12.974  43.075  1.00 14.09  ? 437 LEU A CA  1 
ATOM   3554 C  C   . LEU A 1 436 ? -30.098 14.351  42.400  1.00 14.30  ? 437 LEU A C   1 
ATOM   3555 O  O   . LEU A 1 436 ? -29.820 14.451  41.205  1.00 14.00  ? 437 LEU A O   1 
ATOM   3556 C  CB  . LEU A 1 436 ? -31.449 12.278  43.036  1.00 13.95  ? 437 LEU A CB  1 
ATOM   3557 C  CG  . LEU A 1 436 ? -31.404 10.771  43.387  1.00 13.61  ? 437 LEU A CG  1 
ATOM   3558 C  CD1 . LEU A 1 436 ? -32.800 10.211  43.599  1.00 12.48  ? 437 LEU A CD1 1 
ATOM   3559 C  CD2 . LEU A 1 436 ? -30.642 9.927   42.339  1.00 12.24  ? 437 LEU A CD2 1 
ATOM   3560 N  N   . ILE A 1 437 ? -30.410 15.395  43.171  1.00 14.70  ? 438 ILE A N   1 
ATOM   3561 C  CA  . ILE A 1 437 ? -30.281 16.776  42.688  1.00 15.15  ? 438 ILE A CA  1 
ATOM   3562 C  C   . ILE A 1 437 ? -28.851 17.027  42.191  1.00 15.54  ? 438 ILE A C   1 
ATOM   3563 O  O   . ILE A 1 437 ? -28.660 17.493  41.070  1.00 15.98  ? 438 ILE A O   1 
ATOM   3564 C  CB  . ILE A 1 437 ? -30.649 17.829  43.780  1.00 14.89  ? 438 ILE A CB  1 
ATOM   3565 C  CG1 . ILE A 1 437 ? -32.162 17.903  43.968  1.00 14.77  ? 438 ILE A CG1 1 
ATOM   3566 C  CG2 . ILE A 1 437 ? -30.102 19.232  43.405  1.00 15.26  ? 438 ILE A CG2 1 
ATOM   3567 C  CD1 . ILE A 1 437 ? -32.619 18.719  45.171  1.00 14.20  ? 438 ILE A CD1 1 
ATOM   3568 N  N   . ASN A 1 438 ? -27.856 16.703  43.017  1.00 15.85  ? 439 ASN A N   1 
ATOM   3569 C  CA  . ASN A 1 438 ? -26.453 16.905  42.648  1.00 16.07  ? 439 ASN A CA  1 
ATOM   3570 C  C   . ASN A 1 438 ? -26.024 16.077  41.433  1.00 16.04  ? 439 ASN A C   1 
ATOM   3571 O  O   . ASN A 1 438 ? -25.347 16.598  40.539  1.00 15.92  ? 439 ASN A O   1 
ATOM   3572 C  CB  . ASN A 1 438 ? -25.542 16.645  43.846  1.00 16.38  ? 439 ASN A CB  1 
ATOM   3573 C  CG  . ASN A 1 438 ? -25.512 17.823  44.816  1.00 18.11  ? 439 ASN A CG  1 
ATOM   3574 O  OD1 . ASN A 1 438 ? -24.861 18.834  44.553  1.00 20.89  ? 439 ASN A OD1 1 
ATOM   3575 N  ND2 . ASN A 1 438 ? -26.224 17.699  45.935  1.00 16.19  ? 439 ASN A ND2 1 
ATOM   3576 N  N   . MET A 1 439 ? -26.441 14.808  41.395  1.00 15.90  ? 440 MET A N   1 
ATOM   3577 C  CA  . MET A 1 439 ? -26.149 13.914  40.263  1.00 16.23  ? 440 MET A CA  1 
ATOM   3578 C  C   . MET A 1 439 ? -26.815 14.375  38.966  1.00 16.70  ? 440 MET A C   1 
ATOM   3579 O  O   . MET A 1 439 ? -26.173 14.408  37.916  1.00 17.00  ? 440 MET A O   1 
ATOM   3580 C  CB  . MET A 1 439 ? -26.570 12.473  40.570  1.00 16.01  ? 440 MET A CB  1 
ATOM   3581 C  CG  . MET A 1 439 ? -25.729 11.778  41.635  1.00 15.93  ? 440 MET A CG  1 
ATOM   3582 S  SD  . MET A 1 439 ? -24.022 11.514  41.133  1.00 16.00  ? 440 MET A SD  1 
ATOM   3583 C  CE  . MET A 1 439 ? -24.260 10.167  39.968  1.00 13.20  ? 440 MET A CE  1 
ATOM   3584 N  N   . LEU A 1 440 ? -28.098 14.726  39.042  1.00 17.34  ? 441 LEU A N   1 
ATOM   3585 C  CA  . LEU A 1 440 ? -28.850 15.157  37.863  1.00 17.90  ? 441 LEU A CA  1 
ATOM   3586 C  C   . LEU A 1 440 ? -28.281 16.440  37.258  1.00 18.39  ? 441 LEU A C   1 
ATOM   3587 O  O   . LEU A 1 440 ? -28.237 16.591  36.040  1.00 18.50  ? 441 LEU A O   1 
ATOM   3588 C  CB  . LEU A 1 440 ? -30.344 15.291  38.180  1.00 17.42  ? 441 LEU A CB  1 
ATOM   3589 C  CG  . LEU A 1 440 ? -31.079 13.938  38.177  1.00 18.35  ? 441 LEU A CG  1 
ATOM   3590 C  CD1 . LEU A 1 440 ? -32.474 13.997  38.819  1.00 17.98  ? 441 LEU A CD1 1 
ATOM   3591 C  CD2 . LEU A 1 440 ? -31.149 13.331  36.761  1.00 18.03  ? 441 LEU A CD2 1 
ATOM   3592 N  N   . GLU A 1 441 ? -27.813 17.341  38.116  1.00 19.21  ? 442 GLU A N   1 
ATOM   3593 C  CA  . GLU A 1 441 ? -27.184 18.588  37.673  1.00 19.90  ? 442 GLU A CA  1 
ATOM   3594 C  C   . GLU A 1 441 ? -25.836 18.389  36.992  1.00 19.57  ? 442 GLU A C   1 
ATOM   3595 O  O   . GLU A 1 441 ? -25.392 19.260  36.252  1.00 20.04  ? 442 GLU A O   1 
ATOM   3596 C  CB  . GLU A 1 441 ? -27.000 19.544  38.851  1.00 20.05  ? 442 GLU A CB  1 
ATOM   3597 C  CG  . GLU A 1 441 ? -28.256 20.292  39.222  1.00 22.17  ? 442 GLU A CG  1 
ATOM   3598 C  CD  . GLU A 1 441 ? -28.102 21.106  40.495  1.00 24.90  ? 442 GLU A CD  1 
ATOM   3599 O  OE1 . GLU A 1 441 ? -27.121 20.886  41.241  1.00 27.36  ? 442 GLU A OE1 1 
ATOM   3600 O  OE2 . GLU A 1 441 ? -28.970 21.965  40.751  1.00 26.46  ? 442 GLU A OE2 1 
ATOM   3601 N  N   . ASN A 1 442 ? -25.190 17.255  37.245  1.00 19.20  ? 443 ASN A N   1 
ATOM   3602 C  CA  . ASN A 1 442 ? -23.805 17.064  36.832  1.00 18.78  ? 443 ASN A CA  1 
ATOM   3603 C  C   . ASN A 1 442 ? -23.556 15.977  35.787  1.00 18.62  ? 443 ASN A C   1 
ATOM   3604 O  O   . ASN A 1 442 ? -22.565 16.040  35.054  1.00 18.18  ? 443 ASN A O   1 
ATOM   3605 C  CB  . ASN A 1 442 ? -22.937 16.798  38.058  1.00 18.64  ? 443 ASN A CB  1 
ATOM   3606 C  CG  . ASN A 1 442 ? -22.492 18.075  38.734  1.00 19.61  ? 443 ASN A CG  1 
ATOM   3607 O  OD1 . ASN A 1 442 ? -21.473 18.658  38.363  1.00 20.54  ? 443 ASN A OD1 1 
ATOM   3608 N  ND2 . ASN A 1 442 ? -23.241 18.507  39.744  1.00 18.98  ? 443 ASN A ND2 1 
ATOM   3609 N  N   . PHE A 1 443 ? -24.428 14.971  35.733  1.00 18.14  ? 444 PHE A N   1 
ATOM   3610 C  CA  . PHE A 1 443 ? -24.183 13.836  34.847  1.00 18.16  ? 444 PHE A CA  1 
ATOM   3611 C  C   . PHE A 1 443 ? -25.416 13.327  34.125  1.00 18.39  ? 444 PHE A C   1 
ATOM   3612 O  O   . PHE A 1 443 ? -26.533 13.418  34.630  1.00 17.66  ? 444 PHE A O   1 
ATOM   3613 C  CB  . PHE A 1 443 ? -23.535 12.662  35.597  1.00 17.68  ? 444 PHE A CB  1 
ATOM   3614 C  CG  . PHE A 1 443 ? -22.358 13.049  36.448  1.00 17.53  ? 444 PHE A CG  1 
ATOM   3615 C  CD1 . PHE A 1 443 ? -22.493 13.139  37.832  1.00 16.56  ? 444 PHE A CD1 1 
ATOM   3616 C  CD2 . PHE A 1 443 ? -21.117 13.318  35.874  1.00 16.89  ? 444 PHE A CD2 1 
ATOM   3617 C  CE1 . PHE A 1 443 ? -21.413 13.502  38.633  1.00 16.61  ? 444 PHE A CE1 1 
ATOM   3618 C  CE2 . PHE A 1 443 ? -20.023 13.678  36.671  1.00 16.53  ? 444 PHE A CE2 1 
ATOM   3619 C  CZ  . PHE A 1 443 ? -20.177 13.764  38.056  1.00 16.20  ? 444 PHE A CZ  1 
ATOM   3620 N  N   . ARG A 1 444 ? -25.179 12.786  32.935  1.00 19.30  ? 445 ARG A N   1 
ATOM   3621 C  CA  . ARG A 1 444 ? -26.128 11.917  32.261  1.00 20.45  ? 445 ARG A CA  1 
ATOM   3622 C  C   . ARG A 1 444 ? -25.735 10.490  32.601  1.00 20.02  ? 445 ARG A C   1 
ATOM   3623 O  O   . ARG A 1 444 ? -24.552 10.142  32.531  1.00 20.04  ? 445 ARG A O   1 
ATOM   3624 C  CB  . ARG A 1 444 ? -26.072 12.122  30.739  1.00 20.82  ? 445 ARG A CB  1 
ATOM   3625 C  CG  . ARG A 1 444 ? -26.458 13.524  30.275  1.00 24.88  ? 445 ARG A CG  1 
ATOM   3626 C  CD  . ARG A 1 444 ? -26.598 13.602  28.739  1.00 30.77  ? 445 ARG A CD  1 
ATOM   3627 N  NE  . ARG A 1 444 ? -25.295 13.655  28.060  1.00 35.15  ? 445 ARG A NE  1 
ATOM   3628 C  CZ  . ARG A 1 444 ? -24.802 12.698  27.267  1.00 36.67  ? 445 ARG A CZ  1 
ATOM   3629 N  NH1 . ARG A 1 444 ? -25.499 11.589  27.024  1.00 36.84  ? 445 ARG A NH1 1 
ATOM   3630 N  NH2 . ARG A 1 444 ? -23.605 12.856  26.705  1.00 36.54  ? 445 ARG A NH2 1 
ATOM   3631 N  N   . VAL A 1 445 ? -26.719 9.668   32.969  1.00 20.13  ? 446 VAL A N   1 
ATOM   3632 C  CA  . VAL A 1 445 ? -26.466 8.284   33.376  1.00 19.90  ? 446 VAL A CA  1 
ATOM   3633 C  C   . VAL A 1 445 ? -27.009 7.283   32.366  1.00 20.39  ? 446 VAL A C   1 
ATOM   3634 O  O   . VAL A 1 445 ? -28.181 7.333   31.993  1.00 19.86  ? 446 VAL A O   1 
ATOM   3635 C  CB  . VAL A 1 445 ? -27.071 7.952   34.769  1.00 20.10  ? 446 VAL A CB  1 
ATOM   3636 C  CG1 . VAL A 1 445 ? -26.449 6.673   35.315  1.00 19.20  ? 446 VAL A CG1 1 
ATOM   3637 C  CG2 . VAL A 1 445 ? -26.866 9.108   35.756  1.00 20.89  ? 446 VAL A CG2 1 
ATOM   3638 N  N   . GLU A 1 446 ? -26.144 6.363   31.946  1.00 21.04  ? 447 GLU A N   1 
ATOM   3639 C  CA  . GLU A 1 446 ? -26.506 5.304   31.014  1.00 22.26  ? 447 GLU A CA  1 
ATOM   3640 C  C   . GLU A 1 446 ? -25.969 3.947   31.474  1.00 22.02  ? 447 GLU A C   1 
ATOM   3641 O  O   . GLU A 1 446 ? -25.099 3.880   32.349  1.00 21.81  ? 447 GLU A O   1 
ATOM   3642 C  CB  . GLU A 1 446 ? -25.955 5.627   29.623  1.00 22.74  ? 447 GLU A CB  1 
ATOM   3643 C  CG  . GLU A 1 446 ? -26.576 6.858   28.971  1.00 26.94  ? 447 GLU A CG  1 
ATOM   3644 C  CD  . GLU A 1 446 ? -26.158 7.040   27.511  1.00 32.14  ? 447 GLU A CD  1 
ATOM   3645 O  OE1 . GLU A 1 446 ? -25.881 6.026   26.829  1.00 34.55  ? 447 GLU A OE1 1 
ATOM   3646 O  OE2 . GLU A 1 446 ? -26.120 8.203   27.044  1.00 34.68  ? 447 GLU A OE2 1 
ATOM   3647 N  N   . ILE A 1 447 ? -26.492 2.873   30.888  1.00 22.36  ? 448 ILE A N   1 
ATOM   3648 C  CA  . ILE A 1 447 ? -25.910 1.534   31.053  1.00 23.07  ? 448 ILE A CA  1 
ATOM   3649 C  C   . ILE A 1 447 ? -25.636 0.899   29.685  1.00 24.30  ? 448 ILE A C   1 
ATOM   3650 O  O   . ILE A 1 447 ? -26.557 0.734   28.882  1.00 24.13  ? 448 ILE A O   1 
ATOM   3651 C  CB  . ILE A 1 447 ? -26.805 0.604   31.919  1.00 22.88  ? 448 ILE A CB  1 
ATOM   3652 C  CG1 . ILE A 1 447 ? -26.876 1.118   33.368  1.00 21.79  ? 448 ILE A CG1 1 
ATOM   3653 C  CG2 . ILE A 1 447 ? -26.296 -0.861  31.874  1.00 21.64  ? 448 ILE A CG2 1 
ATOM   3654 C  CD1 . ILE A 1 447 ? -28.106 0.637   34.133  1.00 20.75  ? 448 ILE A CD1 1 
ATOM   3655 N  N   . GLN A 1 448 ? -24.367 0.580   29.422  1.00 25.71  ? 449 GLN A N   1 
ATOM   3656 C  CA  . GLN A 1 448 ? -23.959 -0.115  28.194  1.00 27.61  ? 449 GLN A CA  1 
ATOM   3657 C  C   . GLN A 1 448 ? -24.419 -1.570  28.238  1.00 28.60  ? 449 GLN A C   1 
ATOM   3658 O  O   . GLN A 1 448 ? -24.324 -2.231  29.286  1.00 28.32  ? 449 GLN A O   1 
ATOM   3659 C  CB  . GLN A 1 448 ? -22.437 -0.094  28.021  1.00 27.85  ? 449 GLN A CB  1 
ATOM   3660 C  CG  . GLN A 1 448 ? -21.836 1.250   27.630  1.00 30.09  ? 449 GLN A CG  1 
ATOM   3661 C  CD  . GLN A 1 448 ? -20.312 1.205   27.517  1.00 34.02  ? 449 GLN A CD  1 
ATOM   3662 O  OE1 . GLN A 1 448 ? -19.740 0.325   26.860  1.00 34.80  ? 449 GLN A OE1 1 
ATOM   3663 N  NE2 . GLN A 1 448 ? -19.647 2.165   28.158  1.00 35.58  ? 449 GLN A NE2 1 
ATOM   3664 N  N   . HIS A 1 449 ? -24.901 -2.069  27.098  1.00 29.54  ? 450 HIS A N   1 
ATOM   3665 C  CA  . HIS A 1 449 ? -25.427 -3.436  27.010  1.00 30.76  ? 450 HIS A CA  1 
ATOM   3666 C  C   . HIS A 1 449 ? -26.427 -3.684  28.145  1.00 30.90  ? 450 HIS A C   1 
ATOM   3667 O  O   . HIS A 1 449 ? -26.348 -4.685  28.875  1.00 31.31  ? 450 HIS A O   1 
ATOM   3668 C  CB  . HIS A 1 449 ? -24.283 -4.463  27.002  1.00 31.13  ? 450 HIS A CB  1 
ATOM   3669 C  CG  . HIS A 1 449 ? -23.206 -4.146  26.006  1.00 33.69  ? 450 HIS A CG  1 
ATOM   3670 N  ND1 . HIS A 1 449 ? -23.308 -4.471  24.667  1.00 35.32  ? 450 HIS A ND1 1 
ATOM   3671 C  CD2 . HIS A 1 449 ? -22.019 -3.507  26.148  1.00 35.15  ? 450 HIS A CD2 1 
ATOM   3672 C  CE1 . HIS A 1 449 ? -22.225 -4.054  24.032  1.00 36.44  ? 450 HIS A CE1 1 
ATOM   3673 N  NE2 . HIS A 1 449 ? -21.427 -3.467  24.907  1.00 36.09  ? 450 HIS A NE2 1 
ATOM   3674 N  N   . LEU A 1 450 ? -27.345 -2.732  28.295  1.00 30.87  ? 451 LEU A N   1 
ATOM   3675 C  CA  . LEU A 1 450 ? -28.432 -2.810  29.260  1.00 30.96  ? 451 LEU A CA  1 
ATOM   3676 C  C   . LEU A 1 450 ? -29.188 -4.141  29.171  1.00 30.80  ? 451 LEU A C   1 
ATOM   3677 O  O   . LEU A 1 450 ? -29.538 -4.598  28.082  1.00 31.01  ? 451 LEU A O   1 
ATOM   3678 C  CB  . LEU A 1 450 ? -29.393 -1.638  29.045  1.00 30.92  ? 451 LEU A CB  1 
ATOM   3679 C  CG  . LEU A 1 450 ? -30.618 -1.495  29.957  1.00 31.67  ? 451 LEU A CG  1 
ATOM   3680 C  CD1 . LEU A 1 450 ? -30.211 -1.199  31.406  1.00 31.15  ? 451 LEU A CD1 1 
ATOM   3681 C  CD2 . LEU A 1 450 ? -31.558 -0.412  29.414  1.00 31.22  ? 451 LEU A CD2 1 
ATOM   3682 N  N   . SER A 1 451 ? -29.403 -4.759  30.330  1.00 30.56  ? 452 SER A N   1 
ATOM   3683 C  CA  . SER A 1 451 ? -30.227 -5.959  30.457  1.00 30.32  ? 452 SER A CA  1 
ATOM   3684 C  C   . SER A 1 451 ? -31.021 -5.854  31.752  1.00 29.63  ? 452 SER A C   1 
ATOM   3685 O  O   . SER A 1 451 ? -30.622 -5.129  32.664  1.00 29.96  ? 452 SER A O   1 
ATOM   3686 C  CB  . SER A 1 451 ? -29.357 -7.218  30.479  1.00 30.31  ? 452 SER A CB  1 
ATOM   3687 O  OG  . SER A 1 451 ? -28.584 -7.272  31.667  1.00 31.97  ? 452 SER A OG  1 
ATOM   3688 N  N   . ASP A 1 452 ? -32.135 -6.574  31.828  1.00 28.75  ? 453 ASP A N   1 
ATOM   3689 C  CA  . ASP A 1 452 ? -32.961 -6.604  33.031  1.00 27.87  ? 453 ASP A CA  1 
ATOM   3690 C  C   . ASP A 1 452 ? -32.193 -7.181  34.213  1.00 26.53  ? 453 ASP A C   1 
ATOM   3691 O  O   . ASP A 1 452 ? -31.677 -8.301  34.151  1.00 26.18  ? 453 ASP A O   1 
ATOM   3692 C  CB  . ASP A 1 452 ? -34.235 -7.415  32.792  1.00 28.38  ? 453 ASP A CB  1 
ATOM   3693 C  CG  . ASP A 1 452 ? -35.133 -6.801  31.735  1.00 30.28  ? 453 ASP A CG  1 
ATOM   3694 O  OD1 . ASP A 1 452 ? -34.996 -5.591  31.442  1.00 32.38  ? 453 ASP A OD1 1 
ATOM   3695 O  OD2 . ASP A 1 452 ? -35.989 -7.535  31.193  1.00 33.49  ? 453 ASP A OD2 1 
ATOM   3696 N  N   . VAL A 1 453 ? -32.107 -6.397  35.283  1.00 25.03  ? 454 VAL A N   1 
ATOM   3697 C  CA  . VAL A 1 453 ? -31.456 -6.843  36.507  1.00 23.29  ? 454 VAL A CA  1 
ATOM   3698 C  C   . VAL A 1 453 ? -32.521 -7.280  37.509  1.00 22.65  ? 454 VAL A C   1 
ATOM   3699 O  O   . VAL A 1 453 ? -33.392 -6.498  37.897  1.00 22.10  ? 454 VAL A O   1 
ATOM   3700 C  CB  . VAL A 1 453 ? -30.557 -5.736  37.099  1.00 23.76  ? 454 VAL A CB  1 
ATOM   3701 C  CG1 . VAL A 1 453 ? -29.937 -6.167  38.443  1.00 21.97  ? 454 VAL A CG1 1 
ATOM   3702 C  CG2 . VAL A 1 453 ? -29.480 -5.340  36.092  1.00 22.41  ? 454 VAL A CG2 1 
ATOM   3703 N  N   . GLY A 1 454 ? -32.454 -8.548  37.904  1.00 21.70  ? 455 GLY A N   1 
ATOM   3704 C  CA  . GLY A 1 454 ? -33.363 -9.081  38.900  1.00 20.40  ? 455 GLY A CA  1 
ATOM   3705 C  C   . GLY A 1 454 ? -32.889 -8.775  40.308  1.00 19.85  ? 455 GLY A C   1 
ATOM   3706 O  O   . GLY A 1 454 ? -31.890 -8.079  40.511  1.00 19.41  ? 455 GLY A O   1 
ATOM   3707 N  N   . THR A 1 455 ? -33.598 -9.348  41.274  1.00 19.14  ? 456 THR A N   1 
ATOM   3708 C  CA  . THR A 1 455 ? -33.420 -9.055  42.687  1.00 18.75  ? 456 THR A CA  1 
ATOM   3709 C  C   . THR A 1 455 ? -33.019 -10.322 43.461  1.00 18.28  ? 456 THR A C   1 
ATOM   3710 O  O   . THR A 1 455 ? -33.506 -11.409 43.154  1.00 18.30  ? 456 THR A O   1 
ATOM   3711 C  CB  . THR A 1 455 ? -34.743 -8.477  43.237  1.00 18.45  ? 456 THR A CB  1 
ATOM   3712 O  OG1 . THR A 1 455 ? -35.016 -7.244  42.562  1.00 19.13  ? 456 THR A OG1 1 
ATOM   3713 C  CG2 . THR A 1 455 ? -34.685 -8.244  44.737  1.00 17.96  ? 456 THR A CG2 1 
ATOM   3714 N  N   . THR A 1 456 ? -32.132 -10.172 44.447  1.00 17.76  ? 457 THR A N   1 
ATOM   3715 C  CA  . THR A 1 456 ? -31.782 -11.258 45.373  1.00 17.98  ? 457 THR A CA  1 
ATOM   3716 C  C   . THR A 1 456 ? -32.075 -10.842 46.806  1.00 17.04  ? 457 THR A C   1 
ATOM   3717 O  O   . THR A 1 456 ? -31.876 -9.689  47.184  1.00 17.28  ? 457 THR A O   1 
ATOM   3718 C  CB  . THR A 1 456 ? -30.291 -11.648 45.292  1.00 18.10  ? 457 THR A CB  1 
ATOM   3719 O  OG1 . THR A 1 456 ? -29.961 -11.937 43.942  1.00 22.58  ? 457 THR A OG1 1 
ATOM   3720 C  CG2 . THR A 1 456 ? -30.007 -12.892 46.100  1.00 17.84  ? 457 THR A CG2 1 
ATOM   3721 N  N   . PHE A 1 457 ? -32.535 -11.799 47.596  1.00 16.25  ? 458 PHE A N   1 
ATOM   3722 C  CA  . PHE A 1 457 ? -32.787 -11.593 49.010  1.00 16.04  ? 458 PHE A CA  1 
ATOM   3723 C  C   . PHE A 1 457 ? -31.537 -11.927 49.823  1.00 16.22  ? 458 PHE A C   1 
ATOM   3724 O  O   . PHE A 1 457 ? -31.162 -13.095 49.949  1.00 16.76  ? 458 PHE A O   1 
ATOM   3725 C  CB  . PHE A 1 457 ? -33.959 -12.468 49.451  1.00 15.38  ? 458 PHE A CB  1 
ATOM   3726 C  CG  . PHE A 1 457 ? -34.264 -12.391 50.914  1.00 14.81  ? 458 PHE A CG  1 
ATOM   3727 C  CD1 . PHE A 1 457 ? -34.949 -11.293 51.438  1.00 13.87  ? 458 PHE A CD1 1 
ATOM   3728 C  CD2 . PHE A 1 457 ? -33.897 -13.432 51.774  1.00 13.11  ? 458 PHE A CD2 1 
ATOM   3729 C  CE1 . PHE A 1 457 ? -35.255 -11.235 52.792  1.00 12.95  ? 458 PHE A CE1 1 
ATOM   3730 C  CE2 . PHE A 1 457 ? -34.198 -13.378 53.134  1.00 11.43  ? 458 PHE A CE2 1 
ATOM   3731 C  CZ  . PHE A 1 457 ? -34.870 -12.284 53.644  1.00 12.53  ? 458 PHE A CZ  1 
ATOM   3732 N  N   . ASN A 1 458 ? -30.890 -10.890 50.347  1.00 16.40  ? 459 ASN A N   1 
ATOM   3733 C  CA  . ASN A 1 458 ? -29.780 -11.038 51.295  1.00 16.58  ? 459 ASN A CA  1 
ATOM   3734 C  C   . ASN A 1 458 ? -30.149 -10.374 52.610  1.00 16.02  ? 459 ASN A C   1 
ATOM   3735 O  O   . ASN A 1 458 ? -29.429 -9.523  53.113  1.00 15.74  ? 459 ASN A O   1 
ATOM   3736 C  CB  . ASN A 1 458 ? -28.498 -10.434 50.715  1.00 17.19  ? 459 ASN A CB  1 
ATOM   3737 C  CG  . ASN A 1 458 ? -27.887 -11.311 49.652  1.00 19.36  ? 459 ASN A CG  1 
ATOM   3738 O  OD1 . ASN A 1 458 ? -27.750 -12.523 49.836  1.00 21.49  ? 459 ASN A OD1 1 
ATOM   3739 N  ND2 . ASN A 1 458 ? -27.543 -10.715 48.518  1.00 20.99  ? 459 ASN A ND2 1 
ATOM   3740 N  N   . LEU A 1 459 ? -31.287 -10.802 53.154  1.00 15.98  ? 460 LEU A N   1 
ATOM   3741 C  CA  . LEU A 1 459 ? -31.991 -10.149 54.263  1.00 16.29  ? 460 LEU A CA  1 
ATOM   3742 C  C   . LEU A 1 459 ? -32.644 -8.827  53.855  1.00 16.39  ? 460 LEU A C   1 
ATOM   3743 O  O   . LEU A 1 459 ? -33.859 -8.671  53.990  1.00 16.48  ? 460 LEU A O   1 
ATOM   3744 C  CB  . LEU A 1 459 ? -31.163 -10.035 55.564  1.00 16.31  ? 460 LEU A CB  1 
ATOM   3745 C  CG  . LEU A 1 459 ? -32.277 -10.040 56.621  1.00 17.58  ? 460 LEU A CG  1 
ATOM   3746 C  CD1 . LEU A 1 459 ? -32.239 -11.255 57.533  1.00 17.83  ? 460 LEU A CD1 1 
ATOM   3747 C  CD2 . LEU A 1 459 ? -32.456 -8.733  57.356  1.00 15.98  ? 460 LEU A CD2 1 
ATOM   3748 N  N   . ILE A 1 460 ? -31.840 -7.887  53.369  1.00 16.36  ? 461 ILE A N   1 
ATOM   3749 C  CA  . ILE A 1 460 ? -32.364 -6.779  52.591  1.00 17.12  ? 461 ILE A CA  1 
ATOM   3750 C  C   . ILE A 1 460 ? -32.391 -7.242  51.135  1.00 16.86  ? 461 ILE A C   1 
ATOM   3751 O  O   . ILE A 1 460 ? -31.608 -8.109  50.744  1.00 16.92  ? 461 ILE A O   1 
ATOM   3752 C  CB  . ILE A 1 460 ? -31.519 -5.469  52.726  1.00 17.29  ? 461 ILE A CB  1 
ATOM   3753 C  CG1 . ILE A 1 460 ? -30.104 -5.664  52.185  1.00 18.21  ? 461 ILE A CG1 1 
ATOM   3754 C  CG2 . ILE A 1 460 ? -31.488 -4.977  54.182  1.00 17.33  ? 461 ILE A CG2 1 
ATOM   3755 C  CD1 . ILE A 1 460 ? -29.327 -4.360  51.952  1.00 20.94  ? 461 ILE A CD1 1 
ATOM   3756 N  N   . LEU A 1 461 ? -33.300 -6.686  50.344  1.00 16.70  ? 462 LEU A N   1 
ATOM   3757 C  CA  . LEU A 1 461 ? -33.335 -6.981  48.915  1.00 16.86  ? 462 LEU A CA  1 
ATOM   3758 C  C   . LEU A 1 461 ? -32.278 -6.170  48.185  1.00 17.06  ? 462 LEU A C   1 
ATOM   3759 O  O   . LEU A 1 461 ? -31.999 -5.030  48.549  1.00 16.19  ? 462 LEU A O   1 
ATOM   3760 C  CB  . LEU A 1 461 ? -34.723 -6.711  48.327  1.00 16.25  ? 462 LEU A CB  1 
ATOM   3761 C  CG  . LEU A 1 461 ? -35.841 -7.667  48.769  1.00 16.49  ? 462 LEU A CG  1 
ATOM   3762 C  CD1 . LEU A 1 461 ? -37.198 -7.163  48.283  1.00 14.49  ? 462 LEU A CD1 1 
ATOM   3763 C  CD2 . LEU A 1 461 ? -35.584 -9.109  48.301  1.00 13.97  ? 462 LEU A CD2 1 
ATOM   3764 N  N   . MET A 1 462 ? -31.696 -6.773  47.154  1.00 18.16  ? 463 MET A N   1 
ATOM   3765 C  CA  . MET A 1 462 ? -30.558 -6.194  46.441  1.00 19.78  ? 463 MET A CA  1 
ATOM   3766 C  C   . MET A 1 462 ? -30.571 -6.649  44.992  1.00 19.79  ? 463 MET A C   1 
ATOM   3767 O  O   . MET A 1 462 ? -31.180 -7.675  44.680  1.00 19.37  ? 463 MET A O   1 
ATOM   3768 C  CB  . MET A 1 462 ? -29.252 -6.693  47.063  1.00 20.48  ? 463 MET A CB  1 
ATOM   3769 C  CG  . MET A 1 462 ? -28.997 -6.259  48.498  1.00 24.06  ? 463 MET A CG  1 
ATOM   3770 S  SD  . MET A 1 462 ? -27.412 -6.929  49.012  1.00 30.67  ? 463 MET A SD  1 
ATOM   3771 C  CE  . MET A 1 462 ? -26.338 -5.595  48.465  1.00 31.48  ? 463 MET A CE  1 
ATOM   3772 N  N   . PRO A 1 463 ? -29.868 -5.915  44.104  1.00 20.15  ? 464 PRO A N   1 
ATOM   3773 C  CA  . PRO A 1 463 ? -29.697 -6.389  42.731  1.00 20.60  ? 464 PRO A CA  1 
ATOM   3774 C  C   . PRO A 1 463 ? -29.038 -7.754  42.721  1.00 21.14  ? 464 PRO A C   1 
ATOM   3775 O  O   . PRO A 1 463 ? -28.124 -8.004  43.508  1.00 21.11  ? 464 PRO A O   1 
ATOM   3776 C  CB  . PRO A 1 463 ? -28.739 -5.364  42.114  1.00 20.43  ? 464 PRO A CB  1 
ATOM   3777 C  CG  . PRO A 1 463 ? -28.864 -4.170  42.968  1.00 20.94  ? 464 PRO A CG  1 
ATOM   3778 C  CD  . PRO A 1 463 ? -29.107 -4.679  44.348  1.00 20.17  ? 464 PRO A CD  1 
ATOM   3779 N  N   . GLU A 1 464 ? -29.508 -8.625  41.837  1.00 21.78  ? 465 GLU A N   1 
ATOM   3780 C  CA  . GLU A 1 464 ? -28.958 -9.972  41.689  1.00 22.63  ? 465 GLU A CA  1 
ATOM   3781 C  C   . GLU A 1 464 ? -27.527 -10.011 41.131  1.00 22.09  ? 465 GLU A C   1 
ATOM   3782 O  O   . GLU A 1 464 ? -26.809 -10.979 41.344  1.00 21.90  ? 465 GLU A O   1 
ATOM   3783 C  CB  . GLU A 1 464 ? -29.892 -10.808 40.808  1.00 23.30  ? 465 GLU A CB  1 
ATOM   3784 C  CG  . GLU A 1 464 ? -29.294 -12.105 40.306  1.00 27.44  ? 465 GLU A CG  1 
ATOM   3785 C  CD  . GLU A 1 464 ? -30.339 -13.086 39.841  1.00 32.49  ? 465 GLU A CD  1 
ATOM   3786 O  OE1 . GLU A 1 464 ? -31.244 -12.670 39.080  1.00 33.55  ? 465 GLU A OE1 1 
ATOM   3787 O  OE2 . GLU A 1 464 ? -30.249 -14.271 40.246  1.00 35.22  ? 465 GLU A OE2 1 
ATOM   3788 N  N   . LYS A 1 465 ? -27.124 -8.966  40.416  1.00 21.90  ? 466 LYS A N   1 
ATOM   3789 C  CA  . LYS A 1 465 ? -25.817 -8.935  39.764  1.00 21.85  ? 466 LYS A CA  1 
ATOM   3790 C  C   . LYS A 1 465 ? -25.320 -7.488  39.671  1.00 21.48  ? 466 LYS A C   1 
ATOM   3791 O  O   . LYS A 1 465 ? -26.110 -6.561  39.848  1.00 21.23  ? 466 LYS A O   1 
ATOM   3792 C  CB  . LYS A 1 465 ? -25.904 -9.590  38.378  1.00 22.15  ? 466 LYS A CB  1 
ATOM   3793 C  CG  . LYS A 1 465 ? -26.853 -8.886  37.401  1.00 23.15  ? 466 LYS A CG  1 
ATOM   3794 C  CD  . LYS A 1 465 ? -27.126 -9.753  36.170  1.00 25.25  ? 466 LYS A CD  1 
ATOM   3795 C  CE  . LYS A 1 465 ? -27.728 -8.921  35.037  1.00 27.33  ? 466 LYS A CE  1 
ATOM   3796 N  NZ  . LYS A 1 465 ? -27.581 -9.588  33.710  1.00 27.15  ? 466 LYS A NZ  1 
ATOM   3797 N  N   . PRO A 1 466 ? -24.014 -7.286  39.409  1.00 21.13  ? 467 PRO A N   1 
ATOM   3798 C  CA  . PRO A 1 466 ? -23.490 -5.923  39.393  1.00 20.92  ? 467 PRO A CA  1 
ATOM   3799 C  C   . PRO A 1 466 ? -24.091 -5.076  38.276  1.00 20.97  ? 467 PRO A C   1 
ATOM   3800 O  O   . PRO A 1 466 ? -24.507 -5.610  37.237  1.00 20.58  ? 467 PRO A O   1 
ATOM   3801 C  CB  . PRO A 1 466 ? -21.991 -6.128  39.164  1.00 20.99  ? 467 PRO A CB  1 
ATOM   3802 C  CG  . PRO A 1 466 ? -21.716 -7.492  39.729  1.00 21.13  ? 467 PRO A CG  1 
ATOM   3803 C  CD  . PRO A 1 466 ? -22.927 -8.280  39.297  1.00 21.43  ? 467 PRO A CD  1 
ATOM   3804 N  N   . ILE A 1 467 ? -24.167 -3.771  38.524  1.00 20.68  ? 468 ILE A N   1 
ATOM   3805 C  CA  . ILE A 1 467 ? -24.610 -2.814  37.529  1.00 20.99  ? 468 ILE A CA  1 
ATOM   3806 C  C   . ILE A 1 467 ? -23.451 -1.880  37.242  1.00 21.21  ? 468 ILE A C   1 
ATOM   3807 O  O   . ILE A 1 467 ? -22.957 -1.196  38.146  1.00 21.39  ? 468 ILE A O   1 
ATOM   3808 C  CB  . ILE A 1 467 ? -25.836 -1.990  38.005  1.00 21.07  ? 468 ILE A CB  1 
ATOM   3809 C  CG1 . ILE A 1 467 ? -26.993 -2.917  38.398  1.00 20.90  ? 468 ILE A CG1 1 
ATOM   3810 C  CG2 . ILE A 1 467 ? -26.279 -1.015  36.915  1.00 20.84  ? 468 ILE A CG2 1 
ATOM   3811 C  CD1 . ILE A 1 467 ? -28.130 -2.231  39.127  1.00 21.02  ? 468 ILE A CD1 1 
ATOM   3812 N  N   . SER A 1 468 ? -23.017 -1.859  35.985  1.00 20.92  ? 469 SER A N   1 
ATOM   3813 C  CA  . SER A 1 468 ? -21.940 -0.973  35.562  1.00 20.87  ? 469 SER A CA  1 
ATOM   3814 C  C   . SER A 1 468 ? -22.506 0.224   34.791  1.00 20.45  ? 469 SER A C   1 
ATOM   3815 O  O   . SER A 1 468 ? -23.029 0.073   33.676  1.00 20.60  ? 469 SER A O   1 
ATOM   3816 C  CB  . SER A 1 468 ? -20.917 -1.734  34.721  1.00 20.91  ? 469 SER A CB  1 
ATOM   3817 O  OG  . SER A 1 468 ? -19.842 -0.886  34.359  1.00 23.62  ? 469 SER A OG  1 
ATOM   3818 N  N   . PHE A 1 469 ? -22.402 1.405   35.398  1.00 19.29  ? 470 PHE A N   1 
ATOM   3819 C  CA  . PHE A 1 469 ? -22.936 2.631   34.826  1.00 18.43  ? 470 PHE A CA  1 
ATOM   3820 C  C   . PHE A 1 469 ? -21.912 3.345   33.964  1.00 18.55  ? 470 PHE A C   1 
ATOM   3821 O  O   . PHE A 1 469 ? -20.707 3.142   34.109  1.00 18.16  ? 470 PHE A O   1 
ATOM   3822 C  CB  . PHE A 1 469 ? -23.357 3.599   35.932  1.00 17.88  ? 470 PHE A CB  1 
ATOM   3823 C  CG  . PHE A 1 469 ? -24.538 3.149   36.723  1.00 17.17  ? 470 PHE A CG  1 
ATOM   3824 C  CD1 . PHE A 1 469 ? -24.369 2.584   37.983  1.00 16.42  ? 470 PHE A CD1 1 
ATOM   3825 C  CD2 . PHE A 1 469 ? -25.823 3.294   36.218  1.00 16.84  ? 470 PHE A CD2 1 
ATOM   3826 C  CE1 . PHE A 1 469 ? -25.460 2.169   38.723  1.00 16.77  ? 470 PHE A CE1 1 
ATOM   3827 C  CE2 . PHE A 1 469 ? -26.923 2.882   36.948  1.00 16.96  ? 470 PHE A CE2 1 
ATOM   3828 C  CZ  . PHE A 1 469 ? -26.741 2.317   38.208  1.00 17.23  ? 470 PHE A CZ  1 
ATOM   3829 N  N   . THR A 1 470 ? -22.407 4.206   33.080  1.00 18.82  ? 471 THR A N   1 
ATOM   3830 C  CA  . THR A 1 470 ? -21.559 5.129   32.341  1.00 18.75  ? 471 THR A CA  1 
ATOM   3831 C  C   . THR A 1 470 ? -22.064 6.528   32.654  1.00 19.10  ? 471 THR A C   1 
ATOM   3832 O  O   . THR A 1 470 ? -23.263 6.808   32.525  1.00 19.12  ? 471 THR A O   1 
ATOM   3833 C  CB  . THR A 1 470 ? -21.569 4.843   30.813  1.00 19.02  ? 471 THR A CB  1 
ATOM   3834 O  OG1 . THR A 1 470 ? -21.029 3.540   30.566  1.00 18.14  ? 471 THR A OG1 1 
ATOM   3835 C  CG2 . THR A 1 470 ? -20.729 5.885   30.047  1.00 18.25  ? 471 THR A CG2 1 
ATOM   3836 N  N   . PHE A 1 471 ? -21.154 7.392   33.093  1.00 19.52  ? 472 PHE A N   1 
ATOM   3837 C  CA  . PHE A 1 471 ? -21.503 8.767   33.432  1.00 20.25  ? 472 PHE A CA  1 
ATOM   3838 C  C   . PHE A 1 471 ? -20.888 9.737   32.428  1.00 21.34  ? 472 PHE A C   1 
ATOM   3839 O  O   . PHE A 1 471 ? -19.683 9.686   32.169  1.00 20.86  ? 472 PHE A O   1 
ATOM   3840 C  CB  . PHE A 1 471 ? -21.034 9.105   34.847  1.00 20.12  ? 472 PHE A CB  1 
ATOM   3841 C  CG  . PHE A 1 471 ? -21.663 8.252   35.915  1.00 20.20  ? 472 PHE A CG  1 
ATOM   3842 C  CD1 . PHE A 1 471 ? -21.017 7.112   36.385  1.00 19.12  ? 472 PHE A CD1 1 
ATOM   3843 C  CD2 . PHE A 1 471 ? -22.910 8.584   36.444  1.00 19.13  ? 472 PHE A CD2 1 
ATOM   3844 C  CE1 . PHE A 1 471 ? -21.608 6.317   37.375  1.00 20.00  ? 472 PHE A CE1 1 
ATOM   3845 C  CE2 . PHE A 1 471 ? -23.503 7.801   37.423  1.00 19.24  ? 472 PHE A CE2 1 
ATOM   3846 C  CZ  . PHE A 1 471 ? -22.853 6.662   37.892  1.00 18.54  ? 472 PHE A CZ  1 
ATOM   3847 N  N   . TRP A 1 472 ? -21.723 10.610  31.864  1.00 22.72  ? 473 TRP A N   1 
ATOM   3848 C  CA  . TRP A 1 472 ? -21.251 11.686  30.985  1.00 24.51  ? 473 TRP A CA  1 
ATOM   3849 C  C   . TRP A 1 472 ? -21.445 13.036  31.682  1.00 25.40  ? 473 TRP A C   1 
ATOM   3850 O  O   . TRP A 1 472 ? -22.535 13.307  32.192  1.00 24.90  ? 473 TRP A O   1 
ATOM   3851 C  CB  . TRP A 1 472 ? -22.005 11.682  29.647  1.00 24.59  ? 473 TRP A CB  1 
ATOM   3852 C  CG  . TRP A 1 472 ? -22.010 10.353  28.925  1.00 25.71  ? 473 TRP A CG  1 
ATOM   3853 C  CD1 . TRP A 1 472 ? -22.773 9.257   29.224  1.00 26.43  ? 473 TRP A CD1 1 
ATOM   3854 C  CD2 . TRP A 1 472 ? -21.235 9.998   27.778  1.00 26.75  ? 473 TRP A CD2 1 
ATOM   3855 N  NE1 . TRP A 1 472 ? -22.513 8.243   28.338  1.00 27.21  ? 473 TRP A NE1 1 
ATOM   3856 C  CE2 . TRP A 1 472 ? -21.573 8.671   27.439  1.00 27.52  ? 473 TRP A CE2 1 
ATOM   3857 C  CE3 . TRP A 1 472 ? -20.283 10.674  27.001  1.00 27.85  ? 473 TRP A CE3 1 
ATOM   3858 C  CZ2 . TRP A 1 472 ? -20.991 8.000   26.359  1.00 28.83  ? 473 TRP A CZ2 1 
ATOM   3859 C  CZ3 . TRP A 1 472 ? -19.707 10.008  25.918  1.00 29.02  ? 473 TRP A CZ3 1 
ATOM   3860 C  CH2 . TRP A 1 472 ? -20.060 8.685   25.612  1.00 29.56  ? 473 TRP A CH2 1 
ATOM   3861 N  N   . PRO A 1 473 ? -20.393 13.879  31.714  1.00 26.70  ? 474 PRO A N   1 
ATOM   3862 C  CA  . PRO A 1 473 ? -20.540 15.222  32.281  1.00 28.35  ? 474 PRO A CA  1 
ATOM   3863 C  C   . PRO A 1 473 ? -21.612 15.988  31.507  1.00 30.01  ? 474 PRO A C   1 
ATOM   3864 O  O   . PRO A 1 473 ? -21.589 16.003  30.276  1.00 29.96  ? 474 PRO A O   1 
ATOM   3865 C  CB  . PRO A 1 473 ? -19.168 15.870  32.067  1.00 28.30  ? 474 PRO A CB  1 
ATOM   3866 C  CG  . PRO A 1 473 ? -18.271 14.824  31.556  1.00 27.44  ? 474 PRO A CG  1 
ATOM   3867 C  CD  . PRO A 1 473 ? -19.091 13.689  31.052  1.00 26.88  ? 474 PRO A CD  1 
ATOM   3868 N  N   . PHE A 1 474 ? -22.567 16.569  32.229  1.00 32.24  ? 475 PHE A N   1 
ATOM   3869 C  CA  . PHE A 1 474 ? -23.693 17.285  31.616  1.00 34.41  ? 475 PHE A CA  1 
ATOM   3870 C  C   . PHE A 1 474 ? -23.369 18.770  31.513  1.00 35.74  ? 475 PHE A C   1 
ATOM   3871 O  O   . PHE A 1 474 ? -22.848 19.372  32.459  1.00 36.06  ? 475 PHE A O   1 
ATOM   3872 C  CB  . PHE A 1 474 ? -24.991 17.051  32.413  1.00 34.37  ? 475 PHE A CB  1 
ATOM   3873 C  CG  . PHE A 1 474 ? -26.150 17.910  31.966  1.00 35.46  ? 475 PHE A CG  1 
ATOM   3874 C  CD1 . PHE A 1 474 ? -26.864 17.601  30.806  1.00 36.45  ? 475 PHE A CD1 1 
ATOM   3875 C  CD2 . PHE A 1 474 ? -26.530 19.031  32.709  1.00 35.68  ? 475 PHE A CD2 1 
ATOM   3876 C  CE1 . PHE A 1 474 ? -27.943 18.405  30.392  1.00 36.55  ? 475 PHE A CE1 1 
ATOM   3877 C  CE2 . PHE A 1 474 ? -27.596 19.836  32.307  1.00 35.20  ? 475 PHE A CE2 1 
ATOM   3878 C  CZ  . PHE A 1 474 ? -28.304 19.525  31.146  1.00 36.09  ? 475 PHE A CZ  1 
ATOM   3879 N  N   . ASN A 1 475 ? -23.685 19.353  30.358  1.00 37.41  ? 476 ASN A N   1 
ATOM   3880 C  CA  . ASN A 1 475 ? -23.345 20.753  30.065  1.00 38.74  ? 476 ASN A CA  1 
ATOM   3881 C  C   . ASN A 1 475 ? -24.565 21.676  30.035  1.00 38.78  ? 476 ASN A C   1 
ATOM   3882 O  O   . ASN A 1 475 ? -25.341 21.666  29.075  1.00 38.99  ? 476 ASN A O   1 
ATOM   3883 C  CB  . ASN A 1 475 ? -22.571 20.839  28.743  1.00 39.18  ? 476 ASN A CB  1 
ATOM   3884 C  CG  . ASN A 1 475 ? -21.485 19.771  28.632  1.00 41.52  ? 476 ASN A CG  1 
ATOM   3885 O  OD1 . ASN A 1 475 ? -20.612 19.654  29.501  1.00 43.96  ? 476 ASN A OD1 1 
ATOM   3886 N  ND2 . ASN A 1 475 ? -21.541 18.982  27.563  1.00 43.16  ? 476 ASN A ND2 1 
ATOM   3887 N  N   . PRO B 1 5   ? 21.191  14.908  -13.447 1.00 37.79  ? 6   PRO B N   1 
ATOM   3888 C  CA  . PRO B 1 5   ? 20.630  14.863  -12.094 1.00 37.37  ? 6   PRO B CA  1 
ATOM   3889 C  C   . PRO B 1 5   ? 20.603  16.258  -11.480 1.00 36.87  ? 6   PRO B C   1 
ATOM   3890 O  O   . PRO B 1 5   ? 21.635  16.923  -11.414 1.00 36.90  ? 6   PRO B O   1 
ATOM   3891 C  CB  . PRO B 1 5   ? 21.608  13.962  -11.323 1.00 37.48  ? 6   PRO B CB  1 
ATOM   3892 C  CG  . PRO B 1 5   ? 22.618  13.458  -12.351 1.00 37.84  ? 6   PRO B CG  1 
ATOM   3893 C  CD  . PRO B 1 5   ? 22.586  14.438  -13.479 1.00 38.16  ? 6   PRO B CD  1 
ATOM   3894 N  N   . ARG B 1 6   ? 19.424  16.694  -11.047 1.00 36.29  ? 7   ARG B N   1 
ATOM   3895 C  CA  . ARG B 1 6   ? 19.252  18.015  -10.446 1.00 35.68  ? 7   ARG B CA  1 
ATOM   3896 C  C   . ARG B 1 6   ? 19.962  18.133  -9.085  1.00 35.17  ? 7   ARG B C   1 
ATOM   3897 O  O   . ARG B 1 6   ? 20.131  17.129  -8.382  1.00 34.95  ? 7   ARG B O   1 
ATOM   3898 C  CB  . ARG B 1 6   ? 17.765  18.335  -10.314 1.00 35.87  ? 7   ARG B CB  1 
ATOM   3899 C  CG  . ARG B 1 6   ? 17.022  18.396  -11.639 1.00 36.55  ? 7   ARG B CG  1 
ATOM   3900 C  CD  . ARG B 1 6   ? 15.515  18.456  -11.418 1.00 38.43  ? 7   ARG B CD  1 
ATOM   3901 N  NE  . ARG B 1 6   ? 14.963  17.153  -11.041 1.00 39.63  ? 7   ARG B NE  1 
ATOM   3902 C  CZ  . ARG B 1 6   ? 13.662  16.877  -10.951 1.00 40.37  ? 7   ARG B CZ  1 
ATOM   3903 N  NH1 . ARG B 1 6   ? 12.755  17.814  -11.207 1.00 40.53  ? 7   ARG B NH1 1 
ATOM   3904 N  NH2 . ARG B 1 6   ? 13.264  15.658  -10.605 1.00 40.37  ? 7   ARG B NH2 1 
ATOM   3905 N  N   . PRO B 1 7   ? 20.399  19.357  -8.716  1.00 34.58  ? 8   PRO B N   1 
ATOM   3906 C  CA  . PRO B 1 7   ? 21.101  19.531  -7.439  1.00 34.02  ? 8   PRO B CA  1 
ATOM   3907 C  C   . PRO B 1 7   ? 20.165  19.456  -6.232  1.00 33.20  ? 8   PRO B C   1 
ATOM   3908 O  O   . PRO B 1 7   ? 18.956  19.649  -6.372  1.00 33.24  ? 8   PRO B O   1 
ATOM   3909 C  CB  . PRO B 1 7   ? 21.705  20.939  -7.552  1.00 34.02  ? 8   PRO B CB  1 
ATOM   3910 C  CG  . PRO B 1 7   ? 20.813  21.658  -8.503  1.00 34.53  ? 8   PRO B CG  1 
ATOM   3911 C  CD  . PRO B 1 7   ? 20.301  20.623  -9.472  1.00 34.61  ? 8   PRO B CD  1 
ATOM   3912 N  N   . PHE B 1 8   ? 20.749  19.178  -5.068  1.00 32.37  ? 9   PHE B N   1 
ATOM   3913 C  CA  . PHE B 1 8   ? 20.047  19.051  -3.787  1.00 31.40  ? 9   PHE B CA  1 
ATOM   3914 C  C   . PHE B 1 8   ? 19.059  20.186  -3.520  1.00 30.92  ? 9   PHE B C   1 
ATOM   3915 O  O   . PHE B 1 8   ? 17.920  19.942  -3.116  1.00 30.52  ? 9   PHE B O   1 
ATOM   3916 C  CB  . PHE B 1 8   ? 21.079  18.970  -2.652  1.00 31.41  ? 9   PHE B CB  1 
ATOM   3917 C  CG  . PHE B 1 8   ? 20.479  18.823  -1.286  1.00 31.36  ? 9   PHE B CG  1 
ATOM   3918 C  CD1 . PHE B 1 8   ? 20.016  17.586  -0.847  1.00 30.84  ? 9   PHE B CD1 1 
ATOM   3919 C  CD2 . PHE B 1 8   ? 20.386  19.920  -0.432  1.00 32.13  ? 9   PHE B CD2 1 
ATOM   3920 C  CE1 . PHE B 1 8   ? 19.465  17.441  0.413   1.00 31.30  ? 9   PHE B CE1 1 
ATOM   3921 C  CE2 . PHE B 1 8   ? 19.833  19.787  0.840   1.00 32.64  ? 9   PHE B CE2 1 
ATOM   3922 C  CZ  . PHE B 1 8   ? 19.367  18.540  1.261   1.00 32.19  ? 9   PHE B CZ  1 
ATOM   3923 N  N   . ASN B 1 9   ? 19.495  21.422  -3.758  1.00 30.50  ? 10  ASN B N   1 
ATOM   3924 C  CA  . ASN B 1 9   ? 18.674  22.603  -3.473  1.00 29.87  ? 10  ASN B CA  1 
ATOM   3925 C  C   . ASN B 1 9   ? 17.408  22.734  -4.325  1.00 28.98  ? 10  ASN B C   1 
ATOM   3926 O  O   . ASN B 1 9   ? 16.563  23.582  -4.041  1.00 29.05  ? 10  ASN B O   1 
ATOM   3927 C  CB  . ASN B 1 9   ? 19.511  23.891  -3.525  1.00 30.11  ? 10  ASN B CB  1 
ATOM   3928 C  CG  . ASN B 1 9   ? 20.209  24.090  -4.860  1.00 31.39  ? 10  ASN B CG  1 
ATOM   3929 O  OD1 . ASN B 1 9   ? 21.427  23.958  -4.954  1.00 33.84  ? 10  ASN B OD1 1 
ATOM   3930 N  ND2 . ASN B 1 9   ? 19.443  24.417  -5.894  1.00 32.16  ? 10  ASN B ND2 1 
ATOM   3931 N  N   . GLU B 1 10  ? 17.269  21.892  -5.347  1.00 28.04  ? 11  GLU B N   1 
ATOM   3932 C  CA  . GLU B 1 10  ? 16.054  21.903  -6.169  1.00 27.62  ? 11  GLU B CA  1 
ATOM   3933 C  C   . GLU B 1 10  ? 14.933  21.005  -5.636  1.00 26.65  ? 11  GLU B C   1 
ATOM   3934 O  O   . GLU B 1 10  ? 13.780  21.132  -6.054  1.00 26.39  ? 11  GLU B O   1 
ATOM   3935 C  CB  . GLU B 1 10  ? 16.361  21.619  -7.641  1.00 27.83  ? 11  GLU B CB  1 
ATOM   3936 C  CG  . GLU B 1 10  ? 16.726  22.891  -8.407  1.00 29.72  ? 11  GLU B CG  1 
ATOM   3937 C  CD  . GLU B 1 10  ? 17.261  22.635  -9.803  1.00 31.83  ? 11  GLU B CD  1 
ATOM   3938 O  OE1 . GLU B 1 10  ? 16.714  21.764  -10.513 1.00 33.70  ? 11  GLU B OE1 1 
ATOM   3939 O  OE2 . GLU B 1 10  ? 18.230  23.322  -10.194 1.00 33.41  ? 11  GLU B OE2 1 
ATOM   3940 N  N   . ILE B 1 11  ? 15.278  20.121  -4.701  1.00 25.48  ? 12  ILE B N   1 
ATOM   3941 C  CA  . ILE B 1 11  ? 14.287  19.317  -4.006  1.00 24.58  ? 12  ILE B CA  1 
ATOM   3942 C  C   . ILE B 1 11  ? 13.295  20.280  -3.357  1.00 24.16  ? 12  ILE B C   1 
ATOM   3943 O  O   . ILE B 1 11  ? 13.703  21.170  -2.610  1.00 24.20  ? 12  ILE B O   1 
ATOM   3944 C  CB  . ILE B 1 11  ? 14.942  18.377  -2.953  1.00 24.14  ? 12  ILE B CB  1 
ATOM   3945 C  CG1 . ILE B 1 11  ? 15.796  17.316  -3.646  1.00 24.12  ? 12  ILE B CG1 1 
ATOM   3946 C  CG2 . ILE B 1 11  ? 13.890  17.711  -2.092  1.00 23.56  ? 12  ILE B CG2 1 
ATOM   3947 C  CD1 . ILE B 1 11  ? 16.691  16.511  -2.723  1.00 23.74  ? 12  ILE B CD1 1 
ATOM   3948 N  N   . PRO B 1 12  ? 11.997  20.132  -3.673  1.00 23.81  ? 13  PRO B N   1 
ATOM   3949 C  CA  . PRO B 1 12  ? 10.969  20.984  -3.078  1.00 23.66  ? 13  PRO B CA  1 
ATOM   3950 C  C   . PRO B 1 12  ? 11.119  21.080  -1.559  1.00 23.64  ? 13  PRO B C   1 
ATOM   3951 O  O   . PRO B 1 12  ? 11.478  20.102  -0.902  1.00 23.07  ? 13  PRO B O   1 
ATOM   3952 C  CB  . PRO B 1 12  ? 9.665   20.272  -3.445  1.00 23.14  ? 13  PRO B CB  1 
ATOM   3953 C  CG  . PRO B 1 12  ? 9.972   19.578  -4.706  1.00 23.69  ? 13  PRO B CG  1 
ATOM   3954 C  CD  . PRO B 1 12  ? 11.426  19.185  -4.651  1.00 23.90  ? 13  PRO B CD  1 
ATOM   3955 N  N   . SER B 1 13  ? 10.838  22.262  -1.024  1.00 23.98  ? 14  SER B N   1 
ATOM   3956 C  CA  . SER B 1 13  ? 11.084  22.565  0.373   1.00 24.47  ? 14  SER B CA  1 
ATOM   3957 C  C   . SER B 1 13  ? 10.227  23.759  0.806   1.00 24.54  ? 14  SER B C   1 
ATOM   3958 O  O   . SER B 1 13  ? 9.996   24.662  0.007   1.00 24.49  ? 14  SER B O   1 
ATOM   3959 C  CB  . SER B 1 13  ? 12.568  22.903  0.544   1.00 24.25  ? 14  SER B CB  1 
ATOM   3960 O  OG  . SER B 1 13  ? 12.841  23.384  1.847   1.00 26.33  ? 14  SER B OG  1 
ATOM   3961 N  N   . PRO B 1 14  ? 9.759   23.774  2.073   1.00 24.72  ? 15  PRO B N   1 
ATOM   3962 C  CA  . PRO B 1 14  ? 9.122   24.996  2.603   1.00 24.40  ? 15  PRO B CA  1 
ATOM   3963 C  C   . PRO B 1 14  ? 10.076  26.185  2.729   1.00 24.22  ? 15  PRO B C   1 
ATOM   3964 O  O   . PRO B 1 14  ? 9.617   27.294  2.964   1.00 24.58  ? 15  PRO B O   1 
ATOM   3965 C  CB  . PRO B 1 14  ? 8.652   24.574  4.005   1.00 24.35  ? 15  PRO B CB  1 
ATOM   3966 C  CG  . PRO B 1 14  ? 9.508   23.385  4.355   1.00 24.35  ? 15  PRO B CG  1 
ATOM   3967 C  CD  . PRO B 1 14  ? 9.710   22.667  3.051   1.00 24.47  ? 15  PRO B CD  1 
ATOM   3968 N  N   . GLY B 1 15  ? 11.383  25.959  2.582   1.00 23.84  ? 16  GLY B N   1 
ATOM   3969 C  CA  . GLY B 1 15  ? 12.375  27.029  2.747   1.00 23.39  ? 16  GLY B CA  1 
ATOM   3970 C  C   . GLY B 1 15  ? 13.593  26.616  3.561   1.00 23.12  ? 16  GLY B C   1 
ATOM   3971 O  O   . GLY B 1 15  ? 13.615  25.531  4.141   1.00 22.99  ? 16  GLY B O   1 
ATOM   3972 N  N   . ASP B 1 16  ? 14.602  27.486  3.609   1.00 22.97  ? 17  ASP B N   1 
ATOM   3973 C  CA  . ASP B 1 16  ? 15.890  27.149  4.216   1.00 23.26  ? 17  ASP B CA  1 
ATOM   3974 C  C   . ASP B 1 16  ? 16.063  27.542  5.686   1.00 22.73  ? 17  ASP B C   1 
ATOM   3975 O  O   . ASP B 1 16  ? 17.075  27.205  6.297   1.00 22.86  ? 17  ASP B O   1 
ATOM   3976 C  CB  . ASP B 1 16  ? 17.051  27.703  3.381   1.00 24.07  ? 17  ASP B CB  1 
ATOM   3977 C  CG  . ASP B 1 16  ? 17.298  26.893  2.110   1.00 26.33  ? 17  ASP B CG  1 
ATOM   3978 O  OD1 . ASP B 1 16  ? 17.729  25.720  2.201   1.00 29.75  ? 17  ASP B OD1 1 
ATOM   3979 O  OD2 . ASP B 1 16  ? 17.066  27.434  1.015   1.00 29.02  ? 17  ASP B OD2 1 
ATOM   3980 N  N   . ASN B 1 17  ? 15.082  28.230  6.257   1.00 22.17  ? 18  ASN B N   1 
ATOM   3981 C  CA  . ASN B 1 17  ? 15.174  28.654  7.654   1.00 21.71  ? 18  ASN B CA  1 
ATOM   3982 C  C   . ASN B 1 17  ? 14.561  27.612  8.582   1.00 20.90  ? 18  ASN B C   1 
ATOM   3983 O  O   . ASN B 1 17  ? 13.340  27.531  8.714   1.00 20.57  ? 18  ASN B O   1 
ATOM   3984 C  CB  . ASN B 1 17  ? 14.538  30.041  7.854   1.00 21.63  ? 18  ASN B CB  1 
ATOM   3985 C  CG  . ASN B 1 17  ? 14.826  30.628  9.238   1.00 23.10  ? 18  ASN B CG  1 
ATOM   3986 O  OD1 . ASN B 1 17  ? 14.805  29.922  10.258  1.00 23.78  ? 18  ASN B OD1 1 
ATOM   3987 N  ND2 . ASN B 1 17  ? 15.084  31.931  9.276   1.00 22.99  ? 18  ASN B ND2 1 
ATOM   3988 N  N   . GLY B 1 18  ? 15.419  26.812  9.217   1.00 20.53  ? 19  GLY B N   1 
ATOM   3989 C  CA  . GLY B 1 18  ? 14.969  25.759  10.137  1.00 19.69  ? 19  GLY B CA  1 
ATOM   3990 C  C   . GLY B 1 18  ? 14.044  26.234  11.248  1.00 19.50  ? 19  GLY B C   1 
ATOM   3991 O  O   . GLY B 1 18  ? 13.122  25.515  11.646  1.00 19.54  ? 19  GLY B O   1 
ATOM   3992 N  N   . TRP B 1 19  ? 14.281  27.451  11.741  1.00 19.00  ? 20  TRP B N   1 
ATOM   3993 C  CA  . TRP B 1 19  ? 13.525  27.996  12.875  1.00 18.75  ? 20  TRP B CA  1 
ATOM   3994 C  C   . TRP B 1 19  ? 12.179  28.531  12.450  1.00 18.67  ? 20  TRP B C   1 
ATOM   3995 O  O   . TRP B 1 19  ? 11.195  28.403  13.187  1.00 18.71  ? 20  TRP B O   1 
ATOM   3996 C  CB  . TRP B 1 19  ? 14.334  29.078  13.614  1.00 18.65  ? 20  TRP B CB  1 
ATOM   3997 C  CG  . TRP B 1 19  ? 15.690  28.595  13.959  1.00 19.71  ? 20  TRP B CG  1 
ATOM   3998 C  CD1 . TRP B 1 19  ? 16.874  28.960  13.368  1.00 19.82  ? 20  TRP B CD1 1 
ATOM   3999 C  CD2 . TRP B 1 19  ? 16.019  27.610  14.945  1.00 20.09  ? 20  TRP B CD2 1 
ATOM   4000 N  NE1 . TRP B 1 19  ? 17.915  28.272  13.940  1.00 20.78  ? 20  TRP B NE1 1 
ATOM   4001 C  CE2 . TRP B 1 19  ? 17.418  27.436  14.909  1.00 21.17  ? 20  TRP B CE2 1 
ATOM   4002 C  CE3 . TRP B 1 19  ? 15.267  26.867  15.864  1.00 21.64  ? 20  TRP B CE3 1 
ATOM   4003 C  CZ2 . TRP B 1 19  ? 18.084  26.543  15.759  1.00 22.67  ? 20  TRP B CZ2 1 
ATOM   4004 C  CZ3 . TRP B 1 19  ? 15.931  25.973  16.708  1.00 21.47  ? 20  TRP B CZ3 1 
ATOM   4005 C  CH2 . TRP B 1 19  ? 17.320  25.821  16.645  1.00 21.60  ? 20  TRP B CH2 1 
ATOM   4006 N  N   . LEU B 1 20  ? 12.133  29.141  11.267  1.00 18.53  ? 21  LEU B N   1 
ATOM   4007 C  CA  . LEU B 1 20  ? 10.863  29.574  10.684  1.00 18.58  ? 21  LEU B CA  1 
ATOM   4008 C  C   . LEU B 1 20  ? 9.995   28.366  10.327  1.00 18.15  ? 21  LEU B C   1 
ATOM   4009 O  O   . LEU B 1 20  ? 8.780   28.369  10.572  1.00 17.94  ? 21  LEU B O   1 
ATOM   4010 C  CB  . LEU B 1 20  ? 11.097  30.460  9.450   1.00 18.69  ? 21  LEU B CB  1 
ATOM   4011 C  CG  . LEU B 1 20  ? 9.870   31.092  8.780   1.00 20.49  ? 21  LEU B CG  1 
ATOM   4012 C  CD1 . LEU B 1 20  ? 9.027   31.954  9.754   1.00 20.96  ? 21  LEU B CD1 1 
ATOM   4013 C  CD2 . LEU B 1 20  ? 10.307  31.924  7.575   1.00 22.68  ? 21  LEU B CD2 1 
ATOM   4014 N  N   . ASN B 1 21  ? 10.618  27.333  9.758   1.00 17.79  ? 22  ASN B N   1 
ATOM   4015 C  CA  . ASN B 1 21  ? 9.895   26.094  9.431   1.00 18.00  ? 22  ASN B CA  1 
ATOM   4016 C  C   . ASN B 1 21  ? 9.311   25.433  10.681  1.00 17.93  ? 22  ASN B C   1 
ATOM   4017 O  O   . ASN B 1 21  ? 8.179   24.927  10.669  1.00 17.70  ? 22  ASN B O   1 
ATOM   4018 C  CB  . ASN B 1 21  ? 10.793  25.111  8.673   1.00 17.89  ? 22  ASN B CB  1 
ATOM   4019 C  CG  . ASN B 1 21  ? 11.244  25.645  7.325   1.00 18.66  ? 22  ASN B CG  1 
ATOM   4020 O  OD1 . ASN B 1 21  ? 10.595  26.508  6.730   1.00 20.45  ? 22  ASN B OD1 1 
ATOM   4021 N  ND2 . ASN B 1 21  ? 12.369  25.133  6.838   1.00 17.84  ? 22  ASN B ND2 1 
ATOM   4022 N  N   . LEU B 1 22  ? 10.073  25.482  11.770  1.00 17.91  ? 23  LEU B N   1 
ATOM   4023 C  CA  . LEU B 1 22  ? 9.636   24.909  13.043  1.00 18.21  ? 23  LEU B CA  1 
ATOM   4024 C  C   . LEU B 1 22  ? 8.448   25.697  13.591  1.00 18.40  ? 23  LEU B C   1 
ATOM   4025 O  O   . LEU B 1 22  ? 7.469   25.127  14.073  1.00 18.00  ? 23  LEU B O   1 
ATOM   4026 C  CB  . LEU B 1 22  ? 10.796  24.888  14.042  1.00 17.76  ? 23  LEU B CB  1 
ATOM   4027 C  CG  . LEU B 1 22  ? 10.645  24.024  15.300  1.00 19.12  ? 23  LEU B CG  1 
ATOM   4028 C  CD1 . LEU B 1 22  ? 10.237  22.580  14.967  1.00 17.76  ? 23  LEU B CD1 1 
ATOM   4029 C  CD2 . LEU B 1 22  ? 11.942  24.048  16.115  1.00 17.60  ? 23  LEU B CD2 1 
ATOM   4030 N  N   . TYR B 1 23  ? 8.540   27.016  13.494  1.00 19.22  ? 24  TYR B N   1 
ATOM   4031 C  CA  . TYR B 1 23  ? 7.459   27.890  13.912  1.00 20.11  ? 24  TYR B CA  1 
ATOM   4032 C  C   . TYR B 1 23  ? 6.151   27.592  13.155  1.00 20.15  ? 24  TYR B C   1 
ATOM   4033 O  O   . TYR B 1 23  ? 5.100   27.449  13.777  1.00 20.34  ? 24  TYR B O   1 
ATOM   4034 C  CB  . TYR B 1 23  ? 7.887   29.357  13.781  1.00 20.32  ? 24  TYR B CB  1 
ATOM   4035 C  CG  . TYR B 1 23  ? 6.755   30.346  13.891  1.00 22.64  ? 24  TYR B CG  1 
ATOM   4036 C  CD1 . TYR B 1 23  ? 6.286   30.769  15.134  1.00 25.56  ? 24  TYR B CD1 1 
ATOM   4037 C  CD2 . TYR B 1 23  ? 6.155   30.863  12.748  1.00 25.33  ? 24  TYR B CD2 1 
ATOM   4038 C  CE1 . TYR B 1 23  ? 5.235   31.689  15.233  1.00 27.45  ? 24  TYR B CE1 1 
ATOM   4039 C  CE2 . TYR B 1 23  ? 5.111   31.770  12.829  1.00 28.50  ? 24  TYR B CE2 1 
ATOM   4040 C  CZ  . TYR B 1 23  ? 4.659   32.185  14.074  1.00 29.26  ? 24  TYR B CZ  1 
ATOM   4041 O  OH  . TYR B 1 23  ? 3.624   33.089  14.140  1.00 31.94  ? 24  TYR B OH  1 
ATOM   4042 N  N   . HIS B 1 24  ? 6.214   27.483  11.828  1.00 20.48  ? 25  HIS B N   1 
ATOM   4043 C  CA  . HIS B 1 24  ? 5.012   27.166  11.039  1.00 21.09  ? 25  HIS B CA  1 
ATOM   4044 C  C   . HIS B 1 24  ? 4.462   25.768  11.354  1.00 21.08  ? 25  HIS B C   1 
ATOM   4045 O  O   . HIS B 1 24  ? 3.249   25.591  11.448  1.00 21.05  ? 25  HIS B O   1 
ATOM   4046 C  CB  . HIS B 1 24  ? 5.265   27.326  9.532   1.00 21.11  ? 25  HIS B CB  1 
ATOM   4047 C  CG  . HIS B 1 24  ? 5.448   28.748  9.104   1.00 22.27  ? 25  HIS B CG  1 
ATOM   4048 N  ND1 . HIS B 1 24  ? 4.528   29.735  9.387   1.00 23.50  ? 25  HIS B ND1 1 
ATOM   4049 C  CD2 . HIS B 1 24  ? 6.440   29.348  8.405   1.00 22.97  ? 25  HIS B CD2 1 
ATOM   4050 C  CE1 . HIS B 1 24  ? 4.952   30.884  8.891   1.00 23.67  ? 25  HIS B CE1 1 
ATOM   4051 N  NE2 . HIS B 1 24  ? 6.109   30.675  8.289   1.00 23.06  ? 25  HIS B NE2 1 
ATOM   4052 N  N   . PHE B 1 25  ? 5.358   24.793  11.518  1.00 20.91  ? 26  PHE B N   1 
ATOM   4053 C  CA  . PHE B 1 25  ? 4.977   23.435  11.934  1.00 21.31  ? 26  PHE B CA  1 
ATOM   4054 C  C   . PHE B 1 25  ? 4.235   23.448  13.278  1.00 21.89  ? 26  PHE B C   1 
ATOM   4055 O  O   . PHE B 1 25  ? 3.147   22.873  13.388  1.00 21.61  ? 26  PHE B O   1 
ATOM   4056 C  CB  . PHE B 1 25  ? 6.206   22.504  11.964  1.00 20.95  ? 26  PHE B CB  1 
ATOM   4057 C  CG  . PHE B 1 25  ? 5.974   21.187  12.665  1.00 21.26  ? 26  PHE B CG  1 
ATOM   4058 C  CD1 . PHE B 1 25  ? 4.930   20.344  12.286  1.00 21.46  ? 26  PHE B CD1 1 
ATOM   4059 C  CD2 . PHE B 1 25  ? 6.819   20.782  13.697  1.00 21.86  ? 26  PHE B CD2 1 
ATOM   4060 C  CE1 . PHE B 1 25  ? 4.709   19.138  12.936  1.00 20.78  ? 26  PHE B CE1 1 
ATOM   4061 C  CE2 . PHE B 1 25  ? 6.618   19.568  14.353  1.00 21.99  ? 26  PHE B CE2 1 
ATOM   4062 C  CZ  . PHE B 1 25  ? 5.560   18.743  13.971  1.00 22.34  ? 26  PHE B CZ  1 
ATOM   4063 N  N   . TRP B 1 26  ? 4.805   24.114  14.284  1.00 22.56  ? 27  TRP B N   1 
ATOM   4064 C  CA  . TRP B 1 26  ? 4.158   24.193  15.606  1.00 23.60  ? 27  TRP B CA  1 
ATOM   4065 C  C   . TRP B 1 26  ? 2.807   24.905  15.554  1.00 24.51  ? 27  TRP B C   1 
ATOM   4066 O  O   . TRP B 1 26  ? 1.829   24.420  16.119  1.00 24.55  ? 27  TRP B O   1 
ATOM   4067 C  CB  . TRP B 1 26  ? 5.058   24.854  16.659  1.00 22.96  ? 27  TRP B CB  1 
ATOM   4068 C  CG  . TRP B 1 26  ? 6.247   24.042  17.062  1.00 23.05  ? 27  TRP B CG  1 
ATOM   4069 C  CD1 . TRP B 1 26  ? 6.555   22.773  16.654  1.00 22.54  ? 27  TRP B CD1 1 
ATOM   4070 C  CD2 . TRP B 1 26  ? 7.280   24.430  17.976  1.00 22.25  ? 27  TRP B CD2 1 
ATOM   4071 N  NE1 . TRP B 1 26  ? 7.713   22.354  17.249  1.00 23.20  ? 27  TRP B NE1 1 
ATOM   4072 C  CE2 . TRP B 1 26  ? 8.183   23.349  18.067  1.00 22.78  ? 27  TRP B CE2 1 
ATOM   4073 C  CE3 . TRP B 1 26  ? 7.530   25.588  18.726  1.00 23.49  ? 27  TRP B CE3 1 
ATOM   4074 C  CZ2 . TRP B 1 26  ? 9.325   23.386  18.874  1.00 22.58  ? 27  TRP B CZ2 1 
ATOM   4075 C  CZ3 . TRP B 1 26  ? 8.666   25.630  19.533  1.00 23.69  ? 27  TRP B CZ3 1 
ATOM   4076 C  CH2 . TRP B 1 26  ? 9.552   24.532  19.596  1.00 23.75  ? 27  TRP B CH2 1 
ATOM   4077 N  N   . ARG B 1 27  ? 2.762   26.044  14.867  1.00 25.80  ? 28  ARG B N   1 
ATOM   4078 C  CA  . ARG B 1 27  ? 1.552   26.860  14.777  1.00 27.53  ? 28  ARG B CA  1 
ATOM   4079 C  C   . ARG B 1 27  ? 0.440   26.174  13.980  1.00 27.58  ? 28  ARG B C   1 
ATOM   4080 O  O   . ARG B 1 27  ? -0.714  26.193  14.396  1.00 27.79  ? 28  ARG B O   1 
ATOM   4081 C  CB  . ARG B 1 27  ? 1.876   28.238  14.164  1.00 28.00  ? 28  ARG B CB  1 
ATOM   4082 C  CG  . ARG B 1 27  ? 0.858   29.354  14.470  1.00 31.32  ? 28  ARG B CG  1 
ATOM   4083 C  CD  . ARG B 1 27  ? 1.034   30.554  13.514  1.00 36.52  ? 28  ARG B CD  1 
ATOM   4084 N  NE  . ARG B 1 27  ? 0.916   30.129  12.115  1.00 41.17  ? 28  ARG B NE  1 
ATOM   4085 C  CZ  . ARG B 1 27  ? 1.495   30.722  11.070  1.00 43.48  ? 28  ARG B CZ  1 
ATOM   4086 N  NH1 . ARG B 1 27  ? 2.258   31.800  11.228  1.00 45.35  ? 28  ARG B NH1 1 
ATOM   4087 N  NH2 . ARG B 1 27  ? 1.307   30.230  9.851   1.00 44.26  ? 28  ARG B NH2 1 
ATOM   4088 N  N   . GLU B 1 28  ? 0.795   25.569  12.847  1.00 27.95  ? 29  GLU B N   1 
ATOM   4089 C  CA  . GLU B 1 28  ? -0.189  25.028  11.902  1.00 28.68  ? 29  GLU B CA  1 
ATOM   4090 C  C   . GLU B 1 28  ? -0.661  23.616  12.216  1.00 28.49  ? 29  GLU B C   1 
ATOM   4091 O  O   . GLU B 1 28  ? -1.845  23.307  12.057  1.00 28.51  ? 29  GLU B O   1 
ATOM   4092 C  CB  . GLU B 1 28  ? 0.354   25.065  10.468  1.00 28.83  ? 29  GLU B CB  1 
ATOM   4093 C  CG  . GLU B 1 28  ? 0.173   26.419  9.785   1.00 31.98  ? 29  GLU B CG  1 
ATOM   4094 C  CD  . GLU B 1 28  ? 1.252   26.727  8.756   1.00 35.11  ? 29  GLU B CD  1 
ATOM   4095 O  OE1 . GLU B 1 28  ? 1.634   25.829  7.971   1.00 36.78  ? 29  GLU B OE1 1 
ATOM   4096 O  OE2 . GLU B 1 28  ? 1.719   27.887  8.731   1.00 37.52  ? 29  GLU B OE2 1 
ATOM   4097 N  N   . THR B 1 29  ? 0.263   22.760  12.645  1.00 28.01  ? 30  THR B N   1 
ATOM   4098 C  CA  . THR B 1 29  ? -0.030  21.335  12.786  1.00 27.69  ? 30  THR B CA  1 
ATOM   4099 C  C   . THR B 1 29  ? 0.093   20.875  14.238  1.00 26.99  ? 30  THR B C   1 
ATOM   4100 O  O   . THR B 1 29  ? -0.810  20.230  14.771  1.00 27.15  ? 30  THR B O   1 
ATOM   4101 C  CB  . THR B 1 29  ? 0.855   20.492  11.830  1.00 27.84  ? 30  THR B CB  1 
ATOM   4102 O  OG1 . THR B 1 29  ? 0.661   20.952  10.480  1.00 28.53  ? 30  THR B OG1 1 
ATOM   4103 C  CG2 . THR B 1 29  ? 0.492   19.016  11.901  1.00 28.04  ? 30  THR B CG2 1 
ATOM   4104 N  N   . GLY B 1 30  ? 1.203   21.229  14.877  1.00 26.21  ? 31  GLY B N   1 
ATOM   4105 C  CA  . GLY B 1 30  ? 1.414   20.899  16.270  1.00 25.03  ? 31  GLY B CA  1 
ATOM   4106 C  C   . GLY B 1 30  ? 2.393   19.755  16.440  1.00 24.59  ? 31  GLY B C   1 
ATOM   4107 O  O   . GLY B 1 30  ? 2.473   18.839  15.596  1.00 23.70  ? 31  GLY B O   1 
ATOM   4108 N  N   . THR B 1 31  ? 3.124   19.814  17.551  1.00 23.83  ? 32  THR B N   1 
ATOM   4109 C  CA  . THR B 1 31  ? 4.157   18.835  17.897  1.00 23.42  ? 32  THR B CA  1 
ATOM   4110 C  C   . THR B 1 31  ? 3.620   17.394  17.920  1.00 22.49  ? 32  THR B C   1 
ATOM   4111 O  O   . THR B 1 31  ? 4.344   16.460  17.607  1.00 22.59  ? 32  THR B O   1 
ATOM   4112 C  CB  . THR B 1 31  ? 4.812   19.182  19.266  1.00 23.65  ? 32  THR B CB  1 
ATOM   4113 O  OG1 . THR B 1 31  ? 3.860   18.996  20.318  1.00 23.99  ? 32  THR B OG1 1 
ATOM   4114 C  CG2 . THR B 1 31  ? 5.283   20.648  19.300  1.00 24.05  ? 32  THR B CG2 1 
ATOM   4115 N  N   . HIS B 1 32  ? 2.347   17.230  18.261  1.00 21.45  ? 33  HIS B N   1 
ATOM   4116 C  CA  . HIS B 1 32  ? 1.751   15.901  18.419  1.00 21.32  ? 33  HIS B CA  1 
ATOM   4117 C  C   . HIS B 1 32  ? 1.087   15.336  17.157  1.00 20.45  ? 33  HIS B C   1 
ATOM   4118 O  O   . HIS B 1 32  ? 0.462   14.278  17.195  1.00 20.16  ? 33  HIS B O   1 
ATOM   4119 C  CB  . HIS B 1 32  ? 0.769   15.895  19.597  1.00 21.52  ? 33  HIS B CB  1 
ATOM   4120 C  CG  . HIS B 1 32  ? 1.423   16.165  20.913  1.00 23.47  ? 33  HIS B CG  1 
ATOM   4121 N  ND1 . HIS B 1 32  ? 2.350   15.308  21.471  1.00 25.00  ? 33  HIS B ND1 1 
ATOM   4122 C  CD2 . HIS B 1 32  ? 1.295   17.199  21.778  1.00 25.08  ? 33  HIS B CD2 1 
ATOM   4123 C  CE1 . HIS B 1 32  ? 2.765   15.804  22.624  1.00 25.92  ? 33  HIS B CE1 1 
ATOM   4124 N  NE2 . HIS B 1 32  ? 2.141   16.951  22.834  1.00 27.12  ? 33  HIS B NE2 1 
ATOM   4125 N  N   . LYS B 1 33  ? 1.245   16.041  16.044  1.00 19.82  ? 34  LYS B N   1 
ATOM   4126 C  CA  . LYS B 1 33  ? 0.636   15.651  14.784  1.00 19.56  ? 34  LYS B CA  1 
ATOM   4127 C  C   . LYS B 1 33  ? 1.681   15.583  13.663  1.00 18.83  ? 34  LYS B C   1 
ATOM   4128 O  O   . LYS B 1 33  ? 1.398   15.887  12.500  1.00 18.40  ? 34  LYS B O   1 
ATOM   4129 C  CB  . LYS B 1 33  ? -0.551  16.580  14.444  1.00 19.77  ? 34  LYS B CB  1 
ATOM   4130 C  CG  . LYS B 1 33  ? -1.780  16.451  15.394  1.00 21.67  ? 34  LYS B CG  1 
ATOM   4131 C  CD  . LYS B 1 33  ? -2.405  15.027  15.353  1.00 26.04  ? 34  LYS B CD  1 
ATOM   4132 C  CE  . LYS B 1 33  ? -3.548  14.795  16.367  1.00 26.22  ? 34  LYS B CE  1 
ATOM   4133 N  NZ  . LYS B 1 33  ? -3.058  14.506  17.756  1.00 28.39  ? 34  LYS B NZ  1 
ATOM   4134 N  N   . VAL B 1 34  ? 2.893   15.173  14.032  1.00 17.96  ? 35  VAL B N   1 
ATOM   4135 C  CA  . VAL B 1 34  ? 3.995   14.984  13.086  1.00 17.62  ? 35  VAL B CA  1 
ATOM   4136 C  C   . VAL B 1 34  ? 3.579   14.132  11.875  1.00 16.73  ? 35  VAL B C   1 
ATOM   4137 O  O   . VAL B 1 34  ? 3.927   14.444  10.737  1.00 15.85  ? 35  VAL B O   1 
ATOM   4138 C  CB  . VAL B 1 34  ? 5.223   14.306  13.767  1.00 17.87  ? 35  VAL B CB  1 
ATOM   4139 C  CG1 . VAL B 1 34  ? 6.354   14.127  12.769  1.00 18.71  ? 35  VAL B CG1 1 
ATOM   4140 C  CG2 . VAL B 1 34  ? 5.707   15.137  14.927  1.00 19.28  ? 35  VAL B CG2 1 
ATOM   4141 N  N   . HIS B 1 35  ? 2.852   13.051  12.136  1.00 16.23  ? 36  HIS B N   1 
ATOM   4142 C  CA  . HIS B 1 35  ? 2.414   12.146  11.076  1.00 16.55  ? 36  HIS B CA  1 
ATOM   4143 C  C   . HIS B 1 35  ? 1.540   12.858  10.038  1.00 16.67  ? 36  HIS B C   1 
ATOM   4144 O  O   . HIS B 1 35  ? 1.704   12.644  8.844   1.00 16.13  ? 36  HIS B O   1 
ATOM   4145 C  CB  . HIS B 1 35  ? 1.704   10.919  11.664  1.00 16.30  ? 36  HIS B CB  1 
ATOM   4146 C  CG  . HIS B 1 35  ? 0.558   11.253  12.571  1.00 16.74  ? 36  HIS B CG  1 
ATOM   4147 N  ND1 . HIS B 1 35  ? 0.716   11.961  13.742  1.00 16.66  ? 36  HIS B ND1 1 
ATOM   4148 C  CD2 . HIS B 1 35  ? -0.762  10.973  12.477  1.00 16.86  ? 36  HIS B CD2 1 
ATOM   4149 C  CE1 . HIS B 1 35  ? -0.456  12.100  14.333  1.00 17.43  ? 36  HIS B CE1 1 
ATOM   4150 N  NE2 . HIS B 1 35  ? -1.371  11.514  13.583  1.00 17.51  ? 36  HIS B NE2 1 
ATOM   4151 N  N   . LEU B 1 36  ? 0.627   13.715  10.504  1.00 17.51  ? 37  LEU B N   1 
ATOM   4152 C  CA  . LEU B 1 36  ? -0.261  14.462  9.610   1.00 18.14  ? 37  LEU B CA  1 
ATOM   4153 C  C   . LEU B 1 36  ? 0.526   15.499  8.813   1.00 17.90  ? 37  LEU B C   1 
ATOM   4154 O  O   . LEU B 1 36  ? 0.215   15.786  7.660   1.00 18.01  ? 37  LEU B O   1 
ATOM   4155 C  CB  . LEU B 1 36  ? -1.410  15.111  10.381  1.00 18.02  ? 37  LEU B CB  1 
ATOM   4156 C  CG  . LEU B 1 36  ? -2.403  14.194  11.123  1.00 19.68  ? 37  LEU B CG  1 
ATOM   4157 C  CD1 . LEU B 1 36  ? -3.546  15.024  11.686  1.00 19.35  ? 37  LEU B CD1 1 
ATOM   4158 C  CD2 . LEU B 1 36  ? -2.979  13.023  10.266  1.00 19.39  ? 37  LEU B CD2 1 
ATOM   4159 N  N   . HIS B 1 37  ? 1.568   16.029  9.433   1.00 17.91  ? 38  HIS B N   1 
ATOM   4160 C  CA  . HIS B 1 37  ? 2.465   16.980  8.793   1.00 17.72  ? 38  HIS B CA  1 
ATOM   4161 C  C   . HIS B 1 37  ? 3.122   16.345  7.559   1.00 17.48  ? 38  HIS B C   1 
ATOM   4162 O  O   . HIS B 1 37  ? 3.166   16.961  6.491   1.00 17.37  ? 38  HIS B O   1 
ATOM   4163 C  CB  . HIS B 1 37  ? 3.504   17.441  9.820   1.00 17.64  ? 38  HIS B CB  1 
ATOM   4164 C  CG  . HIS B 1 37  ? 4.498   18.424  9.298   1.00 18.47  ? 38  HIS B CG  1 
ATOM   4165 N  ND1 . HIS B 1 37  ? 4.151   19.700  8.910   1.00 19.11  ? 38  HIS B ND1 1 
ATOM   4166 C  CD2 . HIS B 1 37  ? 5.843   18.342  9.166   1.00 19.34  ? 38  HIS B CD2 1 
ATOM   4167 C  CE1 . HIS B 1 37  ? 5.235   20.351  8.525   1.00 18.87  ? 38  HIS B CE1 1 
ATOM   4168 N  NE2 . HIS B 1 37  ? 6.277   19.552  8.678   1.00 18.94  ? 38  HIS B NE2 1 
ATOM   4169 N  N   . HIS B 1 38  ? 3.623   15.119  7.708   1.00 16.91  ? 39  HIS B N   1 
ATOM   4170 C  CA  . HIS B 1 38  ? 4.197   14.387  6.583   1.00 17.37  ? 39  HIS B CA  1 
ATOM   4171 C  C   . HIS B 1 38  ? 3.200   14.189  5.446   1.00 17.50  ? 39  HIS B C   1 
ATOM   4172 O  O   . HIS B 1 38  ? 3.524   14.452  4.295   1.00 17.56  ? 39  HIS B O   1 
ATOM   4173 C  CB  . HIS B 1 38  ? 4.755   13.040  7.020   1.00 17.16  ? 39  HIS B CB  1 
ATOM   4174 C  CG  . HIS B 1 38  ? 5.856   13.143  8.025   1.00 16.90  ? 39  HIS B CG  1 
ATOM   4175 N  ND1 . HIS B 1 38  ? 6.191   12.105  8.864   1.00 14.25  ? 39  HIS B ND1 1 
ATOM   4176 C  CD2 . HIS B 1 38  ? 6.694   14.165  8.331   1.00 16.77  ? 39  HIS B CD2 1 
ATOM   4177 C  CE1 . HIS B 1 38  ? 7.197   12.475  9.635   1.00 16.32  ? 39  HIS B CE1 1 
ATOM   4178 N  NE2 . HIS B 1 38  ? 7.518   13.723  9.336   1.00 16.90  ? 39  HIS B NE2 1 
ATOM   4179 N  N   . VAL B 1 39  ? 1.997   13.734  5.784   1.00 17.99  ? 40  VAL B N   1 
ATOM   4180 C  CA  . VAL B 1 39  ? 0.930   13.518  4.807   1.00 18.68  ? 40  VAL B CA  1 
ATOM   4181 C  C   . VAL B 1 39  ? 0.663   14.803  4.033   1.00 19.03  ? 40  VAL B C   1 
ATOM   4182 O  O   . VAL B 1 39  ? 0.671   14.799  2.803   1.00 19.21  ? 40  VAL B O   1 
ATOM   4183 C  CB  . VAL B 1 39  ? -0.372  13.033  5.472   1.00 18.69  ? 40  VAL B CB  1 
ATOM   4184 C  CG1 . VAL B 1 39  ? -1.520  12.989  4.454   1.00 18.93  ? 40  VAL B CG1 1 
ATOM   4185 C  CG2 . VAL B 1 39  ? -0.171  11.661  6.107   1.00 19.21  ? 40  VAL B CG2 1 
ATOM   4186 N  N   . GLN B 1 40  ? 0.467   15.899  4.765   1.00 19.25  ? 41  GLN B N   1 
ATOM   4187 C  CA  . GLN B 1 40  ? 0.211   17.207  4.167   1.00 19.88  ? 41  GLN B CA  1 
ATOM   4188 C  C   . GLN B 1 40  ? 1.362   17.681  3.285   1.00 19.33  ? 41  GLN B C   1 
ATOM   4189 O  O   . GLN B 1 40  ? 1.122   18.283  2.243   1.00 19.20  ? 41  GLN B O   1 
ATOM   4190 C  CB  . GLN B 1 40  ? -0.102  18.254  5.240   1.00 19.94  ? 41  GLN B CB  1 
ATOM   4191 C  CG  . GLN B 1 40  ? -1.419  18.009  5.972   1.00 23.10  ? 41  GLN B CG  1 
ATOM   4192 C  CD  . GLN B 1 40  ? -1.568  18.849  7.237   1.00 26.18  ? 41  GLN B CD  1 
ATOM   4193 O  OE1 . GLN B 1 40  ? -0.581  19.296  7.828   1.00 28.24  ? 41  GLN B OE1 1 
ATOM   4194 N  NE2 . GLN B 1 40  ? -2.807  19.073  7.650   1.00 27.76  ? 41  GLN B NE2 1 
ATOM   4195 N  N   . ASN B 1 41  ? 2.594   17.401  3.703   1.00 18.86  ? 42  ASN B N   1 
ATOM   4196 C  CA  . ASN B 1 41  ? 3.779   17.817  2.954   1.00 18.73  ? 42  ASN B CA  1 
ATOM   4197 C  C   . ASN B 1 41  ? 3.885   17.091  1.612   1.00 19.14  ? 42  ASN B C   1 
ATOM   4198 O  O   . ASN B 1 41  ? 4.232   17.705  0.604   1.00 19.07  ? 42  ASN B O   1 
ATOM   4199 C  CB  . ASN B 1 41  ? 5.058   17.609  3.767   1.00 18.32  ? 42  ASN B CB  1 
ATOM   4200 C  CG  . ASN B 1 41  ? 5.307   18.723  4.806   1.00 18.56  ? 42  ASN B CG  1 
ATOM   4201 O  OD1 . ASN B 1 41  ? 4.710   19.794  4.746   1.00 17.97  ? 42  ASN B OD1 1 
ATOM   4202 N  ND2 . ASN B 1 41  ? 6.204   18.456  5.757   1.00 16.00  ? 42  ASN B ND2 1 
ATOM   4203 N  N   . PHE B 1 42  ? 3.570   15.795  1.593   1.00 18.89  ? 43  PHE B N   1 
ATOM   4204 C  CA  . PHE B 1 42  ? 3.560   15.054  0.329   1.00 19.16  ? 43  PHE B CA  1 
ATOM   4205 C  C   . PHE B 1 42  ? 2.460   15.524  -0.636  1.00 19.81  ? 43  PHE B C   1 
ATOM   4206 O  O   . PHE B 1 42  ? 2.687   15.579  -1.844  1.00 19.89  ? 43  PHE B O   1 
ATOM   4207 C  CB  . PHE B 1 42  ? 3.495   13.545  0.555   1.00 18.46  ? 43  PHE B CB  1 
ATOM   4208 C  CG  . PHE B 1 42  ? 4.751   12.973  1.152   1.00 16.81  ? 43  PHE B CG  1 
ATOM   4209 C  CD1 . PHE B 1 42  ? 4.740   12.407  2.428   1.00 13.70  ? 43  PHE B CD1 1 
ATOM   4210 C  CD2 . PHE B 1 42  ? 5.947   13.011  0.441   1.00 14.61  ? 43  PHE B CD2 1 
ATOM   4211 C  CE1 . PHE B 1 42  ? 5.906   11.887  2.975   1.00 13.86  ? 43  PHE B CE1 1 
ATOM   4212 C  CE2 . PHE B 1 42  ? 7.114   12.499  0.975   1.00 13.82  ? 43  PHE B CE2 1 
ATOM   4213 C  CZ  . PHE B 1 42  ? 7.100   11.931  2.244   1.00 13.95  ? 43  PHE B CZ  1 
ATOM   4214 N  N   . GLN B 1 43  ? 1.287   15.867  -0.107  1.00 20.71  ? 44  GLN B N   1 
ATOM   4215 C  CA  . GLN B 1 43  ? 0.223   16.463  -0.922  1.00 21.97  ? 44  GLN B CA  1 
ATOM   4216 C  C   . GLN B 1 43  ? 0.723   17.770  -1.549  1.00 22.16  ? 44  GLN B C   1 
ATOM   4217 O  O   . GLN B 1 43  ? 0.450   18.058  -2.718  1.00 22.20  ? 44  GLN B O   1 
ATOM   4218 C  CB  . GLN B 1 43  ? -1.043  16.699  -0.089  1.00 21.97  ? 44  GLN B CB  1 
ATOM   4219 C  CG  . GLN B 1 43  ? -1.652  15.407  0.480   1.00 25.71  ? 44  GLN B CG  1 
ATOM   4220 C  CD  . GLN B 1 43  ? -2.764  15.636  1.520   1.00 30.38  ? 44  GLN B CD  1 
ATOM   4221 O  OE1 . GLN B 1 43  ? -2.821  16.679  2.194   1.00 32.23  ? 44  GLN B OE1 1 
ATOM   4222 N  NE2 . GLN B 1 43  ? -3.650  14.646  1.657   1.00 31.00  ? 44  GLN B NE2 1 
ATOM   4223 N  N   . LYS B 1 44  ? 1.510   18.513  -0.770  1.00 22.11  ? 45  LYS B N   1 
ATOM   4224 C  CA  . LYS B 1 44  ? 2.007   19.826  -1.139  1.00 22.48  ? 45  LYS B CA  1 
ATOM   4225 C  C   . LYS B 1 44  ? 3.164   19.777  -2.140  1.00 21.86  ? 45  LYS B C   1 
ATOM   4226 O  O   . LYS B 1 44  ? 3.165   20.524  -3.114  1.00 21.99  ? 45  LYS B O   1 
ATOM   4227 C  CB  . LYS B 1 44  ? 2.460   20.557  0.130   1.00 22.96  ? 45  LYS B CB  1 
ATOM   4228 C  CG  . LYS B 1 44  ? 2.157   22.038  0.172   1.00 25.93  ? 45  LYS B CG  1 
ATOM   4229 C  CD  . LYS B 1 44  ? 2.599   22.651  1.505   1.00 29.53  ? 45  LYS B CD  1 
ATOM   4230 C  CE  . LYS B 1 44  ? 1.584   22.372  2.611   1.00 31.86  ? 45  LYS B CE  1 
ATOM   4231 N  NZ  . LYS B 1 44  ? 1.938   23.096  3.879   1.00 33.65  ? 45  LYS B NZ  1 
ATOM   4232 N  N   . TYR B 1 45  ? 4.144   18.905  -1.901  1.00 21.04  ? 46  TYR B N   1 
ATOM   4233 C  CA  . TYR B 1 45  ? 5.398   18.948  -2.648  1.00 20.84  ? 46  TYR B CA  1 
ATOM   4234 C  C   . TYR B 1 45  ? 5.589   17.833  -3.693  1.00 20.25  ? 46  TYR B C   1 
ATOM   4235 O  O   . TYR B 1 45  ? 6.479   17.916  -4.560  1.00 19.52  ? 46  TYR B O   1 
ATOM   4236 C  CB  . TYR B 1 45  ? 6.593   18.990  -1.680  1.00 21.08  ? 46  TYR B CB  1 
ATOM   4237 C  CG  . TYR B 1 45  ? 6.562   20.152  -0.698  1.00 22.35  ? 46  TYR B CG  1 
ATOM   4238 C  CD1 . TYR B 1 45  ? 6.515   19.923  0.676   1.00 23.20  ? 46  TYR B CD1 1 
ATOM   4239 C  CD2 . TYR B 1 45  ? 6.580   21.480  -1.145  1.00 23.36  ? 46  TYR B CD2 1 
ATOM   4240 C  CE1 . TYR B 1 45  ? 6.487   20.974  1.583   1.00 24.34  ? 46  TYR B CE1 1 
ATOM   4241 C  CE2 . TYR B 1 45  ? 6.552   22.547  -0.239  1.00 24.36  ? 46  TYR B CE2 1 
ATOM   4242 C  CZ  . TYR B 1 45  ? 6.506   22.281  1.124   1.00 25.36  ? 46  TYR B CZ  1 
ATOM   4243 O  OH  . TYR B 1 45  ? 6.470   23.320  2.031   1.00 27.93  ? 46  TYR B OH  1 
ATOM   4244 N  N   . GLY B 1 46  ? 4.753   16.802  -3.615  1.00 19.50  ? 47  GLY B N   1 
ATOM   4245 C  CA  . GLY B 1 46  ? 4.978   15.587  -4.393  1.00 18.86  ? 47  GLY B CA  1 
ATOM   4246 C  C   . GLY B 1 46  ? 5.732   14.540  -3.588  1.00 18.79  ? 47  GLY B C   1 
ATOM   4247 O  O   . GLY B 1 46  ? 5.850   14.662  -2.361  1.00 18.68  ? 47  GLY B O   1 
ATOM   4248 N  N   . PRO B 1 47  ? 6.253   13.500  -4.271  1.00 18.55  ? 48  PRO B N   1 
ATOM   4249 C  CA  . PRO B 1 47  ? 6.760   12.276  -3.623  1.00 18.21  ? 48  PRO B CA  1 
ATOM   4250 C  C   . PRO B 1 47  ? 8.119   12.403  -2.911  1.00 18.44  ? 48  PRO B C   1 
ATOM   4251 O  O   . PRO B 1 47  ? 8.560   11.461  -2.236  1.00 18.18  ? 48  PRO B O   1 
ATOM   4252 C  CB  . PRO B 1 47  ? 6.848   11.282  -4.784  1.00 18.15  ? 48  PRO B CB  1 
ATOM   4253 C  CG  . PRO B 1 47  ? 7.085   12.157  -6.003  1.00 18.34  ? 48  PRO B CG  1 
ATOM   4254 C  CD  . PRO B 1 47  ? 6.301   13.411  -5.745  1.00 18.49  ? 48  PRO B CD  1 
ATOM   4255 N  N   . ILE B 1 48  ? 8.777   13.545  -3.061  1.00 18.36  ? 49  ILE B N   1 
ATOM   4256 C  CA  . ILE B 1 48  ? 10.026  13.801  -2.354  1.00 18.51  ? 49  ILE B CA  1 
ATOM   4257 C  C   . ILE B 1 48  ? 10.122  15.273  -1.969  1.00 18.60  ? 49  ILE B C   1 
ATOM   4258 O  O   . ILE B 1 48  ? 9.821   16.157  -2.773  1.00 18.99  ? 49  ILE B O   1 
ATOM   4259 C  CB  . ILE B 1 48  ? 11.277  13.346  -3.179  1.00 18.64  ? 49  ILE B CB  1 
ATOM   4260 C  CG1 . ILE B 1 48  ? 12.566  13.531  -2.365  1.00 18.26  ? 49  ILE B CG1 1 
ATOM   4261 C  CG2 . ILE B 1 48  ? 11.337  14.063  -4.548  1.00 18.38  ? 49  ILE B CG2 1 
ATOM   4262 C  CD1 . ILE B 1 48  ? 13.815  12.849  -2.975  1.00 17.94  ? 49  ILE B CD1 1 
ATOM   4263 N  N   . TYR B 1 49  ? 10.511  15.534  -0.727  1.00 18.67  ? 50  TYR B N   1 
ATOM   4264 C  CA  . TYR B 1 49  ? 10.791  16.895  -0.301  1.00 18.54  ? 50  TYR B CA  1 
ATOM   4265 C  C   . TYR B 1 49  ? 11.901  16.907  0.731   1.00 18.93  ? 50  TYR B C   1 
ATOM   4266 O  O   . TYR B 1 49  ? 12.306  15.851  1.225   1.00 18.67  ? 50  TYR B O   1 
ATOM   4267 C  CB  . TYR B 1 49  ? 9.529   17.591  0.222   1.00 18.57  ? 50  TYR B CB  1 
ATOM   4268 C  CG  . TYR B 1 49  ? 9.005   17.052  1.531   1.00 18.89  ? 50  TYR B CG  1 
ATOM   4269 C  CD1 . TYR B 1 49  ? 9.389   17.632  2.749   1.00 18.58  ? 50  TYR B CD1 1 
ATOM   4270 C  CD2 . TYR B 1 49  ? 8.122   15.964  1.561   1.00 18.42  ? 50  TYR B CD2 1 
ATOM   4271 C  CE1 . TYR B 1 49  ? 8.906   17.148  3.962   1.00 17.91  ? 50  TYR B CE1 1 
ATOM   4272 C  CE2 . TYR B 1 49  ? 7.643   15.462  2.777   1.00 18.41  ? 50  TYR B CE2 1 
ATOM   4273 C  CZ  . TYR B 1 49  ? 8.038   16.066  3.968   1.00 19.27  ? 50  TYR B CZ  1 
ATOM   4274 O  OH  . TYR B 1 49  ? 7.568   15.590  5.168   1.00 20.71  ? 50  TYR B OH  1 
ATOM   4275 N  N   . ARG B 1 50  ? 12.420  18.100  1.018   1.00 19.43  ? 51  ARG B N   1 
ATOM   4276 C  CA  . ARG B 1 50  ? 13.383  18.292  2.096   1.00 20.15  ? 51  ARG B CA  1 
ATOM   4277 C  C   . ARG B 1 50  ? 12.841  19.344  3.058   1.00 20.45  ? 51  ARG B C   1 
ATOM   4278 O  O   . ARG B 1 50  ? 12.191  20.310  2.638   1.00 20.43  ? 51  ARG B O   1 
ATOM   4279 C  CB  . ARG B 1 50  ? 14.758  18.705  1.560   1.00 20.58  ? 51  ARG B CB  1 
ATOM   4280 C  CG  . ARG B 1 50  ? 14.760  20.014  0.806   1.00 21.73  ? 51  ARG B CG  1 
ATOM   4281 C  CD  . ARG B 1 50  ? 16.126  20.341  0.240   1.00 23.78  ? 51  ARG B CD  1 
ATOM   4282 N  NE  . ARG B 1 50  ? 16.061  21.553  -0.572  1.00 25.50  ? 51  ARG B NE  1 
ATOM   4283 C  CZ  . ARG B 1 50  ? 16.235  22.791  -0.107  1.00 26.59  ? 51  ARG B CZ  1 
ATOM   4284 N  NH1 . ARG B 1 50  ? 16.512  22.998  1.178   1.00 25.72  ? 51  ARG B NH1 1 
ATOM   4285 N  NH2 . ARG B 1 50  ? 16.151  23.828  -0.940  1.00 26.83  ? 51  ARG B NH2 1 
ATOM   4286 N  N   . GLU B 1 51  ? 13.078  19.140  4.344   1.00 20.24  ? 52  GLU B N   1 
ATOM   4287 C  CA  . GLU B 1 51  ? 12.648  20.109  5.339   1.00 21.14  ? 52  GLU B CA  1 
ATOM   4288 C  C   . GLU B 1 51  ? 13.642  20.171  6.489   1.00 21.07  ? 52  GLU B C   1 
ATOM   4289 O  O   . GLU B 1 51  ? 13.939  19.157  7.130   1.00 21.16  ? 52  GLU B O   1 
ATOM   4290 C  CB  . GLU B 1 51  ? 11.234  19.806  5.860   1.00 21.03  ? 52  GLU B CB  1 
ATOM   4291 C  CG  . GLU B 1 51  ? 10.710  20.875  6.832   1.00 22.80  ? 52  GLU B CG  1 
ATOM   4292 C  CD  . GLU B 1 51  ? 9.279   20.628  7.318   1.00 25.66  ? 52  GLU B CD  1 
ATOM   4293 O  OE1 . GLU B 1 51  ? 8.914   19.467  7.610   1.00 26.52  ? 52  GLU B OE1 1 
ATOM   4294 O  OE2 . GLU B 1 51  ? 8.516   21.616  7.420   1.00 27.85  ? 52  GLU B OE2 1 
ATOM   4295 N  N   . LYS B 1 52  ? 14.168  21.368  6.723   1.00 21.25  ? 53  LYS B N   1 
ATOM   4296 C  CA  . LYS B 1 52  ? 14.986  21.632  7.896   1.00 21.47  ? 53  LYS B CA  1 
ATOM   4297 C  C   . LYS B 1 52  ? 14.070  22.053  9.045   1.00 21.09  ? 53  LYS B C   1 
ATOM   4298 O  O   . LYS B 1 52  ? 13.274  22.983  8.906   1.00 20.24  ? 53  LYS B O   1 
ATOM   4299 C  CB  . LYS B 1 52  ? 16.032  22.711  7.600   1.00 21.60  ? 53  LYS B CB  1 
ATOM   4300 C  CG  . LYS B 1 52  ? 17.084  22.884  8.687   1.00 22.88  ? 53  LYS B CG  1 
ATOM   4301 C  CD  . LYS B 1 52  ? 18.114  23.956  8.299   1.00 26.71  ? 53  LYS B CD  1 
ATOM   4302 C  CE  . LYS B 1 52  ? 19.334  23.889  9.208   1.00 30.11  ? 53  LYS B CE  1 
ATOM   4303 N  NZ  . LYS B 1 52  ? 20.439  24.851  8.829   1.00 31.82  ? 53  LYS B NZ  1 
ATOM   4304 N  N   . LEU B 1 53  ? 14.170  21.327  10.156  1.00 21.42  ? 54  LEU B N   1 
ATOM   4305 C  CA  . LEU B 1 53  ? 13.475  21.678  11.399  1.00 22.12  ? 54  LEU B CA  1 
ATOM   4306 C  C   . LEU B 1 53  ? 14.483  21.933  12.509  1.00 22.58  ? 54  LEU B C   1 
ATOM   4307 O  O   . LEU B 1 53  ? 15.201  21.023  12.935  1.00 22.69  ? 54  LEU B O   1 
ATOM   4308 C  CB  . LEU B 1 53  ? 12.480  20.593  11.808  1.00 21.84  ? 54  LEU B CB  1 
ATOM   4309 C  CG  . LEU B 1 53  ? 11.257  20.412  10.905  1.00 21.61  ? 54  LEU B CG  1 
ATOM   4310 C  CD1 . LEU B 1 53  ? 10.421  19.230  11.380  1.00 20.69  ? 54  LEU B CD1 1 
ATOM   4311 C  CD2 . LEU B 1 53  ? 10.407  21.696  10.812  1.00 20.15  ? 54  LEU B CD2 1 
ATOM   4312 N  N   . GLY B 1 54  ? 14.547  23.185  12.954  1.00 23.24  ? 55  GLY B N   1 
ATOM   4313 C  CA  . GLY B 1 54  ? 15.578  23.620  13.895  1.00 23.69  ? 55  GLY B CA  1 
ATOM   4314 C  C   . GLY B 1 54  ? 16.925  23.547  13.209  1.00 24.05  ? 55  GLY B C   1 
ATOM   4315 O  O   . GLY B 1 54  ? 17.153  24.246  12.228  1.00 23.75  ? 55  GLY B O   1 
ATOM   4316 N  N   . ASN B 1 55  ? 17.806  22.685  13.714  1.00 24.96  ? 56  ASN B N   1 
ATOM   4317 C  CA  . ASN B 1 55  ? 19.143  22.495  13.130  1.00 25.79  ? 56  ASN B CA  1 
ATOM   4318 C  C   . ASN B 1 55  ? 19.274  21.303  12.174  1.00 25.61  ? 56  ASN B C   1 
ATOM   4319 O  O   . ASN B 1 55  ? 20.272  21.199  11.444  1.00 25.97  ? 56  ASN B O   1 
ATOM   4320 C  CB  . ASN B 1 55  ? 20.210  22.399  14.233  1.00 26.44  ? 56  ASN B CB  1 
ATOM   4321 C  CG  . ASN B 1 55  ? 20.669  23.773  14.734  1.00 29.03  ? 56  ASN B CG  1 
ATOM   4322 O  OD1 . ASN B 1 55  ? 20.473  24.802  14.064  1.00 31.90  ? 56  ASN B OD1 1 
ATOM   4323 N  ND2 . ASN B 1 55  ? 21.296  23.792  15.908  1.00 30.08  ? 56  ASN B ND2 1 
ATOM   4324 N  N   . VAL B 1 56  ? 18.274  20.421  12.167  1.00 24.93  ? 57  VAL B N   1 
ATOM   4325 C  CA  . VAL B 1 56  ? 18.334  19.177  11.381  1.00 24.42  ? 57  VAL B CA  1 
ATOM   4326 C  C   . VAL B 1 56  ? 17.494  19.210  10.094  1.00 23.46  ? 57  VAL B C   1 
ATOM   4327 O  O   . VAL B 1 56  ? 16.276  19.408  10.123  1.00 22.88  ? 57  VAL B O   1 
ATOM   4328 C  CB  . VAL B 1 56  ? 17.975  17.945  12.252  1.00 24.85  ? 57  VAL B CB  1 
ATOM   4329 C  CG1 . VAL B 1 56  ? 17.915  16.662  11.423  1.00 25.31  ? 57  VAL B CG1 1 
ATOM   4330 C  CG2 . VAL B 1 56  ? 18.995  17.796  13.403  1.00 25.64  ? 57  VAL B CG2 1 
ATOM   4331 N  N   . GLU B 1 57  ? 18.180  19.025  8.969   1.00 22.32  ? 58  GLU B N   1 
ATOM   4332 C  CA  . GLU B 1 57  ? 17.539  18.895  7.675   1.00 21.93  ? 58  GLU B CA  1 
ATOM   4333 C  C   . GLU B 1 57  ? 17.438  17.429  7.275   1.00 21.14  ? 58  GLU B C   1 
ATOM   4334 O  O   . GLU B 1 57  ? 18.377  16.649  7.460   1.00 21.25  ? 58  GLU B O   1 
ATOM   4335 C  CB  . GLU B 1 57  ? 18.296  19.680  6.594   1.00 22.25  ? 58  GLU B CB  1 
ATOM   4336 C  CG  . GLU B 1 57  ? 17.537  19.739  5.258   1.00 24.13  ? 58  GLU B CG  1 
ATOM   4337 C  CD  . GLU B 1 57  ? 18.062  20.794  4.287   1.00 27.92  ? 58  GLU B CD  1 
ATOM   4338 O  OE1 . GLU B 1 57  ? 19.300  20.910  4.137   1.00 29.66  ? 58  GLU B OE1 1 
ATOM   4339 O  OE2 . GLU B 1 57  ? 17.221  21.485  3.659   1.00 28.57  ? 58  GLU B OE2 1 
ATOM   4340 N  N   . SER B 1 58  ? 16.289  17.053  6.737   1.00 19.95  ? 59  SER B N   1 
ATOM   4341 C  CA  . SER B 1 58  ? 16.126  15.709  6.218   1.00 19.45  ? 59  SER B CA  1 
ATOM   4342 C  C   . SER B 1 58  ? 15.510  15.770  4.842   1.00 18.44  ? 59  SER B C   1 
ATOM   4343 O  O   . SER B 1 58  ? 14.783  16.710  4.531   1.00 17.94  ? 59  SER B O   1 
ATOM   4344 C  CB  . SER B 1 58  ? 15.202  14.894  7.120   1.00 19.25  ? 59  SER B CB  1 
ATOM   4345 O  OG  . SER B 1 58  ? 15.755  14.726  8.400   1.00 21.31  ? 59  SER B OG  1 
ATOM   4346 N  N   . VAL B 1 59  ? 15.800  14.753  4.041   1.00 17.73  ? 60  VAL B N   1 
ATOM   4347 C  CA  . VAL B 1 59  ? 15.049  14.480  2.823   1.00 17.30  ? 60  VAL B CA  1 
ATOM   4348 C  C   . VAL B 1 59  ? 13.983  13.446  3.172   1.00 17.09  ? 60  VAL B C   1 
ATOM   4349 O  O   . VAL B 1 59  ? 14.285  12.421  3.777   1.00 16.76  ? 60  VAL B O   1 
ATOM   4350 C  CB  . VAL B 1 59  ? 15.956  13.928  1.682   1.00 17.29  ? 60  VAL B CB  1 
ATOM   4351 C  CG1 . VAL B 1 59  ? 15.108  13.394  0.513   1.00 15.98  ? 60  VAL B CG1 1 
ATOM   4352 C  CG2 . VAL B 1 59  ? 16.932  15.008  1.182   1.00 17.83  ? 60  VAL B CG2 1 
ATOM   4353 N  N   . TYR B 1 60  ? 12.741  13.722  2.795   1.00 17.09  ? 61  TYR B N   1 
ATOM   4354 C  CA  . TYR B 1 60  ? 11.649  12.805  3.057   1.00 17.37  ? 61  TYR B CA  1 
ATOM   4355 C  C   . TYR B 1 60  ? 11.192  12.118  1.779   1.00 17.88  ? 61  TYR B C   1 
ATOM   4356 O  O   . TYR B 1 60  ? 11.063  12.742  0.714   1.00 17.47  ? 61  TYR B O   1 
ATOM   4357 C  CB  . TYR B 1 60  ? 10.470  13.510  3.738   1.00 17.26  ? 61  TYR B CB  1 
ATOM   4358 C  CG  . TYR B 1 60  ? 10.788  14.060  5.114   1.00 17.49  ? 61  TYR B CG  1 
ATOM   4359 C  CD1 . TYR B 1 60  ? 11.472  15.275  5.258   1.00 17.19  ? 61  TYR B CD1 1 
ATOM   4360 C  CD2 . TYR B 1 60  ? 10.415  13.372  6.271   1.00 15.57  ? 61  TYR B CD2 1 
ATOM   4361 C  CE1 . TYR B 1 60  ? 11.768  15.794  6.521   1.00 18.08  ? 61  TYR B CE1 1 
ATOM   4362 C  CE2 . TYR B 1 60  ? 10.713  13.889  7.543   1.00 16.91  ? 61  TYR B CE2 1 
ATOM   4363 C  CZ  . TYR B 1 60  ? 11.385  15.098  7.656   1.00 16.76  ? 61  TYR B CZ  1 
ATOM   4364 O  OH  . TYR B 1 60  ? 11.687  15.629  8.892   1.00 18.06  ? 61  TYR B OH  1 
ATOM   4365 N  N   . VAL B 1 61  ? 10.904  10.832  1.935   1.00 18.21  ? 62  VAL B N   1 
ATOM   4366 C  CA  . VAL B 1 61  ? 10.645  9.909   0.838   1.00 18.92  ? 62  VAL B CA  1 
ATOM   4367 C  C   . VAL B 1 61  ? 9.439   9.049   1.218   1.00 18.89  ? 62  VAL B C   1 
ATOM   4368 O  O   . VAL B 1 61  ? 9.216   8.775   2.407   1.00 18.57  ? 62  VAL B O   1 
ATOM   4369 C  CB  . VAL B 1 61  ? 11.959  9.109   0.562   1.00 18.94  ? 62  VAL B CB  1 
ATOM   4370 C  CG1 . VAL B 1 61  ? 11.746  7.614   0.444   1.00 20.31  ? 62  VAL B CG1 1 
ATOM   4371 C  CG2 . VAL B 1 61  ? 12.694  9.714   -0.640  1.00 18.46  ? 62  VAL B CG2 1 
ATOM   4372 N  N   . ILE B 1 62  ? 8.631   8.687   0.223   1.00 19.42  ? 63  ILE B N   1 
ATOM   4373 C  CA  . ILE B 1 62  ? 7.381   7.938   0.452   1.00 19.59  ? 63  ILE B CA  1 
ATOM   4374 C  C   . ILE B 1 62  ? 7.219   6.724   -0.472  1.00 20.34  ? 63  ILE B C   1 
ATOM   4375 O  O   . ILE B 1 62  ? 6.633   5.715   -0.072  1.00 20.38  ? 63  ILE B O   1 
ATOM   4376 C  CB  . ILE B 1 62  ? 6.122   8.851   0.357   1.00 19.53  ? 63  ILE B CB  1 
ATOM   4377 C  CG1 . ILE B 1 62  ? 4.890   8.147   0.972   1.00 18.27  ? 63  ILE B CG1 1 
ATOM   4378 C  CG2 . ILE B 1 62  ? 5.882   9.311   -1.094  1.00 19.14  ? 63  ILE B CG2 1 
ATOM   4379 C  CD1 . ILE B 1 62  ? 3.592   8.923   0.849   1.00 16.38  ? 63  ILE B CD1 1 
ATOM   4380 N  N   . ASP B 1 63  ? 7.758   6.822   -1.689  1.00 20.91  ? 64  ASP B N   1 
ATOM   4381 C  CA  . ASP B 1 63  ? 7.630   5.762   -2.701  1.00 20.88  ? 64  ASP B CA  1 
ATOM   4382 C  C   . ASP B 1 63  ? 8.476   4.542   -2.364  1.00 21.07  ? 64  ASP B C   1 
ATOM   4383 O  O   . ASP B 1 63  ? 9.690   4.651   -2.206  1.00 20.98  ? 64  ASP B O   1 
ATOM   4384 C  CB  . ASP B 1 63  ? 8.024   6.301   -4.085  1.00 21.12  ? 64  ASP B CB  1 
ATOM   4385 C  CG  . ASP B 1 63  ? 7.611   5.371   -5.237  1.00 21.35  ? 64  ASP B CG  1 
ATOM   4386 O  OD1 . ASP B 1 63  ? 7.796   4.140   -5.160  1.00 21.90  ? 64  ASP B OD1 1 
ATOM   4387 O  OD2 . ASP B 1 63  ? 7.112   5.888   -6.244  1.00 22.04  ? 64  ASP B OD2 1 
ATOM   4388 N  N   . PRO B 1 64  ? 7.843   3.357   -2.281  1.00 21.69  ? 65  PRO B N   1 
ATOM   4389 C  CA  . PRO B 1 64  ? 8.584   2.113   -2.044  1.00 22.31  ? 65  PRO B CA  1 
ATOM   4390 C  C   . PRO B 1 64  ? 9.784   1.910   -2.983  1.00 23.28  ? 65  PRO B C   1 
ATOM   4391 O  O   . PRO B 1 64  ? 10.788  1.311   -2.585  1.00 23.42  ? 65  PRO B O   1 
ATOM   4392 C  CB  . PRO B 1 64  ? 7.519   1.042   -2.260  1.00 22.27  ? 65  PRO B CB  1 
ATOM   4393 C  CG  . PRO B 1 64  ? 6.272   1.716   -1.772  1.00 21.95  ? 65  PRO B CG  1 
ATOM   4394 C  CD  . PRO B 1 64  ? 6.387   3.133   -2.266  1.00 21.30  ? 65  PRO B CD  1 
ATOM   4395 N  N   . GLU B 1 65  ? 9.692   2.435   -4.202  1.00 24.19  ? 66  GLU B N   1 
ATOM   4396 C  CA  . GLU B 1 65  ? 10.774  2.316   -5.177  1.00 25.63  ? 66  GLU B CA  1 
ATOM   4397 C  C   . GLU B 1 65  ? 12.024  3.107   -4.748  1.00 24.90  ? 66  GLU B C   1 
ATOM   4398 O  O   . GLU B 1 65  ? 13.148  2.645   -4.921  1.00 25.45  ? 66  GLU B O   1 
ATOM   4399 C  CB  . GLU B 1 65  ? 10.275  2.741   -6.567  1.00 26.37  ? 66  GLU B CB  1 
ATOM   4400 C  CG  . GLU B 1 65  ? 11.071  2.171   -7.733  1.00 30.86  ? 66  GLU B CG  1 
ATOM   4401 C  CD  . GLU B 1 65  ? 11.014  0.647   -7.804  1.00 35.36  ? 66  GLU B CD  1 
ATOM   4402 O  OE1 . GLU B 1 65  ? 9.897   0.090   -7.931  1.00 36.95  ? 66  GLU B OE1 1 
ATOM   4403 O  OE2 . GLU B 1 65  ? 12.096  0.013   -7.734  1.00 36.85  ? 66  GLU B OE2 1 
ATOM   4404 N  N   . ASP B 1 66  ? 11.813  4.286   -4.169  1.00 24.51  ? 67  ASP B N   1 
ATOM   4405 C  CA  . ASP B 1 66  ? 12.883  5.084   -3.559  1.00 23.88  ? 67  ASP B CA  1 
ATOM   4406 C  C   . ASP B 1 66  ? 13.392  4.454   -2.270  1.00 23.12  ? 67  ASP B C   1 
ATOM   4407 O  O   . ASP B 1 66  ? 14.582  4.493   -1.985  1.00 23.19  ? 67  ASP B O   1 
ATOM   4408 C  CB  . ASP B 1 66  ? 12.387  6.510   -3.291  1.00 24.13  ? 67  ASP B CB  1 
ATOM   4409 C  CG  . ASP B 1 66  ? 11.993  7.228   -4.561  1.00 24.58  ? 67  ASP B CG  1 
ATOM   4410 O  OD1 . ASP B 1 66  ? 12.610  6.938   -5.608  1.00 26.54  ? 67  ASP B OD1 1 
ATOM   4411 O  OD2 . ASP B 1 66  ? 11.066  8.069   -4.528  1.00 25.08  ? 67  ASP B OD2 1 
ATOM   4412 N  N   . VAL B 1 67  ? 12.483  3.872   -1.493  1.00 22.79  ? 68  VAL B N   1 
ATOM   4413 C  CA  . VAL B 1 67  ? 12.859  3.149   -0.282  1.00 22.13  ? 68  VAL B CA  1 
ATOM   4414 C  C   . VAL B 1 67  ? 13.843  2.034   -0.639  1.00 22.47  ? 68  VAL B C   1 
ATOM   4415 O  O   . VAL B 1 67  ? 14.874  1.871   0.021   1.00 21.93  ? 68  VAL B O   1 
ATOM   4416 C  CB  . VAL B 1 67  ? 11.624  2.565   0.454   1.00 22.26  ? 68  VAL B CB  1 
ATOM   4417 C  CG1 . VAL B 1 67  ? 12.035  1.845   1.748   1.00 21.26  ? 68  VAL B CG1 1 
ATOM   4418 C  CG2 . VAL B 1 67  ? 10.619  3.640   0.745   1.00 20.75  ? 68  VAL B CG2 1 
ATOM   4419 N  N   . ALA B 1 68  ? 13.527  1.292   -1.702  1.00 22.94  ? 69  ALA B N   1 
ATOM   4420 C  CA  . ALA B 1 68  ? 14.376  0.193   -2.183  1.00 23.39  ? 69  ALA B CA  1 
ATOM   4421 C  C   . ALA B 1 68  ? 15.807  0.653   -2.481  1.00 23.70  ? 69  ALA B C   1 
ATOM   4422 O  O   . ALA B 1 68  ? 16.781  0.019   -2.059  1.00 23.07  ? 69  ALA B O   1 
ATOM   4423 C  CB  . ALA B 1 68  ? 13.753  -0.460  -3.423  1.00 23.11  ? 69  ALA B CB  1 
ATOM   4424 N  N   . LEU B 1 69  ? 15.917  1.771   -3.195  1.00 24.66  ? 70  LEU B N   1 
ATOM   4425 C  CA  . LEU B 1 69  ? 17.203  2.361   -3.516  1.00 25.53  ? 70  LEU B CA  1 
ATOM   4426 C  C   . LEU B 1 69  ? 17.928  2.847   -2.263  1.00 26.10  ? 70  LEU B C   1 
ATOM   4427 O  O   . LEU B 1 69  ? 19.147  2.713   -2.158  1.00 26.29  ? 70  LEU B O   1 
ATOM   4428 C  CB  . LEU B 1 69  ? 17.035  3.487   -4.538  1.00 25.62  ? 70  LEU B CB  1 
ATOM   4429 C  CG  . LEU B 1 69  ? 16.739  3.079   -5.990  1.00 27.12  ? 70  LEU B CG  1 
ATOM   4430 C  CD1 . LEU B 1 69  ? 16.386  4.286   -6.859  1.00 26.98  ? 70  LEU B CD1 1 
ATOM   4431 C  CD2 . LEU B 1 69  ? 17.909  2.295   -6.612  1.00 27.51  ? 70  LEU B CD2 1 
ATOM   4432 N  N   . LEU B 1 70  ? 17.181  3.388   -1.303  1.00 26.87  ? 71  LEU B N   1 
ATOM   4433 C  CA  . LEU B 1 70  ? 17.785  3.830   -0.044  1.00 27.63  ? 71  LEU B CA  1 
ATOM   4434 C  C   . LEU B 1 70  ? 18.443  2.674   0.702   1.00 28.73  ? 71  LEU B C   1 
ATOM   4435 O  O   . LEU B 1 70  ? 19.598  2.764   1.112   1.00 28.75  ? 71  LEU B O   1 
ATOM   4436 C  CB  . LEU B 1 70  ? 16.763  4.532   0.864   1.00 27.18  ? 71  LEU B CB  1 
ATOM   4437 C  CG  . LEU B 1 70  ? 17.287  4.921   2.254   1.00 26.00  ? 71  LEU B CG  1 
ATOM   4438 C  CD1 . LEU B 1 70  ? 18.429  5.925   2.132   1.00 24.73  ? 71  LEU B CD1 1 
ATOM   4439 C  CD2 . LEU B 1 70  ? 16.182  5.468   3.146   1.00 23.91  ? 71  LEU B CD2 1 
ATOM   4440 N  N   . PHE B 1 71  ? 17.705  1.584   0.864   1.00 30.21  ? 72  PHE B N   1 
ATOM   4441 C  CA  . PHE B 1 71  ? 18.215  0.446   1.613   1.00 31.97  ? 72  PHE B CA  1 
ATOM   4442 C  C   . PHE B 1 71  ? 19.218  -0.409  0.818   1.00 33.07  ? 72  PHE B C   1 
ATOM   4443 O  O   . PHE B 1 71  ? 20.048  -1.105  1.408   1.00 33.39  ? 72  PHE B O   1 
ATOM   4444 C  CB  . PHE B 1 71  ? 17.055  -0.379  2.175   1.00 31.90  ? 72  PHE B CB  1 
ATOM   4445 C  CG  . PHE B 1 71  ? 16.377  0.261   3.376   1.00 33.03  ? 72  PHE B CG  1 
ATOM   4446 C  CD1 . PHE B 1 71  ? 15.105  0.814   3.264   1.00 33.49  ? 72  PHE B CD1 1 
ATOM   4447 C  CD2 . PHE B 1 71  ? 17.019  0.318   4.617   1.00 33.27  ? 72  PHE B CD2 1 
ATOM   4448 C  CE1 . PHE B 1 71  ? 14.471  1.399   4.367   1.00 33.97  ? 72  PHE B CE1 1 
ATOM   4449 C  CE2 . PHE B 1 71  ? 16.397  0.907   5.716   1.00 33.56  ? 72  PHE B CE2 1 
ATOM   4450 C  CZ  . PHE B 1 71  ? 15.118  1.451   5.586   1.00 34.03  ? 72  PHE B CZ  1 
ATOM   4451 N  N   . LYS B 1 72  ? 19.151  -0.336  -0.511  1.00 34.32  ? 73  LYS B N   1 
ATOM   4452 C  CA  . LYS B 1 72  ? 20.117  -1.009  -1.391  1.00 35.70  ? 73  LYS B CA  1 
ATOM   4453 C  C   . LYS B 1 72  ? 21.525  -0.441  -1.195  1.00 36.04  ? 73  LYS B C   1 
ATOM   4454 O  O   . LYS B 1 72  ? 22.512  -1.178  -1.228  1.00 36.43  ? 73  LYS B O   1 
ATOM   4455 C  CB  . LYS B 1 72  ? 19.718  -0.820  -2.859  1.00 36.01  ? 73  LYS B CB  1 
ATOM   4456 C  CG  . LYS B 1 72  ? 19.505  -2.104  -3.651  1.00 37.39  ? 73  LYS B CG  1 
ATOM   4457 C  CD  . LYS B 1 72  ? 18.060  -2.608  -3.518  1.00 39.10  ? 73  LYS B CD  1 
ATOM   4458 C  CE  . LYS B 1 72  ? 17.603  -3.353  -4.764  1.00 40.27  ? 73  LYS B CE  1 
ATOM   4459 N  NZ  . LYS B 1 72  ? 17.545  -2.469  -5.971  1.00 41.05  ? 73  LYS B NZ  1 
ATOM   4460 N  N   . SER B 1 73  ? 21.605  0.871   -0.986  1.00 36.24  ? 74  SER B N   1 
ATOM   4461 C  CA  . SER B 1 73  ? 22.885  1.567   -0.886  1.00 36.39  ? 74  SER B CA  1 
ATOM   4462 C  C   . SER B 1 73  ? 23.329  1.733   0.564   1.00 36.35  ? 74  SER B C   1 
ATOM   4463 O  O   . SER B 1 73  ? 24.055  2.674   0.904   1.00 36.74  ? 74  SER B O   1 
ATOM   4464 C  CB  . SER B 1 73  ? 22.779  2.941   -1.548  1.00 36.50  ? 74  SER B CB  1 
ATOM   4465 O  OG  . SER B 1 73  ? 22.047  3.822   -0.721  1.00 36.76  ? 74  SER B OG  1 
ATOM   4466 N  N   . GLU B 1 74  ? 22.887  0.817   1.416   1.00 35.92  ? 75  GLU B N   1 
ATOM   4467 C  CA  . GLU B 1 74  ? 23.196  0.877   2.829   1.00 35.39  ? 75  GLU B CA  1 
ATOM   4468 C  C   . GLU B 1 74  ? 24.570  0.258   3.108   1.00 34.91  ? 75  GLU B C   1 
ATOM   4469 O  O   . GLU B 1 74  ? 24.898  -0.820  2.588   1.00 34.82  ? 75  GLU B O   1 
ATOM   4470 C  CB  . GLU B 1 74  ? 22.109  0.153   3.620   1.00 35.46  ? 75  GLU B CB  1 
ATOM   4471 C  CG  . GLU B 1 74  ? 21.945  0.654   5.038   1.00 36.31  ? 75  GLU B CG  1 
ATOM   4472 C  CD  . GLU B 1 74  ? 20.748  0.056   5.731   1.00 36.15  ? 75  GLU B CD  1 
ATOM   4473 O  OE1 . GLU B 1 74  ? 20.739  -1.173  5.970   1.00 36.69  ? 75  GLU B OE1 1 
ATOM   4474 O  OE2 . GLU B 1 74  ? 19.820  0.821   6.046   1.00 36.34  ? 75  GLU B OE2 1 
ATOM   4475 N  N   . GLY B 1 75  ? 25.364  0.947   3.927   1.00 33.88  ? 76  GLY B N   1 
ATOM   4476 C  CA  . GLY B 1 75  ? 26.658  0.437   4.367   1.00 32.84  ? 76  GLY B CA  1 
ATOM   4477 C  C   . GLY B 1 75  ? 26.533  -0.685  5.386   1.00 31.90  ? 76  GLY B C   1 
ATOM   4478 O  O   . GLY B 1 75  ? 25.425  -1.044  5.777   1.00 32.03  ? 76  GLY B O   1 
ATOM   4479 N  N   . PRO B 1 76  ? 27.675  -1.253  5.820   1.00 31.23  ? 77  PRO B N   1 
ATOM   4480 C  CA  . PRO B 1 76  ? 27.653  -2.350  6.790   1.00 30.31  ? 77  PRO B CA  1 
ATOM   4481 C  C   . PRO B 1 76  ? 27.215  -1.938  8.208   1.00 29.39  ? 77  PRO B C   1 
ATOM   4482 O  O   . PRO B 1 76  ? 26.703  -2.780  8.949   1.00 29.45  ? 77  PRO B O   1 
ATOM   4483 C  CB  . PRO B 1 76  ? 29.106  -2.846  6.794   1.00 30.43  ? 77  PRO B CB  1 
ATOM   4484 C  CG  . PRO B 1 76  ? 29.910  -1.671  6.360   1.00 30.84  ? 77  PRO B CG  1 
ATOM   4485 C  CD  . PRO B 1 76  ? 29.049  -0.932  5.378   1.00 31.04  ? 77  PRO B CD  1 
ATOM   4486 N  N   . ASN B 1 77  ? 27.422  -0.671  8.574   1.00 27.99  ? 78  ASN B N   1 
ATOM   4487 C  CA  . ASN B 1 77  ? 27.058  -0.166  9.902   1.00 26.85  ? 78  ASN B CA  1 
ATOM   4488 C  C   . ASN B 1 77  ? 26.126  1.051   9.806   1.00 25.79  ? 78  ASN B C   1 
ATOM   4489 O  O   . ASN B 1 77  ? 26.569  2.196   9.985   1.00 25.31  ? 78  ASN B O   1 
ATOM   4490 C  CB  . ASN B 1 77  ? 28.306  0.202   10.718  1.00 26.98  ? 78  ASN B CB  1 
ATOM   4491 C  CG  . ASN B 1 77  ? 29.329  -0.927  10.790  1.00 28.07  ? 78  ASN B CG  1 
ATOM   4492 O  OD1 . ASN B 1 77  ? 29.059  -2.009  11.317  1.00 28.01  ? 78  ASN B OD1 1 
ATOM   4493 N  ND2 . ASN B 1 77  ? 30.519  -0.663  10.277  1.00 28.98  ? 78  ASN B ND2 1 
ATOM   4494 N  N   . PRO B 1 78  ? 24.828  0.807   9.542   1.00 24.75  ? 79  PRO B N   1 
ATOM   4495 C  CA  . PRO B 1 78  ? 23.855  1.874   9.291   1.00 24.13  ? 79  PRO B CA  1 
ATOM   4496 C  C   . PRO B 1 78  ? 23.636  2.751   10.514  1.00 23.36  ? 79  PRO B C   1 
ATOM   4497 O  O   . PRO B 1 78  ? 23.786  2.288   11.649  1.00 23.34  ? 79  PRO B O   1 
ATOM   4498 C  CB  . PRO B 1 78  ? 22.557  1.112   8.971   1.00 24.13  ? 79  PRO B CB  1 
ATOM   4499 C  CG  . PRO B 1 78  ? 22.970  -0.303  8.756   1.00 24.55  ? 79  PRO B CG  1 
ATOM   4500 C  CD  . PRO B 1 78  ? 24.179  -0.510  9.593   1.00 24.42  ? 79  PRO B CD  1 
ATOM   4501 N  N   . GLU B 1 79  ? 23.287  4.009   10.270  1.00 22.57  ? 80  GLU B N   1 
ATOM   4502 C  CA  . GLU B 1 79  ? 22.954  4.954   11.334  1.00 21.93  ? 80  GLU B CA  1 
ATOM   4503 C  C   . GLU B 1 79  ? 21.601  5.574   11.042  1.00 20.53  ? 80  GLU B C   1 
ATOM   4504 O  O   . GLU B 1 79  ? 21.355  6.027   9.925   1.00 20.06  ? 80  GLU B O   1 
ATOM   4505 C  CB  . GLU B 1 79  ? 24.024  6.052   11.452  1.00 22.25  ? 80  GLU B CB  1 
ATOM   4506 C  CG  . GLU B 1 79  ? 25.379  5.536   11.914  1.00 25.21  ? 80  GLU B CG  1 
ATOM   4507 C  CD  . GLU B 1 79  ? 26.450  6.604   11.913  1.00 30.20  ? 80  GLU B CD  1 
ATOM   4508 O  OE1 . GLU B 1 79  ? 26.318  7.605   12.656  1.00 32.93  ? 80  GLU B OE1 1 
ATOM   4509 O  OE2 . GLU B 1 79  ? 27.440  6.437   11.170  1.00 33.54  ? 80  GLU B OE2 1 
ATOM   4510 N  N   . ARG B 1 80  ? 20.724  5.556   12.044  1.00 19.34  ? 81  ARG B N   1 
ATOM   4511 C  CA  . ARG B 1 80  ? 19.426  6.217   11.975  1.00 18.04  ? 81  ARG B CA  1 
ATOM   4512 C  C   . ARG B 1 80  ? 19.519  7.526   12.762  1.00 17.62  ? 81  ARG B C   1 
ATOM   4513 O  O   . ARG B 1 80  ? 20.578  7.857   13.299  1.00 17.33  ? 81  ARG B O   1 
ATOM   4514 C  CB  . ARG B 1 80  ? 18.336  5.318   12.566  1.00 18.16  ? 81  ARG B CB  1 
ATOM   4515 C  CG  . ARG B 1 80  ? 18.342  5.230   14.098  1.00 16.87  ? 81  ARG B CG  1 
ATOM   4516 C  CD  . ARG B 1 80  ? 17.130  4.496   14.646  1.00 16.12  ? 81  ARG B CD  1 
ATOM   4517 N  NE  . ARG B 1 80  ? 17.077  3.087   14.251  1.00 15.68  ? 81  ARG B NE  1 
ATOM   4518 C  CZ  . ARG B 1 80  ? 17.678  2.091   14.904  1.00 16.27  ? 81  ARG B CZ  1 
ATOM   4519 N  NH1 . ARG B 1 80  ? 18.406  2.327   15.993  1.00 15.80  ? 81  ARG B NH1 1 
ATOM   4520 N  NH2 . ARG B 1 80  ? 17.555  0.848   14.467  1.00 16.85  ? 81  ARG B NH2 1 
ATOM   4521 N  N   . PHE B 1 81  ? 18.415  8.258   12.852  1.00 16.84  ? 82  PHE B N   1 
ATOM   4522 C  CA  . PHE B 1 81  ? 18.408  9.493   13.618  1.00 16.31  ? 82  PHE B CA  1 
ATOM   4523 C  C   . PHE B 1 81  ? 18.436  9.208   15.111  1.00 16.01  ? 82  PHE B C   1 
ATOM   4524 O  O   . PHE B 1 81  ? 17.619  8.430   15.612  1.00 15.81  ? 82  PHE B O   1 
ATOM   4525 C  CB  . PHE B 1 81  ? 17.196  10.364  13.267  1.00 16.09  ? 82  PHE B CB  1 
ATOM   4526 C  CG  . PHE B 1 81  ? 17.184  11.688  13.979  1.00 15.80  ? 82  PHE B CG  1 
ATOM   4527 C  CD1 . PHE B 1 81  ? 18.095  12.690  13.625  1.00 14.10  ? 82  PHE B CD1 1 
ATOM   4528 C  CD2 . PHE B 1 81  ? 16.273  11.939  15.004  1.00 16.00  ? 82  PHE B CD2 1 
ATOM   4529 C  CE1 . PHE B 1 81  ? 18.095  13.917  14.267  1.00 14.74  ? 82  PHE B CE1 1 
ATOM   4530 C  CE2 . PHE B 1 81  ? 16.270  13.179  15.675  1.00 15.91  ? 82  PHE B CE2 1 
ATOM   4531 C  CZ  . PHE B 1 81  ? 17.186  14.169  15.300  1.00 15.27  ? 82  PHE B CZ  1 
ATOM   4532 N  N   . LEU B 1 82  ? 19.392  9.825   15.806  1.00 15.60  ? 83  LEU B N   1 
ATOM   4533 C  CA  . LEU B 1 82  ? 19.480  9.719   17.258  1.00 15.59  ? 83  LEU B CA  1 
ATOM   4534 C  C   . LEU B 1 82  ? 18.646  10.817  17.891  1.00 15.23  ? 83  LEU B C   1 
ATOM   4535 O  O   . LEU B 1 82  ? 18.681  11.971  17.446  1.00 15.44  ? 83  LEU B O   1 
ATOM   4536 C  CB  . LEU B 1 82  ? 20.930  9.825   17.737  1.00 15.71  ? 83  LEU B CB  1 
ATOM   4537 C  CG  . LEU B 1 82  ? 21.975  8.807   17.258  1.00 16.83  ? 83  LEU B CG  1 
ATOM   4538 C  CD1 . LEU B 1 82  ? 23.382  9.304   17.608  1.00 16.42  ? 83  LEU B CD1 1 
ATOM   4539 C  CD2 . LEU B 1 82  ? 21.735  7.419   17.849  1.00 16.63  ? 83  LEU B CD2 1 
ATOM   4540 N  N   . ILE B 1 83  ? 17.904  10.454  18.928  1.00 14.68  ? 84  ILE B N   1 
ATOM   4541 C  CA  . ILE B 1 83  ? 17.032  11.388  19.636  1.00 14.61  ? 84  ILE B CA  1 
ATOM   4542 C  C   . ILE B 1 83  ? 17.892  12.234  20.587  1.00 14.69  ? 84  ILE B C   1 
ATOM   4543 O  O   . ILE B 1 83  ? 18.481  11.702  21.526  1.00 14.67  ? 84  ILE B O   1 
ATOM   4544 C  CB  . ILE B 1 83  ? 15.902  10.633  20.405  1.00 14.18  ? 84  ILE B CB  1 
ATOM   4545 C  CG1 . ILE B 1 83  ? 15.112  9.694   19.473  1.00 13.88  ? 84  ILE B CG1 1 
ATOM   4546 C  CG2 . ILE B 1 83  ? 14.962  11.598  21.110  1.00 14.66  ? 84  ILE B CG2 1 
ATOM   4547 C  CD1 . ILE B 1 83  ? 14.176  10.394  18.458  1.00 12.84  ? 84  ILE B CD1 1 
ATOM   4548 N  N   . PRO B 1 84  ? 17.995  13.551  20.329  1.00 15.23  ? 85  PRO B N   1 
ATOM   4549 C  CA  . PRO B 1 84  ? 18.953  14.387  21.091  1.00 15.43  ? 85  PRO B CA  1 
ATOM   4550 C  C   . PRO B 1 84  ? 18.770  14.405  22.617  1.00 15.74  ? 85  PRO B C   1 
ATOM   4551 O  O   . PRO B 1 84  ? 19.768  14.270  23.331  1.00 16.01  ? 85  PRO B O   1 
ATOM   4552 C  CB  . PRO B 1 84  ? 18.786  15.788  20.468  1.00 15.85  ? 85  PRO B CB  1 
ATOM   4553 C  CG  . PRO B 1 84  ? 18.279  15.506  19.068  1.00 14.81  ? 85  PRO B CG  1 
ATOM   4554 C  CD  . PRO B 1 84  ? 17.345  14.320  19.247  1.00 15.13  ? 85  PRO B CD  1 
ATOM   4555 N  N   . PRO B 1 85  ? 17.524  14.536  23.130  1.00 15.79  ? 86  PRO B N   1 
ATOM   4556 C  CA  . PRO B 1 85  ? 17.446  14.438  24.584  1.00 15.93  ? 86  PRO B CA  1 
ATOM   4557 C  C   . PRO B 1 85  ? 17.959  13.108  25.151  1.00 16.03  ? 86  PRO B C   1 
ATOM   4558 O  O   . PRO B 1 85  ? 18.541  13.107  26.245  1.00 15.75  ? 86  PRO B O   1 
ATOM   4559 C  CB  . PRO B 1 85  ? 15.945  14.602  24.879  1.00 16.11  ? 86  PRO B CB  1 
ATOM   4560 C  CG  . PRO B 1 85  ? 15.260  14.302  23.594  1.00 16.02  ? 86  PRO B CG  1 
ATOM   4561 C  CD  . PRO B 1 85  ? 16.199  14.800  22.543  1.00 15.96  ? 86  PRO B CD  1 
ATOM   4562 N  N   . TRP B 1 86  ? 17.752  12.001  24.429  1.00 15.55  ? 87  TRP B N   1 
ATOM   4563 C  CA  . TRP B 1 86  ? 18.249  10.684  24.880  1.00 15.58  ? 87  TRP B CA  1 
ATOM   4564 C  C   . TRP B 1 86  ? 19.764  10.675  24.964  1.00 15.47  ? 87  TRP B C   1 
ATOM   4565 O  O   . TRP B 1 86  ? 20.332  10.249  25.969  1.00 15.44  ? 87  TRP B O   1 
ATOM   4566 C  CB  . TRP B 1 86  ? 17.771  9.532   23.971  1.00 14.98  ? 87  TRP B CB  1 
ATOM   4567 C  CG  . TRP B 1 86  ? 16.274  9.388   23.891  1.00 14.11  ? 87  TRP B CG  1 
ATOM   4568 C  CD1 . TRP B 1 86  ? 15.344  10.215  24.450  1.00 12.27  ? 87  TRP B CD1 1 
ATOM   4569 C  CD2 . TRP B 1 86  ? 15.541  8.383   23.175  1.00 12.96  ? 87  TRP B CD2 1 
ATOM   4570 N  NE1 . TRP B 1 86  ? 14.082  9.779   24.146  1.00 12.96  ? 87  TRP B NE1 1 
ATOM   4571 C  CE2 . TRP B 1 86  ? 14.170  8.653   23.369  1.00 13.46  ? 87  TRP B CE2 1 
ATOM   4572 C  CE3 . TRP B 1 86  ? 15.910  7.274   22.405  1.00 14.63  ? 87  TRP B CE3 1 
ATOM   4573 C  CZ2 . TRP B 1 86  ? 13.163  7.867   22.815  1.00 12.51  ? 87  TRP B CZ2 1 
ATOM   4574 C  CZ3 . TRP B 1 86  ? 14.906  6.484   21.846  1.00 15.48  ? 87  TRP B CZ3 1 
ATOM   4575 C  CH2 . TRP B 1 86  ? 13.542  6.792   22.057  1.00 14.50  ? 87  TRP B CH2 1 
ATOM   4576 N  N   . VAL B 1 87  ? 20.402  11.136  23.894  1.00 16.08  ? 88  VAL B N   1 
ATOM   4577 C  CA  . VAL B 1 87  ? 21.858  11.234  23.818  1.00 16.60  ? 88  VAL B CA  1 
ATOM   4578 C  C   . VAL B 1 87  ? 22.387  12.112  24.957  1.00 17.14  ? 88  VAL B C   1 
ATOM   4579 O  O   . VAL B 1 87  ? 23.273  11.690  25.702  1.00 17.93  ? 88  VAL B O   1 
ATOM   4580 C  CB  . VAL B 1 87  ? 22.310  11.784  22.443  1.00 16.75  ? 88  VAL B CB  1 
ATOM   4581 C  CG1 . VAL B 1 87  ? 23.811  12.082  22.430  1.00 15.88  ? 88  VAL B CG1 1 
ATOM   4582 C  CG2 . VAL B 1 87  ? 21.941  10.803  21.329  1.00 16.63  ? 88  VAL B CG2 1 
ATOM   4583 N  N   . ALA B 1 88  ? 21.814  13.307  25.114  1.00 17.27  ? 89  ALA B N   1 
ATOM   4584 C  CA  . ALA B 1 88  ? 22.271  14.260  26.139  1.00 17.45  ? 89  ALA B CA  1 
ATOM   4585 C  C   . ALA B 1 88  ? 22.201  13.681  27.539  1.00 17.82  ? 89  ALA B C   1 
ATOM   4586 O  O   . ALA B 1 88  ? 23.107  13.911  28.349  1.00 17.94  ? 89  ALA B O   1 
ATOM   4587 C  CB  . ALA B 1 88  ? 21.487  15.578  26.073  1.00 16.86  ? 89  ALA B CB  1 
ATOM   4588 N  N   . TYR B 1 89  ? 21.129  12.941  27.824  1.00 17.96  ? 90  TYR B N   1 
ATOM   4589 C  CA  . TYR B 1 89  ? 20.950  12.346  29.139  1.00 18.53  ? 90  TYR B CA  1 
ATOM   4590 C  C   . TYR B 1 89  ? 22.053  11.325  29.428  1.00 19.15  ? 90  TYR B C   1 
ATOM   4591 O  O   . TYR B 1 89  ? 22.612  11.303  30.523  1.00 18.92  ? 90  TYR B O   1 
ATOM   4592 C  CB  . TYR B 1 89  ? 19.572  11.686  29.295  1.00 18.12  ? 90  TYR B CB  1 
ATOM   4593 C  CG  . TYR B 1 89  ? 19.522  10.767  30.506  1.00 18.09  ? 90  TYR B CG  1 
ATOM   4594 C  CD1 . TYR B 1 89  ? 19.199  11.264  31.768  1.00 18.40  ? 90  TYR B CD1 1 
ATOM   4595 C  CD2 . TYR B 1 89  ? 19.859  9.416   30.398  1.00 17.86  ? 90  TYR B CD2 1 
ATOM   4596 C  CE1 . TYR B 1 89  ? 19.177  10.431  32.885  1.00 19.20  ? 90  TYR B CE1 1 
ATOM   4597 C  CE2 . TYR B 1 89  ? 19.849  8.575   31.515  1.00 18.02  ? 90  TYR B CE2 1 
ATOM   4598 C  CZ  . TYR B 1 89  ? 19.505  9.089   32.746  1.00 18.44  ? 90  TYR B CZ  1 
ATOM   4599 O  OH  . TYR B 1 89  ? 19.484  8.277   33.850  1.00 18.81  ? 90  TYR B OH  1 
ATOM   4600 N  N   . HIS B 1 90  ? 22.340  10.474  28.448  1.00 20.12  ? 91  HIS B N   1 
ATOM   4601 C  CA  . HIS B 1 90  ? 23.361  9.443   28.603  1.00 21.50  ? 91  HIS B CA  1 
ATOM   4602 C  C   . HIS B 1 90  ? 24.747  10.061  28.756  1.00 22.59  ? 91  HIS B C   1 
ATOM   4603 O  O   . HIS B 1 90  ? 25.525  9.607   29.588  1.00 22.20  ? 91  HIS B O   1 
ATOM   4604 C  CB  . HIS B 1 90  ? 23.333  8.438   27.445  1.00 20.95  ? 91  HIS B CB  1 
ATOM   4605 C  CG  . HIS B 1 90  ? 22.168  7.502   27.495  1.00 20.28  ? 91  HIS B CG  1 
ATOM   4606 N  ND1 . HIS B 1 90  ? 20.893  7.884   27.143  1.00 20.56  ? 91  HIS B ND1 1 
ATOM   4607 C  CD2 . HIS B 1 90  ? 22.082  6.202   27.866  1.00 20.22  ? 91  HIS B CD2 1 
ATOM   4608 C  CE1 . HIS B 1 90  ? 20.070  6.862   27.302  1.00 21.17  ? 91  HIS B CE1 1 
ATOM   4609 N  NE2 . HIS B 1 90  ? 20.766  5.831   27.742  1.00 19.93  ? 91  HIS B NE2 1 
ATOM   4610 N  N   . GLN B 1 91  ? 25.031  11.096  27.965  1.00 24.28  ? 92  GLN B N   1 
ATOM   4611 C  CA  . GLN B 1 91  ? 26.334  11.772  27.997  1.00 26.21  ? 92  GLN B CA  1 
ATOM   4612 C  C   . GLN B 1 91  ? 26.531  12.546  29.301  1.00 26.89  ? 92  GLN B C   1 
ATOM   4613 O  O   . GLN B 1 91  ? 27.523  12.335  30.005  1.00 26.99  ? 92  GLN B O   1 
ATOM   4614 C  CB  . GLN B 1 91  ? 26.539  12.666  26.759  1.00 26.57  ? 92  GLN B CB  1 
ATOM   4615 C  CG  . GLN B 1 91  ? 26.711  11.847  25.457  1.00 29.68  ? 92  GLN B CG  1 
ATOM   4616 C  CD  . GLN B 1 91  ? 26.848  12.680  24.173  1.00 32.80  ? 92  GLN B CD  1 
ATOM   4617 O  OE1 . GLN B 1 91  ? 26.461  13.856  24.116  1.00 34.38  ? 92  GLN B OE1 1 
ATOM   4618 N  NE2 . GLN B 1 91  ? 27.381  12.051  23.124  1.00 32.62  ? 92  GLN B NE2 1 
ATOM   4619 N  N   . TYR B 1 92  ? 25.568  13.394  29.649  1.00 27.82  ? 93  TYR B N   1 
ATOM   4620 C  CA  . TYR B 1 92  ? 25.686  14.216  30.853  1.00 28.84  ? 93  TYR B CA  1 
ATOM   4621 C  C   . TYR B 1 92  ? 25.716  13.402  32.149  1.00 28.80  ? 93  TYR B C   1 
ATOM   4622 O  O   . TYR B 1 92  ? 26.483  13.713  33.065  1.00 28.75  ? 93  TYR B O   1 
ATOM   4623 C  CB  . TYR B 1 92  ? 24.592  15.290  30.917  1.00 29.31  ? 93  TYR B CB  1 
ATOM   4624 C  CG  . TYR B 1 92  ? 24.845  16.316  31.996  1.00 32.69  ? 93  TYR B CG  1 
ATOM   4625 C  CD1 . TYR B 1 92  ? 25.709  17.398  31.772  1.00 35.25  ? 93  TYR B CD1 1 
ATOM   4626 C  CD2 . TYR B 1 92  ? 24.243  16.198  33.257  1.00 35.54  ? 93  TYR B CD2 1 
ATOM   4627 C  CE1 . TYR B 1 92  ? 25.956  18.343  32.774  1.00 37.02  ? 93  TYR B CE1 1 
ATOM   4628 C  CE2 . TYR B 1 92  ? 24.482  17.135  34.263  1.00 37.35  ? 93  TYR B CE2 1 
ATOM   4629 C  CZ  . TYR B 1 92  ? 25.342  18.204  34.012  1.00 38.52  ? 93  TYR B CZ  1 
ATOM   4630 O  OH  . TYR B 1 92  ? 25.578  19.135  35.002  1.00 40.87  ? 93  TYR B OH  1 
ATOM   4631 N  N   . TYR B 1 93  ? 24.897  12.358  32.225  1.00 28.46  ? 94  TYR B N   1 
ATOM   4632 C  CA  . TYR B 1 93  ? 24.843  11.543  33.436  1.00 28.42  ? 94  TYR B CA  1 
ATOM   4633 C  C   . TYR B 1 93  ? 25.678  10.270  33.323  1.00 28.76  ? 94  TYR B C   1 
ATOM   4634 O  O   . TYR B 1 93  ? 25.582  9.372   34.165  1.00 28.85  ? 94  TYR B O   1 
ATOM   4635 C  CB  . TYR B 1 93  ? 23.394  11.270  33.838  1.00 28.12  ? 94  TYR B CB  1 
ATOM   4636 C  CG  . TYR B 1 93  ? 22.676  12.526  34.286  1.00 27.67  ? 94  TYR B CG  1 
ATOM   4637 C  CD1 . TYR B 1 93  ? 21.896  13.267  33.395  1.00 26.51  ? 94  TYR B CD1 1 
ATOM   4638 C  CD2 . TYR B 1 93  ? 22.810  12.998  35.594  1.00 27.55  ? 94  TYR B CD2 1 
ATOM   4639 C  CE1 . TYR B 1 93  ? 21.248  14.426  33.802  1.00 25.71  ? 94  TYR B CE1 1 
ATOM   4640 C  CE2 . TYR B 1 93  ? 22.160  14.152  36.010  1.00 27.16  ? 94  TYR B CE2 1 
ATOM   4641 C  CZ  . TYR B 1 93  ? 21.382  14.860  35.109  1.00 26.49  ? 94  TYR B CZ  1 
ATOM   4642 O  OH  . TYR B 1 93  ? 20.743  16.006  35.523  1.00 26.80  ? 94  TYR B OH  1 
ATOM   4643 N  N   . GLN B 1 94  ? 26.508  10.220  32.281  1.00 29.16  ? 95  GLN B N   1 
ATOM   4644 C  CA  . GLN B 1 94  ? 27.485  9.146   32.059  1.00 29.76  ? 95  GLN B CA  1 
ATOM   4645 C  C   . GLN B 1 94  ? 26.891  7.747   32.213  1.00 29.54  ? 95  GLN B C   1 
ATOM   4646 O  O   . GLN B 1 94  ? 27.463  6.863   32.870  1.00 29.92  ? 95  GLN B O   1 
ATOM   4647 C  CB  . GLN B 1 94  ? 28.700  9.331   32.966  1.00 30.28  ? 95  GLN B CB  1 
ATOM   4648 C  CG  . GLN B 1 94  ? 29.401  10.674  32.790  1.00 32.10  ? 95  GLN B CG  1 
ATOM   4649 C  CD  . GLN B 1 94  ? 30.705  10.743  33.563  1.00 35.50  ? 95  GLN B CD  1 
ATOM   4650 O  OE1 . GLN B 1 94  ? 31.782  10.873  32.971  1.00 37.55  ? 95  GLN B OE1 1 
ATOM   4651 N  NE2 . GLN B 1 94  ? 30.618  10.640  34.889  1.00 34.72  ? 95  GLN B NE2 1 
ATOM   4652 N  N   . ARG B 1 95  ? 25.734  7.561   31.593  1.00 29.03  ? 96  ARG B N   1 
ATOM   4653 C  CA  . ARG B 1 95  ? 25.034  6.298   31.628  1.00 28.73  ? 96  ARG B CA  1 
ATOM   4654 C  C   . ARG B 1 95  ? 25.498  5.417   30.476  1.00 28.07  ? 96  ARG B C   1 
ATOM   4655 O  O   . ARG B 1 95  ? 25.559  5.869   29.336  1.00 28.28  ? 96  ARG B O   1 
ATOM   4656 C  CB  . ARG B 1 95  ? 23.523  6.532   31.601  1.00 29.07  ? 96  ARG B CB  1 
ATOM   4657 C  CG  . ARG B 1 95  ? 22.813  6.071   32.868  1.00 30.56  ? 96  ARG B CG  1 
ATOM   4658 C  CD  . ARG B 1 95  ? 22.680  7.131   33.940  1.00 33.19  ? 96  ARG B CD  1 
ATOM   4659 N  NE  . ARG B 1 95  ? 21.998  6.553   35.093  1.00 36.40  ? 96  ARG B NE  1 
ATOM   4660 C  CZ  . ARG B 1 95  ? 21.612  7.217   36.180  1.00 39.40  ? 96  ARG B CZ  1 
ATOM   4661 N  NH1 . ARG B 1 95  ? 21.835  8.527   36.302  1.00 39.86  ? 96  ARG B NH1 1 
ATOM   4662 N  NH2 . ARG B 1 95  ? 20.993  6.558   37.158  1.00 39.75  ? 96  ARG B NH2 1 
ATOM   4663 N  N   . PRO B 1 96  ? 25.858  4.158   30.773  1.00 27.56  ? 97  PRO B N   1 
ATOM   4664 C  CA  . PRO B 1 96  ? 26.391  3.267   29.735  1.00 26.88  ? 97  PRO B CA  1 
ATOM   4665 C  C   . PRO B 1 96  ? 25.356  2.999   28.647  1.00 26.16  ? 97  PRO B C   1 
ATOM   4666 O  O   . PRO B 1 96  ? 24.186  2.767   28.942  1.00 25.77  ? 97  PRO B O   1 
ATOM   4667 C  CB  . PRO B 1 96  ? 26.724  1.986   30.506  1.00 26.85  ? 97  PRO B CB  1 
ATOM   4668 C  CG  . PRO B 1 96  ? 25.851  2.048   31.719  1.00 27.88  ? 97  PRO B CG  1 
ATOM   4669 C  CD  . PRO B 1 96  ? 25.773  3.490   32.084  1.00 27.29  ? 97  PRO B CD  1 
ATOM   4670 N  N   . ILE B 1 97  ? 25.801  3.062   27.398  1.00 25.59  ? 98  ILE B N   1 
ATOM   4671 C  CA  . ILE B 1 97  ? 24.913  3.002   26.254  1.00 24.77  ? 98  ILE B CA  1 
ATOM   4672 C  C   . ILE B 1 97  ? 24.894  1.611   25.650  1.00 24.33  ? 98  ILE B C   1 
ATOM   4673 O  O   . ILE B 1 97  ? 25.897  0.895   25.669  1.00 23.61  ? 98  ILE B O   1 
ATOM   4674 C  CB  . ILE B 1 97  ? 25.303  4.039   25.156  1.00 25.03  ? 98  ILE B CB  1 
ATOM   4675 C  CG1 . ILE B 1 97  ? 26.703  3.746   24.597  1.00 24.40  ? 98  ILE B CG1 1 
ATOM   4676 C  CG2 . ILE B 1 97  ? 25.167  5.476   25.699  1.00 24.99  ? 98  ILE B CG2 1 
ATOM   4677 C  CD1 . ILE B 1 97  ? 27.145  4.665   23.475  1.00 24.69  ? 98  ILE B CD1 1 
ATOM   4678 N  N   . GLY B 1 98  ? 23.737  1.242   25.111  1.00 23.56  ? 99  GLY B N   1 
ATOM   4679 C  CA  . GLY B 1 98  ? 23.591  -0.014  24.413  1.00 22.73  ? 99  GLY B CA  1 
ATOM   4680 C  C   . GLY B 1 98  ? 23.564  0.194   22.918  1.00 22.53  ? 99  GLY B C   1 
ATOM   4681 O  O   . GLY B 1 98  ? 23.892  1.268   22.405  1.00 22.41  ? 99  GLY B O   1 
ATOM   4682 N  N   . VAL B 1 99  ? 23.151  -0.854  22.227  1.00 22.19  ? 100 VAL B N   1 
ATOM   4683 C  CA  . VAL B 1 99  ? 23.146  -0.920  20.777  1.00 21.67  ? 100 VAL B CA  1 
ATOM   4684 C  C   . VAL B 1 99  ? 22.403  0.266   20.111  1.00 21.53  ? 100 VAL B C   1 
ATOM   4685 O  O   . VAL B 1 99  ? 22.823  0.753   19.055  1.00 21.42  ? 100 VAL B O   1 
ATOM   4686 C  CB  . VAL B 1 99  ? 22.604  -2.309  20.352  1.00 21.99  ? 100 VAL B CB  1 
ATOM   4687 C  CG1 . VAL B 1 99  ? 21.063  -2.416  20.542  1.00 21.26  ? 100 VAL B CG1 1 
ATOM   4688 C  CG2 . VAL B 1 99  ? 23.057  -2.691  18.968  1.00 22.55  ? 100 VAL B CG2 1 
ATOM   4689 N  N   . LEU B 1 100 ? 21.330  0.748   20.745  1.00 21.05  ? 101 LEU B N   1 
ATOM   4690 C  CA  . LEU B 1 100 ? 20.556  1.877   20.208  1.00 20.81  ? 101 LEU B CA  1 
ATOM   4691 C  C   . LEU B 1 100 ? 21.393  3.133   19.961  1.00 20.76  ? 101 LEU B C   1 
ATOM   4692 O  O   . LEU B 1 100 ? 21.206  3.798   18.950  1.00 19.92  ? 101 LEU B O   1 
ATOM   4693 C  CB  . LEU B 1 100 ? 19.369  2.230   21.114  1.00 20.51  ? 101 LEU B CB  1 
ATOM   4694 C  CG  . LEU B 1 100 ? 18.521  3.443   20.685  1.00 21.06  ? 101 LEU B CG  1 
ATOM   4695 C  CD1 . LEU B 1 100 ? 17.673  3.120   19.469  1.00 22.04  ? 101 LEU B CD1 1 
ATOM   4696 C  CD2 . LEU B 1 100 ? 17.644  3.945   21.812  1.00 20.18  ? 101 LEU B CD2 1 
ATOM   4697 N  N   . LEU B 1 101 ? 22.301  3.443   20.885  1.00 21.04  ? 102 LEU B N   1 
ATOM   4698 C  CA  . LEU B 1 101 ? 23.056  4.701   20.847  1.00 22.02  ? 102 LEU B CA  1 
ATOM   4699 C  C   . LEU B 1 101 ? 24.493  4.577   20.339  1.00 22.45  ? 102 LEU B C   1 
ATOM   4700 O  O   . LEU B 1 101 ? 25.201  5.581   20.217  1.00 22.89  ? 102 LEU B O   1 
ATOM   4701 C  CB  . LEU B 1 101 ? 23.042  5.380   22.218  1.00 21.83  ? 102 LEU B CB  1 
ATOM   4702 C  CG  . LEU B 1 101 ? 21.674  5.803   22.765  1.00 22.70  ? 102 LEU B CG  1 
ATOM   4703 C  CD1 . LEU B 1 101 ? 21.792  6.320   24.197  1.00 22.15  ? 102 LEU B CD1 1 
ATOM   4704 C  CD2 . LEU B 1 101 ? 21.011  6.842   21.870  1.00 22.83  ? 102 LEU B CD2 1 
ATOM   4705 N  N   . LYS B 1 102 ? 24.912  3.351   20.042  1.00 22.71  ? 103 LYS B N   1 
ATOM   4706 C  CA  . LYS B 1 102 ? 26.232  3.094   19.494  1.00 23.02  ? 103 LYS B CA  1 
ATOM   4707 C  C   . LYS B 1 102 ? 26.243  3.256   17.985  1.00 23.62  ? 103 LYS B C   1 
ATOM   4708 O  O   . LYS B 1 102 ? 25.186  3.372   17.355  1.00 23.93  ? 103 LYS B O   1 
ATOM   4709 C  CB  . LYS B 1 102 ? 26.715  1.688   19.873  1.00 22.75  ? 103 LYS B CB  1 
ATOM   4710 C  CG  . LYS B 1 102 ? 26.994  1.519   21.363  1.00 22.65  ? 103 LYS B CG  1 
ATOM   4711 C  CD  . LYS B 1 102 ? 27.684  0.202   21.676  1.00 22.31  ? 103 LYS B CD  1 
ATOM   4712 C  CE  . LYS B 1 102 ? 27.866  0.075   23.182  1.00 23.85  ? 103 LYS B CE  1 
ATOM   4713 N  NZ  . LYS B 1 102 ? 28.416  -1.225  23.606  1.00 22.77  ? 103 LYS B NZ  1 
ATOM   4714 N  N   . LYS B 1 103 ? 27.447  3.267   17.416  1.00 24.13  ? 104 LYS B N   1 
ATOM   4715 C  CA  . LYS B 1 103 ? 27.637  3.315   15.973  1.00 24.95  ? 104 LYS B CA  1 
ATOM   4716 C  C   . LYS B 1 103 ? 28.861  2.494   15.558  1.00 25.27  ? 104 LYS B C   1 
ATOM   4717 O  O   . LYS B 1 103 ? 29.632  2.036   16.414  1.00 24.94  ? 104 LYS B O   1 
ATOM   4718 C  CB  . LYS B 1 103 ? 27.752  4.768   15.495  1.00 25.39  ? 104 LYS B CB  1 
ATOM   4719 C  CG  . LYS B 1 103 ? 29.080  5.470   15.782  1.00 27.31  ? 104 LYS B CG  1 
ATOM   4720 C  CD  . LYS B 1 103 ? 28.905  6.993   15.690  1.00 31.83  ? 104 LYS B CD  1 
ATOM   4721 C  CE  . LYS B 1 103 ? 30.106  7.705   15.063  1.00 33.59  ? 104 LYS B CE  1 
ATOM   4722 N  NZ  . LYS B 1 103 ? 30.103  7.646   13.564  1.00 35.43  ? 104 LYS B NZ  1 
ATOM   4723 N  N   . SER B 1 104 ? 29.021  2.326   14.245  1.00 25.77  ? 105 SER B N   1 
ATOM   4724 C  CA  . SER B 1 104 ? 30.101  1.547   13.628  1.00 26.20  ? 105 SER B CA  1 
ATOM   4725 C  C   . SER B 1 104 ? 30.453  0.253   14.366  1.00 26.09  ? 105 SER B C   1 
ATOM   4726 O  O   . SER B 1 104 ? 29.554  -0.483  14.794  1.00 25.87  ? 105 SER B O   1 
ATOM   4727 C  CB  . SER B 1 104 ? 31.350  2.414   13.384  1.00 26.81  ? 105 SER B CB  1 
ATOM   4728 O  OG  . SER B 1 104 ? 31.866  2.910   14.601  1.00 28.03  ? 105 SER B OG  1 
ATOM   4729 N  N   . ALA B 1 105 ? 31.755  -0.010  14.509  1.00 25.66  ? 106 ALA B N   1 
ATOM   4730 C  CA  . ALA B 1 105 ? 32.259  -1.290  15.021  1.00 25.43  ? 106 ALA B CA  1 
ATOM   4731 C  C   . ALA B 1 105 ? 31.723  -1.652  16.403  1.00 25.08  ? 106 ALA B C   1 
ATOM   4732 O  O   . ALA B 1 105 ? 31.378  -2.818  16.653  1.00 25.14  ? 106 ALA B O   1 
ATOM   4733 C  CB  . ALA B 1 105 ? 33.808  -1.312  15.017  1.00 25.64  ? 106 ALA B CB  1 
ATOM   4734 N  N   . ALA B 1 106 ? 31.658  -0.657  17.289  1.00 24.06  ? 107 ALA B N   1 
ATOM   4735 C  CA  . ALA B 1 106 ? 31.105  -0.856  18.618  1.00 23.94  ? 107 ALA B CA  1 
ATOM   4736 C  C   . ALA B 1 106 ? 29.632  -1.296  18.561  1.00 23.86  ? 107 ALA B C   1 
ATOM   4737 O  O   . ALA B 1 106 ? 29.196  -2.099  19.387  1.00 23.44  ? 107 ALA B O   1 
ATOM   4738 C  CB  . ALA B 1 106 ? 31.272  0.396   19.476  1.00 23.60  ? 107 ALA B CB  1 
ATOM   4739 N  N   . TRP B 1 107 ? 28.881  -0.768  17.592  1.00 23.73  ? 108 TRP B N   1 
ATOM   4740 C  CA  . TRP B 1 107 ? 27.493  -1.170  17.399  1.00 23.90  ? 108 TRP B CA  1 
ATOM   4741 C  C   . TRP B 1 107 ? 27.432  -2.608  16.894  1.00 24.19  ? 108 TRP B C   1 
ATOM   4742 O  O   . TRP B 1 107 ? 26.670  -3.423  17.423  1.00 23.85  ? 108 TRP B O   1 
ATOM   4743 C  CB  . TRP B 1 107 ? 26.740  -0.238  16.430  1.00 23.55  ? 108 TRP B CB  1 
ATOM   4744 C  CG  . TRP B 1 107 ? 25.424  -0.845  15.989  1.00 23.60  ? 108 TRP B CG  1 
ATOM   4745 C  CD1 . TRP B 1 107 ? 24.250  -0.829  16.682  1.00 23.02  ? 108 TRP B CD1 1 
ATOM   4746 C  CD2 . TRP B 1 107 ? 25.174  -1.608  14.794  1.00 22.92  ? 108 TRP B CD2 1 
ATOM   4747 N  NE1 . TRP B 1 107 ? 23.282  -1.516  15.994  1.00 24.36  ? 108 TRP B NE1 1 
ATOM   4748 C  CE2 . TRP B 1 107 ? 23.820  -2.003  14.829  1.00 23.76  ? 108 TRP B CE2 1 
ATOM   4749 C  CE3 . TRP B 1 107 ? 25.957  -1.978  13.692  1.00 22.45  ? 108 TRP B CE3 1 
ATOM   4750 C  CZ2 . TRP B 1 107 ? 23.227  -2.761  13.804  1.00 22.50  ? 108 TRP B CZ2 1 
ATOM   4751 C  CZ3 . TRP B 1 107 ? 25.367  -2.725  12.668  1.00 22.43  ? 108 TRP B CZ3 1 
ATOM   4752 C  CH2 . TRP B 1 107 ? 24.012  -3.108  12.735  1.00 22.10  ? 108 TRP B CH2 1 
ATOM   4753 N  N   . LYS B 1 108 ? 28.243  -2.901  15.879  1.00 24.89  ? 109 LYS B N   1 
ATOM   4754 C  CA  . LYS B 1 108 ? 28.280  -4.215  15.235  1.00 25.92  ? 109 LYS B CA  1 
ATOM   4755 C  C   . LYS B 1 108 ? 28.540  -5.341  16.237  1.00 26.23  ? 109 LYS B C   1 
ATOM   4756 O  O   . LYS B 1 108 ? 27.910  -6.395  16.161  1.00 26.10  ? 109 LYS B O   1 
ATOM   4757 C  CB  . LYS B 1 108 ? 29.338  -4.220  14.118  1.00 26.32  ? 109 LYS B CB  1 
ATOM   4758 C  CG  . LYS B 1 108 ? 29.401  -5.487  13.259  1.00 27.94  ? 109 LYS B CG  1 
ATOM   4759 C  CD  . LYS B 1 108 ? 28.131  -5.680  12.429  1.00 31.32  ? 109 LYS B CD  1 
ATOM   4760 C  CE  . LYS B 1 108 ? 28.270  -6.855  11.473  1.00 33.22  ? 109 LYS B CE  1 
ATOM   4761 N  NZ  . LYS B 1 108 ? 26.989  -7.086  10.749  1.00 35.25  ? 109 LYS B NZ  1 
ATOM   4762 N  N   . LYS B 1 109 ? 29.450  -5.091  17.180  1.00 26.56  ? 110 LYS B N   1 
ATOM   4763 C  CA  . LYS B 1 109 ? 29.888  -6.093  18.156  1.00 27.16  ? 110 LYS B CA  1 
ATOM   4764 C  C   . LYS B 1 109 ? 28.781  -6.450  19.151  1.00 26.78  ? 110 LYS B C   1 
ATOM   4765 O  O   . LYS B 1 109 ? 28.577  -7.624  19.459  1.00 26.71  ? 110 LYS B O   1 
ATOM   4766 C  CB  . LYS B 1 109 ? 31.159  -5.616  18.879  1.00 27.61  ? 110 LYS B CB  1 
ATOM   4767 C  CG  . LYS B 1 109 ? 31.693  -6.576  19.944  1.00 29.55  ? 110 LYS B CG  1 
ATOM   4768 C  CD  . LYS B 1 109 ? 32.971  -6.038  20.600  1.00 32.74  ? 110 LYS B CD  1 
ATOM   4769 C  CE  . LYS B 1 109 ? 33.229  -6.731  21.931  1.00 34.77  ? 110 LYS B CE  1 
ATOM   4770 N  NZ  . LYS B 1 109 ? 34.610  -6.485  22.432  1.00 36.31  ? 110 LYS B NZ  1 
ATOM   4771 N  N   . ASP B 1 110 ? 28.070  -5.439  19.647  1.00 26.38  ? 111 ASP B N   1 
ATOM   4772 C  CA  . ASP B 1 110 ? 26.870  -5.676  20.447  1.00 25.68  ? 111 ASP B CA  1 
ATOM   4773 C  C   . ASP B 1 110 ? 25.795  -6.366  19.619  1.00 25.22  ? 111 ASP B C   1 
ATOM   4774 O  O   . ASP B 1 110 ? 25.209  -7.353  20.066  1.00 25.38  ? 111 ASP B O   1 
ATOM   4775 C  CB  . ASP B 1 110 ? 26.316  -4.374  21.036  1.00 25.69  ? 111 ASP B CB  1 
ATOM   4776 C  CG  . ASP B 1 110 ? 27.044  -3.939  22.294  1.00 26.65  ? 111 ASP B CG  1 
ATOM   4777 O  OD1 . ASP B 1 110 ? 28.141  -4.477  22.574  1.00 27.34  ? 111 ASP B OD1 1 
ATOM   4778 O  OD2 . ASP B 1 110 ? 26.522  -3.046  23.002  1.00 26.99  ? 111 ASP B OD2 1 
ATOM   4779 N  N   . ARG B 1 111 ? 25.541  -5.860  18.414  1.00 24.54  ? 112 ARG B N   1 
ATOM   4780 C  CA  . ARG B 1 111 ? 24.427  -6.369  17.610  1.00 24.28  ? 112 ARG B CA  1 
ATOM   4781 C  C   . ARG B 1 111 ? 24.591  -7.847  17.293  1.00 24.46  ? 112 ARG B C   1 
ATOM   4782 O  O   . ARG B 1 111 ? 23.641  -8.621  17.435  1.00 24.44  ? 112 ARG B O   1 
ATOM   4783 C  CB  . ARG B 1 111 ? 24.241  -5.573  16.311  1.00 23.96  ? 112 ARG B CB  1 
ATOM   4784 C  CG  . ARG B 1 111 ? 22.980  -5.954  15.509  1.00 22.94  ? 112 ARG B CG  1 
ATOM   4785 C  CD  . ARG B 1 111 ? 21.682  -5.743  16.302  1.00 20.60  ? 112 ARG B CD  1 
ATOM   4786 N  NE  . ARG B 1 111 ? 20.523  -6.278  15.587  1.00 19.73  ? 112 ARG B NE  1 
ATOM   4787 C  CZ  . ARG B 1 111 ? 19.489  -5.564  15.135  1.00 18.80  ? 112 ARG B CZ  1 
ATOM   4788 N  NH1 . ARG B 1 111 ? 19.416  -4.248  15.323  1.00 15.69  ? 112 ARG B NH1 1 
ATOM   4789 N  NH2 . ARG B 1 111 ? 18.509  -6.181  14.490  1.00 16.43  ? 112 ARG B NH2 1 
ATOM   4790 N  N   . VAL B 1 112 ? 25.794  -8.222  16.856  1.00 24.58  ? 113 VAL B N   1 
ATOM   4791 C  CA  . VAL B 1 112 ? 26.110  -9.608  16.509  1.00 24.50  ? 113 VAL B CA  1 
ATOM   4792 C  C   . VAL B 1 112 ? 25.943  -10.531 17.713  1.00 23.94  ? 113 VAL B C   1 
ATOM   4793 O  O   . VAL B 1 112 ? 25.325  -11.577 17.599  1.00 24.21  ? 113 VAL B O   1 
ATOM   4794 C  CB  . VAL B 1 112 ? 27.521  -9.732  15.858  1.00 24.98  ? 113 VAL B CB  1 
ATOM   4795 C  CG1 . VAL B 1 112 ? 28.019  -11.181 15.864  1.00 26.13  ? 113 VAL B CG1 1 
ATOM   4796 C  CG2 . VAL B 1 112 ? 27.483  -9.199  14.432  1.00 25.14  ? 113 VAL B CG2 1 
ATOM   4797 N  N   . ALA B 1 113 ? 26.454  -10.132 18.872  1.00 23.51  ? 114 ALA B N   1 
ATOM   4798 C  CA  . ALA B 1 113 ? 26.293  -10.941 20.087  1.00 22.94  ? 114 ALA B CA  1 
ATOM   4799 C  C   . ALA B 1 113 ? 24.834  -11.044 20.554  1.00 22.84  ? 114 ALA B C   1 
ATOM   4800 O  O   . ALA B 1 113 ? 24.404  -12.091 21.052  1.00 22.33  ? 114 ALA B O   1 
ATOM   4801 C  CB  . ALA B 1 113 ? 27.155  -10.408 21.193  1.00 22.64  ? 114 ALA B CB  1 
ATOM   4802 N  N   . LEU B 1 114 ? 24.086  -9.952  20.401  1.00 22.59  ? 115 LEU B N   1 
ATOM   4803 C  CA  . LEU B 1 114 ? 22.676  -9.926  20.775  1.00 22.14  ? 115 LEU B CA  1 
ATOM   4804 C  C   . LEU B 1 114 ? 21.813  -10.721 19.797  1.00 22.28  ? 115 LEU B C   1 
ATOM   4805 O  O   . LEU B 1 114 ? 20.909  -11.448 20.216  1.00 22.10  ? 115 LEU B O   1 
ATOM   4806 C  CB  . LEU B 1 114 ? 22.166  -8.490  20.881  1.00 21.90  ? 115 LEU B CB  1 
ATOM   4807 C  CG  . LEU B 1 114 ? 22.713  -7.669  22.047  1.00 21.41  ? 115 LEU B CG  1 
ATOM   4808 C  CD1 . LEU B 1 114 ? 22.404  -6.206  21.796  1.00 20.45  ? 115 LEU B CD1 1 
ATOM   4809 C  CD2 . LEU B 1 114 ? 22.163  -8.155  23.389  1.00 20.31  ? 115 LEU B CD2 1 
ATOM   4810 N  N   . ASN B 1 115 ? 22.094  -10.583 18.501  1.00 22.35  ? 116 ASN B N   1 
ATOM   4811 C  CA  . ASN B 1 115 ? 21.379  -11.341 17.470  1.00 22.67  ? 116 ASN B CA  1 
ATOM   4812 C  C   . ASN B 1 115 ? 21.351  -12.842 17.754  1.00 23.34  ? 116 ASN B C   1 
ATOM   4813 O  O   . ASN B 1 115 ? 20.320  -13.490 17.587  1.00 23.52  ? 116 ASN B O   1 
ATOM   4814 C  CB  . ASN B 1 115 ? 21.973  -11.074 16.088  1.00 22.16  ? 116 ASN B CB  1 
ATOM   4815 C  CG  . ASN B 1 115 ? 21.442  -9.794  15.455  1.00 21.96  ? 116 ASN B CG  1 
ATOM   4816 O  OD1 . ASN B 1 115 ? 20.527  -9.145  15.976  1.00 19.31  ? 116 ASN B OD1 1 
ATOM   4817 N  ND2 . ASN B 1 115 ? 22.015  -9.429  14.321  1.00 21.10  ? 116 ASN B ND2 1 
ATOM   4818 N  N   . GLN B 1 116 ? 22.473  -13.381 18.222  1.00 23.86  ? 117 GLN B N   1 
ATOM   4819 C  CA  . GLN B 1 116 ? 22.581  -14.812 18.477  1.00 25.20  ? 117 GLN B CA  1 
ATOM   4820 C  C   . GLN B 1 116 ? 21.636  -15.283 19.581  1.00 24.56  ? 117 GLN B C   1 
ATOM   4821 O  O   . GLN B 1 116 ? 21.218  -16.436 19.591  1.00 24.82  ? 117 GLN B O   1 
ATOM   4822 C  CB  . GLN B 1 116 ? 24.035  -15.205 18.771  1.00 25.60  ? 117 GLN B CB  1 
ATOM   4823 C  CG  . GLN B 1 116 ? 24.991  -14.672 17.696  1.00 29.91  ? 117 GLN B CG  1 
ATOM   4824 C  CD  . GLN B 1 116 ? 26.218  -15.538 17.460  1.00 34.52  ? 117 GLN B CD  1 
ATOM   4825 O  OE1 . GLN B 1 116 ? 26.152  -16.552 16.758  1.00 37.18  ? 117 GLN B OE1 1 
ATOM   4826 N  NE2 . GLN B 1 116 ? 27.353  -15.122 18.019  1.00 34.68  ? 117 GLN B NE2 1 
ATOM   4827 N  N   . GLU B 1 117 ? 21.273  -14.381 20.484  1.00 24.25  ? 118 GLU B N   1 
ATOM   4828 C  CA  . GLU B 1 117 ? 20.401  -14.749 21.598  1.00 23.81  ? 118 GLU B CA  1 
ATOM   4829 C  C   . GLU B 1 117 ? 18.945  -14.285 21.479  1.00 23.43  ? 118 GLU B C   1 
ATOM   4830 O  O   . GLU B 1 117 ? 18.091  -14.760 22.226  1.00 22.87  ? 118 GLU B O   1 
ATOM   4831 C  CB  . GLU B 1 117 ? 21.015  -14.308 22.929  1.00 23.80  ? 118 GLU B CB  1 
ATOM   4832 C  CG  . GLU B 1 117 ? 22.334  -15.029 23.283  1.00 24.88  ? 118 GLU B CG  1 
ATOM   4833 C  CD  . GLU B 1 117 ? 22.238  -16.568 23.292  1.00 26.77  ? 118 GLU B CD  1 
ATOM   4834 O  OE1 . GLU B 1 117 ? 21.123  -17.132 23.400  1.00 27.14  ? 118 GLU B OE1 1 
ATOM   4835 O  OE2 . GLU B 1 117 ? 23.304  -17.220 23.201  1.00 28.57  ? 118 GLU B OE2 1 
ATOM   4836 N  N   . VAL B 1 118 ? 18.658  -13.386 20.535  1.00 23.37  ? 119 VAL B N   1 
ATOM   4837 C  CA  . VAL B 1 118 ? 17.309  -12.798 20.419  1.00 23.33  ? 119 VAL B CA  1 
ATOM   4838 C  C   . VAL B 1 118 ? 16.699  -12.823 19.012  1.00 23.53  ? 119 VAL B C   1 
ATOM   4839 O  O   . VAL B 1 118 ? 15.488  -12.672 18.861  1.00 23.37  ? 119 VAL B O   1 
ATOM   4840 C  CB  . VAL B 1 118 ? 17.239  -11.339 20.999  1.00 23.41  ? 119 VAL B CB  1 
ATOM   4841 C  CG1 . VAL B 1 118 ? 18.034  -11.225 22.310  1.00 23.47  ? 119 VAL B CG1 1 
ATOM   4842 C  CG2 . VAL B 1 118 ? 17.739  -10.325 19.996  1.00 22.34  ? 119 VAL B CG2 1 
ATOM   4843 N  N   . MET B 1 119 ? 17.530  -12.978 17.984  1.00 24.11  ? 120 MET B N   1 
ATOM   4844 C  CA  . MET B 1 119 ? 17.030  -13.012 16.605  1.00 24.65  ? 120 MET B CA  1 
ATOM   4845 C  C   . MET B 1 119 ? 17.107  -14.422 16.014  1.00 24.67  ? 120 MET B C   1 
ATOM   4846 O  O   . MET B 1 119 ? 16.213  -14.836 15.268  1.00 24.55  ? 120 MET B O   1 
ATOM   4847 C  CB  . MET B 1 119 ? 17.779  -12.018 15.705  1.00 24.79  ? 120 MET B CB  1 
ATOM   4848 C  CG  . MET B 1 119 ? 17.526  -10.523 15.980  1.00 27.29  ? 120 MET B CG  1 
ATOM   4849 S  SD  . MET B 1 119 ? 15.891  -9.861  15.528  1.00 35.19  ? 120 MET B SD  1 
ATOM   4850 C  CE  . MET B 1 119 ? 15.747  -10.225 13.777  1.00 32.41  ? 120 MET B CE  1 
ATOM   4851 N  N   . ALA B 1 120 ? 18.171  -15.148 16.364  1.00 24.86  ? 121 ALA B N   1 
ATOM   4852 C  CA  . ALA B 1 120 ? 18.466  -16.477 15.794  1.00 25.38  ? 121 ALA B CA  1 
ATOM   4853 C  C   . ALA B 1 120 ? 17.404  -17.531 16.144  1.00 25.22  ? 121 ALA B C   1 
ATOM   4854 O  O   . ALA B 1 120 ? 17.004  -17.638 17.303  1.00 24.99  ? 121 ALA B O   1 
ATOM   4855 C  CB  . ALA B 1 120 ? 19.863  -16.949 16.229  1.00 24.86  ? 121 ALA B CB  1 
ATOM   4856 N  N   . PRO B 1 121 ? 16.953  -18.312 15.139  1.00 25.65  ? 122 PRO B N   1 
ATOM   4857 C  CA  . PRO B 1 121 ? 15.889  -19.310 15.324  1.00 26.09  ? 122 PRO B CA  1 
ATOM   4858 C  C   . PRO B 1 121 ? 16.210  -20.322 16.415  1.00 26.48  ? 122 PRO B C   1 
ATOM   4859 O  O   . PRO B 1 121 ? 15.330  -20.704 17.177  1.00 26.68  ? 122 PRO B O   1 
ATOM   4860 C  CB  . PRO B 1 121 ? 15.817  -20.011 13.961  1.00 26.10  ? 122 PRO B CB  1 
ATOM   4861 C  CG  . PRO B 1 121 ? 16.388  -19.021 12.992  1.00 26.20  ? 122 PRO B CG  1 
ATOM   4862 C  CD  . PRO B 1 121 ? 17.456  -18.300 13.751  1.00 25.58  ? 122 PRO B CD  1 
ATOM   4863 N  N   . GLU B 1 122 ? 17.473  -20.722 16.498  1.00 27.16  ? 123 GLU B N   1 
ATOM   4864 C  CA  . GLU B 1 122 ? 17.933  -21.682 17.495  1.00 28.05  ? 123 GLU B CA  1 
ATOM   4865 C  C   . GLU B 1 122 ? 17.690  -21.166 18.903  1.00 27.34  ? 123 GLU B C   1 
ATOM   4866 O  O   . GLU B 1 122 ? 17.479  -21.954 19.826  1.00 27.53  ? 123 GLU B O   1 
ATOM   4867 C  CB  . GLU B 1 122 ? 19.426  -21.982 17.303  1.00 28.77  ? 123 GLU B CB  1 
ATOM   4868 C  CG  . GLU B 1 122 ? 19.779  -22.560 15.924  1.00 32.87  ? 123 GLU B CG  1 
ATOM   4869 C  CD  . GLU B 1 122 ? 19.836  -21.507 14.805  1.00 37.74  ? 123 GLU B CD  1 
ATOM   4870 O  OE1 . GLU B 1 122 ? 20.073  -20.304 15.100  1.00 38.08  ? 123 GLU B OE1 1 
ATOM   4871 O  OE2 . GLU B 1 122 ? 19.656  -21.898 13.622  1.00 39.98  ? 123 GLU B OE2 1 
ATOM   4872 N  N   . ALA B 1 123 ? 17.747  -19.845 19.064  1.00 26.45  ? 124 ALA B N   1 
ATOM   4873 C  CA  . ALA B 1 123 ? 17.459  -19.207 20.347  1.00 25.52  ? 124 ALA B CA  1 
ATOM   4874 C  C   . ALA B 1 123 ? 15.963  -18.920 20.537  1.00 24.94  ? 124 ALA B C   1 
ATOM   4875 O  O   . ALA B 1 123 ? 15.400  -19.239 21.583  1.00 24.83  ? 124 ALA B O   1 
ATOM   4876 C  CB  . ALA B 1 123 ? 18.276  -17.935 20.506  1.00 25.40  ? 124 ALA B CB  1 
ATOM   4877 N  N   . THR B 1 124 ? 15.319  -18.350 19.521  1.00 24.39  ? 125 THR B N   1 
ATOM   4878 C  CA  . THR B 1 124 ? 13.939  -17.866 19.670  1.00 24.24  ? 125 THR B CA  1 
ATOM   4879 C  C   . THR B 1 124 ? 12.901  -18.977 19.880  1.00 24.10  ? 125 THR B C   1 
ATOM   4880 O  O   . THR B 1 124 ? 11.866  -18.746 20.502  1.00 23.70  ? 125 THR B O   1 
ATOM   4881 C  CB  . THR B 1 124 ? 13.499  -16.943 18.498  1.00 24.40  ? 125 THR B CB  1 
ATOM   4882 O  OG1 . THR B 1 124 ? 13.434  -17.698 17.284  1.00 24.45  ? 125 THR B OG1 1 
ATOM   4883 C  CG2 . THR B 1 124 ? 14.468  -15.768 18.328  1.00 23.26  ? 125 THR B CG2 1 
ATOM   4884 N  N   . LYS B 1 125 ? 13.186  -20.175 19.374  1.00 23.91  ? 126 LYS B N   1 
ATOM   4885 C  CA  . LYS B 1 125 ? 12.316  -21.326 19.605  1.00 24.10  ? 126 LYS B CA  1 
ATOM   4886 C  C   . LYS B 1 125 ? 12.068  -21.544 21.107  1.00 23.32  ? 126 LYS B C   1 
ATOM   4887 O  O   . LYS B 1 125 ? 11.004  -21.998 21.495  1.00 22.89  ? 126 LYS B O   1 
ATOM   4888 C  CB  . LYS B 1 125 ? 12.884  -22.592 18.947  1.00 24.68  ? 126 LYS B CB  1 
ATOM   4889 C  CG  . LYS B 1 125 ? 14.273  -22.981 19.439  1.00 27.13  ? 126 LYS B CG  1 
ATOM   4890 C  CD  . LYS B 1 125 ? 14.724  -24.339 18.916  1.00 31.24  ? 126 LYS B CD  1 
ATOM   4891 C  CE  . LYS B 1 125 ? 15.965  -24.820 19.680  1.00 32.83  ? 126 LYS B CE  1 
ATOM   4892 N  NZ  . LYS B 1 125 ? 16.365  -26.199 19.272  1.00 36.05  ? 126 LYS B NZ  1 
ATOM   4893 N  N   . ASN B 1 126 ? 13.040  -21.183 21.942  1.00 22.93  ? 127 ASN B N   1 
ATOM   4894 C  CA  . ASN B 1 126 ? 12.886  -21.274 23.397  1.00 22.71  ? 127 ASN B CA  1 
ATOM   4895 C  C   . ASN B 1 126 ? 11.953  -20.219 23.998  1.00 22.30  ? 127 ASN B C   1 
ATOM   4896 O  O   . ASN B 1 126 ? 11.558  -20.328 25.158  1.00 22.14  ? 127 ASN B O   1 
ATOM   4897 C  CB  . ASN B 1 126 ? 14.244  -21.200 24.092  1.00 22.87  ? 127 ASN B CB  1 
ATOM   4898 C  CG  . ASN B 1 126 ? 15.183  -22.297 23.654  1.00 24.15  ? 127 ASN B CG  1 
ATOM   4899 O  OD1 . ASN B 1 126 ? 14.909  -23.482 23.852  1.00 27.00  ? 127 ASN B OD1 1 
ATOM   4900 N  ND2 . ASN B 1 126 ? 16.298  -21.912 23.043  1.00 24.00  ? 127 ASN B ND2 1 
ATOM   4901 N  N   . PHE B 1 127 ? 11.596  -19.201 23.218  1.00 21.79  ? 128 PHE B N   1 
ATOM   4902 C  CA  . PHE B 1 127 ? 10.719  -18.143 23.731  1.00 21.29  ? 128 PHE B CA  1 
ATOM   4903 C  C   . PHE B 1 127 ? 9.270   -18.599 23.866  1.00 21.25  ? 128 PHE B C   1 
ATOM   4904 O  O   . PHE B 1 127 ? 8.527   -18.061 24.695  1.00 21.35  ? 128 PHE B O   1 
ATOM   4905 C  CB  . PHE B 1 127 ? 10.784  -16.870 22.867  1.00 21.09  ? 128 PHE B CB  1 
ATOM   4906 C  CG  . PHE B 1 127 ? 12.156  -16.224 22.791  1.00 20.72  ? 128 PHE B CG  1 
ATOM   4907 C  CD1 . PHE B 1 127 ? 13.159  -16.527 23.713  1.00 20.78  ? 128 PHE B CD1 1 
ATOM   4908 C  CD2 . PHE B 1 127 ? 12.426  -15.285 21.805  1.00 19.74  ? 128 PHE B CD2 1 
ATOM   4909 C  CE1 . PHE B 1 127 ? 14.414  -15.918 23.635  1.00 21.46  ? 128 PHE B CE1 1 
ATOM   4910 C  CE2 . PHE B 1 127 ? 13.681  -14.666 21.722  1.00 20.51  ? 128 PHE B CE2 1 
ATOM   4911 C  CZ  . PHE B 1 127 ? 14.674  -14.982 22.642  1.00 20.11  ? 128 PHE B CZ  1 
ATOM   4912 N  N   . LEU B 1 128 ? 8.871   -19.584 23.054  1.00 21.04  ? 129 LEU B N   1 
ATOM   4913 C  CA  . LEU B 1 128 ? 7.454   -19.961 22.922  1.00 21.02  ? 129 LEU B CA  1 
ATOM   4914 C  C   . LEU B 1 128 ? 6.738   -20.265 24.238  1.00 20.69  ? 129 LEU B C   1 
ATOM   4915 O  O   . LEU B 1 128 ? 5.715   -19.647 24.514  1.00 21.00  ? 129 LEU B O   1 
ATOM   4916 C  CB  . LEU B 1 128 ? 7.236   -21.096 21.902  1.00 21.14  ? 129 LEU B CB  1 
ATOM   4917 C  CG  . LEU B 1 128 ? 7.874   -20.997 20.513  1.00 22.43  ? 129 LEU B CG  1 
ATOM   4918 C  CD1 . LEU B 1 128 ? 7.210   -21.981 19.556  1.00 23.72  ? 129 LEU B CD1 1 
ATOM   4919 C  CD2 . LEU B 1 128 ? 7.816   -19.588 19.939  1.00 22.94  ? 129 LEU B CD2 1 
ATOM   4920 N  N   . PRO B 1 129 ? 7.265   -21.204 25.057  1.00 20.53  ? 130 PRO B N   1 
ATOM   4921 C  CA  . PRO B 1 129 ? 6.548   -21.503 26.308  1.00 20.23  ? 130 PRO B CA  1 
ATOM   4922 C  C   . PRO B 1 129 ? 6.538   -20.338 27.305  1.00 19.94  ? 130 PRO B C   1 
ATOM   4923 O  O   . PRO B 1 129 ? 5.597   -20.205 28.095  1.00 19.77  ? 130 PRO B O   1 
ATOM   4924 C  CB  . PRO B 1 129 ? 7.325   -22.692 26.891  1.00 20.39  ? 130 PRO B CB  1 
ATOM   4925 C  CG  . PRO B 1 129 ? 8.666   -22.667 26.208  1.00 20.35  ? 130 PRO B CG  1 
ATOM   4926 C  CD  . PRO B 1 129 ? 8.414   -22.112 24.850  1.00 20.41  ? 130 PRO B CD  1 
ATOM   4927 N  N   . LEU B 1 130 ? 7.578   -19.506 27.260  1.00 19.66  ? 131 LEU B N   1 
ATOM   4928 C  CA  . LEU B 1 130 ? 7.695   -18.349 28.158  1.00 19.15  ? 131 LEU B CA  1 
ATOM   4929 C  C   . LEU B 1 130 ? 6.656   -17.287 27.813  1.00 18.91  ? 131 LEU B C   1 
ATOM   4930 O  O   . LEU B 1 130 ? 6.042   -16.693 28.708  1.00 18.84  ? 131 LEU B O   1 
ATOM   4931 C  CB  . LEU B 1 130 ? 9.103   -17.752 28.089  1.00 18.77  ? 131 LEU B CB  1 
ATOM   4932 C  CG  . LEU B 1 130 ? 10.217  -18.627 28.673  1.00 19.50  ? 131 LEU B CG  1 
ATOM   4933 C  CD1 . LEU B 1 130 ? 11.593  -18.017 28.386  1.00 18.85  ? 131 LEU B CD1 1 
ATOM   4934 C  CD2 . LEU B 1 130 ? 10.020  -18.853 30.178  1.00 19.00  ? 131 LEU B CD2 1 
ATOM   4935 N  N   . LEU B 1 131 ? 6.459   -17.068 26.512  1.00 18.24  ? 132 LEU B N   1 
ATOM   4936 C  CA  . LEU B 1 131 ? 5.505   -16.069 26.039  1.00 17.74  ? 132 LEU B CA  1 
ATOM   4937 C  C   . LEU B 1 131 ? 4.081   -16.601 26.152  1.00 17.65  ? 132 LEU B C   1 
ATOM   4938 O  O   . LEU B 1 131 ? 3.177   -15.872 26.548  1.00 17.63  ? 132 LEU B O   1 
ATOM   4939 C  CB  . LEU B 1 131 ? 5.820   -15.638 24.596  1.00 17.20  ? 132 LEU B CB  1 
ATOM   4940 C  CG  . LEU B 1 131 ? 7.168   -14.942 24.323  1.00 15.41  ? 132 LEU B CG  1 
ATOM   4941 C  CD1 . LEU B 1 131 ? 7.393   -14.825 22.843  1.00 13.24  ? 132 LEU B CD1 1 
ATOM   4942 C  CD2 . LEU B 1 131 ? 7.256   -13.575 24.956  1.00 13.93  ? 132 LEU B CD2 1 
ATOM   4943 N  N   . ASP B 1 132 ? 3.894   -17.875 25.810  1.00 17.55  ? 133 ASP B N   1 
ATOM   4944 C  CA  . ASP B 1 132 ? 2.586   -18.523 25.899  1.00 17.97  ? 133 ASP B CA  1 
ATOM   4945 C  C   . ASP B 1 132 ? 2.047   -18.541 27.325  1.00 17.73  ? 133 ASP B C   1 
ATOM   4946 O  O   . ASP B 1 132 ? 0.870   -18.310 27.529  1.00 17.97  ? 133 ASP B O   1 
ATOM   4947 C  CB  . ASP B 1 132 ? 2.656   -19.949 25.350  1.00 18.28  ? 133 ASP B CB  1 
ATOM   4948 C  CG  . ASP B 1 132 ? 1.290   -20.517 24.984  1.00 20.10  ? 133 ASP B CG  1 
ATOM   4949 O  OD1 . ASP B 1 132 ? 1.193   -21.765 24.909  1.00 23.16  ? 133 ASP B OD1 1 
ATOM   4950 O  OD2 . ASP B 1 132 ? 0.324   -19.744 24.753  1.00 19.79  ? 133 ASP B OD2 1 
ATOM   4951 N  N   . ALA B 1 133 ? 2.911   -18.817 28.302  1.00 17.34  ? 134 ALA B N   1 
ATOM   4952 C  CA  . ALA B 1 133 ? 2.525   -18.753 29.715  1.00 17.30  ? 134 ALA B CA  1 
ATOM   4953 C  C   . ALA B 1 133 ? 1.952   -17.384 30.092  1.00 17.01  ? 134 ALA B C   1 
ATOM   4954 O  O   . ALA B 1 133 ? 0.990   -17.305 30.857  1.00 17.59  ? 134 ALA B O   1 
ATOM   4955 C  CB  . ALA B 1 133 ? 3.727   -19.109 30.635  1.00 17.24  ? 134 ALA B CB  1 
ATOM   4956 N  N   . VAL B 1 134 ? 2.534   -16.310 29.565  1.00 16.31  ? 135 VAL B N   1 
ATOM   4957 C  CA  . VAL B 1 134 ? 2.076   -14.957 29.931  1.00 16.04  ? 135 VAL B CA  1 
ATOM   4958 C  C   . VAL B 1 134 ? 0.720   -14.669 29.272  1.00 16.00  ? 135 VAL B C   1 
ATOM   4959 O  O   . VAL B 1 134 ? -0.209  -14.187 29.927  1.00 14.77  ? 135 VAL B O   1 
ATOM   4960 C  CB  . VAL B 1 134 ? 3.124   -13.856 29.604  1.00 15.57  ? 135 VAL B CB  1 
ATOM   4961 C  CG1 . VAL B 1 134 ? 2.605   -12.482 30.011  1.00 15.54  ? 135 VAL B CG1 1 
ATOM   4962 C  CG2 . VAL B 1 134 ? 4.444   -14.144 30.323  1.00 15.69  ? 135 VAL B CG2 1 
ATOM   4963 N  N   . SER B 1 135 ? 0.611   -15.030 27.993  1.00 16.43  ? 136 SER B N   1 
ATOM   4964 C  CA  . SER B 1 135 ? -0.637  -14.884 27.239  1.00 17.45  ? 136 SER B CA  1 
ATOM   4965 C  C   . SER B 1 135 ? -1.791  -15.688 27.830  1.00 17.62  ? 136 SER B C   1 
ATOM   4966 O  O   . SER B 1 135 ? -2.917  -15.206 27.869  1.00 17.23  ? 136 SER B O   1 
ATOM   4967 C  CB  . SER B 1 135 ? -0.434  -15.254 25.772  1.00 17.11  ? 136 SER B CB  1 
ATOM   4968 O  OG  . SER B 1 135 ? 0.286   -14.230 25.130  1.00 18.28  ? 136 SER B OG  1 
ATOM   4969 N  N   . ARG B 1 136 ? -1.500  -16.901 28.295  1.00 18.31  ? 137 ARG B N   1 
ATOM   4970 C  CA  . ARG B 1 136 ? -2.510  -17.721 28.964  1.00 19.54  ? 137 ARG B CA  1 
ATOM   4971 C  C   . ARG B 1 136 ? -3.025  -17.019 30.212  1.00 19.15  ? 137 ARG B C   1 
ATOM   4972 O  O   . ARG B 1 136 ? -4.227  -16.982 30.454  1.00 19.27  ? 137 ARG B O   1 
ATOM   4973 C  CB  . ARG B 1 136 ? -1.955  -19.100 29.317  1.00 20.20  ? 137 ARG B CB  1 
ATOM   4974 C  CG  . ARG B 1 136 ? -1.858  -20.049 28.131  1.00 23.11  ? 137 ARG B CG  1 
ATOM   4975 C  CD  . ARG B 1 136 ? -1.592  -21.462 28.619  1.00 29.34  ? 137 ARG B CD  1 
ATOM   4976 N  NE  . ARG B 1 136 ? -2.448  -22.401 27.898  1.00 35.32  ? 137 ARG B NE  1 
ATOM   4977 C  CZ  . ARG B 1 136 ? -2.020  -23.253 26.971  1.00 38.49  ? 137 ARG B CZ  1 
ATOM   4978 N  NH1 . ARG B 1 136 ? -0.725  -23.317 26.660  1.00 40.11  ? 137 ARG B NH1 1 
ATOM   4979 N  NH2 . ARG B 1 136 ? -2.887  -24.051 26.357  1.00 39.82  ? 137 ARG B NH2 1 
ATOM   4980 N  N   . ASP B 1 137 ? -2.112  -16.433 30.981  1.00 19.33  ? 138 ASP B N   1 
ATOM   4981 C  CA  . ASP B 1 137 ? -2.493  -15.662 32.163  1.00 19.61  ? 138 ASP B CA  1 
ATOM   4982 C  C   . ASP B 1 137 ? -3.311  -14.416 31.812  1.00 19.41  ? 138 ASP B C   1 
ATOM   4983 O  O   . ASP B 1 137 ? -4.263  -14.092 32.516  1.00 19.51  ? 138 ASP B O   1 
ATOM   4984 C  CB  . ASP B 1 137 ? -1.264  -15.320 33.019  1.00 19.74  ? 138 ASP B CB  1 
ATOM   4985 C  CG  . ASP B 1 137 ? -0.703  -16.545 33.737  1.00 22.29  ? 138 ASP B CG  1 
ATOM   4986 O  OD1 . ASP B 1 137 ? -1.452  -17.537 33.891  1.00 23.10  ? 138 ASP B OD1 1 
ATOM   4987 O  OD2 . ASP B 1 137 ? 0.482   -16.526 34.139  1.00 25.38  ? 138 ASP B OD2 1 
ATOM   4988 N  N   . PHE B 1 138 ? -2.965  -13.739 30.718  1.00 18.97  ? 139 PHE B N   1 
ATOM   4989 C  CA  . PHE B 1 138 ? -3.750  -12.584 30.288  1.00 19.26  ? 139 PHE B CA  1 
ATOM   4990 C  C   . PHE B 1 138 ? -5.203  -12.962 30.017  1.00 19.45  ? 139 PHE B C   1 
ATOM   4991 O  O   . PHE B 1 138 ? -6.115  -12.246 30.430  1.00 19.58  ? 139 PHE B O   1 
ATOM   4992 C  CB  . PHE B 1 138 ? -3.150  -11.896 29.055  1.00 18.80  ? 139 PHE B CB  1 
ATOM   4993 C  CG  . PHE B 1 138 ? -3.717  -10.533 28.810  1.00 19.19  ? 139 PHE B CG  1 
ATOM   4994 C  CD1 . PHE B 1 138 ? -3.220  -9.429  29.502  1.00 19.36  ? 139 PHE B CD1 1 
ATOM   4995 C  CD2 . PHE B 1 138 ? -4.770  -10.345 27.918  1.00 20.00  ? 139 PHE B CD2 1 
ATOM   4996 C  CE1 . PHE B 1 138 ? -3.750  -8.159  29.294  1.00 19.80  ? 139 PHE B CE1 1 
ATOM   4997 C  CE2 . PHE B 1 138 ? -5.311  -9.071  27.706  1.00 18.88  ? 139 PHE B CE2 1 
ATOM   4998 C  CZ  . PHE B 1 138 ? -4.794  -7.978  28.397  1.00 18.65  ? 139 PHE B CZ  1 
ATOM   4999 N  N   . VAL B 1 139 ? -5.398  -14.079 29.316  1.00 19.69  ? 140 VAL B N   1 
ATOM   5000 C  CA  . VAL B 1 139 ? -6.724  -14.639 29.061  1.00 20.34  ? 140 VAL B CA  1 
ATOM   5001 C  C   . VAL B 1 139 ? -7.477  -14.890 30.365  1.00 20.82  ? 140 VAL B C   1 
ATOM   5002 O  O   . VAL B 1 139 ? -8.644  -14.510 30.479  1.00 20.54  ? 140 VAL B O   1 
ATOM   5003 C  CB  . VAL B 1 139 ? -6.642  -15.944 28.212  1.00 20.43  ? 140 VAL B CB  1 
ATOM   5004 C  CG1 . VAL B 1 139 ? -7.931  -16.762 28.307  1.00 20.03  ? 140 VAL B CG1 1 
ATOM   5005 C  CG2 . VAL B 1 139 ? -6.321  -15.610 26.752  1.00 20.10  ? 140 VAL B CG2 1 
ATOM   5006 N  N   . SER B 1 140 ? -6.797  -15.507 31.340  1.00 21.57  ? 141 SER B N   1 
ATOM   5007 C  CA  . SER B 1 140 ? -7.379  -15.795 32.665  1.00 22.42  ? 141 SER B CA  1 
ATOM   5008 C  C   . SER B 1 140 ? -7.872  -14.542 33.376  1.00 22.97  ? 141 SER B C   1 
ATOM   5009 O  O   . SER B 1 140 ? -8.940  -14.562 33.977  1.00 23.84  ? 141 SER B O   1 
ATOM   5010 C  CB  . SER B 1 140 ? -6.383  -16.534 33.573  1.00 22.19  ? 141 SER B CB  1 
ATOM   5011 O  OG  . SER B 1 140 ? -6.062  -17.811 33.046  1.00 22.64  ? 141 SER B OG  1 
ATOM   5012 N  N   . VAL B 1 141 ? -7.088  -13.467 33.310  1.00 23.21  ? 142 VAL B N   1 
ATOM   5013 C  CA  . VAL B 1 141 ? -7.480  -12.172 33.873  1.00 23.63  ? 142 VAL B CA  1 
ATOM   5014 C  C   . VAL B 1 141 ? -8.820  -11.724 33.283  1.00 23.55  ? 142 VAL B C   1 
ATOM   5015 O  O   . VAL B 1 141 ? -9.750  -11.376 34.012  1.00 23.41  ? 142 VAL B O   1 
ATOM   5016 C  CB  . VAL B 1 141 ? -6.406  -11.076 33.605  1.00 23.40  ? 142 VAL B CB  1 
ATOM   5017 C  CG1 . VAL B 1 141 ? -6.877  -9.712  34.084  1.00 23.64  ? 142 VAL B CG1 1 
ATOM   5018 C  CG2 . VAL B 1 141 ? -5.099  -11.431 34.280  1.00 24.63  ? 142 VAL B CG2 1 
ATOM   5019 N  N   . LEU B 1 142 ? -8.910  -11.741 31.957  1.00 23.48  ? 143 LEU B N   1 
ATOM   5020 C  CA  . LEU B 1 142 ? -10.130 -11.310 31.285  1.00 23.21  ? 143 LEU B CA  1 
ATOM   5021 C  C   . LEU B 1 142 ? -11.328 -12.182 31.679  1.00 23.22  ? 143 LEU B C   1 
ATOM   5022 O  O   . LEU B 1 142 ? -12.393 -11.652 31.966  1.00 22.65  ? 143 LEU B O   1 
ATOM   5023 C  CB  . LEU B 1 142 ? -9.934  -11.249 29.766  1.00 22.63  ? 143 LEU B CB  1 
ATOM   5024 C  CG  . LEU B 1 142 ? -9.040  -10.140 29.205  1.00 22.33  ? 143 LEU B CG  1 
ATOM   5025 C  CD1 . LEU B 1 142 ? -9.002  -10.231 27.698  1.00 21.17  ? 143 LEU B CD1 1 
ATOM   5026 C  CD2 . LEU B 1 142 ? -9.533  -8.760  29.618  1.00 22.88  ? 143 LEU B CD2 1 
ATOM   5027 N  N   . HIS B 1 143 ? -11.137 -13.503 31.717  1.00 23.84  ? 144 HIS B N   1 
ATOM   5028 C  CA  . HIS B 1 143 ? -12.209 -14.433 32.126  1.00 25.31  ? 144 HIS B CA  1 
ATOM   5029 C  C   . HIS B 1 143 ? -12.719 -14.130 33.525  1.00 25.95  ? 144 HIS B C   1 
ATOM   5030 O  O   . HIS B 1 143 ? -13.920 -14.233 33.784  1.00 26.31  ? 144 HIS B O   1 
ATOM   5031 C  CB  . HIS B 1 143 ? -11.765 -15.902 32.069  1.00 24.91  ? 144 HIS B CB  1 
ATOM   5032 C  CG  . HIS B 1 143 ? -11.890 -16.530 30.715  1.00 25.21  ? 144 HIS B CG  1 
ATOM   5033 N  ND1 . HIS B 1 143 ? -13.048 -16.471 29.966  1.00 25.48  ? 144 HIS B ND1 1 
ATOM   5034 C  CD2 . HIS B 1 143 ? -11.009 -17.258 29.988  1.00 24.83  ? 144 HIS B CD2 1 
ATOM   5035 C  CE1 . HIS B 1 143 ? -12.870 -17.122 28.830  1.00 25.41  ? 144 HIS B CE1 1 
ATOM   5036 N  NE2 . HIS B 1 143 ? -11.642 -17.611 28.819  1.00 25.80  ? 144 HIS B NE2 1 
ATOM   5037 N  N   . ARG B 1 144 ? -11.799 -13.768 34.422  1.00 26.89  ? 145 ARG B N   1 
ATOM   5038 C  CA  . ARG B 1 144 ? -12.157 -13.394 35.788  1.00 28.00  ? 145 ARG B CA  1 
ATOM   5039 C  C   . ARG B 1 144 ? -12.984 -12.114 35.799  1.00 27.95  ? 145 ARG B C   1 
ATOM   5040 O  O   . ARG B 1 144 ? -14.042 -12.062 36.433  1.00 28.30  ? 145 ARG B O   1 
ATOM   5041 C  CB  . ARG B 1 144 ? -10.909 -13.250 36.667  1.00 28.39  ? 145 ARG B CB  1 
ATOM   5042 C  CG  . ARG B 1 144 ? -10.232 -14.577 36.954  1.00 31.01  ? 145 ARG B CG  1 
ATOM   5043 C  CD  . ARG B 1 144 ? -9.344  -14.528 38.204  1.00 35.75  ? 145 ARG B CD  1 
ATOM   5044 N  NE  . ARG B 1 144 ? -8.024  -13.937 37.951  1.00 38.38  ? 145 ARG B NE  1 
ATOM   5045 C  CZ  . ARG B 1 144 ? -6.988  -14.588 37.420  1.00 38.99  ? 145 ARG B CZ  1 
ATOM   5046 N  NH1 . ARG B 1 144 ? -7.101  -15.861 37.061  1.00 38.52  ? 145 ARG B NH1 1 
ATOM   5047 N  NH2 . ARG B 1 144 ? -5.836  -13.953 37.236  1.00 40.12  ? 145 ARG B NH2 1 
ATOM   5048 N  N   . ARG B 1 145 ? -12.504 -11.092 35.086  1.00 27.80  ? 146 ARG B N   1 
ATOM   5049 C  CA  . ARG B 1 145 ? -13.224 -9.822  34.963  1.00 27.57  ? 146 ARG B CA  1 
ATOM   5050 C  C   . ARG B 1 145 ? -14.630 -9.983  34.379  1.00 27.25  ? 146 ARG B C   1 
ATOM   5051 O  O   . ARG B 1 145 ? -15.554 -9.291  34.802  1.00 27.34  ? 146 ARG B O   1 
ATOM   5052 C  CB  . ARG B 1 145 ? -12.421 -8.815  34.145  1.00 27.41  ? 146 ARG B CB  1 
ATOM   5053 C  CG  . ARG B 1 145 ? -11.191 -8.328  34.861  1.00 28.00  ? 146 ARG B CG  1 
ATOM   5054 C  CD  . ARG B 1 145 ? -10.595 -7.133  34.159  1.00 28.81  ? 146 ARG B CD  1 
ATOM   5055 N  NE  . ARG B 1 145 ? -9.293  -6.802  34.720  1.00 29.18  ? 146 ARG B NE  1 
ATOM   5056 C  CZ  . ARG B 1 145 ? -8.446  -5.930  34.185  1.00 29.59  ? 146 ARG B CZ  1 
ATOM   5057 N  NH1 . ARG B 1 145 ? -8.760  -5.290  33.063  1.00 29.49  ? 146 ARG B NH1 1 
ATOM   5058 N  NH2 . ARG B 1 145 ? -7.278  -5.702  34.773  1.00 28.87  ? 146 ARG B NH2 1 
ATOM   5059 N  N   . ILE B 1 146 ? -14.778 -10.888 33.413  1.00 26.94  ? 147 ILE B N   1 
ATOM   5060 C  CA  . ILE B 1 146 ? -16.085 -11.226 32.853  1.00 27.09  ? 147 ILE B CA  1 
ATOM   5061 C  C   . ILE B 1 146 ? -17.016 -11.817 33.923  1.00 27.70  ? 147 ILE B C   1 
ATOM   5062 O  O   . ILE B 1 146 ? -18.168 -11.379 34.070  1.00 27.45  ? 147 ILE B O   1 
ATOM   5063 C  CB  . ILE B 1 146 ? -15.956 -12.189 31.649  1.00 26.87  ? 147 ILE B CB  1 
ATOM   5064 C  CG1 . ILE B 1 146 ? -15.362 -11.447 30.442  1.00 26.52  ? 147 ILE B CG1 1 
ATOM   5065 C  CG2 . ILE B 1 146 ? -17.314 -12.828 31.302  1.00 26.17  ? 147 ILE B CG2 1 
ATOM   5066 C  CD1 . ILE B 1 146 ? -14.993 -12.345 29.262  1.00 25.31  ? 147 ILE B CD1 1 
ATOM   5067 N  N   . LYS B 1 147 ? -16.504 -12.798 34.667  1.00 28.24  ? 148 LYS B N   1 
ATOM   5068 C  CA  . LYS B 1 147 ? -17.253 -13.459 35.734  1.00 29.32  ? 148 LYS B CA  1 
ATOM   5069 C  C   . LYS B 1 147 ? -17.668 -12.472 36.825  1.00 29.32  ? 148 LYS B C   1 
ATOM   5070 O  O   . LYS B 1 147 ? -18.788 -12.539 37.318  1.00 29.61  ? 148 LYS B O   1 
ATOM   5071 C  CB  . LYS B 1 147 ? -16.416 -14.600 36.326  1.00 29.99  ? 148 LYS B CB  1 
ATOM   5072 C  CG  . LYS B 1 147 ? -17.120 -15.481 37.353  1.00 32.20  ? 148 LYS B CG  1 
ATOM   5073 C  CD  . LYS B 1 147 ? -16.265 -16.712 37.672  1.00 35.88  ? 148 LYS B CD  1 
ATOM   5074 C  CE  . LYS B 1 147 ? -16.971 -17.658 38.642  1.00 37.35  ? 148 LYS B CE  1 
ATOM   5075 N  NZ  . LYS B 1 147 ? -16.872 -17.140 40.037  1.00 38.30  ? 148 LYS B NZ  1 
ATOM   5076 N  N   . LYS B 1 148 ? -16.765 -11.559 37.181  1.00 29.51  ? 149 LYS B N   1 
ATOM   5077 C  CA  . LYS B 1 148 ? -17.018 -10.541 38.204  1.00 29.60  ? 149 LYS B CA  1 
ATOM   5078 C  C   . LYS B 1 148 ? -18.050 -9.498  37.759  1.00 29.25  ? 149 LYS B C   1 
ATOM   5079 O  O   . LYS B 1 148 ? -18.890 -9.067  38.561  1.00 29.35  ? 149 LYS B O   1 
ATOM   5080 C  CB  . LYS B 1 148 ? -15.714 -9.851  38.609  1.00 29.74  ? 149 LYS B CB  1 
ATOM   5081 C  CG  . LYS B 1 148 ? -15.913 -8.553  39.397  1.00 31.99  ? 149 LYS B CG  1 
ATOM   5082 C  CD  . LYS B 1 148 ? -14.663 -8.150  40.165  1.00 35.29  ? 149 LYS B CD  1 
ATOM   5083 C  CE  . LYS B 1 148 ? -14.826 -6.789  40.840  1.00 36.68  ? 149 LYS B CE  1 
ATOM   5084 N  NZ  . LYS B 1 148 ? -15.889 -6.784  41.897  1.00 37.33  ? 149 LYS B NZ  1 
ATOM   5085 N  N   . ALA B 1 149 ? -17.972 -9.095  36.489  1.00 28.55  ? 150 ALA B N   1 
ATOM   5086 C  CA  . ALA B 1 149 ? -18.912 -8.137  35.903  1.00 27.67  ? 150 ALA B CA  1 
ATOM   5087 C  C   . ALA B 1 149 ? -20.338 -8.685  35.871  1.00 27.18  ? 150 ALA B C   1 
ATOM   5088 O  O   . ALA B 1 149 ? -21.297 -7.919  35.891  1.00 27.08  ? 150 ALA B O   1 
ATOM   5089 C  CB  . ALA B 1 149 ? -18.461 -7.723  34.511  1.00 27.53  ? 150 ALA B CB  1 
ATOM   5090 N  N   . GLY B 1 150 ? -20.463 -10.009 35.802  1.00 26.99  ? 151 GLY B N   1 
ATOM   5091 C  CA  . GLY B 1 150 ? -21.728 -10.699 36.049  1.00 26.75  ? 151 GLY B CA  1 
ATOM   5092 C  C   . GLY B 1 150 ? -22.747 -10.845 34.928  1.00 26.86  ? 151 GLY B C   1 
ATOM   5093 O  O   . GLY B 1 150 ? -23.702 -11.599 35.082  1.00 27.01  ? 151 GLY B O   1 
ATOM   5094 N  N   . SER B 1 151 ? -22.573 -10.136 33.811  1.00 26.64  ? 152 SER B N   1 
ATOM   5095 C  CA  . SER B 1 151 ? -23.529 -10.240 32.693  1.00 26.64  ? 152 SER B CA  1 
ATOM   5096 C  C   . SER B 1 151 ? -22.958 -10.861 31.412  1.00 26.25  ? 152 SER B C   1 
ATOM   5097 O  O   . SER B 1 151 ? -23.421 -10.548 30.320  1.00 26.57  ? 152 SER B O   1 
ATOM   5098 C  CB  . SER B 1 151 ? -24.147 -8.874  32.367  1.00 26.62  ? 152 SER B CB  1 
ATOM   5099 O  OG  . SER B 1 151 ? -25.130 -8.510  33.318  1.00 27.61  ? 152 SER B OG  1 
ATOM   5100 N  N   . GLY B 1 152 ? -21.952 -11.721 31.536  1.00 25.63  ? 153 GLY B N   1 
ATOM   5101 C  CA  . GLY B 1 152 ? -21.425 -12.433 30.369  1.00 25.20  ? 153 GLY B CA  1 
ATOM   5102 C  C   . GLY B 1 152 ? -20.548 -11.629 29.416  1.00 25.00  ? 153 GLY B C   1 
ATOM   5103 O  O   . GLY B 1 152 ? -20.317 -12.051 28.277  1.00 24.68  ? 153 GLY B O   1 
ATOM   5104 N  N   . ASN B 1 153 ? -20.064 -10.476 29.881  1.00 24.56  ? 154 ASN B N   1 
ATOM   5105 C  CA  . ASN B 1 153 ? -19.125 -9.645  29.132  1.00 24.23  ? 154 ASN B CA  1 
ATOM   5106 C  C   . ASN B 1 153 ? -18.280 -8.753  30.049  1.00 23.79  ? 154 ASN B C   1 
ATOM   5107 O  O   . ASN B 1 153 ? -18.605 -8.572  31.218  1.00 24.06  ? 154 ASN B O   1 
ATOM   5108 C  CB  . ASN B 1 153 ? -19.863 -8.789  28.095  1.00 24.36  ? 154 ASN B CB  1 
ATOM   5109 C  CG  . ASN B 1 153 ? -20.716 -7.698  28.731  1.00 25.30  ? 154 ASN B CG  1 
ATOM   5110 O  OD1 . ASN B 1 153 ? -21.935 -7.806  28.780  1.00 27.12  ? 154 ASN B OD1 1 
ATOM   5111 N  ND2 . ASN B 1 153 ? -20.075 -6.645  29.218  1.00 25.74  ? 154 ASN B ND2 1 
ATOM   5112 N  N   . TYR B 1 154 ? -17.197 -8.205  29.504  1.00 23.09  ? 155 TYR B N   1 
ATOM   5113 C  CA  . TYR B 1 154 ? -16.387 -7.201  30.187  1.00 22.28  ? 155 TYR B CA  1 
ATOM   5114 C  C   . TYR B 1 154 ? -16.081 -6.062  29.222  1.00 21.69  ? 155 TYR B C   1 
ATOM   5115 O  O   . TYR B 1 154 ? -15.649 -6.305  28.102  1.00 21.36  ? 155 TYR B O   1 
ATOM   5116 C  CB  . TYR B 1 154 ? -15.073 -7.792  30.718  1.00 22.22  ? 155 TYR B CB  1 
ATOM   5117 C  CG  . TYR B 1 154 ? -14.113 -6.729  31.226  1.00 23.01  ? 155 TYR B CG  1 
ATOM   5118 C  CD1 . TYR B 1 154 ? -14.435 -5.946  32.341  1.00 23.51  ? 155 TYR B CD1 1 
ATOM   5119 C  CD2 . TYR B 1 154 ? -12.897 -6.494  30.587  1.00 22.65  ? 155 TYR B CD2 1 
ATOM   5120 C  CE1 . TYR B 1 154 ? -13.571 -4.962  32.807  1.00 24.27  ? 155 TYR B CE1 1 
ATOM   5121 C  CE2 . TYR B 1 154 ? -12.018 -5.511  31.049  1.00 24.26  ? 155 TYR B CE2 1 
ATOM   5122 C  CZ  . TYR B 1 154 ? -12.364 -4.747  32.158  1.00 25.47  ? 155 TYR B CZ  1 
ATOM   5123 O  OH  . TYR B 1 154 ? -11.508 -3.768  32.626  1.00 27.26  ? 155 TYR B OH  1 
ATOM   5124 N  N   . SER B 1 155 ? -16.320 -4.832  29.665  1.00 20.79  ? 156 SER B N   1 
ATOM   5125 C  CA  . SER B 1 155 ? -16.014 -3.636  28.894  1.00 20.51  ? 156 SER B CA  1 
ATOM   5126 C  C   . SER B 1 155 ? -15.012 -2.788  29.647  1.00 19.99  ? 156 SER B C   1 
ATOM   5127 O  O   . SER B 1 155 ? -15.119 -2.627  30.860  1.00 19.86  ? 156 SER B O   1 
ATOM   5128 C  CB  . SER B 1 155 ? -17.265 -2.802  28.635  1.00 20.38  ? 156 SER B CB  1 
ATOM   5129 O  OG  . SER B 1 155 ? -18.088 -3.425  27.672  1.00 22.79  ? 156 SER B OG  1 
ATOM   5130 N  N   . GLY B 1 156 ? -14.038 -2.249  28.925  1.00 19.37  ? 157 GLY B N   1 
ATOM   5131 C  CA  . GLY B 1 156 ? -13.030 -1.416  29.546  1.00 18.79  ? 157 GLY B CA  1 
ATOM   5132 C  C   . GLY B 1 156 ? -11.867 -1.076  28.641  1.00 18.48  ? 157 GLY B C   1 
ATOM   5133 O  O   . GLY B 1 156 ? -11.631 -1.730  27.622  1.00 18.05  ? 157 GLY B O   1 
ATOM   5134 N  N   . ASP B 1 157 ? -11.157 -0.022  29.030  1.00 18.11  ? 158 ASP B N   1 
ATOM   5135 C  CA  . ASP B 1 157 ? -9.890  0.356   28.443  1.00 17.60  ? 158 ASP B CA  1 
ATOM   5136 C  C   . ASP B 1 157 ? -8.820  -0.536  29.090  1.00 16.91  ? 158 ASP B C   1 
ATOM   5137 O  O   . ASP B 1 157 ? -8.575  -0.436  30.280  1.00 16.50  ? 158 ASP B O   1 
ATOM   5138 C  CB  . ASP B 1 157 ? -9.662  1.839   28.753  1.00 17.68  ? 158 ASP B CB  1 
ATOM   5139 C  CG  . ASP B 1 157 ? -8.304  2.356   28.304  1.00 18.20  ? 158 ASP B CG  1 
ATOM   5140 O  OD1 . ASP B 1 157 ? -7.422  1.571   27.909  1.00 18.53  ? 158 ASP B OD1 1 
ATOM   5141 O  OD2 . ASP B 1 157 ? -8.120  3.589   28.369  1.00 20.06  ? 158 ASP B OD2 1 
ATOM   5142 N  N   . ILE B 1 158 ? -8.193  -1.401  28.295  1.00 16.82  ? 159 ILE B N   1 
ATOM   5143 C  CA  . ILE B 1 158 ? -7.208  -2.373  28.795  1.00 16.36  ? 159 ILE B CA  1 
ATOM   5144 C  C   . ILE B 1 158 ? -5.758  -1.997  28.490  1.00 16.27  ? 159 ILE B C   1 
ATOM   5145 O  O   . ILE B 1 158 ? -4.856  -2.851  28.586  1.00 16.16  ? 159 ILE B O   1 
ATOM   5146 C  CB  . ILE B 1 158 ? -7.483  -3.817  28.262  1.00 16.36  ? 159 ILE B CB  1 
ATOM   5147 C  CG1 . ILE B 1 158 ? -7.482  -3.843  26.729  1.00 16.31  ? 159 ILE B CG1 1 
ATOM   5148 C  CG2 . ILE B 1 158 ? -8.791  -4.370  28.854  1.00 16.95  ? 159 ILE B CG2 1 
ATOM   5149 C  CD1 . ILE B 1 158 ? -7.263  -5.212  26.135  1.00 15.20  ? 159 ILE B CD1 1 
ATOM   5150 N  N   . SER B 1 159 ? -5.531  -0.731  28.131  1.00 16.02  ? 160 SER B N   1 
ATOM   5151 C  CA  . SER B 1 159 ? -4.190  -0.261  27.782  1.00 16.53  ? 160 SER B CA  1 
ATOM   5152 C  C   . SER B 1 159 ? -3.192  -0.524  28.914  1.00 16.55  ? 160 SER B C   1 
ATOM   5153 O  O   . SER B 1 159 ? -2.099  -1.023  28.659  1.00 16.36  ? 160 SER B O   1 
ATOM   5154 C  CB  . SER B 1 159 ? -4.183  1.230   27.392  1.00 16.54  ? 160 SER B CB  1 
ATOM   5155 O  OG  . SER B 1 159 ? -4.863  2.014   28.361  1.00 17.30  ? 160 SER B OG  1 
ATOM   5156 N  N   . ASP B 1 160 ? -3.587  -0.224  30.153  1.00 16.67  ? 161 ASP B N   1 
ATOM   5157 C  CA  . ASP B 1 160 ? -2.722  -0.469  31.318  1.00 17.19  ? 161 ASP B CA  1 
ATOM   5158 C  C   . ASP B 1 160 ? -2.377  -1.943  31.482  1.00 16.96  ? 161 ASP B C   1 
ATOM   5159 O  O   . ASP B 1 160 ? -1.240  -2.280  31.800  1.00 16.61  ? 161 ASP B O   1 
ATOM   5160 C  CB  . ASP B 1 160 ? -3.354  0.057   32.611  1.00 17.35  ? 161 ASP B CB  1 
ATOM   5161 C  CG  . ASP B 1 160 ? -3.349  1.576   32.698  1.00 19.85  ? 161 ASP B CG  1 
ATOM   5162 O  OD1 . ASP B 1 160 ? -2.723  2.255   31.852  1.00 22.11  ? 161 ASP B OD1 1 
ATOM   5163 O  OD2 . ASP B 1 160 ? -3.983  2.104   33.635  1.00 24.32  ? 161 ASP B OD2 1 
ATOM   5164 N  N   . ASP B 1 161 ? -3.365  -2.811  31.259  1.00 16.92  ? 162 ASP B N   1 
ATOM   5165 C  CA  . ASP B 1 161 ? -3.139  -4.251  31.303  1.00 17.21  ? 162 ASP B CA  1 
ATOM   5166 C  C   . ASP B 1 161 ? -2.239  -4.717  30.161  1.00 16.64  ? 162 ASP B C   1 
ATOM   5167 O  O   . ASP B 1 161 ? -1.447  -5.639  30.339  1.00 16.78  ? 162 ASP B O   1 
ATOM   5168 C  CB  . ASP B 1 161 ? -4.458  -5.005  31.283  1.00 17.69  ? 162 ASP B CB  1 
ATOM   5169 C  CG  . ASP B 1 161 ? -5.407  -4.527  32.355  1.00 20.13  ? 162 ASP B CG  1 
ATOM   5170 O  OD1 . ASP B 1 161 ? -5.094  -4.698  33.564  1.00 21.75  ? 162 ASP B OD1 1 
ATOM   5171 O  OD2 . ASP B 1 161 ? -6.462  -3.968  31.982  1.00 22.25  ? 162 ASP B OD2 1 
ATOM   5172 N  N   . LEU B 1 162 ? -2.348  -4.067  29.002  1.00 16.04  ? 163 LEU B N   1 
ATOM   5173 C  CA  . LEU B 1 162 ? -1.503  -4.410  27.857  1.00 15.40  ? 163 LEU B CA  1 
ATOM   5174 C  C   . LEU B 1 162 ? -0.043  -4.048  28.116  1.00 15.16  ? 163 LEU B C   1 
ATOM   5175 O  O   . LEU B 1 162 ? 0.852   -4.824  27.768  1.00 14.80  ? 163 LEU B O   1 
ATOM   5176 C  CB  . LEU B 1 162 ? -2.014  -3.755  26.570  1.00 15.11  ? 163 LEU B CB  1 
ATOM   5177 C  CG  . LEU B 1 162 ? -3.285  -4.402  26.002  1.00 16.03  ? 163 LEU B CG  1 
ATOM   5178 C  CD1 . LEU B 1 162 ? -3.863  -3.559  24.881  1.00 15.34  ? 163 LEU B CD1 1 
ATOM   5179 C  CD2 . LEU B 1 162 ? -2.975  -5.828  25.514  1.00 14.85  ? 163 LEU B CD2 1 
ATOM   5180 N  N   . PHE B 1 163 ? 0.181   -2.881  28.737  1.00 14.78  ? 164 PHE B N   1 
ATOM   5181 C  CA  . PHE B 1 163 ? 1.515   -2.462  29.186  1.00 14.97  ? 164 PHE B CA  1 
ATOM   5182 C  C   . PHE B 1 163 ? 2.098   -3.467  30.183  1.00 14.51  ? 164 PHE B C   1 
ATOM   5183 O  O   . PHE B 1 163 ? 3.264   -3.854  30.058  1.00 14.54  ? 164 PHE B O   1 
ATOM   5184 C  CB  . PHE B 1 163 ? 1.503   -1.060  29.820  1.00 15.18  ? 164 PHE B CB  1 
ATOM   5185 C  CG  . PHE B 1 163 ? 1.262   0.066   28.845  1.00 17.28  ? 164 PHE B CG  1 
ATOM   5186 C  CD1 . PHE B 1 163 ? 0.196   0.944   29.029  1.00 19.76  ? 164 PHE B CD1 1 
ATOM   5187 C  CD2 . PHE B 1 163 ? 2.106   0.271   27.765  1.00 19.09  ? 164 PHE B CD2 1 
ATOM   5188 C  CE1 . PHE B 1 163 ? -0.035  1.993   28.133  1.00 20.50  ? 164 PHE B CE1 1 
ATOM   5189 C  CE2 . PHE B 1 163 ? 1.887   1.324   26.869  1.00 20.11  ? 164 PHE B CE2 1 
ATOM   5190 C  CZ  . PHE B 1 163 ? 0.824   2.179   27.054  1.00 20.39  ? 164 PHE B CZ  1 
ATOM   5191 N  N   . ARG B 1 164 ? 1.288   -3.888  31.159  1.00 13.75  ? 165 ARG B N   1 
ATOM   5192 C  CA  . ARG B 1 164 ? 1.709   -4.916  32.115  1.00 13.62  ? 165 ARG B CA  1 
ATOM   5193 C  C   . ARG B 1 164 ? 1.987   -6.230  31.382  1.00 13.69  ? 165 ARG B C   1 
ATOM   5194 O  O   . ARG B 1 164 ? 2.997   -6.893  31.649  1.00 13.49  ? 165 ARG B O   1 
ATOM   5195 C  CB  . ARG B 1 164 ? 0.678   -5.101  33.231  1.00 13.30  ? 165 ARG B CB  1 
ATOM   5196 C  CG  . ARG B 1 164 ? 0.766   -4.014  34.327  1.00 13.93  ? 165 ARG B CG  1 
ATOM   5197 C  CD  . ARG B 1 164 ? -0.217  -4.242  35.488  1.00 13.91  ? 165 ARG B CD  1 
ATOM   5198 N  NE  . ARG B 1 164 ? -1.609  -3.955  35.120  1.00 13.78  ? 165 ARG B NE  1 
ATOM   5199 C  CZ  . ARG B 1 164 ? -2.181  -2.755  35.206  1.00 14.28  ? 165 ARG B CZ  1 
ATOM   5200 N  NH1 . ARG B 1 164 ? -1.484  -1.706  35.650  1.00 13.68  ? 165 ARG B NH1 1 
ATOM   5201 N  NH2 . ARG B 1 164 ? -3.451  -2.599  34.847  1.00 12.89  ? 165 ARG B NH2 1 
ATOM   5202 N  N   . PHE B 1 165 ? 1.110   -6.585  30.438  1.00 13.13  ? 166 PHE B N   1 
ATOM   5203 C  CA  . PHE B 1 165 ? 1.333   -7.770  29.614  1.00 12.95  ? 166 PHE B CA  1 
ATOM   5204 C  C   . PHE B 1 165 ? 2.673   -7.707  28.874  1.00 12.80  ? 166 PHE B C   1 
ATOM   5205 O  O   . PHE B 1 165 ? 3.447   -8.667  28.903  1.00 12.82  ? 166 PHE B O   1 
ATOM   5206 C  CB  . PHE B 1 165 ? 0.194   -7.999  28.595  1.00 13.03  ? 166 PHE B CB  1 
ATOM   5207 C  CG  . PHE B 1 165 ? 0.538   -9.025  27.556  1.00 12.10  ? 166 PHE B CG  1 
ATOM   5208 C  CD1 . PHE B 1 165 ? 0.478   -10.378 27.866  1.00 11.78  ? 166 PHE B CD1 1 
ATOM   5209 C  CD2 . PHE B 1 165 ? 0.999   -8.641  26.294  1.00 12.50  ? 166 PHE B CD2 1 
ATOM   5210 C  CE1 . PHE B 1 165 ? 0.838   -11.344 26.932  1.00 11.61  ? 166 PHE B CE1 1 
ATOM   5211 C  CE2 . PHE B 1 165 ? 1.366   -9.598  25.348  1.00 11.12  ? 166 PHE B CE2 1 
ATOM   5212 C  CZ  . PHE B 1 165 ? 1.289   -10.953 25.671  1.00 12.45  ? 166 PHE B CZ  1 
ATOM   5213 N  N   . ALA B 1 166 ? 2.937   -6.589  28.198  1.00 12.70  ? 167 ALA B N   1 
ATOM   5214 C  CA  . ALA B 1 166 ? 4.191   -6.430  27.462  1.00 13.03  ? 167 ALA B CA  1 
ATOM   5215 C  C   . ALA B 1 166 ? 5.424   -6.527  28.369  1.00 13.06  ? 167 ALA B C   1 
ATOM   5216 O  O   . ALA B 1 166 ? 6.429   -7.125  27.995  1.00 13.73  ? 167 ALA B O   1 
ATOM   5217 C  CB  . ALA B 1 166 ? 4.196   -5.119  26.666  1.00 12.52  ? 167 ALA B CB  1 
ATOM   5218 N  N   . PHE B 1 167 ? 5.335   -5.948  29.558  1.00 13.61  ? 168 PHE B N   1 
ATOM   5219 C  CA  . PHE B 1 167 ? 6.432   -5.977  30.529  1.00 14.32  ? 168 PHE B CA  1 
ATOM   5220 C  C   . PHE B 1 167 ? 6.667   -7.403  31.041  1.00 14.60  ? 168 PHE B C   1 
ATOM   5221 O  O   . PHE B 1 167 ? 7.804   -7.877  31.083  1.00 14.48  ? 168 PHE B O   1 
ATOM   5222 C  CB  . PHE B 1 167 ? 6.144   -5.017  31.689  1.00 14.04  ? 168 PHE B CB  1 
ATOM   5223 C  CG  . PHE B 1 167 ? 7.167   -5.068  32.799  1.00 15.27  ? 168 PHE B CG  1 
ATOM   5224 C  CD1 . PHE B 1 167 ? 8.345   -4.330  32.716  1.00 15.85  ? 168 PHE B CD1 1 
ATOM   5225 C  CD2 . PHE B 1 167 ? 6.942   -5.839  33.931  1.00 14.51  ? 168 PHE B CD2 1 
ATOM   5226 C  CE1 . PHE B 1 167 ? 9.294   -4.380  33.743  1.00 16.61  ? 168 PHE B CE1 1 
ATOM   5227 C  CE2 . PHE B 1 167 ? 7.869   -5.882  34.969  1.00 15.93  ? 168 PHE B CE2 1 
ATOM   5228 C  CZ  . PHE B 1 167 ? 9.051   -5.150  34.875  1.00 15.21  ? 168 PHE B CZ  1 
ATOM   5229 N  N   . GLU B 1 168 ? 5.584   -8.078  31.417  1.00 15.00  ? 169 GLU B N   1 
ATOM   5230 C  CA  . GLU B 1 168 ? 5.653   -9.463  31.881  1.00 15.57  ? 169 GLU B CA  1 
ATOM   5231 C  C   . GLU B 1 168 ? 6.286   -10.372 30.820  1.00 15.78  ? 169 GLU B C   1 
ATOM   5232 O  O   . GLU B 1 168 ? 7.076   -11.254 31.150  1.00 16.09  ? 169 GLU B O   1 
ATOM   5233 C  CB  . GLU B 1 168 ? 4.258   -9.963  32.274  1.00 15.44  ? 169 GLU B CB  1 
ATOM   5234 C  CG  . GLU B 1 168 ? 4.244   -11.286 33.049  1.00 16.43  ? 169 GLU B CG  1 
ATOM   5235 C  CD  . GLU B 1 168 ? 4.579   -11.140 34.541  1.00 17.75  ? 169 GLU B CD  1 
ATOM   5236 O  OE1 . GLU B 1 168 ? 4.555   -12.176 35.249  1.00 18.38  ? 169 GLU B OE1 1 
ATOM   5237 O  OE2 . GLU B 1 168 ? 4.856   -10.008 35.011  1.00 16.88  ? 169 GLU B OE2 1 
ATOM   5238 N  N   . SER B 1 169 ? 5.960   -10.130 29.548  1.00 15.91  ? 170 SER B N   1 
ATOM   5239 C  CA  . SER B 1 169 ? 6.514   -10.910 28.434  1.00 15.85  ? 170 SER B CA  1 
ATOM   5240 C  C   . SER B 1 169 ? 8.017   -10.692 28.223  1.00 16.23  ? 170 SER B C   1 
ATOM   5241 O  O   . SER B 1 169 ? 8.777   -11.659 28.130  1.00 16.56  ? 170 SER B O   1 
ATOM   5242 C  CB  . SER B 1 169 ? 5.761   -10.616 27.128  1.00 16.01  ? 170 SER B CB  1 
ATOM   5243 O  OG  . SER B 1 169 ? 4.384   -10.945 27.221  1.00 15.27  ? 170 SER B OG  1 
ATOM   5244 N  N   . ILE B 1 170 ? 8.445   -9.432  28.127  1.00 16.21  ? 171 ILE B N   1 
ATOM   5245 C  CA  . ILE B 1 170 ? 9.851   -9.141  27.865  1.00 15.92  ? 171 ILE B CA  1 
ATOM   5246 C  C   . ILE B 1 170 ? 10.744  -9.586  29.028  1.00 16.22  ? 171 ILE B C   1 
ATOM   5247 O  O   . ILE B 1 170 ? 11.820  -10.130 28.799  1.00 15.93  ? 171 ILE B O   1 
ATOM   5248 C  CB  . ILE B 1 170 ? 10.112  -7.644  27.460  1.00 15.96  ? 171 ILE B CB  1 
ATOM   5249 C  CG1 . ILE B 1 170 ? 11.558  -7.431  27.003  1.00 15.62  ? 171 ILE B CG1 1 
ATOM   5250 C  CG2 . ILE B 1 170 ? 9.810   -6.686  28.602  1.00 16.00  ? 171 ILE B CG2 1 
ATOM   5251 C  CD1 . ILE B 1 170 ? 11.979  -8.275  25.802  1.00 14.79  ? 171 ILE B CD1 1 
ATOM   5252 N  N   . THR B 1 171 ? 10.288  -9.365  30.263  1.00 16.36  ? 172 THR B N   1 
ATOM   5253 C  CA  . THR B 1 171 ? 11.044  -9.778  31.444  1.00 16.69  ? 172 THR B CA  1 
ATOM   5254 C  C   . THR B 1 171 ? 11.086  -11.300 31.569  1.00 16.92  ? 172 THR B C   1 
ATOM   5255 O  O   . THR B 1 171 ? 12.083  -11.852 32.010  1.00 16.38  ? 172 THR B O   1 
ATOM   5256 C  CB  . THR B 1 171 ? 10.468  -9.201  32.761  1.00 16.56  ? 172 THR B CB  1 
ATOM   5257 O  OG1 . THR B 1 171 ? 9.075   -9.514  32.851  1.00 16.55  ? 172 THR B OG1 1 
ATOM   5258 C  CG2 . THR B 1 171 ? 10.655  -7.689  32.843  1.00 15.66  ? 172 THR B CG2 1 
ATOM   5259 N  N   . ASN B 1 172 ? 10.000  -11.975 31.197  1.00 17.50  ? 173 ASN B N   1 
ATOM   5260 C  CA  . ASN B 1 172 ? 9.984   -13.429 31.288  1.00 18.13  ? 173 ASN B CA  1 
ATOM   5261 C  C   . ASN B 1 172 ? 11.005  -14.038 30.351  1.00 18.43  ? 173 ASN B C   1 
ATOM   5262 O  O   . ASN B 1 172 ? 11.703  -14.995 30.696  1.00 18.37  ? 173 ASN B O   1 
ATOM   5263 C  CB  . ASN B 1 172 ? 8.603   -14.020 31.000  1.00 18.25  ? 173 ASN B CB  1 
ATOM   5264 C  CG  . ASN B 1 172 ? 8.437   -15.399 31.616  1.00 19.40  ? 173 ASN B CG  1 
ATOM   5265 O  OD1 . ASN B 1 172 ? 9.142   -15.743 32.576  1.00 19.53  ? 173 ASN B OD1 1 
ATOM   5266 N  ND2 . ASN B 1 172 ? 7.517   -16.197 31.076  1.00 17.88  ? 173 ASN B ND2 1 
ATOM   5267 N  N   . VAL B 1 173 ? 11.109  -13.450 29.171  1.00 18.69  ? 174 VAL B N   1 
ATOM   5268 C  CA  . VAL B 1 173 ? 12.006  -13.951 28.149  1.00 19.31  ? 174 VAL B CA  1 
ATOM   5269 C  C   . VAL B 1 173 ? 13.473  -13.570 28.465  1.00 19.43  ? 174 VAL B C   1 
ATOM   5270 O  O   . VAL B 1 173 ? 14.412  -14.326 28.162  1.00 19.48  ? 174 VAL B O   1 
ATOM   5271 C  CB  . VAL B 1 173 ? 11.500  -13.491 26.754  1.00 19.55  ? 174 VAL B CB  1 
ATOM   5272 C  CG1 . VAL B 1 173 ? 12.172  -12.213 26.279  1.00 19.61  ? 174 VAL B CG1 1 
ATOM   5273 C  CG2 . VAL B 1 173 ? 11.656  -14.586 25.762  1.00 21.00  ? 174 VAL B CG2 1 
ATOM   5274 N  N   . ILE B 1 174 ? 13.660  -12.419 29.110  1.00 19.00  ? 175 ILE B N   1 
ATOM   5275 C  CA  . ILE B 1 174 ? 14.997  -11.955 29.476  1.00 19.03  ? 175 ILE B CA  1 
ATOM   5276 C  C   . ILE B 1 174 ? 15.527  -12.645 30.747  1.00 19.21  ? 175 ILE B C   1 
ATOM   5277 O  O   . ILE B 1 174 ? 16.659  -13.135 30.765  1.00 18.77  ? 175 ILE B O   1 
ATOM   5278 C  CB  . ILE B 1 174 ? 15.057  -10.405 29.610  1.00 18.97  ? 175 ILE B CB  1 
ATOM   5279 C  CG1 . ILE B 1 174 ? 15.037  -9.754  28.218  1.00 18.68  ? 175 ILE B CG1 1 
ATOM   5280 C  CG2 . ILE B 1 174 ? 16.305  -9.972  30.398  1.00 18.93  ? 175 ILE B CG2 1 
ATOM   5281 C  CD1 . ILE B 1 174 ? 15.074  -8.256  28.239  1.00 19.31  ? 175 ILE B CD1 1 
ATOM   5282 N  N   . PHE B 1 175 ? 14.695  -12.691 31.785  1.00 19.15  ? 176 PHE B N   1 
ATOM   5283 C  CA  . PHE B 1 175 ? 15.089  -13.225 33.088  1.00 19.69  ? 176 PHE B CA  1 
ATOM   5284 C  C   . PHE B 1 175 ? 14.675  -14.680 33.354  1.00 20.01  ? 176 PHE B C   1 
ATOM   5285 O  O   . PHE B 1 175 ? 15.200  -15.320 34.272  1.00 20.02  ? 176 PHE B O   1 
ATOM   5286 C  CB  . PHE B 1 175 ? 14.579  -12.299 34.204  1.00 19.27  ? 176 PHE B CB  1 
ATOM   5287 C  CG  . PHE B 1 175 ? 15.103  -10.899 34.098  1.00 19.92  ? 176 PHE B CG  1 
ATOM   5288 C  CD1 . PHE B 1 175 ? 14.287  -9.869  33.638  1.00 19.42  ? 176 PHE B CD1 1 
ATOM   5289 C  CD2 . PHE B 1 175 ? 16.430  -10.610 34.425  1.00 19.37  ? 176 PHE B CD2 1 
ATOM   5290 C  CE1 . PHE B 1 175 ? 14.779  -8.553  33.521  1.00 20.41  ? 176 PHE B CE1 1 
ATOM   5291 C  CE2 . PHE B 1 175 ? 16.932  -9.304  34.308  1.00 20.73  ? 176 PHE B CE2 1 
ATOM   5292 C  CZ  . PHE B 1 175 ? 16.099  -8.272  33.850  1.00 20.05  ? 176 PHE B CZ  1 
ATOM   5293 N  N   . GLY B 1 176 ? 13.742  -15.202 32.560  1.00 20.24  ? 177 GLY B N   1 
ATOM   5294 C  CA  . GLY B 1 176 ? 13.193  -16.536 32.797  1.00 20.90  ? 177 GLY B CA  1 
ATOM   5295 C  C   . GLY B 1 176 ? 12.415  -16.605 34.101  1.00 21.52  ? 177 GLY B C   1 
ATOM   5296 O  O   . GLY B 1 176 ? 12.282  -17.671 34.689  1.00 22.01  ? 177 GLY B O   1 
ATOM   5297 N  N   . GLU B 1 177 ? 11.914  -15.460 34.556  1.00 21.77  ? 178 GLU B N   1 
ATOM   5298 C  CA  . GLU B 1 177 ? 11.195  -15.372 35.816  1.00 22.87  ? 178 GLU B CA  1 
ATOM   5299 C  C   . GLU B 1 177 ? 9.981   -14.478 35.633  1.00 22.50  ? 178 GLU B C   1 
ATOM   5300 O  O   . GLU B 1 177 ? 10.059  -13.433 34.984  1.00 22.50  ? 178 GLU B O   1 
ATOM   5301 C  CB  . GLU B 1 177 ? 12.097  -14.834 36.946  1.00 23.16  ? 178 GLU B CB  1 
ATOM   5302 C  CG  . GLU B 1 177 ? 13.348  -15.702 37.215  1.00 27.24  ? 178 GLU B CG  1 
ATOM   5303 C  CD  . GLU B 1 177 ? 14.327  -15.101 38.228  1.00 31.55  ? 178 GLU B CD  1 
ATOM   5304 O  OE1 . GLU B 1 177 ? 14.577  -13.873 38.192  1.00 33.98  ? 178 GLU B OE1 1 
ATOM   5305 O  OE2 . GLU B 1 177 ? 14.861  -15.873 39.055  1.00 33.04  ? 178 GLU B OE2 1 
ATOM   5306 N  N   . ARG B 1 178 ? 8.865   -14.918 36.201  1.00 22.26  ? 179 ARG B N   1 
ATOM   5307 C  CA  . ARG B 1 178 ? 7.615   -14.178 36.197  1.00 22.14  ? 179 ARG B CA  1 
ATOM   5308 C  C   . ARG B 1 178 ? 7.667   -13.046 37.210  1.00 22.39  ? 179 ARG B C   1 
ATOM   5309 O  O   . ARG B 1 178 ? 7.981   -13.267 38.378  1.00 22.64  ? 179 ARG B O   1 
ATOM   5310 C  CB  . ARG B 1 178 ? 6.445   -15.123 36.506  1.00 21.63  ? 179 ARG B CB  1 
ATOM   5311 C  CG  . ARG B 1 178 ? 6.156   -16.128 35.374  1.00 20.67  ? 179 ARG B CG  1 
ATOM   5312 C  CD  . ARG B 1 178 ? 5.774   -15.410 34.051  1.00 18.40  ? 179 ARG B CD  1 
ATOM   5313 N  NE  . ARG B 1 178 ? 4.536   -14.638 34.181  1.00 17.31  ? 179 ARG B NE  1 
ATOM   5314 C  CZ  . ARG B 1 178 ? 3.313   -15.141 33.995  1.00 17.06  ? 179 ARG B CZ  1 
ATOM   5315 N  NH1 . ARG B 1 178 ? 3.147   -16.418 33.657  1.00 16.02  ? 179 ARG B NH1 1 
ATOM   5316 N  NH2 . ARG B 1 178 ? 2.249   -14.371 34.145  1.00 16.48  ? 179 ARG B NH2 1 
ATOM   5317 N  N   . GLN B 1 179 ? 7.358   -11.835 36.759  1.00 22.44  ? 180 GLN B N   1 
ATOM   5318 C  CA  . GLN B 1 179 ? 7.387   -10.673 37.632  1.00 22.50  ? 180 GLN B CA  1 
ATOM   5319 C  C   . GLN B 1 179 ? 6.053   -10.490 38.349  1.00 22.19  ? 180 GLN B C   1 
ATOM   5320 O  O   . GLN B 1 179 ? 5.942   -9.682  39.274  1.00 21.70  ? 180 GLN B O   1 
ATOM   5321 C  CB  . GLN B 1 179 ? 7.762   -9.423  36.840  1.00 22.61  ? 180 GLN B CB  1 
ATOM   5322 C  CG  . GLN B 1 179 ? 9.066   -9.546  36.068  1.00 24.52  ? 180 GLN B CG  1 
ATOM   5323 C  CD  . GLN B 1 179 ? 10.271  -9.843  36.949  1.00 28.24  ? 180 GLN B CD  1 
ATOM   5324 O  OE1 . GLN B 1 179 ? 10.593  -9.077  37.857  1.00 28.58  ? 180 GLN B OE1 1 
ATOM   5325 N  NE2 . GLN B 1 179 ? 10.947  -10.964 36.677  1.00 28.99  ? 180 GLN B NE2 1 
ATOM   5326 N  N   . GLY B 1 180 ? 5.046   -11.243 37.910  1.00 21.97  ? 181 GLY B N   1 
ATOM   5327 C  CA  . GLY B 1 180 ? 3.737   -11.264 38.571  1.00 22.10  ? 181 GLY B CA  1 
ATOM   5328 C  C   . GLY B 1 180 ? 2.817   -10.086 38.277  1.00 22.25  ? 181 GLY B C   1 
ATOM   5329 O  O   . GLY B 1 180 ? 1.896   -9.816  39.058  1.00 22.03  ? 181 GLY B O   1 
ATOM   5330 N  N   . MET B 1 181 ? 3.027   -9.409  37.143  1.00 22.19  ? 182 MET B N   1 
ATOM   5331 C  CA  . MET B 1 181 ? 2.256   -8.195  36.811  1.00 22.66  ? 182 MET B CA  1 
ATOM   5332 C  C   . MET B 1 181 ? 0.824   -8.457  36.325  1.00 23.18  ? 182 MET B C   1 
ATOM   5333 O  O   . MET B 1 181 ? 0.041   -7.522  36.170  1.00 23.33  ? 182 MET B O   1 
ATOM   5334 C  CB  . MET B 1 181 ? 3.012   -7.316  35.806  1.00 22.65  ? 182 MET B CB  1 
ATOM   5335 C  CG  . MET B 1 181 ? 4.399   -6.895  36.274  1.00 23.13  ? 182 MET B CG  1 
ATOM   5336 S  SD  . MET B 1 181 ? 4.299   -6.039  37.852  1.00 26.14  ? 182 MET B SD  1 
ATOM   5337 C  CE  . MET B 1 181 ? 3.740   -4.414  37.284  1.00 22.85  ? 182 MET B CE  1 
ATOM   5338 N  N   . LEU B 1 182 ? 0.480   -9.719  36.089  1.00 23.84  ? 183 LEU B N   1 
ATOM   5339 C  CA  . LEU B 1 182 ? -0.894  -10.062 35.715  1.00 25.06  ? 183 LEU B CA  1 
ATOM   5340 C  C   . LEU B 1 182 ? -1.725  -10.605 36.879  1.00 26.25  ? 183 LEU B C   1 
ATOM   5341 O  O   . LEU B 1 182 ? -2.880  -10.980 36.688  1.00 26.44  ? 183 LEU B O   1 
ATOM   5342 C  CB  . LEU B 1 182 ? -0.926  -11.010 34.508  1.00 24.35  ? 183 LEU B CB  1 
ATOM   5343 C  CG  . LEU B 1 182 ? -0.293  -10.487 33.208  1.00 23.52  ? 183 LEU B CG  1 
ATOM   5344 C  CD1 . LEU B 1 182 ? -0.486  -11.485 32.076  1.00 21.67  ? 183 LEU B CD1 1 
ATOM   5345 C  CD2 . LEU B 1 182 ? -0.827  -9.100  32.816  1.00 21.55  ? 183 LEU B CD2 1 
ATOM   5346 N  N   . GLU B 1 183 ? -1.136  -10.630 38.076  1.00 27.82  ? 184 GLU B N   1 
ATOM   5347 C  CA  . GLU B 1 183 ? -1.854  -11.002 39.300  1.00 29.62  ? 184 GLU B CA  1 
ATOM   5348 C  C   . GLU B 1 183 ? -2.733  -9.842  39.776  1.00 30.30  ? 184 GLU B C   1 
ATOM   5349 O  O   . GLU B 1 183 ? -2.578  -8.708  39.322  1.00 30.28  ? 184 GLU B O   1 
ATOM   5350 C  CB  . GLU B 1 183 ? -0.878  -11.406 40.416  1.00 29.80  ? 184 GLU B CB  1 
ATOM   5351 C  CG  . GLU B 1 183 ? 0.074   -12.568 40.089  1.00 32.39  ? 184 GLU B CG  1 
ATOM   5352 C  CD  . GLU B 1 183 ? -0.622  -13.922 39.907  1.00 36.54  ? 184 GLU B CD  1 
ATOM   5353 O  OE1 . GLU B 1 183 ? -1.864  -14.008 40.038  1.00 39.14  ? 184 GLU B OE1 1 
ATOM   5354 O  OE2 . GLU B 1 183 ? 0.084   -14.917 39.633  1.00 38.38  ? 184 GLU B OE2 1 
ATOM   5355 N  N   . GLU B 1 184 ? -3.644  -10.125 40.702  1.00 31.61  ? 185 GLU B N   1 
ATOM   5356 C  CA  . GLU B 1 184 ? -4.565  -9.105  41.207  1.00 32.79  ? 185 GLU B CA  1 
ATOM   5357 C  C   . GLU B 1 184 ? -3.901  -8.005  42.024  1.00 32.87  ? 185 GLU B C   1 
ATOM   5358 O  O   . GLU B 1 184 ? -4.317  -6.850  41.950  1.00 33.06  ? 185 GLU B O   1 
ATOM   5359 C  CB  . GLU B 1 184 ? -5.716  -9.735  41.982  1.00 33.18  ? 185 GLU B CB  1 
ATOM   5360 C  CG  . GLU B 1 184 ? -6.983  -9.837  41.152  1.00 36.46  ? 185 GLU B CG  1 
ATOM   5361 C  CD  . GLU B 1 184 ? -8.181  -10.274 41.966  1.00 40.79  ? 185 GLU B CD  1 
ATOM   5362 O  OE1 . GLU B 1 184 ? -8.257  -11.479 42.305  1.00 42.56  ? 185 GLU B OE1 1 
ATOM   5363 O  OE2 . GLU B 1 184 ? -9.048  -9.413  42.259  1.00 42.37  ? 185 GLU B OE2 1 
ATOM   5364 N  N   . VAL B 1 185 ? -2.881  -8.366  42.798  1.00 33.26  ? 186 VAL B N   1 
ATOM   5365 C  CA  . VAL B 1 185 ? -2.079  -7.390  43.533  1.00 33.62  ? 186 VAL B CA  1 
ATOM   5366 C  C   . VAL B 1 185 ? -0.690  -7.345  42.903  1.00 33.55  ? 186 VAL B C   1 
ATOM   5367 O  O   . VAL B 1 185 ? 0.024   -8.353  42.859  1.00 33.82  ? 186 VAL B O   1 
ATOM   5368 C  CB  . VAL B 1 185 ? -2.008  -7.708  45.052  1.00 33.93  ? 186 VAL B CB  1 
ATOM   5369 C  CG1 . VAL B 1 185 ? -1.090  -6.717  45.775  1.00 34.33  ? 186 VAL B CG1 1 
ATOM   5370 C  CG2 . VAL B 1 185 ? -3.411  -7.674  45.673  1.00 34.18  ? 186 VAL B CG2 1 
ATOM   5371 N  N   . VAL B 1 186 ? -0.321  -6.165  42.420  1.00 33.17  ? 187 VAL B N   1 
ATOM   5372 C  CA  . VAL B 1 186 ? 0.828   -5.999  41.528  1.00 32.80  ? 187 VAL B CA  1 
ATOM   5373 C  C   . VAL B 1 186 ? 2.016   -5.367  42.258  1.00 32.22  ? 187 VAL B C   1 
ATOM   5374 O  O   . VAL B 1 186 ? 1.829   -4.613  43.210  1.00 32.42  ? 187 VAL B O   1 
ATOM   5375 C  CB  . VAL B 1 186 ? 0.402   -5.156  40.282  1.00 32.89  ? 187 VAL B CB  1 
ATOM   5376 C  CG1 . VAL B 1 186 ? 1.551   -4.363  39.704  1.00 32.99  ? 187 VAL B CG1 1 
ATOM   5377 C  CG2 . VAL B 1 186 ? -0.256  -6.052  39.219  1.00 33.12  ? 187 VAL B CG2 1 
ATOM   5378 N  N   . ASN B 1 187 ? 3.230   -5.688  41.819  1.00 31.29  ? 188 ASN B N   1 
ATOM   5379 C  CA  . ASN B 1 187 ? 4.425   -5.039  42.336  1.00 30.71  ? 188 ASN B CA  1 
ATOM   5380 C  C   . ASN B 1 187 ? 4.441   -3.538  41.988  1.00 29.83  ? 188 ASN B C   1 
ATOM   5381 O  O   . ASN B 1 187 ? 4.559   -3.175  40.815  1.00 29.52  ? 188 ASN B O   1 
ATOM   5382 C  CB  . ASN B 1 187 ? 5.690   -5.734  41.814  1.00 31.04  ? 188 ASN B CB  1 
ATOM   5383 C  CG  . ASN B 1 187 ? 6.952   -5.271  42.534  1.00 32.93  ? 188 ASN B CG  1 
ATOM   5384 O  OD1 . ASN B 1 187 ? 7.083   -4.101  42.903  1.00 35.57  ? 188 ASN B OD1 1 
ATOM   5385 N  ND2 . ASN B 1 187 ? 7.883   -6.194  42.748  1.00 34.45  ? 188 ASN B ND2 1 
ATOM   5386 N  N   . PRO B 1 188 ? 4.332   -2.664  43.013  1.00 29.05  ? 189 PRO B N   1 
ATOM   5387 C  CA  . PRO B 1 188 ? 4.277   -1.220  42.763  1.00 28.11  ? 189 PRO B CA  1 
ATOM   5388 C  C   . PRO B 1 188 ? 5.566   -0.661  42.160  1.00 27.25  ? 189 PRO B C   1 
ATOM   5389 O  O   . PRO B 1 188 ? 5.510   0.318   41.419  1.00 26.87  ? 189 PRO B O   1 
ATOM   5390 C  CB  . PRO B 1 188 ? 4.031   -0.618  44.156  1.00 28.42  ? 189 PRO B CB  1 
ATOM   5391 C  CG  . PRO B 1 188 ? 3.685   -1.786  45.051  1.00 29.40  ? 189 PRO B CG  1 
ATOM   5392 C  CD  . PRO B 1 188 ? 4.358   -2.970  44.456  1.00 28.88  ? 189 PRO B CD  1 
ATOM   5393 N  N   . GLU B 1 189 ? 6.706   -1.281  42.464  1.00 26.32  ? 190 GLU B N   1 
ATOM   5394 C  CA  . GLU B 1 189 ? 7.994   -0.825  41.936  1.00 25.86  ? 190 GLU B CA  1 
ATOM   5395 C  C   . GLU B 1 189 ? 8.159   -1.185  40.465  1.00 24.67  ? 190 GLU B C   1 
ATOM   5396 O  O   . GLU B 1 189 ? 8.751   -0.421  39.699  1.00 24.17  ? 190 GLU B O   1 
ATOM   5397 C  CB  . GLU B 1 189 ? 9.179   -1.352  42.763  1.00 26.32  ? 190 GLU B CB  1 
ATOM   5398 C  CG  . GLU B 1 189 ? 9.310   -0.698  44.148  1.00 29.01  ? 190 GLU B CG  1 
ATOM   5399 C  CD  . GLU B 1 189 ? 9.488   0.818   44.072  1.00 32.59  ? 190 GLU B CD  1 
ATOM   5400 O  OE1 . GLU B 1 189 ? 10.410  1.273   43.367  1.00 34.59  ? 190 GLU B OE1 1 
ATOM   5401 O  OE2 . GLU B 1 189 ? 8.708   1.558   44.713  1.00 35.04  ? 190 GLU B OE2 1 
ATOM   5402 N  N   . ALA B 1 190 ? 7.642   -2.349  40.083  1.00 23.46  ? 191 ALA B N   1 
ATOM   5403 C  CA  . ALA B 1 190 ? 7.563   -2.731  38.678  1.00 22.63  ? 191 ALA B CA  1 
ATOM   5404 C  C   . ALA B 1 190 ? 6.599   -1.816  37.900  1.00 22.05  ? 191 ALA B C   1 
ATOM   5405 O  O   . ALA B 1 190 ? 6.892   -1.421  36.769  1.00 21.95  ? 191 ALA B O   1 
ATOM   5406 C  CB  . ALA B 1 190 ? 7.158   -4.191  38.540  1.00 22.32  ? 191 ALA B CB  1 
ATOM   5407 N  N   . GLN B 1 191 ? 5.465   -1.473  38.508  1.00 21.54  ? 192 GLN B N   1 
ATOM   5408 C  CA  . GLN B 1 191 ? 4.525   -0.523  37.894  1.00 21.55  ? 192 GLN B CA  1 
ATOM   5409 C  C   . GLN B 1 191 ? 5.188   0.840   37.658  1.00 21.66  ? 192 GLN B C   1 
ATOM   5410 O  O   . GLN B 1 191 ? 4.986   1.458   36.606  1.00 21.94  ? 192 GLN B O   1 
ATOM   5411 C  CB  . GLN B 1 191 ? 3.253   -0.382  38.729  1.00 21.09  ? 192 GLN B CB  1 
ATOM   5412 C  CG  . GLN B 1 191 ? 2.132   0.413   38.048  1.00 21.12  ? 192 GLN B CG  1 
ATOM   5413 C  CD  . GLN B 1 191 ? 1.612   -0.267  36.782  1.00 20.48  ? 192 GLN B CD  1 
ATOM   5414 O  OE1 . GLN B 1 191 ? 1.065   -1.369  36.836  1.00 20.46  ? 192 GLN B OE1 1 
ATOM   5415 N  NE2 . GLN B 1 191 ? 1.783   0.391   35.641  1.00 17.91  ? 192 GLN B NE2 1 
ATOM   5416 N  N   . ARG B 1 192 ? 6.001   1.282   38.623  1.00 21.56  ? 193 ARG B N   1 
ATOM   5417 C  CA  . ARG B 1 192 ? 6.783   2.515   38.494  1.00 21.41  ? 193 ARG B CA  1 
ATOM   5418 C  C   . ARG B 1 192 ? 7.743   2.474   37.308  1.00 20.46  ? 193 ARG B C   1 
ATOM   5419 O  O   . ARG B 1 192 ? 7.936   3.496   36.631  1.00 19.96  ? 193 ARG B O   1 
ATOM   5420 C  CB  . ARG B 1 192 ? 7.553   2.831   39.783  1.00 21.99  ? 193 ARG B CB  1 
ATOM   5421 C  CG  . ARG B 1 192 ? 6.900   3.922   40.633  1.00 25.52  ? 193 ARG B CG  1 
ATOM   5422 C  CD  . ARG B 1 192 ? 7.659   4.213   41.958  1.00 30.38  ? 193 ARG B CD  1 
ATOM   5423 N  NE  . ARG B 1 192 ? 9.116   4.376   41.814  1.00 33.58  ? 193 ARG B NE  1 
ATOM   5424 C  CZ  . ARG B 1 192 ? 9.728   5.461   41.333  1.00 36.09  ? 193 ARG B CZ  1 
ATOM   5425 N  NH1 . ARG B 1 192 ? 9.023   6.512   40.904  1.00 37.74  ? 193 ARG B NH1 1 
ATOM   5426 N  NH2 . ARG B 1 192 ? 11.057  5.494   41.262  1.00 35.48  ? 193 ARG B NH2 1 
ATOM   5427 N  N   . PHE B 1 193 ? 8.340   1.305   37.064  1.00 19.21  ? 194 PHE B N   1 
ATOM   5428 C  CA  . PHE B 1 193 ? 9.223   1.131   35.920  1.00 18.83  ? 194 PHE B CA  1 
ATOM   5429 C  C   . PHE B 1 193 ? 8.453   1.309   34.603  1.00 18.07  ? 194 PHE B C   1 
ATOM   5430 O  O   . PHE B 1 193 ? 8.911   2.011   33.705  1.00 17.45  ? 194 PHE B O   1 
ATOM   5431 C  CB  . PHE B 1 193 ? 9.933   -0.232  35.960  1.00 19.21  ? 194 PHE B CB  1 
ATOM   5432 C  CG  . PHE B 1 193 ? 10.868  -0.468  34.791  1.00 21.03  ? 194 PHE B CG  1 
ATOM   5433 C  CD1 . PHE B 1 193 ? 12.140  0.084   34.778  1.00 23.54  ? 194 PHE B CD1 1 
ATOM   5434 C  CD2 . PHE B 1 193 ? 10.469  -1.235  33.700  1.00 23.97  ? 194 PHE B CD2 1 
ATOM   5435 C  CE1 . PHE B 1 193 ? 13.008  -0.131  33.711  1.00 24.32  ? 194 PHE B CE1 1 
ATOM   5436 C  CE2 . PHE B 1 193 ? 11.333  -1.450  32.620  1.00 24.97  ? 194 PHE B CE2 1 
ATOM   5437 C  CZ  . PHE B 1 193 ? 12.607  -0.891  32.632  1.00 24.65  ? 194 PHE B CZ  1 
ATOM   5438 N  N   . ILE B 1 194 ? 7.288   0.667   34.510  1.00 17.48  ? 195 ILE B N   1 
ATOM   5439 C  CA  . ILE B 1 194 ? 6.412   0.763   33.339  1.00 16.89  ? 195 ILE B CA  1 
ATOM   5440 C  C   . ILE B 1 194 ? 6.022   2.220   33.058  1.00 17.04  ? 195 ILE B C   1 
ATOM   5441 O  O   . ILE B 1 194 ? 6.174   2.692   31.933  1.00 16.75  ? 195 ILE B O   1 
ATOM   5442 C  CB  . ILE B 1 194 ? 5.145   -0.127  33.485  1.00 16.46  ? 195 ILE B CB  1 
ATOM   5443 C  CG1 . ILE B 1 194 ? 5.519   -1.608  33.464  1.00 16.33  ? 195 ILE B CG1 1 
ATOM   5444 C  CG2 . ILE B 1 194 ? 4.125   0.176   32.386  1.00 15.99  ? 195 ILE B CG2 1 
ATOM   5445 C  CD1 . ILE B 1 194 ? 4.392   -2.559  33.914  1.00 15.25  ? 195 ILE B CD1 1 
ATOM   5446 N  N   . ASP B 1 195 ? 5.543   2.923   34.086  1.00 17.23  ? 196 ASP B N   1 
ATOM   5447 C  CA  . ASP B 1 195 ? 5.133   4.326   33.962  1.00 17.53  ? 196 ASP B CA  1 
ATOM   5448 C  C   . ASP B 1 195 ? 6.271   5.223   33.522  1.00 16.90  ? 196 ASP B C   1 
ATOM   5449 O  O   . ASP B 1 195 ? 6.053   6.173   32.789  1.00 16.83  ? 196 ASP B O   1 
ATOM   5450 C  CB  . ASP B 1 195 ? 4.572   4.857   35.292  1.00 18.02  ? 196 ASP B CB  1 
ATOM   5451 C  CG  . ASP B 1 195 ? 3.325   4.117   35.742  1.00 20.75  ? 196 ASP B CG  1 
ATOM   5452 O  OD1 . ASP B 1 195 ? 2.791   3.277   34.980  1.00 23.08  ? 196 ASP B OD1 1 
ATOM   5453 O  OD2 . ASP B 1 195 ? 2.873   4.381   36.875  1.00 25.46  ? 196 ASP B OD2 1 
ATOM   5454 N  N   . ALA B 1 196 ? 7.481   4.920   33.978  1.00 16.65  ? 197 ALA B N   1 
ATOM   5455 C  CA  . ALA B 1 196 ? 8.647   5.734   33.655  1.00 16.82  ? 197 ALA B CA  1 
ATOM   5456 C  C   . ALA B 1 196 ? 8.964   5.656   32.173  1.00 17.11  ? 197 ALA B C   1 
ATOM   5457 O  O   . ALA B 1 196 ? 9.408   6.643   31.576  1.00 17.09  ? 197 ALA B O   1 
ATOM   5458 C  CB  . ALA B 1 196 ? 9.837   5.305   34.466  1.00 16.22  ? 197 ALA B CB  1 
ATOM   5459 N  N   . ILE B 1 197 ? 8.741   4.477   31.591  1.00 17.12  ? 198 ILE B N   1 
ATOM   5460 C  CA  . ILE B 1 197 ? 9.032   4.254   30.185  1.00 17.15  ? 198 ILE B CA  1 
ATOM   5461 C  C   . ILE B 1 197 ? 8.163   5.160   29.311  1.00 17.48  ? 198 ILE B C   1 
ATOM   5462 O  O   . ILE B 1 197 ? 8.666   5.829   28.404  1.00 16.88  ? 198 ILE B O   1 
ATOM   5463 C  CB  . ILE B 1 197 ? 8.863   2.763   29.788  1.00 17.26  ? 198 ILE B CB  1 
ATOM   5464 C  CG1 . ILE B 1 197 ? 9.970   1.918   30.436  1.00 15.92  ? 198 ILE B CG1 1 
ATOM   5465 C  CG2 . ILE B 1 197 ? 8.848   2.610   28.257  1.00 15.73  ? 198 ILE B CG2 1 
ATOM   5466 C  CD1 . ILE B 1 197 ? 9.741   0.435   30.333  1.00 16.30  ? 198 ILE B CD1 1 
ATOM   5467 N  N   . TYR B 1 198 ? 6.868   5.185   29.608  1.00 18.11  ? 199 TYR B N   1 
ATOM   5468 C  CA  . TYR B 1 198 ? 5.926   6.030   28.888  1.00 19.12  ? 199 TYR B CA  1 
ATOM   5469 C  C   . TYR B 1 198 ? 6.248   7.504   29.105  1.00 18.61  ? 199 TYR B C   1 
ATOM   5470 O  O   . TYR B 1 198 ? 6.209   8.309   28.165  1.00 17.93  ? 199 TYR B O   1 
ATOM   5471 C  CB  . TYR B 1 198 ? 4.496   5.734   29.344  1.00 20.14  ? 199 TYR B CB  1 
ATOM   5472 C  CG  . TYR B 1 198 ? 3.470   6.632   28.711  1.00 23.94  ? 199 TYR B CG  1 
ATOM   5473 C  CD1 . TYR B 1 198 ? 3.102   6.462   27.377  1.00 29.01  ? 199 TYR B CD1 1 
ATOM   5474 C  CD2 . TYR B 1 198 ? 2.874   7.662   29.437  1.00 26.52  ? 199 TYR B CD2 1 
ATOM   5475 C  CE1 . TYR B 1 198 ? 2.152   7.299   26.781  1.00 31.90  ? 199 TYR B CE1 1 
ATOM   5476 C  CE2 . TYR B 1 198 ? 1.929   8.498   28.859  1.00 29.59  ? 199 TYR B CE2 1 
ATOM   5477 C  CZ  . TYR B 1 198 ? 1.571   8.310   27.533  1.00 32.29  ? 199 TYR B CZ  1 
ATOM   5478 O  OH  . TYR B 1 198 ? 0.635   9.129   26.947  1.00 35.95  ? 199 TYR B OH  1 
ATOM   5479 N  N   . GLN B 1 199 ? 6.561   7.841   30.354  1.00 18.20  ? 200 GLN B N   1 
ATOM   5480 C  CA  . GLN B 1 199 ? 6.920   9.207   30.736  1.00 18.06  ? 200 GLN B CA  1 
ATOM   5481 C  C   . GLN B 1 199 ? 8.161   9.663   29.977  1.00 17.31  ? 200 GLN B C   1 
ATOM   5482 O  O   . GLN B 1 199 ? 8.208   10.789  29.479  1.00 17.14  ? 200 GLN B O   1 
ATOM   5483 C  CB  . GLN B 1 199 ? 7.104   9.307   32.261  1.00 18.12  ? 200 GLN B CB  1 
ATOM   5484 C  CG  . GLN B 1 199 ? 7.641   10.643  32.765  1.00 20.48  ? 200 GLN B CG  1 
ATOM   5485 C  CD  . GLN B 1 199 ? 6.589   11.760  32.835  1.00 23.40  ? 200 GLN B CD  1 
ATOM   5486 O  OE1 . GLN B 1 199 ? 5.529   11.695  32.179  1.00 23.07  ? 200 GLN B OE1 1 
ATOM   5487 N  NE2 . GLN B 1 199 ? 6.884   12.798  33.638  1.00 20.97  ? 200 GLN B NE2 1 
ATOM   5488 N  N   . MET B 1 200 ? 9.143   8.771   29.861  1.00 16.14  ? 201 MET B N   1 
ATOM   5489 C  CA  . MET B 1 200 ? 10.339  9.022   29.056  1.00 15.90  ? 201 MET B CA  1 
ATOM   5490 C  C   . MET B 1 200 ? 10.020  9.376   27.579  1.00 15.64  ? 201 MET B C   1 
ATOM   5491 O  O   . MET B 1 200 ? 10.554  10.360  27.033  1.00 15.04  ? 201 MET B O   1 
ATOM   5492 C  CB  . MET B 1 200 ? 11.271  7.810   29.142  1.00 15.66  ? 201 MET B CB  1 
ATOM   5493 C  CG  . MET B 1 200 ? 12.617  7.959   28.466  1.00 16.96  ? 201 MET B CG  1 
ATOM   5494 S  SD  . MET B 1 200 ? 12.602  7.593   26.696  1.00 19.31  ? 201 MET B SD  1 
ATOM   5495 C  CE  . MET B 1 200 ? 12.903  9.200   26.115  1.00 21.33  ? 201 MET B CE  1 
ATOM   5496 N  N   . PHE B 1 201 ? 9.162   8.578   26.939  1.00 15.08  ? 202 PHE B N   1 
ATOM   5497 C  CA  . PHE B 1 201 ? 8.699   8.883   25.575  1.00 14.89  ? 202 PHE B CA  1 
ATOM   5498 C  C   . PHE B 1 201 ? 7.938   10.204  25.508  1.00 14.90  ? 202 PHE B C   1 
ATOM   5499 O  O   . PHE B 1 201 ? 8.236   11.075  24.675  1.00 14.68  ? 202 PHE B O   1 
ATOM   5500 C  CB  . PHE B 1 201 ? 7.822   7.755   25.031  1.00 14.69  ? 202 PHE B CB  1 
ATOM   5501 C  CG  . PHE B 1 201 ? 8.590   6.532   24.643  1.00 14.47  ? 202 PHE B CG  1 
ATOM   5502 C  CD1 . PHE B 1 201 ? 8.254   5.293   25.166  1.00 14.24  ? 202 PHE B CD1 1 
ATOM   5503 C  CD2 . PHE B 1 201 ? 9.668   6.625   23.760  1.00 14.18  ? 202 PHE B CD2 1 
ATOM   5504 C  CE1 . PHE B 1 201 ? 8.974   4.150   24.803  1.00 15.90  ? 202 PHE B CE1 1 
ATOM   5505 C  CE2 . PHE B 1 201 ? 10.386  5.495   23.388  1.00 15.39  ? 202 PHE B CE2 1 
ATOM   5506 C  CZ  . PHE B 1 201 ? 10.044  4.253   23.914  1.00 14.22  ? 202 PHE B CZ  1 
ATOM   5507 N  N   . HIS B 1 202 ? 6.970   10.344  26.403  1.00 15.06  ? 203 HIS B N   1 
ATOM   5508 C  CA  . HIS B 1 202 ? 6.110   11.517  26.434  1.00 15.84  ? 203 HIS B CA  1 
ATOM   5509 C  C   . HIS B 1 202 ? 6.916   12.804  26.630  1.00 15.58  ? 203 HIS B C   1 
ATOM   5510 O  O   . HIS B 1 202 ? 6.711   13.778  25.897  1.00 16.01  ? 203 HIS B O   1 
ATOM   5511 C  CB  . HIS B 1 202 ? 5.016   11.365  27.497  1.00 16.04  ? 203 HIS B CB  1 
ATOM   5512 C  CG  . HIS B 1 202 ? 3.936   12.390  27.398  1.00 18.42  ? 203 HIS B CG  1 
ATOM   5513 N  ND1 . HIS B 1 202 ? 2.860   12.254  26.548  1.00 22.51  ? 203 HIS B ND1 1 
ATOM   5514 C  CD2 . HIS B 1 202 ? 3.760   13.570  28.042  1.00 20.34  ? 203 HIS B CD2 1 
ATOM   5515 C  CE1 . HIS B 1 202 ? 2.075   13.315  26.661  1.00 22.93  ? 203 HIS B CE1 1 
ATOM   5516 N  NE2 . HIS B 1 202 ? 2.599   14.126  27.563  1.00 21.72  ? 203 HIS B NE2 1 
ATOM   5517 N  N   . THR B 1 203 ? 7.849   12.808  27.582  1.00 15.03  ? 204 THR B N   1 
ATOM   5518 C  CA  . THR B 1 203 ? 8.639   14.016  27.851  1.00 14.23  ? 204 THR B CA  1 
ATOM   5519 C  C   . THR B 1 203 ? 9.682   14.307  26.764  1.00 14.43  ? 204 THR B C   1 
ATOM   5520 O  O   . THR B 1 203 ? 10.267  15.385  26.741  1.00 14.52  ? 204 THR B O   1 
ATOM   5521 C  CB  . THR B 1 203 ? 9.324   13.997  29.250  1.00 14.34  ? 204 THR B CB  1 
ATOM   5522 O  OG1 . THR B 1 203 ? 10.230  12.887  29.340  1.00 13.18  ? 204 THR B OG1 1 
ATOM   5523 C  CG2 . THR B 1 203 ? 8.291   13.946  30.368  1.00 13.24  ? 204 THR B CG2 1 
ATOM   5524 N  N   . SER B 1 204 ? 9.904   13.360  25.856  1.00 13.85  ? 205 SER B N   1 
ATOM   5525 C  CA  . SER B 1 204 ? 10.836  13.586  24.759  1.00 13.63  ? 205 SER B CA  1 
ATOM   5526 C  C   . SER B 1 204 ? 10.318  14.633  23.768  1.00 13.61  ? 205 SER B C   1 
ATOM   5527 O  O   . SER B 1 204 ? 11.106  15.369  23.180  1.00 13.09  ? 205 SER B O   1 
ATOM   5528 C  CB  . SER B 1 204 ? 11.111  12.290  23.976  1.00 13.48  ? 205 SER B CB  1 
ATOM   5529 O  OG  . SER B 1 204 ? 11.661  11.272  24.785  1.00 14.50  ? 205 SER B OG  1 
ATOM   5530 N  N   . VAL B 1 205 ? 9.001   14.682  23.586  1.00 13.53  ? 206 VAL B N   1 
ATOM   5531 C  CA  . VAL B 1 205 ? 8.384   15.443  22.489  1.00 13.88  ? 206 VAL B CA  1 
ATOM   5532 C  C   . VAL B 1 205 ? 8.702   16.949  22.492  1.00 14.46  ? 206 VAL B C   1 
ATOM   5533 O  O   . VAL B 1 205 ? 9.137   17.472  21.465  1.00 14.64  ? 206 VAL B O   1 
ATOM   5534 C  CB  . VAL B 1 205 ? 6.849   15.143  22.381  1.00 13.86  ? 206 VAL B CB  1 
ATOM   5535 C  CG1 . VAL B 1 205 ? 6.204   15.916  21.241  1.00 13.55  ? 206 VAL B CG1 1 
ATOM   5536 C  CG2 . VAL B 1 205 ? 6.639   13.649  22.172  1.00 13.38  ? 206 VAL B CG2 1 
ATOM   5537 N  N   . PRO B 1 206 ? 8.531   17.642  23.645  1.00 15.03  ? 207 PRO B N   1 
ATOM   5538 C  CA  . PRO B 1 206 ? 8.824   19.089  23.644  1.00 15.40  ? 207 PRO B CA  1 
ATOM   5539 C  C   . PRO B 1 206 ? 10.280  19.448  23.341  1.00 16.44  ? 207 PRO B C   1 
ATOM   5540 O  O   . PRO B 1 206 ? 10.567  20.601  23.053  1.00 16.88  ? 207 PRO B O   1 
ATOM   5541 C  CB  . PRO B 1 206 ? 8.461   19.531  25.069  1.00 15.10  ? 207 PRO B CB  1 
ATOM   5542 C  CG  . PRO B 1 206 ? 7.489   18.476  25.572  1.00 15.50  ? 207 PRO B CG  1 
ATOM   5543 C  CD  . PRO B 1 206 ? 7.997   17.193  24.950  1.00 14.59  ? 207 PRO B CD  1 
ATOM   5544 N  N   . MET B 1 207 ? 11.188  18.479  23.386  1.00 16.96  ? 208 MET B N   1 
ATOM   5545 C  CA  . MET B 1 207 ? 12.591  18.774  23.132  1.00 18.16  ? 208 MET B CA  1 
ATOM   5546 C  C   . MET B 1 207 ? 13.078  18.319  21.753  1.00 19.01  ? 208 MET B C   1 
ATOM   5547 O  O   . MET B 1 207 ? 14.245  18.523  21.419  1.00 19.08  ? 208 MET B O   1 
ATOM   5548 C  CB  . MET B 1 207 ? 13.483  18.166  24.224  1.00 17.27  ? 208 MET B CB  1 
ATOM   5549 C  CG  . MET B 1 207 ? 13.113  18.576  25.638  1.00 17.46  ? 208 MET B CG  1 
ATOM   5550 S  SD  . MET B 1 207 ? 14.197  17.835  26.881  1.00 15.16  ? 208 MET B SD  1 
ATOM   5551 C  CE  . MET B 1 207 ? 13.550  16.154  26.947  1.00 13.64  ? 208 MET B CE  1 
ATOM   5552 N  N   . LEU B 1 208 ? 12.182  17.753  20.946  1.00 20.29  ? 209 LEU B N   1 
ATOM   5553 C  CA  . LEU B 1 208 ? 12.569  16.944  19.760  1.00 21.82  ? 209 LEU B CA  1 
ATOM   5554 C  C   . LEU B 1 208 ? 13.414  17.578  18.630  1.00 21.91  ? 209 LEU B C   1 
ATOM   5555 O  O   . LEU B 1 208 ? 14.398  16.969  18.145  1.00 22.60  ? 209 LEU B O   1 
ATOM   5556 C  CB  . LEU B 1 208 ? 11.337  16.249  19.172  1.00 22.16  ? 209 LEU B CB  1 
ATOM   5557 C  CG  . LEU B 1 208 ? 11.621  15.032  18.288  1.00 25.03  ? 209 LEU B CG  1 
ATOM   5558 C  CD1 . LEU B 1 208 ? 12.625  14.053  18.935  1.00 25.68  ? 209 LEU B CD1 1 
ATOM   5559 C  CD2 . LEU B 1 208 ? 10.323  14.333  17.926  1.00 24.67  ? 209 LEU B CD2 1 
ATOM   5560 N  N   . ASN B 1 209 ? 13.047  18.780  18.206  1.00 21.17  ? 210 ASN B N   1 
ATOM   5561 C  CA  . ASN B 1 209 ? 13.747  19.435  17.104  1.00 20.97  ? 210 ASN B CA  1 
ATOM   5562 C  C   . ASN B 1 209 ? 14.713  20.527  17.589  1.00 20.99  ? 210 ASN B C   1 
ATOM   5563 O  O   . ASN B 1 209 ? 14.969  21.509  16.879  1.00 21.15  ? 210 ASN B O   1 
ATOM   5564 C  CB  . ASN B 1 209 ? 12.728  20.007  16.106  1.00 20.63  ? 210 ASN B CB  1 
ATOM   5565 C  CG  . ASN B 1 209 ? 11.946  18.918  15.391  1.00 21.51  ? 210 ASN B CG  1 
ATOM   5566 O  OD1 . ASN B 1 209 ? 12.429  18.329  14.418  1.00 22.76  ? 210 ASN B OD1 1 
ATOM   5567 N  ND2 . ASN B 1 209 ? 10.744  18.632  15.876  1.00 20.31  ? 210 ASN B ND2 1 
ATOM   5568 N  N   . LEU B 1 210 ? 15.253  20.348  18.794  1.00 20.58  ? 211 LEU B N   1 
ATOM   5569 C  CA  . LEU B 1 210 ? 16.116  21.365  19.413  1.00 20.69  ? 211 LEU B CA  1 
ATOM   5570 C  C   . LEU B 1 210 ? 17.500  20.835  19.764  1.00 20.54  ? 211 LEU B C   1 
ATOM   5571 O  O   . LEU B 1 210 ? 17.637  19.691  20.192  1.00 20.66  ? 211 LEU B O   1 
ATOM   5572 C  CB  . LEU B 1 210 ? 15.452  21.925  20.678  1.00 20.58  ? 211 LEU B CB  1 
ATOM   5573 C  CG  . LEU B 1 210 ? 14.069  22.561  20.506  1.00 20.64  ? 211 LEU B CG  1 
ATOM   5574 C  CD1 . LEU B 1 210 ? 13.477  22.903  21.870  1.00 20.91  ? 211 LEU B CD1 1 
ATOM   5575 C  CD2 . LEU B 1 210 ? 14.128  23.790  19.595  1.00 19.81  ? 211 LEU B CD2 1 
ATOM   5576 N  N   . PRO B 1 211 ? 18.539  21.666  19.596  1.00 20.68  ? 212 PRO B N   1 
ATOM   5577 C  CA  . PRO B 1 211 ? 19.841  21.224  20.115  1.00 20.67  ? 212 PRO B CA  1 
ATOM   5578 C  C   . PRO B 1 211 ? 19.841  21.208  21.653  1.00 20.32  ? 212 PRO B C   1 
ATOM   5579 O  O   . PRO B 1 211 ? 19.015  21.888  22.271  1.00 19.72  ? 212 PRO B O   1 
ATOM   5580 C  CB  . PRO B 1 211 ? 20.819  22.267  19.561  1.00 20.78  ? 212 PRO B CB  1 
ATOM   5581 C  CG  . PRO B 1 211 ? 19.986  23.498  19.360  1.00 20.97  ? 212 PRO B CG  1 
ATOM   5582 C  CD  . PRO B 1 211 ? 18.600  23.012  18.993  1.00 20.73  ? 212 PRO B CD  1 
ATOM   5583 N  N   . PRO B 1 212 ? 20.729  20.407  22.268  1.00 20.71  ? 213 PRO B N   1 
ATOM   5584 C  CA  . PRO B 1 212 ? 20.720  20.336  23.740  1.00 21.27  ? 213 PRO B CA  1 
ATOM   5585 C  C   . PRO B 1 212 ? 20.906  21.689  24.435  1.00 21.70  ? 213 PRO B C   1 
ATOM   5586 O  O   . PRO B 1 212 ? 20.271  21.914  25.461  1.00 21.91  ? 213 PRO B O   1 
ATOM   5587 C  CB  . PRO B 1 212 ? 21.859  19.362  24.084  1.00 21.03  ? 213 PRO B CB  1 
ATOM   5588 C  CG  . PRO B 1 212 ? 22.527  19.019  22.806  1.00 21.01  ? 213 PRO B CG  1 
ATOM   5589 C  CD  . PRO B 1 212 ? 21.656  19.432  21.663  1.00 20.72  ? 213 PRO B CD  1 
ATOM   5590 N  N   . ASP B 1 213 ? 21.714  22.584  23.858  1.00 21.95  ? 214 ASP B N   1 
ATOM   5591 C  CA  . ASP B 1 213 ? 21.893  23.949  24.388  1.00 23.05  ? 214 ASP B CA  1 
ATOM   5592 C  C   . ASP B 1 213 ? 20.583  24.700  24.616  1.00 23.62  ? 214 ASP B C   1 
ATOM   5593 O  O   . ASP B 1 213 ? 20.514  25.560  25.491  1.00 23.21  ? 214 ASP B O   1 
ATOM   5594 C  CB  . ASP B 1 213 ? 22.774  24.804  23.468  1.00 22.99  ? 214 ASP B CB  1 
ATOM   5595 C  CG  . ASP B 1 213 ? 24.253  24.543  23.659  1.00 24.06  ? 214 ASP B CG  1 
ATOM   5596 O  OD1 . ASP B 1 213 ? 24.644  23.922  24.673  1.00 25.80  ? 214 ASP B OD1 1 
ATOM   5597 O  OD2 . ASP B 1 213 ? 25.034  24.957  22.778  1.00 26.51  ? 214 ASP B OD2 1 
ATOM   5598 N  N   . LEU B 1 214 ? 19.559  24.393  23.818  1.00 24.13  ? 215 LEU B N   1 
ATOM   5599 C  CA  . LEU B 1 214 ? 18.265  25.053  23.978  1.00 24.68  ? 215 LEU B CA  1 
ATOM   5600 C  C   . LEU B 1 214 ? 17.270  24.315  24.899  1.00 25.42  ? 215 LEU B C   1 
ATOM   5601 O  O   . LEU B 1 214 ? 16.315  24.942  25.365  1.00 25.40  ? 215 LEU B O   1 
ATOM   5602 C  CB  . LEU B 1 214 ? 17.653  25.424  22.616  1.00 24.62  ? 215 LEU B CB  1 
ATOM   5603 C  CG  . LEU B 1 214 ? 18.545  26.222  21.648  1.00 24.19  ? 215 LEU B CG  1 
ATOM   5604 C  CD1 . LEU B 1 214 ? 17.801  26.517  20.364  1.00 24.04  ? 215 LEU B CD1 1 
ATOM   5605 C  CD2 . LEU B 1 214 ? 19.103  27.531  22.246  1.00 23.33  ? 215 LEU B CD2 1 
ATOM   5606 N  N   . PHE B 1 215 ? 17.527  23.027  25.208  1.00 26.51  ? 216 PHE B N   1 
ATOM   5607 C  CA  . PHE B 1 215 ? 16.669  22.220  26.116  1.00 26.68  ? 216 PHE B CA  1 
ATOM   5608 C  C   . PHE B 1 215 ? 16.512  22.914  27.422  1.00 27.25  ? 216 PHE B C   1 
ATOM   5609 O  O   . PHE B 1 215 ? 15.400  23.250  27.835  1.00 27.71  ? 216 PHE B O   1 
ATOM   5610 C  CB  . PHE B 1 215 ? 17.285  20.869  26.544  1.00 26.98  ? 216 PHE B CB  1 
ATOM   5611 C  CG  . PHE B 1 215 ? 17.470  19.875  25.455  1.00 24.73  ? 216 PHE B CG  1 
ATOM   5612 C  CD1 . PHE B 1 215 ? 18.264  18.751  25.691  1.00 23.72  ? 216 PHE B CD1 1 
ATOM   5613 C  CD2 . PHE B 1 215 ? 16.886  20.042  24.215  1.00 21.51  ? 216 PHE B CD2 1 
ATOM   5614 C  CE1 . PHE B 1 215 ? 18.480  17.815  24.699  1.00 22.56  ? 216 PHE B CE1 1 
ATOM   5615 C  CE2 . PHE B 1 215 ? 17.103  19.108  23.217  1.00 21.45  ? 216 PHE B CE2 1 
ATOM   5616 C  CZ  . PHE B 1 215 ? 17.893  17.990  23.463  1.00 21.67  ? 216 PHE B CZ  1 
ATOM   5617 N  N   . ARG B 1 216 ? 17.651  23.061  28.101  1.00 27.44  ? 217 ARG B N   1 
ATOM   5618 C  CA  . ARG B 1 216 ? 17.702  23.596  29.452  1.00 27.66  ? 217 ARG B CA  1 
ATOM   5619 C  C   . ARG B 1 216 ? 17.269  25.042  29.524  1.00 27.02  ? 217 ARG B C   1 
ATOM   5620 O  O   . ARG B 1 216 ? 16.911  25.532  30.598  1.00 27.51  ? 217 ARG B O   1 
ATOM   5621 C  CB  . ARG B 1 216 ? 19.106  23.426  30.051  1.00 28.96  ? 217 ARG B CB  1 
ATOM   5622 C  CG  . ARG B 1 216 ? 20.263  23.670  29.076  1.00 30.81  ? 217 ARG B CG  1 
ATOM   5623 C  CD  . ARG B 1 216 ? 21.627  23.629  29.789  1.00 34.26  ? 217 ARG B CD  1 
ATOM   5624 N  NE  . ARG B 1 216 ? 22.703  24.065  28.896  1.00 36.59  ? 217 ARG B NE  1 
ATOM   5625 C  CZ  . ARG B 1 216 ? 23.422  23.265  28.107  1.00 38.40  ? 217 ARG B CZ  1 
ATOM   5626 N  NH1 . ARG B 1 216 ? 23.219  21.946  28.085  1.00 39.43  ? 217 ARG B NH1 1 
ATOM   5627 N  NH2 . ARG B 1 216 ? 24.361  23.792  27.334  1.00 39.53  ? 217 ARG B NH2 1 
ATOM   5628 N  N   . LEU B 1 217 ? 17.300  25.731  28.386  1.00 25.98  ? 218 LEU B N   1 
ATOM   5629 C  CA  . LEU B 1 217 ? 16.887  27.131  28.338  1.00 24.87  ? 218 LEU B CA  1 
ATOM   5630 C  C   . LEU B 1 217 ? 15.373  27.287  28.266  1.00 23.72  ? 218 LEU B C   1 
ATOM   5631 O  O   . LEU B 1 217 ? 14.789  28.048  29.028  1.00 23.38  ? 218 LEU B O   1 
ATOM   5632 C  CB  . LEU B 1 217 ? 17.557  27.856  27.161  1.00 24.83  ? 218 LEU B CB  1 
ATOM   5633 C  CG  . LEU B 1 217 ? 18.936  28.463  27.410  1.00 25.59  ? 218 LEU B CG  1 
ATOM   5634 C  CD1 . LEU B 1 217 ? 19.416  29.199  26.178  1.00 25.06  ? 218 LEU B CD1 1 
ATOM   5635 C  CD2 . LEU B 1 217 ? 18.883  29.422  28.601  1.00 26.01  ? 218 LEU B CD2 1 
ATOM   5636 N  N   . PHE B 1 218 ? 14.747  26.553  27.350  1.00 22.74  ? 219 PHE B N   1 
ATOM   5637 C  CA  . PHE B 1 218 ? 13.331  26.750  27.047  1.00 22.06  ? 219 PHE B CA  1 
ATOM   5638 C  C   . PHE B 1 218 ? 12.419  25.578  27.383  1.00 21.56  ? 219 PHE B C   1 
ATOM   5639 O  O   . PHE B 1 218 ? 11.196  25.698  27.284  1.00 21.50  ? 219 PHE B O   1 
ATOM   5640 C  CB  . PHE B 1 218 ? 13.155  27.119  25.579  1.00 21.95  ? 219 PHE B CB  1 
ATOM   5641 C  CG  . PHE B 1 218 ? 13.949  28.311  25.162  1.00 22.20  ? 219 PHE B CG  1 
ATOM   5642 C  CD1 . PHE B 1 218 ? 15.036  28.167  24.308  1.00 22.72  ? 219 PHE B CD1 1 
ATOM   5643 C  CD2 . PHE B 1 218 ? 13.621  29.580  25.632  1.00 21.97  ? 219 PHE B CD2 1 
ATOM   5644 C  CE1 . PHE B 1 218 ? 15.781  29.274  23.912  1.00 23.31  ? 219 PHE B CE1 1 
ATOM   5645 C  CE2 . PHE B 1 218 ? 14.352  30.689  25.241  1.00 22.14  ? 219 PHE B CE2 1 
ATOM   5646 C  CZ  . PHE B 1 218 ? 15.440  30.538  24.386  1.00 23.05  ? 219 PHE B CZ  1 
ATOM   5647 N  N   . ARG B 1 219 ? 13.010  24.455  27.778  1.00 21.17  ? 220 ARG B N   1 
ATOM   5648 C  CA  . ARG B 1 219 ? 12.248  23.258  28.130  1.00 21.32  ? 220 ARG B CA  1 
ATOM   5649 C  C   . ARG B 1 219 ? 12.783  22.689  29.450  1.00 21.49  ? 220 ARG B C   1 
ATOM   5650 O  O   . ARG B 1 219 ? 12.910  21.469  29.623  1.00 20.51  ? 220 ARG B O   1 
ATOM   5651 C  CB  . ARG B 1 219 ? 12.328  22.220  26.997  1.00 21.40  ? 220 ARG B CB  1 
ATOM   5652 C  CG  . ARG B 1 219 ? 11.769  22.699  25.649  1.00 21.59  ? 220 ARG B CG  1 
ATOM   5653 C  CD  . ARG B 1 219 ? 10.252  22.763  25.683  1.00 22.60  ? 220 ARG B CD  1 
ATOM   5654 N  NE  . ARG B 1 219 ? 9.666   23.151  24.401  1.00 23.15  ? 220 ARG B NE  1 
ATOM   5655 C  CZ  . ARG B 1 219 ? 9.284   24.390  24.092  1.00 24.11  ? 220 ARG B CZ  1 
ATOM   5656 N  NH1 . ARG B 1 219 ? 9.424   25.386  24.963  1.00 22.92  ? 220 ARG B NH1 1 
ATOM   5657 N  NH2 . ARG B 1 219 ? 8.759   24.638  22.901  1.00 25.82  ? 220 ARG B NH2 1 
ATOM   5658 N  N   . THR B 1 220 ? 13.087  23.602  30.371  1.00 21.52  ? 221 THR B N   1 
ATOM   5659 C  CA  . THR B 1 220 ? 13.710  23.272  31.647  1.00 22.33  ? 221 THR B CA  1 
ATOM   5660 C  C   . THR B 1 220 ? 12.921  22.231  32.422  1.00 22.09  ? 221 THR B C   1 
ATOM   5661 O  O   . THR B 1 220 ? 13.484  21.214  32.825  1.00 22.13  ? 221 THR B O   1 
ATOM   5662 C  CB  . THR B 1 220 ? 13.931  24.552  32.512  1.00 22.71  ? 221 THR B CB  1 
ATOM   5663 O  OG1 . THR B 1 220 ? 15.083  25.252  32.021  1.00 24.34  ? 221 THR B OG1 1 
ATOM   5664 C  CG2 . THR B 1 220 ? 14.139  24.207  33.986  1.00 23.18  ? 221 THR B CG2 1 
ATOM   5665 N  N   . LYS B 1 221 ? 11.627  22.482  32.616  1.00 21.78  ? 222 LYS B N   1 
ATOM   5666 C  CA  . LYS B 1 221 ? 10.767  21.561  33.349  1.00 22.07  ? 222 LYS B CA  1 
ATOM   5667 C  C   . LYS B 1 221 ? 10.644  20.191  32.664  1.00 21.45  ? 222 LYS B C   1 
ATOM   5668 O  O   . LYS B 1 221 ? 10.726  19.148  33.325  1.00 21.55  ? 222 LYS B O   1 
ATOM   5669 C  CB  . LYS B 1 221 ? 9.377   22.171  33.568  1.00 22.55  ? 222 LYS B CB  1 
ATOM   5670 C  CG  . LYS B 1 221 ? 8.453   21.256  34.380  1.00 25.94  ? 222 LYS B CG  1 
ATOM   5671 C  CD  . LYS B 1 221 ? 7.050   21.835  34.547  1.00 30.12  ? 222 LYS B CD  1 
ATOM   5672 C  CE  . LYS B 1 221 ? 6.154   20.891  35.357  1.00 32.87  ? 222 LYS B CE  1 
ATOM   5673 N  NZ  . LYS B 1 221 ? 5.806   19.649  34.603  1.00 33.93  ? 222 LYS B NZ  1 
ATOM   5674 N  N   . THR B 1 222 ? 10.444  20.194  31.345  1.00 20.28  ? 223 THR B N   1 
ATOM   5675 C  CA  . THR B 1 222 ? 10.340  18.941  30.596  1.00 19.15  ? 223 THR B CA  1 
ATOM   5676 C  C   . THR B 1 222 ? 11.631  18.121  30.714  1.00 18.45  ? 223 THR B C   1 
ATOM   5677 O  O   . THR B 1 222 ? 11.589  16.920  30.963  1.00 17.84  ? 223 THR B O   1 
ATOM   5678 C  CB  . THR B 1 222 ? 9.990   19.189  29.108  1.00 18.84  ? 223 THR B CB  1 
ATOM   5679 O  OG1 . THR B 1 222 ? 8.679   19.765  29.020  1.00 19.22  ? 223 THR B OG1 1 
ATOM   5680 C  CG2 . THR B 1 222 ? 9.992   17.889  28.355  1.00 17.62  ? 223 THR B CG2 1 
ATOM   5681 N  N   . TRP B 1 223 ? 12.768  18.791  30.549  1.00 18.25  ? 224 TRP B N   1 
ATOM   5682 C  CA  . TRP B 1 223 ? 14.067  18.159  30.634  1.00 18.55  ? 224 TRP B CA  1 
ATOM   5683 C  C   . TRP B 1 223 ? 14.274  17.510  32.002  1.00 19.04  ? 224 TRP B C   1 
ATOM   5684 O  O   . TRP B 1 223 ? 14.736  16.370  32.078  1.00 18.97  ? 224 TRP B O   1 
ATOM   5685 C  CB  . TRP B 1 223 ? 15.184  19.159  30.303  1.00 18.52  ? 224 TRP B CB  1 
ATOM   5686 C  CG  . TRP B 1 223 ? 16.562  18.650  30.611  1.00 19.01  ? 224 TRP B CG  1 
ATOM   5687 C  CD1 . TRP B 1 223 ? 17.383  19.084  31.608  1.00 19.15  ? 224 TRP B CD1 1 
ATOM   5688 C  CD2 . TRP B 1 223 ? 17.270  17.595  29.941  1.00 18.79  ? 224 TRP B CD2 1 
ATOM   5689 N  NE1 . TRP B 1 223 ? 18.557  18.378  31.597  1.00 20.40  ? 224 TRP B NE1 1 
ATOM   5690 C  CE2 . TRP B 1 223 ? 18.518  17.457  30.585  1.00 19.97  ? 224 TRP B CE2 1 
ATOM   5691 C  CE3 . TRP B 1 223 ? 16.972  16.757  28.860  1.00 19.08  ? 224 TRP B CE3 1 
ATOM   5692 C  CZ2 . TRP B 1 223 ? 19.476  16.515  30.183  1.00 19.95  ? 224 TRP B CZ2 1 
ATOM   5693 C  CZ3 . TRP B 1 223 ? 17.929  15.817  28.457  1.00 19.11  ? 224 TRP B CZ3 1 
ATOM   5694 C  CH2 . TRP B 1 223 ? 19.163  15.706  29.119  1.00 19.04  ? 224 TRP B CH2 1 
ATOM   5695 N  N   . LYS B 1 224 ? 13.899  18.215  33.071  1.00 19.38  ? 225 LYS B N   1 
ATOM   5696 C  CA  . LYS B 1 224 ? 13.996  17.655  34.413  1.00 20.00  ? 225 LYS B CA  1 
ATOM   5697 C  C   . LYS B 1 224 ? 13.114  16.415  34.597  1.00 19.07  ? 225 LYS B C   1 
ATOM   5698 O  O   . LYS B 1 224 ? 13.550  15.441  35.208  1.00 18.48  ? 225 LYS B O   1 
ATOM   5699 C  CB  . LYS B 1 224 ? 13.682  18.706  35.486  1.00 20.59  ? 225 LYS B CB  1 
ATOM   5700 C  CG  . LYS B 1 224 ? 14.915  19.457  35.978  1.00 24.02  ? 225 LYS B CG  1 
ATOM   5701 C  CD  . LYS B 1 224 ? 14.546  20.610  36.923  1.00 28.97  ? 225 LYS B CD  1 
ATOM   5702 C  CE  . LYS B 1 224 ? 15.739  21.567  37.146  1.00 31.16  ? 225 LYS B CE  1 
ATOM   5703 N  NZ  . LYS B 1 224 ? 15.269  22.938  37.530  1.00 32.68  ? 225 LYS B NZ  1 
ATOM   5704 N  N   . ASP B 1 225 ? 11.884  16.458  34.082  1.00 18.25  ? 226 ASP B N   1 
ATOM   5705 C  CA  . ASP B 1 225 ? 10.987  15.292  34.142  1.00 17.56  ? 226 ASP B CA  1 
ATOM   5706 C  C   . ASP B 1 225 ? 11.541  14.113  33.333  1.00 17.10  ? 226 ASP B C   1 
ATOM   5707 O  O   . ASP B 1 225 ? 11.421  12.951  33.735  1.00 17.51  ? 226 ASP B O   1 
ATOM   5708 C  CB  . ASP B 1 225 ? 9.587   15.652  33.631  1.00 17.78  ? 226 ASP B CB  1 
ATOM   5709 C  CG  . ASP B 1 225 ? 8.842   16.601  34.559  1.00 17.56  ? 226 ASP B CG  1 
ATOM   5710 O  OD1 . ASP B 1 225 ? 9.265   16.782  35.717  1.00 18.36  ? 226 ASP B OD1 1 
ATOM   5711 O  OD2 . ASP B 1 225 ? 7.813   17.155  34.131  1.00 17.68  ? 226 ASP B OD2 1 
ATOM   5712 N  N   . HIS B 1 226 ? 12.162  14.434  32.207  1.00 16.09  ? 227 HIS B N   1 
ATOM   5713 C  CA  . HIS B 1 226 ? 12.739  13.450  31.311  1.00 15.71  ? 227 HIS B CA  1 
ATOM   5714 C  C   . HIS B 1 226 ? 13.907  12.716  31.982  1.00 15.83  ? 227 HIS B C   1 
ATOM   5715 O  O   . HIS B 1 226 ? 13.960  11.485  31.967  1.00 15.46  ? 227 HIS B O   1 
ATOM   5716 C  CB  . HIS B 1 226 ? 13.210  14.153  30.038  1.00 14.74  ? 227 HIS B CB  1 
ATOM   5717 C  CG  . HIS B 1 226 ? 13.682  13.222  28.967  1.00 14.04  ? 227 HIS B CG  1 
ATOM   5718 N  ND1 . HIS B 1 226 ? 12.824  12.417  28.249  1.00 12.59  ? 227 HIS B ND1 1 
ATOM   5719 C  CD2 . HIS B 1 226 ? 14.919  12.988  28.473  1.00 12.66  ? 227 HIS B CD2 1 
ATOM   5720 C  CE1 . HIS B 1 226 ? 13.516  11.717  27.371  1.00 11.88  ? 227 HIS B CE1 1 
ATOM   5721 N  NE2 . HIS B 1 226 ? 14.789  12.046  27.486  1.00 13.71  ? 227 HIS B NE2 1 
ATOM   5722 N  N   . VAL B 1 227 ? 14.829  13.487  32.564  1.00 15.83  ? 228 VAL B N   1 
ATOM   5723 C  CA  . VAL B 1 227 ? 15.944  12.949  33.349  1.00 15.99  ? 228 VAL B CA  1 
ATOM   5724 C  C   . VAL B 1 227 ? 15.447  12.011  34.443  1.00 15.99  ? 228 VAL B C   1 
ATOM   5725 O  O   . VAL B 1 227 ? 15.992  10.925  34.616  1.00 16.43  ? 228 VAL B O   1 
ATOM   5726 C  CB  . VAL B 1 227 ? 16.825  14.080  33.973  1.00 16.44  ? 228 VAL B CB  1 
ATOM   5727 C  CG1 . VAL B 1 227 ? 17.858  13.503  34.971  1.00 15.11  ? 228 VAL B CG1 1 
ATOM   5728 C  CG2 . VAL B 1 227 ? 17.527  14.868  32.883  1.00 16.64  ? 228 VAL B CG2 1 
ATOM   5729 N  N   . ALA B 1 228 ? 14.410  12.423  35.168  1.00 15.70  ? 229 ALA B N   1 
ATOM   5730 C  CA  . ALA B 1 228 ? 13.869  11.609  36.258  1.00 15.69  ? 229 ALA B CA  1 
ATOM   5731 C  C   . ALA B 1 228 ? 13.296  10.291  35.752  1.00 15.76  ? 229 ALA B C   1 
ATOM   5732 O  O   . ALA B 1 228 ? 13.403  9.269   36.431  1.00 15.97  ? 229 ALA B O   1 
ATOM   5733 C  CB  . ALA B 1 228 ? 12.794  12.383  37.054  1.00 15.71  ? 229 ALA B CB  1 
ATOM   5734 N  N   . ALA B 1 229 ? 12.685  10.314  34.566  1.00 15.65  ? 230 ALA B N   1 
ATOM   5735 C  CA  . ALA B 1 229 ? 12.095  9.103   33.995  1.00 15.52  ? 230 ALA B CA  1 
ATOM   5736 C  C   . ALA B 1 229 ? 13.178  8.094   33.608  1.00 15.38  ? 230 ALA B C   1 
ATOM   5737 O  O   . ALA B 1 229 ? 13.069  6.905   33.930  1.00 15.25  ? 230 ALA B O   1 
ATOM   5738 C  CB  . ALA B 1 229 ? 11.194  9.439   32.804  1.00 15.20  ? 230 ALA B CB  1 
ATOM   5739 N  N   . TRP B 1 230 ? 14.216  8.569   32.925  1.00 15.55  ? 231 TRP B N   1 
ATOM   5740 C  CA  . TRP B 1 230 ? 15.366  7.724   32.603  1.00 16.39  ? 231 TRP B CA  1 
ATOM   5741 C  C   . TRP B 1 230 ? 16.021  7.159   33.873  1.00 16.93  ? 231 TRP B C   1 
ATOM   5742 O  O   . TRP B 1 230 ? 16.376  5.989   33.891  1.00 16.90  ? 231 TRP B O   1 
ATOM   5743 C  CB  . TRP B 1 230 ? 16.419  8.475   31.785  1.00 16.18  ? 231 TRP B CB  1 
ATOM   5744 C  CG  . TRP B 1 230 ? 16.216  8.507   30.289  1.00 15.71  ? 231 TRP B CG  1 
ATOM   5745 C  CD1 . TRP B 1 230 ? 15.896  9.602   29.528  1.00 14.77  ? 231 TRP B CD1 1 
ATOM   5746 C  CD2 . TRP B 1 230 ? 16.356  7.413   29.375  1.00 15.08  ? 231 TRP B CD2 1 
ATOM   5747 N  NE1 . TRP B 1 230 ? 15.811  9.250   28.205  1.00 14.74  ? 231 TRP B NE1 1 
ATOM   5748 C  CE2 . TRP B 1 230 ? 16.085  7.914   28.080  1.00 14.90  ? 231 TRP B CE2 1 
ATOM   5749 C  CE3 . TRP B 1 230 ? 16.657  6.049   29.527  1.00 15.09  ? 231 TRP B CE3 1 
ATOM   5750 C  CZ2 . TRP B 1 230 ? 16.116  7.103   26.941  1.00 14.61  ? 231 TRP B CZ2 1 
ATOM   5751 C  CZ3 . TRP B 1 230 ? 16.693  5.246   28.404  1.00 13.94  ? 231 TRP B CZ3 1 
ATOM   5752 C  CH2 . TRP B 1 230 ? 16.427  5.775   27.120  1.00 15.11  ? 231 TRP B CH2 1 
ATOM   5753 N  N   . ASP B 1 231 ? 16.172  7.986   34.917  1.00 17.67  ? 232 ASP B N   1 
ATOM   5754 C  CA  . ASP B 1 231 ? 16.735  7.528   36.207  1.00 19.00  ? 232 ASP B CA  1 
ATOM   5755 C  C   . ASP B 1 231 ? 15.963  6.347   36.806  1.00 19.13  ? 232 ASP B C   1 
ATOM   5756 O  O   . ASP B 1 231 ? 16.562  5.463   37.400  1.00 20.08  ? 232 ASP B O   1 
ATOM   5757 C  CB  . ASP B 1 231 ? 16.819  8.662   37.250  1.00 18.88  ? 232 ASP B CB  1 
ATOM   5758 C  CG  . ASP B 1 231 ? 17.942  9.658   36.974  1.00 20.74  ? 232 ASP B CG  1 
ATOM   5759 O  OD1 . ASP B 1 231 ? 18.960  9.323   36.331  1.00 23.15  ? 232 ASP B OD1 1 
ATOM   5760 O  OD2 . ASP B 1 231 ? 17.805  10.808  37.426  1.00 24.50  ? 232 ASP B OD2 1 
ATOM   5761 N  N   . VAL B 1 232 ? 14.641  6.330   36.666  1.00 19.49  ? 233 VAL B N   1 
ATOM   5762 C  CA  . VAL B 1 232 ? 13.870  5.177   37.132  1.00 19.56  ? 233 VAL B CA  1 
ATOM   5763 C  C   . VAL B 1 232 ? 14.210  3.966   36.276  1.00 20.05  ? 233 VAL B C   1 
ATOM   5764 O  O   . VAL B 1 232 ? 14.503  2.894   36.812  1.00 20.13  ? 233 VAL B O   1 
ATOM   5765 C  CB  . VAL B 1 232 ? 12.351  5.426   37.110  1.00 19.82  ? 233 VAL B CB  1 
ATOM   5766 C  CG1 . VAL B 1 232 ? 11.594  4.149   37.486  1.00 19.28  ? 233 VAL B CG1 1 
ATOM   5767 C  CG2 . VAL B 1 232 ? 11.980  6.575   38.044  1.00 18.51  ? 233 VAL B CG2 1 
ATOM   5768 N  N   . ILE B 1 233 ? 14.199  4.150   34.953  1.00 20.23  ? 234 ILE B N   1 
ATOM   5769 C  CA  . ILE B 1 233 ? 14.522  3.083   34.013  1.00 20.34  ? 234 ILE B CA  1 
ATOM   5770 C  C   . ILE B 1 233 ? 15.870  2.449   34.366  1.00 21.12  ? 234 ILE B C   1 
ATOM   5771 O  O   . ILE B 1 233 ? 15.959  1.238   34.546  1.00 20.86  ? 234 ILE B O   1 
ATOM   5772 C  CB  . ILE B 1 233 ? 14.507  3.580   32.516  1.00 20.68  ? 234 ILE B CB  1 
ATOM   5773 C  CG1 . ILE B 1 233 ? 13.079  3.979   32.085  1.00 20.16  ? 234 ILE B CG1 1 
ATOM   5774 C  CG2 . ILE B 1 233 ? 15.119  2.517   31.569  1.00 18.92  ? 234 ILE B CG2 1 
ATOM   5775 C  CD1 . ILE B 1 233 ? 13.016  4.779   30.779  1.00 18.87  ? 234 ILE B CD1 1 
ATOM   5776 N  N   . PHE B 1 234 ? 16.909  3.273   34.481  1.00 21.98  ? 235 PHE B N   1 
ATOM   5777 C  CA  . PHE B 1 234 ? 18.250  2.777   34.768  1.00 22.88  ? 235 PHE B CA  1 
ATOM   5778 C  C   . PHE B 1 234 ? 18.403  2.124   36.132  1.00 23.87  ? 235 PHE B C   1 
ATOM   5779 O  O   . PHE B 1 234 ? 19.003  1.059   36.227  1.00 24.66  ? 235 PHE B O   1 
ATOM   5780 C  CB  . PHE B 1 234 ? 19.307  3.868   34.571  1.00 22.80  ? 235 PHE B CB  1 
ATOM   5781 C  CG  . PHE B 1 234 ? 19.901  3.863   33.203  1.00 21.85  ? 235 PHE B CG  1 
ATOM   5782 C  CD1 . PHE B 1 234 ? 19.374  4.670   32.206  1.00 22.36  ? 235 PHE B CD1 1 
ATOM   5783 C  CD2 . PHE B 1 234 ? 20.957  3.011   32.895  1.00 21.37  ? 235 PHE B CD2 1 
ATOM   5784 C  CE1 . PHE B 1 234 ? 19.902  4.649   30.919  1.00 21.95  ? 235 PHE B CE1 1 
ATOM   5785 C  CE2 . PHE B 1 234 ? 21.491  2.977   31.613  1.00 21.20  ? 235 PHE B CE2 1 
ATOM   5786 C  CZ  . PHE B 1 234 ? 20.962  3.805   30.624  1.00 22.71  ? 235 PHE B CZ  1 
ATOM   5787 N  N   . SER B 1 235 ? 17.854  2.732   37.176  1.00 24.77  ? 236 SER B N   1 
ATOM   5788 C  CA  . SER B 1 235 ? 18.044  2.176   38.511  1.00 26.17  ? 236 SER B CA  1 
ATOM   5789 C  C   . SER B 1 235 ? 17.320  0.842   38.686  1.00 26.11  ? 236 SER B C   1 
ATOM   5790 O  O   . SER B 1 235 ? 17.861  -0.069  39.300  1.00 26.09  ? 236 SER B O   1 
ATOM   5791 C  CB  . SER B 1 235 ? 17.670  3.175   39.609  1.00 26.03  ? 236 SER B CB  1 
ATOM   5792 O  OG  . SER B 1 235 ? 16.278  3.384   39.636  1.00 29.32  ? 236 SER B OG  1 
ATOM   5793 N  N   . LYS B 1 236 ? 16.122  0.722   38.112  1.00 26.18  ? 237 LYS B N   1 
ATOM   5794 C  CA  . LYS B 1 236 ? 15.365  -0.532  38.144  1.00 26.22  ? 237 LYS B CA  1 
ATOM   5795 C  C   . LYS B 1 236 ? 16.014  -1.625  37.306  1.00 25.96  ? 237 LYS B C   1 
ATOM   5796 O  O   . LYS B 1 236 ? 16.144  -2.760  37.764  1.00 25.47  ? 237 LYS B O   1 
ATOM   5797 C  CB  . LYS B 1 236 ? 13.931  -0.314  37.676  1.00 26.53  ? 237 LYS B CB  1 
ATOM   5798 C  CG  . LYS B 1 236 ? 12.920  -0.105  38.786  1.00 28.51  ? 237 LYS B CG  1 
ATOM   5799 C  CD  . LYS B 1 236 ? 13.316  0.979   39.755  1.00 31.29  ? 237 LYS B CD  1 
ATOM   5800 C  CE  . LYS B 1 236 ? 12.249  1.134   40.815  1.00 33.13  ? 237 LYS B CE  1 
ATOM   5801 N  NZ  . LYS B 1 236 ? 11.018  1.686   40.198  1.00 34.55  ? 237 LYS B NZ  1 
ATOM   5802 N  N   . ALA B 1 237 ? 16.421  -1.281  36.085  1.00 25.79  ? 238 ALA B N   1 
ATOM   5803 C  CA  . ALA B 1 237 ? 17.073  -2.249  35.203  1.00 26.02  ? 238 ALA B CA  1 
ATOM   5804 C  C   . ALA B 1 237 ? 18.396  -2.732  35.797  1.00 25.94  ? 238 ALA B C   1 
ATOM   5805 O  O   . ALA B 1 237 ? 18.708  -3.907  35.720  1.00 25.90  ? 238 ALA B O   1 
ATOM   5806 C  CB  . ALA B 1 237 ? 17.288  -1.669  33.815  1.00 25.56  ? 238 ALA B CB  1 
ATOM   5807 N  N   . ASP B 1 238 ? 19.166  -1.811  36.369  1.00 26.44  ? 239 ASP B N   1 
ATOM   5808 C  CA  . ASP B 1 238 ? 20.403  -2.142  37.084  1.00 27.10  ? 239 ASP B CA  1 
ATOM   5809 C  C   . ASP B 1 238 ? 20.157  -3.203  38.154  1.00 26.50  ? 239 ASP B C   1 
ATOM   5810 O  O   . ASP B 1 238 ? 20.824  -4.224  38.186  1.00 26.17  ? 239 ASP B O   1 
ATOM   5811 C  CB  . ASP B 1 238 ? 20.975  -0.893  37.764  1.00 27.58  ? 239 ASP B CB  1 
ATOM   5812 C  CG  . ASP B 1 238 ? 22.040  -0.208  36.945  1.00 31.07  ? 239 ASP B CG  1 
ATOM   5813 O  OD1 . ASP B 1 238 ? 21.778  0.152   35.773  1.00 32.80  ? 239 ASP B OD1 1 
ATOM   5814 O  OD2 . ASP B 1 238 ? 23.155  -0.011  37.498  1.00 36.47  ? 239 ASP B OD2 1 
ATOM   5815 N  N   . ILE B 1 239 ? 19.197  -2.935  39.030  1.00 26.48  ? 240 ILE B N   1 
ATOM   5816 C  CA  . ILE B 1 239 ? 18.862  -3.826  40.141  1.00 26.79  ? 240 ILE B CA  1 
ATOM   5817 C  C   . ILE B 1 239 ? 18.463  -5.229  39.661  1.00 26.63  ? 240 ILE B C   1 
ATOM   5818 O  O   . ILE B 1 239 ? 18.964  -6.224  40.194  1.00 26.61  ? 240 ILE B O   1 
ATOM   5819 C  CB  . ILE B 1 239 ? 17.786  -3.184  41.061  1.00 26.99  ? 240 ILE B CB  1 
ATOM   5820 C  CG1 . ILE B 1 239 ? 18.379  -1.957  41.771  1.00 27.65  ? 240 ILE B CG1 1 
ATOM   5821 C  CG2 . ILE B 1 239 ? 17.242  -4.192  42.090  1.00 27.89  ? 240 ILE B CG2 1 
ATOM   5822 C  CD1 . ILE B 1 239 ? 17.342  -1.035  42.437  1.00 29.53  ? 240 ILE B CD1 1 
ATOM   5823 N  N   . TYR B 1 240 ? 17.598  -5.310  38.646  1.00 25.98  ? 241 TYR B N   1 
ATOM   5824 C  CA  . TYR B 1 240 ? 17.218  -6.604  38.062  1.00 25.48  ? 241 TYR B CA  1 
ATOM   5825 C  C   . TYR B 1 240 ? 18.442  -7.379  37.583  1.00 24.45  ? 241 TYR B C   1 
ATOM   5826 O  O   . TYR B 1 240 ? 18.620  -8.545  37.922  1.00 23.64  ? 241 TYR B O   1 
ATOM   5827 C  CB  . TYR B 1 240 ? 16.269  -6.438  36.870  1.00 25.96  ? 241 TYR B CB  1 
ATOM   5828 C  CG  . TYR B 1 240 ? 14.862  -5.965  37.176  1.00 28.06  ? 241 TYR B CG  1 
ATOM   5829 C  CD1 . TYR B 1 240 ? 14.153  -5.214  36.238  1.00 29.63  ? 241 TYR B CD1 1 
ATOM   5830 C  CD2 . TYR B 1 240 ? 14.234  -6.272  38.381  1.00 30.75  ? 241 TYR B CD2 1 
ATOM   5831 C  CE1 . TYR B 1 240 ? 12.859  -4.773  36.490  1.00 30.74  ? 241 TYR B CE1 1 
ATOM   5832 C  CE2 . TYR B 1 240 ? 12.931  -5.825  38.648  1.00 32.22  ? 241 TYR B CE2 1 
ATOM   5833 C  CZ  . TYR B 1 240 ? 12.257  -5.078  37.693  1.00 31.49  ? 241 TYR B CZ  1 
ATOM   5834 O  OH  . TYR B 1 240 ? 10.984  -4.641  37.936  1.00 32.04  ? 241 TYR B OH  1 
ATOM   5835 N  N   . THR B 1 241 ? 19.273  -6.720  36.783  1.00 23.81  ? 242 THR B N   1 
ATOM   5836 C  CA  . THR B 1 241 ? 20.447  -7.361  36.204  1.00 23.41  ? 242 THR B CA  1 
ATOM   5837 C  C   . THR B 1 241 ? 21.436  -7.814  37.285  1.00 23.14  ? 242 THR B C   1 
ATOM   5838 O  O   . THR B 1 241 ? 21.938  -8.927  37.225  1.00 22.95  ? 242 THR B O   1 
ATOM   5839 C  CB  . THR B 1 241 ? 21.130  -6.449  35.164  1.00 23.20  ? 242 THR B CB  1 
ATOM   5840 O  OG1 . THR B 1 241 ? 20.234  -6.261  34.063  1.00 23.84  ? 242 THR B OG1 1 
ATOM   5841 C  CG2 . THR B 1 241 ? 22.430  -7.067  34.637  1.00 21.95  ? 242 THR B CG2 1 
ATOM   5842 N  N   . GLN B 1 242 ? 21.687  -6.956  38.267  1.00 22.96  ? 243 GLN B N   1 
ATOM   5843 C  CA  . GLN B 1 242 ? 22.651  -7.253  39.322  1.00 23.60  ? 243 GLN B CA  1 
ATOM   5844 C  C   . GLN B 1 242 ? 22.177  -8.364  40.259  1.00 22.91  ? 243 GLN B C   1 
ATOM   5845 O  O   . GLN B 1 242 ? 22.965  -9.258  40.594  1.00 22.26  ? 243 GLN B O   1 
ATOM   5846 C  CB  . GLN B 1 242 ? 23.041  -5.981  40.095  1.00 23.97  ? 243 GLN B CB  1 
ATOM   5847 C  CG  . GLN B 1 242 ? 24.158  -5.220  39.381  1.00 27.54  ? 243 GLN B CG  1 
ATOM   5848 C  CD  . GLN B 1 242 ? 24.384  -3.795  39.866  1.00 31.48  ? 243 GLN B CD  1 
ATOM   5849 O  OE1 . GLN B 1 242 ? 23.922  -3.397  40.945  1.00 34.09  ? 243 GLN B OE1 1 
ATOM   5850 N  NE2 . GLN B 1 242 ? 25.124  -3.017  39.064  1.00 31.36  ? 243 GLN B NE2 1 
ATOM   5851 N  N   . ASN B 1 243 ? 20.903  -8.307  40.665  1.00 22.11  ? 244 ASN B N   1 
ATOM   5852 C  CA  . ASN B 1 243 ? 20.288  -9.390  41.439  1.00 21.98  ? 244 ASN B CA  1 
ATOM   5853 C  C   . ASN B 1 243 ? 20.387  -10.739 40.730  1.00 21.76  ? 244 ASN B C   1 
ATOM   5854 O  O   . ASN B 1 243 ? 20.695  -11.748 41.355  1.00 21.71  ? 244 ASN B O   1 
ATOM   5855 C  CB  . ASN B 1 243 ? 18.821  -9.089  41.772  1.00 21.85  ? 244 ASN B CB  1 
ATOM   5856 C  CG  . ASN B 1 243 ? 18.666  -8.004  42.824  1.00 23.16  ? 244 ASN B CG  1 
ATOM   5857 O  OD1 . ASN B 1 243 ? 19.639  -7.577  43.447  1.00 24.21  ? 244 ASN B OD1 1 
ATOM   5858 N  ND2 . ASN B 1 243 ? 17.436  -7.540  43.017  1.00 24.57  ? 244 ASN B ND2 1 
ATOM   5859 N  N   . PHE B 1 244 ? 20.134  -10.747 39.423  1.00 21.26  ? 245 PHE B N   1 
ATOM   5860 C  CA  . PHE B 1 244 ? 20.173  -11.977 38.643  1.00 21.01  ? 245 PHE B CA  1 
ATOM   5861 C  C   . PHE B 1 244 ? 21.600  -12.518 38.630  1.00 21.20  ? 245 PHE B C   1 
ATOM   5862 O  O   . PHE B 1 244 ? 21.823  -13.716 38.819  1.00 20.60  ? 245 PHE B O   1 
ATOM   5863 C  CB  . PHE B 1 244 ? 19.675  -11.717 37.216  1.00 20.69  ? 245 PHE B CB  1 
ATOM   5864 C  CG  . PHE B 1 244 ? 19.579  -12.950 36.372  1.00 20.99  ? 245 PHE B CG  1 
ATOM   5865 C  CD1 . PHE B 1 244 ? 18.386  -13.656 36.287  1.00 22.01  ? 245 PHE B CD1 1 
ATOM   5866 C  CD2 . PHE B 1 244 ? 20.681  -13.411 35.661  1.00 20.99  ? 245 PHE B CD2 1 
ATOM   5867 C  CE1 . PHE B 1 244 ? 18.299  -14.808 35.512  1.00 21.10  ? 245 PHE B CE1 1 
ATOM   5868 C  CE2 . PHE B 1 244 ? 20.599  -14.554 34.883  1.00 20.84  ? 245 PHE B CE2 1 
ATOM   5869 C  CZ  . PHE B 1 244 ? 19.407  -15.252 34.808  1.00 20.63  ? 245 PHE B CZ  1 
ATOM   5870 N  N   . TYR B 1 245 ? 22.553  -11.614 38.398  1.00 21.21  ? 246 TYR B N   1 
ATOM   5871 C  CA  . TYR B 1 245 ? 23.976  -11.935 38.380  1.00 21.75  ? 246 TYR B CA  1 
ATOM   5872 C  C   . TYR B 1 245 ? 24.395  -12.663 39.655  1.00 21.94  ? 246 TYR B C   1 
ATOM   5873 O  O   . TYR B 1 245 ? 25.023  -13.713 39.590  1.00 21.83  ? 246 TYR B O   1 
ATOM   5874 C  CB  . TYR B 1 245 ? 24.776  -10.647 38.189  1.00 21.47  ? 246 TYR B CB  1 
ATOM   5875 C  CG  . TYR B 1 245 ? 26.291  -10.758 38.235  1.00 21.92  ? 246 TYR B CG  1 
ATOM   5876 C  CD1 . TYR B 1 245 ? 27.043  -10.777 37.061  1.00 21.65  ? 246 TYR B CD1 1 
ATOM   5877 C  CD2 . TYR B 1 245 ? 26.971  -10.792 39.450  1.00 21.66  ? 246 TYR B CD2 1 
ATOM   5878 C  CE1 . TYR B 1 245 ? 28.426  -10.847 37.088  1.00 21.73  ? 246 TYR B CE1 1 
ATOM   5879 C  CE2 . TYR B 1 245 ? 28.363  -10.857 39.490  1.00 22.48  ? 246 TYR B CE2 1 
ATOM   5880 C  CZ  . TYR B 1 245 ? 29.080  -10.877 38.307  1.00 22.84  ? 246 TYR B CZ  1 
ATOM   5881 O  OH  . TYR B 1 245 ? 30.450  -10.945 38.350  1.00 24.39  ? 246 TYR B OH  1 
ATOM   5882 N  N   . TRP B 1 246 ? 24.016  -12.116 40.806  1.00 22.93  ? 247 TRP B N   1 
ATOM   5883 C  CA  . TRP B 1 246 ? 24.424  -12.692 42.081  1.00 24.15  ? 247 TRP B CA  1 
ATOM   5884 C  C   . TRP B 1 246 ? 23.670  -13.971 42.441  1.00 25.29  ? 247 TRP B C   1 
ATOM   5885 O  O   . TRP B 1 246 ? 24.291  -14.933 42.905  1.00 25.18  ? 247 TRP B O   1 
ATOM   5886 C  CB  . TRP B 1 246 ? 24.390  -11.653 43.199  1.00 23.52  ? 247 TRP B CB  1 
ATOM   5887 C  CG  . TRP B 1 246 ? 25.581  -10.761 43.142  1.00 24.15  ? 247 TRP B CG  1 
ATOM   5888 C  CD1 . TRP B 1 246 ? 25.602  -9.427  42.836  1.00 23.95  ? 247 TRP B CD1 1 
ATOM   5889 C  CD2 . TRP B 1 246 ? 26.951  -11.145 43.356  1.00 24.66  ? 247 TRP B CD2 1 
ATOM   5890 N  NE1 . TRP B 1 246 ? 26.894  -8.957  42.864  1.00 24.16  ? 247 TRP B NE1 1 
ATOM   5891 C  CE2 . TRP B 1 246 ? 27.740  -9.990  43.179  1.00 23.94  ? 247 TRP B CE2 1 
ATOM   5892 C  CE3 . TRP B 1 246 ? 27.586  -12.356 43.680  1.00 23.43  ? 247 TRP B CE3 1 
ATOM   5893 C  CZ2 . TRP B 1 246 ? 29.136  -10.006 43.321  1.00 24.22  ? 247 TRP B CZ2 1 
ATOM   5894 C  CZ3 . TRP B 1 246 ? 28.968  -12.369 43.822  1.00 24.21  ? 247 TRP B CZ3 1 
ATOM   5895 C  CH2 . TRP B 1 246 ? 29.727  -11.199 43.642  1.00 23.45  ? 247 TRP B CH2 1 
ATOM   5896 N  N   . GLU B 1 247 ? 22.356  -13.990 42.204  1.00 26.29  ? 248 GLU B N   1 
ATOM   5897 C  CA  . GLU B 1 247 ? 21.547  -15.207 42.384  1.00 27.97  ? 248 GLU B CA  1 
ATOM   5898 C  C   . GLU B 1 247 ? 22.062  -16.360 41.532  1.00 28.51  ? 248 GLU B C   1 
ATOM   5899 O  O   . GLU B 1 247 ? 22.022  -17.513 41.951  1.00 28.48  ? 248 GLU B O   1 
ATOM   5900 C  CB  . GLU B 1 247 ? 20.077  -14.954 42.053  1.00 27.98  ? 248 GLU B CB  1 
ATOM   5901 C  CG  . GLU B 1 247 ? 19.322  -14.154 43.098  1.00 30.61  ? 248 GLU B CG  1 
ATOM   5902 C  CD  . GLU B 1 247 ? 17.932  -13.753 42.629  1.00 34.24  ? 248 GLU B CD  1 
ATOM   5903 O  OE1 . GLU B 1 247 ? 17.325  -14.507 41.830  1.00 36.59  ? 248 GLU B OE1 1 
ATOM   5904 O  OE2 . GLU B 1 247 ? 17.443  -12.681 43.056  1.00 35.41  ? 248 GLU B OE2 1 
ATOM   5905 N  N   . LEU B 1 248 ? 22.563  -16.040 40.344  1.00 29.57  ? 249 LEU B N   1 
ATOM   5906 C  CA  . LEU B 1 248 ? 23.145  -17.043 39.461  1.00 31.19  ? 249 LEU B CA  1 
ATOM   5907 C  C   . LEU B 1 248 ? 24.289  -17.789 40.164  1.00 32.17  ? 249 LEU B C   1 
ATOM   5908 O  O   . LEU B 1 248 ? 24.422  -19.013 40.041  1.00 32.28  ? 249 LEU B O   1 
ATOM   5909 C  CB  . LEU B 1 248 ? 23.647  -16.381 38.176  1.00 31.06  ? 249 LEU B CB  1 
ATOM   5910 C  CG  . LEU B 1 248 ? 23.813  -17.258 36.939  1.00 32.45  ? 249 LEU B CG  1 
ATOM   5911 C  CD1 . LEU B 1 248 ? 22.436  -17.794 36.504  1.00 33.37  ? 249 LEU B CD1 1 
ATOM   5912 C  CD2 . LEU B 1 248 ? 24.492  -16.486 35.807  1.00 31.04  ? 249 LEU B CD2 1 
ATOM   5913 N  N   . ARG B 1 249 ? 25.096  -17.039 40.912  1.00 33.04  ? 250 ARG B N   1 
ATOM   5914 C  CA  . ARG B 1 249 ? 26.236  -17.593 41.625  1.00 34.22  ? 250 ARG B CA  1 
ATOM   5915 C  C   . ARG B 1 249 ? 25.817  -18.301 42.915  1.00 35.18  ? 250 ARG B C   1 
ATOM   5916 O  O   . ARG B 1 249 ? 26.495  -19.231 43.356  1.00 34.88  ? 250 ARG B O   1 
ATOM   5917 C  CB  . ARG B 1 249 ? 27.269  -16.501 41.904  1.00 34.16  ? 250 ARG B CB  1 
ATOM   5918 C  CG  . ARG B 1 249 ? 27.912  -15.962 40.647  1.00 34.51  ? 250 ARG B CG  1 
ATOM   5919 C  CD  . ARG B 1 249 ? 28.572  -14.634 40.880  1.00 36.10  ? 250 ARG B CD  1 
ATOM   5920 N  NE  . ARG B 1 249 ? 29.509  -14.336 39.802  1.00 38.92  ? 250 ARG B NE  1 
ATOM   5921 C  CZ  . ARG B 1 249 ? 30.677  -13.716 39.969  1.00 42.01  ? 250 ARG B CZ  1 
ATOM   5922 N  NH1 . ARG B 1 249 ? 31.063  -13.310 41.176  1.00 43.32  ? 250 ARG B NH1 1 
ATOM   5923 N  NH2 . ARG B 1 249 ? 31.471  -13.501 38.926  1.00 43.33  ? 250 ARG B NH2 1 
ATOM   5924 N  N   . GLN B 1 250 ? 24.701  -17.866 43.502  1.00 36.50  ? 251 GLN B N   1 
ATOM   5925 C  CA  . GLN B 1 250 ? 24.142  -18.510 44.693  1.00 38.23  ? 251 GLN B CA  1 
ATOM   5926 C  C   . GLN B 1 250 ? 23.568  -19.889 44.368  1.00 39.36  ? 251 GLN B C   1 
ATOM   5927 O  O   . GLN B 1 250 ? 23.859  -20.864 45.058  1.00 39.67  ? 251 GLN B O   1 
ATOM   5928 C  CB  . GLN B 1 250 ? 23.067  -17.637 45.344  1.00 38.12  ? 251 GLN B CB  1 
ATOM   5929 C  CG  . GLN B 1 250 ? 23.568  -16.312 45.917  1.00 39.27  ? 251 GLN B CG  1 
ATOM   5930 C  CD  . GLN B 1 250 ? 22.436  -15.351 46.279  1.00 40.60  ? 251 GLN B CD  1 
ATOM   5931 O  OE1 . GLN B 1 250 ? 21.404  -15.760 46.823  1.00 41.82  ? 251 GLN B OE1 1 
ATOM   5932 N  NE2 . GLN B 1 250 ? 22.627  -14.067 45.979  1.00 40.22  ? 251 GLN B NE2 1 
ATOM   5933 N  N   . LYS B 1 251 ? 22.764  -19.960 43.311  1.00 40.76  ? 252 LYS B N   1 
ATOM   5934 C  CA  . LYS B 1 251 ? 22.124  -21.202 42.881  1.00 42.31  ? 252 LYS B CA  1 
ATOM   5935 C  C   . LYS B 1 251 ? 23.087  -22.068 42.060  1.00 43.21  ? 252 LYS B C   1 
ATOM   5936 O  O   . LYS B 1 251 ? 24.198  -21.632 41.727  1.00 43.60  ? 252 LYS B O   1 
ATOM   5937 C  CB  . LYS B 1 251 ? 20.852  -20.882 42.088  1.00 42.40  ? 252 LYS B CB  1 
ATOM   5938 C  CG  . LYS B 1 251 ? 19.767  -20.202 42.934  1.00 43.58  ? 252 LYS B CG  1 
ATOM   5939 C  CD  . LYS B 1 251 ? 18.826  -19.339 42.101  1.00 45.61  ? 252 LYS B CD  1 
ATOM   5940 C  CE  . LYS B 1 251 ? 17.919  -18.490 43.003  1.00 46.49  ? 252 LYS B CE  1 
ATOM   5941 N  NZ  . LYS B 1 251 ? 17.088  -17.515 42.231  1.00 47.01  ? 252 LYS B NZ  1 
ATOM   5942 N  N   . GLY B 1 252 ? 22.672  -23.293 41.744  1.00 44.10  ? 253 GLY B N   1 
ATOM   5943 C  CA  . GLY B 1 252 ? 23.505  -24.208 40.957  1.00 45.10  ? 253 GLY B CA  1 
ATOM   5944 C  C   . GLY B 1 252 ? 23.499  -23.873 39.476  1.00 45.83  ? 253 GLY B C   1 
ATOM   5945 O  O   . GLY B 1 252 ? 22.547  -24.222 38.771  1.00 46.08  ? 253 GLY B O   1 
ATOM   5946 N  N   . SER B 1 253 ? 24.564  -23.212 39.004  1.00 46.23  ? 254 SER B N   1 
ATOM   5947 C  CA  . SER B 1 253 ? 24.663  -22.727 37.610  1.00 46.48  ? 254 SER B CA  1 
ATOM   5948 C  C   . SER B 1 253 ? 24.871  -23.831 36.555  1.00 46.63  ? 254 SER B C   1 
ATOM   5949 O  O   . SER B 1 253 ? 25.454  -23.587 35.486  1.00 46.75  ? 254 SER B O   1 
ATOM   5950 C  CB  . SER B 1 253 ? 25.828  -21.748 37.465  1.00 46.62  ? 254 SER B CB  1 
ATOM   5951 O  OG  . SER B 1 253 ? 27.065  -22.383 37.739  1.00 20.00  ? 254 SER B OG  1 
ATOM   5952 N  N   . VAL B 1 254 ? 24.393  -25.035 36.864  1.00 46.37  ? 255 VAL B N   1 
ATOM   5953 C  CA  . VAL B 1 254 ? 24.380  -26.148 35.920  1.00 45.99  ? 255 VAL B CA  1 
ATOM   5954 C  C   . VAL B 1 254 ? 22.916  -26.435 35.570  1.00 45.44  ? 255 VAL B C   1 
ATOM   5955 O  O   . VAL B 1 254 ? 22.164  -26.946 36.398  1.00 45.25  ? 255 VAL B O   1 
ATOM   5956 C  CB  . VAL B 1 254 ? 25.062  -27.412 36.511  1.00 46.13  ? 255 VAL B CB  1 
ATOM   5957 C  CG1 . VAL B 1 254 ? 25.199  -28.502 35.444  1.00 46.69  ? 255 VAL B CG1 1 
ATOM   5958 C  CG2 . VAL B 1 254 ? 26.436  -27.067 37.099  1.00 46.44  ? 255 VAL B CG2 1 
ATOM   5959 N  N   . HIS B 1 255 ? 22.518  -26.072 34.351  1.00 44.98  ? 256 HIS B N   1 
ATOM   5960 C  CA  . HIS B 1 255 ? 21.116  -26.158 33.923  1.00 44.51  ? 256 HIS B CA  1 
ATOM   5961 C  C   . HIS B 1 255 ? 20.967  -26.683 32.503  1.00 43.82  ? 256 HIS B C   1 
ATOM   5962 O  O   . HIS B 1 255 ? 21.582  -26.154 31.570  1.00 43.50  ? 256 HIS B O   1 
ATOM   5963 C  CB  . HIS B 1 255 ? 20.432  -24.790 34.018  1.00 44.71  ? 256 HIS B CB  1 
ATOM   5964 C  CG  . HIS B 1 255 ? 20.138  -24.355 35.419  1.00 46.11  ? 256 HIS B CG  1 
ATOM   5965 N  ND1 . HIS B 1 255 ? 18.970  -24.685 36.071  1.00 47.57  ? 256 HIS B ND1 1 
ATOM   5966 C  CD2 . HIS B 1 255 ? 20.857  -23.609 36.292  1.00 47.34  ? 256 HIS B CD2 1 
ATOM   5967 C  CE1 . HIS B 1 255 ? 18.985  -24.170 37.288  1.00 48.06  ? 256 HIS B CE1 1 
ATOM   5968 N  NE2 . HIS B 1 255 ? 20.119  -23.512 37.447  1.00 48.12  ? 256 HIS B NE2 1 
ATOM   5969 N  N   . HIS B 1 256 ? 20.141  -27.718 32.347  1.00 42.99  ? 257 HIS B N   1 
ATOM   5970 C  CA  . HIS B 1 256 ? 19.793  -28.230 31.025  1.00 42.39  ? 257 HIS B CA  1 
ATOM   5971 C  C   . HIS B 1 256 ? 18.628  -27.454 30.410  1.00 41.38  ? 257 HIS B C   1 
ATOM   5972 O  O   . HIS B 1 256 ? 18.619  -27.198 29.204  1.00 41.38  ? 257 HIS B O   1 
ATOM   5973 C  CB  . HIS B 1 256 ? 19.468  -29.720 31.065  1.00 42.71  ? 257 HIS B CB  1 
ATOM   5974 C  CG  . HIS B 1 256 ? 19.130  -30.295 29.724  1.00 44.44  ? 257 HIS B CG  1 
ATOM   5975 N  ND1 . HIS B 1 256 ? 20.067  -30.907 28.918  1.00 45.92  ? 257 HIS B ND1 1 
ATOM   5976 C  CD2 . HIS B 1 256 ? 17.961  -30.333 29.038  1.00 45.76  ? 257 HIS B CD2 1 
ATOM   5977 C  CE1 . HIS B 1 256 ? 19.489  -31.304 27.797  1.00 46.82  ? 257 HIS B CE1 1 
ATOM   5978 N  NE2 . HIS B 1 256 ? 18.211  -30.971 27.846  1.00 46.62  ? 257 HIS B NE2 1 
ATOM   5979 N  N   . ASP B 1 257 ? 17.648  -27.093 31.235  1.00 40.11  ? 258 ASP B N   1 
ATOM   5980 C  CA  . ASP B 1 257 ? 16.492  -26.323 30.770  1.00 38.99  ? 258 ASP B CA  1 
ATOM   5981 C  C   . ASP B 1 257 ? 16.885  -24.891 30.410  1.00 37.93  ? 258 ASP B C   1 
ATOM   5982 O  O   . ASP B 1 257 ? 17.802  -24.317 31.007  1.00 37.87  ? 258 ASP B O   1 
ATOM   5983 C  CB  . ASP B 1 257 ? 15.375  -26.319 31.821  1.00 39.05  ? 258 ASP B CB  1 
ATOM   5984 C  CG  . ASP B 1 257 ? 15.814  -25.721 33.154  1.00 39.65  ? 258 ASP B CG  1 
ATOM   5985 O  OD1 . ASP B 1 257 ? 16.984  -25.935 33.559  1.00 40.19  ? 258 ASP B OD1 1 
ATOM   5986 O  OD2 . ASP B 1 257 ? 14.982  -25.047 33.806  1.00 39.17  ? 258 ASP B OD2 1 
ATOM   5987 N  N   . TYR B 1 258 ? 16.187  -24.330 29.426  1.00 36.45  ? 259 TYR B N   1 
ATOM   5988 C  CA  . TYR B 1 258 ? 16.388  -22.943 29.019  1.00 34.97  ? 259 TYR B CA  1 
ATOM   5989 C  C   . TYR B 1 258 ? 15.993  -21.969 30.128  1.00 34.09  ? 259 TYR B C   1 
ATOM   5990 O  O   . TYR B 1 258 ? 14.915  -22.088 30.724  1.00 33.77  ? 259 TYR B O   1 
ATOM   5991 C  CB  . TYR B 1 258 ? 15.587  -22.644 27.760  1.00 34.70  ? 259 TYR B CB  1 
ATOM   5992 C  CG  . TYR B 1 258 ? 15.772  -21.241 27.248  1.00 33.92  ? 259 TYR B CG  1 
ATOM   5993 C  CD1 . TYR B 1 258 ? 16.922  -20.887 26.541  1.00 33.37  ? 259 TYR B CD1 1 
ATOM   5994 C  CD2 . TYR B 1 258 ? 14.795  -20.266 27.458  1.00 33.06  ? 259 TYR B CD2 1 
ATOM   5995 C  CE1 . TYR B 1 258 ? 17.096  -19.599 26.060  1.00 33.53  ? 259 TYR B CE1 1 
ATOM   5996 C  CE2 . TYR B 1 258 ? 14.961  -18.969 26.972  1.00 33.26  ? 259 TYR B CE2 1 
ATOM   5997 C  CZ  . TYR B 1 258 ? 16.116  -18.645 26.279  1.00 32.56  ? 259 TYR B CZ  1 
ATOM   5998 O  OH  . TYR B 1 258 ? 16.307  -17.377 25.799  1.00 31.50  ? 259 TYR B OH  1 
ATOM   5999 N  N   . ARG B 1 259 ? 16.862  -20.999 30.393  1.00 32.98  ? 260 ARG B N   1 
ATOM   6000 C  CA  . ARG B 1 259 ? 16.639  -20.093 31.517  1.00 32.24  ? 260 ARG B CA  1 
ATOM   6001 C  C   . ARG B 1 259 ? 16.480  -18.621 31.142  1.00 30.83  ? 260 ARG B C   1 
ATOM   6002 O  O   . ARG B 1 259 ? 16.358  -17.773 32.028  1.00 31.27  ? 260 ARG B O   1 
ATOM   6003 C  CB  . ARG B 1 259 ? 17.739  -20.263 32.567  1.00 32.67  ? 260 ARG B CB  1 
ATOM   6004 C  CG  . ARG B 1 259 ? 17.837  -21.675 33.131  1.00 35.07  ? 260 ARG B CG  1 
ATOM   6005 C  CD  . ARG B 1 259 ? 18.201  -21.665 34.607  1.00 38.47  ? 260 ARG B CD  1 
ATOM   6006 N  NE  . ARG B 1 259 ? 17.044  -21.398 35.460  1.00 41.15  ? 260 ARG B NE  1 
ATOM   6007 C  CZ  . ARG B 1 259 ? 16.200  -22.326 35.916  1.00 42.64  ? 260 ARG B CZ  1 
ATOM   6008 N  NH1 . ARG B 1 259 ? 16.359  -23.605 35.598  1.00 42.62  ? 260 ARG B NH1 1 
ATOM   6009 N  NH2 . ARG B 1 259 ? 15.182  -21.972 36.693  1.00 43.25  ? 260 ARG B NH2 1 
ATOM   6010 N  N   . GLY B 1 260 ? 16.474  -18.310 29.849  1.00 29.07  ? 261 GLY B N   1 
ATOM   6011 C  CA  . GLY B 1 260 ? 16.282  -16.926 29.405  1.00 26.58  ? 261 GLY B CA  1 
ATOM   6012 C  C   . GLY B 1 260 ? 17.498  -16.295 28.751  1.00 25.08  ? 261 GLY B C   1 
ATOM   6013 O  O   . GLY B 1 260 ? 18.597  -16.854 28.780  1.00 24.90  ? 261 GLY B O   1 
ATOM   6014 N  N   . ILE B 1 261 ? 17.296  -15.113 28.175  1.00 23.35  ? 262 ILE B N   1 
ATOM   6015 C  CA  . ILE B 1 261 ? 18.340  -14.412 27.435  1.00 21.77  ? 262 ILE B CA  1 
ATOM   6016 C  C   . ILE B 1 261 ? 19.545  -14.025 28.305  1.00 21.24  ? 262 ILE B C   1 
ATOM   6017 O  O   . ILE B 1 261 ? 20.683  -14.210 27.891  1.00 20.36  ? 262 ILE B O   1 
ATOM   6018 C  CB  . ILE B 1 261 ? 17.787  -13.156 26.709  1.00 21.20  ? 262 ILE B CB  1 
ATOM   6019 C  CG1 . ILE B 1 261 ? 16.730  -13.552 25.676  1.00 21.06  ? 262 ILE B CG1 1 
ATOM   6020 C  CG2 . ILE B 1 261 ? 18.908  -12.380 26.035  1.00 19.83  ? 262 ILE B CG2 1 
ATOM   6021 C  CD1 . ILE B 1 261 ? 15.724  -12.429 25.364  1.00 20.64  ? 262 ILE B CD1 1 
ATOM   6022 N  N   . LEU B 1 262 ? 19.283  -13.473 29.487  1.00 21.07  ? 263 LEU B N   1 
ATOM   6023 C  CA  . LEU B 1 262 ? 20.347  -12.983 30.359  1.00 21.51  ? 263 LEU B CA  1 
ATOM   6024 C  C   . LEU B 1 262 ? 21.266  -14.122 30.806  1.00 22.29  ? 263 LEU B C   1 
ATOM   6025 O  O   . LEU B 1 262 ? 22.490  -13.969 30.838  1.00 21.89  ? 263 LEU B O   1 
ATOM   6026 C  CB  . LEU B 1 262 ? 19.777  -12.229 31.574  1.00 20.77  ? 263 LEU B CB  1 
ATOM   6027 C  CG  . LEU B 1 262 ? 20.798  -11.500 32.467  1.00 19.79  ? 263 LEU B CG  1 
ATOM   6028 C  CD1 . LEU B 1 262 ? 21.721  -10.610 31.655  1.00 17.98  ? 263 LEU B CD1 1 
ATOM   6029 C  CD2 . LEU B 1 262 ? 20.099  -10.678 33.532  1.00 19.05  ? 263 LEU B CD2 1 
ATOM   6030 N  N   . TYR B 1 263 ? 20.657  -15.259 31.142  1.00 23.48  ? 264 TYR B N   1 
ATOM   6031 C  CA  . TYR B 1 263 ? 21.395  -16.456 31.530  1.00 24.86  ? 264 TYR B CA  1 
ATOM   6032 C  C   . TYR B 1 263 ? 22.420  -16.806 30.464  1.00 25.16  ? 264 TYR B C   1 
ATOM   6033 O  O   . TYR B 1 263 ? 23.568  -17.096 30.780  1.00 25.36  ? 264 TYR B O   1 
ATOM   6034 C  CB  . TYR B 1 263 ? 20.437  -17.635 31.752  1.00 25.15  ? 264 TYR B CB  1 
ATOM   6035 C  CG  . TYR B 1 263 ? 21.111  -18.895 32.250  1.00 26.73  ? 264 TYR B CG  1 
ATOM   6036 C  CD1 . TYR B 1 263 ? 21.150  -19.190 33.615  1.00 27.22  ? 264 TYR B CD1 1 
ATOM   6037 C  CD2 . TYR B 1 263 ? 21.719  -19.794 31.356  1.00 27.43  ? 264 TYR B CD2 1 
ATOM   6038 C  CE1 . TYR B 1 263 ? 21.774  -20.347 34.082  1.00 29.04  ? 264 TYR B CE1 1 
ATOM   6039 C  CE2 . TYR B 1 263 ? 22.348  -20.955 31.813  1.00 27.97  ? 264 TYR B CE2 1 
ATOM   6040 C  CZ  . TYR B 1 263 ? 22.371  -21.223 33.175  1.00 29.40  ? 264 TYR B CZ  1 
ATOM   6041 O  OH  . TYR B 1 263 ? 22.976  -22.371 33.644  1.00 31.40  ? 264 TYR B OH  1 
ATOM   6042 N  N   . ARG B 1 264 ? 21.999  -16.766 29.204  1.00 25.81  ? 265 ARG B N   1 
ATOM   6043 C  CA  . ARG B 1 264 ? 22.873  -17.101 28.089  1.00 26.77  ? 265 ARG B CA  1 
ATOM   6044 C  C   . ARG B 1 264 ? 23.943  -16.048 27.787  1.00 27.19  ? 265 ARG B C   1 
ATOM   6045 O  O   . ARG B 1 264 ? 25.055  -16.388 27.364  1.00 27.17  ? 265 ARG B O   1 
ATOM   6046 C  CB  . ARG B 1 264 ? 22.045  -17.394 26.849  1.00 27.01  ? 265 ARG B CB  1 
ATOM   6047 C  CG  . ARG B 1 264 ? 21.811  -18.871 26.641  1.00 28.49  ? 265 ARG B CG  1 
ATOM   6048 C  CD  . ARG B 1 264 ? 20.456  -19.091 26.063  1.00 32.42  ? 265 ARG B CD  1 
ATOM   6049 N  NE  . ARG B 1 264 ? 20.217  -20.490 25.700  1.00 34.00  ? 265 ARG B NE  1 
ATOM   6050 C  CZ  . ARG B 1 264 ? 20.223  -20.954 24.454  1.00 34.11  ? 265 ARG B CZ  1 
ATOM   6051 N  NH1 . ARG B 1 264 ? 20.474  -20.137 23.430  1.00 34.23  ? 265 ARG B NH1 1 
ATOM   6052 N  NH2 . ARG B 1 264 ? 19.974  -22.237 24.232  1.00 33.97  ? 265 ARG B NH2 1 
ATOM   6053 N  N   . LEU B 1 265 ? 23.617  -14.776 28.001  1.00 27.31  ? 266 LEU B N   1 
ATOM   6054 C  CA  . LEU B 1 265 ? 24.591  -13.730 27.748  1.00 27.89  ? 266 LEU B CA  1 
ATOM   6055 C  C   . LEU B 1 265 ? 25.664  -13.759 28.838  1.00 28.34  ? 266 LEU B C   1 
ATOM   6056 O  O   . LEU B 1 265 ? 26.848  -13.707 28.533  1.00 28.15  ? 266 LEU B O   1 
ATOM   6057 C  CB  . LEU B 1 265 ? 23.931  -12.352 27.626  1.00 27.59  ? 266 LEU B CB  1 
ATOM   6058 C  CG  . LEU B 1 265 ? 22.986  -12.090 26.445  1.00 27.53  ? 266 LEU B CG  1 
ATOM   6059 C  CD1 . LEU B 1 265 ? 22.284  -10.742 26.621  1.00 26.14  ? 266 LEU B CD1 1 
ATOM   6060 C  CD2 . LEU B 1 265 ? 23.721  -12.142 25.102  1.00 27.16  ? 266 LEU B CD2 1 
ATOM   6061 N  N   . LEU B 1 266 ? 25.245  -13.876 30.096  1.00 29.02  ? 267 LEU B N   1 
ATOM   6062 C  CA  . LEU B 1 266 ? 26.189  -13.986 31.209  1.00 30.16  ? 267 LEU B CA  1 
ATOM   6063 C  C   . LEU B 1 266 ? 27.025  -15.261 31.123  1.00 31.41  ? 267 LEU B C   1 
ATOM   6064 O  O   . LEU B 1 266 ? 28.207  -15.256 31.456  1.00 31.46  ? 267 LEU B O   1 
ATOM   6065 C  CB  . LEU B 1 266 ? 25.459  -13.932 32.546  1.00 29.85  ? 267 LEU B CB  1 
ATOM   6066 C  CG  . LEU B 1 266 ? 24.839  -12.588 32.936  1.00 28.86  ? 267 LEU B CG  1 
ATOM   6067 C  CD1 . LEU B 1 266 ? 24.115  -12.748 34.241  1.00 27.54  ? 267 LEU B CD1 1 
ATOM   6068 C  CD2 . LEU B 1 266 ? 25.904  -11.502 33.025  1.00 27.63  ? 267 LEU B CD2 1 
ATOM   6069 N  N   . GLY B 1 267 ? 26.399  -16.336 30.650  1.00 32.71  ? 268 GLY B N   1 
ATOM   6070 C  CA  . GLY B 1 267 ? 27.037  -17.633 30.532  1.00 34.37  ? 268 GLY B CA  1 
ATOM   6071 C  C   . GLY B 1 267 ? 28.049  -17.748 29.413  1.00 35.41  ? 268 GLY B C   1 
ATOM   6072 O  O   . GLY B 1 267 ? 29.146  -18.248 29.632  1.00 35.62  ? 268 GLY B O   1 
ATOM   6073 N  N   . ASP B 1 268 ? 27.695  -17.275 28.219  1.00 36.52  ? 269 ASP B N   1 
ATOM   6074 C  CA  . ASP B 1 268 ? 28.506  -17.540 27.023  1.00 37.55  ? 269 ASP B CA  1 
ATOM   6075 C  C   . ASP B 1 268 ? 28.327  -16.496 25.910  1.00 37.40  ? 269 ASP B C   1 
ATOM   6076 O  O   . ASP B 1 268 ? 27.679  -16.771 24.893  1.00 37.18  ? 269 ASP B O   1 
ATOM   6077 C  CB  . ASP B 1 268 ? 28.192  -18.959 26.491  1.00 38.18  ? 269 ASP B CB  1 
ATOM   6078 C  CG  . ASP B 1 268 ? 29.198  -19.455 25.436  1.00 40.09  ? 269 ASP B CG  1 
ATOM   6079 O  OD1 . ASP B 1 268 ? 28.888  -20.481 24.778  1.00 41.57  ? 269 ASP B OD1 1 
ATOM   6080 O  OD2 . ASP B 1 268 ? 30.283  -18.842 25.266  1.00 41.54  ? 269 ASP B OD2 1 
ATOM   6081 N  N   . SER B 1 269 ? 28.916  -15.312 26.101  1.00 37.32  ? 270 SER B N   1 
ATOM   6082 C  CA  . SER B 1 269 ? 28.961  -14.289 25.044  1.00 37.10  ? 270 SER B CA  1 
ATOM   6083 C  C   . SER B 1 269 ? 30.233  -13.441 25.052  1.00 36.83  ? 270 SER B C   1 
ATOM   6084 O  O   . SER B 1 269 ? 30.900  -13.298 26.077  1.00 36.91  ? 270 SER B O   1 
ATOM   6085 C  CB  . SER B 1 269 ? 27.719  -13.382 25.088  1.00 37.19  ? 270 SER B CB  1 
ATOM   6086 O  OG  . SER B 1 269 ? 27.834  -12.379 26.073  1.00 36.96  ? 270 SER B OG  1 
ATOM   6087 N  N   . LYS B 1 270 ? 30.540  -12.855 23.899  1.00 36.58  ? 271 LYS B N   1 
ATOM   6088 C  CA  . LYS B 1 270 ? 31.687  -11.965 23.754  1.00 36.37  ? 271 LYS B CA  1 
ATOM   6089 C  C   . LYS B 1 270 ? 31.490  -10.602 24.429  1.00 35.89  ? 271 LYS B C   1 
ATOM   6090 O  O   . LYS B 1 270 ? 32.409  -9.779  24.448  1.00 36.08  ? 271 LYS B O   1 
ATOM   6091 C  CB  . LYS B 1 270 ? 32.026  -11.778 22.270  1.00 36.71  ? 271 LYS B CB  1 
ATOM   6092 C  CG  . LYS B 1 270 ? 32.714  -12.985 21.631  1.00 38.02  ? 271 LYS B CG  1 
ATOM   6093 C  CD  . LYS B 1 270 ? 32.835  -12.841 20.117  1.00 39.70  ? 271 LYS B CD  1 
ATOM   6094 C  CE  . LYS B 1 270 ? 33.551  -14.042 19.510  1.00 40.33  ? 271 LYS B CE  1 
ATOM   6095 N  NZ  . LYS B 1 270 ? 33.866  -13.813 18.070  1.00 41.53  ? 271 LYS B NZ  1 
ATOM   6096 N  N   . MET B 1 271 ? 30.299  -10.370 24.982  1.00 35.10  ? 272 MET B N   1 
ATOM   6097 C  CA  . MET B 1 271 ? 29.962  -9.092  25.613  1.00 34.20  ? 272 MET B CA  1 
ATOM   6098 C  C   . MET B 1 271 ? 30.480  -8.990  27.046  1.00 33.22  ? 272 MET B C   1 
ATOM   6099 O  O   . MET B 1 271 ? 30.440  -9.958  27.812  1.00 33.35  ? 272 MET B O   1 
ATOM   6100 C  CB  . MET B 1 271 ? 28.443  -8.866  25.627  1.00 34.27  ? 272 MET B CB  1 
ATOM   6101 C  CG  . MET B 1 271 ? 27.782  -8.753  24.264  1.00 35.26  ? 272 MET B CG  1 
ATOM   6102 S  SD  . MET B 1 271 ? 26.013  -8.354  24.343  1.00 36.52  ? 272 MET B SD  1 
ATOM   6103 C  CE  . MET B 1 271 ? 26.089  -6.646  24.784  1.00 33.43  ? 272 MET B CE  1 
ATOM   6104 N  N   . SER B 1 272 ? 30.939  -7.799  27.406  1.00 31.94  ? 273 SER B N   1 
ATOM   6105 C  CA  . SER B 1 272 ? 31.264  -7.485  28.790  1.00 30.85  ? 273 SER B CA  1 
ATOM   6106 C  C   . SER B 1 272 ? 29.975  -7.367  29.602  1.00 29.98  ? 273 SER B C   1 
ATOM   6107 O  O   . SER B 1 272 ? 28.893  -7.167  29.037  1.00 29.64  ? 273 SER B O   1 
ATOM   6108 C  CB  . SER B 1 272 ? 32.045  -6.173  28.852  1.00 30.77  ? 273 SER B CB  1 
ATOM   6109 O  OG  . SER B 1 272 ? 31.282  -5.118  28.285  1.00 31.13  ? 273 SER B OG  1 
ATOM   6110 N  N   . PHE B 1 273 ? 30.090  -7.484  30.924  1.00 28.96  ? 274 PHE B N   1 
ATOM   6111 C  CA  . PHE B 1 273 ? 28.942  -7.287  31.807  1.00 27.92  ? 274 PHE B CA  1 
ATOM   6112 C  C   . PHE B 1 273 ? 28.332  -5.897  31.621  1.00 27.67  ? 274 PHE B C   1 
ATOM   6113 O  O   . PHE B 1 273 ? 27.116  -5.723  31.720  1.00 27.19  ? 274 PHE B O   1 
ATOM   6114 C  CB  . PHE B 1 273 ? 29.312  -7.491  33.278  1.00 27.43  ? 274 PHE B CB  1 
ATOM   6115 C  CG  . PHE B 1 273 ? 28.151  -7.285  34.217  1.00 26.40  ? 274 PHE B CG  1 
ATOM   6116 C  CD1 . PHE B 1 273 ? 27.160  -8.253  34.331  1.00 24.88  ? 274 PHE B CD1 1 
ATOM   6117 C  CD2 . PHE B 1 273 ? 28.031  -6.111  34.957  1.00 24.77  ? 274 PHE B CD2 1 
ATOM   6118 C  CE1 . PHE B 1 273 ? 26.073  -8.066  35.172  1.00 23.55  ? 274 PHE B CE1 1 
ATOM   6119 C  CE2 . PHE B 1 273 ? 26.948  -5.917  35.805  1.00 24.64  ? 274 PHE B CE2 1 
ATOM   6120 C  CZ  . PHE B 1 273 ? 25.965  -6.899  35.912  1.00 24.30  ? 274 PHE B CZ  1 
ATOM   6121 N  N   . GLU B 1 274 ? 29.202  -4.923  31.369  1.00 27.45  ? 275 GLU B N   1 
ATOM   6122 C  CA  . GLU B 1 274 ? 28.821  -3.529  31.164  1.00 27.24  ? 275 GLU B CA  1 
ATOM   6123 C  C   . GLU B 1 274 ? 27.881  -3.399  29.959  1.00 26.45  ? 275 GLU B C   1 
ATOM   6124 O  O   . GLU B 1 274 ? 26.817  -2.789  30.052  1.00 26.23  ? 275 GLU B O   1 
ATOM   6125 C  CB  . GLU B 1 274 ? 30.078  -2.668  30.970  1.00 27.35  ? 275 GLU B CB  1 
ATOM   6126 C  CG  . GLU B 1 274 ? 30.849  -2.317  32.264  1.00 28.68  ? 275 GLU B CG  1 
ATOM   6127 C  CD  . GLU B 1 274 ? 31.574  -3.502  32.940  1.00 30.47  ? 275 GLU B CD  1 
ATOM   6128 O  OE1 . GLU B 1 274 ? 32.079  -4.398  32.221  1.00 30.23  ? 275 GLU B OE1 1 
ATOM   6129 O  OE2 . GLU B 1 274 ? 31.643  -3.516  34.202  1.00 29.36  ? 275 GLU B OE2 1 
ATOM   6130 N  N   . ASP B 1 275 ? 28.281  -3.999  28.842  1.00 25.69  ? 276 ASP B N   1 
ATOM   6131 C  CA  . ASP B 1 275 ? 27.491  -3.997  27.621  1.00 25.14  ? 276 ASP B CA  1 
ATOM   6132 C  C   . ASP B 1 275 ? 26.192  -4.795  27.759  1.00 24.44  ? 276 ASP B C   1 
ATOM   6133 O  O   . ASP B 1 275 ? 25.150  -4.397  27.230  1.00 24.34  ? 276 ASP B O   1 
ATOM   6134 C  CB  . ASP B 1 275 ? 28.322  -4.537  26.461  1.00 25.71  ? 276 ASP B CB  1 
ATOM   6135 C  CG  . ASP B 1 275 ? 29.438  -3.588  26.047  1.00 26.57  ? 276 ASP B CG  1 
ATOM   6136 O  OD1 . ASP B 1 275 ? 29.263  -2.356  26.156  1.00 26.95  ? 276 ASP B OD1 1 
ATOM   6137 O  OD2 . ASP B 1 275 ? 30.487  -4.084  25.599  1.00 29.09  ? 276 ASP B OD2 1 
ATOM   6138 N  N   . ILE B 1 276 ? 26.261  -5.912  28.478  1.00 23.28  ? 277 ILE B N   1 
ATOM   6139 C  CA  . ILE B 1 276 ? 25.093  -6.740  28.722  1.00 22.27  ? 277 ILE B CA  1 
ATOM   6140 C  C   . ILE B 1 276 ? 24.039  -5.961  29.500  1.00 22.12  ? 277 ILE B C   1 
ATOM   6141 O  O   . ILE B 1 276 ? 22.885  -5.913  29.088  1.00 22.29  ? 277 ILE B O   1 
ATOM   6142 C  CB  . ILE B 1 276 ? 25.462  -8.068  29.432  1.00 21.97  ? 277 ILE B CB  1 
ATOM   6143 C  CG1 . ILE B 1 276 ? 26.210  -8.983  28.458  1.00 21.48  ? 277 ILE B CG1 1 
ATOM   6144 C  CG2 . ILE B 1 276 ? 24.211  -8.768  29.956  1.00 21.27  ? 277 ILE B CG2 1 
ATOM   6145 C  CD1 . ILE B 1 276 ? 26.867  -10.198 29.106  1.00 21.21  ? 277 ILE B CD1 1 
ATOM   6146 N  N   . LYS B 1 277 ? 24.435  -5.337  30.606  1.00 21.60  ? 278 LYS B N   1 
ATOM   6147 C  CA  . LYS B 1 277 ? 23.497  -4.568  31.415  1.00 21.21  ? 278 LYS B CA  1 
ATOM   6148 C  C   . LYS B 1 277 ? 22.916  -3.382  30.642  1.00 20.31  ? 278 LYS B C   1 
ATOM   6149 O  O   . LYS B 1 277 ? 21.728  -3.079  30.760  1.00 20.18  ? 278 LYS B O   1 
ATOM   6150 C  CB  . LYS B 1 277 ? 24.151  -4.073  32.700  1.00 21.70  ? 278 LYS B CB  1 
ATOM   6151 C  CG  . LYS B 1 277 ? 23.155  -3.467  33.686  1.00 23.52  ? 278 LYS B CG  1 
ATOM   6152 C  CD  . LYS B 1 277 ? 23.704  -2.211  34.352  1.00 28.34  ? 278 LYS B CD  1 
ATOM   6153 C  CE  . LYS B 1 277 ? 24.554  -2.516  35.556  1.00 29.38  ? 278 LYS B CE  1 
ATOM   6154 N  NZ  . LYS B 1 277 ? 25.949  -2.795  35.138  1.00 33.08  ? 278 LYS B NZ  1 
ATOM   6155 N  N   . ALA B 1 278 ? 23.759  -2.712  29.865  1.00 19.49  ? 279 ALA B N   1 
ATOM   6156 C  CA  . ALA B 1 278 ? 23.316  -1.587  29.048  1.00 19.17  ? 279 ALA B CA  1 
ATOM   6157 C  C   . ALA B 1 278 ? 22.217  -2.018  28.065  1.00 18.58  ? 279 ALA B C   1 
ATOM   6158 O  O   . ALA B 1 278 ? 21.181  -1.364  27.956  1.00 18.65  ? 279 ALA B O   1 
ATOM   6159 C  CB  . ALA B 1 278 ? 24.502  -0.956  28.310  1.00 19.09  ? 279 ALA B CB  1 
ATOM   6160 N  N   . ASN B 1 279 ? 22.443  -3.140  27.389  1.00 18.00  ? 280 ASN B N   1 
ATOM   6161 C  CA  . ASN B 1 279 ? 21.495  -3.675  26.413  1.00 17.44  ? 280 ASN B CA  1 
ATOM   6162 C  C   . ASN B 1 279 ? 20.222  -4.276  26.984  1.00 17.45  ? 280 ASN B C   1 
ATOM   6163 O  O   . ASN B 1 279 ? 19.153  -4.158  26.373  1.00 17.45  ? 280 ASN B O   1 
ATOM   6164 C  CB  . ASN B 1 279 ? 22.194  -4.636  25.466  1.00 16.65  ? 280 ASN B CB  1 
ATOM   6165 C  CG  . ASN B 1 279 ? 23.010  -3.907  24.437  1.00 16.98  ? 280 ASN B CG  1 
ATOM   6166 O  OD1 . ASN B 1 279 ? 22.473  -3.110  23.668  1.00 15.45  ? 280 ASN B OD1 1 
ATOM   6167 N  ND2 . ASN B 1 279 ? 24.323  -4.149  24.425  1.00 16.27  ? 280 ASN B ND2 1 
ATOM   6168 N  N   . VAL B 1 280 ? 20.333  -4.919  28.146  1.00 17.28  ? 281 VAL B N   1 
ATOM   6169 C  CA  . VAL B 1 280 ? 19.159  -5.388  28.886  1.00 17.35  ? 281 VAL B CA  1 
ATOM   6170 C  C   . VAL B 1 280 ? 18.235  -4.215  29.190  1.00 17.62  ? 281 VAL B C   1 
ATOM   6171 O  O   . VAL B 1 280 ? 17.017  -4.302  28.998  1.00 17.38  ? 281 VAL B O   1 
ATOM   6172 C  CB  . VAL B 1 280 ? 19.555  -6.102  30.209  1.00 17.14  ? 281 VAL B CB  1 
ATOM   6173 C  CG1 . VAL B 1 280 ? 18.374  -6.221  31.146  1.00 16.77  ? 281 VAL B CG1 1 
ATOM   6174 C  CG2 . VAL B 1 280 ? 20.122  -7.477  29.915  1.00 17.86  ? 281 VAL B CG2 1 
ATOM   6175 N  N   . THR B 1 281 ? 18.822  -3.115  29.663  1.00 18.07  ? 282 THR B N   1 
ATOM   6176 C  CA  . THR B 1 281 ? 18.061  -1.907  29.951  1.00 18.83  ? 282 THR B CA  1 
ATOM   6177 C  C   . THR B 1 281 ? 17.275  -1.459  28.711  1.00 18.79  ? 282 THR B C   1 
ATOM   6178 O  O   . THR B 1 281 ? 16.072  -1.175  28.809  1.00 18.93  ? 282 THR B O   1 
ATOM   6179 C  CB  . THR B 1 281 ? 18.982  -0.779  30.453  1.00 19.23  ? 282 THR B CB  1 
ATOM   6180 O  OG1 . THR B 1 281 ? 19.616  -1.206  31.662  1.00 20.09  ? 282 THR B OG1 1 
ATOM   6181 C  CG2 . THR B 1 281 ? 18.200  0.507   30.713  1.00 18.91  ? 282 THR B CG2 1 
ATOM   6182 N  N   . GLU B 1 282 ? 17.947  -1.444  27.559  1.00 18.54  ? 283 GLU B N   1 
ATOM   6183 C  CA  . GLU B 1 282 ? 17.330  -1.004  26.295  1.00 19.12  ? 283 GLU B CA  1 
ATOM   6184 C  C   . GLU B 1 282 ? 16.274  -1.959  25.756  1.00 19.03  ? 283 GLU B C   1 
ATOM   6185 O  O   . GLU B 1 282 ? 15.249  -1.523  25.227  1.00 19.32  ? 283 GLU B O   1 
ATOM   6186 C  CB  . GLU B 1 282 ? 18.386  -0.694  25.229  1.00 18.71  ? 283 GLU B CB  1 
ATOM   6187 C  CG  . GLU B 1 282 ? 19.203  0.531   25.589  1.00 19.64  ? 283 GLU B CG  1 
ATOM   6188 C  CD  . GLU B 1 282 ? 20.254  0.881   24.561  1.00 20.75  ? 283 GLU B CD  1 
ATOM   6189 O  OE1 . GLU B 1 282 ? 20.411  0.143   23.565  1.00 22.28  ? 283 GLU B OE1 1 
ATOM   6190 O  OE2 . GLU B 1 282 ? 20.935  1.907   24.757  1.00 21.38  ? 283 GLU B OE2 1 
ATOM   6191 N  N   . MET B 1 283 ? 16.511  -3.257  25.906  1.00 19.17  ? 284 MET B N   1 
ATOM   6192 C  CA  . MET B 1 283 ? 15.517  -4.254  25.505  1.00 19.43  ? 284 MET B CA  1 
ATOM   6193 C  C   . MET B 1 283 ? 14.258  -4.155  26.357  1.00 18.98  ? 284 MET B C   1 
ATOM   6194 O  O   . MET B 1 283 ? 13.139  -4.213  25.838  1.00 18.88  ? 284 MET B O   1 
ATOM   6195 C  CB  . MET B 1 283 ? 16.108  -5.658  25.533  1.00 19.40  ? 284 MET B CB  1 
ATOM   6196 C  CG  . MET B 1 283 ? 17.060  -5.906  24.363  1.00 21.42  ? 284 MET B CG  1 
ATOM   6197 S  SD  . MET B 1 283 ? 17.821  -7.540  24.408  1.00 25.52  ? 284 MET B SD  1 
ATOM   6198 C  CE  . MET B 1 283 ? 16.389  -8.581  24.192  1.00 26.64  ? 284 MET B CE  1 
ATOM   6199 N  N   . LEU B 1 284 ? 14.445  -3.990  27.660  1.00 18.71  ? 285 LEU B N   1 
ATOM   6200 C  CA  . LEU B 1 284 ? 13.320  -3.812  28.576  1.00 18.63  ? 285 LEU B CA  1 
ATOM   6201 C  C   . LEU B 1 284 ? 12.475  -2.588  28.226  1.00 18.68  ? 285 LEU B C   1 
ATOM   6202 O  O   . LEU B 1 284 ? 11.252  -2.673  28.163  1.00 19.31  ? 285 LEU B O   1 
ATOM   6203 C  CB  . LEU B 1 284 ? 13.820  -3.685  30.013  1.00 18.70  ? 285 LEU B CB  1 
ATOM   6204 C  CG  . LEU B 1 284 ? 14.325  -4.941  30.725  1.00 18.52  ? 285 LEU B CG  1 
ATOM   6205 C  CD1 . LEU B 1 284 ? 14.724  -4.561  32.127  1.00 17.39  ? 285 LEU B CD1 1 
ATOM   6206 C  CD2 . LEU B 1 284 ? 13.246  -6.016  30.746  1.00 18.73  ? 285 LEU B CD2 1 
ATOM   6207 N  N   . ALA B 1 285 ? 13.132  -1.455  27.989  1.00 18.39  ? 286 ALA B N   1 
ATOM   6208 C  CA  . ALA B 1 285 ? 12.432  -0.197  27.749  1.00 18.36  ? 286 ALA B CA  1 
ATOM   6209 C  C   . ALA B 1 285 ? 11.810  -0.134  26.350  1.00 18.55  ? 286 ALA B C   1 
ATOM   6210 O  O   . ALA B 1 285 ? 10.796  0.545   26.139  1.00 18.96  ? 286 ALA B O   1 
ATOM   6211 C  CB  . ALA B 1 285 ? 13.367  0.979   27.970  1.00 17.81  ? 286 ALA B CB  1 
ATOM   6212 N  N   . GLY B 1 286 ? 12.437  -0.817  25.397  1.00 18.23  ? 287 GLY B N   1 
ATOM   6213 C  CA  . GLY B 1 286 ? 11.978  -0.797  24.021  1.00 18.40  ? 287 GLY B CA  1 
ATOM   6214 C  C   . GLY B 1 286 ? 10.792  -1.721  23.785  1.00 18.68  ? 287 GLY B C   1 
ATOM   6215 O  O   . GLY B 1 286 ? 10.107  -1.606  22.774  1.00 18.83  ? 287 GLY B O   1 
ATOM   6216 N  N   . GLY B 1 287 ? 10.547  -2.630  24.722  1.00 18.60  ? 288 GLY B N   1 
ATOM   6217 C  CA  . GLY B 1 287 ? 9.575   -3.692  24.515  1.00 19.04  ? 288 GLY B CA  1 
ATOM   6218 C  C   . GLY B 1 287 ? 8.227   -3.580  25.206  1.00 18.95  ? 288 GLY B C   1 
ATOM   6219 O  O   . GLY B 1 287 ? 7.403   -4.478  25.073  1.00 19.19  ? 288 GLY B O   1 
ATOM   6220 N  N   . VAL B 1 288 ? 7.998   -2.488  25.930  1.00 18.46  ? 289 VAL B N   1 
ATOM   6221 C  CA  . VAL B 1 288 ? 6.771   -2.322  26.697  1.00 18.68  ? 289 VAL B CA  1 
ATOM   6222 C  C   . VAL B 1 288 ? 5.698   -1.518  25.933  1.00 18.86  ? 289 VAL B C   1 
ATOM   6223 O  O   . VAL B 1 288 ? 4.597   -2.019  25.717  1.00 19.48  ? 289 VAL B O   1 
ATOM   6224 C  CB  . VAL B 1 288 ? 7.052   -1.731  28.113  1.00 18.71  ? 289 VAL B CB  1 
ATOM   6225 C  CG1 . VAL B 1 288 ? 5.758   -1.552  28.899  1.00 19.08  ? 289 VAL B CG1 1 
ATOM   6226 C  CG2 . VAL B 1 288 ? 8.019   -2.644  28.885  1.00 18.28  ? 289 VAL B CG2 1 
ATOM   6227 N  N   . ASP B 1 289 ? 6.014   -0.288  25.530  1.00 18.34  ? 290 ASP B N   1 
ATOM   6228 C  CA  . ASP B 1 289 ? 5.045   0.564   24.828  1.00 18.28  ? 290 ASP B CA  1 
ATOM   6229 C  C   . ASP B 1 289 ? 4.805   0.128   23.370  1.00 17.53  ? 290 ASP B C   1 
ATOM   6230 O  O   . ASP B 1 289 ? 3.790   0.463   22.777  1.00 17.34  ? 290 ASP B O   1 
ATOM   6231 C  CB  . ASP B 1 289 ? 5.477   2.033   24.872  1.00 18.52  ? 290 ASP B CB  1 
ATOM   6232 C  CG  . ASP B 1 289 ? 5.531   2.592   26.285  1.00 20.08  ? 290 ASP B CG  1 
ATOM   6233 O  OD1 . ASP B 1 289 ? 5.832   1.827   27.220  1.00 24.54  ? 290 ASP B OD1 1 
ATOM   6234 O  OD2 . ASP B 1 289 ? 5.286   3.802   26.469  1.00 21.28  ? 290 ASP B OD2 1 
ATOM   6235 N  N   . THR B 1 290 ? 5.730   -0.646  22.823  1.00 16.95  ? 291 THR B N   1 
ATOM   6236 C  CA  . THR B 1 290 ? 5.697   -1.007  21.412  1.00 16.58  ? 291 THR B CA  1 
ATOM   6237 C  C   . THR B 1 290 ? 4.679   -2.101  21.103  1.00 16.40  ? 291 THR B C   1 
ATOM   6238 O  O   . THR B 1 290 ? 3.729   -1.876  20.346  1.00 15.66  ? 291 THR B O   1 
ATOM   6239 C  CB  . THR B 1 290 ? 7.099   -1.397  20.909  1.00 16.55  ? 291 THR B CB  1 
ATOM   6240 O  OG1 . THR B 1 290 ? 7.685   -2.348  21.808  1.00 16.44  ? 291 THR B OG1 1 
ATOM   6241 C  CG2 . THR B 1 290 ? 7.979   -0.165  20.820  1.00 15.55  ? 291 THR B CG2 1 
ATOM   6242 N  N   . THR B 1 291 ? 4.872   -3.275  21.699  1.00 16.29  ? 292 THR B N   1 
ATOM   6243 C  CA  . THR B 1 291 ? 3.987   -4.399  21.457  1.00 16.67  ? 292 THR B CA  1 
ATOM   6244 C  C   . THR B 1 291 ? 2.592   -4.153  22.027  1.00 16.50  ? 292 THR B C   1 
ATOM   6245 O  O   . THR B 1 291 ? 1.600   -4.595  21.446  1.00 16.38  ? 292 THR B O   1 
ATOM   6246 C  CB  . THR B 1 291 ? 4.550   -5.705  22.040  1.00 16.86  ? 292 THR B CB  1 
ATOM   6247 O  OG1 . THR B 1 291 ? 4.749   -5.540  23.445  1.00 18.79  ? 292 THR B OG1 1 
ATOM   6248 C  CG2 . THR B 1 291 ? 5.872   -6.035  21.416  1.00 17.58  ? 292 THR B CG2 1 
ATOM   6249 N  N   . SER B 1 292 ? 2.516   -3.454  23.159  1.00 16.17  ? 293 SER B N   1 
ATOM   6250 C  CA  . SER B 1 292 ? 1.224   -3.160  23.778  1.00 16.30  ? 293 SER B CA  1 
ATOM   6251 C  C   . SER B 1 292 ? 0.334   -2.241  22.919  1.00 15.92  ? 293 SER B C   1 
ATOM   6252 O  O   . SER B 1 292 ? -0.849  -2.522  22.755  1.00 15.48  ? 293 SER B O   1 
ATOM   6253 C  CB  . SER B 1 292 ? 1.406   -2.583  25.182  1.00 15.91  ? 293 SER B CB  1 
ATOM   6254 O  OG  . SER B 1 292 ? 2.243   -1.452  25.126  1.00 17.49  ? 293 SER B OG  1 
ATOM   6255 N  N   . MET B 1 293 ? 0.898   -1.159  22.374  1.00 15.69  ? 294 MET B N   1 
ATOM   6256 C  CA  . MET B 1 293 ? 0.132   -0.264  21.492  1.00 15.47  ? 294 MET B CA  1 
ATOM   6257 C  C   . MET B 1 293 ? -0.267  -0.973  20.198  1.00 14.92  ? 294 MET B C   1 
ATOM   6258 O  O   . MET B 1 293 ? -1.388  -0.793  19.690  1.00 14.44  ? 294 MET B O   1 
ATOM   6259 C  CB  . MET B 1 293 ? 0.904   1.033   21.182  1.00 16.35  ? 294 MET B CB  1 
ATOM   6260 C  CG  . MET B 1 293 ? 0.988   2.034   22.361  1.00 18.01  ? 294 MET B CG  1 
ATOM   6261 S  SD  . MET B 1 293 ? -0.608  2.528   23.041  1.00 21.58  ? 294 MET B SD  1 
ATOM   6262 C  CE  . MET B 1 293 ? -0.968  1.218   24.216  1.00 21.29  ? 294 MET B CE  1 
ATOM   6263 N  N   . THR B 1 294 ? 0.643   -1.800  19.690  1.00 14.11  ? 295 THR B N   1 
ATOM   6264 C  CA  . THR B 1 294 ? 0.420   -2.502  18.437  1.00 13.97  ? 295 THR B CA  1 
ATOM   6265 C  C   . THR B 1 294 ? -0.725  -3.507  18.598  1.00 14.06  ? 295 THR B C   1 
ATOM   6266 O  O   . THR B 1 294 ? -1.655  -3.543  17.778  1.00 14.00  ? 295 THR B O   1 
ATOM   6267 C  CB  . THR B 1 294 ? 1.730   -3.148  17.924  1.00 14.21  ? 295 THR B CB  1 
ATOM   6268 O  OG1 . THR B 1 294 ? 2.721   -2.121  17.770  1.00 13.57  ? 295 THR B OG1 1 
ATOM   6269 C  CG2 . THR B 1 294 ? 1.521   -3.848  16.589  1.00 13.05  ? 295 THR B CG2 1 
ATOM   6270 N  N   . LEU B 1 295 ? -0.666  -4.281  19.680  1.00 13.42  ? 296 LEU B N   1 
ATOM   6271 C  CA  . LEU B 1 295 ? -1.725  -5.222  20.040  1.00 13.03  ? 296 LEU B CA  1 
ATOM   6272 C  C   . LEU B 1 295 ? -3.084  -4.552  20.262  1.00 12.82  ? 296 LEU B C   1 
ATOM   6273 O  O   . LEU B 1 295 ? -4.109  -5.074  19.824  1.00 13.25  ? 296 LEU B O   1 
ATOM   6274 C  CB  . LEU B 1 295 ? -1.318  -6.050  21.271  1.00 12.71  ? 296 LEU B CB  1 
ATOM   6275 C  CG  . LEU B 1 295 ? -0.348  -7.202  20.988  1.00 12.97  ? 296 LEU B CG  1 
ATOM   6276 C  CD1 . LEU B 1 295 ? 0.119   -7.891  22.281  1.00 12.56  ? 296 LEU B CD1 1 
ATOM   6277 C  CD2 . LEU B 1 295 ? -0.973  -8.213  20.037  1.00 11.13  ? 296 LEU B CD2 1 
ATOM   6278 N  N   . GLN B 1 296 ? -3.092  -3.403  20.938  1.00 12.33  ? 297 GLN B N   1 
ATOM   6279 C  CA  . GLN B 1 296 ? -4.313  -2.622  21.098  1.00 12.22  ? 297 GLN B CA  1 
ATOM   6280 C  C   . GLN B 1 296 ? -4.915  -2.187  19.747  1.00 12.27  ? 297 GLN B C   1 
ATOM   6281 O  O   . GLN B 1 296 ? -6.133  -2.211  19.568  1.00 12.77  ? 297 GLN B O   1 
ATOM   6282 C  CB  . GLN B 1 296 ? -4.062  -1.389  21.971  1.00 11.78  ? 297 GLN B CB  1 
ATOM   6283 C  CG  . GLN B 1 296 ? -5.346  -0.666  22.357  1.00 11.22  ? 297 GLN B CG  1 
ATOM   6284 C  CD  . GLN B 1 296 ? -5.118  0.493   23.315  1.00 12.41  ? 297 GLN B CD  1 
ATOM   6285 O  OE1 . GLN B 1 296 ? -5.739  0.561   24.387  1.00 12.12  ? 297 GLN B OE1 1 
ATOM   6286 N  NE2 . GLN B 1 296 ? -4.230  1.419   22.930  1.00 9.63   ? 297 GLN B NE2 1 
ATOM   6287 N  N   . TRP B 1 297 ? -4.066  -1.776  18.811  1.00 12.35  ? 298 TRP B N   1 
ATOM   6288 C  CA  . TRP B 1 297 ? -4.523  -1.443  17.456  1.00 12.26  ? 298 TRP B CA  1 
ATOM   6289 C  C   . TRP B 1 297 ? -5.071  -2.666  16.715  1.00 12.40  ? 298 TRP B C   1 
ATOM   6290 O  O   . TRP B 1 297 ? -6.064  -2.568  16.000  1.00 12.69  ? 298 TRP B O   1 
ATOM   6291 C  CB  . TRP B 1 297 ? -3.400  -0.830  16.647  1.00 12.10  ? 298 TRP B CB  1 
ATOM   6292 C  CG  . TRP B 1 297 ? -3.116  0.641   16.884  1.00 12.51  ? 298 TRP B CG  1 
ATOM   6293 C  CD1 . TRP B 1 297 ? -1.917  1.187   17.223  1.00 11.61  ? 298 TRP B CD1 1 
ATOM   6294 C  CD2 . TRP B 1 297 ? -4.031  1.742   16.739  1.00 13.12  ? 298 TRP B CD2 1 
ATOM   6295 N  NE1 . TRP B 1 297 ? -2.020  2.549   17.310  1.00 12.54  ? 298 TRP B NE1 1 
ATOM   6296 C  CE2 . TRP B 1 297 ? -3.307  2.922   17.017  1.00 12.75  ? 298 TRP B CE2 1 
ATOM   6297 C  CE3 . TRP B 1 297 ? -5.393  1.844   16.404  1.00 13.47  ? 298 TRP B CE3 1 
ATOM   6298 C  CZ2 . TRP B 1 297 ? -3.892  4.197   16.972  1.00 12.19  ? 298 TRP B CZ2 1 
ATOM   6299 C  CZ3 . TRP B 1 297 ? -5.984  3.121   16.368  1.00 12.73  ? 298 TRP B CZ3 1 
ATOM   6300 C  CH2 . TRP B 1 297 ? -5.228  4.275   16.647  1.00 12.40  ? 298 TRP B CH2 1 
ATOM   6301 N  N   . HIS B 1 298 ? -4.426  -3.815  16.888  1.00 12.44  ? 299 HIS B N   1 
ATOM   6302 C  CA  . HIS B 1 298 ? -4.882  -5.030  16.238  1.00 12.68  ? 299 HIS B CA  1 
ATOM   6303 C  C   . HIS B 1 298 ? -6.264  -5.412  16.758  1.00 13.01  ? 299 HIS B C   1 
ATOM   6304 O  O   . HIS B 1 298 ? -7.182  -5.670  15.970  1.00 12.75  ? 299 HIS B O   1 
ATOM   6305 C  CB  . HIS B 1 298 ? -3.896  -6.176  16.456  1.00 12.68  ? 299 HIS B CB  1 
ATOM   6306 C  CG  . HIS B 1 298 ? -4.220  -7.396  15.653  1.00 12.82  ? 299 HIS B CG  1 
ATOM   6307 N  ND1 . HIS B 1 298 ? -3.453  -7.806  14.581  1.00 12.57  ? 299 HIS B ND1 1 
ATOM   6308 C  CD2 . HIS B 1 298 ? -5.243  -8.278  15.745  1.00 12.12  ? 299 HIS B CD2 1 
ATOM   6309 C  CE1 . HIS B 1 298 ? -3.979  -8.901  14.064  1.00 11.78  ? 299 HIS B CE1 1 
ATOM   6310 N  NE2 . HIS B 1 298 ? -5.071  -9.201  14.741  1.00 12.37  ? 299 HIS B NE2 1 
ATOM   6311 N  N   . LEU B 1 299 ? -6.418  -5.423  18.082  1.00 13.42  ? 300 LEU B N   1 
ATOM   6312 C  CA  . LEU B 1 299 ? -7.727  -5.662  18.689  1.00 13.99  ? 300 LEU B CA  1 
ATOM   6313 C  C   . LEU B 1 299 ? -8.756  -4.684  18.152  1.00 13.99  ? 300 LEU B C   1 
ATOM   6314 O  O   . LEU B 1 299 ? -9.883  -5.070  17.827  1.00 14.18  ? 300 LEU B O   1 
ATOM   6315 C  CB  . LEU B 1 299 ? -7.658  -5.590  20.211  1.00 14.03  ? 300 LEU B CB  1 
ATOM   6316 C  CG  . LEU B 1 299 ? -6.879  -6.731  20.876  1.00 15.42  ? 300 LEU B CG  1 
ATOM   6317 C  CD1 . LEU B 1 299 ? -6.630  -6.411  22.346  1.00 15.61  ? 300 LEU B CD1 1 
ATOM   6318 C  CD2 . LEU B 1 299 ? -7.617  -8.078  20.710  1.00 16.64  ? 300 LEU B CD2 1 
ATOM   6319 N  N   . TYR B 1 300 ? -8.348  -3.425  18.042  1.00 13.89  ? 301 TYR B N   1 
ATOM   6320 C  CA  . TYR B 1 300 ? -9.210  -2.379  17.530  1.00 14.32  ? 301 TYR B CA  1 
ATOM   6321 C  C   . TYR B 1 300 ? -9.658  -2.648  16.081  1.00 14.48  ? 301 TYR B C   1 
ATOM   6322 O  O   . TYR B 1 300 ? -10.847 -2.541  15.775  1.00 14.14  ? 301 TYR B O   1 
ATOM   6323 C  CB  . TYR B 1 300 ? -8.519  -1.023  17.650  1.00 14.49  ? 301 TYR B CB  1 
ATOM   6324 C  CG  . TYR B 1 300 ? -9.195  0.095   16.886  1.00 14.56  ? 301 TYR B CG  1 
ATOM   6325 C  CD1 . TYR B 1 300 ? -10.245 0.811   17.450  1.00 15.49  ? 301 TYR B CD1 1 
ATOM   6326 C  CD2 . TYR B 1 300 ? -8.768  0.447   15.616  1.00 15.08  ? 301 TYR B CD2 1 
ATOM   6327 C  CE1 . TYR B 1 300 ? -10.868 1.841   16.756  1.00 16.15  ? 301 TYR B CE1 1 
ATOM   6328 C  CE2 . TYR B 1 300 ? -9.379  1.481   14.914  1.00 16.33  ? 301 TYR B CE2 1 
ATOM   6329 C  CZ  . TYR B 1 300 ? -10.428 2.169   15.491  1.00 16.20  ? 301 TYR B CZ  1 
ATOM   6330 O  OH  . TYR B 1 300 ? -11.036 3.191   14.807  1.00 18.09  ? 301 TYR B OH  1 
ATOM   6331 N  N   . GLU B 1 301 ? -8.716  -3.009  15.212  1.00 14.51  ? 302 GLU B N   1 
ATOM   6332 C  CA  . GLU B 1 301 ? -9.028  -3.276  13.798  1.00 15.00  ? 302 GLU B CA  1 
ATOM   6333 C  C   . GLU B 1 301 ? -9.903  -4.532  13.630  1.00 15.46  ? 302 GLU B C   1 
ATOM   6334 O  O   . GLU B 1 301 ? -10.768 -4.587  12.743  1.00 15.71  ? 302 GLU B O   1 
ATOM   6335 C  CB  . GLU B 1 301 ? -7.751  -3.392  12.955  1.00 14.73  ? 302 GLU B CB  1 
ATOM   6336 C  CG  . GLU B 1 301 ? -6.911  -2.096  12.840  1.00 15.47  ? 302 GLU B CG  1 
ATOM   6337 C  CD  . GLU B 1 301 ? -7.655  -0.948  12.159  1.00 16.43  ? 302 GLU B CD  1 
ATOM   6338 O  OE1 . GLU B 1 301 ? -8.708  -1.186  11.533  1.00 16.69  ? 302 GLU B OE1 1 
ATOM   6339 O  OE2 . GLU B 1 301 ? -7.186  0.206   12.250  1.00 16.98  ? 302 GLU B OE2 1 
ATOM   6340 N  N   . MET B 1 302 ? -9.693  -5.528  14.489  1.00 15.60  ? 303 MET B N   1 
ATOM   6341 C  CA  . MET B 1 302 ? -10.555 -6.715  14.492  1.00 16.16  ? 303 MET B CA  1 
ATOM   6342 C  C   . MET B 1 302 ? -11.993 -6.383  14.897  1.00 16.54  ? 303 MET B C   1 
ATOM   6343 O  O   . MET B 1 302 ? -12.944 -6.899  14.301  1.00 16.45  ? 303 MET B O   1 
ATOM   6344 C  CB  . MET B 1 302 ? -9.986  -7.819  15.381  1.00 15.93  ? 303 MET B CB  1 
ATOM   6345 C  CG  . MET B 1 302 ? -8.769  -8.498  14.801  1.00 16.05  ? 303 MET B CG  1 
ATOM   6346 S  SD  . MET B 1 302 ? -8.544  -10.165 15.460  1.00 19.57  ? 303 MET B SD  1 
ATOM   6347 C  CE  . MET B 1 302 ? -8.051  -9.850  17.159  1.00 17.46  ? 303 MET B CE  1 
ATOM   6348 N  N   . ALA B 1 303 ? -12.146 -5.522  15.904  1.00 16.61  ? 304 ALA B N   1 
ATOM   6349 C  CA  . ALA B 1 303 ? -13.467 -5.120  16.375  1.00 17.26  ? 304 ALA B CA  1 
ATOM   6350 C  C   . ALA B 1 303 ? -14.166 -4.238  15.350  1.00 18.00  ? 304 ALA B C   1 
ATOM   6351 O  O   . ALA B 1 303 ? -15.396 -4.195  15.285  1.00 18.25  ? 304 ALA B O   1 
ATOM   6352 C  CB  . ALA B 1 303 ? -13.360 -4.387  17.709  1.00 16.80  ? 304 ALA B CB  1 
ATOM   6353 N  N   . ARG B 1 304 ? -13.365 -3.525  14.568  1.00 18.96  ? 305 ARG B N   1 
ATOM   6354 C  CA  . ARG B 1 304 ? -13.857 -2.605  13.551  1.00 19.98  ? 305 ARG B CA  1 
ATOM   6355 C  C   . ARG B 1 304 ? -14.232 -3.354  12.257  1.00 20.11  ? 305 ARG B C   1 
ATOM   6356 O  O   . ARG B 1 304 ? -15.060 -2.891  11.482  1.00 19.84  ? 305 ARG B O   1 
ATOM   6357 C  CB  . ARG B 1 304 ? -12.778 -1.557  13.280  1.00 20.08  ? 305 ARG B CB  1 
ATOM   6358 C  CG  . ARG B 1 304 ? -13.261 -0.262  12.627  1.00 22.97  ? 305 ARG B CG  1 
ATOM   6359 C  CD  . ARG B 1 304 ? -12.075 0.682   12.377  1.00 26.44  ? 305 ARG B CD  1 
ATOM   6360 N  NE  . ARG B 1 304 ? -12.202 1.332   11.080  1.00 30.75  ? 305 ARG B NE  1 
ATOM   6361 C  CZ  . ARG B 1 304 ? -11.430 1.104   10.019  1.00 31.85  ? 305 ARG B CZ  1 
ATOM   6362 N  NH1 . ARG B 1 304 ? -10.411 0.257   10.071  1.00 31.78  ? 305 ARG B NH1 1 
ATOM   6363 N  NH2 . ARG B 1 304 ? -11.672 1.760   8.893   1.00 33.11  ? 305 ARG B NH2 1 
ATOM   6364 N  N   . ASN B 1 305 ? -13.606 -4.506  12.034  1.00 20.60  ? 306 ASN B N   1 
ATOM   6365 C  CA  . ASN B 1 305 ? -13.905 -5.346  10.879  1.00 20.97  ? 306 ASN B CA  1 
ATOM   6366 C  C   . ASN B 1 305 ? -14.205 -6.784  11.315  1.00 20.80  ? 306 ASN B C   1 
ATOM   6367 O  O   . ASN B 1 305 ? -13.340 -7.662  11.270  1.00 20.33  ? 306 ASN B O   1 
ATOM   6368 C  CB  . ASN B 1 305 ? -12.754 -5.296  9.877   1.00 21.08  ? 306 ASN B CB  1 
ATOM   6369 C  CG  . ASN B 1 305 ? -13.139 -5.849  8.512   1.00 23.12  ? 306 ASN B CG  1 
ATOM   6370 O  OD1 . ASN B 1 305 ? -13.912 -6.810  8.407   1.00 24.28  ? 306 ASN B OD1 1 
ATOM   6371 N  ND2 . ASN B 1 305 ? -12.595 -5.241  7.451   1.00 24.10  ? 306 ASN B ND2 1 
ATOM   6372 N  N   . LEU B 1 306 ? -15.447 -7.012  11.731  1.00 21.08  ? 307 LEU B N   1 
ATOM   6373 C  CA  . LEU B 1 306 ? -15.858 -8.303  12.293  1.00 21.68  ? 307 LEU B CA  1 
ATOM   6374 C  C   . LEU B 1 306 ? -15.715 -9.464  11.305  1.00 21.69  ? 307 LEU B C   1 
ATOM   6375 O  O   . LEU B 1 306 ? -15.491 -10.600 11.713  1.00 21.84  ? 307 LEU B O   1 
ATOM   6376 C  CB  . LEU B 1 306 ? -17.291 -8.231  12.834  1.00 21.71  ? 307 LEU B CB  1 
ATOM   6377 C  CG  . LEU B 1 306 ? -17.599 -7.150  13.877  1.00 22.65  ? 307 LEU B CG  1 
ATOM   6378 C  CD1 . LEU B 1 306 ? -19.104 -7.070  14.145  1.00 23.91  ? 307 LEU B CD1 1 
ATOM   6379 C  CD2 . LEU B 1 306 ? -16.841 -7.387  15.181  1.00 22.95  ? 307 LEU B CD2 1 
ATOM   6380 N  N   . LYS B 1 307 ? -15.819 -9.173  10.012  1.00 21.75  ? 308 LYS B N   1 
ATOM   6381 C  CA  . LYS B 1 307 ? -15.612 -10.188 8.983   1.00 21.94  ? 308 LYS B CA  1 
ATOM   6382 C  C   . LYS B 1 307 ? -14.168 -10.693 9.021   1.00 20.99  ? 308 LYS B C   1 
ATOM   6383 O  O   . LYS B 1 307 ? -13.928 -11.905 8.969   1.00 20.52  ? 308 LYS B O   1 
ATOM   6384 C  CB  . LYS B 1 307 ? -15.977 -9.644  7.595   1.00 22.45  ? 308 LYS B CB  1 
ATOM   6385 C  CG  . LYS B 1 307 ? -16.024 -10.709 6.504   1.00 25.70  ? 308 LYS B CG  1 
ATOM   6386 C  CD  . LYS B 1 307 ? -16.306 -10.124 5.114   1.00 29.65  ? 308 LYS B CD  1 
ATOM   6387 C  CE  . LYS B 1 307 ? -16.297 -11.232 4.051   1.00 32.48  ? 308 LYS B CE  1 
ATOM   6388 N  NZ  . LYS B 1 307 ? -16.738 -10.755 2.697   1.00 34.18  ? 308 LYS B NZ  1 
ATOM   6389 N  N   . VAL B 1 308 ? -13.216 -9.765  9.135   1.00 20.25  ? 309 VAL B N   1 
ATOM   6390 C  CA  . VAL B 1 308 ? -11.806 -10.131 9.269   1.00 19.67  ? 309 VAL B CA  1 
ATOM   6391 C  C   . VAL B 1 308 ? -11.558 -10.888 10.582  1.00 19.45  ? 309 VAL B C   1 
ATOM   6392 O  O   . VAL B 1 308 ? -10.844 -11.892 10.588  1.00 19.73  ? 309 VAL B O   1 
ATOM   6393 C  CB  . VAL B 1 308 ? -10.854 -8.913  9.078   1.00 19.76  ? 309 VAL B CB  1 
ATOM   6394 C  CG1 . VAL B 1 308 ? -9.434  -9.209  9.583   1.00 19.53  ? 309 VAL B CG1 1 
ATOM   6395 C  CG2 . VAL B 1 308 ? -10.799 -8.524  7.608   1.00 19.87  ? 309 VAL B CG2 1 
ATOM   6396 N  N   . GLN B 1 309 ? -12.170 -10.436 11.675  1.00 19.02  ? 310 GLN B N   1 
ATOM   6397 C  CA  . GLN B 1 309 ? -12.048 -11.137 12.960  1.00 19.10  ? 310 GLN B CA  1 
ATOM   6398 C  C   . GLN B 1 309 ? -12.504 -12.603 12.868  1.00 19.36  ? 310 GLN B C   1 
ATOM   6399 O  O   . GLN B 1 309 ? -11.812 -13.501 13.359  1.00 19.19  ? 310 GLN B O   1 
ATOM   6400 C  CB  . GLN B 1 309 ? -12.800 -10.397 14.077  1.00 18.56  ? 310 GLN B CB  1 
ATOM   6401 C  CG  . GLN B 1 309 ? -12.535 -10.952 15.469  1.00 17.16  ? 310 GLN B CG  1 
ATOM   6402 C  CD  . GLN B 1 309 ? -13.281 -10.211 16.564  1.00 15.74  ? 310 GLN B CD  1 
ATOM   6403 O  OE1 . GLN B 1 309 ? -13.624 -9.031  16.431  1.00 16.87  ? 310 GLN B OE1 1 
ATOM   6404 N  NE2 . GLN B 1 309 ? -13.535 -10.899 17.653  1.00 13.59  ? 310 GLN B NE2 1 
ATOM   6405 N  N   . ASP B 1 310 ? -13.656 -12.839 12.233  1.00 19.78  ? 311 ASP B N   1 
ATOM   6406 C  CA  . ASP B 1 310 ? -14.159 -14.204 12.007  1.00 20.27  ? 311 ASP B CA  1 
ATOM   6407 C  C   . ASP B 1 310 ? -13.163 -15.048 11.211  1.00 20.32  ? 311 ASP B C   1 
ATOM   6408 O  O   . ASP B 1 310 ? -12.899 -16.200 11.551  1.00 20.47  ? 311 ASP B O   1 
ATOM   6409 C  CB  . ASP B 1 310 ? -15.509 -14.190 11.273  1.00 20.57  ? 311 ASP B CB  1 
ATOM   6410 C  CG  . ASP B 1 310 ? -16.654 -13.650 12.129  1.00 21.54  ? 311 ASP B CG  1 
ATOM   6411 O  OD1 . ASP B 1 310 ? -16.601 -13.757 13.381  1.00 23.47  ? 311 ASP B OD1 1 
ATOM   6412 O  OD2 . ASP B 1 310 ? -17.625 -13.124 11.538  1.00 22.33  ? 311 ASP B OD2 1 
ATOM   6413 N  N   . MET B 1 311 ? -12.604 -14.467 10.157  1.00 20.59  ? 312 MET B N   1 
ATOM   6414 C  CA  . MET B 1 311 ? -11.601 -15.161 9.348   1.00 21.26  ? 312 MET B CA  1 
ATOM   6415 C  C   . MET B 1 311 ? -10.395 -15.588 10.177  1.00 20.63  ? 312 MET B C   1 
ATOM   6416 O  O   . MET B 1 311 ? -9.912  -16.719 10.049  1.00 21.05  ? 312 MET B O   1 
ATOM   6417 C  CB  . MET B 1 311 ? -11.138 -14.287 8.182   1.00 21.67  ? 312 MET B CB  1 
ATOM   6418 C  CG  . MET B 1 311 ? -12.048 -14.302 6.967   1.00 25.13  ? 312 MET B CG  1 
ATOM   6419 S  SD  . MET B 1 311 ? -11.539 -13.037 5.773   1.00 33.73  ? 312 MET B SD  1 
ATOM   6420 C  CE  . MET B 1 311 ? -9.949  -13.686 5.219   1.00 29.51  ? 312 MET B CE  1 
ATOM   6421 N  N   . LEU B 1 312 ? -9.915  -14.690 11.033  1.00 19.58  ? 313 LEU B N   1 
ATOM   6422 C  CA  . LEU B 1 312 ? -8.723  -14.981 11.818  1.00 18.71  ? 313 LEU B CA  1 
ATOM   6423 C  C   . LEU B 1 312 ? -8.998  -16.047 12.875  1.00 18.47  ? 313 LEU B C   1 
ATOM   6424 O  O   . LEU B 1 312 ? -8.167  -16.930 13.096  1.00 17.99  ? 313 LEU B O   1 
ATOM   6425 C  CB  . LEU B 1 312 ? -8.132  -13.700 12.434  1.00 18.26  ? 313 LEU B CB  1 
ATOM   6426 C  CG  . LEU B 1 312 ? -7.596  -12.638 11.450  1.00 17.77  ? 313 LEU B CG  1 
ATOM   6427 C  CD1 . LEU B 1 312 ? -7.308  -11.322 12.148  1.00 15.66  ? 313 LEU B CD1 1 
ATOM   6428 C  CD2 . LEU B 1 312 ? -6.355  -13.109 10.700  1.00 15.89  ? 313 LEU B CD2 1 
ATOM   6429 N  N   . ARG B 1 313 ? -10.158 -15.966 13.526  1.00 18.31  ? 314 ARG B N   1 
ATOM   6430 C  CA  . ARG B 1 313 ? -10.527 -16.981 14.509  1.00 18.45  ? 314 ARG B CA  1 
ATOM   6431 C  C   . ARG B 1 313 ? -10.608 -18.350 13.838  1.00 18.53  ? 314 ARG B C   1 
ATOM   6432 O  O   . ARG B 1 313 ? -10.023 -19.314 14.339  1.00 18.12  ? 314 ARG B O   1 
ATOM   6433 C  CB  . ARG B 1 313 ? -11.849 -16.649 15.211  1.00 18.49  ? 314 ARG B CB  1 
ATOM   6434 C  CG  . ARG B 1 313 ? -12.239 -17.650 16.294  1.00 18.15  ? 314 ARG B CG  1 
ATOM   6435 C  CD  . ARG B 1 313 ? -13.411 -17.172 17.148  1.00 19.74  ? 314 ARG B CD  1 
ATOM   6436 N  NE  . ARG B 1 313 ? -13.067 -15.927 17.831  1.00 21.70  ? 314 ARG B NE  1 
ATOM   6437 C  CZ  . ARG B 1 313 ? -13.500 -14.717 17.473  1.00 22.48  ? 314 ARG B CZ  1 
ATOM   6438 N  NH1 . ARG B 1 313 ? -14.346 -14.562 16.451  1.00 20.57  ? 314 ARG B NH1 1 
ATOM   6439 N  NH2 . ARG B 1 313 ? -13.088 -13.655 18.155  1.00 20.84  ? 314 ARG B NH2 1 
ATOM   6440 N  N   . ALA B 1 314 ? -11.310 -18.429 12.703  1.00 18.75  ? 315 ALA B N   1 
ATOM   6441 C  CA  . ALA B 1 314 ? -11.456 -19.707 11.988  1.00 19.12  ? 315 ALA B CA  1 
ATOM   6442 C  C   . ALA B 1 314 ? -10.094 -20.286 11.617  1.00 19.57  ? 315 ALA B C   1 
ATOM   6443 O  O   . ALA B 1 314 ? -9.879  -21.499 11.732  1.00 19.57  ? 315 ALA B O   1 
ATOM   6444 C  CB  . ALA B 1 314 ? -12.339 -19.553 10.744  1.00 18.86  ? 315 ALA B CB  1 
ATOM   6445 N  N   . GLU B 1 315 ? -9.166  -19.424 11.195  1.00 19.81  ? 316 GLU B N   1 
ATOM   6446 C  CA  . GLU B 1 315 ? -7.812  -19.886 10.877  1.00 20.52  ? 316 GLU B CA  1 
ATOM   6447 C  C   . GLU B 1 315 ? -7.078  -20.436 12.101  1.00 20.76  ? 316 GLU B C   1 
ATOM   6448 O  O   . GLU B 1 315 ? -6.373  -21.441 11.997  1.00 20.86  ? 316 GLU B O   1 
ATOM   6449 C  CB  . GLU B 1 315 ? -6.973  -18.798 10.218  1.00 20.62  ? 316 GLU B CB  1 
ATOM   6450 C  CG  . GLU B 1 315 ? -5.633  -19.323 9.704   1.00 22.52  ? 316 GLU B CG  1 
ATOM   6451 C  CD  . GLU B 1 315 ? -4.700  -18.228 9.222   1.00 25.63  ? 316 GLU B CD  1 
ATOM   6452 O  OE1 . GLU B 1 315 ? -4.328  -17.349 10.039  1.00 27.64  ? 316 GLU B OE1 1 
ATOM   6453 O  OE2 . GLU B 1 315 ? -4.326  -18.253 8.028   1.00 25.10  ? 316 GLU B OE2 1 
ATOM   6454 N  N   . VAL B 1 316 ? -7.255  -19.777 13.246  1.00 20.86  ? 317 VAL B N   1 
ATOM   6455 C  CA  . VAL B 1 316 ? -6.609  -20.178 14.494  1.00 21.37  ? 317 VAL B CA  1 
ATOM   6456 C  C   . VAL B 1 316 ? -7.159  -21.509 15.023  1.00 21.51  ? 317 VAL B C   1 
ATOM   6457 O  O   . VAL B 1 316 ? -6.386  -22.398 15.392  1.00 21.10  ? 317 VAL B O   1 
ATOM   6458 C  CB  . VAL B 1 316 ? -6.727  -19.073 15.585  1.00 21.52  ? 317 VAL B CB  1 
ATOM   6459 C  CG1 . VAL B 1 316 ? -6.241  -19.587 16.931  1.00 21.69  ? 317 VAL B CG1 1 
ATOM   6460 C  CG2 . VAL B 1 316 ? -5.933  -17.841 15.185  1.00 21.26  ? 317 VAL B CG2 1 
ATOM   6461 N  N   . LEU B 1 317 ? -8.487  -21.633 15.056  1.00 21.71  ? 318 LEU B N   1 
ATOM   6462 C  CA  . LEU B 1 317 ? -9.141  -22.887 15.449  1.00 22.40  ? 318 LEU B CA  1 
ATOM   6463 C  C   . LEU B 1 317 ? -8.665  -24.076 14.601  1.00 22.62  ? 318 LEU B C   1 
ATOM   6464 O  O   . LEU B 1 317 ? -8.358  -25.143 15.141  1.00 22.47  ? 318 LEU B O   1 
ATOM   6465 C  CB  . LEU B 1 317 ? -10.664 -22.755 15.390  1.00 22.47  ? 318 LEU B CB  1 
ATOM   6466 C  CG  . LEU B 1 317 ? -11.335 -21.791 16.381  1.00 24.18  ? 318 LEU B CG  1 
ATOM   6467 C  CD1 . LEU B 1 317 ? -12.867 -21.763 16.162  1.00 24.68  ? 318 LEU B CD1 1 
ATOM   6468 C  CD2 . LEU B 1 317 ? -11.004 -22.140 17.830  1.00 23.63  ? 318 LEU B CD2 1 
ATOM   6469 N  N   . ALA B 1 318 ? -8.566  -23.869 13.287  1.00 22.87  ? 319 ALA B N   1 
ATOM   6470 C  CA  . ALA B 1 318 ? -8.104  -24.911 12.370  1.00 23.67  ? 319 ALA B CA  1 
ATOM   6471 C  C   . ALA B 1 318 ? -6.657  -25.271 12.662  1.00 24.14  ? 319 ALA B C   1 
ATOM   6472 O  O   . ALA B 1 318 ? -6.298  -26.451 12.666  1.00 24.09  ? 319 ALA B O   1 
ATOM   6473 C  CB  . ALA B 1 318 ? -8.271  -24.478 10.911  1.00 23.22  ? 319 ALA B CB  1 
ATOM   6474 N  N   . ALA B 1 319 ? -5.845  -24.249 12.933  1.00 24.64  ? 320 ALA B N   1 
ATOM   6475 C  CA  . ALA B 1 319 ? -4.427  -24.437 13.228  1.00 25.62  ? 320 ALA B CA  1 
ATOM   6476 C  C   . ALA B 1 319 ? -4.199  -25.217 14.525  1.00 26.29  ? 320 ALA B C   1 
ATOM   6477 O  O   . ALA B 1 319 ? -3.377  -26.133 14.548  1.00 26.58  ? 320 ALA B O   1 
ATOM   6478 C  CB  . ALA B 1 319 ? -3.697  -23.097 13.264  1.00 25.37  ? 320 ALA B CB  1 
ATOM   6479 N  N   . ARG B 1 320 ? -4.917  -24.857 15.590  1.00 27.19  ? 321 ARG B N   1 
ATOM   6480 C  CA  . ARG B 1 320 ? -4.838  -25.578 16.868  1.00 28.34  ? 321 ARG B CA  1 
ATOM   6481 C  C   . ARG B 1 320 ? -5.211  -27.048 16.689  1.00 29.08  ? 321 ARG B C   1 
ATOM   6482 O  O   . ARG B 1 320 ? -4.552  -27.935 17.236  1.00 29.35  ? 321 ARG B O   1 
ATOM   6483 C  CB  . ARG B 1 320 ? -5.731  -24.924 17.935  1.00 27.97  ? 321 ARG B CB  1 
ATOM   6484 C  CG  . ARG B 1 320 ? -5.654  -25.565 19.333  1.00 27.66  ? 321 ARG B CG  1 
ATOM   6485 C  CD  . ARG B 1 320 ? -4.335  -25.264 20.052  1.00 27.62  ? 321 ARG B CD  1 
ATOM   6486 N  NE  . ARG B 1 320 ? -4.300  -23.922 20.640  1.00 26.05  ? 321 ARG B NE  1 
ATOM   6487 C  CZ  . ARG B 1 320 ? -3.350  -23.470 21.465  1.00 25.50  ? 321 ARG B CZ  1 
ATOM   6488 N  NH1 . ARG B 1 320 ? -2.320  -24.243 21.809  1.00 24.20  ? 321 ARG B NH1 1 
ATOM   6489 N  NH2 . ARG B 1 320 ? -3.429  -22.236 21.951  1.00 22.35  ? 321 ARG B NH2 1 
ATOM   6490 N  N   . HIS B 1 321 ? -6.261  -27.291 15.913  1.00 30.24  ? 322 HIS B N   1 
ATOM   6491 C  CA  . HIS B 1 321 ? -6.695  -28.648 15.596  1.00 31.50  ? 322 HIS B CA  1 
ATOM   6492 C  C   . HIS B 1 321 ? -5.676  -29.426 14.757  1.00 31.75  ? 322 HIS B C   1 
ATOM   6493 O  O   . HIS B 1 321 ? -5.362  -30.569 15.080  1.00 31.73  ? 322 HIS B O   1 
ATOM   6494 C  CB  . HIS B 1 321 ? -8.067  -28.645 14.911  1.00 31.69  ? 322 HIS B CB  1 
ATOM   6495 C  CG  . HIS B 1 321 ? -8.524  -30.006 14.479  1.00 33.88  ? 322 HIS B CG  1 
ATOM   6496 N  ND1 . HIS B 1 321 ? -8.431  -30.444 13.173  1.00 35.61  ? 322 HIS B ND1 1 
ATOM   6497 C  CD2 . HIS B 1 321 ? -9.053  -31.034 15.184  1.00 35.19  ? 322 HIS B CD2 1 
ATOM   6498 C  CE1 . HIS B 1 321 ? -8.901  -31.676 13.089  1.00 36.24  ? 322 HIS B CE1 1 
ATOM   6499 N  NE2 . HIS B 1 321 ? -9.281  -32.059 14.296  1.00 36.70  ? 322 HIS B NE2 1 
ATOM   6500 N  N   . GLN B 1 322 ? -5.165  -28.817 13.687  1.00 32.42  ? 323 GLN B N   1 
ATOM   6501 C  CA  . GLN B 1 322 ? -4.221  -29.514 12.804  1.00 33.30  ? 323 GLN B CA  1 
ATOM   6502 C  C   . GLN B 1 322 ? -2.873  -29.767 13.487  1.00 33.44  ? 323 GLN B C   1 
ATOM   6503 O  O   . GLN B 1 322 ? -2.178  -30.730 13.157  1.00 33.54  ? 323 GLN B O   1 
ATOM   6504 C  CB  . GLN B 1 322 ? -4.029  -28.763 11.486  1.00 33.43  ? 323 GLN B CB  1 
ATOM   6505 C  CG  . GLN B 1 322 ? -3.212  -29.538 10.451  1.00 36.27  ? 323 GLN B CG  1 
ATOM   6506 C  CD  . GLN B 1 322 ? -2.950  -28.748 9.181   1.00 40.20  ? 323 GLN B CD  1 
ATOM   6507 O  OE1 . GLN B 1 322 ? -3.812  -27.998 8.705   1.00 42.80  ? 323 GLN B OE1 1 
ATOM   6508 N  NE2 . GLN B 1 322 ? -1.753  -28.916 8.617   1.00 41.06  ? 323 GLN B NE2 1 
ATOM   6509 N  N   . ALA B 1 323 ? -2.521  -28.906 14.442  1.00 33.43  ? 324 ALA B N   1 
ATOM   6510 C  CA  . ALA B 1 323 ? -1.278  -29.041 15.197  1.00 33.49  ? 324 ALA B CA  1 
ATOM   6511 C  C   . ALA B 1 323 ? -1.465  -29.948 16.408  1.00 33.59  ? 324 ALA B C   1 
ATOM   6512 O  O   . ALA B 1 323 ? -0.530  -30.155 17.188  1.00 33.59  ? 324 ALA B O   1 
ATOM   6513 C  CB  . ALA B 1 323 ? -0.769  -27.667 15.636  1.00 33.53  ? 324 ALA B CB  1 
ATOM   6514 N  N   . GLN B 1 324 ? -2.678  -30.481 16.563  1.00 33.54  ? 325 GLN B N   1 
ATOM   6515 C  CA  . GLN B 1 324 ? -3.047  -31.289 17.724  1.00 33.51  ? 325 GLN B CA  1 
ATOM   6516 C  C   . GLN B 1 324 ? -2.612  -30.619 19.028  1.00 32.96  ? 325 GLN B C   1 
ATOM   6517 O  O   . GLN B 1 324 ? -2.158  -31.283 19.956  1.00 33.32  ? 325 GLN B O   1 
ATOM   6518 C  CB  . GLN B 1 324 ? -2.478  -32.716 17.599  1.00 33.87  ? 325 GLN B CB  1 
ATOM   6519 C  CG  . GLN B 1 324 ? -3.034  -33.489 16.400  1.00 35.68  ? 325 GLN B CG  1 
ATOM   6520 C  CD  . GLN B 1 324 ? -2.309  -34.806 16.127  1.00 38.36  ? 325 GLN B CD  1 
ATOM   6521 O  OE1 . GLN B 1 324 ? -1.852  -35.050 15.004  1.00 39.08  ? 325 GLN B OE1 1 
ATOM   6522 N  NE2 . GLN B 1 324 ? -2.209  -35.665 17.149  1.00 37.57  ? 325 GLN B NE2 1 
ATOM   6523 N  N   . GLY B 1 325 ? -2.736  -29.292 19.081  1.00 32.43  ? 326 GLY B N   1 
ATOM   6524 C  CA  . GLY B 1 325 ? -2.429  -28.527 20.288  1.00 30.99  ? 326 GLY B CA  1 
ATOM   6525 C  C   . GLY B 1 325 ? -1.045  -27.887 20.382  1.00 30.26  ? 326 GLY B C   1 
ATOM   6526 O  O   . GLY B 1 325 ? -0.861  -26.956 21.175  1.00 30.11  ? 326 GLY B O   1 
ATOM   6527 N  N   . ASP B 1 326 ? -0.075  -28.370 19.596  1.00 28.91  ? 327 ASP B N   1 
ATOM   6528 C  CA  . ASP B 1 326 ? 1.322   -27.877 19.678  1.00 28.18  ? 327 ASP B CA  1 
ATOM   6529 C  C   . ASP B 1 326 ? 1.484   -26.421 19.197  1.00 27.11  ? 327 ASP B C   1 
ATOM   6530 O  O   . ASP B 1 326 ? 1.117   -26.092 18.068  1.00 26.98  ? 327 ASP B O   1 
ATOM   6531 C  CB  . ASP B 1 326 ? 2.282   -28.794 18.897  1.00 28.36  ? 327 ASP B CB  1 
ATOM   6532 C  CG  . ASP B 1 326 ? 3.756   -28.442 19.124  1.00 29.13  ? 327 ASP B CG  1 
ATOM   6533 O  OD1 . ASP B 1 326 ? 4.210   -28.473 20.284  1.00 31.81  ? 327 ASP B OD1 1 
ATOM   6534 O  OD2 . ASP B 1 326 ? 4.472   -28.141 18.146  1.00 29.17  ? 327 ASP B OD2 1 
ATOM   6535 N  N   . MET B 1 327 ? 2.036   -25.563 20.053  1.00 25.90  ? 328 MET B N   1 
ATOM   6536 C  CA  . MET B 1 327 ? 2.164   -24.139 19.729  1.00 24.93  ? 328 MET B CA  1 
ATOM   6537 C  C   . MET B 1 327 ? 3.171   -23.900 18.605  1.00 24.29  ? 328 MET B C   1 
ATOM   6538 O  O   . MET B 1 327 ? 2.862   -23.188 17.661  1.00 23.95  ? 328 MET B O   1 
ATOM   6539 C  CB  . MET B 1 327 ? 2.487   -23.278 20.965  1.00 24.67  ? 328 MET B CB  1 
ATOM   6540 C  CG  . MET B 1 327 ? 2.693   -21.767 20.657  1.00 24.09  ? 328 MET B CG  1 
ATOM   6541 S  SD  . MET B 1 327 ? 1.297   -20.913 19.854  1.00 21.71  ? 328 MET B SD  1 
ATOM   6542 C  CE  . MET B 1 327 ? 0.085   -20.881 21.181  1.00 20.19  ? 328 MET B CE  1 
ATOM   6543 N  N   . ALA B 1 328 ? 4.353   -24.506 18.700  1.00 23.79  ? 329 ALA B N   1 
ATOM   6544 C  CA  . ALA B 1 328 ? 5.362   -24.407 17.636  1.00 23.67  ? 329 ALA B CA  1 
ATOM   6545 C  C   . ALA B 1 328 ? 4.780   -24.782 16.275  1.00 23.61  ? 329 ALA B C   1 
ATOM   6546 O  O   . ALA B 1 328 ? 4.994   -24.076 15.293  1.00 23.01  ? 329 ALA B O   1 
ATOM   6547 C  CB  . ALA B 1 328 ? 6.593   -25.272 17.955  1.00 23.40  ? 329 ALA B CB  1 
ATOM   6548 N  N   . THR B 1 329 ? 4.028   -25.885 16.233  1.00 23.74  ? 330 THR B N   1 
ATOM   6549 C  CA  . THR B 1 329 ? 3.368   -26.318 14.997  1.00 23.95  ? 330 THR B CA  1 
ATOM   6550 C  C   . THR B 1 329 ? 2.292   -25.313 14.525  1.00 23.96  ? 330 THR B C   1 
ATOM   6551 O  O   . THR B 1 329 ? 2.217   -25.010 13.339  1.00 23.70  ? 330 THR B O   1 
ATOM   6552 C  CB  . THR B 1 329 ? 2.790   -27.749 15.126  1.00 23.84  ? 330 THR B CB  1 
ATOM   6553 O  OG1 . THR B 1 329 ? 3.792   -28.623 15.666  1.00 24.20  ? 330 THR B OG1 1 
ATOM   6554 C  CG2 . THR B 1 329 ? 2.334   -28.286 13.761  1.00 23.54  ? 330 THR B CG2 1 
ATOM   6555 N  N   . MET B 1 330 ? 1.488   -24.797 15.457  1.00 24.30  ? 331 MET B N   1 
ATOM   6556 C  CA  . MET B 1 330 ? 0.430   -23.814 15.154  1.00 25.11  ? 331 MET B CA  1 
ATOM   6557 C  C   . MET B 1 330 ? 0.944   -22.589 14.422  1.00 25.13  ? 331 MET B C   1 
ATOM   6558 O  O   . MET B 1 330 ? 0.295   -22.095 13.500  1.00 25.02  ? 331 MET B O   1 
ATOM   6559 C  CB  . MET B 1 330 ? -0.215  -23.306 16.436  1.00 25.29  ? 331 MET B CB  1 
ATOM   6560 C  CG  . MET B 1 330 ? -1.364  -24.105 16.931  1.00 27.25  ? 331 MET B CG  1 
ATOM   6561 S  SD  . MET B 1 330 ? -2.223  -23.114 18.157  1.00 30.54  ? 331 MET B SD  1 
ATOM   6562 C  CE  . MET B 1 330 ? -3.308  -22.144 17.109  1.00 28.53  ? 331 MET B CE  1 
ATOM   6563 N  N   . LEU B 1 331 ? 2.100   -22.098 14.871  1.00 25.41  ? 332 LEU B N   1 
ATOM   6564 C  CA  . LEU B 1 331 ? 2.702   -20.866 14.372  1.00 25.90  ? 332 LEU B CA  1 
ATOM   6565 C  C   . LEU B 1 331 ? 3.113   -20.965 12.912  1.00 26.48  ? 332 LEU B C   1 
ATOM   6566 O  O   . LEU B 1 331 ? 3.361   -19.943 12.267  1.00 26.96  ? 332 LEU B O   1 
ATOM   6567 C  CB  . LEU B 1 331 ? 3.907   -20.469 15.234  1.00 25.61  ? 332 LEU B CB  1 
ATOM   6568 C  CG  . LEU B 1 331 ? 3.626   -20.007 16.668  1.00 25.59  ? 332 LEU B CG  1 
ATOM   6569 C  CD1 . LEU B 1 331 ? 4.929   -19.862 17.431  1.00 26.31  ? 332 LEU B CD1 1 
ATOM   6570 C  CD2 . LEU B 1 331 ? 2.843   -18.701 16.695  1.00 24.11  ? 332 LEU B CD2 1 
ATOM   6571 N  N   . GLN B 1 332 ? 3.195   -22.194 12.401  1.00 26.73  ? 333 GLN B N   1 
ATOM   6572 C  CA  . GLN B 1 332 ? 3.463   -22.425 10.983  1.00 27.26  ? 333 GLN B CA  1 
ATOM   6573 C  C   . GLN B 1 332 ? 2.176   -22.575 10.165  1.00 26.46  ? 333 GLN B C   1 
ATOM   6574 O  O   . GLN B 1 332 ? 2.222   -22.761 8.949   1.00 26.30  ? 333 GLN B O   1 
ATOM   6575 C  CB  . GLN B 1 332 ? 4.391   -23.632 10.790  1.00 27.65  ? 333 GLN B CB  1 
ATOM   6576 C  CG  . GLN B 1 332 ? 5.840   -23.372 11.248  1.00 30.62  ? 333 GLN B CG  1 
ATOM   6577 C  CD  . GLN B 1 332 ? 6.534   -22.259 10.450  1.00 34.87  ? 333 GLN B CD  1 
ATOM   6578 O  OE1 . GLN B 1 332 ? 6.945   -21.235 11.010  1.00 37.23  ? 333 GLN B OE1 1 
ATOM   6579 N  NE2 . GLN B 1 332 ? 6.663   -22.459 9.137   1.00 36.34  ? 333 GLN B NE2 1 
ATOM   6580 N  N   . LEU B 1 333 ? 1.031   -22.471 10.833  1.00 25.73  ? 334 LEU B N   1 
ATOM   6581 C  CA  . LEU B 1 333 ? -0.255  -22.731 10.181  1.00 25.04  ? 334 LEU B CA  1 
ATOM   6582 C  C   . LEU B 1 333 ? -1.219  -21.554 10.239  1.00 24.61  ? 334 LEU B C   1 
ATOM   6583 O  O   . LEU B 1 333 ? -2.428  -21.720 10.044  1.00 24.57  ? 334 LEU B O   1 
ATOM   6584 C  CB  . LEU B 1 333 ? -0.913  -23.974 10.801  1.00 25.30  ? 334 LEU B CB  1 
ATOM   6585 C  CG  . LEU B 1 333 ? -0.153  -25.306 10.717  1.00 24.99  ? 334 LEU B CG  1 
ATOM   6586 C  CD1 . LEU B 1 333 ? -0.778  -26.307 11.661  1.00 25.75  ? 334 LEU B CD1 1 
ATOM   6587 C  CD2 . LEU B 1 333 ? -0.153  -25.838 9.287   1.00 25.02  ? 334 LEU B CD2 1 
ATOM   6588 N  N   . VAL B 1 334 ? -0.692  -20.360 10.487  1.00 23.92  ? 335 VAL B N   1 
ATOM   6589 C  CA  . VAL B 1 334 ? -1.551  -19.215 10.740  1.00 23.64  ? 335 VAL B CA  1 
ATOM   6590 C  C   . VAL B 1 334 ? -1.135  -17.983 9.883   1.00 23.52  ? 335 VAL B C   1 
ATOM   6591 O  O   . VAL B 1 334 ? -0.977  -16.872 10.401  1.00 23.60  ? 335 VAL B O   1 
ATOM   6592 C  CB  . VAL B 1 334 ? -1.685  -19.000 12.299  1.00 23.66  ? 335 VAL B CB  1 
ATOM   6593 C  CG1 . VAL B 1 334 ? -0.590  -18.083 12.886  1.00 22.48  ? 335 VAL B CG1 1 
ATOM   6594 C  CG2 . VAL B 1 334 ? -3.076  -18.557 12.671  1.00 25.32  ? 335 VAL B CG2 1 
ATOM   6595 N  N   . PRO B 1 335 ? -0.967  -18.190 8.549   1.00 23.31  ? 336 PRO B N   1 
ATOM   6596 C  CA  . PRO B 1 335 ? -0.436  -17.143 7.670   1.00 22.63  ? 336 PRO B CA  1 
ATOM   6597 C  C   . PRO B 1 335 ? -1.297  -15.881 7.593   1.00 22.08  ? 336 PRO B C   1 
ATOM   6598 O  O   . PRO B 1 335 ? -0.758  -14.793 7.427   1.00 21.46  ? 336 PRO B O   1 
ATOM   6599 C  CB  . PRO B 1 335 ? -0.351  -17.837 6.297   1.00 22.65  ? 336 PRO B CB  1 
ATOM   6600 C  CG  . PRO B 1 335 ? -1.315  -18.963 6.368   1.00 23.11  ? 336 PRO B CG  1 
ATOM   6601 C  CD  . PRO B 1 335 ? -1.277  -19.423 7.789   1.00 23.12  ? 336 PRO B CD  1 
ATOM   6602 N  N   . LEU B 1 336 ? -2.615  -16.017 7.712   1.00 21.88  ? 337 LEU B N   1 
ATOM   6603 C  CA  . LEU B 1 336 ? -3.481  -14.837 7.721   1.00 21.66  ? 337 LEU B CA  1 
ATOM   6604 C  C   . LEU B 1 336 ? -3.301  -14.002 9.000   1.00 21.23  ? 337 LEU B C   1 
ATOM   6605 O  O   . LEU B 1 336 ? -3.438  -12.781 8.952   1.00 21.35  ? 337 LEU B O   1 
ATOM   6606 C  CB  . LEU B 1 336 ? -4.952  -15.207 7.498   1.00 21.84  ? 337 LEU B CB  1 
ATOM   6607 C  CG  . LEU B 1 336 ? -5.980  -14.086 7.265   1.00 23.16  ? 337 LEU B CG  1 
ATOM   6608 C  CD1 . LEU B 1 336 ? -5.869  -13.497 5.861   1.00 24.09  ? 337 LEU B CD1 1 
ATOM   6609 C  CD2 . LEU B 1 336 ? -7.399  -14.594 7.510   1.00 24.10  ? 337 LEU B CD2 1 
ATOM   6610 N  N   . LEU B 1 337 ? -2.982  -14.650 10.125  1.00 20.50  ? 338 LEU B N   1 
ATOM   6611 C  CA  . LEU B 1 337 ? -2.740  -13.930 11.389  1.00 19.99  ? 338 LEU B CA  1 
ATOM   6612 C  C   . LEU B 1 337 ? -1.437  -13.137 11.299  1.00 19.39  ? 338 LEU B C   1 
ATOM   6613 O  O   . LEU B 1 337 ? -1.368  -11.997 11.741  1.00 19.04  ? 338 LEU B O   1 
ATOM   6614 C  CB  . LEU B 1 337 ? -2.662  -14.880 12.590  1.00 19.50  ? 338 LEU B CB  1 
ATOM   6615 C  CG  . LEU B 1 337 ? -3.397  -14.595 13.917  1.00 20.60  ? 338 LEU B CG  1 
ATOM   6616 C  CD1 . LEU B 1 337 ? -2.695  -15.302 15.102  1.00 18.36  ? 338 LEU B CD1 1 
ATOM   6617 C  CD2 . LEU B 1 337 ? -3.640  -13.120 14.249  1.00 16.83  ? 338 LEU B CD2 1 
ATOM   6618 N  N   . LYS B 1 338 ? -0.412  -13.761 10.729  1.00 18.87  ? 339 LYS B N   1 
ATOM   6619 C  CA  . LYS B 1 338 ? 0.878   -13.119 10.537  1.00 18.96  ? 339 LYS B CA  1 
ATOM   6620 C  C   . LYS B 1 338 ? 0.767   -11.915 9.608   1.00 18.40  ? 339 LYS B C   1 
ATOM   6621 O  O   . LYS B 1 338 ? 1.374   -10.870 9.866   1.00 18.02  ? 339 LYS B O   1 
ATOM   6622 C  CB  . LYS B 1 338 ? 1.921   -14.117 10.019  1.00 18.89  ? 339 LYS B CB  1 
ATOM   6623 C  CG  . LYS B 1 338 ? 2.305   -15.157 11.066  1.00 20.93  ? 339 LYS B CG  1 
ATOM   6624 C  CD  . LYS B 1 338 ? 3.487   -16.021 10.632  1.00 22.31  ? 339 LYS B CD  1 
ATOM   6625 C  CE  . LYS B 1 338 ? 3.946   -16.881 11.801  1.00 24.90  ? 339 LYS B CE  1 
ATOM   6626 N  NZ  . LYS B 1 338 ? 5.160   -17.689 11.477  1.00 27.10  ? 339 LYS B NZ  1 
ATOM   6627 N  N   . ALA B 1 339 ? -0.017  -12.067 8.544   1.00 17.61  ? 340 ALA B N   1 
ATOM   6628 C  CA  . ALA B 1 339 ? -0.309  -10.963 7.629   1.00 17.32  ? 340 ALA B CA  1 
ATOM   6629 C  C   . ALA B 1 339 ? -1.099  -9.845  8.322   1.00 16.79  ? 340 ALA B C   1 
ATOM   6630 O  O   . ALA B 1 339 ? -0.939  -8.674  7.985   1.00 17.03  ? 340 ALA B O   1 
ATOM   6631 C  CB  . ALA B 1 339 ? -1.065  -11.467 6.399   1.00 16.80  ? 340 ALA B CB  1 
ATOM   6632 N  N   . SER B 1 340 ? -1.936  -10.206 9.291   1.00 16.05  ? 341 SER B N   1 
ATOM   6633 C  CA  . SER B 1 340 ? -2.752  -9.224  10.000  1.00 15.83  ? 341 SER B CA  1 
ATOM   6634 C  C   . SER B 1 340 ? -1.886  -8.349  10.917  1.00 16.05  ? 341 SER B C   1 
ATOM   6635 O  O   . SER B 1 340 ? -2.248  -7.215  11.234  1.00 16.18  ? 341 SER B O   1 
ATOM   6636 C  CB  . SER B 1 340 ? -3.855  -9.912  10.800  1.00 15.50  ? 341 SER B CB  1 
ATOM   6637 O  OG  . SER B 1 340 ? -3.314  -10.632 11.892  1.00 14.98  ? 341 SER B OG  1 
ATOM   6638 N  N   . ILE B 1 341 ? -0.746  -8.890  11.335  1.00 15.75  ? 342 ILE B N   1 
ATOM   6639 C  CA  . ILE B 1 341 ? 0.233   -8.128  12.080  1.00 16.01  ? 342 ILE B CA  1 
ATOM   6640 C  C   . ILE B 1 341 ? 0.936   -7.126  11.151  1.00 16.03  ? 342 ILE B C   1 
ATOM   6641 O  O   . ILE B 1 341 ? 1.078   -5.953  11.499  1.00 15.74  ? 342 ILE B O   1 
ATOM   6642 C  CB  . ILE B 1 341 ? 1.225   -9.058  12.821  1.00 16.14  ? 342 ILE B CB  1 
ATOM   6643 C  CG1 . ILE B 1 341 ? 0.465   -9.854  13.887  1.00 16.84  ? 342 ILE B CG1 1 
ATOM   6644 C  CG2 . ILE B 1 341 ? 2.359   -8.261  13.466  1.00 15.74  ? 342 ILE B CG2 1 
ATOM   6645 C  CD1 . ILE B 1 341 ? 1.270   -10.937 14.557  1.00 18.24  ? 342 ILE B CD1 1 
ATOM   6646 N  N   . LYS B 1 342 ? 1.349   -7.586  9.968   1.00 16.05  ? 343 LYS B N   1 
ATOM   6647 C  CA  . LYS B 1 342 ? 1.916   -6.700  8.944   1.00 15.85  ? 343 LYS B CA  1 
ATOM   6648 C  C   . LYS B 1 342 ? 0.911   -5.603  8.621   1.00 15.45  ? 343 LYS B C   1 
ATOM   6649 O  O   . LYS B 1 342 ? 1.265   -4.416  8.565   1.00 15.68  ? 343 LYS B O   1 
ATOM   6650 C  CB  . LYS B 1 342 ? 2.251   -7.481  7.671   1.00 16.01  ? 343 LYS B CB  1 
ATOM   6651 C  CG  . LYS B 1 342 ? 3.297   -8.551  7.863   1.00 16.63  ? 343 LYS B CG  1 
ATOM   6652 C  CD  . LYS B 1 342 ? 3.518   -9.340  6.577   1.00 17.63  ? 343 LYS B CD  1 
ATOM   6653 C  CE  . LYS B 1 342 ? 4.429   -10.531 6.858   1.00 18.71  ? 343 LYS B CE  1 
ATOM   6654 N  NZ  . LYS B 1 342 ? 4.830   -11.252 5.603   1.00 21.02  ? 343 LYS B NZ  1 
ATOM   6655 N  N   . GLU B 1 343 ? -0.347  -6.002  8.447   1.00 14.50  ? 344 GLU B N   1 
ATOM   6656 C  CA  . GLU B 1 343 ? -1.438  -5.060  8.191   1.00 13.81  ? 344 GLU B CA  1 
ATOM   6657 C  C   . GLU B 1 343 ? -1.669  -4.061  9.329   1.00 13.69  ? 344 GLU B C   1 
ATOM   6658 O  O   . GLU B 1 343 ? -2.011  -2.903  9.072   1.00 13.64  ? 344 GLU B O   1 
ATOM   6659 C  CB  . GLU B 1 343 ? -2.735  -5.814  7.876   1.00 13.63  ? 344 GLU B CB  1 
ATOM   6660 C  CG  . GLU B 1 343 ? -3.893  -4.953  7.340   1.00 13.30  ? 344 GLU B CG  1 
ATOM   6661 C  CD  . GLU B 1 343 ? -3.639  -4.344  5.949   1.00 14.68  ? 344 GLU B CD  1 
ATOM   6662 O  OE1 . GLU B 1 343 ? -2.479  -4.348  5.469   1.00 13.90  ? 344 GLU B OE1 1 
ATOM   6663 O  OE2 . GLU B 1 343 ? -4.608  -3.834  5.345   1.00 14.60  ? 344 GLU B OE2 1 
ATOM   6664 N  N   . THR B 1 344 ? -1.513  -4.500  10.579  1.00 13.15  ? 345 THR B N   1 
ATOM   6665 C  CA  . THR B 1 344 ? -1.693  -3.582  11.701  1.00 13.23  ? 345 THR B CA  1 
ATOM   6666 C  C   . THR B 1 344 ? -0.566  -2.540  11.699  1.00 13.29  ? 345 THR B C   1 
ATOM   6667 O  O   . THR B 1 344 ? -0.807  -1.345  11.857  1.00 13.64  ? 345 THR B O   1 
ATOM   6668 C  CB  . THR B 1 344 ? -1.805  -4.322  13.061  1.00 13.53  ? 345 THR B CB  1 
ATOM   6669 O  OG1 . THR B 1 344 ? -2.940  -5.205  13.037  1.00 13.08  ? 345 THR B OG1 1 
ATOM   6670 C  CG2 . THR B 1 344 ? -1.973  -3.328  14.221  1.00 11.86  ? 345 THR B CG2 1 
ATOM   6671 N  N   . LEU B 1 345 ? 0.654   -2.998  11.462  1.00 13.51  ? 346 LEU B N   1 
ATOM   6672 C  CA  . LEU B 1 345 ? 1.810   -2.109  11.404  1.00 13.96  ? 346 LEU B CA  1 
ATOM   6673 C  C   . LEU B 1 345 ? 1.861   -1.180  10.178  1.00 14.17  ? 346 LEU B C   1 
ATOM   6674 O  O   . LEU B 1 345 ? 2.490   -0.116  10.228  1.00 14.32  ? 346 LEU B O   1 
ATOM   6675 C  CB  . LEU B 1 345 ? 3.088   -2.921  11.564  1.00 14.27  ? 346 LEU B CB  1 
ATOM   6676 C  CG  . LEU B 1 345 ? 3.327   -3.330  13.032  1.00 14.73  ? 346 LEU B CG  1 
ATOM   6677 C  CD1 . LEU B 1 345 ? 4.367   -4.417  13.129  1.00 13.06  ? 346 LEU B CD1 1 
ATOM   6678 C  CD2 . LEU B 1 345 ? 3.718   -2.102  13.904  1.00 15.42  ? 346 LEU B CD2 1 
ATOM   6679 N  N   . ARG B 1 346 ? 1.181   -1.555  9.094   1.00 14.26  ? 347 ARG B N   1 
ATOM   6680 C  CA  . ARG B 1 346 ? 1.050   -0.660  7.937   1.00 14.64  ? 347 ARG B CA  1 
ATOM   6681 C  C   . ARG B 1 346 ? 0.226   0.582   8.306   1.00 14.67  ? 347 ARG B C   1 
ATOM   6682 O  O   . ARG B 1 346 ? 0.632   1.714   8.032   1.00 14.68  ? 347 ARG B O   1 
ATOM   6683 C  CB  . ARG B 1 346 ? 0.409   -1.379  6.742   1.00 14.71  ? 347 ARG B CB  1 
ATOM   6684 C  CG  . ARG B 1 346 ? -0.124  -0.430  5.668   1.00 15.17  ? 347 ARG B CG  1 
ATOM   6685 C  CD  . ARG B 1 346 ? -0.891  -1.176  4.560   1.00 15.45  ? 347 ARG B CD  1 
ATOM   6686 N  NE  . ARG B 1 346 ? -2.262  -1.490  4.960   1.00 15.20  ? 347 ARG B NE  1 
ATOM   6687 C  CZ  . ARG B 1 346 ? -3.267  -0.616  4.960   1.00 15.44  ? 347 ARG B CZ  1 
ATOM   6688 N  NH1 . ARG B 1 346 ? -3.073  0.646   4.592   1.00 17.07  ? 347 ARG B NH1 1 
ATOM   6689 N  NH2 . ARG B 1 346 ? -4.471  -1.001  5.334   1.00 15.64  ? 347 ARG B NH2 1 
ATOM   6690 N  N   . LEU B 1 347 ? -0.927  0.352   8.922   1.00 14.53  ? 348 LEU B N   1 
ATOM   6691 C  CA  . LEU B 1 347 ? -1.817  1.419   9.330   1.00 15.15  ? 348 LEU B CA  1 
ATOM   6692 C  C   . LEU B 1 347 ? -1.333  2.150   10.569  1.00 15.18  ? 348 LEU B C   1 
ATOM   6693 O  O   . LEU B 1 347 ? -1.556  3.346   10.708  1.00 15.40  ? 348 LEU B O   1 
ATOM   6694 C  CB  . LEU B 1 347 ? -3.195  0.852   9.644   1.00 15.35  ? 348 LEU B CB  1 
ATOM   6695 C  CG  . LEU B 1 347 ? -4.165  0.608   8.494   1.00 16.72  ? 348 LEU B CG  1 
ATOM   6696 C  CD1 . LEU B 1 347 ? -5.379  -0.147  9.063   1.00 18.22  ? 348 LEU B CD1 1 
ATOM   6697 C  CD2 . LEU B 1 347 ? -4.588  1.928   7.868   1.00 15.87  ? 348 LEU B CD2 1 
ATOM   6698 N  N   . HIS B 1 348 ? -0.705  1.417   11.483  1.00 15.16  ? 349 HIS B N   1 
ATOM   6699 C  CA  . HIS B 1 348 ? -0.348  1.961   12.783  1.00 14.72  ? 349 HIS B CA  1 
ATOM   6700 C  C   . HIS B 1 348 ? 1.111   1.618   13.113  1.00 14.47  ? 349 HIS B C   1 
ATOM   6701 O  O   . HIS B 1 348 ? 1.376   0.816   14.018  1.00 14.38  ? 349 HIS B O   1 
ATOM   6702 C  CB  . HIS B 1 348 ? -1.275  1.404   13.875  1.00 14.59  ? 349 HIS B CB  1 
ATOM   6703 C  CG  . HIS B 1 348 ? -2.736  1.539   13.573  1.00 14.85  ? 349 HIS B CG  1 
ATOM   6704 N  ND1 . HIS B 1 348 ? -3.384  2.757   13.542  1.00 15.14  ? 349 HIS B ND1 1 
ATOM   6705 C  CD2 . HIS B 1 348 ? -3.683  0.602   13.320  1.00 13.84  ? 349 HIS B CD2 1 
ATOM   6706 C  CE1 . HIS B 1 348 ? -4.662  2.566   13.262  1.00 14.99  ? 349 HIS B CE1 1 
ATOM   6707 N  NE2 . HIS B 1 348 ? -4.869  1.267   13.122  1.00 14.75  ? 349 HIS B NE2 1 
ATOM   6708 N  N   . PRO B 1 349 ? 2.062   2.222   12.380  1.00 13.90  ? 350 PRO B N   1 
ATOM   6709 C  CA  . PRO B 1 349 ? 3.439   2.004   12.757  1.00 13.85  ? 350 PRO B CA  1 
ATOM   6710 C  C   . PRO B 1 349 ? 3.704   2.612   14.132  1.00 14.20  ? 350 PRO B C   1 
ATOM   6711 O  O   . PRO B 1 349 ? 3.066   3.597   14.517  1.00 14.06  ? 350 PRO B O   1 
ATOM   6712 C  CB  . PRO B 1 349 ? 4.229   2.779   11.686  1.00 14.00  ? 350 PRO B CB  1 
ATOM   6713 C  CG  . PRO B 1 349 ? 3.306   3.838   11.220  1.00 13.06  ? 350 PRO B CG  1 
ATOM   6714 C  CD  . PRO B 1 349 ? 1.924   3.266   11.341  1.00 13.73  ? 350 PRO B CD  1 
ATOM   6715 N  N   . ILE B 1 350 ? 4.627   2.014   14.868  1.00 14.41  ? 351 ILE B N   1 
ATOM   6716 C  CA  . ILE B 1 350 ? 5.104   2.622   16.100  1.00 15.50  ? 351 ILE B CA  1 
ATOM   6717 C  C   . ILE B 1 350 ? 6.008   3.834   15.760  1.00 15.06  ? 351 ILE B C   1 
ATOM   6718 O  O   . ILE B 1 350 ? 5.947   4.889   16.410  1.00 15.14  ? 351 ILE B O   1 
ATOM   6719 C  CB  . ILE B 1 350 ? 5.788   1.554   17.004  1.00 15.20  ? 351 ILE B CB  1 
ATOM   6720 C  CG1 . ILE B 1 350 ? 5.282   1.655   18.440  1.00 18.32  ? 351 ILE B CG1 1 
ATOM   6721 C  CG2 . ILE B 1 350 ? 7.297   1.679   16.989  1.00 17.10  ? 351 ILE B CG2 1 
ATOM   6722 C  CD1 . ILE B 1 350 ? 3.879   1.181   18.652  1.00 18.40  ? 351 ILE B CD1 1 
ATOM   6723 N  N   . SER B 1 351 ? 6.791   3.669   14.699  1.00 14.46  ? 352 SER B N   1 
ATOM   6724 C  CA  . SER B 1 351 ? 7.787   4.630   14.219  1.00 14.99  ? 352 SER B CA  1 
ATOM   6725 C  C   . SER B 1 351 ? 7.190   5.485   13.091  1.00 14.76  ? 352 SER B C   1 
ATOM   6726 O  O   . SER B 1 351 ? 6.801   4.929   12.056  1.00 14.09  ? 352 SER B O   1 
ATOM   6727 C  CB  . SER B 1 351 ? 8.954   3.812   13.643  1.00 14.87  ? 352 SER B CB  1 
ATOM   6728 O  OG  . SER B 1 351 ? 10.181  4.501   13.726  1.00 17.32  ? 352 SER B OG  1 
ATOM   6729 N  N   . VAL B 1 352 ? 7.106   6.813   13.262  1.00 14.75  ? 353 VAL B N   1 
ATOM   6730 C  CA  . VAL B 1 352 ? 6.529   7.661   12.201  1.00 14.86  ? 353 VAL B CA  1 
ATOM   6731 C  C   . VAL B 1 352 ? 7.320   7.520   10.916  1.00 14.79  ? 353 VAL B C   1 
ATOM   6732 O  O   . VAL B 1 352 ? 6.757   7.618   9.831   1.00 14.91  ? 353 VAL B O   1 
ATOM   6733 C  CB  . VAL B 1 352 ? 6.558   9.197   12.436  1.00 15.14  ? 353 VAL B CB  1 
ATOM   6734 C  CG1 . VAL B 1 352 ? 5.236   9.806   11.985  1.00 13.94  ? 353 VAL B CG1 1 
ATOM   6735 C  CG2 . VAL B 1 352 ? 6.914   9.587   13.828  1.00 16.70  ? 353 VAL B CG2 1 
ATOM   6736 N  N   . THR B 1 353 ? 8.633   7.352   11.056  1.00 14.47  ? 354 THR B N   1 
ATOM   6737 C  CA  . THR B 1 353 ? 9.529   7.234   9.928   1.00 14.40  ? 354 THR B CA  1 
ATOM   6738 C  C   . THR B 1 353 ? 10.607  6.203   10.241  1.00 14.82  ? 354 THR B C   1 
ATOM   6739 O  O   . THR B 1 353 ? 10.814  5.829   11.396  1.00 14.59  ? 354 THR B O   1 
ATOM   6740 C  CB  . THR B 1 353 ? 10.285  8.559   9.637   1.00 14.12  ? 354 THR B CB  1 
ATOM   6741 O  OG1 . THR B 1 353 ? 11.126  8.886   10.749  1.00 13.84  ? 354 THR B OG1 1 
ATOM   6742 C  CG2 . THR B 1 353 ? 9.341   9.725   9.354   1.00 14.83  ? 354 THR B CG2 1 
ATOM   6743 N  N   . LEU B 1 354 ? 11.302  5.770   9.191   1.00 15.13  ? 355 LEU B N   1 
ATOM   6744 C  CA  . LEU B 1 354 ? 12.605  5.144   9.325   1.00 15.36  ? 355 LEU B CA  1 
ATOM   6745 C  C   . LEU B 1 354 ? 13.601  6.177   8.812   1.00 15.23  ? 355 LEU B C   1 
ATOM   6746 O  O   . LEU B 1 354 ? 13.257  7.013   7.979   1.00 14.89  ? 355 LEU B O   1 
ATOM   6747 C  CB  . LEU B 1 354 ? 12.688  3.867   8.486   1.00 15.20  ? 355 LEU B CB  1 
ATOM   6748 C  CG  . LEU B 1 354 ? 11.642  2.765   8.676   1.00 16.25  ? 355 LEU B CG  1 
ATOM   6749 C  CD1 . LEU B 1 354 ? 11.884  1.637   7.661   1.00 16.34  ? 355 LEU B CD1 1 
ATOM   6750 C  CD2 . LEU B 1 354 ? 11.621  2.209   10.102  1.00 15.96  ? 355 LEU B CD2 1 
ATOM   6751 N  N   . GLN B 1 355 ? 14.825  6.142   9.312   1.00 15.27  ? 356 GLN B N   1 
ATOM   6752 C  CA  . GLN B 1 355 ? 15.824  7.101   8.845   1.00 15.54  ? 356 GLN B CA  1 
ATOM   6753 C  C   . GLN B 1 355 ? 17.160  6.406   8.657   1.00 15.90  ? 356 GLN B C   1 
ATOM   6754 O  O   . GLN B 1 355 ? 17.479  5.453   9.380   1.00 16.40  ? 356 GLN B O   1 
ATOM   6755 C  CB  . GLN B 1 355 ? 15.973  8.305   9.805   1.00 15.06  ? 356 GLN B CB  1 
ATOM   6756 C  CG  . GLN B 1 355 ? 14.748  8.634   10.677  1.00 14.10  ? 356 GLN B CG  1 
ATOM   6757 C  CD  . GLN B 1 355 ? 14.620  7.704   11.869  1.00 13.70  ? 356 GLN B CD  1 
ATOM   6758 O  OE1 . GLN B 1 355 ? 15.620  7.351   12.498  1.00 14.45  ? 356 GLN B OE1 1 
ATOM   6759 N  NE2 . GLN B 1 355 ? 13.389  7.290   12.181  1.00 10.57  ? 356 GLN B NE2 1 
ATOM   6760 N  N   . ARG B 1 356 ? 17.920  6.887   7.676   1.00 16.09  ? 357 ARG B N   1 
ATOM   6761 C  CA  . ARG B 1 356 ? 19.284  6.463   7.438   1.00 16.75  ? 357 ARG B CA  1 
ATOM   6762 C  C   . ARG B 1 356 ? 20.123  7.657   6.992   1.00 17.49  ? 357 ARG B C   1 
ATOM   6763 O  O   . ARG B 1 356 ? 19.650  8.492   6.218   1.00 17.46  ? 357 ARG B O   1 
ATOM   6764 C  CB  . ARG B 1 356 ? 19.337  5.363   6.362   1.00 16.85  ? 357 ARG B CB  1 
ATOM   6765 C  CG  . ARG B 1 356 ? 18.800  3.977   6.785   1.00 17.30  ? 357 ARG B CG  1 
ATOM   6766 C  CD  . ARG B 1 356 ? 19.528  3.436   8.013   1.00 16.17  ? 357 ARG B CD  1 
ATOM   6767 N  NE  . ARG B 1 356 ? 19.105  2.077   8.354   1.00 17.86  ? 357 ARG B NE  1 
ATOM   6768 C  CZ  . ARG B 1 356 ? 18.179  1.763   9.263   1.00 16.95  ? 357 ARG B CZ  1 
ATOM   6769 N  NH1 . ARG B 1 356 ? 17.524  2.707   9.930   1.00 14.73  ? 357 ARG B NH1 1 
ATOM   6770 N  NH2 . ARG B 1 356 ? 17.890  0.489   9.483   1.00 16.68  ? 357 ARG B NH2 1 
ATOM   6771 N  N   . TYR B 1 357 ? 21.351  7.753   7.496   1.00 18.02  ? 358 TYR B N   1 
ATOM   6772 C  CA  . TYR B 1 357 ? 22.320  8.680   6.946   1.00 19.49  ? 358 TYR B CA  1 
ATOM   6773 C  C   . TYR B 1 357 ? 22.989  7.999   5.765   1.00 20.99  ? 358 TYR B C   1 
ATOM   6774 O  O   . TYR B 1 357 ? 23.411  6.842   5.868   1.00 21.31  ? 358 TYR B O   1 
ATOM   6775 C  CB  . TYR B 1 357 ? 23.371  9.067   7.989   1.00 18.98  ? 358 TYR B CB  1 
ATOM   6776 C  CG  . TYR B 1 357 ? 22.850  10.007  9.055   1.00 18.50  ? 358 TYR B CG  1 
ATOM   6777 C  CD1 . TYR B 1 357 ? 22.318  9.508   10.248  1.00 16.65  ? 358 TYR B CD1 1 
ATOM   6778 C  CD2 . TYR B 1 357 ? 22.879  11.392  8.873   1.00 17.20  ? 358 TYR B CD2 1 
ATOM   6779 C  CE1 . TYR B 1 357 ? 21.843  10.353  11.237  1.00 15.97  ? 358 TYR B CE1 1 
ATOM   6780 C  CE2 . TYR B 1 357 ? 22.387  12.258  9.867   1.00 16.92  ? 358 TYR B CE2 1 
ATOM   6781 C  CZ  . TYR B 1 357 ? 21.871  11.722  11.045  1.00 16.61  ? 358 TYR B CZ  1 
ATOM   6782 O  OH  . TYR B 1 357 ? 21.387  12.545  12.043  1.00 16.66  ? 358 TYR B OH  1 
ATOM   6783 N  N   . LEU B 1 358 ? 23.075  8.706   4.643   1.00 22.45  ? 359 LEU B N   1 
ATOM   6784 C  CA  . LEU B 1 358 ? 23.733  8.171   3.456   1.00 23.98  ? 359 LEU B CA  1 
ATOM   6785 C  C   . LEU B 1 358 ? 25.229  8.051   3.687   1.00 25.13  ? 359 LEU B C   1 
ATOM   6786 O  O   . LEU B 1 358 ? 25.851  8.955   4.231   1.00 25.58  ? 359 LEU B O   1 
ATOM   6787 C  CB  . LEU B 1 358 ? 23.463  9.059   2.242   1.00 23.75  ? 359 LEU B CB  1 
ATOM   6788 C  CG  . LEU B 1 358 ? 22.024  9.190   1.748   1.00 23.47  ? 359 LEU B CG  1 
ATOM   6789 C  CD1 . LEU B 1 358 ? 21.977  10.120  0.543   1.00 22.68  ? 359 LEU B CD1 1 
ATOM   6790 C  CD2 . LEU B 1 358 ? 21.440  7.832   1.400   1.00 22.09  ? 359 LEU B CD2 1 
ATOM   6791 N  N   . VAL B 1 359 ? 25.797  6.920   3.291   1.00 26.83  ? 360 VAL B N   1 
ATOM   6792 C  CA  . VAL B 1 359 ? 27.250  6.720   3.358   1.00 28.27  ? 360 VAL B CA  1 
ATOM   6793 C  C   . VAL B 1 359 ? 27.905  7.270   2.080   1.00 28.86  ? 360 VAL B C   1 
ATOM   6794 O  O   . VAL B 1 359 ? 29.012  7.816   2.126   1.00 29.42  ? 360 VAL B O   1 
ATOM   6795 C  CB  . VAL B 1 359 ? 27.610  5.223   3.627   1.00 28.54  ? 360 VAL B CB  1 
ATOM   6796 C  CG1 . VAL B 1 359 ? 29.108  4.947   3.416   1.00 29.44  ? 360 VAL B CG1 1 
ATOM   6797 C  CG2 . VAL B 1 359 ? 27.205  4.832   5.049   1.00 28.54  ? 360 VAL B CG2 1 
ATOM   6798 N  N   . ASN B 1 360 ? 27.197  7.142   0.960   1.00 29.31  ? 361 ASN B N   1 
ATOM   6799 C  CA  . ASN B 1 360 ? 27.615  7.704   -0.318  1.00 30.37  ? 361 ASN B CA  1 
ATOM   6800 C  C   . ASN B 1 360 ? 26.514  8.563   -0.936  1.00 30.78  ? 361 ASN B C   1 
ATOM   6801 O  O   . ASN B 1 360 ? 25.340  8.440   -0.567  1.00 30.95  ? 361 ASN B O   1 
ATOM   6802 C  CB  . ASN B 1 360 ? 27.964  6.580   -1.305  1.00 30.74  ? 361 ASN B CB  1 
ATOM   6803 C  CG  . ASN B 1 360 ? 29.165  5.767   -0.870  1.00 31.55  ? 361 ASN B CG  1 
ATOM   6804 O  OD1 . ASN B 1 360 ? 30.209  6.319   -0.522  1.00 32.62  ? 361 ASN B OD1 1 
ATOM   6805 N  ND2 . ASN B 1 360 ? 29.025  4.442   -0.897  1.00 32.36  ? 361 ASN B ND2 1 
ATOM   6806 N  N   . ASP B 1 361 ? 26.897  9.417   -1.885  1.00 31.03  ? 362 ASP B N   1 
ATOM   6807 C  CA  . ASP B 1 361 ? 25.943  10.177  -2.688  1.00 31.50  ? 362 ASP B CA  1 
ATOM   6808 C  C   . ASP B 1 361 ? 24.915  9.229   -3.283  1.00 31.26  ? 362 ASP B C   1 
ATOM   6809 O  O   . ASP B 1 361 ? 25.245  8.101   -3.637  1.00 31.63  ? 362 ASP B O   1 
ATOM   6810 C  CB  . ASP B 1 361 ? 26.653  10.929  -3.829  1.00 32.05  ? 362 ASP B CB  1 
ATOM   6811 C  CG  . ASP B 1 361 ? 27.660  11.978  -3.335  1.00 32.97  ? 362 ASP B CG  1 
ATOM   6812 O  OD1 . ASP B 1 361 ? 27.875  12.132  -2.111  1.00 35.02  ? 362 ASP B OD1 1 
ATOM   6813 O  OD2 . ASP B 1 361 ? 28.255  12.651  -4.196  1.00 35.24  ? 362 ASP B OD2 1 
ATOM   6814 N  N   . LEU B 1 362 ? 23.671  9.687   -3.387  1.00 31.15  ? 363 LEU B N   1 
ATOM   6815 C  CA  . LEU B 1 362 ? 22.592  8.875   -3.946  1.00 30.98  ? 363 LEU B CA  1 
ATOM   6816 C  C   . LEU B 1 362 ? 21.625  9.709   -4.768  1.00 30.90  ? 363 LEU B C   1 
ATOM   6817 O  O   . LEU B 1 362 ? 21.242  10.807  -4.362  1.00 31.24  ? 363 LEU B O   1 
ATOM   6818 C  CB  . LEU B 1 362 ? 21.827  8.143   -2.830  1.00 30.87  ? 363 LEU B CB  1 
ATOM   6819 C  CG  . LEU B 1 362 ? 20.615  7.303   -3.264  1.00 31.16  ? 363 LEU B CG  1 
ATOM   6820 C  CD1 . LEU B 1 362 ? 21.042  6.090   -4.109  1.00 30.48  ? 363 LEU B CD1 1 
ATOM   6821 C  CD2 . LEU B 1 362 ? 19.789  6.868   -2.055  1.00 30.80  ? 363 LEU B CD2 1 
ATOM   6822 N  N   . VAL B 1 363 ? 21.219  9.177   -5.917  1.00 30.67  ? 364 VAL B N   1 
ATOM   6823 C  CA  . VAL B 1 363 ? 20.225  9.837   -6.752  1.00 30.72  ? 364 VAL B CA  1 
ATOM   6824 C  C   . VAL B 1 363 ? 18.835  9.262   -6.483  1.00 30.63  ? 364 VAL B C   1 
ATOM   6825 O  O   . VAL B 1 363 ? 18.624  8.061   -6.594  1.00 30.94  ? 364 VAL B O   1 
ATOM   6826 C  CB  . VAL B 1 363 ? 20.571  9.735   -8.274  1.00 30.81  ? 364 VAL B CB  1 
ATOM   6827 C  CG1 . VAL B 1 363 ? 19.513  10.432  -9.117  1.00 29.92  ? 364 VAL B CG1 1 
ATOM   6828 C  CG2 . VAL B 1 363 ? 21.953  10.334  -8.561  1.00 30.46  ? 364 VAL B CG2 1 
ATOM   6829 N  N   . LEU B 1 364 ? 17.895  10.130  -6.130  1.00 30.72  ? 365 LEU B N   1 
ATOM   6830 C  CA  . LEU B 1 364 ? 16.492  9.749   -5.975  1.00 30.93  ? 365 LEU B CA  1 
ATOM   6831 C  C   . LEU B 1 364 ? 15.600  10.754  -6.684  1.00 31.19  ? 365 LEU B C   1 
ATOM   6832 O  O   . LEU B 1 364 ? 15.725  11.965  -6.465  1.00 31.03  ? 365 LEU B O   1 
ATOM   6833 C  CB  . LEU B 1 364 ? 16.098  9.661   -4.493  1.00 30.56  ? 365 LEU B CB  1 
ATOM   6834 C  CG  . LEU B 1 364 ? 16.700  8.543   -3.639  1.00 30.66  ? 365 LEU B CG  1 
ATOM   6835 C  CD1 . LEU B 1 364 ? 16.344  8.729   -2.164  1.00 31.52  ? 365 LEU B CD1 1 
ATOM   6836 C  CD2 . LEU B 1 364 ? 16.260  7.171   -4.113  1.00 30.20  ? 365 LEU B CD2 1 
ATOM   6837 N  N   . ARG B 1 365 ? 14.705  10.254  -7.536  1.00 31.66  ? 366 ARG B N   1 
ATOM   6838 C  CA  . ARG B 1 365 ? 13.733  11.101  -8.245  1.00 32.09  ? 366 ARG B CA  1 
ATOM   6839 C  C   . ARG B 1 365 ? 14.421  12.133  -9.141  1.00 32.28  ? 366 ARG B C   1 
ATOM   6840 O  O   . ARG B 1 365 ? 13.873  13.211  -9.391  1.00 32.21  ? 366 ARG B O   1 
ATOM   6841 C  CB  . ARG B 1 365 ? 12.825  11.817  -7.245  1.00 32.20  ? 366 ARG B CB  1 
ATOM   6842 C  CG  . ARG B 1 365 ? 11.970  10.895  -6.398  1.00 33.10  ? 366 ARG B CG  1 
ATOM   6843 C  CD  . ARG B 1 365 ? 10.584  10.857  -6.948  1.00 33.69  ? 366 ARG B CD  1 
ATOM   6844 N  NE  . ARG B 1 365 ? 10.005  9.543   -6.748  1.00 36.19  ? 366 ARG B NE  1 
ATOM   6845 C  CZ  . ARG B 1 365 ? 8.890   9.125   -7.329  1.00 36.07  ? 366 ARG B CZ  1 
ATOM   6846 N  NH1 . ARG B 1 365 ? 8.224   9.921   -8.151  1.00 35.60  ? 366 ARG B NH1 1 
ATOM   6847 N  NH2 . ARG B 1 365 ? 8.445   7.906   -7.078  1.00 37.35  ? 366 ARG B NH2 1 
ATOM   6848 N  N   . ASP B 1 366 ? 15.621  11.796  -9.611  1.00 32.56  ? 367 ASP B N   1 
ATOM   6849 C  CA  . ASP B 1 366 ? 16.431  12.688  -10.455 1.00 33.09  ? 367 ASP B CA  1 
ATOM   6850 C  C   . ASP B 1 366 ? 17.070  13.841  -9.657  1.00 32.35  ? 367 ASP B C   1 
ATOM   6851 O  O   . ASP B 1 366 ? 17.427  14.880  -10.219 1.00 32.16  ? 367 ASP B O   1 
ATOM   6852 C  CB  . ASP B 1 366 ? 15.593  13.232  -11.622 1.00 33.71  ? 367 ASP B CB  1 
ATOM   6853 C  CG  . ASP B 1 366 ? 16.255  13.022  -12.962 1.00 36.49  ? 367 ASP B CG  1 
ATOM   6854 O  OD1 . ASP B 1 366 ? 17.254  13.720  -13.255 1.00 38.00  ? 367 ASP B OD1 1 
ATOM   6855 O  OD2 . ASP B 1 366 ? 15.760  12.156  -13.724 1.00 39.74  ? 367 ASP B OD2 1 
ATOM   6856 N  N   . TYR B 1 367 ? 17.216  13.646  -8.348  1.00 31.63  ? 368 TYR B N   1 
ATOM   6857 C  CA  . TYR B 1 367 ? 17.905  14.608  -7.496  1.00 30.65  ? 368 TYR B CA  1 
ATOM   6858 C  C   . TYR B 1 367 ? 19.139  13.970  -6.864  1.00 30.70  ? 368 TYR B C   1 
ATOM   6859 O  O   . TYR B 1 367 ? 19.100  12.816  -6.430  1.00 30.56  ? 368 TYR B O   1 
ATOM   6860 C  CB  . TYR B 1 367 ? 16.988  15.110  -6.384  1.00 30.01  ? 368 TYR B CB  1 
ATOM   6861 C  CG  . TYR B 1 367 ? 15.760  15.888  -6.807  1.00 28.20  ? 368 TYR B CG  1 
ATOM   6862 C  CD1 . TYR B 1 367 ? 14.505  15.297  -6.779  1.00 26.41  ? 368 TYR B CD1 1 
ATOM   6863 C  CD2 . TYR B 1 367 ? 15.846  17.235  -7.167  1.00 26.69  ? 368 TYR B CD2 1 
ATOM   6864 C  CE1 . TYR B 1 367 ? 13.367  16.008  -7.126  1.00 26.40  ? 368 TYR B CE1 1 
ATOM   6865 C  CE2 . TYR B 1 367 ? 14.708  17.960  -7.517  1.00 25.83  ? 368 TYR B CE2 1 
ATOM   6866 C  CZ  . TYR B 1 367 ? 13.476  17.335  -7.496  1.00 26.01  ? 368 TYR B CZ  1 
ATOM   6867 O  OH  . TYR B 1 367 ? 12.343  18.027  -7.843  1.00 26.96  ? 368 TYR B OH  1 
ATOM   6868 N  N   . MET B 1 368 ? 20.224  14.736  -6.801  1.00 30.58  ? 369 MET B N   1 
ATOM   6869 C  CA  . MET B 1 368 ? 21.455  14.270  -6.182  1.00 30.73  ? 369 MET B CA  1 
ATOM   6870 C  C   . MET B 1 368 ? 21.419  14.541  -4.678  1.00 30.02  ? 369 MET B C   1 
ATOM   6871 O  O   . MET B 1 368 ? 21.387  15.694  -4.245  1.00 30.07  ? 369 MET B O   1 
ATOM   6872 C  CB  . MET B 1 368 ? 22.665  14.960  -6.815  1.00 31.41  ? 369 MET B CB  1 
ATOM   6873 C  CG  . MET B 1 368 ? 23.776  14.007  -7.261  1.00 33.95  ? 369 MET B CG  1 
ATOM   6874 S  SD  . MET B 1 368 ? 24.460  13.001  -5.932  1.00 39.64  ? 369 MET B SD  1 
ATOM   6875 C  CE  . MET B 1 368 ? 25.199  14.284  -4.913  1.00 39.35  ? 369 MET B CE  1 
ATOM   6876 N  N   . ILE B 1 369 ? 21.408  13.474  -3.887  1.00 29.11  ? 370 ILE B N   1 
ATOM   6877 C  CA  . ILE B 1 369 ? 21.439  13.602  -2.438  1.00 28.36  ? 370 ILE B CA  1 
ATOM   6878 C  C   . ILE B 1 369 ? 22.829  13.232  -1.932  1.00 28.01  ? 370 ILE B C   1 
ATOM   6879 O  O   . ILE B 1 369 ? 23.243  12.067  -2.030  1.00 27.69  ? 370 ILE B O   1 
ATOM   6880 C  CB  . ILE B 1 369 ? 20.346  12.764  -1.752  1.00 28.32  ? 370 ILE B CB  1 
ATOM   6881 C  CG1 . ILE B 1 369 ? 18.996  13.029  -2.414  1.00 28.11  ? 370 ILE B CG1 1 
ATOM   6882 C  CG2 . ILE B 1 369 ? 20.242  13.137  -0.281  1.00 27.99  ? 370 ILE B CG2 1 
ATOM   6883 C  CD1 . ILE B 1 369 ? 18.173  11.818  -2.564  1.00 28.12  ? 370 ILE B CD1 1 
ATOM   6884 N  N   . PRO B 1 370 ? 23.566  14.237  -1.419  1.00 27.51  ? 371 PRO B N   1 
ATOM   6885 C  CA  . PRO B 1 370 ? 24.957  14.060  -0.998  1.00 27.31  ? 371 PRO B CA  1 
ATOM   6886 C  C   . PRO B 1 370 ? 25.131  13.135  0.204   1.00 27.11  ? 371 PRO B C   1 
ATOM   6887 O  O   . PRO B 1 370 ? 24.229  13.008  1.040   1.00 27.33  ? 371 PRO B O   1 
ATOM   6888 C  CB  . PRO B 1 370 ? 25.420  15.484  -0.660  1.00 27.30  ? 371 PRO B CB  1 
ATOM   6889 C  CG  . PRO B 1 370 ? 24.181  16.283  -0.495  1.00 27.77  ? 371 PRO B CG  1 
ATOM   6890 C  CD  . PRO B 1 370 ? 23.141  15.647  -1.359  1.00 27.50  ? 371 PRO B CD  1 
ATOM   6891 N  N   . ALA B 1 371 ? 26.296  12.497  0.270   1.00 26.62  ? 372 ALA B N   1 
ATOM   6892 C  CA  . ALA B 1 371 ? 26.696  11.659  1.395   1.00 26.13  ? 372 ALA B CA  1 
ATOM   6893 C  C   . ALA B 1 371 ? 26.511  12.385  2.722   1.00 25.89  ? 372 ALA B C   1 
ATOM   6894 O  O   . ALA B 1 371 ? 26.705  13.602  2.802   1.00 25.90  ? 372 ALA B O   1 
ATOM   6895 C  CB  . ALA B 1 371 ? 28.155  11.223  1.225   1.00 26.36  ? 372 ALA B CB  1 
ATOM   6896 N  N   . LYS B 1 372 ? 26.130  11.626  3.752   1.00 25.27  ? 373 LYS B N   1 
ATOM   6897 C  CA  . LYS B 1 372 ? 25.849  12.149  5.098   1.00 24.95  ? 373 LYS B CA  1 
ATOM   6898 C  C   . LYS B 1 372 ? 24.490  12.863  5.249   1.00 23.61  ? 373 LYS B C   1 
ATOM   6899 O  O   . LYS B 1 372 ? 24.132  13.278  6.353   1.00 23.67  ? 373 LYS B O   1 
ATOM   6900 C  CB  . LYS B 1 372 ? 26.988  13.051  5.607   1.00 25.80  ? 373 LYS B CB  1 
ATOM   6901 C  CG  . LYS B 1 372 ? 28.322  12.339  5.836   1.00 28.75  ? 373 LYS B CG  1 
ATOM   6902 C  CD  . LYS B 1 372 ? 29.390  13.321  6.317   1.00 32.52  ? 373 LYS B CD  1 
ATOM   6903 C  CE  . LYS B 1 372 ? 30.707  12.602  6.623   1.00 35.68  ? 373 LYS B CE  1 
ATOM   6904 N  NZ  . LYS B 1 372 ? 30.608  11.662  7.797   1.00 37.52  ? 373 LYS B NZ  1 
ATOM   6905 N  N   . THR B 1 373 ? 23.741  13.022  4.162   1.00 22.06  ? 374 THR B N   1 
ATOM   6906 C  CA  . THR B 1 373 ? 22.383  13.559  4.263   1.00 20.79  ? 374 THR B CA  1 
ATOM   6907 C  C   . THR B 1 373 ? 21.504  12.554  5.027   1.00 19.81  ? 374 THR B C   1 
ATOM   6908 O  O   . THR B 1 373 ? 21.608  11.345  4.810   1.00 19.59  ? 374 THR B O   1 
ATOM   6909 C  CB  . THR B 1 373 ? 21.740  13.817  2.875   1.00 20.79  ? 374 THR B CB  1 
ATOM   6910 O  OG1 . THR B 1 373 ? 22.593  14.645  2.071   1.00 21.39  ? 374 THR B OG1 1 
ATOM   6911 C  CG2 . THR B 1 373 ? 20.400  14.493  3.025   1.00 20.06  ? 374 THR B CG2 1 
ATOM   6912 N  N   . LEU B 1 374 ? 20.664  13.064  5.924   1.00 18.24  ? 375 LEU B N   1 
ATOM   6913 C  CA  . LEU B 1 374 ? 19.656  12.256  6.598   1.00 17.31  ? 375 LEU B CA  1 
ATOM   6914 C  C   . LEU B 1 374 ? 18.435  12.058  5.698   1.00 16.60  ? 375 LEU B C   1 
ATOM   6915 O  O   . LEU B 1 374 ? 17.800  13.030  5.286   1.00 15.99  ? 375 LEU B O   1 
ATOM   6916 C  CB  . LEU B 1 374 ? 19.233  12.917  7.917   1.00 16.92  ? 375 LEU B CB  1 
ATOM   6917 C  CG  . LEU B 1 374 ? 18.219  12.204  8.824   1.00 16.41  ? 375 LEU B CG  1 
ATOM   6918 C  CD1 . LEU B 1 374 ? 18.695  10.809  9.248   1.00 16.50  ? 375 LEU B CD1 1 
ATOM   6919 C  CD2 . LEU B 1 374 ? 17.932  13.062  10.045  1.00 15.41  ? 375 LEU B CD2 1 
ATOM   6920 N  N   . VAL B 1 375 ? 18.115  10.799  5.397   1.00 15.91  ? 376 VAL B N   1 
ATOM   6921 C  CA  . VAL B 1 375 ? 16.928  10.469  4.597   1.00 15.19  ? 376 VAL B CA  1 
ATOM   6922 C  C   . VAL B 1 375 ? 15.904  9.756   5.476   1.00 14.93  ? 376 VAL B C   1 
ATOM   6923 O  O   . VAL B 1 375 ? 16.246  8.806   6.185   1.00 14.80  ? 376 VAL B O   1 
ATOM   6924 C  CB  . VAL B 1 375 ? 17.289  9.617   3.331   1.00 15.37  ? 376 VAL B CB  1 
ATOM   6925 C  CG1 . VAL B 1 375 ? 16.040  9.293   2.504   1.00 15.14  ? 376 VAL B CG1 1 
ATOM   6926 C  CG2 . VAL B 1 375 ? 18.307  10.366  2.457   1.00 15.44  ? 376 VAL B CG2 1 
ATOM   6927 N  N   . GLN B 1 376 ? 14.661  10.230  5.436   1.00 14.46  ? 377 GLN B N   1 
ATOM   6928 C  CA  . GLN B 1 376 ? 13.572  9.636   6.218   1.00 14.50  ? 377 GLN B CA  1 
ATOM   6929 C  C   . GLN B 1 376 ? 12.486  9.062   5.311   1.00 14.76  ? 377 GLN B C   1 
ATOM   6930 O  O   . GLN B 1 376 ? 12.014  9.722   4.391   1.00 14.74  ? 377 GLN B O   1 
ATOM   6931 C  CB  . GLN B 1 376 ? 12.970  10.647  7.211   1.00 14.08  ? 377 GLN B CB  1 
ATOM   6932 C  CG  . GLN B 1 376 ? 14.007  11.263  8.176   1.00 13.95  ? 377 GLN B CG  1 
ATOM   6933 C  CD  . GLN B 1 376 ? 13.406  11.876  9.442   1.00 13.51  ? 377 GLN B CD  1 
ATOM   6934 O  OE1 . GLN B 1 376 ? 12.430  11.364  10.006  1.00 10.78  ? 377 GLN B OE1 1 
ATOM   6935 N  NE2 . GLN B 1 376 ? 14.011  12.970  9.908   1.00 11.62  ? 377 GLN B NE2 1 
ATOM   6936 N  N   . VAL B 1 377 ? 12.119  7.813   5.564   1.00 14.99  ? 378 VAL B N   1 
ATOM   6937 C  CA  . VAL B 1 377 ? 10.996  7.177   4.885   1.00 15.03  ? 378 VAL B CA  1 
ATOM   6938 C  C   . VAL B 1 377 ? 9.741   7.409   5.708   1.00 15.32  ? 378 VAL B C   1 
ATOM   6939 O  O   . VAL B 1 377 ? 9.649   6.923   6.836   1.00 15.63  ? 378 VAL B O   1 
ATOM   6940 C  CB  . VAL B 1 377 ? 11.202  5.655   4.757   1.00 14.95  ? 378 VAL B CB  1 
ATOM   6941 C  CG1 . VAL B 1 377 ? 10.047  5.038   3.992   1.00 15.09  ? 378 VAL B CG1 1 
ATOM   6942 C  CG2 . VAL B 1 377 ? 12.536  5.350   4.072   1.00 15.35  ? 378 VAL B CG2 1 
ATOM   6943 N  N   . ALA B 1 378 ? 8.784   8.141   5.144   1.00 14.95  ? 379 ALA B N   1 
ATOM   6944 C  CA  . ALA B 1 378 ? 7.560   8.467   5.848   1.00 15.16  ? 379 ALA B CA  1 
ATOM   6945 C  C   . ALA B 1 378 ? 6.604   7.276   5.844   1.00 15.44  ? 379 ALA B C   1 
ATOM   6946 O  O   . ALA B 1 378 ? 5.656   7.191   5.051   1.00 15.42  ? 379 ALA B O   1 
ATOM   6947 C  CB  . ALA B 1 378 ? 6.909   9.714   5.271   1.00 14.59  ? 379 ALA B CB  1 
ATOM   6948 N  N   . ILE B 1 379 ? 6.870   6.370   6.774   1.00 15.77  ? 380 ILE B N   1 
ATOM   6949 C  CA  . ILE B 1 379 ? 6.210   5.081   6.839   1.00 16.17  ? 380 ILE B CA  1 
ATOM   6950 C  C   . ILE B 1 379 ? 4.726   5.206   7.193   1.00 15.37  ? 380 ILE B C   1 
ATOM   6951 O  O   . ILE B 1 379 ? 3.887   4.482   6.649   1.00 14.97  ? 380 ILE B O   1 
ATOM   6952 C  CB  . ILE B 1 379 ? 7.015   4.133   7.778   1.00 16.99  ? 380 ILE B CB  1 
ATOM   6953 C  CG1 . ILE B 1 379 ? 7.443   2.908   7.011   1.00 17.99  ? 380 ILE B CG1 1 
ATOM   6954 C  CG2 . ILE B 1 379 ? 6.305   3.798   9.066   1.00 16.96  ? 380 ILE B CG2 1 
ATOM   6955 C  CD1 . ILE B 1 379 ? 8.738   3.130   6.361   1.00 20.17  ? 380 ILE B CD1 1 
ATOM   6956 N  N   . TYR B 1 380 ? 4.396   6.162   8.059   1.00 15.11  ? 381 TYR B N   1 
ATOM   6957 C  CA  . TYR B 1 380 ? 2.996   6.441   8.351   1.00 14.16  ? 381 TYR B CA  1 
ATOM   6958 C  C   . TYR B 1 380 ? 2.280   6.945   7.093   1.00 14.37  ? 381 TYR B C   1 
ATOM   6959 O  O   . TYR B 1 380 ? 1.232   6.415   6.730   1.00 14.41  ? 381 TYR B O   1 
ATOM   6960 C  CB  . TYR B 1 380 ? 2.817   7.426   9.509   1.00 13.86  ? 381 TYR B CB  1 
ATOM   6961 C  CG  . TYR B 1 380 ? 1.353   7.760   9.739   1.00 13.08  ? 381 TYR B CG  1 
ATOM   6962 C  CD1 . TYR B 1 380 ? 0.591   7.042   10.661  1.00 12.57  ? 381 TYR B CD1 1 
ATOM   6963 C  CD2 . TYR B 1 380 ? 0.718   8.761   8.995   1.00 12.49  ? 381 TYR B CD2 1 
ATOM   6964 C  CE1 . TYR B 1 380 ? -0.771  7.325   10.853  1.00 13.51  ? 381 TYR B CE1 1 
ATOM   6965 C  CE2 . TYR B 1 380 ? -0.647  9.050   9.172   1.00 12.70  ? 381 TYR B CE2 1 
ATOM   6966 C  CZ  . TYR B 1 380 ? -1.376  8.327   10.101  1.00 13.23  ? 381 TYR B CZ  1 
ATOM   6967 O  OH  . TYR B 1 380 ? -2.705  8.614   10.297  1.00 15.71  ? 381 TYR B OH  1 
ATOM   6968 N  N   . ALA B 1 381 ? 2.842   7.964   6.443   1.00 14.14  ? 382 ALA B N   1 
ATOM   6969 C  CA  . ALA B 1 381 ? 2.240   8.518   5.220   1.00 14.72  ? 382 ALA B CA  1 
ATOM   6970 C  C   . ALA B 1 381 ? 2.120   7.487   4.096   1.00 14.69  ? 382 ALA B C   1 
ATOM   6971 O  O   . ALA B 1 381 ? 1.128   7.483   3.362   1.00 14.83  ? 382 ALA B O   1 
ATOM   6972 C  CB  . ALA B 1 381 ? 3.009   9.761   4.730   1.00 14.27  ? 382 ALA B CB  1 
ATOM   6973 N  N   . LEU B 1 382 ? 3.134   6.637   3.961   1.00 14.91  ? 383 LEU B N   1 
ATOM   6974 C  CA  . LEU B 1 382 ? 3.107   5.525   3.009   1.00 15.93  ? 383 LEU B CA  1 
ATOM   6975 C  C   . LEU B 1 382 ? 1.920   4.565   3.231   1.00 16.68  ? 383 LEU B C   1 
ATOM   6976 O  O   . LEU B 1 382 ? 1.219   4.214   2.281   1.00 17.44  ? 383 LEU B O   1 
ATOM   6977 C  CB  . LEU B 1 382 ? 4.437   4.775   3.043   1.00 15.70  ? 383 LEU B CB  1 
ATOM   6978 C  CG  . LEU B 1 382 ? 4.592   3.423   2.336   1.00 16.94  ? 383 LEU B CG  1 
ATOM   6979 C  CD1 . LEU B 1 382 ? 4.143   3.464   0.878   1.00 15.70  ? 383 LEU B CD1 1 
ATOM   6980 C  CD2 . LEU B 1 382 ? 6.040   2.993   2.434   1.00 16.95  ? 383 LEU B CD2 1 
ATOM   6981 N  N   . GLY B 1 383 ? 1.690   4.169   4.481   1.00 17.01  ? 384 GLY B N   1 
ATOM   6982 C  CA  . GLY B 1 383 ? 0.590   3.285   4.837   1.00 17.08  ? 384 GLY B CA  1 
ATOM   6983 C  C   . GLY B 1 383 ? -0.807  3.803   4.530   1.00 17.49  ? 384 GLY B C   1 
ATOM   6984 O  O   . GLY B 1 383 ? -1.720  3.005   4.319   1.00 17.78  ? 384 GLY B O   1 
ATOM   6985 N  N   . ARG B 1 384 ? -0.987  5.125   4.504   1.00 17.60  ? 385 ARG B N   1 
ATOM   6986 C  CA  . ARG B 1 384 ? -2.295  5.717   4.170   1.00 17.92  ? 385 ARG B CA  1 
ATOM   6987 C  C   . ARG B 1 384 ? -2.408  6.221   2.723   1.00 18.22  ? 385 ARG B C   1 
ATOM   6988 O  O   . ARG B 1 384 ? -3.406  6.841   2.363   1.00 18.01  ? 385 ARG B O   1 
ATOM   6989 C  CB  . ARG B 1 384 ? -2.651  6.891   5.111   1.00 17.68  ? 385 ARG B CB  1 
ATOM   6990 C  CG  . ARG B 1 384 ? -2.521  6.646   6.612   1.00 17.47  ? 385 ARG B CG  1 
ATOM   6991 C  CD  . ARG B 1 384 ? -3.201  5.368   7.041   1.00 16.14  ? 385 ARG B CD  1 
ATOM   6992 N  NE  . ARG B 1 384 ? -3.022  5.118   8.465   1.00 15.25  ? 385 ARG B NE  1 
ATOM   6993 C  CZ  . ARG B 1 384 ? -3.856  5.543   9.404   1.00 16.24  ? 385 ARG B CZ  1 
ATOM   6994 N  NH1 . ARG B 1 384 ? -4.925  6.261   9.063   1.00 14.14  ? 385 ARG B NH1 1 
ATOM   6995 N  NH2 . ARG B 1 384 ? -3.619  5.259   10.687  1.00 14.86  ? 385 ARG B NH2 1 
ATOM   6996 N  N   . GLU B 1 385 ? -1.391  5.974   1.908   1.00 18.93  ? 386 GLU B N   1 
ATOM   6997 C  CA  . GLU B 1 385 ? -1.322  6.569   0.571   1.00 20.45  ? 386 GLU B CA  1 
ATOM   6998 C  C   . GLU B 1 385 ? -2.024  5.663   -0.464  1.00 20.69  ? 386 GLU B C   1 
ATOM   6999 O  O   . GLU B 1 385 ? -1.600  4.522   -0.679  1.00 21.02  ? 386 GLU B O   1 
ATOM   7000 C  CB  . GLU B 1 385 ? 0.145   6.867   0.222   1.00 20.46  ? 386 GLU B CB  1 
ATOM   7001 C  CG  . GLU B 1 385 ? 0.453   7.361   -1.191  1.00 23.84  ? 386 GLU B CG  1 
ATOM   7002 C  CD  . GLU B 1 385 ? -0.520  8.405   -1.725  1.00 25.30  ? 386 GLU B CD  1 
ATOM   7003 O  OE1 . GLU B 1 385 ? -0.610  9.514   -1.164  1.00 25.94  ? 386 GLU B OE1 1 
ATOM   7004 O  OE2 . GLU B 1 385 ? -1.181  8.098   -2.732  1.00 26.86  ? 386 GLU B OE2 1 
ATOM   7005 N  N   . PRO B 1 386 ? -3.113  6.161   -1.095  1.00 21.21  ? 387 PRO B N   1 
ATOM   7006 C  CA  . PRO B 1 386 ? -3.892  5.293   -2.005  1.00 21.74  ? 387 PRO B CA  1 
ATOM   7007 C  C   . PRO B 1 386 ? -3.145  4.798   -3.251  1.00 22.30  ? 387 PRO B C   1 
ATOM   7008 O  O   . PRO B 1 386 ? -3.567  3.800   -3.837  1.00 23.39  ? 387 PRO B O   1 
ATOM   7009 C  CB  . PRO B 1 386 ? -5.094  6.163   -2.404  1.00 21.88  ? 387 PRO B CB  1 
ATOM   7010 C  CG  . PRO B 1 386 ? -5.137  7.272   -1.368  1.00 22.30  ? 387 PRO B CG  1 
ATOM   7011 C  CD  . PRO B 1 386 ? -3.726  7.495   -0.938  1.00 20.51  ? 387 PRO B CD  1 
ATOM   7012 N  N   . THR B 1 387 ? -2.055  5.461   -3.649  1.00 22.44  ? 388 THR B N   1 
ATOM   7013 C  CA  . THR B 1 387 ? -1.284  5.026   -4.831  1.00 22.16  ? 388 THR B CA  1 
ATOM   7014 C  C   . THR B 1 387 ? -0.345  3.875   -4.532  1.00 22.01  ? 388 THR B C   1 
ATOM   7015 O  O   . THR B 1 387 ? 0.171   3.242   -5.445  1.00 22.25  ? 388 THR B O   1 
ATOM   7016 C  CB  . THR B 1 387 ? -0.446  6.162   -5.498  1.00 22.28  ? 388 THR B CB  1 
ATOM   7017 O  OG1 . THR B 1 387 ? 0.495   6.710   -4.567  1.00 22.79  ? 388 THR B OG1 1 
ATOM   7018 C  CG2 . THR B 1 387 ? -1.337  7.261   -6.026  1.00 22.29  ? 388 THR B CG2 1 
ATOM   7019 N  N   . PHE B 1 388 ? -0.109  3.600   -3.255  1.00 21.79  ? 389 PHE B N   1 
ATOM   7020 C  CA  . PHE B 1 388 ? 0.772   2.495   -2.897  1.00 21.20  ? 389 PHE B CA  1 
ATOM   7021 C  C   . PHE B 1 388 ? 0.032   1.319   -2.259  1.00 20.84  ? 389 PHE B C   1 
ATOM   7022 O  O   . PHE B 1 388 ? 0.546   0.207   -2.231  1.00 20.64  ? 389 PHE B O   1 
ATOM   7023 C  CB  . PHE B 1 388 ? 1.938   2.991   -2.038  1.00 20.98  ? 389 PHE B CB  1 
ATOM   7024 C  CG  . PHE B 1 388 ? 2.757   4.074   -2.704  1.00 21.40  ? 389 PHE B CG  1 
ATOM   7025 C  CD1 . PHE B 1 388 ? 2.979   5.286   -2.070  1.00 20.62  ? 389 PHE B CD1 1 
ATOM   7026 C  CD2 . PHE B 1 388 ? 3.288   3.882   -3.982  1.00 21.07  ? 389 PHE B CD2 1 
ATOM   7027 C  CE1 . PHE B 1 388 ? 3.727   6.289   -2.683  1.00 20.45  ? 389 PHE B CE1 1 
ATOM   7028 C  CE2 . PHE B 1 388 ? 4.034   4.879   -4.602  1.00 21.18  ? 389 PHE B CE2 1 
ATOM   7029 C  CZ  . PHE B 1 388 ? 4.255   6.088   -3.946  1.00 20.22  ? 389 PHE B CZ  1 
ATOM   7030 N  N   . PHE B 1 389 ? -1.174  1.568   -1.760  1.00 20.60  ? 390 PHE B N   1 
ATOM   7031 C  CA  . PHE B 1 389 ? -2.017  0.505   -1.225  1.00 20.77  ? 390 PHE B CA  1 
ATOM   7032 C  C   . PHE B 1 389 ? -3.437  0.735   -1.683  1.00 21.53  ? 390 PHE B C   1 
ATOM   7033 O  O   . PHE B 1 389 ? -3.943  1.850   -1.604  1.00 21.01  ? 390 PHE B O   1 
ATOM   7034 C  CB  . PHE B 1 389 ? -1.988  0.464   0.308   1.00 20.26  ? 390 PHE B CB  1 
ATOM   7035 C  CG  . PHE B 1 389 ? -0.667  0.042   0.886   1.00 19.56  ? 390 PHE B CG  1 
ATOM   7036 C  CD1 . PHE B 1 389 ? 0.217   0.987   1.395   1.00 18.20  ? 390 PHE B CD1 1 
ATOM   7037 C  CD2 . PHE B 1 389 ? -0.316  -1.304  0.939   1.00 18.88  ? 390 PHE B CD2 1 
ATOM   7038 C  CE1 . PHE B 1 389 ? 1.434   0.597   1.940   1.00 17.61  ? 390 PHE B CE1 1 
ATOM   7039 C  CE2 . PHE B 1 389 ? 0.900   -1.704  1.482   1.00 18.06  ? 390 PHE B CE2 1 
ATOM   7040 C  CZ  . PHE B 1 389 ? 1.774   -0.743  1.986   1.00 18.38  ? 390 PHE B CZ  1 
ATOM   7041 N  N   . PHE B 1 390 ? -4.069  -0.334  -2.158  1.00 22.67  ? 391 PHE B N   1 
ATOM   7042 C  CA  . PHE B 1 390 ? -5.473  -0.315  -2.533  1.00 23.97  ? 391 PHE B CA  1 
ATOM   7043 C  C   . PHE B 1 390 ? -6.348  -0.178  -1.298  1.00 24.28  ? 391 PHE B C   1 
ATOM   7044 O  O   . PHE B 1 390 ? -6.206  -0.949  -0.347  1.00 24.34  ? 391 PHE B O   1 
ATOM   7045 C  CB  . PHE B 1 390 ? -5.830  -1.606  -3.287  1.00 24.50  ? 391 PHE B CB  1 
ATOM   7046 C  CG  . PHE B 1 390 ? -7.283  -1.706  -3.659  1.00 27.01  ? 391 PHE B CG  1 
ATOM   7047 C  CD1 . PHE B 1 390 ? -7.745  -1.172  -4.860  1.00 28.72  ? 391 PHE B CD1 1 
ATOM   7048 C  CD2 . PHE B 1 390 ? -8.193  -2.326  -2.803  1.00 28.59  ? 391 PHE B CD2 1 
ATOM   7049 C  CE1 . PHE B 1 390 ? -9.100  -1.257  -5.204  1.00 30.07  ? 391 PHE B CE1 1 
ATOM   7050 C  CE2 . PHE B 1 390 ? -9.547  -2.414  -3.138  1.00 30.80  ? 391 PHE B CE2 1 
ATOM   7051 C  CZ  . PHE B 1 390 ? -10.000 -1.879  -4.343  1.00 29.90  ? 391 PHE B CZ  1 
ATOM   7052 N  N   . ASP B 1 391 ? -7.263  0.787   -1.333  1.00 24.82  ? 392 ASP B N   1 
ATOM   7053 C  CA  . ASP B 1 391 ? -8.194  1.059   -0.228  1.00 25.75  ? 392 ASP B CA  1 
ATOM   7054 C  C   . ASP B 1 391 ? -7.488  1.107   1.143   1.00 25.64  ? 392 ASP B C   1 
ATOM   7055 O  O   . ASP B 1 391 ? -7.839  0.350   2.055   1.00 25.55  ? 392 ASP B O   1 
ATOM   7056 C  CB  . ASP B 1 391 ? -9.343  0.040   -0.242  1.00 26.23  ? 392 ASP B CB  1 
ATOM   7057 C  CG  . ASP B 1 391 ? -10.537 0.467   0.610   1.00 28.55  ? 392 ASP B CG  1 
ATOM   7058 O  OD1 . ASP B 1 391 ? -10.678 1.674   0.931   1.00 30.48  ? 392 ASP B OD1 1 
ATOM   7059 O  OD2 . ASP B 1 391 ? -11.347 -0.423  0.961   1.00 31.77  ? 392 ASP B OD2 1 
ATOM   7060 N  N   . PRO B 1 392 ? -6.501  2.019   1.297   1.00 25.81  ? 393 PRO B N   1 
ATOM   7061 C  CA  . PRO B 1 392 ? -5.598  1.998   2.470   1.00 25.96  ? 393 PRO B CA  1 
ATOM   7062 C  C   . PRO B 1 392 ? -6.279  2.091   3.842   1.00 25.86  ? 393 PRO B C   1 
ATOM   7063 O  O   . PRO B 1 392 ? -5.747  1.571   4.817   1.00 25.88  ? 393 PRO B O   1 
ATOM   7064 C  CB  . PRO B 1 392 ? -4.670  3.203   2.237   1.00 26.01  ? 393 PRO B CB  1 
ATOM   7065 C  CG  . PRO B 1 392 ? -5.422  4.102   1.300   1.00 26.01  ? 393 PRO B CG  1 
ATOM   7066 C  CD  . PRO B 1 392 ? -6.238  3.186   0.426   1.00 25.64  ? 393 PRO B CD  1 
ATOM   7067 N  N   . GLU B 1 393 ? -7.446  2.719   3.919   1.00 26.11  ? 394 GLU B N   1 
ATOM   7068 C  CA  . GLU B 1 393 ? -8.161  2.819   5.194   1.00 26.58  ? 394 GLU B CA  1 
ATOM   7069 C  C   . GLU B 1 393 ? -8.814  1.505   5.627   1.00 26.12  ? 394 GLU B C   1 
ATOM   7070 O  O   . GLU B 1 393 ? -9.247  1.368   6.774   1.00 26.31  ? 394 GLU B O   1 
ATOM   7071 C  CB  . GLU B 1 393 ? -9.195  3.954   5.176   1.00 26.96  ? 394 GLU B CB  1 
ATOM   7072 C  CG  . GLU B 1 393 ? -8.603  5.373   5.011   1.00 29.50  ? 394 GLU B CG  1 
ATOM   7073 C  CD  . GLU B 1 393 ? -7.605  5.757   6.114   1.00 33.27  ? 394 GLU B CD  1 
ATOM   7074 O  OE1 . GLU B 1 393 ? -7.857  5.451   7.305   1.00 33.80  ? 394 GLU B OE1 1 
ATOM   7075 O  OE2 . GLU B 1 393 ? -6.563  6.370   5.782   1.00 35.03  ? 394 GLU B OE2 1 
ATOM   7076 N  N   . ASN B 1 394 ? -8.873  0.544   4.710   1.00 25.33  ? 395 ASN B N   1 
ATOM   7077 C  CA  . ASN B 1 394 ? -9.445  -0.761  4.996   1.00 24.69  ? 395 ASN B CA  1 
ATOM   7078 C  C   . ASN B 1 394 ? -8.422  -1.721  5.606   1.00 23.62  ? 395 ASN B C   1 
ATOM   7079 O  O   . ASN B 1 394 ? -7.287  -1.817  5.135   1.00 23.30  ? 395 ASN B O   1 
ATOM   7080 C  CB  . ASN B 1 394 ? -10.030 -1.368  3.713   1.00 25.07  ? 395 ASN B CB  1 
ATOM   7081 C  CG  . ASN B 1 394 ? -10.825 -2.626  3.972   1.00 26.35  ? 395 ASN B CG  1 
ATOM   7082 O  OD1 . ASN B 1 394 ? -11.791 -2.624  4.745   1.00 28.04  ? 395 ASN B OD1 1 
ATOM   7083 N  ND2 . ASN B 1 394 ? -10.423 -3.718  3.329   1.00 28.84  ? 395 ASN B ND2 1 
ATOM   7084 N  N   . PHE B 1 395 ? -8.835  -2.431  6.652   1.00 22.60  ? 396 PHE B N   1 
ATOM   7085 C  CA  . PHE B 1 395 ? -7.993  -3.445  7.277   1.00 21.56  ? 396 PHE B CA  1 
ATOM   7086 C  C   . PHE B 1 395 ? -8.117  -4.729  6.466   1.00 21.27  ? 396 PHE B C   1 
ATOM   7087 O  O   . PHE B 1 395 ? -9.132  -5.418  6.555   1.00 20.58  ? 396 PHE B O   1 
ATOM   7088 C  CB  . PHE B 1 395 ? -8.418  -3.666  8.733   1.00 21.41  ? 396 PHE B CB  1 
ATOM   7089 C  CG  . PHE B 1 395 ? -7.491  -4.569  9.527   1.00 20.89  ? 396 PHE B CG  1 
ATOM   7090 C  CD1 . PHE B 1 395 ? -6.218  -4.132  9.910   1.00 19.56  ? 396 PHE B CD1 1 
ATOM   7091 C  CD2 . PHE B 1 395 ? -7.909  -5.834  9.931   1.00 19.42  ? 396 PHE B CD2 1 
ATOM   7092 C  CE1 . PHE B 1 395 ? -5.367  -4.948  10.660  1.00 18.75  ? 396 PHE B CE1 1 
ATOM   7093 C  CE2 . PHE B 1 395 ? -7.061  -6.664  10.684  1.00 19.31  ? 396 PHE B CE2 1 
ATOM   7094 C  CZ  . PHE B 1 395 ? -5.786  -6.216  11.046  1.00 19.06  ? 396 PHE B CZ  1 
ATOM   7095 N  N   . ASP B 1 396 ? -7.090  -5.039  5.670   1.00 21.21  ? 397 ASP B N   1 
ATOM   7096 C  CA  . ASP B 1 396 ? -7.114  -6.224  4.796   1.00 21.64  ? 397 ASP B CA  1 
ATOM   7097 C  C   . ASP B 1 396 ? -5.810  -7.025  4.824   1.00 21.55  ? 397 ASP B C   1 
ATOM   7098 O  O   . ASP B 1 396 ? -4.900  -6.778  4.023   1.00 21.55  ? 397 ASP B O   1 
ATOM   7099 C  CB  . ASP B 1 396 ? -7.496  -5.851  3.359   1.00 21.93  ? 397 ASP B CB  1 
ATOM   7100 C  CG  . ASP B 1 396 ? -7.654  -7.068  2.449   1.00 24.12  ? 397 ASP B CG  1 
ATOM   7101 O  OD1 . ASP B 1 396 ? -7.670  -8.224  2.932   1.00 26.07  ? 397 ASP B OD1 1 
ATOM   7102 O  OD2 . ASP B 1 396 ? -7.755  -6.864  1.224   1.00 27.52  ? 397 ASP B OD2 1 
ATOM   7103 N  N   . PRO B 1 397 ? -5.724  -8.001  5.750   1.00 21.43  ? 398 PRO B N   1 
ATOM   7104 C  CA  . PRO B 1 397 ? -4.555  -8.860  5.868   1.00 21.32  ? 398 PRO B CA  1 
ATOM   7105 C  C   . PRO B 1 397 ? -4.236  -9.628  4.583   1.00 21.46  ? 398 PRO B C   1 
ATOM   7106 O  O   . PRO B 1 397 ? -3.068  -9.928  4.343   1.00 21.30  ? 398 PRO B O   1 
ATOM   7107 C  CB  . PRO B 1 397 ? -4.954  -9.843  6.977   1.00 21.22  ? 398 PRO B CB  1 
ATOM   7108 C  CG  . PRO B 1 397 ? -5.992  -9.135  7.754   1.00 21.32  ? 398 PRO B CG  1 
ATOM   7109 C  CD  . PRO B 1 397 ? -6.758  -8.351  6.744   1.00 21.23  ? 398 PRO B CD  1 
ATOM   7110 N  N   . THR B 1 398 ? -5.251  -9.950  3.776   1.00 21.45  ? 399 THR B N   1 
ATOM   7111 C  CA  . THR B 1 398 ? -5.024  -10.759 2.563   1.00 22.15  ? 399 THR B CA  1 
ATOM   7112 C  C   . THR B 1 398 ? -4.110  -10.063 1.546   1.00 22.37  ? 399 THR B C   1 
ATOM   7113 O  O   . THR B 1 398 ? -3.478  -10.736 0.734   1.00 22.38  ? 399 THR B O   1 
ATOM   7114 C  CB  . THR B 1 398 ? -6.331  -11.236 1.850   1.00 21.77  ? 399 THR B CB  1 
ATOM   7115 O  OG1 . THR B 1 398 ? -6.965  -10.128 1.205   1.00 22.76  ? 399 THR B OG1 1 
ATOM   7116 C  CG2 . THR B 1 398 ? -7.310  -11.872 2.833   1.00 22.11  ? 399 THR B CG2 1 
ATOM   7117 N  N   . ARG B 1 399 ? -4.013  -8.732  1.616   1.00 22.65  ? 400 ARG B N   1 
ATOM   7118 C  CA  . ARG B 1 399 ? -3.099  -7.987  0.738   1.00 23.28  ? 400 ARG B CA  1 
ATOM   7119 C  C   . ARG B 1 399 ? -1.649  -8.499  0.813   1.00 24.15  ? 400 ARG B C   1 
ATOM   7120 O  O   . ARG B 1 399 ? -0.942  -8.485  -0.194  1.00 24.12  ? 400 ARG B O   1 
ATOM   7121 C  CB  . ARG B 1 399 ? -3.203  -6.457  0.940   1.00 22.83  ? 400 ARG B CB  1 
ATOM   7122 C  CG  . ARG B 1 399 ? -2.345  -5.861  2.064   1.00 22.34  ? 400 ARG B CG  1 
ATOM   7123 C  CD  . ARG B 1 399 ? -2.348  -4.321  2.070   1.00 19.79  ? 400 ARG B CD  1 
ATOM   7124 N  NE  . ARG B 1 399 ? -3.620  -3.735  2.518   1.00 17.96  ? 400 ARG B NE  1 
ATOM   7125 C  CZ  . ARG B 1 399 ? -4.444  -3.036  1.743   1.00 18.89  ? 400 ARG B CZ  1 
ATOM   7126 N  NH1 . ARG B 1 399 ? -4.143  -2.807  0.469   1.00 18.82  ? 400 ARG B NH1 1 
ATOM   7127 N  NH2 . ARG B 1 399 ? -5.568  -2.540  2.243   1.00 20.25  ? 400 ARG B NH2 1 
ATOM   7128 N  N   . TRP B 1 400 ? -1.232  -8.990  1.987   1.00 24.87  ? 401 TRP B N   1 
ATOM   7129 C  CA  . TRP B 1 400 ? 0.138   -9.489  2.189   1.00 25.96  ? 401 TRP B CA  1 
ATOM   7130 C  C   . TRP B 1 400 ? 0.340   -10.928 1.689   1.00 27.68  ? 401 TRP B C   1 
ATOM   7131 O  O   . TRP B 1 400 ? 1.459   -11.446 1.687   1.00 27.73  ? 401 TRP B O   1 
ATOM   7132 C  CB  . TRP B 1 400 ? 0.561   -9.345  3.666   1.00 25.27  ? 401 TRP B CB  1 
ATOM   7133 C  CG  . TRP B 1 400 ? 0.470   -7.917  4.145   1.00 23.10  ? 401 TRP B CG  1 
ATOM   7134 C  CD1 . TRP B 1 400 ? -0.574  -7.338  4.814   1.00 20.96  ? 401 TRP B CD1 1 
ATOM   7135 C  CD2 . TRP B 1 400 ? 1.434   -6.884  3.939   1.00 20.49  ? 401 TRP B CD2 1 
ATOM   7136 N  NE1 . TRP B 1 400 ? -0.312  -6.016  5.046   1.00 19.24  ? 401 TRP B NE1 1 
ATOM   7137 C  CE2 . TRP B 1 400 ? 0.916   -5.707  4.525   1.00 20.30  ? 401 TRP B CE2 1 
ATOM   7138 C  CE3 . TRP B 1 400 ? 2.694   -6.839  3.324   1.00 20.39  ? 401 TRP B CE3 1 
ATOM   7139 C  CZ2 . TRP B 1 400 ? 1.613   -4.488  4.514   1.00 18.81  ? 401 TRP B CZ2 1 
ATOM   7140 C  CZ3 . TRP B 1 400 ? 3.391   -5.625  3.317   1.00 20.56  ? 401 TRP B CZ3 1 
ATOM   7141 C  CH2 . TRP B 1 400 ? 2.839   -4.465  3.914   1.00 19.32  ? 401 TRP B CH2 1 
ATOM   7142 N  N   . LEU B 1 401 ? -0.748  -11.559 1.262   1.00 29.91  ? 402 LEU B N   1 
ATOM   7143 C  CA  . LEU B 1 401 ? -0.706  -12.922 0.749   1.00 32.07  ? 402 LEU B CA  1 
ATOM   7144 C  C   . LEU B 1 401 ? -0.673  -12.946 -0.773  1.00 33.75  ? 402 LEU B C   1 
ATOM   7145 O  O   . LEU B 1 401 ? -0.277  -13.945 -1.371  1.00 34.21  ? 402 LEU B O   1 
ATOM   7146 C  CB  . LEU B 1 401 ? -1.880  -13.747 1.297   1.00 31.82  ? 402 LEU B CB  1 
ATOM   7147 C  CG  . LEU B 1 401 ? -1.826  -14.049 2.807   1.00 32.16  ? 402 LEU B CG  1 
ATOM   7148 C  CD1 . LEU B 1 401 ? -3.125  -14.677 3.296   1.00 31.77  ? 402 LEU B CD1 1 
ATOM   7149 C  CD2 . LEU B 1 401 ? -0.626  -14.924 3.182   1.00 31.62  ? 402 LEU B CD2 1 
ATOM   7150 N  N   . SER B 1 402 ? -1.076  -11.838 -1.390  1.00 35.94  ? 403 SER B N   1 
ATOM   7151 C  CA  . SER B 1 402 ? -1.026  -11.675 -2.843  1.00 38.23  ? 403 SER B CA  1 
ATOM   7152 C  C   . SER B 1 402 ? 0.274   -12.207 -3.449  1.00 39.52  ? 403 SER B C   1 
ATOM   7153 O  O   . SER B 1 402 ? 1.368   -11.897 -2.966  1.00 39.60  ? 403 SER B O   1 
ATOM   7154 C  CB  . SER B 1 402 ? -1.205  -10.197 -3.211  1.00 38.20  ? 403 SER B CB  1 
ATOM   7155 O  OG  . SER B 1 402 ? -0.858  -9.950  -4.566  1.00 39.00  ? 403 SER B OG  1 
ATOM   7156 N  N   . LYS B 1 403 ? 0.147   -13.030 -4.490  1.00 41.43  ? 404 LYS B N   1 
ATOM   7157 C  CA  . LYS B 1 403 ? 1.320   -13.474 -5.259  1.00 43.19  ? 404 LYS B CA  1 
ATOM   7158 C  C   . LYS B 1 403 ? 1.573   -12.528 -6.434  1.00 43.77  ? 404 LYS B C   1 
ATOM   7159 O  O   . LYS B 1 403 ? 1.497   -12.912 -7.603  1.00 44.47  ? 404 LYS B O   1 
ATOM   7160 C  CB  . LYS B 1 403 ? 1.226   -14.950 -5.694  1.00 43.44  ? 404 LYS B CB  1 
ATOM   7161 C  CG  . LYS B 1 403 ? -0.188  -15.508 -5.888  1.00 45.08  ? 404 LYS B CG  1 
ATOM   7162 C  CD  . LYS B 1 403 ? -0.183  -17.042 -5.866  1.00 47.44  ? 404 LYS B CD  1 
ATOM   7163 C  CE  . LYS B 1 403 ? 0.113   -17.597 -4.463  1.00 49.15  ? 404 LYS B CE  1 
ATOM   7164 N  NZ  . LYS B 1 403 ? 0.520   -19.037 -4.491  1.00 50.49  ? 404 LYS B NZ  1 
ATOM   7165 N  N   . ASP B 1 404 ? 1.859   -11.279 -6.088  1.00 44.26  ? 405 ASP B N   1 
ATOM   7166 C  CA  . ASP B 1 404 ? 2.125   -10.214 -7.040  1.00 44.76  ? 405 ASP B CA  1 
ATOM   7167 C  C   . ASP B 1 404 ? 3.050   -9.238  -6.318  1.00 44.79  ? 405 ASP B C   1 
ATOM   7168 O  O   . ASP B 1 404 ? 2.607   -8.448  -5.473  1.00 44.82  ? 405 ASP B O   1 
ATOM   7169 C  CB  . ASP B 1 404 ? 0.811   -9.549  -7.494  1.00 44.77  ? 405 ASP B CB  1 
ATOM   7170 C  CG  . ASP B 1 404 ? 1.026   -8.212  -8.214  1.00 45.56  ? 405 ASP B CG  1 
ATOM   7171 O  OD1 . ASP B 1 404 ? 0.041   -7.448  -8.348  1.00 45.95  ? 405 ASP B OD1 1 
ATOM   7172 O  OD2 . ASP B 1 404 ? 2.166   -7.912  -8.638  1.00 46.12  ? 405 ASP B OD2 1 
ATOM   7173 N  N   . LYS B 1 405 ? 4.336   -9.332  -6.652  1.00 44.82  ? 406 LYS B N   1 
ATOM   7174 C  CA  . LYS B 1 405 ? 5.411   -8.573  -6.009  1.00 44.78  ? 406 LYS B CA  1 
ATOM   7175 C  C   . LYS B 1 405 ? 5.098   -7.101  -5.781  1.00 44.21  ? 406 LYS B C   1 
ATOM   7176 O  O   . LYS B 1 405 ? 5.372   -6.569  -4.705  1.00 44.44  ? 406 LYS B O   1 
ATOM   7177 C  CB  . LYS B 1 405 ? 6.710   -8.707  -6.814  1.00 45.17  ? 406 LYS B CB  1 
ATOM   7178 C  CG  . LYS B 1 405 ? 7.813   -9.542  -6.142  1.00 46.93  ? 406 LYS B CG  1 
ATOM   7179 C  CD  . LYS B 1 405 ? 7.416   -11.005 -5.915  1.00 48.93  ? 406 LYS B CD  1 
ATOM   7180 C  CE  . LYS B 1 405 ? 8.639   -11.859 -5.588  1.00 49.85  ? 406 LYS B CE  1 
ATOM   7181 N  NZ  . LYS B 1 405 ? 8.262   -13.241 -5.171  1.00 50.58  ? 406 LYS B NZ  1 
ATOM   7182 N  N   . ASN B 1 406 ? 4.510   -6.462  -6.789  1.00 43.30  ? 407 ASN B N   1 
ATOM   7183 C  CA  . ASN B 1 406 ? 4.242   -5.025  -6.774  1.00 42.23  ? 407 ASN B CA  1 
ATOM   7184 C  C   . ASN B 1 406 ? 3.330   -4.567  -5.645  1.00 40.92  ? 407 ASN B C   1 
ATOM   7185 O  O   . ASN B 1 406 ? 3.316   -3.384  -5.291  1.00 40.89  ? 407 ASN B O   1 
ATOM   7186 C  CB  . ASN B 1 406 ? 3.647   -4.588  -8.117  1.00 42.58  ? 407 ASN B CB  1 
ATOM   7187 C  CG  . ASN B 1 406 ? 4.592   -4.833  -9.280  1.00 44.28  ? 407 ASN B CG  1 
ATOM   7188 O  OD1 . ASN B 1 406 ? 5.264   -5.868  -9.348  1.00 45.90  ? 407 ASN B OD1 1 
ATOM   7189 N  ND2 . ASN B 1 406 ? 4.648   -3.879  -10.208 1.00 45.53  ? 407 ASN B ND2 1 
ATOM   7190 N  N   . ILE B 1 407 ? 2.553   -5.497  -5.100  1.00 39.00  ? 408 ILE B N   1 
ATOM   7191 C  CA  . ILE B 1 407 ? 1.617   -5.161  -4.038  1.00 37.15  ? 408 ILE B CA  1 
ATOM   7192 C  C   . ILE B 1 407 ? 2.299   -5.068  -2.671  1.00 35.57  ? 408 ILE B C   1 
ATOM   7193 O  O   . ILE B 1 407 ? 1.907   -4.248  -1.846  1.00 35.23  ? 408 ILE B O   1 
ATOM   7194 C  CB  . ILE B 1 407 ? 0.377   -6.091  -4.048  1.00 37.37  ? 408 ILE B CB  1 
ATOM   7195 C  CG1 . ILE B 1 407 ? -0.638  -5.554  -5.066  1.00 37.80  ? 408 ILE B CG1 1 
ATOM   7196 C  CG2 . ILE B 1 407 ? -0.253  -6.212  -2.653  1.00 36.99  ? 408 ILE B CG2 1 
ATOM   7197 C  CD1 . ILE B 1 407 ? -1.940  -6.317  -5.139  1.00 39.03  ? 408 ILE B CD1 1 
ATOM   7198 N  N   . THR B 1 408 ? 3.332   -5.876  -2.448  1.00 33.62  ? 409 THR B N   1 
ATOM   7199 C  CA  . THR B 1 408 ? 4.002   -5.893  -1.144  1.00 32.34  ? 409 THR B CA  1 
ATOM   7200 C  C   . THR B 1 408 ? 5.450   -5.392  -1.194  1.00 31.16  ? 409 THR B C   1 
ATOM   7201 O  O   . THR B 1 408 ? 6.132   -5.357  -0.166  1.00 30.83  ? 409 THR B O   1 
ATOM   7202 C  CB  . THR B 1 408 ? 3.995   -7.303  -0.496  1.00 32.18  ? 409 THR B CB  1 
ATOM   7203 O  OG1 . THR B 1 408 ? 4.755   -8.204  -1.309  1.00 33.29  ? 409 THR B OG1 1 
ATOM   7204 C  CG2 . THR B 1 408 ? 2.586   -7.827  -0.326  1.00 32.19  ? 409 THR B CG2 1 
ATOM   7205 N  N   . TYR B 1 409 ? 5.910   -5.008  -2.383  1.00 29.74  ? 410 TYR B N   1 
ATOM   7206 C  CA  . TYR B 1 409 ? 7.298   -4.593  -2.581  1.00 28.62  ? 410 TYR B CA  1 
ATOM   7207 C  C   . TYR B 1 409 ? 7.697   -3.430  -1.659  1.00 27.47  ? 410 TYR B C   1 
ATOM   7208 O  O   . TYR B 1 409 ? 7.116   -2.350  -1.727  1.00 26.94  ? 410 TYR B O   1 
ATOM   7209 C  CB  . TYR B 1 409 ? 7.543   -4.230  -4.049  1.00 28.75  ? 410 TYR B CB  1 
ATOM   7210 C  CG  . TYR B 1 409 ? 8.997   -3.980  -4.374  1.00 29.43  ? 410 TYR B CG  1 
ATOM   7211 C  CD1 . TYR B 1 409 ? 9.942   -5.001  -4.260  1.00 30.59  ? 410 TYR B CD1 1 
ATOM   7212 C  CD2 . TYR B 1 409 ? 9.427   -2.724  -4.800  1.00 29.62  ? 410 TYR B CD2 1 
ATOM   7213 C  CE1 . TYR B 1 409 ? 11.292  -4.772  -4.562  1.00 31.68  ? 410 TYR B CE1 1 
ATOM   7214 C  CE2 . TYR B 1 409 ? 10.765  -2.486  -5.105  1.00 30.41  ? 410 TYR B CE2 1 
ATOM   7215 C  CZ  . TYR B 1 409 ? 11.689  -3.510  -4.984  1.00 31.22  ? 410 TYR B CZ  1 
ATOM   7216 O  OH  . TYR B 1 409 ? 13.011  -3.271  -5.281  1.00 32.51  ? 410 TYR B OH  1 
ATOM   7217 N  N   . PHE B 1 410 ? 8.682   -3.686  -0.800  1.00 26.46  ? 411 PHE B N   1 
ATOM   7218 C  CA  . PHE B 1 410 ? 9.165   -2.733  0.208   1.00 25.80  ? 411 PHE B CA  1 
ATOM   7219 C  C   . PHE B 1 410 ? 8.045   -1.994  0.945   1.00 25.34  ? 411 PHE B C   1 
ATOM   7220 O  O   . PHE B 1 410 ? 8.116   -0.778  1.138   1.00 24.56  ? 411 PHE B O   1 
ATOM   7221 C  CB  . PHE B 1 410 ? 10.187  -1.753  -0.407  1.00 26.10  ? 411 PHE B CB  1 
ATOM   7222 C  CG  . PHE B 1 410 ? 11.597  -2.271  -0.387  1.00 25.50  ? 411 PHE B CG  1 
ATOM   7223 C  CD1 . PHE B 1 410 ? 12.075  -3.072  -1.420  1.00 24.80  ? 411 PHE B CD1 1 
ATOM   7224 C  CD2 . PHE B 1 410 ? 12.445  -1.967  0.677   1.00 25.25  ? 411 PHE B CD2 1 
ATOM   7225 C  CE1 . PHE B 1 410 ? 13.374  -3.565  -1.394  1.00 24.13  ? 411 PHE B CE1 1 
ATOM   7226 C  CE2 . PHE B 1 410 ? 13.745  -2.461  0.722   1.00 24.32  ? 411 PHE B CE2 1 
ATOM   7227 C  CZ  . PHE B 1 410 ? 14.213  -3.260  -0.322  1.00 24.98  ? 411 PHE B CZ  1 
ATOM   7228 N  N   . ARG B 1 411 ? 7.014   -2.747  1.336   1.00 24.92  ? 412 ARG B N   1 
ATOM   7229 C  CA  . ARG B 1 411 ? 5.851   -2.207  2.031   1.00 25.04  ? 412 ARG B CA  1 
ATOM   7230 C  C   . ARG B 1 411 ? 5.807   -2.621  3.496   1.00 23.99  ? 412 ARG B C   1 
ATOM   7231 O  O   . ARG B 1 411 ? 5.112   -1.985  4.279   1.00 24.03  ? 412 ARG B O   1 
ATOM   7232 C  CB  . ARG B 1 411 ? 4.533   -2.672  1.398   1.00 25.80  ? 412 ARG B CB  1 
ATOM   7233 C  CG  . ARG B 1 411 ? 4.368   -2.482  -0.093  1.00 28.20  ? 412 ARG B CG  1 
ATOM   7234 C  CD  . ARG B 1 411 ? 4.332   -1.049  -0.499  1.00 31.69  ? 412 ARG B CD  1 
ATOM   7235 N  NE  . ARG B 1 411 ? 4.640   -0.930  -1.925  1.00 35.12  ? 412 ARG B NE  1 
ATOM   7236 C  CZ  . ARG B 1 411 ? 3.727   -0.841  -2.875  1.00 34.40  ? 412 ARG B CZ  1 
ATOM   7237 N  NH1 . ARG B 1 411 ? 2.446   -0.855  -2.559  1.00 35.87  ? 412 ARG B NH1 1 
ATOM   7238 N  NH2 . ARG B 1 411 ? 4.096   -0.720  -4.132  1.00 34.70  ? 412 ARG B NH2 1 
ATOM   7239 N  N   . ASN B 1 412 ? 6.511   -3.702  3.840   1.00 22.95  ? 413 ASN B N   1 
ATOM   7240 C  CA  . ASN B 1 412 ? 6.506   -4.284  5.189   1.00 21.93  ? 413 ASN B CA  1 
ATOM   7241 C  C   . ASN B 1 412 ? 7.614   -3.664  6.026   1.00 20.58  ? 413 ASN B C   1 
ATOM   7242 O  O   . ASN B 1 412 ? 8.686   -4.240  6.175   1.00 20.50  ? 413 ASN B O   1 
ATOM   7243 C  CB  . ASN B 1 412 ? 6.691   -5.808  5.114   1.00 22.43  ? 413 ASN B CB  1 
ATOM   7244 C  CG  . ASN B 1 412 ? 6.546   -6.499  6.481   1.00 24.29  ? 413 ASN B CG  1 
ATOM   7245 O  OD1 . ASN B 1 412 ? 5.836   -6.024  7.373   1.00 26.64  ? 413 ASN B OD1 1 
ATOM   7246 N  ND2 . ASN B 1 412 ? 7.212   -7.633  6.635   1.00 25.25  ? 413 ASN B ND2 1 
ATOM   7247 N  N   . LEU B 1 413 ? 7.356   -2.487  6.575   1.00 19.10  ? 414 LEU B N   1 
ATOM   7248 C  CA  . LEU B 1 413 ? 8.442   -1.680  7.117   1.00 18.36  ? 414 LEU B CA  1 
ATOM   7249 C  C   . LEU B 1 413 ? 8.302   -1.355  8.611   1.00 17.98  ? 414 LEU B C   1 
ATOM   7250 O  O   . LEU B 1 413 ? 9.101   -0.604  9.163   1.00 17.86  ? 414 LEU B O   1 
ATOM   7251 C  CB  . LEU B 1 413 ? 8.596   -0.403  6.274   1.00 17.98  ? 414 LEU B CB  1 
ATOM   7252 C  CG  . LEU B 1 413 ? 8.964   -0.577  4.791   1.00 17.84  ? 414 LEU B CG  1 
ATOM   7253 C  CD1 . LEU B 1 413 ? 8.824   0.730   4.026   1.00 18.69  ? 414 LEU B CD1 1 
ATOM   7254 C  CD2 . LEU B 1 413 ? 10.367  -1.105  4.653   1.00 18.03  ? 414 LEU B CD2 1 
ATOM   7255 N  N   . GLY B 1 414 ? 7.303   -1.949  9.255   1.00 17.68  ? 415 GLY B N   1 
ATOM   7256 C  CA  . GLY B 1 414 ? 7.006   -1.701  10.669  1.00 17.64  ? 415 GLY B CA  1 
ATOM   7257 C  C   . GLY B 1 414 ? 8.136   -1.962  11.657  1.00 17.43  ? 415 GLY B C   1 
ATOM   7258 O  O   . GLY B 1 414 ? 8.192   -1.334  12.720  1.00 17.63  ? 415 GLY B O   1 
ATOM   7259 N  N   . PHE B 1 415 ? 9.031   -2.881  11.305  1.00 17.03  ? 416 PHE B N   1 
ATOM   7260 C  CA  . PHE B 1 415 ? 10.199  -3.206  12.132  1.00 16.68  ? 416 PHE B CA  1 
ATOM   7261 C  C   . PHE B 1 415 ? 11.502  -2.718  11.506  1.00 16.99  ? 416 PHE B C   1 
ATOM   7262 O  O   . PHE B 1 415 ? 12.588  -3.091  11.956  1.00 16.84  ? 416 PHE B O   1 
ATOM   7263 C  CB  . PHE B 1 415 ? 10.299  -4.718  12.369  1.00 15.98  ? 416 PHE B CB  1 
ATOM   7264 C  CG  . PHE B 1 415 ? 9.192   -5.287  13.222  1.00 14.88  ? 416 PHE B CG  1 
ATOM   7265 C  CD1 . PHE B 1 415 ? 8.120   -5.957  12.631  1.00 13.99  ? 416 PHE B CD1 1 
ATOM   7266 C  CD2 . PHE B 1 415 ? 9.235   -5.181  14.614  1.00 13.65  ? 416 PHE B CD2 1 
ATOM   7267 C  CE1 . PHE B 1 415 ? 7.098   -6.508  13.406  1.00 13.53  ? 416 PHE B CE1 1 
ATOM   7268 C  CE2 . PHE B 1 415 ? 8.219   -5.728  15.404  1.00 13.38  ? 416 PHE B CE2 1 
ATOM   7269 C  CZ  . PHE B 1 415 ? 7.143   -6.394  14.797  1.00 14.01  ? 416 PHE B CZ  1 
ATOM   7270 N  N   . GLY B 1 416 ? 11.393  -1.884  10.470  1.00 16.96  ? 417 GLY B N   1 
ATOM   7271 C  CA  . GLY B 1 416 ? 12.557  -1.408  9.745   1.00 17.30  ? 417 GLY B CA  1 
ATOM   7272 C  C   . GLY B 1 416 ? 13.079  -2.435  8.759   1.00 18.00  ? 417 GLY B C   1 
ATOM   7273 O  O   . GLY B 1 416 ? 12.350  -3.349  8.366   1.00 17.60  ? 417 GLY B O   1 
ATOM   7274 N  N   . TRP B 1 417 ? 14.345  -2.296  8.370   1.00 18.57  ? 418 TRP B N   1 
ATOM   7275 C  CA  . TRP B 1 417 ? 14.922  -3.137  7.320   1.00 20.12  ? 418 TRP B CA  1 
ATOM   7276 C  C   . TRP B 1 417 ? 16.391  -3.393  7.592   1.00 19.80  ? 418 TRP B C   1 
ATOM   7277 O  O   . TRP B 1 417 ? 17.061  -2.576  8.231   1.00 19.93  ? 418 TRP B O   1 
ATOM   7278 C  CB  . TRP B 1 417 ? 14.762  -2.456  5.947   1.00 20.77  ? 418 TRP B CB  1 
ATOM   7279 C  CG  . TRP B 1 417 ? 15.190  -3.294  4.757   1.00 24.91  ? 418 TRP B CG  1 
ATOM   7280 C  CD1 . TRP B 1 417 ? 14.397  -4.124  4.017   1.00 27.01  ? 418 TRP B CD1 1 
ATOM   7281 C  CD2 . TRP B 1 417 ? 16.508  -3.370  4.166   1.00 28.56  ? 418 TRP B CD2 1 
ATOM   7282 N  NE1 . TRP B 1 417 ? 15.133  -4.716  3.011   1.00 29.15  ? 418 TRP B NE1 1 
ATOM   7283 C  CE2 . TRP B 1 417 ? 16.428  -4.271  3.077   1.00 29.36  ? 418 TRP B CE2 1 
ATOM   7284 C  CE3 . TRP B 1 417 ? 17.747  -2.777  4.462   1.00 30.30  ? 418 TRP B CE3 1 
ATOM   7285 C  CZ2 . TRP B 1 417 ? 17.540  -4.592  2.273   1.00 30.44  ? 418 TRP B CZ2 1 
ATOM   7286 C  CZ3 . TRP B 1 417 ? 18.858  -3.095  3.657   1.00 31.20  ? 418 TRP B CZ3 1 
ATOM   7287 C  CH2 . TRP B 1 417 ? 18.739  -3.996  2.578   1.00 31.24  ? 418 TRP B CH2 1 
ATOM   7288 N  N   . GLY B 1 418 ? 16.879  -4.533  7.109   1.00 19.53  ? 419 GLY B N   1 
ATOM   7289 C  CA  . GLY B 1 418 ? 18.313  -4.814  7.059   1.00 19.40  ? 419 GLY B CA  1 
ATOM   7290 C  C   . GLY B 1 418 ? 18.954  -5.089  8.393   1.00 19.49  ? 419 GLY B C   1 
ATOM   7291 O  O   . GLY B 1 418 ? 18.278  -5.442  9.363   1.00 19.69  ? 419 GLY B O   1 
ATOM   7292 N  N   . VAL B 1 419 ? 20.267  -4.900  8.439   1.00 19.50  ? 420 VAL B N   1 
ATOM   7293 C  CA  . VAL B 1 419 ? 21.094  -5.298  9.576   1.00 19.25  ? 420 VAL B CA  1 
ATOM   7294 C  C   . VAL B 1 419 ? 20.781  -4.526  10.883  1.00 18.88  ? 420 VAL B C   1 
ATOM   7295 O  O   . VAL B 1 419 ? 21.004  -5.037  11.981  1.00 18.29  ? 420 VAL B O   1 
ATOM   7296 C  CB  . VAL B 1 419 ? 22.608  -5.255  9.180   1.00 19.81  ? 420 VAL B CB  1 
ATOM   7297 C  CG1 . VAL B 1 419 ? 23.061  -3.836  8.849   1.00 19.18  ? 420 VAL B CG1 1 
ATOM   7298 C  CG2 . VAL B 1 419 ? 23.479  -5.861  10.255  1.00 21.34  ? 420 VAL B CG2 1 
ATOM   7299 N  N   . ARG B 1 420 ? 20.236  -3.314  10.762  1.00 18.19  ? 421 ARG B N   1 
ATOM   7300 C  CA  . ARG B 1 420 ? 19.875  -2.541  11.944  1.00 17.58  ? 421 ARG B CA  1 
ATOM   7301 C  C   . ARG B 1 420 ? 18.356  -2.383  12.136  1.00 17.34  ? 421 ARG B C   1 
ATOM   7302 O  O   . ARG B 1 420 ? 17.898  -1.442  12.785  1.00 17.30  ? 421 ARG B O   1 
ATOM   7303 C  CB  . ARG B 1 420 ? 20.602  -1.183  11.976  1.00 17.78  ? 421 ARG B CB  1 
ATOM   7304 C  CG  . ARG B 1 420 ? 20.546  -0.512  13.345  1.00 17.81  ? 421 ARG B CG  1 
ATOM   7305 C  CD  . ARG B 1 420 ? 21.580  0.571   13.514  1.00 18.12  ? 421 ARG B CD  1 
ATOM   7306 N  NE  . ARG B 1 420 ? 21.655  0.996   14.907  1.00 17.30  ? 421 ARG B NE  1 
ATOM   7307 C  CZ  . ARG B 1 420 ? 22.467  1.942   15.362  1.00 17.93  ? 421 ARG B CZ  1 
ATOM   7308 N  NH1 . ARG B 1 420 ? 23.286  2.583   14.536  1.00 17.93  ? 421 ARG B NH1 1 
ATOM   7309 N  NH2 . ARG B 1 420 ? 22.450  2.257   16.650  1.00 17.59  ? 421 ARG B NH2 1 
ATOM   7310 N  N   . GLN B 1 421 ? 17.585  -3.321  11.586  1.00 16.86  ? 422 GLN B N   1 
ATOM   7311 C  CA  . GLN B 1 421 ? 16.150  -3.408  11.849  1.00 16.69  ? 422 GLN B CA  1 
ATOM   7312 C  C   . GLN B 1 421 ? 15.920  -3.612  13.352  1.00 16.05  ? 422 GLN B C   1 
ATOM   7313 O  O   . GLN B 1 421 ? 16.867  -3.849  14.105  1.00 16.31  ? 422 GLN B O   1 
ATOM   7314 C  CB  . GLN B 1 421 ? 15.520  -4.564  11.054  1.00 16.58  ? 422 GLN B CB  1 
ATOM   7315 C  CG  . GLN B 1 421 ? 15.833  -5.947  11.618  1.00 18.79  ? 422 GLN B CG  1 
ATOM   7316 C  CD  . GLN B 1 421 ? 15.233  -7.077  10.797  1.00 22.73  ? 422 GLN B CD  1 
ATOM   7317 O  OE1 . GLN B 1 421 ? 14.012  -7.209  10.677  1.00 24.03  ? 422 GLN B OE1 1 
ATOM   7318 N  NE2 . GLN B 1 421 ? 16.093  -7.905  10.240  1.00 24.27  ? 422 GLN B NE2 1 
ATOM   7319 N  N   . CYS B 1 422 ? 14.667  -3.520  13.778  1.00 15.60  ? 423 CYS B N   1 
ATOM   7320 C  CA  . CYS B 1 422 ? 14.294  -3.785  15.162  1.00 15.09  ? 423 CYS B CA  1 
ATOM   7321 C  C   . CYS B 1 422 ? 15.032  -4.999  15.726  1.00 15.15  ? 423 CYS B C   1 
ATOM   7322 O  O   . CYS B 1 422 ? 14.941  -6.098  15.174  1.00 15.16  ? 423 CYS B O   1 
ATOM   7323 C  CB  . CYS B 1 422 ? 12.795  -4.028  15.272  1.00 14.56  ? 423 CYS B CB  1 
ATOM   7324 S  SG  . CYS B 1 422 ? 12.257  -4.333  16.985  1.00 13.64  ? 423 CYS B SG  1 
ATOM   7325 N  N   . LEU B 1 423 ? 15.752  -4.803  16.825  1.00 14.99  ? 424 LEU B N   1 
ATOM   7326 C  CA  . LEU B 1 423 ? 16.411  -5.927  17.489  1.00 15.15  ? 424 LEU B CA  1 
ATOM   7327 C  C   . LEU B 1 423 ? 15.379  -6.874  18.121  1.00 15.13  ? 424 LEU B C   1 
ATOM   7328 O  O   . LEU B 1 423 ? 15.609  -8.086  18.213  1.00 15.33  ? 424 LEU B O   1 
ATOM   7329 C  CB  . LEU B 1 423 ? 17.408  -5.441  18.550  1.00 14.69  ? 424 LEU B CB  1 
ATOM   7330 C  CG  . LEU B 1 423 ? 18.088  -6.529  19.389  1.00 15.69  ? 424 LEU B CG  1 
ATOM   7331 C  CD1 . LEU B 1 423 ? 19.069  -7.356  18.526  1.00 16.71  ? 424 LEU B CD1 1 
ATOM   7332 C  CD2 . LEU B 1 423 ? 18.787  -5.947  20.624  1.00 14.51  ? 424 LEU B CD2 1 
ATOM   7333 N  N   . GLY B 1 424 ? 14.255  -6.316  18.568  1.00 14.50  ? 425 GLY B N   1 
ATOM   7334 C  CA  . GLY B 1 424 ? 13.235  -7.109  19.237  1.00 14.29  ? 425 GLY B CA  1 
ATOM   7335 C  C   . GLY B 1 424 ? 12.217  -7.734  18.302  1.00 14.12  ? 425 GLY B C   1 
ATOM   7336 O  O   . GLY B 1 424 ? 11.190  -8.224  18.756  1.00 13.56  ? 425 GLY B O   1 
ATOM   7337 N  N   . ARG B 1 425 ? 12.504  -7.738  17.004  1.00 14.44  ? 426 ARG B N   1 
ATOM   7338 C  CA  . ARG B 1 425 ? 11.502  -8.144  16.014  1.00 15.28  ? 426 ARG B CA  1 
ATOM   7339 C  C   . ARG B 1 425 ? 10.937  -9.554  16.242  1.00 15.13  ? 426 ARG B C   1 
ATOM   7340 O  O   . ARG B 1 425 ? 9.718   -9.741  16.218  1.00 15.07  ? 426 ARG B O   1 
ATOM   7341 C  CB  . ARG B 1 425 ? 12.034  -8.006  14.581  1.00 15.44  ? 426 ARG B CB  1 
ATOM   7342 C  CG  . ARG B 1 425 ? 10.976  -8.343  13.520  1.00 16.26  ? 426 ARG B CG  1 
ATOM   7343 C  CD  . ARG B 1 425 ? 11.549  -8.365  12.118  1.00 17.29  ? 426 ARG B CD  1 
ATOM   7344 N  NE  . ARG B 1 425 ? 10.476  -8.400  11.124  1.00 19.24  ? 426 ARG B NE  1 
ATOM   7345 C  CZ  . ARG B 1 425 ? 10.566  -7.891  9.899   1.00 21.50  ? 426 ARG B CZ  1 
ATOM   7346 N  NH1 . ARG B 1 425 ? 11.684  -7.296  9.489   1.00 22.41  ? 426 ARG B NH1 1 
ATOM   7347 N  NH2 . ARG B 1 425 ? 9.532   -7.967  9.080   1.00 22.22  ? 426 ARG B NH2 1 
ATOM   7348 N  N   . ARG B 1 426 ? 11.812  -10.534 16.466  1.00 15.64  ? 427 ARG B N   1 
ATOM   7349 C  CA  . ARG B 1 426 ? 11.360  -11.922 16.689  1.00 16.01  ? 427 ARG B CA  1 
ATOM   7350 C  C   . ARG B 1 426 ? 10.600  -12.071 17.998  1.00 15.45  ? 427 ARG B C   1 
ATOM   7351 O  O   . ARG B 1 426 ? 9.590   -12.761 18.046  1.00 15.33  ? 427 ARG B O   1 
ATOM   7352 C  CB  . ARG B 1 426 ? 12.514  -12.924 16.622  1.00 16.31  ? 427 ARG B CB  1 
ATOM   7353 C  CG  . ARG B 1 426 ? 13.247  -12.963 15.289  1.00 18.48  ? 427 ARG B CG  1 
ATOM   7354 C  CD  . ARG B 1 426 ? 12.305  -13.028 14.077  1.00 24.44  ? 427 ARG B CD  1 
ATOM   7355 N  NE  . ARG B 1 426 ? 13.077  -12.923 12.839  1.00 29.82  ? 427 ARG B NE  1 
ATOM   7356 C  CZ  . ARG B 1 426 ? 12.632  -12.452 11.674  1.00 32.85  ? 427 ARG B CZ  1 
ATOM   7357 N  NH1 . ARG B 1 426 ? 11.380  -12.008 11.528  1.00 32.28  ? 427 ARG B NH1 1 
ATOM   7358 N  NH2 . ARG B 1 426 ? 13.463  -12.430 10.638  1.00 34.79  ? 427 ARG B NH2 1 
ATOM   7359 N  N   . ILE B 1 427 ? 11.081  -11.418 19.053  1.00 15.13  ? 428 ILE B N   1 
ATOM   7360 C  CA  . ILE B 1 427 ? 10.364  -11.408 20.324  1.00 14.91  ? 428 ILE B CA  1 
ATOM   7361 C  C   . ILE B 1 427 ? 8.959   -10.832 20.112  1.00 14.77  ? 428 ILE B C   1 
ATOM   7362 O  O   . ILE B 1 427 ? 7.963   -11.426 20.538  1.00 14.68  ? 428 ILE B O   1 
ATOM   7363 C  CB  . ILE B 1 427 ? 11.120  -10.603 21.408  1.00 14.71  ? 428 ILE B CB  1 
ATOM   7364 C  CG1 . ILE B 1 427 ? 12.455  -11.285 21.741  1.00 15.76  ? 428 ILE B CG1 1 
ATOM   7365 C  CG2 . ILE B 1 427 ? 10.269  -10.464 22.657  1.00 14.23  ? 428 ILE B CG2 1 
ATOM   7366 C  CD1 . ILE B 1 427 ? 13.357  -10.496 22.652  1.00 15.33  ? 428 ILE B CD1 1 
ATOM   7367 N  N   . ALA B 1 428 ? 8.901   -9.700  19.413  1.00 14.40  ? 429 ALA B N   1 
ATOM   7368 C  CA  . ALA B 1 428 ? 7.672   -8.955  19.205  1.00 14.56  ? 429 ALA B CA  1 
ATOM   7369 C  C   . ALA B 1 428 ? 6.671   -9.763  18.374  1.00 14.61  ? 429 ALA B C   1 
ATOM   7370 O  O   . ALA B 1 428 ? 5.512   -9.903  18.758  1.00 14.42  ? 429 ALA B O   1 
ATOM   7371 C  CB  . ALA B 1 428 ? 7.979   -7.592  18.545  1.00 14.36  ? 429 ALA B CB  1 
ATOM   7372 N  N   . GLU B 1 429 ? 7.130   -10.305 17.249  1.00 15.11  ? 430 GLU B N   1 
ATOM   7373 C  CA  . GLU B 1 429 ? 6.280   -11.133 16.386  1.00 15.57  ? 430 GLU B CA  1 
ATOM   7374 C  C   . GLU B 1 429 ? 5.742   -12.354 17.118  1.00 15.66  ? 430 GLU B C   1 
ATOM   7375 O  O   . GLU B 1 429 ? 4.546   -12.609 17.100  1.00 16.26  ? 430 GLU B O   1 
ATOM   7376 C  CB  . GLU B 1 429 ? 7.019   -11.560 15.125  1.00 15.36  ? 430 GLU B CB  1 
ATOM   7377 C  CG  . GLU B 1 429 ? 7.362   -10.400 14.220  1.00 16.42  ? 430 GLU B CG  1 
ATOM   7378 C  CD  . GLU B 1 429 ? 8.197   -10.808 13.011  1.00 17.65  ? 430 GLU B CD  1 
ATOM   7379 O  OE1 . GLU B 1 429 ? 8.970   -11.793 13.106  1.00 17.62  ? 430 GLU B OE1 1 
ATOM   7380 O  OE2 . GLU B 1 429 ? 8.075   -10.121 11.971  1.00 16.85  ? 430 GLU B OE2 1 
ATOM   7381 N  N   . LEU B 1 430 ? 6.619   -13.092 17.784  1.00 15.82  ? 431 LEU B N   1 
ATOM   7382 C  CA  . LEU B 1 430 ? 6.183   -14.241 18.575  1.00 15.82  ? 431 LEU B CA  1 
ATOM   7383 C  C   . LEU B 1 430 ? 5.205   -13.848 19.682  1.00 15.59  ? 431 LEU B C   1 
ATOM   7384 O  O   . LEU B 1 430 ? 4.164   -14.487 19.847  1.00 15.62  ? 431 LEU B O   1 
ATOM   7385 C  CB  . LEU B 1 430 ? 7.389   -14.995 19.148  1.00 15.67  ? 431 LEU B CB  1 
ATOM   7386 C  CG  . LEU B 1 430 ? 8.261   -15.720 18.122  1.00 16.15  ? 431 LEU B CG  1 
ATOM   7387 C  CD1 . LEU B 1 430 ? 9.568   -16.204 18.769  1.00 15.70  ? 431 LEU B CD1 1 
ATOM   7388 C  CD2 . LEU B 1 430 ? 7.488   -16.879 17.452  1.00 15.80  ? 431 LEU B CD2 1 
ATOM   7389 N  N   . GLU B 1 431 ? 5.533   -12.789 20.423  1.00 15.26  ? 432 GLU B N   1 
ATOM   7390 C  CA  . GLU B 1 431 ? 4.675   -12.308 21.499  1.00 15.16  ? 432 GLU B CA  1 
ATOM   7391 C  C   . GLU B 1 431 ? 3.263   -11.966 21.005  1.00 14.84  ? 432 GLU B C   1 
ATOM   7392 O  O   . GLU B 1 431 ? 2.273   -12.351 21.625  1.00 15.13  ? 432 GLU B O   1 
ATOM   7393 C  CB  . GLU B 1 431 ? 5.304   -11.081 22.175  1.00 15.45  ? 432 GLU B CB  1 
ATOM   7394 C  CG  . GLU B 1 431 ? 4.589   -10.618 23.430  1.00 15.62  ? 432 GLU B CG  1 
ATOM   7395 C  CD  . GLU B 1 431 ? 5.148   -9.305  23.961  1.00 18.75  ? 432 GLU B CD  1 
ATOM   7396 O  OE1 . GLU B 1 431 ? 6.378   -9.066  23.846  1.00 19.41  ? 432 GLU B OE1 1 
ATOM   7397 O  OE2 . GLU B 1 431 ? 4.354   -8.509  24.501  1.00 18.30  ? 432 GLU B OE2 1 
ATOM   7398 N  N   . MET B 1 432 ? 3.178   -11.236 19.899  1.00 14.50  ? 433 MET B N   1 
ATOM   7399 C  CA  . MET B 1 432 ? 1.890   -10.777 19.391  1.00 14.21  ? 433 MET B CA  1 
ATOM   7400 C  C   . MET B 1 432 ? 1.123   -11.915 18.744  1.00 14.05  ? 433 MET B C   1 
ATOM   7401 O  O   . MET B 1 432 ? -0.083  -12.019 18.933  1.00 13.83  ? 433 MET B O   1 
ATOM   7402 C  CB  . MET B 1 432 ? 2.061   -9.603  18.422  1.00 14.00  ? 433 MET B CB  1 
ATOM   7403 C  CG  . MET B 1 432 ? 2.530   -8.312  19.112  1.00 14.83  ? 433 MET B CG  1 
ATOM   7404 S  SD  . MET B 1 432 ? 2.641   -6.895  17.992  1.00 16.03  ? 433 MET B SD  1 
ATOM   7405 C  CE  . MET B 1 432 ? 3.994   -7.398  16.931  1.00 13.27  ? 433 MET B CE  1 
ATOM   7406 N  N   . THR B 1 433 ? 1.818   -12.785 18.012  1.00 14.04  ? 434 THR B N   1 
ATOM   7407 C  CA  . THR B 1 433 ? 1.135   -13.901 17.365  1.00 14.87  ? 434 THR B CA  1 
ATOM   7408 C  C   . THR B 1 433 ? 0.532   -14.841 18.402  1.00 14.81  ? 434 THR B C   1 
ATOM   7409 O  O   . THR B 1 433 ? -0.638  -15.199 18.299  1.00 15.12  ? 434 THR B O   1 
ATOM   7410 C  CB  . THR B 1 433 ? 2.019   -14.649 16.343  1.00 14.84  ? 434 THR B CB  1 
ATOM   7411 O  OG1 . THR B 1 433 ? 2.606   -13.701 15.441  1.00 15.20  ? 434 THR B OG1 1 
ATOM   7412 C  CG2 . THR B 1 433 ? 1.169   -15.615 15.543  1.00 14.72  ? 434 THR B CG2 1 
ATOM   7413 N  N   . ILE B 1 434 ? 1.312   -15.191 19.420  1.00 15.29  ? 435 ILE B N   1 
ATOM   7414 C  CA  . ILE B 1 434 ? 0.844   -16.064 20.503  1.00 15.53  ? 435 ILE B CA  1 
ATOM   7415 C  C   . ILE B 1 434 ? -0.270  -15.419 21.325  1.00 15.81  ? 435 ILE B C   1 
ATOM   7416 O  O   . ILE B 1 434 ? -1.237  -16.085 21.725  1.00 16.37  ? 435 ILE B O   1 
ATOM   7417 C  CB  . ILE B 1 434 ? 2.012   -16.510 21.418  1.00 15.76  ? 435 ILE B CB  1 
ATOM   7418 C  CG1 . ILE B 1 434 ? 2.983   -17.387 20.624  1.00 16.76  ? 435 ILE B CG1 1 
ATOM   7419 C  CG2 . ILE B 1 434 ? 1.491   -17.268 22.649  1.00 16.74  ? 435 ILE B CG2 1 
ATOM   7420 C  CD1 . ILE B 1 434 ? 4.355   -17.571 21.278  1.00 19.41  ? 435 ILE B CD1 1 
ATOM   7421 N  N   . PHE B 1 435 ? -0.146  -14.119 21.569  1.00 15.31  ? 436 PHE B N   1 
ATOM   7422 C  CA  . PHE B 1 435 ? -1.170  -13.399 22.306  1.00 14.84  ? 436 PHE B CA  1 
ATOM   7423 C  C   . PHE B 1 435 ? -2.488  -13.457 21.544  1.00 14.47  ? 436 PHE B C   1 
ATOM   7424 O  O   . PHE B 1 435 ? -3.549  -13.666 22.137  1.00 13.39  ? 436 PHE B O   1 
ATOM   7425 C  CB  . PHE B 1 435 ? -0.742  -11.940 22.515  1.00 14.54  ? 436 PHE B CB  1 
ATOM   7426 C  CG  . PHE B 1 435 ? -1.828  -11.048 23.054  1.00 15.03  ? 436 PHE B CG  1 
ATOM   7427 C  CD1 . PHE B 1 435 ? -1.979  -10.863 24.430  1.00 14.97  ? 436 PHE B CD1 1 
ATOM   7428 C  CD2 . PHE B 1 435 ? -2.683  -10.365 22.189  1.00 14.35  ? 436 PHE B CD2 1 
ATOM   7429 C  CE1 . PHE B 1 435 ? -2.975  -10.023 24.934  1.00 15.31  ? 436 PHE B CE1 1 
ATOM   7430 C  CE2 . PHE B 1 435 ? -3.683  -9.525  22.684  1.00 15.87  ? 436 PHE B CE2 1 
ATOM   7431 C  CZ  . PHE B 1 435 ? -3.825  -9.350  24.067  1.00 15.00  ? 436 PHE B CZ  1 
ATOM   7432 N  N   . LEU B 1 436 ? -2.405  -13.262 20.230  1.00 14.41  ? 437 LEU B N   1 
ATOM   7433 C  CA  . LEU B 1 436 ? -3.607  -13.176 19.405  1.00 14.99  ? 437 LEU B CA  1 
ATOM   7434 C  C   . LEU B 1 436 ? -4.269  -14.543 19.210  1.00 14.89  ? 437 LEU B C   1 
ATOM   7435 O  O   . LEU B 1 436 ? -5.488  -14.617 19.141  1.00 15.35  ? 437 LEU B O   1 
ATOM   7436 C  CB  . LEU B 1 436 ? -3.336  -12.454 18.074  1.00 14.62  ? 437 LEU B CB  1 
ATOM   7437 C  CG  . LEU B 1 436 ? -3.012  -10.941 18.205  1.00 15.01  ? 437 LEU B CG  1 
ATOM   7438 C  CD1 . LEU B 1 436 ? -2.442  -10.361 16.909  1.00 12.15  ? 437 LEU B CD1 1 
ATOM   7439 C  CD2 . LEU B 1 436 ? -4.215  -10.101 18.699  1.00 14.45  ? 437 LEU B CD2 1 
ATOM   7440 N  N   . ILE B 1 437 ? -3.467  -15.605 19.142  1.00 15.00  ? 438 ILE B N   1 
ATOM   7441 C  CA  . ILE B 1 437 ? -3.978  -16.982 19.159  1.00 15.21  ? 438 ILE B CA  1 
ATOM   7442 C  C   . ILE B 1 437 ? -4.805  -17.212 20.421  1.00 15.63  ? 438 ILE B C   1 
ATOM   7443 O  O   . ILE B 1 437 ? -5.948  -17.672 20.351  1.00 15.47  ? 438 ILE B O   1 
ATOM   7444 C  CB  . ILE B 1 437 ? -2.824  -18.041 19.087  1.00 15.44  ? 438 ILE B CB  1 
ATOM   7445 C  CG1 . ILE B 1 437 ? -2.258  -18.129 17.659  1.00 14.54  ? 438 ILE B CG1 1 
ATOM   7446 C  CG2 . ILE B 1 437 ? -3.308  -19.428 19.560  1.00 14.95  ? 438 ILE B CG2 1 
ATOM   7447 C  CD1 . ILE B 1 437 ? -1.031  -19.004 17.534  1.00 14.45  ? 438 ILE B CD1 1 
ATOM   7448 N  N   . ASN B 1 438 ? -4.227  -16.872 21.574  1.00 15.81  ? 439 ASN B N   1 
ATOM   7449 C  CA  . ASN B 1 438 ? -4.918  -17.054 22.849  1.00 16.11  ? 439 ASN B CA  1 
ATOM   7450 C  C   . ASN B 1 438 ? -6.205  -16.248 22.945  1.00 15.84  ? 439 ASN B C   1 
ATOM   7451 O  O   . ASN B 1 438 ? -7.236  -16.769 23.387  1.00 15.70  ? 439 ASN B O   1 
ATOM   7452 C  CB  . ASN B 1 438 ? -3.983  -16.768 24.023  1.00 16.05  ? 439 ASN B CB  1 
ATOM   7453 C  CG  . ASN B 1 438 ? -3.074  -17.943 24.323  1.00 17.13  ? 439 ASN B CG  1 
ATOM   7454 O  OD1 . ASN B 1 438 ? -3.507  -18.946 24.901  1.00 19.57  ? 439 ASN B OD1 1 
ATOM   7455 N  ND2 . ASN B 1 438 ? -1.818  -17.838 23.922  1.00 14.98  ? 439 ASN B ND2 1 
ATOM   7456 N  N   . MET B 1 439 ? -6.147  -14.995 22.501  1.00 15.85  ? 440 MET B N   1 
ATOM   7457 C  CA  . MET B 1 439 ? -7.305  -14.109 22.527  1.00 16.04  ? 440 MET B CA  1 
ATOM   7458 C  C   . MET B 1 439 ? -8.418  -14.590 21.586  1.00 16.65  ? 440 MET B C   1 
ATOM   7459 O  O   . MET B 1 439 ? -9.573  -14.710 22.003  1.00 16.72  ? 440 MET B O   1 
ATOM   7460 C  CB  . MET B 1 439 ? -6.897  -12.661 22.228  1.00 15.95  ? 440 MET B CB  1 
ATOM   7461 C  CG  . MET B 1 439 ? -6.102  -11.986 23.366  1.00 16.01  ? 440 MET B CG  1 
ATOM   7462 S  SD  . MET B 1 439 ? -7.085  -11.675 24.848  1.00 17.48  ? 440 MET B SD  1 
ATOM   7463 C  CE  . MET B 1 439 ? -8.141  -10.370 24.223  1.00 17.38  ? 440 MET B CE  1 
ATOM   7464 N  N   . LEU B 1 440 ? -8.060  -14.892 20.336  1.00 16.88  ? 441 LEU B N   1 
ATOM   7465 C  CA  . LEU B 1 440 ? -9.022  -15.364 19.343  1.00 17.67  ? 441 LEU B CA  1 
ATOM   7466 C  C   . LEU B 1 440 ? -9.736  -16.672 19.744  1.00 18.19  ? 441 LEU B C   1 
ATOM   7467 O  O   . LEU B 1 440 ? -10.924 -16.828 19.486  1.00 18.68  ? 441 LEU B O   1 
ATOM   7468 C  CB  . LEU B 1 440 ? -8.360  -15.492 17.965  1.00 17.35  ? 441 LEU B CB  1 
ATOM   7469 C  CG  . LEU B 1 440 ? -8.139  -14.151 17.250  1.00 17.94  ? 441 LEU B CG  1 
ATOM   7470 C  CD1 . LEU B 1 440 ? -7.244  -14.302 16.037  1.00 17.03  ? 441 LEU B CD1 1 
ATOM   7471 C  CD2 . LEU B 1 440 ? -9.472  -13.482 16.868  1.00 17.94  ? 441 LEU B CD2 1 
ATOM   7472 N  N   . GLU B 1 441 ? -9.007  -17.591 20.374  1.00 18.63  ? 442 GLU B N   1 
ATOM   7473 C  CA  . GLU B 1 441 ? -9.585  -18.833 20.898  1.00 19.36  ? 442 GLU B CA  1 
ATOM   7474 C  C   . GLU B 1 441 ? -10.589 -18.620 22.043  1.00 19.18  ? 442 GLU B C   1 
ATOM   7475 O  O   . GLU B 1 441 ? -11.440 -19.475 22.274  1.00 19.19  ? 442 GLU B O   1 
ATOM   7476 C  CB  . GLU B 1 441 ? -8.482  -19.789 21.371  1.00 19.48  ? 442 GLU B CB  1 
ATOM   7477 C  CG  . GLU B 1 441 ? -7.759  -20.498 20.250  1.00 20.76  ? 442 GLU B CG  1 
ATOM   7478 C  CD  . GLU B 1 441 ? -6.569  -21.323 20.718  1.00 22.73  ? 442 GLU B CD  1 
ATOM   7479 O  OE1 . GLU B 1 441 ? -5.953  -20.993 21.756  1.00 24.22  ? 442 GLU B OE1 1 
ATOM   7480 O  OE2 . GLU B 1 441 ? -6.229  -22.301 20.024  1.00 23.93  ? 442 GLU B OE2 1 
ATOM   7481 N  N   . ASN B 1 442 ? -10.498 -17.486 22.736  1.00 19.04  ? 443 ASN B N   1 
ATOM   7482 C  CA  . ASN B 1 442 ? -11.263 -17.272 23.969  1.00 19.02  ? 443 ASN B CA  1 
ATOM   7483 C  C   . ASN B 1 442 ? -12.330 -16.184 23.946  1.00 19.07  ? 443 ASN B C   1 
ATOM   7484 O  O   . ASN B 1 442 ? -13.317 -16.270 24.693  1.00 19.10  ? 443 ASN B O   1 
ATOM   7485 C  CB  . ASN B 1 442 ? -10.304 -17.014 25.133  1.00 18.87  ? 443 ASN B CB  1 
ATOM   7486 C  CG  . ASN B 1 442 ? -9.653  -18.287 25.632  1.00 20.27  ? 443 ASN B CG  1 
ATOM   7487 O  OD1 . ASN B 1 442 ? -10.213 -18.989 26.478  1.00 21.35  ? 443 ASN B OD1 1 
ATOM   7488 N  ND2 . ASN B 1 442 ? -8.467  -18.596 25.111  1.00 19.41  ? 443 ASN B ND2 1 
ATOM   7489 N  N   . PHE B 1 443 ? -12.138 -15.150 23.127  1.00 18.59  ? 444 PHE B N   1 
ATOM   7490 C  CA  . PHE B 1 443 ? -13.073 -14.022 23.142  1.00 18.91  ? 444 PHE B CA  1 
ATOM   7491 C  C   . PHE B 1 443 ? -13.446 -13.505 21.761  1.00 19.25  ? 444 PHE B C   1 
ATOM   7492 O  O   . PHE B 1 443 ? -12.681 -13.630 20.800  1.00 18.68  ? 444 PHE B O   1 
ATOM   7493 C  CB  . PHE B 1 443 ? -12.530 -12.841 23.968  1.00 18.41  ? 444 PHE B CB  1 
ATOM   7494 C  CG  . PHE B 1 443 ? -11.932 -13.230 25.293  1.00 18.38  ? 444 PHE B CG  1 
ATOM   7495 C  CD1 . PHE B 1 443 ? -10.550 -13.314 25.442  1.00 17.02  ? 444 PHE B CD1 1 
ATOM   7496 C  CD2 . PHE B 1 443 ? -12.742 -13.498 26.391  1.00 18.20  ? 444 PHE B CD2 1 
ATOM   7497 C  CE1 . PHE B 1 443 ? -9.977  -13.671 26.658  1.00 16.82  ? 444 PHE B CE1 1 
ATOM   7498 C  CE2 . PHE B 1 443 ? -12.175 -13.854 27.625  1.00 18.26  ? 444 PHE B CE2 1 
ATOM   7499 C  CZ  . PHE B 1 443 ? -10.785 -13.947 27.752  1.00 17.60  ? 444 PHE B CZ  1 
ATOM   7500 N  N   . ARG B 1 444 ? -14.635 -12.920 21.696  1.00 20.18  ? 445 ARG B N   1 
ATOM   7501 C  CA  . ARG B 1 444 ? -15.038 -12.052 20.606  1.00 21.35  ? 445 ARG B CA  1 
ATOM   7502 C  C   . ARG B 1 444 ? -14.828 -10.633 21.095  1.00 21.27  ? 445 ARG B C   1 
ATOM   7503 O  O   . ARG B 1 444 ? -15.167 -10.311 22.244  1.00 21.15  ? 445 ARG B O   1 
ATOM   7504 C  CB  . ARG B 1 444 ? -16.519 -12.274 20.263  1.00 21.94  ? 445 ARG B CB  1 
ATOM   7505 C  CG  . ARG B 1 444 ? -16.800 -13.561 19.489  1.00 24.83  ? 445 ARG B CG  1 
ATOM   7506 C  CD  . ARG B 1 444 ? -18.272 -13.651 19.047  1.00 30.55  ? 445 ARG B CD  1 
ATOM   7507 N  NE  . ARG B 1 444 ? -18.430 -14.471 17.839  1.00 34.56  ? 445 ARG B NE  1 
ATOM   7508 C  CZ  . ARG B 1 444 ? -18.790 -15.755 17.835  1.00 37.59  ? 445 ARG B CZ  1 
ATOM   7509 N  NH1 . ARG B 1 444 ? -19.044 -16.392 18.976  1.00 39.82  ? 445 ARG B NH1 1 
ATOM   7510 N  NH2 . ARG B 1 444 ? -18.901 -16.411 16.685  1.00 38.74  ? 445 ARG B NH2 1 
ATOM   7511 N  N   . VAL B 1 445 ? -14.270 -9.789  20.233  1.00 21.61  ? 446 VAL B N   1 
ATOM   7512 C  CA  . VAL B 1 445 ? -13.929 -8.416  20.593  1.00 22.10  ? 446 VAL B CA  1 
ATOM   7513 C  C   . VAL B 1 445 ? -14.808 -7.403  19.866  1.00 22.68  ? 446 VAL B C   1 
ATOM   7514 O  O   . VAL B 1 445 ? -14.942 -7.462  18.640  1.00 22.26  ? 446 VAL B O   1 
ATOM   7515 C  CB  . VAL B 1 445 ? -12.445 -8.092  20.277  1.00 22.05  ? 446 VAL B CB  1 
ATOM   7516 C  CG1 . VAL B 1 445 ? -12.019 -6.838  21.020  1.00 20.92  ? 446 VAL B CG1 1 
ATOM   7517 C  CG2 . VAL B 1 445 ? -11.547 -9.262  20.640  1.00 22.81  ? 446 VAL B CG2 1 
ATOM   7518 N  N   . GLU B 1 446 ? -15.384 -6.473  20.628  1.00 23.62  ? 447 GLU B N   1 
ATOM   7519 C  CA  . GLU B 1 446 ? -16.198 -5.378  20.076  1.00 25.53  ? 447 GLU B CA  1 
ATOM   7520 C  C   . GLU B 1 446 ? -15.777 -3.998  20.579  1.00 25.97  ? 447 GLU B C   1 
ATOM   7521 O  O   . GLU B 1 446 ? -15.170 -3.866  21.645  1.00 25.48  ? 447 GLU B O   1 
ATOM   7522 C  CB  . GLU B 1 446 ? -17.683 -5.571  20.404  1.00 25.65  ? 447 GLU B CB  1 
ATOM   7523 C  CG  . GLU B 1 446 ? -18.283 -6.866  19.870  1.00 29.41  ? 447 GLU B CG  1 
ATOM   7524 C  CD  . GLU B 1 446 ? -19.797 -6.960  20.047  1.00 33.25  ? 447 GLU B CD  1 
ATOM   7525 O  OE1 . GLU B 1 446 ? -20.339 -6.393  21.034  1.00 34.97  ? 447 GLU B OE1 1 
ATOM   7526 O  OE2 . GLU B 1 446 ? -20.431 -7.621  19.191  1.00 34.85  ? 447 GLU B OE2 1 
ATOM   7527 N  N   . ILE B 1 447 ? -16.132 -2.986  19.794  1.00 27.25  ? 448 ILE B N   1 
ATOM   7528 C  CA  . ILE B 1 447 ? -16.021 -1.576  20.164  1.00 29.20  ? 448 ILE B CA  1 
ATOM   7529 C  C   . ILE B 1 447 ? -17.367 -0.888  19.899  1.00 30.82  ? 448 ILE B C   1 
ATOM   7530 O  O   . ILE B 1 447 ? -18.216 -1.436  19.203  1.00 30.69  ? 448 ILE B O   1 
ATOM   7531 C  CB  . ILE B 1 447 ? -14.900 -0.846  19.362  1.00 28.86  ? 448 ILE B CB  1 
ATOM   7532 C  CG1 . ILE B 1 447 ? -15.095 -1.047  17.845  1.00 29.08  ? 448 ILE B CG1 1 
ATOM   7533 C  CG2 . ILE B 1 447 ? -13.500 -1.275  19.851  1.00 28.04  ? 448 ILE B CG2 1 
ATOM   7534 C  CD1 . ILE B 1 447 ? -14.243 -0.133  16.949  1.00 29.82  ? 448 ILE B CD1 1 
ATOM   7535 N  N   . GLN B 1 448 ? -17.547 0.309   20.449  1.00 33.41  ? 449 GLN B N   1 
ATOM   7536 C  CA  . GLN B 1 448 ? -18.751 1.122   20.236  1.00 35.89  ? 449 GLN B CA  1 
ATOM   7537 C  C   . GLN B 1 448 ? -18.976 1.445   18.754  1.00 37.32  ? 449 GLN B C   1 
ATOM   7538 O  O   . GLN B 1 448 ? -18.027 1.768   18.021  1.00 37.24  ? 449 GLN B O   1 
ATOM   7539 C  CB  . GLN B 1 448 ? -18.662 2.412   21.052  1.00 36.04  ? 449 GLN B CB  1 
ATOM   7540 C  CG  . GLN B 1 448 ? -18.760 2.199   22.559  1.00 37.98  ? 449 GLN B CG  1 
ATOM   7541 C  CD  . GLN B 1 448 ? -17.743 3.034   23.349  1.00 41.26  ? 449 GLN B CD  1 
ATOM   7542 O  OE1 . GLN B 1 448 ? -18.116 3.876   24.177  1.00 41.35  ? 449 GLN B OE1 1 
ATOM   7543 N  NE2 . GLN B 1 448 ? -16.453 2.798   23.095  1.00 40.60  ? 449 GLN B NE2 1 
ATOM   7544 N  N   . HIS B 1 449 ? -20.243 1.359   18.340  1.00 39.25  ? 450 HIS B N   1 
ATOM   7545 C  CA  . HIS B 1 449 ? -20.667 1.399   16.927  1.00 41.09  ? 450 HIS B CA  1 
ATOM   7546 C  C   . HIS B 1 449 ? -19.961 2.435   16.046  1.00 41.67  ? 450 HIS B C   1 
ATOM   7547 O  O   . HIS B 1 449 ? -19.609 2.137   14.889  1.00 42.05  ? 450 HIS B O   1 
ATOM   7548 C  CB  . HIS B 1 449 ? -22.195 1.564   16.827  1.00 41.56  ? 450 HIS B CB  1 
ATOM   7549 C  CG  . HIS B 1 449 ? -22.700 1.730   15.424  1.00 44.11  ? 450 HIS B CG  1 
ATOM   7550 N  ND1 . HIS B 1 449 ? -22.999 0.659   14.606  1.00 46.18  ? 450 HIS B ND1 1 
ATOM   7551 C  CD2 . HIS B 1 449 ? -22.963 2.844   14.695  1.00 45.83  ? 450 HIS B CD2 1 
ATOM   7552 C  CE1 . HIS B 1 449 ? -23.420 1.105   13.434  1.00 46.67  ? 450 HIS B CE1 1 
ATOM   7553 N  NE2 . HIS B 1 449 ? -23.406 2.428   13.462  1.00 47.05  ? 450 HIS B NE2 1 
ATOM   7554 N  N   . LEU B 1 450 ? -19.764 3.643   16.579  1.00 41.95  ? 451 LEU B N   1 
ATOM   7555 C  CA  . LEU B 1 450 ? -19.105 4.711   15.816  1.00 42.17  ? 451 LEU B CA  1 
ATOM   7556 C  C   . LEU B 1 450 ? -17.597 4.447   15.690  1.00 41.71  ? 451 LEU B C   1 
ATOM   7557 O  O   . LEU B 1 450 ? -17.159 3.790   14.746  1.00 42.09  ? 451 LEU B O   1 
ATOM   7558 C  CB  . LEU B 1 450 ? -19.402 6.098   16.423  1.00 42.61  ? 451 LEU B CB  1 
ATOM   7559 C  CG  . LEU B 1 450 ? -20.860 6.599   16.430  1.00 43.56  ? 451 LEU B CG  1 
ATOM   7560 C  CD1 . LEU B 1 450 ? -20.971 7.952   17.150  1.00 44.47  ? 451 LEU B CD1 1 
ATOM   7561 C  CD2 . LEU B 1 450 ? -21.465 6.677   15.019  1.00 43.90  ? 451 LEU B CD2 1 
ATOM   7562 N  N   . SER B 1 451 ? -16.823 4.959   16.645  1.00 40.98  ? 452 SER B N   1 
ATOM   7563 C  CA  . SER B 1 451 ? -15.384 4.699   16.767  1.00 39.79  ? 452 SER B CA  1 
ATOM   7564 C  C   . SER B 1 451 ? -14.543 4.959   15.503  1.00 38.69  ? 452 SER B C   1 
ATOM   7565 O  O   . SER B 1 451 ? -14.356 4.074   14.655  1.00 38.98  ? 452 SER B O   1 
ATOM   7566 C  CB  . SER B 1 451 ? -15.139 3.290   17.315  1.00 39.82  ? 452 SER B CB  1 
ATOM   7567 O  OG  . SER B 1 451 ? -14.080 3.301   18.254  1.00 40.58  ? 452 SER B OG  1 
ATOM   7568 N  N   . ASP B 1 452 ? -14.061 6.189   15.384  1.00 36.93  ? 453 ASP B N   1 
ATOM   7569 C  CA  . ASP B 1 452 ? -13.003 6.531   14.439  1.00 35.44  ? 453 ASP B CA  1 
ATOM   7570 C  C   . ASP B 1 452 ? -11.871 7.141   15.257  1.00 33.23  ? 453 ASP B C   1 
ATOM   7571 O  O   . ASP B 1 452 ? -11.807 8.358   15.436  1.00 33.20  ? 453 ASP B O   1 
ATOM   7572 C  CB  . ASP B 1 452 ? -13.489 7.534   13.386  1.00 36.35  ? 453 ASP B CB  1 
ATOM   7573 C  CG  . ASP B 1 452 ? -13.982 6.870   12.107  1.00 38.65  ? 453 ASP B CG  1 
ATOM   7574 O  OD1 . ASP B 1 452 ? -14.311 5.658   12.119  1.00 41.15  ? 453 ASP B OD1 1 
ATOM   7575 O  OD2 . ASP B 1 452 ? -14.050 7.582   11.077  1.00 41.12  ? 453 ASP B OD2 1 
ATOM   7576 N  N   . VAL B 1 453 ? -11.000 6.283   15.777  1.00 30.43  ? 454 VAL B N   1 
ATOM   7577 C  CA  . VAL B 1 453 ? -9.915  6.717   16.643  1.00 27.54  ? 454 VAL B CA  1 
ATOM   7578 C  C   . VAL B 1 453 ? -8.689  7.077   15.800  1.00 26.16  ? 454 VAL B C   1 
ATOM   7579 O  O   . VAL B 1 453 ? -8.145  6.240   15.079  1.00 25.25  ? 454 VAL B O   1 
ATOM   7580 C  CB  . VAL B 1 453 ? -9.566  5.629   17.686  1.00 27.74  ? 454 VAL B CB  1 
ATOM   7581 C  CG1 . VAL B 1 453 ? -8.408  6.075   18.584  1.00 25.95  ? 454 VAL B CG1 1 
ATOM   7582 C  CG2 . VAL B 1 453 ? -10.796 5.283   18.515  1.00 27.06  ? 454 VAL B CG2 1 
ATOM   7583 N  N   . GLY B 1 454 ? -8.273  8.336   15.886  1.00 24.69  ? 455 GLY B N   1 
ATOM   7584 C  CA  . GLY B 1 454 ? -7.076  8.795   15.191  1.00 22.96  ? 455 GLY B CA  1 
ATOM   7585 C  C   . GLY B 1 454 ? -5.815  8.505   15.982  1.00 21.63  ? 455 GLY B C   1 
ATOM   7586 O  O   . GLY B 1 454 ? -5.834  7.783   16.983  1.00 21.48  ? 455 GLY B O   1 
ATOM   7587 N  N   . THR B 1 455 ? -4.724  9.113   15.538  1.00 20.41  ? 456 THR B N   1 
ATOM   7588 C  CA  . THR B 1 455 ? -3.391  8.839   16.044  1.00 18.94  ? 456 THR B CA  1 
ATOM   7589 C  C   . THR B 1 455 ? -2.785  10.108  16.638  1.00 18.38  ? 456 THR B C   1 
ATOM   7590 O  O   . THR B 1 455 ? -2.992  11.203  16.117  1.00 18.31  ? 456 THR B O   1 
ATOM   7591 C  CB  . THR B 1 455 ? -2.507  8.337   14.885  1.00 18.68  ? 456 THR B CB  1 
ATOM   7592 O  OG1 . THR B 1 455 ? -3.051  7.110   14.380  1.00 18.10  ? 456 THR B OG1 1 
ATOM   7593 C  CG2 . THR B 1 455 ? -1.059  8.129   15.314  1.00 17.20  ? 456 THR B CG2 1 
ATOM   7594 N  N   . THR B 1 456 ? -2.021  9.956   17.712  1.00 17.57  ? 457 THR B N   1 
ATOM   7595 C  CA  . THR B 1 456 ? -1.251  11.070  18.252  1.00 17.50  ? 457 THR B CA  1 
ATOM   7596 C  C   . THR B 1 456 ? 0.242   10.717  18.365  1.00 16.83  ? 457 THR B C   1 
ATOM   7597 O  O   . THR B 1 456 ? 0.606   9.566   18.595  1.00 17.00  ? 457 THR B O   1 
ATOM   7598 C  CB  . THR B 1 456 ? -1.853  11.600  19.597  1.00 17.66  ? 457 THR B CB  1 
ATOM   7599 O  OG1 . THR B 1 456 ? -1.189  12.806  19.975  1.00 20.09  ? 457 THR B OG1 1 
ATOM   7600 C  CG2 . THR B 1 456 ? -1.704  10.594  20.734  1.00 18.35  ? 457 THR B CG2 1 
ATOM   7601 N  N   . PHE B 1 457 ? 1.108   11.702  18.173  1.00 16.09  ? 458 PHE B N   1 
ATOM   7602 C  CA  . PHE B 1 457 ? 2.547   11.471  18.260  1.00 15.19  ? 458 PHE B CA  1 
ATOM   7603 C  C   . PHE B 1 457 ? 3.089   11.829  19.651  1.00 15.51  ? 458 PHE B C   1 
ATOM   7604 O  O   . PHE B 1 457 ? 3.122   13.004  20.032  1.00 15.72  ? 458 PHE B O   1 
ATOM   7605 C  CB  . PHE B 1 457 ? 3.270   12.256  17.162  1.00 14.66  ? 458 PHE B CB  1 
ATOM   7606 C  CG  . PHE B 1 457 ? 4.764   12.225  17.267  1.00 13.51  ? 458 PHE B CG  1 
ATOM   7607 C  CD1 . PHE B 1 457 ? 5.488   11.177  16.726  1.00 12.34  ? 458 PHE B CD1 1 
ATOM   7608 C  CD2 . PHE B 1 457 ? 5.459   13.265  17.893  1.00 13.12  ? 458 PHE B CD2 1 
ATOM   7609 C  CE1 . PHE B 1 457 ? 6.891   11.156  16.805  1.00 12.27  ? 458 PHE B CE1 1 
ATOM   7610 C  CE2 . PHE B 1 457 ? 6.856   13.250  17.977  1.00 12.15  ? 458 PHE B CE2 1 
ATOM   7611 C  CZ  . PHE B 1 457 ? 7.571   12.192  17.437  1.00 11.21  ? 458 PHE B CZ  1 
ATOM   7612 N  N   . ASN B 1 458 ? 3.478   10.801  20.407  1.00 15.73  ? 459 ASN B N   1 
ATOM   7613 C  CA  . ASN B 1 458 ? 4.158   10.955  21.698  1.00 16.02  ? 459 ASN B CA  1 
ATOM   7614 C  C   . ASN B 1 458 ? 5.501   10.262  21.636  1.00 15.70  ? 459 ASN B C   1 
ATOM   7615 O  O   . ASN B 1 458 ? 5.780   9.347   22.414  1.00 15.51  ? 459 ASN B O   1 
ATOM   7616 C  CB  . ASN B 1 458 ? 3.315   10.362  22.833  1.00 16.58  ? 459 ASN B CB  1 
ATOM   7617 C  CG  . ASN B 1 458 ? 2.122   11.229  23.181  1.00 18.30  ? 459 ASN B CG  1 
ATOM   7618 O  OD1 . ASN B 1 458 ? 2.248   12.445  23.322  1.00 20.19  ? 459 ASN B OD1 1 
ATOM   7619 N  ND2 . ASN B 1 458 ? 0.954   10.606  23.315  1.00 19.93  ? 459 ASN B ND2 1 
ATOM   7620 N  N   . LEU B 1 459 ? 6.318   10.711  20.686  1.00 15.57  ? 460 LEU B N   1 
ATOM   7621 C  CA  . LEU B 1 459 ? 7.563   10.057  20.277  1.00 15.54  ? 460 LEU B CA  1 
ATOM   7622 C  C   . LEU B 1 459 ? 7.320   8.708   19.601  1.00 15.38  ? 460 LEU B C   1 
ATOM   7623 O  O   . LEU B 1 459 ? 7.775   8.480   18.479  1.00 15.27  ? 460 LEU B O   1 
ATOM   7624 C  CB  . LEU B 1 459 ? 8.621   9.992   21.391  1.00 15.56  ? 460 LEU B CB  1 
ATOM   7625 C  CG  . LEU B 1 459 ? 9.926   9.884   20.594  1.00 17.86  ? 460 LEU B CG  1 
ATOM   7626 C  CD1 . LEU B 1 459 ? 10.850  11.106  20.707  1.00 16.39  ? 460 LEU B CD1 1 
ATOM   7627 C  CD2 . LEU B 1 459 ? 10.637  8.539   20.782  1.00 17.25  ? 460 LEU B CD2 1 
ATOM   7628 N  N   . ILE B 1 460 ? 6.604   7.815   20.267  1.00 15.36  ? 461 ILE B N   1 
ATOM   7629 C  CA  . ILE B 1 460 ? 5.998   6.710   19.548  1.00 15.82  ? 461 ILE B CA  1 
ATOM   7630 C  C   . ILE B 1 460 ? 4.599   7.157   19.148  1.00 15.49  ? 461 ILE B C   1 
ATOM   7631 O  O   . ILE B 1 460 ? 4.000   8.011   19.819  1.00 15.35  ? 461 ILE B O   1 
ATOM   7632 C  CB  . ILE B 1 460 ? 5.939   5.402   20.371  1.00 16.36  ? 461 ILE B CB  1 
ATOM   7633 C  CG1 . ILE B 1 460 ? 5.102   5.591   21.643  1.00 17.49  ? 461 ILE B CG1 1 
ATOM   7634 C  CG2 . ILE B 1 460 ? 7.361   4.897   20.690  1.00 16.45  ? 461 ILE B CG2 1 
ATOM   7635 C  CD1 . ILE B 1 460 ? 4.577   4.289   22.225  1.00 19.59  ? 461 ILE B CD1 1 
ATOM   7636 N  N   . LEU B 1 461 ? 4.091   6.612   18.051  1.00 14.68  ? 462 LEU B N   1 
ATOM   7637 C  CA  . LEU B 1 461 ? 2.705   6.863   17.661  1.00 14.74  ? 462 LEU B CA  1 
ATOM   7638 C  C   . LEU B 1 461 ? 1.746   6.029   18.509  1.00 14.94  ? 462 LEU B C   1 
ATOM   7639 O  O   . LEU B 1 461 ? 2.045   4.883   18.863  1.00 13.46  ? 462 LEU B O   1 
ATOM   7640 C  CB  . LEU B 1 461 ? 2.480   6.589   16.168  1.00 13.93  ? 462 LEU B CB  1 
ATOM   7641 C  CG  . LEU B 1 461 ? 3.158   7.519   15.151  1.00 14.11  ? 462 LEU B CG  1 
ATOM   7642 C  CD1 . LEU B 1 461 ? 2.985   6.979   13.723  1.00 13.33  ? 462 LEU B CD1 1 
ATOM   7643 C  CD2 . LEU B 1 461 ? 2.655   8.968   15.237  1.00 13.37  ? 462 LEU B CD2 1 
ATOM   7644 N  N   . MET B 1 462 ? 0.590   6.616   18.828  1.00 15.75  ? 463 MET B N   1 
ATOM   7645 C  CA  . MET B 1 462 ? -0.414  5.938   19.639  1.00 17.07  ? 463 MET B CA  1 
ATOM   7646 C  C   . MET B 1 462 ? -1.818  6.519   19.415  1.00 17.30  ? 463 MET B C   1 
ATOM   7647 O  O   . MET B 1 462 ? -1.955  7.573   18.772  1.00 17.10  ? 463 MET B O   1 
ATOM   7648 C  CB  . MET B 1 462 ? -0.022  5.995   21.114  1.00 17.73  ? 463 MET B CB  1 
ATOM   7649 C  CG  . MET B 1 462 ? 0.243   7.388   21.634  1.00 21.12  ? 463 MET B CG  1 
ATOM   7650 S  SD  . MET B 1 462 ? 0.881   7.430   23.330  1.00 29.27  ? 463 MET B SD  1 
ATOM   7651 C  CE  . MET B 1 462 ? 1.752   5.881   23.489  1.00 26.07  ? 463 MET B CE  1 
ATOM   7652 N  N   . PRO B 1 463 ? -2.864  5.833   19.927  1.00 17.21  ? 464 PRO B N   1 
ATOM   7653 C  CA  . PRO B 1 463 ? -4.231  6.337   19.762  1.00 17.86  ? 464 PRO B CA  1 
ATOM   7654 C  C   . PRO B 1 463 ? -4.368  7.739   20.333  1.00 18.52  ? 464 PRO B C   1 
ATOM   7655 O  O   . PRO B 1 463 ? -3.771  8.044   21.370  1.00 17.92  ? 464 PRO B O   1 
ATOM   7656 C  CB  . PRO B 1 463 ? -5.076  5.362   20.587  1.00 17.51  ? 464 PRO B CB  1 
ATOM   7657 C  CG  . PRO B 1 463 ? -4.254  4.149   20.715  1.00 17.57  ? 464 PRO B CG  1 
ATOM   7658 C  CD  . PRO B 1 463 ? -2.830  4.586   20.713  1.00 17.17  ? 464 PRO B CD  1 
ATOM   7659 N  N   . GLU B 1 464 ? -5.131  8.580   19.645  1.00 19.43  ? 465 GLU B N   1 
ATOM   7660 C  CA  . GLU B 1 464 ? -5.352  9.960   20.081  1.00 20.84  ? 465 GLU B CA  1 
ATOM   7661 C  C   . GLU B 1 464 ? -6.204  10.034  21.343  1.00 20.48  ? 465 GLU B C   1 
ATOM   7662 O  O   . GLU B 1 464 ? -6.111  10.990  22.089  1.00 20.52  ? 465 GLU B O   1 
ATOM   7663 C  CB  . GLU B 1 464 ? -6.011  10.783  18.966  1.00 21.40  ? 465 GLU B CB  1 
ATOM   7664 C  CG  . GLU B 1 464 ? -7.436  10.334  18.634  1.00 25.23  ? 465 GLU B CG  1 
ATOM   7665 C  CD  . GLU B 1 464 ? -8.076  11.144  17.521  1.00 30.78  ? 465 GLU B CD  1 
ATOM   7666 O  OE1 . GLU B 1 464 ? -9.102  10.675  16.966  1.00 31.69  ? 465 GLU B OE1 1 
ATOM   7667 O  OE2 . GLU B 1 464 ? -7.553  12.242  17.204  1.00 32.55  ? 465 GLU B OE2 1 
ATOM   7668 N  N   . LYS B 1 465 ? -7.051  9.029   21.554  1.00 20.75  ? 466 LYS B N   1 
ATOM   7669 C  CA  . LYS B 1 465 ? -7.943  8.979   22.709  1.00 20.77  ? 466 LYS B CA  1 
ATOM   7670 C  C   . LYS B 1 465 ? -8.075  7.511   23.134  1.00 20.31  ? 466 LYS B C   1 
ATOM   7671 O  O   . LYS B 1 465 ? -7.643  6.623   22.391  1.00 20.05  ? 466 LYS B O   1 
ATOM   7672 C  CB  . LYS B 1 465 ? -9.306  9.602   22.369  1.00 21.24  ? 466 LYS B CB  1 
ATOM   7673 C  CG  . LYS B 1 465 ? -10.107 8.846   21.299  1.00 23.25  ? 466 LYS B CG  1 
ATOM   7674 C  CD  . LYS B 1 465 ? -11.425 9.561   20.996  1.00 27.03  ? 466 LYS B CD  1 
ATOM   7675 C  CE  . LYS B 1 465 ? -12.190 8.897   19.848  1.00 29.02  ? 466 LYS B CE  1 
ATOM   7676 N  NZ  . LYS B 1 465 ? -13.293 9.788   19.349  1.00 30.55  ? 466 LYS B NZ  1 
ATOM   7677 N  N   . PRO B 1 466 ? -8.627  7.251   24.336  1.00 19.65  ? 467 PRO B N   1 
ATOM   7678 C  CA  . PRO B 1 466 ? -8.729  5.863   24.790  1.00 19.13  ? 467 PRO B CA  1 
ATOM   7679 C  C   . PRO B 1 466 ? -9.701  5.004   23.979  1.00 18.76  ? 467 PRO B C   1 
ATOM   7680 O  O   . PRO B 1 466 ? -10.692 5.503   23.435  1.00 18.13  ? 467 PRO B O   1 
ATOM   7681 C  CB  . PRO B 1 466 ? -9.216  5.998   26.237  1.00 19.08  ? 467 PRO B CB  1 
ATOM   7682 C  CG  . PRO B 1 466 ? -8.720  7.336   26.676  1.00 19.36  ? 467 PRO B CG  1 
ATOM   7683 C  CD  . PRO B 1 466 ? -8.851  8.204   25.444  1.00 19.98  ? 467 PRO B CD  1 
ATOM   7684 N  N   . ILE B 1 467 ? -9.389  3.713   23.907  1.00 18.42  ? 468 ILE B N   1 
ATOM   7685 C  CA  . ILE B 1 467 ? -10.247 2.742   23.258  1.00 18.25  ? 468 ILE B CA  1 
ATOM   7686 C  C   . ILE B 1 467 ? -10.825 1.821   24.316  1.00 18.30  ? 468 ILE B C   1 
ATOM   7687 O  O   . ILE B 1 467 ? -10.087 1.172   25.054  1.00 18.24  ? 468 ILE B O   1 
ATOM   7688 C  CB  . ILE B 1 467 ? -9.481  1.916   22.196  1.00 18.21  ? 468 ILE B CB  1 
ATOM   7689 C  CG1 . ILE B 1 467 ? -8.866  2.847   21.140  1.00 17.84  ? 468 ILE B CG1 1 
ATOM   7690 C  CG2 . ILE B 1 467 ? -10.400 0.872   21.558  1.00 17.64  ? 468 ILE B CG2 1 
ATOM   7691 C  CD1 . ILE B 1 467 ? -7.661  2.260   20.424  1.00 17.72  ? 468 ILE B CD1 1 
ATOM   7692 N  N   . SER B 1 468 ? -12.152 1.769   24.373  1.00 18.23  ? 469 SER B N   1 
ATOM   7693 C  CA  . SER B 1 468 ? -12.848 0.912   25.311  1.00 18.28  ? 469 SER B CA  1 
ATOM   7694 C  C   . SER B 1 468 ? -13.405 -0.305  24.568  1.00 18.02  ? 469 SER B C   1 
ATOM   7695 O  O   . SER B 1 468 ? -14.250 -0.167  23.671  1.00 17.92  ? 469 SER B O   1 
ATOM   7696 C  CB  . SER B 1 468 ? -13.966 1.695   26.010  1.00 18.63  ? 469 SER B CB  1 
ATOM   7697 O  OG  . SER B 1 468 ? -14.598 0.900   27.006  1.00 20.63  ? 469 SER B OG  1 
ATOM   7698 N  N   . PHE B 1 469 ? -12.905 -1.488  24.926  1.00 17.39  ? 470 PHE B N   1 
ATOM   7699 C  CA  . PHE B 1 469 ? -13.340 -2.742  24.322  1.00 16.83  ? 470 PHE B CA  1 
ATOM   7700 C  C   . PHE B 1 469 ? -14.428 -3.421  25.144  1.00 17.35  ? 470 PHE B C   1 
ATOM   7701 O  O   . PHE B 1 469 ? -14.504 -3.247  26.359  1.00 17.28  ? 470 PHE B O   1 
ATOM   7702 C  CB  . PHE B 1 469 ? -12.168 -3.723  24.222  1.00 16.33  ? 470 PHE B CB  1 
ATOM   7703 C  CG  . PHE B 1 469 ? -11.084 -3.299  23.276  1.00 15.01  ? 470 PHE B CG  1 
ATOM   7704 C  CD1 . PHE B 1 469 ? -9.898  -2.760  23.760  1.00 15.05  ? 470 PHE B CD1 1 
ATOM   7705 C  CD2 . PHE B 1 469 ? -11.239 -3.449  21.907  1.00 14.00  ? 470 PHE B CD2 1 
ATOM   7706 C  CE1 . PHE B 1 469 ? -8.882  -2.368  22.894  1.00 14.60  ? 470 PHE B CE1 1 
ATOM   7707 C  CE2 . PHE B 1 469 ? -10.231 -3.068  21.029  1.00 14.82  ? 470 PHE B CE2 1 
ATOM   7708 C  CZ  . PHE B 1 469 ? -9.047  -2.519  21.525  1.00 14.92  ? 470 PHE B CZ  1 
ATOM   7709 N  N   . THR B 1 470 ? -15.241 -4.228  24.469  1.00 17.99  ? 471 THR B N   1 
ATOM   7710 C  CA  . THR B 1 470 ? -16.117 -5.191  25.122  1.00 18.36  ? 471 THR B CA  1 
ATOM   7711 C  C   . THR B 1 470 ? -15.677 -6.595  24.710  1.00 18.74  ? 471 THR B C   1 
ATOM   7712 O  O   . THR B 1 470 ? -15.548 -6.889  23.514  1.00 19.07  ? 471 THR B O   1 
ATOM   7713 C  CB  . THR B 1 470 ? -17.605 -4.975  24.740  1.00 18.49  ? 471 THR B CB  1 
ATOM   7714 O  OG1 . THR B 1 470 ? -18.007 -3.648  25.100  1.00 18.23  ? 471 THR B OG1 1 
ATOM   7715 C  CG2 . THR B 1 470 ? -18.502 -5.979  25.458  1.00 18.65  ? 471 THR B CG2 1 
ATOM   7716 N  N   . PHE B 1 471 ? -15.445 -7.454  25.698  1.00 18.98  ? 472 PHE B N   1 
ATOM   7717 C  CA  . PHE B 1 471 ? -15.049 -8.835  25.453  1.00 19.59  ? 472 PHE B CA  1 
ATOM   7718 C  C   . PHE B 1 471 ? -16.181 -9.798  25.803  1.00 20.49  ? 472 PHE B C   1 
ATOM   7719 O  O   . PHE B 1 471 ? -16.747 -9.728  26.896  1.00 19.92  ? 472 PHE B O   1 
ATOM   7720 C  CB  . PHE B 1 471 ? -13.790 -9.188  26.251  1.00 19.55  ? 472 PHE B CB  1 
ATOM   7721 C  CG  . PHE B 1 471 ? -12.585 -8.360  25.886  1.00 19.52  ? 472 PHE B CG  1 
ATOM   7722 C  CD1 . PHE B 1 471 ? -12.282 -7.208  26.597  1.00 18.54  ? 472 PHE B CD1 1 
ATOM   7723 C  CD2 . PHE B 1 471 ? -11.775 -8.720  24.812  1.00 18.81  ? 472 PHE B CD2 1 
ATOM   7724 C  CE1 . PHE B 1 471 ? -11.180 -6.434  26.260  1.00 19.42  ? 472 PHE B CE1 1 
ATOM   7725 C  CE2 . PHE B 1 471 ? -10.672 -7.953  24.464  1.00 19.09  ? 472 PHE B CE2 1 
ATOM   7726 C  CZ  . PHE B 1 471 ? -10.370 -6.806  25.194  1.00 18.84  ? 472 PHE B CZ  1 
ATOM   7727 N  N   . TRP B 1 472 ? -16.504 -10.678 24.855  1.00 21.84  ? 473 TRP B N   1 
ATOM   7728 C  CA  . TRP B 1 472 ? -17.482 -11.757 25.049  1.00 23.58  ? 473 TRP B CA  1 
ATOM   7729 C  C   . TRP B 1 472 ? -16.748 -13.083 24.971  1.00 24.57  ? 473 TRP B C   1 
ATOM   7730 O  O   . TRP B 1 472 ? -15.957 -13.283 24.054  1.00 24.39  ? 473 TRP B O   1 
ATOM   7731 C  CB  . TRP B 1 472 ? -18.563 -11.737 23.953  1.00 23.44  ? 473 TRP B CB  1 
ATOM   7732 C  CG  . TRP B 1 472 ? -19.317 -10.456 23.847  1.00 24.44  ? 473 TRP B CG  1 
ATOM   7733 C  CD1 . TRP B 1 472 ? -18.963 -9.352  23.125  1.00 25.27  ? 473 TRP B CD1 1 
ATOM   7734 C  CD2 . TRP B 1 472 ? -20.563 -10.143 24.475  1.00 25.94  ? 473 TRP B CD2 1 
ATOM   7735 N  NE1 . TRP B 1 472 ? -19.909 -8.365  23.270  1.00 26.37  ? 473 TRP B NE1 1 
ATOM   7736 C  CE2 . TRP B 1 472 ? -20.903 -8.824  24.094  1.00 26.55  ? 473 TRP B CE2 1 
ATOM   7737 C  CE3 . TRP B 1 472 ? -21.427 -10.848 25.325  1.00 26.80  ? 473 TRP B CE3 1 
ATOM   7738 C  CZ2 . TRP B 1 472 ? -22.066 -8.194  24.533  1.00 27.46  ? 473 TRP B CZ2 1 
ATOM   7739 C  CZ3 . TRP B 1 472 ? -22.583 -10.221 25.767  1.00 28.35  ? 473 TRP B CZ3 1 
ATOM   7740 C  CH2 . TRP B 1 472 ? -22.893 -8.905  25.368  1.00 28.94  ? 473 TRP B CH2 1 
ATOM   7741 N  N   . PRO B 1 473 ? -17.013 -14.002 25.919  1.00 26.06  ? 474 PRO B N   1 
ATOM   7742 C  CA  . PRO B 1 473 ? -16.396 -15.325 25.832  1.00 27.34  ? 474 PRO B CA  1 
ATOM   7743 C  C   . PRO B 1 473 ? -16.865 -16.044 24.576  1.00 28.82  ? 474 PRO B C   1 
ATOM   7744 O  O   . PRO B 1 473 ? -18.061 -16.074 24.298  1.00 28.88  ? 474 PRO B O   1 
ATOM   7745 C  CB  . PRO B 1 473 ? -16.913 -16.059 27.082  1.00 27.34  ? 474 PRO B CB  1 
ATOM   7746 C  CG  . PRO B 1 473 ? -17.574 -15.030 27.932  1.00 26.79  ? 474 PRO B CG  1 
ATOM   7747 C  CD  . PRO B 1 473 ? -17.982 -13.909 27.025  1.00 26.12  ? 474 PRO B CD  1 
ATOM   7748 N  N   . PHE B 1 474 ? -15.925 -16.598 23.814  1.00 30.77  ? 475 PHE B N   1 
ATOM   7749 C  CA  . PHE B 1 474 ? -16.259 -17.357 22.607  1.00 32.29  ? 475 PHE B CA  1 
ATOM   7750 C  C   . PHE B 1 474 ? -16.677 -18.790 22.960  1.00 33.57  ? 475 PHE B C   1 
ATOM   7751 O  O   . PHE B 1 474 ? -15.895 -19.538 23.563  1.00 33.70  ? 475 PHE B O   1 
ATOM   7752 C  CB  . PHE B 1 474 ? -15.090 -17.338 21.611  1.00 32.04  ? 475 PHE B CB  1 
ATOM   7753 C  CG  . PHE B 1 474 ? -15.289 -18.241 20.426  1.00 32.05  ? 475 PHE B CG  1 
ATOM   7754 C  CD1 . PHE B 1 474 ? -16.247 -17.940 19.458  1.00 32.16  ? 475 PHE B CD1 1 
ATOM   7755 C  CD2 . PHE B 1 474 ? -14.517 -19.390 20.273  1.00 31.19  ? 475 PHE B CD2 1 
ATOM   7756 C  CE1 . PHE B 1 474 ? -16.437 -18.780 18.355  1.00 32.10  ? 475 PHE B CE1 1 
ATOM   7757 C  CE2 . PHE B 1 474 ? -14.699 -20.233 19.181  1.00 31.35  ? 475 PHE B CE2 1 
ATOM   7758 C  CZ  . PHE B 1 474 ? -15.662 -19.929 18.220  1.00 31.37  ? 475 PHE B CZ  1 
ATOM   7759 N  N   . ASN B 1 475 ? -17.910 -19.144 22.569  1.00 35.14  ? 476 ASN B N   1 
ATOM   7760 C  CA  . ASN B 1 475 ? -18.592 -20.428 22.901  1.00 36.39  ? 476 ASN B CA  1 
ATOM   7761 C  C   . ASN B 1 475 ? -19.377 -20.412 24.220  1.00 36.75  ? 476 ASN B C   1 
ATOM   7762 O  O   . ASN B 1 475 ? -19.800 -19.353 24.701  1.00 37.24  ? 476 ASN B O   1 
ATOM   7763 C  CB  . ASN B 1 475 ? -17.641 -21.641 22.870  1.00 36.71  ? 476 ASN B CB  1 
ATOM   7764 C  CG  . ASN B 1 475 ? -17.432 -22.192 21.467  1.00 38.20  ? 476 ASN B CG  1 
ATOM   7765 O  OD1 . ASN B 1 475 ? -18.272 -22.008 20.578  1.00 39.83  ? 476 ASN B OD1 1 
ATOM   7766 N  ND2 . ASN B 1 475 ? -16.307 -22.883 21.263  1.00 38.83  ? 476 ASN B ND2 1 
ATOM   7767 N  N   . GLY C 2 43  ? -51.982 12.262  69.976  1.00 77.86  ? 44  GLY C N   1 
ATOM   7768 C  CA  . GLY C 2 43  ? -50.635 12.509  69.383  1.00 77.93  ? 44  GLY C CA  1 
ATOM   7769 C  C   . GLY C 2 43  ? -49.655 11.398  69.710  1.00 77.95  ? 44  GLY C C   1 
ATOM   7770 O  O   . GLY C 2 43  ? -48.869 11.510  70.657  1.00 77.93  ? 44  GLY C O   1 
ATOM   7771 N  N   . ALA C 2 44  ? -49.702 10.329  68.915  1.00 77.97  ? 45  ALA C N   1 
ATOM   7772 C  CA  . ALA C 2 44  ? -48.902 9.124   69.154  1.00 77.97  ? 45  ALA C CA  1 
ATOM   7773 C  C   . ALA C 2 44  ? -47.383 9.357   69.086  1.00 78.04  ? 45  ALA C C   1 
ATOM   7774 O  O   . ALA C 2 44  ? -46.669 9.046   70.040  1.00 77.99  ? 45  ALA C O   1 
ATOM   7775 C  CB  . ALA C 2 44  ? -49.333 8.005   68.213  1.00 77.88  ? 45  ALA C CB  1 
ATOM   7776 N  N   . CYS C 2 45  ? -46.897 9.918   67.977  1.00 78.11  ? 46  CYS C N   1 
ATOM   7777 C  CA  . CYS C 2 45  ? -45.466 10.232  67.835  1.00 78.19  ? 46  CYS C CA  1 
ATOM   7778 C  C   . CYS C 2 45  ? -45.049 11.451  68.674  1.00 78.35  ? 46  CYS C C   1 
ATOM   7779 O  O   . CYS C 2 45  ? -43.852 11.717  68.847  1.00 78.21  ? 46  CYS C O   1 
ATOM   7780 C  CB  . CYS C 2 45  ? -45.087 10.433  66.361  1.00 78.18  ? 46  CYS C CB  1 
ATOM   7781 S  SG  . CYS C 2 45  ? -45.687 11.971  65.604  1.00 77.55  ? 46  CYS C SG  1 
ATOM   7782 N  N   . GLU C 2 46  ? -46.057 12.165  69.184  1.00 78.56  ? 47  GLU C N   1 
ATOM   7783 C  CA  . GLU C 2 46  ? -45.912 13.347  70.055  1.00 78.82  ? 47  GLU C CA  1 
ATOM   7784 C  C   . GLU C 2 46  ? -45.366 14.599  69.347  1.00 78.84  ? 47  GLU C C   1 
ATOM   7785 O  O   . GLU C 2 46  ? -44.425 15.246  69.820  1.00 78.79  ? 47  GLU C O   1 
ATOM   7786 C  CB  . GLU C 2 46  ? -45.149 13.020  71.356  1.00 78.91  ? 47  GLU C CB  1 
ATOM   7787 C  CG  . GLU C 2 46  ? -45.918 12.096  72.311  1.00 79.24  ? 47  GLU C CG  1 
ATOM   7788 C  CD  . GLU C 2 46  ? -45.395 12.138  73.740  1.00 79.80  ? 47  GLU C CD  1 
ATOM   7789 O  OE1 . GLU C 2 46  ? -44.174 11.941  73.942  1.00 80.02  ? 47  GLU C OE1 1 
ATOM   7790 O  OE2 . GLU C 2 46  ? -46.212 12.356  74.667  1.00 79.79  ? 47  GLU C OE2 1 
ATOM   7791 N  N   . GLY C 2 47  ? -45.984 14.931  68.213  1.00 78.86  ? 48  GLY C N   1 
ATOM   7792 C  CA  . GLY C 2 47  ? -45.710 16.176  67.495  1.00 78.97  ? 48  GLY C CA  1 
ATOM   7793 C  C   . GLY C 2 47  ? -44.401 16.227  66.729  1.00 79.08  ? 48  GLY C C   1 
ATOM   7794 O  O   . GLY C 2 47  ? -43.688 17.233  66.788  1.00 79.10  ? 48  GLY C O   1 
ATOM   7795 N  N   . THR C 2 48  ? -44.090 15.152  66.003  1.00 79.11  ? 49  THR C N   1 
ATOM   7796 C  CA  . THR C 2 48  ? -42.837 15.060  65.240  1.00 79.13  ? 49  THR C CA  1 
ATOM   7797 C  C   . THR C 2 48  ? -43.033 14.763  63.750  1.00 79.27  ? 49  THR C C   1 
ATOM   7798 O  O   . THR C 2 48  ? -42.057 14.700  62.998  1.00 79.23  ? 49  THR C O   1 
ATOM   7799 C  CB  . THR C 2 48  ? -41.868 14.003  65.835  1.00 79.10  ? 49  THR C CB  1 
ATOM   7800 O  OG1 . THR C 2 48  ? -42.562 12.763  66.034  1.00 78.91  ? 49  THR C OG1 1 
ATOM   7801 C  CG2 . THR C 2 48  ? -41.274 14.483  67.158  1.00 78.77  ? 49  THR C CG2 1 
ATOM   7802 N  N   . LEU C 2 49  ? -44.291 14.591  63.335  1.00 79.54  ? 50  LEU C N   1 
ATOM   7803 C  CA  . LEU C 2 49  ? -44.650 14.182  61.965  1.00 79.82  ? 50  LEU C CA  1 
ATOM   7804 C  C   . LEU C 2 49  ? -44.095 12.781  61.638  1.00 80.04  ? 50  LEU C C   1 
ATOM   7805 O  O   . LEU C 2 49  ? -43.350 12.596  60.672  1.00 80.05  ? 50  LEU C O   1 
ATOM   7806 C  CB  . LEU C 2 49  ? -44.219 15.247  60.933  1.00 79.79  ? 50  LEU C CB  1 
ATOM   7807 C  CG  . LEU C 2 49  ? -44.735 15.252  59.485  1.00 79.85  ? 50  LEU C CG  1 
ATOM   7808 C  CD1 . LEU C 2 49  ? -46.253 15.362  59.403  1.00 79.77  ? 50  LEU C CD1 1 
ATOM   7809 C  CD2 . LEU C 2 49  ? -44.078 16.381  58.695  1.00 79.74  ? 50  LEU C CD2 1 
ATOM   7810 N  N   . ALA C 2 50  ? -44.466 11.805  62.468  1.00 80.34  ? 51  ALA C N   1 
ATOM   7811 C  CA  . ALA C 2 50  ? -44.008 10.416  62.330  1.00 80.65  ? 51  ALA C CA  1 
ATOM   7812 C  C   . ALA C 2 50  ? -45.148 9.398   62.498  1.00 80.88  ? 51  ALA C C   1 
ATOM   7813 O  O   . ALA C 2 50  ? -44.909 8.231   62.837  1.00 80.88  ? 51  ALA C O   1 
ATOM   7814 C  CB  . ALA C 2 50  ? -42.873 10.129  63.317  1.00 80.57  ? 51  ALA C CB  1 
ATOM   7815 N  N   . CYS C 2 51  ? -46.379 9.862   62.265  1.00 81.20  ? 52  CYS C N   1 
ATOM   7816 C  CA  . CYS C 2 51  ? -47.593 9.033   62.275  1.00 81.51  ? 52  CYS C CA  1 
ATOM   7817 C  C   . CYS C 2 51  ? -48.763 9.846   61.703  1.00 81.82  ? 52  CYS C C   1 
ATOM   7818 O  O   . CYS C 2 51  ? -48.546 10.876  61.060  1.00 81.83  ? 52  CYS C O   1 
ATOM   7819 C  CB  . CYS C 2 51  ? -47.917 8.521   63.689  1.00 81.45  ? 52  CYS C CB  1 
ATOM   7820 S  SG  . CYS C 2 51  ? -48.810 9.681   64.760  1.00 81.21  ? 52  CYS C SG  1 
ATOM   7821 N  N   . SER C 2 52  ? -49.993 9.387   61.931  1.00 82.23  ? 53  SER C N   1 
ATOM   7822 C  CA  . SER C 2 52  ? -51.181 10.114  61.471  1.00 82.61  ? 53  SER C CA  1 
ATOM   7823 C  C   . SER C 2 52  ? -52.408 9.939   62.383  1.00 82.87  ? 53  SER C C   1 
ATOM   7824 O  O   . SER C 2 52  ? -53.544 9.864   61.901  1.00 82.98  ? 53  SER C O   1 
ATOM   7825 C  CB  . SER C 2 52  ? -51.513 9.753   60.012  1.00 82.65  ? 53  SER C CB  1 
ATOM   7826 O  OG  . SER C 2 52  ? -51.531 8.348   59.807  1.00 82.72  ? 53  SER C OG  1 
ATOM   7827 N  N   . THR C 2 53  ? -52.173 9.889   63.695  1.00 83.11  ? 54  THR C N   1 
ATOM   7828 C  CA  . THR C 2 53  ? -53.262 9.769   64.674  1.00 83.25  ? 54  THR C CA  1 
ATOM   7829 C  C   . THR C 2 53  ? -53.966 11.106  64.916  1.00 83.34  ? 54  THR C C   1 
ATOM   7830 O  O   . THR C 2 53  ? -55.172 11.142  65.176  1.00 83.35  ? 54  THR C O   1 
ATOM   7831 C  CB  . THR C 2 53  ? -52.788 9.173   66.029  1.00 83.28  ? 54  THR C CB  1 
ATOM   7832 O  OG1 . THR C 2 53  ? -51.763 10.000  66.597  1.00 83.21  ? 54  THR C OG1 1 
ATOM   7833 C  CG2 . THR C 2 53  ? -52.263 7.747   65.845  1.00 83.21  ? 54  THR C CG2 1 
ATOM   7834 N  N   . CYS C 2 54  ? -53.206 12.196  64.828  1.00 83.46  ? 55  CYS C N   1 
ATOM   7835 C  CA  . CYS C 2 54  ? -53.746 13.545  64.989  1.00 83.62  ? 55  CYS C CA  1 
ATOM   7836 C  C   . CYS C 2 54  ? -54.418 14.022  63.703  1.00 83.57  ? 55  CYS C C   1 
ATOM   7837 O  O   . CYS C 2 54  ? -55.633 14.262  63.678  1.00 83.66  ? 55  CYS C O   1 
ATOM   7838 C  CB  . CYS C 2 54  ? -52.635 14.517  65.386  1.00 83.61  ? 55  CYS C CB  1 
ATOM   7839 S  SG  . CYS C 2 54  ? -51.401 14.774  64.087  1.00 84.20  ? 55  CYS C SG  1 
ATOM   7840 N  N   . ASP C 2 71  ? -44.730 18.430  51.325  1.00 78.99  ? 72  ASP C N   1 
ATOM   7841 C  CA  . ASP C 2 71  ? -44.518 17.130  50.690  1.00 79.03  ? 72  ASP C CA  1 
ATOM   7842 C  C   . ASP C 2 71  ? -44.579 15.986  51.704  1.00 79.13  ? 72  ASP C C   1 
ATOM   7843 O  O   . ASP C 2 71  ? -45.177 14.944  51.433  1.00 79.09  ? 72  ASP C O   1 
ATOM   7844 C  CB  . ASP C 2 71  ? -43.171 17.090  49.952  1.00 78.95  ? 72  ASP C CB  1 
ATOM   7845 C  CG  . ASP C 2 71  ? -43.052 18.155  48.866  1.00 78.76  ? 72  ASP C CG  1 
ATOM   7846 O  OD1 . ASP C 2 71  ? -43.864 18.156  47.914  1.00 78.53  ? 72  ASP C OD1 1 
ATOM   7847 O  OD2 . ASP C 2 71  ? -42.119 18.981  48.954  1.00 78.32  ? 72  ASP C OD2 1 
ATOM   7848 N  N   . GLU C 2 72  ? -43.954 16.189  52.864  1.00 79.32  ? 73  GLU C N   1 
ATOM   7849 C  CA  . GLU C 2 72  ? -43.844 15.154  53.900  1.00 79.50  ? 73  GLU C CA  1 
ATOM   7850 C  C   . GLU C 2 72  ? -45.166 14.915  54.631  1.00 79.63  ? 73  GLU C C   1 
ATOM   7851 O  O   . GLU C 2 72  ? -45.532 13.767  54.895  1.00 79.54  ? 73  GLU C O   1 
ATOM   7852 C  CB  . GLU C 2 72  ? -42.724 15.492  54.899  1.00 79.49  ? 73  GLU C CB  1 
ATOM   7853 C  CG  . GLU C 2 72  ? -41.300 15.256  54.380  1.00 79.53  ? 73  GLU C CG  1 
ATOM   7854 C  CD  . GLU C 2 72  ? -40.891 16.219  53.265  1.00 79.76  ? 73  GLU C CD  1 
ATOM   7855 O  OE1 . GLU C 2 72  ? -41.064 17.449  53.430  1.00 79.17  ? 73  GLU C OE1 1 
ATOM   7856 O  OE2 . GLU C 2 72  ? -40.393 15.739  52.222  1.00 79.57  ? 73  GLU C OE2 1 
ATOM   7857 N  N   . GLU C 2 73  ? -45.870 16.002  54.954  1.00 79.85  ? 74  GLU C N   1 
ATOM   7858 C  CA  . GLU C 2 73  ? -47.207 15.927  55.553  1.00 80.08  ? 74  GLU C CA  1 
ATOM   7859 C  C   . GLU C 2 73  ? -48.209 15.381  54.538  1.00 80.16  ? 74  GLU C C   1 
ATOM   7860 O  O   . GLU C 2 73  ? -49.159 14.688  54.903  1.00 80.13  ? 74  GLU C O   1 
ATOM   7861 C  CB  . GLU C 2 73  ? -47.653 17.307  56.056  1.00 80.13  ? 74  GLU C CB  1 
ATOM   7862 C  CG  . GLU C 2 73  ? -48.995 17.322  56.790  1.00 80.11  ? 74  GLU C CG  1 
ATOM   7863 C  CD  . GLU C 2 73  ? -49.487 18.726  57.106  1.00 80.21  ? 74  GLU C CD  1 
ATOM   7864 O  OE1 . GLU C 2 73  ? -49.219 19.654  56.312  1.00 80.24  ? 74  GLU C OE1 1 
ATOM   7865 O  OE2 . GLU C 2 73  ? -50.155 18.898  58.148  1.00 80.12  ? 74  GLU C OE2 1 
ATOM   7866 N  N   . ASN C 2 74  ? -47.971 15.698  53.266  1.00 80.36  ? 75  ASN C N   1 
ATOM   7867 C  CA  . ASN C 2 74  ? -48.792 15.238  52.147  1.00 80.60  ? 75  ASN C CA  1 
ATOM   7868 C  C   . ASN C 2 74  ? -48.829 13.708  52.023  1.00 80.60  ? 75  ASN C C   1 
ATOM   7869 O  O   . ASN C 2 74  ? -49.847 13.139  51.619  1.00 80.61  ? 75  ASN C O   1 
ATOM   7870 C  CB  . ASN C 2 74  ? -48.272 15.859  50.843  1.00 80.68  ? 75  ASN C CB  1 
ATOM   7871 C  CG  . ASN C 2 74  ? -49.388 16.347  49.928  1.00 81.08  ? 75  ASN C CG  1 
ATOM   7872 O  OD1 . ASN C 2 74  ? -50.359 15.622  49.662  1.00 81.30  ? 75  ASN C OD1 1 
ATOM   7873 N  ND2 . ASN C 2 74  ? -49.241 17.583  49.428  1.00 81.34  ? 75  ASN C ND2 1 
ATOM   7874 N  N   . ASP C 2 75  ? -47.717 13.057  52.373  1.00 80.64  ? 76  ASP C N   1 
ATOM   7875 C  CA  . ASP C 2 75  ? -47.595 11.594  52.304  1.00 80.63  ? 76  ASP C CA  1 
ATOM   7876 C  C   . ASP C 2 75  ? -48.202 10.895  53.523  1.00 80.72  ? 76  ASP C C   1 
ATOM   7877 O  O   . ASP C 2 75  ? -48.717 9.778   53.410  1.00 80.62  ? 76  ASP C O   1 
ATOM   7878 C  CB  . ASP C 2 75  ? -46.129 11.176  52.134  1.00 80.53  ? 76  ASP C CB  1 
ATOM   7879 C  CG  . ASP C 2 75  ? -45.450 11.865  50.958  1.00 80.41  ? 76  ASP C CG  1 
ATOM   7880 O  OD1 . ASP C 2 75  ? -46.155 12.384  50.066  1.00 80.13  ? 76  ASP C OD1 1 
ATOM   7881 O  OD2 . ASP C 2 75  ? -44.201 11.890  50.928  1.00 80.22  ? 76  ASP C OD2 1 
ATOM   7882 N  N   . MET C 2 76  ? -48.121 11.552  54.681  1.00 80.90  ? 77  MET C N   1 
ATOM   7883 C  CA  . MET C 2 76  ? -48.791 11.094  55.903  1.00 81.11  ? 77  MET C CA  1 
ATOM   7884 C  C   . MET C 2 76  ? -50.309 11.239  55.766  1.00 81.39  ? 77  MET C C   1 
ATOM   7885 O  O   . MET C 2 76  ? -51.076 10.430  56.299  1.00 81.31  ? 77  MET C O   1 
ATOM   7886 C  CB  . MET C 2 76  ? -48.302 11.886  57.126  1.00 80.99  ? 77  MET C CB  1 
ATOM   7887 C  CG  . MET C 2 76  ? -46.840 11.664  57.528  1.00 80.67  ? 77  MET C CG  1 
ATOM   7888 S  SD  . MET C 2 76  ? -46.480 10.047  58.258  1.00 80.05  ? 77  MET C SD  1 
ATOM   7889 C  CE  . MET C 2 76  ? -45.992 9.121   56.806  1.00 80.07  ? 77  MET C CE  1 
ATOM   7890 N  N   . LEU C 2 77  ? -50.717 12.280  55.038  1.00 81.79  ? 78  LEU C N   1 
ATOM   7891 C  CA  . LEU C 2 77  ? -52.119 12.607  54.772  1.00 82.14  ? 78  LEU C CA  1 
ATOM   7892 C  C   . LEU C 2 77  ? -52.822 11.517  53.954  1.00 82.29  ? 78  LEU C C   1 
ATOM   7893 O  O   . LEU C 2 77  ? -54.022 11.279  54.130  1.00 82.41  ? 78  LEU C O   1 
ATOM   7894 C  CB  . LEU C 2 77  ? -52.200 13.953  54.035  1.00 82.19  ? 78  LEU C CB  1 
ATOM   7895 C  CG  . LEU C 2 77  ? -53.465 14.819  54.069  1.00 82.50  ? 78  LEU C CG  1 
ATOM   7896 C  CD1 . LEU C 2 77  ? -53.619 15.535  55.412  1.00 82.66  ? 78  LEU C CD1 1 
ATOM   7897 C  CD2 . LEU C 2 77  ? -53.438 15.832  52.924  1.00 82.44  ? 78  LEU C CD2 1 
ATOM   7898 N  N   . ASP C 2 78  ? -52.069 10.866  53.067  1.00 82.41  ? 79  ASP C N   1 
ATOM   7899 C  CA  . ASP C 2 78  ? -52.593 9.796   52.216  1.00 82.56  ? 79  ASP C CA  1 
ATOM   7900 C  C   . ASP C 2 78  ? -52.948 8.543   53.017  1.00 82.59  ? 79  ASP C C   1 
ATOM   7901 O  O   . ASP C 2 78  ? -54.011 7.947   52.820  1.00 82.57  ? 79  ASP C O   1 
ATOM   7902 C  CB  . ASP C 2 78  ? -51.587 9.444   51.111  1.00 82.64  ? 79  ASP C CB  1 
ATOM   7903 C  CG  . ASP C 2 78  ? -51.526 10.492  50.000  1.00 83.09  ? 79  ASP C CG  1 
ATOM   7904 O  OD1 . ASP C 2 78  ? -50.685 10.330  49.089  1.00 83.42  ? 79  ASP C OD1 1 
ATOM   7905 O  OD2 . ASP C 2 78  ? -52.311 11.471  50.027  1.00 83.33  ? 79  ASP C OD2 1 
ATOM   7906 N  N   . LEU C 2 79  ? -52.051 8.158   53.921  1.00 82.62  ? 80  LEU C N   1 
ATOM   7907 C  CA  . LEU C 2 79  ? -52.197 6.936   54.709  1.00 82.62  ? 80  LEU C CA  1 
ATOM   7908 C  C   . LEU C 2 79  ? -52.880 7.210   56.056  1.00 82.65  ? 80  LEU C C   1 
ATOM   7909 O  O   . LEU C 2 79  ? -52.469 6.677   57.091  1.00 82.72  ? 80  LEU C O   1 
ATOM   7910 C  CB  . LEU C 2 79  ? -50.820 6.295   54.926  1.00 82.59  ? 80  LEU C CB  1 
ATOM   7911 C  CG  . LEU C 2 79  ? -49.932 5.953   53.723  1.00 82.69  ? 80  LEU C CG  1 
ATOM   7912 C  CD1 . LEU C 2 79  ? -48.461 5.987   54.102  1.00 82.73  ? 80  LEU C CD1 1 
ATOM   7913 C  CD2 . LEU C 2 79  ? -50.288 4.609   53.142  1.00 82.65  ? 80  LEU C CD2 1 
ATOM   7914 N  N   . ALA C 2 80  ? -53.930 8.032   56.028  1.00 82.63  ? 81  ALA C N   1 
ATOM   7915 C  CA  . ALA C 2 80  ? -54.630 8.481   57.236  1.00 82.59  ? 81  ALA C CA  1 
ATOM   7916 C  C   . ALA C 2 80  ? -55.256 7.340   58.032  1.00 82.58  ? 81  ALA C C   1 
ATOM   7917 O  O   . ALA C 2 80  ? -55.620 6.306   57.473  1.00 82.62  ? 81  ALA C O   1 
ATOM   7918 C  CB  . ALA C 2 80  ? -55.686 9.516   56.879  1.00 82.59  ? 81  ALA C CB  1 
ATOM   7919 N  N   . LEU C 2 89  ? -54.029 17.107  59.815  1.00 98.47  ? 90  LEU C N   1 
ATOM   7920 C  CA  . LEU C 2 89  ? -53.331 16.673  61.022  1.00 98.51  ? 90  LEU C CA  1 
ATOM   7921 C  C   . LEU C 2 89  ? -53.607 17.607  62.201  1.00 98.56  ? 90  LEU C C   1 
ATOM   7922 O  O   . LEU C 2 89  ? -54.462 18.490  62.112  1.00 98.55  ? 90  LEU C O   1 
ATOM   7923 C  CB  . LEU C 2 89  ? -51.822 16.547  60.764  1.00 98.50  ? 90  LEU C CB  1 
ATOM   7924 C  CG  . LEU C 2 89  ? -51.309 15.238  60.149  1.00 98.43  ? 90  LEU C CG  1 
ATOM   7925 C  CD1 . LEU C 2 89  ? -51.538 15.183  58.641  1.00 98.33  ? 90  LEU C CD1 1 
ATOM   7926 C  CD2 . LEU C 2 89  ? -49.835 15.048  60.466  1.00 98.18  ? 90  LEU C CD2 1 
ATOM   7927 N  N   . GLY C 2 90  ? -52.886 17.402  63.301  1.00 98.60  ? 91  GLY C N   1 
ATOM   7928 C  CA  . GLY C 2 90  ? -53.076 18.193  64.514  1.00 98.65  ? 91  GLY C CA  1 
ATOM   7929 C  C   . GLY C 2 90  ? -51.859 18.995  64.936  1.00 98.66  ? 91  GLY C C   1 
ATOM   7930 O  O   . GLY C 2 90  ? -51.984 20.157  65.342  1.00 98.69  ? 91  GLY C O   1 
ATOM   7931 N  N   . CYS C 2 91  ? -50.681 18.379  64.839  1.00 98.62  ? 92  CYS C N   1 
ATOM   7932 C  CA  . CYS C 2 91  ? -49.439 19.004  65.305  1.00 98.57  ? 92  CYS C CA  1 
ATOM   7933 C  C   . CYS C 2 91  ? -48.808 19.966  64.292  1.00 98.53  ? 92  CYS C C   1 
ATOM   7934 O  O   . CYS C 2 91  ? -48.017 20.835  64.674  1.00 98.53  ? 92  CYS C O   1 
ATOM   7935 C  CB  . CYS C 2 91  ? -48.423 17.941  65.760  1.00 98.61  ? 92  CYS C CB  1 
ATOM   7936 S  SG  . CYS C 2 91  ? -47.529 17.051  64.442  1.00 98.35  ? 92  CYS C SG  1 
ATOM   7937 N  N   . GLN C 2 92  ? -49.162 19.816  63.014  1.00 98.46  ? 93  GLN C N   1 
ATOM   7938 C  CA  . GLN C 2 92  ? -48.610 20.666  61.951  1.00 98.37  ? 93  GLN C CA  1 
ATOM   7939 C  C   . GLN C 2 92  ? -49.617 21.721  61.496  1.00 98.33  ? 93  GLN C C   1 
ATOM   7940 O  O   . GLN C 2 92  ? -49.599 22.858  61.972  1.00 98.20  ? 93  GLN C O   1 
ATOM   7941 C  CB  . GLN C 2 92  ? -48.151 19.823  60.749  1.00 98.34  ? 93  GLN C CB  1 
ATOM   7942 C  CG  . GLN C 2 92  ? -47.167 18.688  61.075  1.00 98.14  ? 93  GLN C CG  1 
ATOM   7943 C  CD  . GLN C 2 92  ? -45.784 19.174  61.491  1.00 97.91  ? 93  GLN C CD  1 
ATOM   7944 O  OE1 . GLN C 2 92  ? -45.225 20.095  60.893  1.00 97.90  ? 93  GLN C OE1 1 
ATOM   7945 N  NE2 . GLN C 2 92  ? -45.220 18.539  62.515  1.00 97.52  ? 93  GLN C NE2 1 
ATOM   7946 N  N   . ALA D 2 44  ? 26.085  -10.407 6.667   1.00 79.24  ? 45  ALA D N   1 
ATOM   7947 C  CA  . ALA D 2 44  ? 26.281  -9.234  7.573   1.00 79.28  ? 45  ALA D CA  1 
ATOM   7948 C  C   . ALA D 2 44  ? 25.976  -9.580  9.033   1.00 79.29  ? 45  ALA D C   1 
ATOM   7949 O  O   . ALA D 2 44  ? 26.866  -9.514  9.883   1.00 79.26  ? 45  ALA D O   1 
ATOM   7950 C  CB  . ALA D 2 44  ? 25.442  -8.047  7.106   1.00 79.29  ? 45  ALA D CB  1 
ATOM   7951 N  N   . CYS D 2 45  ? 24.729  -9.965  9.312   1.00 79.34  ? 46  CYS D N   1 
ATOM   7952 C  CA  . CYS D 2 45  ? 24.299  -10.335 10.671  1.00 79.43  ? 46  CYS D CA  1 
ATOM   7953 C  C   . CYS D 2 45  ? 24.961  -11.624 11.182  1.00 79.61  ? 46  CYS D C   1 
ATOM   7954 O  O   . CYS D 2 45  ? 24.864  -11.950 12.373  1.00 79.58  ? 46  CYS D O   1 
ATOM   7955 C  CB  . CYS D 2 45  ? 22.769  -10.450 10.750  1.00 79.40  ? 46  CYS D CB  1 
ATOM   7956 S  SG  . CYS D 2 45  ? 22.055  -11.914 9.940   1.00 79.09  ? 46  CYS D SG  1 
ATOM   7957 N  N   . GLU D 2 46  ? 25.618  -12.340 10.263  1.00 79.74  ? 47  GLU D N   1 
ATOM   7958 C  CA  . GLU D 2 46  ? 26.415  -13.549 10.540  1.00 79.92  ? 47  GLU D CA  1 
ATOM   7959 C  C   . GLU D 2 46  ? 25.589  -14.789 10.935  1.00 79.92  ? 47  GLU D C   1 
ATOM   7960 O  O   . GLU D 2 46  ? 25.734  -15.329 12.037  1.00 79.88  ? 47  GLU D O   1 
ATOM   7961 C  CB  . GLU D 2 46  ? 27.560  -13.259 11.534  1.00 79.98  ? 47  GLU D CB  1 
ATOM   7962 C  CG  . GLU D 2 46  ? 28.696  -12.419 10.934  1.00 80.32  ? 47  GLU D CG  1 
ATOM   7963 C  CD  . GLU D 2 46  ? 29.638  -11.827 11.977  1.00 80.52  ? 47  GLU D CD  1 
ATOM   7964 O  OE1 . GLU D 2 46  ? 30.175  -12.586 12.815  1.00 80.27  ? 47  GLU D OE1 1 
ATOM   7965 O  OE2 . GLU D 2 46  ? 29.855  -10.595 11.945  1.00 80.43  ? 47  GLU D OE2 1 
ATOM   7966 N  N   . GLY D 2 47  ? 24.731  -15.224 10.010  1.00 79.96  ? 48  GLY D N   1 
ATOM   7967 C  CA  . GLY D 2 47  ? 23.957  -16.465 10.141  1.00 79.96  ? 48  GLY D CA  1 
ATOM   7968 C  C   . GLY D 2 47  ? 22.925  -16.467 11.252  1.00 79.95  ? 48  GLY D C   1 
ATOM   7969 O  O   . GLY D 2 47  ? 22.907  -17.379 12.084  1.00 79.99  ? 48  GLY D O   1 
ATOM   7970 N  N   . THR D 2 48  ? 22.053  -15.459 11.249  1.00 79.91  ? 49  THR D N   1 
ATOM   7971 C  CA  . THR D 2 48  ? 21.108  -15.235 12.349  1.00 79.82  ? 49  THR D CA  1 
ATOM   7972 C  C   . THR D 2 48  ? 19.665  -14.951 11.883  1.00 79.91  ? 49  THR D C   1 
ATOM   7973 O  O   . THR D 2 48  ? 18.728  -15.011 12.687  1.00 79.93  ? 49  THR D O   1 
ATOM   7974 C  CB  . THR D 2 48  ? 21.643  -14.122 13.306  1.00 79.77  ? 49  THR D CB  1 
ATOM   7975 O  OG1 . THR D 2 48  ? 22.480  -14.713 14.312  1.00 79.37  ? 49  THR D OG1 1 
ATOM   7976 C  CG2 . THR D 2 48  ? 20.523  -13.373 13.986  1.00 79.64  ? 49  THR D CG2 1 
ATOM   7977 N  N   . LEU D 2 49  ? 19.493  -14.670 10.589  1.00 80.02  ? 50  LEU D N   1 
ATOM   7978 C  CA  . LEU D 2 49  ? 18.183  -14.329 10.004  1.00 80.14  ? 50  LEU D CA  1 
ATOM   7979 C  C   . LEU D 2 49  ? 17.745  -12.916 10.428  1.00 80.24  ? 50  LEU D C   1 
ATOM   7980 O  O   . LEU D 2 49  ? 16.582  -12.683 10.773  1.00 80.18  ? 50  LEU D O   1 
ATOM   7981 C  CB  . LEU D 2 49  ? 17.123  -15.392 10.361  1.00 80.18  ? 50  LEU D CB  1 
ATOM   7982 C  CG  . LEU D 2 49  ? 15.854  -15.613 9.524   1.00 80.10  ? 50  LEU D CG  1 
ATOM   7983 C  CD1 . LEU D 2 49  ? 16.166  -16.336 8.232   1.00 80.07  ? 50  LEU D CD1 1 
ATOM   7984 C  CD2 . LEU D 2 49  ? 14.846  -16.417 10.328  1.00 80.27  ? 50  LEU D CD2 1 
ATOM   7985 N  N   . ALA D 2 50  ? 18.696  -11.981 10.391  1.00 80.39  ? 51  ALA D N   1 
ATOM   7986 C  CA  . ALA D 2 50  ? 18.469  -10.590 10.799  1.00 80.61  ? 51  ALA D CA  1 
ATOM   7987 C  C   . ALA D 2 50  ? 18.969  -9.573  9.758   1.00 80.75  ? 51  ALA D C   1 
ATOM   7988 O  O   . ALA D 2 50  ? 19.239  -8.412  10.091  1.00 80.76  ? 51  ALA D O   1 
ATOM   7989 C  CB  . ALA D 2 50  ? 19.107  -10.327 12.166  1.00 80.50  ? 51  ALA D CB  1 
ATOM   7990 N  N   . CYS D 2 51  ? 19.095  -10.032 8.508   1.00 80.98  ? 52  CYS D N   1 
ATOM   7991 C  CA  . CYS D 2 51  ? 19.446  -9.193  7.349   1.00 81.26  ? 52  CYS D CA  1 
ATOM   7992 C  C   . CYS D 2 51  ? 19.133  -9.943  6.044   1.00 81.47  ? 52  CYS D C   1 
ATOM   7993 O  O   . CYS D 2 51  ? 18.457  -10.978 6.065   1.00 81.47  ? 52  CYS D O   1 
ATOM   7994 C  CB  . CYS D 2 51  ? 20.921  -8.755  7.393   1.00 81.25  ? 52  CYS D CB  1 
ATOM   7995 S  SG  . CYS D 2 51  ? 22.132  -9.965  6.776   1.00 81.15  ? 52  CYS D SG  1 
ATOM   7996 N  N   . SER D 2 52  ? 19.619  -9.422  4.916   1.00 81.74  ? 53  SER D N   1 
ATOM   7997 C  CA  . SER D 2 52  ? 19.429  -10.081 3.617   1.00 81.94  ? 53  SER D CA  1 
ATOM   7998 C  C   . SER D 2 52  ? 20.638  -9.963  2.669   1.00 82.06  ? 53  SER D C   1 
ATOM   7999 O  O   . SER D 2 52  ? 20.474  -9.893  1.447   1.00 82.08  ? 53  SER D O   1 
ATOM   8000 C  CB  . SER D 2 52  ? 18.143  -9.585  2.938   1.00 81.93  ? 53  SER D CB  1 
ATOM   8001 O  OG  . SER D 2 52  ? 18.205  -8.196  2.665   1.00 82.08  ? 53  SER D OG  1 
ATOM   8002 N  N   . THR D 2 53  ? 21.845  -9.963  3.239   1.00 82.16  ? 54  THR D N   1 
ATOM   8003 C  CA  . THR D 2 53  ? 23.085  -9.831  2.459   1.00 82.18  ? 54  THR D CA  1 
ATOM   8004 C  C   . THR D 2 53  ? 23.614  -11.178 1.948   1.00 82.19  ? 54  THR D C   1 
ATOM   8005 O  O   . THR D 2 53  ? 24.809  -11.323 1.672   1.00 82.12  ? 54  THR D O   1 
ATOM   8006 C  CB  . THR D 2 53  ? 24.203  -9.091  3.255   1.00 82.23  ? 54  THR D CB  1 
ATOM   8007 O  OG1 . THR D 2 53  ? 24.466  -9.780  4.484   1.00 82.19  ? 54  THR D OG1 1 
ATOM   8008 C  CG2 . THR D 2 53  ? 23.806  -7.643  3.552   1.00 82.22  ? 54  THR D CG2 1 
ATOM   8009 N  N   . CYS D 2 54  ? 22.715  -12.152 1.814   1.00 82.22  ? 55  CYS D N   1 
ATOM   8010 C  CA  . CYS D 2 54  ? 23.065  -13.488 1.331   1.00 82.28  ? 55  CYS D CA  1 
ATOM   8011 C  C   . CYS D 2 54  ? 21.937  -14.094 0.498   1.00 82.27  ? 55  CYS D C   1 
ATOM   8012 O  O   . CYS D 2 54  ? 21.413  -13.455 -0.416  1.00 82.20  ? 55  CYS D O   1 
ATOM   8013 C  CB  . CYS D 2 54  ? 23.412  -14.410 2.503   1.00 82.26  ? 55  CYS D CB  1 
ATOM   8014 S  SG  . CYS D 2 54  ? 22.188  -14.403 3.837   1.00 82.40  ? 55  CYS D SG  1 
ATOM   8015 N  N   . GLU D 2 72  ? 9.247   -15.986 8.652   1.00 92.97  ? 73  GLU D N   1 
ATOM   8016 C  CA  . GLU D 2 72  ? 10.414  -15.206 9.057   1.00 93.01  ? 73  GLU D CA  1 
ATOM   8017 C  C   . GLU D 2 72  ? 11.363  -14.977 7.879   1.00 92.99  ? 73  GLU D C   1 
ATOM   8018 O  O   . GLU D 2 72  ? 11.867  -13.866 7.691   1.00 93.02  ? 73  GLU D O   1 
ATOM   8019 C  CB  . GLU D 2 72  ? 11.151  -15.879 10.221  1.00 93.03  ? 73  GLU D CB  1 
ATOM   8020 C  CG  . GLU D 2 72  ? 10.376  -15.908 11.542  1.00 93.29  ? 73  GLU D CG  1 
ATOM   8021 C  CD  . GLU D 2 72  ? 11.177  -16.497 12.707  1.00 93.81  ? 73  GLU D CD  1 
ATOM   8022 O  OE1 . GLU D 2 72  ? 12.263  -17.078 12.474  1.00 93.78  ? 73  GLU D OE1 1 
ATOM   8023 O  OE2 . GLU D 2 72  ? 10.712  -16.377 13.866  1.00 93.65  ? 73  GLU D OE2 1 
ATOM   8024 N  N   . GLU D 2 73  ? 11.601  -16.030 7.095   1.00 92.89  ? 74  GLU D N   1 
ATOM   8025 C  CA  . GLU D 2 73  ? 12.411  -15.934 5.878   1.00 92.76  ? 74  GLU D CA  1 
ATOM   8026 C  C   . GLU D 2 73  ? 11.596  -15.328 4.737   1.00 92.66  ? 74  GLU D C   1 
ATOM   8027 O  O   . GLU D 2 73  ? 12.152  -14.731 3.813   1.00 92.53  ? 74  GLU D O   1 
ATOM   8028 C  CB  . GLU D 2 73  ? 12.950  -17.310 5.473   1.00 92.79  ? 74  GLU D CB  1 
ATOM   8029 C  CG  . GLU D 2 73  ? 14.095  -17.259 4.461   1.00 92.83  ? 74  GLU D CG  1 
ATOM   8030 C  CD  . GLU D 2 73  ? 14.559  -18.632 4.011   1.00 92.91  ? 74  GLU D CD  1 
ATOM   8031 O  OE1 . GLU D 2 73  ? 13.737  -19.391 3.454   1.00 92.89  ? 74  GLU D OE1 1 
ATOM   8032 O  OE2 . GLU D 2 73  ? 15.753  -18.948 4.202   1.00 92.94  ? 74  GLU D OE2 1 
ATOM   8033 N  N   . ASN D 2 74  ? 10.277  -15.487 4.820   1.00 92.65  ? 75  ASN D N   1 
ATOM   8034 C  CA  . ASN D 2 74  ? 9.339   -14.969 3.824   1.00 92.61  ? 75  ASN D CA  1 
ATOM   8035 C  C   . ASN D 2 74  ? 9.291   -13.438 3.786   1.00 92.55  ? 75  ASN D C   1 
ATOM   8036 O  O   . ASN D 2 74  ? 9.109   -12.844 2.721   1.00 92.50  ? 75  ASN D O   1 
ATOM   8037 C  CB  . ASN D 2 74  ? 7.933   -15.533 4.074   1.00 92.65  ? 75  ASN D CB  1 
ATOM   8038 C  CG  . ASN D 2 74  ? 7.898   -17.062 4.085   1.00 92.59  ? 75  ASN D CG  1 
ATOM   8039 O  OD1 . ASN D 2 74  ? 8.792   -17.721 4.624   1.00 92.49  ? 75  ASN D OD1 1 
ATOM   8040 N  ND2 . ASN D 2 74  ? 6.848   -17.627 3.500   1.00 92.31  ? 75  ASN D ND2 1 
ATOM   8041 N  N   . ASP D 2 75  ? 9.455   -12.814 4.951   1.00 92.53  ? 76  ASP D N   1 
ATOM   8042 C  CA  . ASP D 2 75  ? 9.469   -11.354 5.075   1.00 92.53  ? 76  ASP D CA  1 
ATOM   8043 C  C   . ASP D 2 75  ? 10.796  -10.764 4.590   1.00 92.52  ? 76  ASP D C   1 
ATOM   8044 O  O   . ASP D 2 75  ? 10.823  -9.674  4.008   1.00 92.45  ? 76  ASP D O   1 
ATOM   8045 C  CB  . ASP D 2 75  ? 9.208   -10.925 6.527   1.00 92.52  ? 76  ASP D CB  1 
ATOM   8046 C  CG  . ASP D 2 75  ? 7.971   -11.585 7.132   1.00 92.50  ? 76  ASP D CG  1 
ATOM   8047 O  OD1 . ASP D 2 75  ? 7.212   -12.249 6.391   1.00 92.18  ? 76  ASP D OD1 1 
ATOM   8048 O  OD2 . ASP D 2 75  ? 7.761   -11.436 8.360   1.00 92.39  ? 76  ASP D OD2 1 
ATOM   8049 N  N   . MET D 2 76  ? 11.885  -11.492 4.842   1.00 92.50  ? 77  MET D N   1 
ATOM   8050 C  CA  . MET D 2 76  ? 13.230  -11.100 4.405   1.00 92.51  ? 77  MET D CA  1 
ATOM   8051 C  C   . MET D 2 76  ? 13.405  -11.254 2.895   1.00 92.57  ? 77  MET D C   1 
ATOM   8052 O  O   . MET D 2 76  ? 14.231  -10.571 2.287   1.00 92.56  ? 77  MET D O   1 
ATOM   8053 C  CB  . MET D 2 76  ? 14.302  -11.925 5.135   1.00 92.45  ? 77  MET D CB  1 
ATOM   8054 C  CG  . MET D 2 76  ? 14.386  -11.716 6.651   1.00 92.31  ? 77  MET D CG  1 
ATOM   8055 S  SD  . MET D 2 76  ? 15.049  -10.114 7.167   1.00 91.78  ? 77  MET D SD  1 
ATOM   8056 C  CE  . MET D 2 76  ? 13.552  -9.136  7.283   1.00 91.73  ? 77  MET D CE  1 
ATOM   8057 N  N   . LEU D 2 77  ? 12.622  -12.155 2.306   1.00 92.67  ? 78  LEU D N   1 
ATOM   8058 C  CA  . LEU D 2 77  ? 12.693  -12.464 0.881   1.00 92.72  ? 78  LEU D CA  1 
ATOM   8059 C  C   . LEU D 2 77  ? 11.993  -11.397 0.035   1.00 92.76  ? 78  LEU D C   1 
ATOM   8060 O  O   . LEU D 2 77  ? 12.369  -11.173 -1.118  1.00 92.77  ? 78  LEU D O   1 
ATOM   8061 C  CB  . LEU D 2 77  ? 12.078  -13.845 0.617   1.00 92.78  ? 78  LEU D CB  1 
ATOM   8062 C  CG  . LEU D 2 77  ? 12.721  -14.790 -0.405  1.00 92.86  ? 78  LEU D CG  1 
ATOM   8063 C  CD1 . LEU D 2 77  ? 14.051  -15.347 0.108   1.00 92.69  ? 78  LEU D CD1 1 
ATOM   8064 C  CD2 . LEU D 2 77  ? 11.764  -15.931 -0.754  1.00 92.79  ? 78  LEU D CD2 1 
ATOM   8065 N  N   . ASP D 2 78  ? 10.983  -10.742 0.614   1.00 92.82  ? 79  ASP D N   1 
ATOM   8066 C  CA  . ASP D 2 78  ? 10.233  -9.673  -0.065  1.00 92.90  ? 79  ASP D CA  1 
ATOM   8067 C  C   . ASP D 2 78  ? 11.026  -8.360  -0.149  1.00 92.90  ? 79  ASP D C   1 
ATOM   8068 O  O   . ASP D 2 78  ? 10.540  -7.351  -0.677  1.00 92.85  ? 79  ASP D O   1 
ATOM   8069 C  CB  . ASP D 2 78  ? 8.878   -9.437  0.625   1.00 92.93  ? 79  ASP D CB  1 
ATOM   8070 C  CG  . ASP D 2 78  ? 7.883   -10.576 0.392   1.00 93.06  ? 79  ASP D CG  1 
ATOM   8071 O  OD1 . ASP D 2 78  ? 7.160   -10.933 1.349   1.00 93.02  ? 79  ASP D OD1 1 
ATOM   8072 O  OD2 . ASP D 2 78  ? 7.814   -11.110 -0.740  1.00 92.87  ? 79  ASP D OD2 1 
ATOM   8073 N  N   . LEU D 2 79  ? 12.249  -8.393  0.376   1.00 92.89  ? 80  LEU D N   1 
ATOM   8074 C  CA  . LEU D 2 79  ? 13.132  -7.236  0.426   1.00 92.90  ? 80  LEU D CA  1 
ATOM   8075 C  C   . LEU D 2 79  ? 14.548  -7.658  0.019   1.00 92.99  ? 80  LEU D C   1 
ATOM   8076 O  O   . LEU D 2 79  ? 15.244  -8.341  0.781   1.00 93.05  ? 80  LEU D O   1 
ATOM   8077 C  CB  . LEU D 2 79  ? 13.145  -6.644  1.842   1.00 92.83  ? 80  LEU D CB  1 
ATOM   8078 C  CG  . LEU D 2 79  ? 11.834  -6.338  2.582   1.00 92.71  ? 80  LEU D CG  1 
ATOM   8079 C  CD1 . LEU D 2 79  ? 12.006  -6.476  4.089   1.00 92.69  ? 80  LEU D CD1 1 
ATOM   8080 C  CD2 . LEU D 2 79  ? 11.296  -4.967  2.230   1.00 92.54  ? 80  LEU D CD2 1 
ATOM   8081 N  N   . ALA D 2 80  ? 14.963  -7.265  -1.188  1.00 93.07  ? 81  ALA D N   1 
ATOM   8082 C  CA  . ALA D 2 80  ? 16.302  -7.589  -1.691  1.00 93.13  ? 81  ALA D CA  1 
ATOM   8083 C  C   . ALA D 2 80  ? 16.860  -6.475  -2.572  1.00 93.18  ? 81  ALA D C   1 
ATOM   8084 O  O   . ALA D 2 80  ? 16.172  -5.964  -3.457  1.00 93.21  ? 81  ALA D O   1 
ATOM   8085 C  CB  . ALA D 2 80  ? 16.285  -8.914  -2.449  1.00 93.14  ? 81  ALA D CB  1 
ATOM   8086 N  N   . LEU D 2 89  ? 17.662  -16.674 0.980   1.00 97.46  ? 90  LEU D N   1 
ATOM   8087 C  CA  . LEU D 2 89  ? 18.866  -16.370 1.751   1.00 97.47  ? 90  LEU D CA  1 
ATOM   8088 C  C   . LEU D 2 89  ? 19.965  -17.410 1.528   1.00 97.44  ? 90  LEU D C   1 
ATOM   8089 O  O   . LEU D 2 89  ? 19.742  -18.423 0.862   1.00 97.39  ? 90  LEU D O   1 
ATOM   8090 C  CB  . LEU D 2 89  ? 18.535  -16.240 3.246   1.00 97.47  ? 90  LEU D CB  1 
ATOM   8091 C  CG  . LEU D 2 89  ? 17.699  -15.030 3.685   1.00 97.48  ? 90  LEU D CG  1 
ATOM   8092 C  CD1 . LEU D 2 89  ? 17.210  -15.209 5.107   1.00 97.38  ? 90  LEU D CD1 1 
ATOM   8093 C  CD2 . LEU D 2 89  ? 18.475  -13.721 3.554   1.00 97.48  ? 90  LEU D CD2 1 
ATOM   8094 N  N   . GLY D 2 90  ? 21.147  -17.150 2.086   1.00 97.47  ? 91  GLY D N   1 
ATOM   8095 C  CA  . GLY D 2 90  ? 22.305  -18.023 1.900   1.00 97.52  ? 91  GLY D CA  1 
ATOM   8096 C  C   . GLY D 2 90  ? 22.851  -18.670 3.162   1.00 97.57  ? 91  GLY D C   1 
ATOM   8097 O  O   . GLY D 2 90  ? 23.855  -19.386 3.105   1.00 97.57  ? 91  GLY D O   1 
ATOM   8098 N  N   . CYS D 2 91  ? 22.196  -18.424 4.298   1.00 97.58  ? 92  CYS D N   1 
ATOM   8099 C  CA  . CYS D 2 91  ? 22.636  -18.978 5.586   1.00 97.57  ? 92  CYS D CA  1 
ATOM   8100 C  C   . CYS D 2 91  ? 21.838  -20.212 6.021   1.00 97.57  ? 92  CYS D C   1 
ATOM   8101 O  O   . CYS D 2 91  ? 22.197  -20.874 7.000   1.00 97.55  ? 92  CYS D O   1 
ATOM   8102 C  CB  . CYS D 2 91  ? 22.634  -17.901 6.688   1.00 97.61  ? 92  CYS D CB  1 
ATOM   8103 S  SG  . CYS D 2 91  ? 21.003  -17.275 7.207   1.00 97.38  ? 92  CYS D SG  1 
ATOM   8104 N  N   . GLN D 2 92  ? 20.764  -20.514 5.287   1.00 97.54  ? 93  GLN D N   1 
ATOM   8105 C  CA  . GLN D 2 92  ? 19.942  -21.707 5.525   1.00 97.48  ? 93  GLN D CA  1 
ATOM   8106 C  C   . GLN D 2 92  ? 19.158  -22.113 4.279   1.00 97.48  ? 93  GLN D C   1 
ATOM   8107 O  O   . GLN D 2 92  ? 19.347  -23.253 3.763   1.00 97.45  ? 93  GLN D O   1 
ATOM   8108 C  CB  . GLN D 2 92  ? 18.994  -21.512 6.720   1.00 97.46  ? 93  GLN D CB  1 
ATOM   8109 C  CG  . GLN D 2 92  ? 18.237  -20.187 6.741   1.00 97.29  ? 93  GLN D CG  1 
ATOM   8110 C  CD  . GLN D 2 92  ? 17.697  -19.851 8.118   1.00 97.05  ? 93  GLN D CD  1 
ATOM   8111 O  OE1 . GLN D 2 92  ? 16.736  -20.463 8.590   1.00 96.84  ? 93  GLN D OE1 1 
ATOM   8112 N  NE2 . GLN D 2 92  ? 18.315  -18.872 8.769   1.00 96.97  ? 93  GLN D NE2 1 
HETATM 8113 C  CHA . HEM E 3 .   ? -37.111 0.452   60.147  1.00 14.24  ? 601 HEM A CHA 1 
HETATM 8114 C  CHB . HEM E 3 .   ? -36.774 0.930   55.302  1.00 14.67  ? 601 HEM A CHB 1 
HETATM 8115 C  CHC . HEM E 3 .   ? -33.045 4.007   55.782  1.00 14.91  ? 601 HEM A CHC 1 
HETATM 8116 C  CHD . HEM E 3 .   ? -33.010 3.114   60.544  1.00 15.40  ? 601 HEM A CHD 1 
HETATM 8117 C  C1A . HEM E 3 .   ? -37.368 0.349   58.791  1.00 14.69  ? 601 HEM A C1A 1 
HETATM 8118 C  C2A . HEM E 3 .   ? -38.481 -0.361  58.177  1.00 14.30  ? 601 HEM A C2A 1 
HETATM 8119 C  C3A . HEM E 3 .   ? -38.382 -0.219  56.848  1.00 14.67  ? 601 HEM A C3A 1 
HETATM 8120 C  C4A . HEM E 3 .   ? -37.204 0.573   56.569  1.00 14.38  ? 601 HEM A C4A 1 
HETATM 8121 C  CMA . HEM E 3 .   ? -39.339 -0.799  55.779  1.00 13.18  ? 601 HEM A CMA 1 
HETATM 8122 C  CAA . HEM E 3 .   ? -39.603 -1.113  58.932  1.00 13.91  ? 601 HEM A CAA 1 
HETATM 8123 C  CBA . HEM E 3 .   ? -40.768 -0.123  59.068  1.00 13.29  ? 601 HEM A CBA 1 
HETATM 8124 C  CGA . HEM E 3 .   ? -42.011 -0.748  59.658  1.00 14.97  ? 601 HEM A CGA 1 
HETATM 8125 O  O1A . HEM E 3 .   ? -41.917 -1.808  60.337  1.00 16.58  ? 601 HEM A O1A 1 
HETATM 8126 O  O2A . HEM E 3 .   ? -43.118 -0.171  59.480  1.00 14.94  ? 601 HEM A O2A 1 
HETATM 8127 C  C1B . HEM E 3 .   ? -35.757 1.807   54.996  1.00 14.98  ? 601 HEM A C1B 1 
HETATM 8128 C  C2B . HEM E 3 .   ? -35.364 2.253   53.668  1.00 14.93  ? 601 HEM A C2B 1 
HETATM 8129 C  C3B . HEM E 3 .   ? -34.333 3.104   53.815  1.00 14.81  ? 601 HEM A C3B 1 
HETATM 8130 C  C4B . HEM E 3 .   ? -34.042 3.219   55.231  1.00 15.22  ? 601 HEM A C4B 1 
HETATM 8131 C  CMB . HEM E 3 .   ? -36.060 1.810   52.353  1.00 15.16  ? 601 HEM A CMB 1 
HETATM 8132 C  CAB . HEM E 3 .   ? -33.527 3.871   52.738  1.00 15.53  ? 601 HEM A CAB 1 
HETATM 8133 C  CBB . HEM E 3 .   ? -33.909 3.943   51.459  1.00 17.27  ? 601 HEM A CBB 1 
HETATM 8134 C  C1C . HEM E 3 .   ? -32.707 4.074   57.115  1.00 14.83  ? 601 HEM A C1C 1 
HETATM 8135 C  C2C . HEM E 3 .   ? -31.687 4.910   57.714  1.00 15.34  ? 601 HEM A C2C 1 
HETATM 8136 C  C3C . HEM E 3 .   ? -31.683 4.652   59.029  1.00 15.01  ? 601 HEM A C3C 1 
HETATM 8137 C  C4C . HEM E 3 .   ? -32.698 3.658   59.313  1.00 15.40  ? 601 HEM A C4C 1 
HETATM 8138 C  CMC . HEM E 3 .   ? -30.764 5.919   56.973  1.00 13.73  ? 601 HEM A CMC 1 
HETATM 8139 C  CAC . HEM E 3 .   ? -30.761 5.323   60.064  1.00 16.11  ? 601 HEM A CAC 1 
HETATM 8140 C  CBC . HEM E 3 .   ? -31.272 6.238   60.896  1.00 17.42  ? 601 HEM A CBC 1 
HETATM 8141 C  C1D . HEM E 3 .   ? -34.087 2.312   60.885  1.00 15.56  ? 601 HEM A C1D 1 
HETATM 8142 C  C2D . HEM E 3 .   ? -34.381 1.855   62.230  1.00 15.73  ? 601 HEM A C2D 1 
HETATM 8143 C  C3D . HEM E 3 .   ? -35.653 1.028   62.117  1.00 15.29  ? 601 HEM A C3D 1 
HETATM 8144 C  C4D . HEM E 3 .   ? -36.011 1.062   60.715  1.00 14.78  ? 601 HEM A C4D 1 
HETATM 8145 C  CMD . HEM E 3 .   ? -33.586 2.123   63.526  1.00 15.57  ? 601 HEM A CMD 1 
HETATM 8146 C  CAD . HEM E 3 .   ? -36.386 0.336   63.287  1.00 15.19  ? 601 HEM A CAD 1 
HETATM 8147 C  CBD . HEM E 3 .   ? -37.268 1.437   63.876  1.00 15.22  ? 601 HEM A CBD 1 
HETATM 8148 C  CGD . HEM E 3 .   ? -38.119 0.977   65.040  1.00 16.33  ? 601 HEM A CGD 1 
HETATM 8149 O  O1D . HEM E 3 .   ? -38.631 1.858   65.781  1.00 15.21  ? 601 HEM A O1D 1 
HETATM 8150 O  O2D . HEM E 3 .   ? -38.309 -0.255  65.234  1.00 17.65  ? 601 HEM A O2D 1 
HETATM 8151 N  NA  . HEM E 3 .   ? -36.625 0.925   57.780  1.00 13.55  ? 601 HEM A NA  1 
HETATM 8152 N  NB  . HEM E 3 .   ? -34.932 2.415   55.924  1.00 14.36  ? 601 HEM A NB  1 
HETATM 8153 N  NC  . HEM E 3 .   ? -33.312 3.348   58.125  1.00 14.92  ? 601 HEM A NC  1 
HETATM 8154 N  ND  . HEM E 3 .   ? -35.076 1.831   60.031  1.00 14.88  ? 601 HEM A ND  1 
HETATM 8155 FE FE  . HEM E 3 .   ? -35.048 2.162   57.959  1.00 15.02  ? 601 HEM A FE  1 
HETATM 8156 C  C1  . HCD F 4 .   ? -36.609 -9.677  56.391  1.00 11.86  ? 602 HCD A C1  1 
HETATM 8157 O  O1  . HCD F 4 .   ? -39.023 -12.567 56.865  1.00 12.14  ? 602 HCD A O1  1 
HETATM 8158 C  C2  . HCD F 4 .   ? -37.476 -10.889 56.013  1.00 13.71  ? 602 HCD A C2  1 
HETATM 8159 O  O2  . HCD F 4 .   ? -34.627 -1.574  57.857  1.00 14.28  ? 602 HCD A O2  1 
HETATM 8160 C  C3  . HCD F 4 .   ? -38.263 -11.403 57.224  1.00 13.22  ? 602 HCD A C3  1 
HETATM 8161 C  C4  . HCD F 4 .   ? -39.182 -10.281 57.729  1.00 11.87  ? 602 HCD A C4  1 
HETATM 8162 C  C5  . HCD F 4 .   ? -38.335 -9.052  58.015  1.00 11.20  ? 602 HCD A C5  1 
HETATM 8163 C  C6  . HCD F 4 .   ? -38.413 -8.516  59.252  1.00 9.96   ? 602 HCD A C6  1 
HETATM 8164 C  C7  . HCD F 4 .   ? -37.693 -7.257  59.689  1.00 10.13  ? 602 HCD A C7  1 
HETATM 8165 C  C8  . HCD F 4 .   ? -37.119 -6.473  58.510  1.00 10.23  ? 602 HCD A C8  1 
HETATM 8166 C  C9  . HCD F 4 .   ? -36.453 -7.423  57.500  1.00 10.10  ? 602 HCD A C9  1 
HETATM 8167 C  C10 . HCD F 4 .   ? -37.424 -8.488  56.932  1.00 11.71  ? 602 HCD A C10 1 
HETATM 8168 C  C11 . HCD F 4 .   ? -35.679 -6.649  56.413  1.00 10.06  ? 602 HCD A C11 1 
HETATM 8169 C  C12 . HCD F 4 .   ? -34.713 -5.597  56.985  1.00 10.92  ? 602 HCD A C12 1 
HETATM 8170 C  C13 . HCD F 4 .   ? -35.425 -4.607  57.914  1.00 11.72  ? 602 HCD A C13 1 
HETATM 8171 C  C14 . HCD F 4 .   ? -36.108 -5.424  59.004  1.00 11.39  ? 602 HCD A C14 1 
HETATM 8172 C  C15 . HCD F 4 .   ? -36.579 -4.394  60.030  1.00 13.09  ? 602 HCD A C15 1 
HETATM 8173 C  C16 . HCD F 4 .   ? -35.453 -3.362  60.015  1.00 13.88  ? 602 HCD A C16 1 
HETATM 8174 C  C17 . HCD F 4 .   ? -34.521 -3.777  58.858  1.00 12.99  ? 602 HCD A C17 1 
HETATM 8175 C  C18 . HCD F 4 .   ? -36.422 -3.739  57.115  1.00 10.48  ? 602 HCD A C18 1 
HETATM 8176 C  C19 . HCD F 4 .   ? -38.289 -7.870  55.819  1.00 10.25  ? 602 HCD A C19 1 
HETATM 8177 C  C20 . HCD F 4 .   ? -33.716 -2.578  58.309  1.00 14.09  ? 602 HCD A C20 1 
HETATM 8178 C  C21 . HCD F 4 .   ? -32.808 -2.954  57.135  1.00 12.49  ? 602 HCD A C21 1 
HETATM 8179 C  C22 . HCD F 4 .   ? -32.873 -1.894  59.404  1.00 14.82  ? 602 HCD A C22 1 
HETATM 8180 C  C23 . HCD F 4 .   ? -31.826 -2.789  60.086  1.00 17.14  ? 602 HCD A C23 1 
HETATM 8181 C  C24 . HCD F 4 .   ? -31.183 -2.088  61.278  1.00 16.38  ? 602 HCD A C24 1 
HETATM 8182 C  C25 . HCD F 4 .   ? -30.256 -2.996  62.082  1.00 17.22  ? 602 HCD A C25 1 
HETATM 8183 C  C26 . HCD F 4 .   ? -29.626 -2.205  63.226  1.00 17.79  ? 602 HCD A C26 1 
HETATM 8184 C  C27 . HCD F 4 .   ? -29.167 -3.638  61.233  1.00 17.01  ? 602 HCD A C27 1 
HETATM 8185 C  CHA . HEM G 3 .   ? 14.578  -0.637  16.750  1.00 13.56  ? 601 HEM B CHA 1 
HETATM 8186 C  CHB . HEM G 3 .   ? 9.818   -1.063  15.932  1.00 13.44  ? 601 HEM B CHB 1 
HETATM 8187 C  CHC . HEM G 3 .   ? 9.395   -4.172  19.648  1.00 14.49  ? 601 HEM B CHC 1 
HETATM 8188 C  CHD . HEM G 3 .   ? 13.994  -3.292  20.820  1.00 14.99  ? 601 HEM B CHD 1 
HETATM 8189 C  C1A . HEM G 3 .   ? 13.336  -0.507  16.162  1.00 13.49  ? 601 HEM B C1A 1 
HETATM 8190 C  C2A . HEM G 3 .   ? 13.015  0.234   14.949  1.00 12.92  ? 601 HEM B C2A 1 
HETATM 8191 C  C3A . HEM G 3 .   ? 11.702  0.111   14.735  1.00 13.02  ? 601 HEM B C3A 1 
HETATM 8192 C  C4A . HEM G 3 .   ? 11.145  -0.705  15.796  1.00 13.55  ? 601 HEM B C4A 1 
HETATM 8193 C  CMA . HEM G 3 .   ? 10.897  0.716   13.560  1.00 12.37  ? 601 HEM B CMA 1 
HETATM 8194 C  CAA . HEM G 3 .   ? 14.016  0.996   14.046  1.00 12.14  ? 601 HEM B CAA 1 
HETATM 8195 C  CBA . HEM G 3 .   ? 14.351  0.033   12.900  1.00 13.88  ? 601 HEM B CBA 1 
HETATM 8196 C  CGA . HEM G 3 .   ? 15.311  0.589   11.865  1.00 15.45  ? 601 HEM B CGA 1 
HETATM 8197 O  O1A . HEM G 3 .   ? 15.994  1.624   12.109  1.00 16.13  ? 601 HEM B O1A 1 
HETATM 8198 O  O2A . HEM G 3 .   ? 15.412  -0.026  10.768  1.00 15.25  ? 601 HEM B O2A 1 
HETATM 8199 C  C1B . HEM G 3 .   ? 9.292   -1.951  16.848  1.00 13.60  ? 601 HEM B C1B 1 
HETATM 8200 C  C2B . HEM G 3 .   ? 7.915   -2.419  16.895  1.00 13.74  ? 601 HEM B C2B 1 
HETATM 8201 C  C3B . HEM G 3 .   ? 7.809   -3.279  17.925  1.00 13.82  ? 601 HEM B C3B 1 
HETATM 8202 C  C4B . HEM G 3 .   ? 9.107   -3.378  18.556  1.00 14.30  ? 601 HEM B C4B 1 
HETATM 8203 C  CMB . HEM G 3 .   ? 6.813   -1.984  15.899  1.00 13.53  ? 601 HEM B CMB 1 
HETATM 8204 C  CAB . HEM G 3 .   ? 6.580   -4.061  18.441  1.00 14.61  ? 601 HEM B CAB 1 
HETATM 8205 C  CBB . HEM G 3 .   ? 5.472   -4.232  17.715  1.00 16.30  ? 601 HEM B CBB 1 
HETATM 8206 C  C1C . HEM G 3 .   ? 10.610  -4.246  20.281  1.00 14.59  ? 601 HEM B C1C 1 
HETATM 8207 C  C2C . HEM G 3 .   ? 10.952  -5.099  21.396  1.00 15.44  ? 601 HEM B C2C 1 
HETATM 8208 C  C3C . HEM G 3 .   ? 12.226  -4.849  21.719  1.00 14.94  ? 601 HEM B C3C 1 
HETATM 8209 C  C4C . HEM G 3 .   ? 12.735  -3.837  20.817  1.00 15.08  ? 601 HEM B C4C 1 
HETATM 8210 C  CMC . HEM G 3 .   ? 10.019  -6.126  22.093  1.00 14.96  ? 601 HEM B CMC 1 
HETATM 8211 C  CAC . HEM G 3 .   ? 13.009  -5.542  22.848  1.00 15.40  ? 601 HEM B CAC 1 
HETATM 8212 C  CBC . HEM G 3 .   ? 14.021  -6.355  22.535  1.00 17.63  ? 601 HEM B CBC 1 
HETATM 8213 C  C1D . HEM G 3 .   ? 14.579  -2.497  19.855  1.00 14.58  ? 601 HEM B C1D 1 
HETATM 8214 C  C2D . HEM G 3 .   ? 15.956  -2.066  19.884  1.00 14.77  ? 601 HEM B C2D 1 
HETATM 8215 C  C3D . HEM G 3 .   ? 16.145  -1.234  18.617  1.00 14.81  ? 601 HEM B C3D 1 
HETATM 8216 C  C4D . HEM G 3 .   ? 14.864  -1.252  17.949  1.00 13.97  ? 601 HEM B C4D 1 
HETATM 8217 C  CMD . HEM G 3 .   ? 17.006  -2.371  20.978  1.00 14.72  ? 601 HEM B CMD 1 
HETATM 8218 C  CAD . HEM G 3 .   ? 17.445  -0.547  18.153  1.00 14.96  ? 601 HEM B CAD 1 
HETATM 8219 C  CBD . HEM G 3 .   ? 18.258  -1.652  17.478  1.00 15.79  ? 601 HEM B CBD 1 
HETATM 8220 C  CGD . HEM G 3 .   ? 19.608  -1.191  16.976  1.00 17.04  ? 601 HEM B CGD 1 
HETATM 8221 O  O1D . HEM G 3 .   ? 20.497  -2.062  16.814  1.00 18.32  ? 601 HEM B O1D 1 
HETATM 8222 O  O2D . HEM G 3 .   ? 19.825  0.023   16.726  1.00 18.18  ? 601 HEM B O2D 1 
HETATM 8223 N  NA  . HEM G 3 .   ? 12.178  -1.079  16.635  1.00 13.43  ? 601 HEM B NA  1 
HETATM 8224 N  NB  . HEM G 3 .   ? 9.990   -2.560  17.876  1.00 13.01  ? 601 HEM B NB  1 
HETATM 8225 N  NC  . HEM G 3 .   ? 11.728  -3.505  19.944  1.00 14.40  ? 601 HEM B NC  1 
HETATM 8226 N  ND  . HEM G 3 .   ? 13.982  -2.012  18.702  1.00 14.27  ? 601 HEM B ND  1 
HETATM 8227 FE FE  . HEM G 3 .   ? 11.971  -2.337  18.248  1.00 15.09  ? 601 HEM B FE  1 
HETATM 8228 C  C1  . HCD H 4 .   ? 10.789  9.584   16.312  1.00 11.80  ? 602 HCD B C1  1 
HETATM 8229 O  O1  . HCD H 4 .   ? 11.838  12.473  14.063  1.00 12.87  ? 602 HCD B O1  1 
HETATM 8230 C  C2  . HCD H 4 .   ? 10.655  10.832  15.416  1.00 13.19  ? 602 HCD B C2  1 
HETATM 8231 O  O2  . HCD H 4 .   ? 11.744  1.359   18.667  1.00 13.64  ? 602 HCD B O2  1 
HETATM 8232 C  C3  . HCD H 4 .   ? 12.014  11.330  14.915  1.00 12.90  ? 602 HCD B C3  1 
HETATM 8233 C  C4  . HCD H 4 .   ? 12.718  10.209  14.136  1.00 11.62  ? 602 HCD B C4  1 
HETATM 8234 C  C5  . HCD H 4 .   ? 12.787  8.961   14.998  1.00 11.81  ? 602 HCD B C5  1 
HETATM 8235 C  C6  . HCD H 4 .   ? 14.000  8.389   15.175  1.00 11.77  ? 602 HCD B C6  1 
HETATM 8236 C  C7  . HCD H 4 .   ? 14.234  7.142   16.009  1.00 11.20  ? 602 HCD B C7  1 
HETATM 8237 C  C8  . HCD H 4 .   ? 12.947  6.371   16.304  1.00 10.94  ? 602 HCD B C8  1 
HETATM 8238 C  C9  . HCD H 4 .   ? 11.836  7.348   16.729  1.00 10.54  ? 602 HCD B C9  1 
HETATM 8239 C  C10 . HCD H 4 .   ? 11.519  8.406   15.641  1.00 12.01  ? 602 HCD B C10 1 
HETATM 8240 C  C11 . HCD H 4 .   ? 10.596  6.593   17.253  1.00 9.01   ? 602 HCD B C11 1 
HETATM 8241 C  C12 . HCD H 4 .   ? 10.907  5.501   18.301  1.00 10.49  ? 602 HCD B C12 1 
HETATM 8242 C  C13 . HCD H 4 .   ? 11.963  4.497   17.818  1.00 11.54  ? 602 HCD B C13 1 
HETATM 8243 C  C14 . HCD H 4 .   ? 13.179  5.323   17.408  1.00 11.46  ? 602 HCD B C14 1 
HETATM 8244 C  C15 . HCD H 4 .   ? 14.308  4.319   17.227  1.00 12.63  ? 602 HCD B C15 1 
HETATM 8245 C  C16 . HCD H 4 .   ? 14.015  3.287   18.314  1.00 13.82  ? 602 HCD B C16 1 
HETATM 8246 C  C17 . HCD H 4 .   ? 12.650  3.654   18.917  1.00 11.71  ? 602 HCD B C17 1 
HETATM 8247 C  C18 . HCD H 4 .   ? 11.442  3.635   16.653  1.00 11.09  ? 602 HCD B C18 1 
HETATM 8248 C  C19 . HCD H 4 .   ? 10.661  7.799   14.515  1.00 10.36  ? 602 HCD B C19 1 
HETATM 8249 C  C20 . HCD H 4 .   ? 11.934  2.446   19.590  1.00 13.00  ? 602 HCD B C20 1 
HETATM 8250 C  C21 . HCD H 4 .   ? 10.559  2.806   20.159  1.00 11.04  ? 602 HCD B C21 1 
HETATM 8251 C  C22 . HCD H 4 .   ? 12.769  1.807   20.717  1.00 13.92  ? 602 HCD B C22 1 
HETATM 8252 C  C23 . HCD H 4 .   ? 13.267  2.741   21.830  1.00 15.79  ? 602 HCD B C23 1 
HETATM 8253 C  C24 . HCD H 4 .   ? 14.161  1.996   22.824  1.00 15.88  ? 602 HCD B C24 1 
HETATM 8254 C  C25 . HCD H 4 .   ? 14.703  2.910   23.925  1.00 16.81  ? 602 HCD B C25 1 
HETATM 8255 C  C26 . HCD H 4 .   ? 15.784  2.196   24.736  1.00 17.49  ? 602 HCD B C26 1 
HETATM 8256 C  C27 . HCD H 4 .   ? 13.584  3.369   24.848  1.00 16.46  ? 602 HCD B C27 1 
HETATM 8257 FE FE1 . FES I 5 .   ? -47.750 12.076  65.127  1.00 99.71  ? 150 FES C FE1 1 
HETATM 8258 FE FE2 . FES I 5 .   ? -48.939 14.844  64.533  1.00 100.22 ? 150 FES C FE2 1 
HETATM 8259 S  S1  . FES I 5 .   ? -48.058 13.254  63.295  1.00 99.63  ? 150 FES C S1  1 
HETATM 8260 S  S2  . FES I 5 .   ? -48.822 13.575  66.326  1.00 99.73  ? 150 FES C S2  1 
HETATM 8261 FE FE1 . FES J 5 .   ? 21.964  -12.476 7.861   1.00 110.44 ? 151 FES D FE1 1 
HETATM 8262 FE FE2 . FES J 5 .   ? 21.817  -14.816 5.916   1.00 110.47 ? 151 FES D FE2 1 
HETATM 8263 S  S1  . FES J 5 .   ? 20.313  -13.668 7.036   1.00 110.59 ? 151 FES D S1  1 
HETATM 8264 S  S2  . FES J 5 .   ? 23.391  -14.025 7.230   1.00 110.44 ? 151 FES D S2  1 
HETATM 8265 O  O   . HOH K 6 .   ? -18.918 11.712  57.634  1.00 18.78  ? 1   HOH A O   1 
HETATM 8266 O  O   . HOH K 6 .   ? -15.688 6.159   47.315  1.00 19.53  ? 489 HOH A O   1 
HETATM 8267 O  O   . HOH K 6 .   ? -23.278 15.249  66.927  1.00 17.61  ? 490 HOH A O   1 
HETATM 8268 O  O   . HOH K 6 .   ? -38.801 -1.124  51.795  1.00 13.84  ? 491 HOH A O   1 
HETATM 8269 O  O   . HOH K 6 .   ? -35.128 10.111  59.785  1.00 13.02  ? 492 HOH A O   1 
HETATM 8270 O  O   . HOH K 6 .   ? -41.885 -4.537  43.762  1.00 14.50  ? 493 HOH A O   1 
HETATM 8271 O  O   . HOH K 6 .   ? -34.210 -22.344 70.127  1.00 27.04  ? 494 HOH A O   1 
HETATM 8272 O  O   . HOH K 6 .   ? -44.604 -16.976 52.149  1.00 21.56  ? 495 HOH A O   1 
HETATM 8273 O  O   . HOH K 6 .   ? -36.768 2.583   33.851  1.00 19.74  ? 496 HOH A O   1 
HETATM 8274 O  O   . HOH K 6 .   ? -23.093 0.516   40.367  1.00 10.45  ? 497 HOH A O   1 
HETATM 8275 O  O   . HOH K 6 .   ? -12.010 12.471  30.044  1.00 18.33  ? 498 HOH A O   1 
HETATM 8276 O  O   . HOH K 6 .   ? -47.256 -28.730 55.344  1.00 20.90  ? 499 HOH A O   1 
HETATM 8277 O  O   . HOH K 6 .   ? -27.234 6.809   55.051  1.00 18.79  ? 500 HOH A O   1 
HETATM 8278 O  O   . HOH K 6 .   ? -15.394 12.062  52.363  1.00 14.37  ? 501 HOH A O   1 
HETATM 8279 O  O   . HOH K 6 .   ? -38.494 -21.085 63.372  1.00 36.85  ? 502 HOH A O   1 
HETATM 8280 O  O   . HOH K 6 .   ? -48.042 5.263   69.932  1.00 55.38  ? 503 HOH A O   1 
HETATM 8281 O  O   . HOH K 6 .   ? -36.000 -7.675  52.575  1.00 8.74   ? 504 HOH A O   1 
HETATM 8282 O  O   . HOH K 6 .   ? -34.730 4.660   27.885  1.00 23.90  ? 505 HOH A O   1 
HETATM 8283 O  O   . HOH K 6 .   ? -46.317 1.662   62.903  1.00 19.74  ? 506 HOH A O   1 
HETATM 8284 O  O   . HOH K 6 .   ? -18.091 18.647  54.931  1.00 11.98  ? 507 HOH A O   1 
HETATM 8285 O  O   . HOH K 6 .   ? -40.980 -12.388 54.918  1.00 13.83  ? 516 HOH A O   1 
HETATM 8286 O  O   . HOH K 6 .   ? -56.656 -16.379 48.884  1.00 17.35  ? 517 HOH A O   1 
HETATM 8287 O  O   . HOH K 6 .   ? -50.592 -3.028  66.758  1.00 41.65  ? 518 HOH A O   1 
HETATM 8288 O  O   . HOH K 6 .   ? -53.004 3.180   69.189  1.00 42.36  ? 519 HOH A O   1 
HETATM 8289 O  O   . HOH K 6 .   ? -40.972 13.156  70.164  1.00 50.78  ? 520 HOH A O   1 
HETATM 8290 O  O   . HOH K 6 .   ? -12.222 13.527  66.209  1.00 47.98  ? 521 HOH A O   1 
HETATM 8291 O  O   . HOH K 6 .   ? -19.961 -0.343  31.195  1.00 33.28  ? 522 HOH A O   1 
HETATM 8292 O  O   . HOH K 6 .   ? -43.203 -9.521  49.068  1.00 13.01  ? 523 HOH A O   1 
HETATM 8293 O  O   . HOH K 6 .   ? -33.306 -15.841 68.814  1.00 31.97  ? 524 HOH A O   1 
HETATM 8294 O  O   . HOH K 6 .   ? -45.767 12.207  45.126  1.00 32.62  ? 525 HOH A O   1 
HETATM 8295 O  O   . HOH K 6 .   ? -42.187 4.064   49.480  1.00 35.24  ? 526 HOH A O   1 
HETATM 8296 O  O   . HOH K 6 .   ? -47.519 6.606   58.093  1.00 30.13  ? 527 HOH A O   1 
HETATM 8297 O  O   . HOH K 6 .   ? -17.265 18.215  66.170  1.00 38.26  ? 528 HOH A O   1 
HETATM 8298 O  O   . HOH K 6 .   ? -28.037 -0.539  56.363  1.00 21.64  ? 529 HOH A O   1 
HETATM 8299 O  O   . HOH K 6 .   ? -26.762 23.624  47.365  1.00 22.60  ? 530 HOH A O   1 
HETATM 8300 O  O   . HOH K 6 .   ? -36.051 -5.170  43.632  1.00 10.83  ? 531 HOH A O   1 
HETATM 8301 O  O   . HOH K 6 .   ? -30.794 25.826  52.149  1.00 27.81  ? 532 HOH A O   1 
HETATM 8302 O  O   . HOH K 6 .   ? -7.582  11.702  26.316  1.00 31.20  ? 533 HOH A O   1 
HETATM 8303 O  O   . HOH K 6 .   ? -54.732 -9.079  50.420  1.00 21.66  ? 534 HOH A O   1 
HETATM 8304 O  O   . HOH K 6 .   ? -23.377 -2.871  41.244  1.00 18.64  ? 535 HOH A O   1 
HETATM 8305 O  O   . HOH K 6 .   ? -22.096 1.221   31.437  1.00 26.49  ? 536 HOH A O   1 
HETATM 8306 O  O   . HOH K 6 .   ? -25.631 21.052  45.791  1.00 21.45  ? 537 HOH A O   1 
HETATM 8307 O  O   . HOH K 6 .   ? -18.345 19.347  50.127  1.00 24.86  ? 538 HOH A O   1 
HETATM 8308 O  O   . HOH K 6 .   ? -40.894 -11.900 66.446  1.00 16.43  ? 539 HOH A O   1 
HETATM 8309 O  O   . HOH K 6 .   ? -24.286 -3.850  33.936  1.00 23.64  ? 540 HOH A O   1 
HETATM 8310 O  O   . HOH K 6 .   ? -28.258 -26.642 69.726  1.00 19.12  ? 541 HOH A O   1 
HETATM 8311 O  O   . HOH K 6 .   ? -45.207 -3.749  72.147  1.00 30.97  ? 542 HOH A O   1 
HETATM 8312 O  O   . HOH K 6 .   ? -38.760 -13.627 65.939  1.00 14.83  ? 543 HOH A O   1 
HETATM 8313 O  O   . HOH K 6 .   ? -10.167 5.154   29.631  1.00 18.46  ? 544 HOH A O   1 
HETATM 8314 O  O   . HOH K 6 .   ? -35.337 -4.302  46.169  1.00 14.43  ? 545 HOH A O   1 
HETATM 8315 O  O   . HOH K 6 .   ? -29.475 -1.340  43.755  1.00 18.33  ? 546 HOH A O   1 
HETATM 8316 O  O   . HOH K 6 .   ? -34.114 -17.770 62.403  1.00 21.54  ? 547 HOH A O   1 
HETATM 8317 O  O   . HOH K 6 .   ? -43.903 -1.956  46.749  1.00 21.79  ? 548 HOH A O   1 
HETATM 8318 O  O   . HOH K 6 .   ? -43.666 4.137   53.601  1.00 18.27  ? 549 HOH A O   1 
HETATM 8319 O  O   . HOH K 6 .   ? -25.502 13.037  51.861  1.00 19.14  ? 550 HOH A O   1 
HETATM 8320 O  O   . HOH K 6 .   ? -38.641 9.416   76.019  1.00 27.25  ? 551 HOH A O   1 
HETATM 8321 O  O   . HOH K 6 .   ? -34.827 6.495   76.336  1.00 38.42  ? 552 HOH A O   1 
HETATM 8322 O  O   . HOH K 6 .   ? -20.106 18.716  56.471  1.00 15.65  ? 553 HOH A O   1 
HETATM 8323 O  O   . HOH K 6 .   ? -17.832 -0.786  43.280  1.00 22.79  ? 554 HOH A O   1 
HETATM 8324 O  O   . HOH K 6 .   ? -14.162 4.557   32.636  1.00 17.39  ? 555 HOH A O   1 
HETATM 8325 O  O   . HOH K 6 .   ? -37.457 -16.691 54.370  1.00 26.89  ? 556 HOH A O   1 
HETATM 8326 O  O   . HOH K 6 .   ? -28.120 -3.713  33.023  1.00 33.67  ? 557 HOH A O   1 
HETATM 8327 O  O   . HOH K 6 .   ? -42.250 -4.398  59.196  1.00 16.01  ? 558 HOH A O   1 
HETATM 8328 O  O   . HOH K 6 .   ? -55.492 -24.382 50.875  1.00 30.93  ? 559 HOH A O   1 
HETATM 8329 O  O   . HOH K 6 .   ? -40.604 18.922  46.157  1.00 24.97  ? 560 HOH A O   1 
HETATM 8330 O  O   . HOH K 6 .   ? -15.310 -9.560  64.635  1.00 25.99  ? 561 HOH A O   1 
HETATM 8331 O  O   . HOH K 6 .   ? -35.723 -11.154 41.056  1.00 20.07  ? 562 HOH A O   1 
HETATM 8332 O  O   . HOH K 6 .   ? -51.981 2.256   41.456  1.00 21.14  ? 563 HOH A O   1 
HETATM 8333 O  O   . HOH K 6 .   ? -26.049 19.709  67.448  1.00 26.37  ? 564 HOH A O   1 
HETATM 8334 O  O   . HOH K 6 .   ? -40.009 10.823  48.314  1.00 20.68  ? 565 HOH A O   1 
HETATM 8335 O  O   . HOH K 6 .   ? -38.068 14.174  54.150  1.00 31.42  ? 566 HOH A O   1 
HETATM 8336 O  O   . HOH K 6 .   ? -23.958 -7.779  35.816  1.00 17.32  ? 567 HOH A O   1 
HETATM 8337 O  O   . HOH K 6 .   ? -22.072 -2.523  53.682  1.00 28.87  ? 568 HOH A O   1 
HETATM 8338 O  O   . HOH K 6 .   ? -55.998 -22.027 43.898  1.00 33.58  ? 569 HOH A O   1 
HETATM 8339 O  O   . HOH K 6 .   ? -30.640 -21.999 54.661  1.00 22.75  ? 570 HOH A O   1 
HETATM 8340 O  O   . HOH K 6 .   ? -14.073 -3.569  51.314  1.00 34.17  ? 571 HOH A O   1 
HETATM 8341 O  O   . HOH K 6 .   ? -41.939 -15.123 54.404  1.00 19.03  ? 572 HOH A O   1 
HETATM 8342 O  O   . HOH K 6 .   ? -32.797 3.098   28.261  1.00 22.45  ? 573 HOH A O   1 
HETATM 8343 O  O   . HOH K 6 .   ? -27.786 24.113  61.007  1.00 24.77  ? 574 HOH A O   1 
HETATM 8344 O  O   . HOH K 6 .   ? -17.275 -15.450 65.685  1.00 19.70  ? 575 HOH A O   1 
HETATM 8345 O  O   . HOH K 6 .   ? -16.082 15.846  34.167  1.00 32.95  ? 576 HOH A O   1 
HETATM 8346 O  O   . HOH K 6 .   ? -36.949 6.479   27.393  1.00 45.83  ? 577 HOH A O   1 
HETATM 8347 O  O   . HOH K 6 .   ? -30.934 16.504  65.725  1.00 16.46  ? 578 HOH A O   1 
HETATM 8348 O  O   . HOH K 6 .   ? -17.760 0.155   50.406  1.00 12.38  ? 579 HOH A O   1 
HETATM 8349 O  O   . HOH K 6 .   ? -20.744 -14.313 53.844  1.00 37.44  ? 580 HOH A O   1 
HETATM 8350 O  O   . HOH K 6 .   ? -49.229 3.826   64.202  1.00 31.34  ? 581 HOH A O   1 
HETATM 8351 O  O   . HOH K 6 .   ? -16.315 11.257  64.410  1.00 29.15  ? 582 HOH A O   1 
HETATM 8352 O  O   . HOH K 6 .   ? -13.717 14.175  53.469  1.00 30.01  ? 583 HOH A O   1 
HETATM 8353 O  O   . HOH K 6 .   ? -40.683 -13.894 58.766  1.00 19.50  ? 584 HOH A O   1 
HETATM 8354 O  O   . HOH K 6 .   ? -35.552 23.156  33.107  1.00 25.48  ? 585 HOH A O   1 
HETATM 8355 O  O   . HOH K 6 .   ? -27.353 21.384  68.970  1.00 32.98  ? 586 HOH A O   1 
HETATM 8356 O  O   . HOH K 6 .   ? -40.154 -4.710  57.359  1.00 22.00  ? 587 HOH A O   1 
HETATM 8357 O  O   . HOH K 6 .   ? -49.793 -1.701  71.134  1.00 27.17  ? 588 HOH A O   1 
HETATM 8358 O  O   . HOH K 6 .   ? -27.401 -1.590  70.061  1.00 23.96  ? 589 HOH A O   1 
HETATM 8359 O  O   . HOH K 6 .   ? -43.445 -26.198 63.293  1.00 34.84  ? 590 HOH A O   1 
HETATM 8360 O  O   . HOH K 6 .   ? -19.337 18.011  58.977  1.00 18.38  ? 591 HOH A O   1 
HETATM 8361 O  O   . HOH K 6 .   ? -40.316 8.977   50.155  1.00 24.21  ? 592 HOH A O   1 
HETATM 8362 O  O   . HOH K 6 .   ? -19.490 19.035  43.455  1.00 33.38  ? 593 HOH A O   1 
HETATM 8363 O  O   . HOH K 6 .   ? -37.037 -2.657  36.993  1.00 28.85  ? 594 HOH A O   1 
HETATM 8364 O  O   . HOH K 6 .   ? -24.640 9.698   25.438  1.00 39.42  ? 595 HOH A O   1 
HETATM 8365 O  O   . HOH K 6 .   ? -30.979 11.908  30.420  1.00 27.25  ? 596 HOH A O   1 
HETATM 8366 O  O   . HOH K 6 .   ? -57.383 -20.501 47.281  1.00 34.76  ? 597 HOH A O   1 
HETATM 8367 O  O   . HOH K 6 .   ? -12.737 4.587   28.506  1.00 31.96  ? 598 HOH A O   1 
HETATM 8368 O  O   . HOH K 6 .   ? -20.815 -5.324  42.847  1.00 26.05  ? 599 HOH A O   1 
HETATM 8369 O  O   . HOH K 6 .   ? -38.405 12.095  75.112  1.00 29.96  ? 600 HOH A O   1 
HETATM 8370 O  O   . HOH K 6 .   ? -28.927 3.495   29.408  1.00 21.15  ? 603 HOH A O   1 
HETATM 8371 O  O   . HOH K 6 .   ? -44.030 -17.188 58.217  1.00 23.82  ? 604 HOH A O   1 
HETATM 8372 O  O   . HOH K 6 .   ? -16.578 18.669  46.428  1.00 31.62  ? 605 HOH A O   1 
HETATM 8373 O  O   . HOH K 6 .   ? -26.065 25.546  62.548  1.00 28.52  ? 606 HOH A O   1 
HETATM 8374 O  O   . HOH K 6 .   ? -40.411 -5.591  69.246  1.00 22.17  ? 607 HOH A O   1 
HETATM 8375 O  O   . HOH K 6 .   ? -25.960 24.458  29.495  1.00 53.46  ? 608 HOH A O   1 
HETATM 8376 O  O   . HOH K 6 .   ? -31.860 -19.121 46.454  1.00 33.04  ? 609 HOH A O   1 
HETATM 8377 O  O   . HOH K 6 .   ? -18.716 -7.565  53.291  1.00 25.06  ? 610 HOH A O   1 
HETATM 8378 O  O   . HOH K 6 .   ? -20.970 14.220  79.771  1.00 39.94  ? 611 HOH A O   1 
HETATM 8379 O  O   . HOH K 6 .   ? -44.073 14.306  44.825  1.00 19.57  ? 612 HOH A O   1 
HETATM 8380 O  O   . HOH K 6 .   ? -60.641 -7.641  53.864  1.00 30.34  ? 613 HOH A O   1 
HETATM 8381 O  O   . HOH K 6 .   ? -48.444 -16.198 63.777  1.00 21.16  ? 614 HOH A O   1 
HETATM 8382 O  O   . HOH K 6 .   ? -30.910 -23.550 52.601  1.00 28.69  ? 615 HOH A O   1 
HETATM 8383 O  O   . HOH K 6 .   ? -18.219 -12.667 70.313  1.00 30.49  ? 616 HOH A O   1 
HETATM 8384 O  O   . HOH K 6 .   ? -49.003 -23.062 56.916  1.00 22.54  ? 617 HOH A O   1 
HETATM 8385 O  O   . HOH K 6 .   ? -16.392 -12.759 67.070  1.00 33.71  ? 618 HOH A O   1 
HETATM 8386 O  O   . HOH K 6 .   ? -15.588 17.164  59.836  1.00 34.52  ? 619 HOH A O   1 
HETATM 8387 O  O   . HOH K 6 .   ? -34.843 -17.023 53.040  1.00 21.06  ? 620 HOH A O   1 
HETATM 8388 O  O   . HOH K 6 .   ? -13.369 16.630  41.017  1.00 36.02  ? 621 HOH A O   1 
HETATM 8389 O  O   . HOH K 6 .   ? -48.753 -12.656 42.688  1.00 24.89  ? 622 HOH A O   1 
HETATM 8390 O  O   . HOH K 6 .   ? -46.203 -18.926 64.613  1.00 29.32  ? 623 HOH A O   1 
HETATM 8391 O  O   . HOH K 6 .   ? -10.992 6.712   35.684  1.00 20.78  ? 624 HOH A O   1 
HETATM 8392 O  O   . HOH K 6 .   ? -45.823 -3.936  33.452  1.00 32.00  ? 625 HOH A O   1 
HETATM 8393 O  O   . HOH K 6 .   ? -32.569 -20.129 55.774  1.00 24.52  ? 626 HOH A O   1 
HETATM 8394 O  O   . HOH K 6 .   ? -50.852 3.043   39.266  1.00 21.65  ? 627 HOH A O   1 
HETATM 8395 O  O   . HOH K 6 .   ? -39.319 2.313   32.679  1.00 29.10  ? 628 HOH A O   1 
HETATM 8396 O  O   . HOH K 6 .   ? -39.540 -16.229 65.754  1.00 31.59  ? 629 HOH A O   1 
HETATM 8397 O  O   . HOH K 6 .   ? -41.509 -16.420 58.695  1.00 30.08  ? 630 HOH A O   1 
HETATM 8398 O  O   . HOH K 6 .   ? -27.306 13.903  49.927  1.00 22.58  ? 631 HOH A O   1 
HETATM 8399 O  O   . HOH K 6 .   ? -17.979 -12.425 59.414  1.00 21.87  ? 632 HOH A O   1 
HETATM 8400 O  O   . HOH K 6 .   ? -40.829 9.446   77.275  1.00 26.09  ? 633 HOH A O   1 
HETATM 8401 O  O   . HOH K 6 .   ? -36.638 -8.052  40.381  1.00 36.53  ? 634 HOH A O   1 
HETATM 8402 O  O   . HOH K 6 .   ? -19.859 14.193  77.422  1.00 24.26  ? 635 HOH A O   1 
HETATM 8403 O  O   . HOH K 6 .   ? -35.622 -4.155  35.198  1.00 35.65  ? 636 HOH A O   1 
HETATM 8404 O  O   . HOH K 6 .   ? -35.942 13.248  75.148  1.00 40.42  ? 637 HOH A O   1 
HETATM 8405 O  O   . HOH K 6 .   ? -14.799 -1.322  71.210  1.00 30.07  ? 638 HOH A O   1 
HETATM 8406 O  O   . HOH K 6 .   ? -45.053 -27.712 61.913  1.00 24.66  ? 639 HOH A O   1 
HETATM 8407 O  O   . HOH K 6 .   ? -43.465 -23.843 51.084  1.00 21.83  ? 640 HOH A O   1 
HETATM 8408 O  O   . HOH K 6 .   ? -48.233 -4.968  66.539  1.00 19.10  ? 641 HOH A O   1 
HETATM 8409 O  O   . HOH K 6 .   ? -34.529 25.557  33.737  1.00 34.79  ? 642 HOH A O   1 
HETATM 8410 O  O   . HOH K 6 .   ? -18.659 -5.403  39.223  1.00 29.93  ? 643 HOH A O   1 
HETATM 8411 O  O   . HOH K 6 .   ? -39.453 -3.396  35.892  1.00 23.02  ? 644 HOH A O   1 
HETATM 8412 O  O   . HOH K 6 .   ? -30.361 25.592  37.200  1.00 24.09  ? 645 HOH A O   1 
HETATM 8413 O  O   . HOH K 6 .   ? -16.220 10.049  67.085  1.00 27.98  ? 646 HOH A O   1 
HETATM 8414 O  O   . HOH K 6 .   ? -26.262 21.841  35.481  1.00 38.25  ? 647 HOH A O   1 
HETATM 8415 O  O   . HOH K 6 .   ? -42.367 6.309   32.370  1.00 32.98  ? 648 HOH A O   1 
HETATM 8416 O  O   . HOH K 6 .   ? -27.888 25.545  49.112  1.00 32.88  ? 649 HOH A O   1 
HETATM 8417 O  O   . HOH K 6 .   ? -46.450 -9.874  39.863  1.00 31.18  ? 650 HOH A O   1 
HETATM 8418 O  O   . HOH K 6 .   ? -12.010 4.510   34.294  1.00 18.30  ? 651 HOH A O   1 
HETATM 8419 O  O   . HOH K 6 .   ? -28.417 -3.336  68.425  1.00 29.86  ? 652 HOH A O   1 
HETATM 8420 O  O   . HOH K 6 .   ? -40.167 -18.432 60.002  1.00 26.47  ? 653 HOH A O   1 
HETATM 8421 O  O   . HOH K 6 .   ? -47.034 -9.797  42.474  1.00 23.46  ? 654 HOH A O   1 
HETATM 8422 O  O   . HOH K 6 .   ? -50.280 -18.076 64.561  1.00 25.23  ? 655 HOH A O   1 
HETATM 8423 O  O   . HOH K 6 .   ? -15.299 -6.150  58.189  1.00 20.97  ? 656 HOH A O   1 
HETATM 8424 O  O   . HOH K 6 .   ? -31.875 16.004  30.144  1.00 26.73  ? 657 HOH A O   1 
HETATM 8425 O  O   . HOH K 6 .   ? -47.231 4.216   74.073  1.00 32.08  ? 658 HOH A O   1 
HETATM 8426 O  O   . HOH K 6 .   ? -26.264 -16.147 52.433  1.00 45.55  ? 659 HOH A O   1 
HETATM 8427 O  O   . HOH K 6 .   ? -32.914 -3.084  47.081  1.00 16.26  ? 660 HOH A O   1 
HETATM 8428 O  O   . HOH K 6 .   ? -35.056 -7.875  64.266  1.00 20.18  ? 661 HOH A O   1 
HETATM 8429 O  O   . HOH K 6 .   ? -30.049 19.488  72.876  1.00 57.89  ? 662 HOH A O   1 
HETATM 8430 O  O   . HOH K 6 .   ? -37.245 24.949  63.485  1.00 49.53  ? 663 HOH A O   1 
HETATM 8431 O  O   . HOH K 6 .   ? -23.984 18.155  73.949  1.00 33.80  ? 664 HOH A O   1 
HETATM 8432 O  O   . HOH K 6 .   ? -43.153 3.502   47.411  1.00 29.65  ? 665 HOH A O   1 
HETATM 8433 O  O   . HOH K 6 .   ? -11.519 1.194   50.988  1.00 38.50  ? 666 HOH A O   1 
HETATM 8434 O  O   . HOH K 6 .   ? -43.839 -20.836 45.370  1.00 43.33  ? 667 HOH A O   1 
HETATM 8435 O  O   . HOH K 6 .   ? -35.279 -8.431  71.461  1.00 27.35  ? 668 HOH A O   1 
HETATM 8436 O  O   . HOH K 6 .   ? -40.977 13.750  60.059  1.00 33.35  ? 669 HOH A O   1 
HETATM 8437 O  O   . HOH K 6 .   ? -43.748 -15.475 65.549  1.00 29.24  ? 670 HOH A O   1 
HETATM 8438 O  O   . HOH K 6 .   ? -14.802 6.686   60.481  1.00 32.22  ? 671 HOH A O   1 
HETATM 8439 O  O   . HOH K 6 .   ? -60.332 -18.169 63.596  1.00 31.44  ? 672 HOH A O   1 
HETATM 8440 O  O   . HOH K 6 .   ? -26.385 22.051  60.150  1.00 26.43  ? 673 HOH A O   1 
HETATM 8441 O  O   . HOH K 6 .   ? -21.583 20.828  56.308  1.00 19.90  ? 674 HOH A O   1 
HETATM 8442 O  O   . HOH K 6 .   ? -9.846  9.500   53.878  1.00 28.85  ? 675 HOH A O   1 
HETATM 8443 O  O   . HOH K 6 .   ? -38.713 22.694  39.360  1.00 25.90  ? 676 HOH A O   1 
HETATM 8444 O  O   . HOH K 6 .   ? -15.916 -15.624 61.023  1.00 39.18  ? 677 HOH A O   1 
HETATM 8445 O  O   . HOH K 6 .   ? -23.034 22.005  52.487  1.00 31.11  ? 678 HOH A O   1 
HETATM 8446 O  O   . HOH K 6 .   ? -37.156 -10.202 72.122  1.00 20.53  ? 679 HOH A O   1 
HETATM 8447 O  O   . HOH K 6 .   ? -47.469 -19.715 41.386  1.00 32.78  ? 680 HOH A O   1 
HETATM 8448 O  O   . HOH K 6 .   ? -35.683 -5.206  38.277  1.00 39.12  ? 681 HOH A O   1 
HETATM 8449 O  O   . HOH K 6 .   ? -34.659 0.703   28.490  1.00 32.24  ? 682 HOH A O   1 
HETATM 8450 O  O   . HOH K 6 .   ? -29.281 10.979  28.657  1.00 35.72  ? 683 HOH A O   1 
HETATM 8451 O  O   . HOH K 6 .   ? -34.612 30.850  48.045  1.00 44.87  ? 684 HOH A O   1 
HETATM 8452 O  O   . HOH K 6 .   ? -14.909 2.052   43.349  1.00 40.38  ? 685 HOH A O   1 
HETATM 8453 O  O   . HOH K 6 .   ? -34.612 13.525  72.783  1.00 25.49  ? 686 HOH A O   1 
HETATM 8454 O  O   . HOH K 6 .   ? -13.270 21.785  78.435  1.00 47.25  ? 687 HOH A O   1 
HETATM 8455 O  O   . HOH K 6 .   ? -43.620 -1.661  70.616  1.00 32.96  ? 688 HOH A O   1 
HETATM 8456 O  O   . HOH K 6 .   ? -23.150 -2.388  31.641  1.00 29.70  ? 689 HOH A O   1 
HETATM 8457 O  O   . HOH K 6 .   ? -10.557 -2.276  55.319  1.00 34.08  ? 690 HOH A O   1 
HETATM 8458 O  O   . HOH K 6 .   ? -22.004 -1.873  73.440  1.00 36.04  ? 691 HOH A O   1 
HETATM 8459 O  O   . HOH K 6 .   ? -45.406 -7.121  37.119  1.00 32.88  ? 692 HOH A O   1 
HETATM 8460 O  O   . HOH K 6 .   ? -8.638  14.003  30.712  1.00 38.76  ? 693 HOH A O   1 
HETATM 8461 O  O   . HOH K 6 .   ? -32.671 -16.048 71.638  1.00 35.16  ? 694 HOH A O   1 
HETATM 8462 O  O   . HOH K 6 .   ? -12.980 -4.524  65.629  1.00 40.12  ? 695 HOH A O   1 
HETATM 8463 O  O   . HOH K 6 .   ? -17.621 14.215  27.623  1.00 28.55  ? 696 HOH A O   1 
HETATM 8464 O  O   . HOH K 6 .   ? -64.232 -9.154  55.505  1.00 35.40  ? 697 HOH A O   1 
HETATM 8465 O  O   . HOH K 6 .   ? -41.243 -2.106  78.239  1.00 35.46  ? 698 HOH A O   1 
HETATM 8466 O  O   . HOH K 6 .   ? -39.533 -8.868  72.307  1.00 34.07  ? 699 HOH A O   1 
HETATM 8467 O  O   . HOH K 6 .   ? -11.547 11.811  25.044  1.00 49.57  ? 700 HOH A O   1 
HETATM 8468 O  O   . HOH K 6 .   ? -21.078 18.488  34.438  1.00 45.08  ? 701 HOH A O   1 
HETATM 8469 O  O   . HOH K 6 .   ? -23.429 -26.613 61.598  1.00 42.00  ? 702 HOH A O   1 
HETATM 8470 O  O   . HOH K 6 .   ? -42.624 4.838   77.160  1.00 39.12  ? 703 HOH A O   1 
HETATM 8471 O  O   . HOH K 6 .   ? -18.428 2.993   75.999  1.00 29.42  ? 704 HOH A O   1 
HETATM 8472 O  O   . HOH K 6 .   ? -14.255 1.168   35.651  1.00 24.22  ? 705 HOH A O   1 
HETATM 8473 O  O   . HOH K 6 .   ? -35.187 -19.889 54.798  1.00 26.82  ? 706 HOH A O   1 
HETATM 8474 O  O   . HOH K 6 .   ? -16.331 20.293  79.281  1.00 44.71  ? 707 HOH A O   1 
HETATM 8475 O  O   . HOH K 6 .   ? -35.963 2.626   76.460  1.00 30.98  ? 708 HOH A O   1 
HETATM 8476 O  O   . HOH K 6 .   ? -52.389 -17.219 65.288  1.00 37.31  ? 709 HOH A O   1 
HETATM 8477 O  O   . HOH K 6 .   ? -13.464 -7.901  60.048  1.00 36.38  ? 710 HOH A O   1 
HETATM 8478 O  O   . HOH K 6 .   ? -17.365 15.762  70.305  1.00 33.45  ? 711 HOH A O   1 
HETATM 8479 O  O   . HOH K 6 .   ? -19.802 17.489  66.026  1.00 32.18  ? 712 HOH A O   1 
HETATM 8480 O  O   . HOH K 6 .   ? -37.317 22.196  52.313  1.00 31.09  ? 713 HOH A O   1 
HETATM 8481 O  O   . HOH K 6 .   ? -41.476 -7.953  69.935  1.00 46.04  ? 714 HOH A O   1 
HETATM 8482 O  O   . HOH K 6 .   ? -24.220 -17.633 53.175  1.00 36.22  ? 715 HOH A O   1 
HETATM 8483 O  O   . HOH K 6 .   ? -39.948 -16.326 55.625  1.00 32.48  ? 716 HOH A O   1 
HETATM 8484 O  O   . HOH K 6 .   ? -38.420 13.665  28.875  1.00 34.24  ? 717 HOH A O   1 
HETATM 8485 O  O   . HOH K 6 .   ? -13.055 6.633   48.059  1.00 42.57  ? 718 HOH A O   1 
HETATM 8486 O  O   . HOH K 6 .   ? -16.261 -1.465  37.883  1.00 33.70  ? 720 HOH A O   1 
HETATM 8487 O  O   . HOH K 6 .   ? -46.188 -16.171 65.314  1.00 37.76  ? 721 HOH A O   1 
HETATM 8488 O  O   . HOH K 6 .   ? -11.991 2.329   35.869  1.00 26.11  ? 722 HOH A O   1 
HETATM 8489 O  O   . HOH K 6 .   ? -45.152 4.431   77.280  1.00 29.14  ? 723 HOH A O   1 
HETATM 8490 O  O   . HOH K 6 .   ? -27.187 -13.931 47.318  1.00 46.22  ? 724 HOH A O   1 
HETATM 8491 O  O   . HOH K 6 .   ? -37.046 -6.546  63.232  1.00 11.76  ? 725 HOH A O   1 
HETATM 8492 O  O   . HOH K 6 .   ? -38.218 -4.926  65.264  1.00 10.42  ? 726 HOH A O   1 
HETATM 8493 O  O   . HOH K 6 .   ? -40.609 -5.672  66.588  1.00 22.72  ? 727 HOH A O   1 
HETATM 8494 O  O   . HOH K 6 .   ? -33.932 -0.489  47.377  1.00 12.99  ? 728 HOH A O   1 
HETATM 8495 O  O   . HOH K 6 .   ? -24.902 0.987   75.064  1.00 32.78  ? 729 HOH A O   1 
HETATM 8496 O  O   . HOH K 6 .   ? -24.319 29.339  64.718  1.00 35.93  ? 730 HOH A O   1 
HETATM 8497 O  O   . HOH K 6 .   ? -33.764 17.530  30.616  1.00 30.42  ? 731 HOH A O   1 
HETATM 8498 O  O   . HOH K 6 .   ? -24.669 24.088  72.734  1.00 36.14  ? 732 HOH A O   1 
HETATM 8499 O  O   . HOH K 6 .   ? -50.478 5.994   63.259  1.00 55.07  ? 733 HOH A O   1 
HETATM 8500 O  O   . HOH K 6 .   ? -23.716 24.712  61.780  1.00 39.90  ? 734 HOH A O   1 
HETATM 8501 O  O   . HOH K 6 .   ? -11.700 10.948  66.867  1.00 37.28  ? 735 HOH A O   1 
HETATM 8502 O  O   . HOH K 6 .   ? -37.914 -3.695  75.474  1.00 29.71  ? 736 HOH A O   1 
HETATM 8503 O  O   . HOH K 6 .   ? -36.312 19.122  56.698  1.00 41.22  ? 737 HOH A O   1 
HETATM 8504 O  O   . HOH K 6 .   ? -18.579 -2.524  49.959  1.00 38.18  ? 738 HOH A O   1 
HETATM 8505 O  O   . HOH K 6 .   ? -60.900 10.316  41.764  1.00 45.46  ? 739 HOH A O   1 
HETATM 8506 O  O   . HOH K 6 .   ? -8.906  20.043  76.076  1.00 50.93  ? 740 HOH A O   1 
HETATM 8507 O  O   . HOH K 6 .   ? -22.487 19.795  42.798  1.00 37.61  ? 741 HOH A O   1 
HETATM 8508 O  O   . HOH K 6 .   ? -39.696 18.497  34.172  1.00 29.49  ? 742 HOH A O   1 
HETATM 8509 O  O   . HOH K 6 .   ? -34.919 -28.357 50.458  1.00 29.71  ? 743 HOH A O   1 
HETATM 8510 O  O   . HOH K 6 .   ? -14.187 -0.872  47.710  1.00 38.52  ? 744 HOH A O   1 
HETATM 8511 O  O   . HOH K 6 .   ? -60.459 -1.047  53.766  1.00 42.28  ? 745 HOH A O   1 
HETATM 8512 O  O   . HOH K 6 .   ? -19.051 19.380  77.831  1.00 36.37  ? 746 HOH A O   1 
HETATM 8513 O  O   . HOH K 6 .   ? -39.918 -4.169  77.467  1.00 32.55  ? 747 HOH A O   1 
HETATM 8514 O  O   . HOH K 6 .   ? -52.624 -15.990 68.014  1.00 33.40  ? 748 HOH A O   1 
HETATM 8515 O  O   . HOH K 6 .   ? -42.472 20.019  38.857  1.00 39.66  ? 749 HOH A O   1 
HETATM 8516 O  O   . HOH K 6 .   ? -44.111 1.191   48.276  1.00 32.09  ? 750 HOH A O   1 
HETATM 8517 O  O   . HOH K 6 .   ? -17.855 -5.245  47.703  1.00 51.61  ? 751 HOH A O   1 
HETATM 8518 O  O   . HOH K 6 .   ? -45.872 5.753   55.922  1.00 33.97  ? 752 HOH A O   1 
HETATM 8519 O  O   . HOH K 6 .   ? -23.184 0.257   70.948  1.00 39.07  ? 753 HOH A O   1 
HETATM 8520 O  O   . HOH K 6 .   ? -27.397 -13.062 43.035  1.00 33.07  ? 754 HOH A O   1 
HETATM 8521 O  O   . HOH K 6 .   ? -26.265 -5.422  32.757  1.00 41.13  ? 755 HOH A O   1 
HETATM 8522 O  O   . HOH K 6 .   ? -37.784 13.157  49.365  1.00 32.86  ? 756 HOH A O   1 
HETATM 8523 O  O   . HOH K 6 .   ? -20.778 -3.502  51.412  1.00 27.88  ? 757 HOH A O   1 
HETATM 8524 O  O   . HOH K 6 .   ? -42.227 -0.717  48.564  1.00 31.56  ? 758 HOH A O   1 
HETATM 8525 O  O   . HOH K 6 .   ? -33.409 0.718   57.545  1.00 30.79  ? 759 HOH A O   1 
HETATM 8526 O  O   . HOH L 6 .   ? -0.143  4.434   8.071   1.00 15.08  ? 489 HOH B O   1 
HETATM 8527 O  O   . HOH L 6 .   ? -7.984  -0.621  25.494  1.00 10.24  ? 490 HOH B O   1 
HETATM 8528 O  O   . HOH L 6 .   ? 18.980  26.263  11.415  1.00 35.61  ? 491 HOH B O   1 
HETATM 8529 O  O   . HOH L 6 .   ? 1.452   0.248   16.737  1.00 12.83  ? 492 HOH B O   1 
HETATM 8530 O  O   . HOH L 6 .   ? 17.807  -15.440 31.895  1.00 16.25  ? 493 HOH B O   1 
HETATM 8531 O  O   . HOH L 6 .   ? -3.031  1.196   20.235  1.00 15.33  ? 494 HOH B O   1 
HETATM 8532 O  O   . HOH L 6 .   ? 6.838   7.513   15.863  1.00 6.76   ? 495 HOH B O   1 
HETATM 8533 O  O   . HOH L 6 .   ? -0.023  -2.516  -2.054  1.00 21.57  ? 496 HOH B O   1 
HETATM 8534 O  O   . HOH L 6 .   ? 21.579  -7.477  12.411  1.00 35.90  ? 497 HOH B O   1 
HETATM 8535 O  O   . HOH L 6 .   ? -20.998 -8.345  32.363  1.00 33.01  ? 498 HOH B O   1 
HETATM 8536 O  O   . HOH L 6 .   ? 26.169  -1.164  32.128  1.00 33.85  ? 499 HOH B O   1 
HETATM 8537 O  O   . HOH L 6 .   ? 19.551  -1.732  8.461   1.00 20.50  ? 500 HOH B O   1 
HETATM 8538 O  O   . HOH L 6 .   ? 6.871   0.999   13.141  1.00 11.32  ? 501 HOH B O   1 
HETATM 8539 O  O   . HOH L 6 .   ? 7.698   -12.066 33.864  1.00 20.20  ? 502 HOH B O   1 
HETATM 8540 O  O   . HOH L 6 .   ? 12.495  28.519  5.652   1.00 23.64  ? 503 HOH B O   1 
HETATM 8541 O  O   . HOH L 6 .   ? 16.062  17.666  20.191  1.00 28.05  ? 504 HOH B O   1 
HETATM 8542 O  O   . HOH L 6 .   ? -10.926 -2.726  10.703  1.00 14.49  ? 505 HOH B O   1 
HETATM 8543 O  O   . HOH L 6 .   ? 7.027   -18.935 32.399  1.00 22.86  ? 506 HOH B O   1 
HETATM 8544 O  O   . HOH L 6 .   ? -6.913  2.843   25.317  1.00 16.85  ? 507 HOH B O   1 
HETATM 8545 O  O   . HOH L 6 .   ? 0.824   2.968   17.544  1.00 14.94  ? 508 HOH B O   1 
HETATM 8546 O  O   . HOH L 6 .   ? 15.161  18.452  14.021  1.00 27.04  ? 509 HOH B O   1 
HETATM 8547 O  O   . HOH L 6 .   ? 28.115  1.641   7.251   1.00 35.08  ? 510 HOH B O   1 
HETATM 8548 O  O   . HOH L 6 .   ? 0.253   12.479  1.305   1.00 27.50  ? 516 HOH B O   1 
HETATM 8549 O  O   . HOH L 6 .   ? -15.477 -13.745 7.669   1.00 32.26  ? 517 HOH B O   1 
HETATM 8550 O  O   . HOH L 6 .   ? 8.570   27.882  6.532   1.00 26.16  ? 518 HOH B O   1 
HETATM 8551 O  O   . HOH L 6 .   ? -6.255  0.813   31.176  1.00 27.51  ? 519 HOH B O   1 
HETATM 8552 O  O   . HOH L 6 .   ? 6.953   16.882  17.342  1.00 20.16  ? 520 HOH B O   1 
HETATM 8553 O  O   . HOH L 6 .   ? 14.831  4.240   11.618  1.00 17.22  ? 521 HOH B O   1 
HETATM 8554 O  O   . HOH L 6 .   ? 2.292   20.843  5.196   1.00 37.37  ? 522 HOH B O   1 
HETATM 8555 O  O   . HOH L 6 .   ? 32.461  -5.028  15.333  1.00 38.88  ? 523 HOH B O   1 
HETATM 8556 O  O   . HOH L 6 .   ? 5.235   9.333   8.079   1.00 14.15  ? 524 HOH B O   1 
HETATM 8557 O  O   . HOH L 6 .   ? -1.935  -21.372 24.340  1.00 21.93  ? 525 HOH B O   1 
HETATM 8558 O  O   . HOH L 6 .   ? 7.273   -7.050  25.120  1.00 14.88  ? 526 HOH B O   1 
HETATM 8559 O  O   . HOH L 6 .   ? 33.055  -4.716  12.925  1.00 31.28  ? 527 HOH B O   1 
HETATM 8560 O  O   . HOH L 6 .   ? 8.627   16.749  7.494   1.00 29.19  ? 528 HOH B O   1 
HETATM 8561 O  O   . HOH L 6 .   ? 13.862  -10.313 18.516  1.00 17.64  ? 529 HOH B O   1 
HETATM 8562 O  O   . HOH L 6 .   ? 28.150  3.591   11.722  1.00 35.97  ? 530 HOH B O   1 
HETATM 8563 O  O   . HOH L 6 .   ? 8.300   4.959   -8.588  1.00 35.48  ? 531 HOH B O   1 
HETATM 8564 O  O   . HOH L 6 .   ? 24.534  15.779  23.763  1.00 34.07  ? 532 HOH B O   1 
HETATM 8565 O  O   . HOH L 6 .   ? -20.665 -12.750 33.659  1.00 14.86  ? 533 HOH B O   1 
HETATM 8566 O  O   . HOH L 6 .   ? -6.498  -26.923 8.652   1.00 35.14  ? 534 HOH B O   1 
HETATM 8567 O  O   . HOH L 6 .   ? 0.506   4.167   15.020  1.00 13.42  ? 535 HOH B O   1 
HETATM 8568 O  O   . HOH L 6 .   ? 3.555   -13.246 25.927  1.00 16.59  ? 536 HOH B O   1 
HETATM 8569 O  O   . HOH L 6 .   ? 23.575  22.153  21.785  1.00 31.49  ? 537 HOH B O   1 
HETATM 8570 O  O   . HOH L 6 .   ? 9.446   8.976   -2.684  1.00 19.40  ? 538 HOH B O   1 
HETATM 8571 O  O   . HOH L 6 .   ? 3.944   -11.002 11.015  1.00 20.63  ? 539 HOH B O   1 
HETATM 8572 O  O   . HOH L 6 .   ? 1.617   -14.631 6.243   1.00 18.34  ? 540 HOH B O   1 
HETATM 8573 O  O   . HOH L 6 .   ? 13.979  17.195  9.393   1.00 18.41  ? 541 HOH B O   1 
HETATM 8574 O  O   . HOH L 6 .   ? 9.766   -4.362  8.829   1.00 15.21  ? 542 HOH B O   1 
HETATM 8575 O  O   . HOH L 6 .   ? 15.297  -6.705  6.131   1.00 26.57  ? 543 HOH B O   1 
HETATM 8576 O  O   . HOH L 6 .   ? 8.708   0.390   24.682  1.00 23.92  ? 544 HOH B O   1 
HETATM 8577 O  O   . HOH L 6 .   ? 15.150  15.157  37.312  1.00 18.69  ? 545 HOH B O   1 
HETATM 8578 O  O   . HOH L 6 .   ? -1.842  4.955   13.887  1.00 13.93  ? 546 HOH B O   1 
HETATM 8579 O  O   . HOH L 6 .   ? 8.345   16.260  -4.917  1.00 16.60  ? 547 HOH B O   1 
HETATM 8580 O  O   . HOH L 6 .   ? -15.726 -16.202 14.599  1.00 23.27  ? 548 HOH B O   1 
HETATM 8581 O  O   . HOH L 6 .   ? 18.004  7.822   19.882  1.00 17.85  ? 549 HOH B O   1 
HETATM 8582 O  O   . HOH L 6 .   ? 1.656   -19.245 9.960   1.00 21.90  ? 550 HOH B O   1 
HETATM 8583 O  O   . HOH L 6 .   ? 24.028  2.950   5.373   1.00 42.71  ? 551 HOH B O   1 
HETATM 8584 O  O   . HOH L 6 .   ? 13.123  -24.248 26.018  1.00 28.57  ? 552 HOH B O   1 
HETATM 8585 O  O   . HOH L 6 .   ? 24.279  5.400   15.777  1.00 26.06  ? 553 HOH B O   1 
HETATM 8586 O  O   . HOH L 6 .   ? 14.207  22.867  4.288   1.00 21.89  ? 554 HOH B O   1 
HETATM 8587 O  O   . HOH L 6 .   ? 5.286   -26.059 21.163  1.00 22.22  ? 555 HOH B O   1 
HETATM 8588 O  O   . HOH L 6 .   ? 26.304  -13.684 22.281  1.00 25.61  ? 556 HOH B O   1 
HETATM 8589 O  O   . HOH L 6 .   ? -12.148 7.386   24.383  1.00 17.96  ? 557 HOH B O   1 
HETATM 8590 O  O   . HOH L 6 .   ? 21.285  -3.908  5.960   1.00 41.06  ? 558 HOH B O   1 
HETATM 8591 O  O   . HOH L 6 .   ? 3.167   1.855   6.864   1.00 21.05  ? 559 HOH B O   1 
HETATM 8592 O  O   . HOH L 6 .   ? 19.079  -19.858 29.182  1.00 29.71  ? 560 HOH B O   1 
HETATM 8593 O  O   . HOH L 6 .   ? 12.604  4.576   13.176  1.00 14.34  ? 561 HOH B O   1 
HETATM 8594 O  O   . HOH L 6 .   ? -11.815 -23.392 11.522  1.00 24.32  ? 562 HOH B O   1 
HETATM 8595 O  O   . HOH L 6 .   ? 10.629  12.188  11.668  1.00 17.85  ? 563 HOH B O   1 
HETATM 8596 O  O   . HOH L 6 .   ? -0.306  9.587   2.800   1.00 18.03  ? 564 HOH B O   1 
HETATM 8597 O  O   . HOH L 6 .   ? -5.872  -19.260 29.701  1.00 31.24  ? 565 HOH B O   1 
HETATM 8598 O  O   . HOH L 6 .   ? 8.949   16.612  15.237  1.00 18.14  ? 566 HOH B O   1 
HETATM 8599 O  O   . HOH L 6 .   ? 9.583   24.149  -3.123  1.00 40.72  ? 567 HOH B O   1 
HETATM 8600 O  O   . HOH L 6 .   ? -9.161  -25.699 17.739  1.00 25.40  ? 568 HOH B O   1 
HETATM 8601 O  O   . HOH L 6 .   ? 9.932   14.889  10.655  1.00 17.56  ? 569 HOH B O   1 
HETATM 8602 O  O   . HOH L 6 .   ? 30.379  -9.644  18.932  1.00 27.43  ? 570 HOH B O   1 
HETATM 8603 O  O   . HOH L 6 .   ? 19.878  1.232   40.947  1.00 31.36  ? 571 HOH B O   1 
HETATM 8604 O  O   . HOH L 6 .   ? -16.911 -1.394  23.879  1.00 19.20  ? 572 HOH B O   1 
HETATM 8605 O  O   . HOH L 6 .   ? 29.250  -12.256 19.219  1.00 29.79  ? 573 HOH B O   1 
HETATM 8606 O  O   . HOH L 6 .   ? 7.473   5.985   37.474  1.00 24.29  ? 574 HOH B O   1 
HETATM 8607 O  O   . HOH L 6 .   ? -5.861  4.946   28.116  1.00 24.69  ? 575 HOH B O   1 
HETATM 8608 O  O   . HOH L 6 .   ? -4.450  10.890  13.456  1.00 21.08  ? 576 HOH B O   1 
HETATM 8609 O  O   . HOH L 6 .   ? -0.400  -1.591  38.999  1.00 36.93  ? 577 HOH B O   1 
HETATM 8610 O  O   . HOH L 6 .   ? 16.792  17.714  15.953  1.00 31.36  ? 578 HOH B O   1 
HETATM 8611 O  O   . HOH L 6 .   ? 28.305  -1.341  34.157  1.00 38.96  ? 579 HOH B O   1 
HETATM 8612 O  O   . HOH L 6 .   ? 0.028   -2.730  43.586  1.00 41.64  ? 580 HOH B O   1 
HETATM 8613 O  O   . HOH L 6 .   ? -4.867  -22.952 9.929   1.00 24.81  ? 581 HOH B O   1 
HETATM 8614 O  O   . HOH L 6 .   ? 29.782  -6.593  22.926  1.00 38.49  ? 582 HOH B O   1 
HETATM 8615 O  O   . HOH L 6 .   ? 1.918   -12.392 36.102  1.00 19.48  ? 583 HOH B O   1 
HETATM 8616 O  O   . HOH L 6 .   ? 16.614  9.086   -10.633 1.00 35.19  ? 584 HOH B O   1 
HETATM 8617 O  O   . HOH L 6 .   ? -17.028 0.249   26.034  1.00 27.83  ? 585 HOH B O   1 
HETATM 8618 O  O   . HOH L 6 .   ? 9.001   -17.171 37.831  1.00 32.84  ? 586 HOH B O   1 
HETATM 8619 O  O   . HOH L 6 .   ? -11.647 1.219   31.651  1.00 23.87  ? 587 HOH B O   1 
HETATM 8620 O  O   . HOH L 6 .   ? -3.127  -6.470  34.268  1.00 21.60  ? 588 HOH B O   1 
HETATM 8621 O  O   . HOH L 6 .   ? 6.800   20.489  -5.713  1.00 28.67  ? 589 HOH B O   1 
HETATM 8622 O  O   . HOH L 6 .   ? 9.207   12.228  35.160  1.00 21.16  ? 590 HOH B O   1 
HETATM 8623 O  O   . HOH L 6 .   ? 22.022  -31.238 31.503  1.00 40.19  ? 591 HOH B O   1 
HETATM 8624 O  O   . HOH L 6 .   ? 14.331  -25.717 27.986  1.00 36.26  ? 592 HOH B O   1 
HETATM 8625 O  O   . HOH L 6 .   ? -3.392  4.062   29.594  1.00 31.26  ? 593 HOH B O   1 
HETATM 8626 O  O   . HOH L 6 .   ? 28.822  -13.422 21.622  1.00 28.85  ? 594 HOH B O   1 
HETATM 8627 O  O   . HOH L 6 .   ? -17.180 -3.917  17.236  1.00 20.80  ? 595 HOH B O   1 
HETATM 8628 O  O   . HOH L 6 .   ? -14.963 1.469   21.419  1.00 31.83  ? 596 HOH B O   1 
HETATM 8629 O  O   . HOH L 6 .   ? 9.239   -18.225 33.720  1.00 19.46  ? 597 HOH B O   1 
HETATM 8630 O  O   . HOH L 6 .   ? -0.031  18.917  18.535  1.00 33.34  ? 598 HOH B O   1 
HETATM 8631 O  O   . HOH L 6 .   ? -9.334  3.863   2.044   1.00 26.28  ? 599 HOH B O   1 
HETATM 8632 O  O   . HOH L 6 .   ? -17.171 -6.920  8.848   1.00 29.61  ? 600 HOH B O   1 
HETATM 8633 O  O   . HOH L 6 .   ? 2.310   -14.107 23.901  1.00 16.43  ? 603 HOH B O   1 
HETATM 8634 O  O   . HOH L 6 .   ? -8.094  2.538   11.333  1.00 19.93  ? 604 HOH B O   1 
HETATM 8635 O  O   . HOH L 6 .   ? -17.406 -4.934  11.247  1.00 25.96  ? 605 HOH B O   1 
HETATM 8636 O  O   . HOH L 6 .   ? -9.652  -9.267  4.391   1.00 33.74  ? 606 HOH B O   1 
HETATM 8637 O  O   . HOH L 6 .   ? 5.657   -9.150  11.197  1.00 28.38  ? 607 HOH B O   1 
HETATM 8638 O  O   . HOH L 6 .   ? 13.895  13.867  12.974  1.00 26.35  ? 608 HOH B O   1 
HETATM 8639 O  O   . HOH L 6 .   ? -11.471 -2.420  8.106   1.00 25.86  ? 609 HOH B O   1 
HETATM 8640 O  O   . HOH L 6 .   ? 20.776  15.933  6.651   1.00 22.59  ? 610 HOH B O   1 
HETATM 8641 O  O   . HOH L 6 .   ? 19.893  12.218  37.452  1.00 26.19  ? 611 HOH B O   1 
HETATM 8642 O  O   . HOH L 6 .   ? 7.898   21.899  21.617  1.00 21.31  ? 612 HOH B O   1 
HETATM 8643 O  O   . HOH L 6 .   ? -8.348  3.230   8.779   1.00 21.32  ? 613 HOH B O   1 
HETATM 8644 O  O   . HOH L 6 .   ? -17.451 -9.308  18.311  1.00 36.22  ? 614 HOH B O   1 
HETATM 8645 O  O   . HOH L 6 .   ? 4.582   0.497   9.077   1.00 26.08  ? 615 HOH B O   1 
HETATM 8646 O  O   . HOH L 6 .   ? 21.923  17.930  5.064   1.00 22.13  ? 616 HOH B O   1 
HETATM 8647 O  O   . HOH L 6 .   ? -17.497 -3.414  13.427  1.00 23.96  ? 617 HOH B O   1 
HETATM 8648 O  O   . HOH L 6 .   ? 9.237   19.857  20.104  1.00 22.68  ? 618 HOH B O   1 
HETATM 8649 O  O   . HOH L 6 .   ? -8.668  -8.274  37.598  1.00 41.49  ? 619 HOH B O   1 
HETATM 8650 O  O   . HOH L 6 .   ? 8.713   19.533  17.415  1.00 30.98  ? 620 HOH B O   1 
HETATM 8651 O  O   . HOH L 6 .   ? -17.662 -11.231 16.923  1.00 35.05  ? 621 HOH B O   1 
HETATM 8652 O  O   . HOH L 6 .   ? 0.353   -0.315  33.208  1.00 13.20  ? 622 HOH B O   1 
HETATM 8653 O  O   . HOH L 6 .   ? 11.930  -22.243 27.066  1.00 23.91  ? 623 HOH B O   1 
HETATM 8654 O  O   . HOH L 6 .   ? 3.359   7.409   32.954  1.00 22.23  ? 624 HOH B O   1 
HETATM 8655 O  O   . HOH L 6 .   ? -3.615  -18.889 33.449  1.00 24.54  ? 625 HOH B O   1 
HETATM 8656 O  O   . HOH L 6 .   ? -1.358  19.556  2.178   1.00 32.39  ? 626 HOH B O   1 
HETATM 8657 O  O   . HOH L 6 .   ? 24.978  8.360   21.479  1.00 27.32  ? 627 HOH B O   1 
HETATM 8658 O  O   . HOH L 6 .   ? -13.889 3.722   23.121  1.00 20.29  ? 628 HOH B O   1 
HETATM 8659 O  O   . HOH L 6 .   ? 20.892  18.799  9.039   1.00 32.54  ? 629 HOH B O   1 
HETATM 8660 O  O   . HOH L 6 .   ? 0.519   3.437   37.143  1.00 39.45  ? 630 HOH B O   1 
HETATM 8661 O  O   . HOH L 6 .   ? -11.189 -6.360  4.782   1.00 25.02  ? 631 HOH B O   1 
HETATM 8662 O  O   . HOH L 6 .   ? 16.226  12.495  38.769  1.00 39.12  ? 632 HOH B O   1 
HETATM 8663 O  O   . HOH L 6 .   ? 3.473   10.071  31.911  1.00 30.71  ? 633 HOH B O   1 
HETATM 8664 O  O   . HOH L 6 .   ? -4.934  7.479   12.569  1.00 27.08  ? 634 HOH B O   1 
HETATM 8665 O  O   . HOH L 6 .   ? 13.751  -11.374 37.915  1.00 34.01  ? 635 HOH B O   1 
HETATM 8666 O  O   . HOH L 6 .   ? 25.917  10.299  19.884  1.00 27.41  ? 636 HOH B O   1 
HETATM 8667 O  O   . HOH L 6 .   ? 7.210   23.889  8.417   1.00 22.68  ? 637 HOH B O   1 
HETATM 8668 O  O   . HOH L 6 .   ? 4.015   -22.165 28.568  1.00 31.33  ? 638 HOH B O   1 
HETATM 8669 O  O   . HOH L 6 .   ? 0.866   -18.176 36.203  1.00 37.35  ? 639 HOH B O   1 
HETATM 8670 O  O   . HOH L 6 .   ? 27.139  22.706  22.968  1.00 47.02  ? 640 HOH B O   1 
HETATM 8671 O  O   . HOH L 6 .   ? -6.988  -2.260  33.962  1.00 42.73  ? 641 HOH B O   1 
HETATM 8672 O  O   . HOH L 6 .   ? 12.759  -25.059 30.355  1.00 39.84  ? 642 HOH B O   1 
HETATM 8673 O  O   . HOH L 6 .   ? 25.415  -15.390 24.222  1.00 36.24  ? 643 HOH B O   1 
HETATM 8674 O  O   . HOH L 6 .   ? 18.616  18.729  17.451  1.00 40.67  ? 644 HOH B O   1 
HETATM 8675 O  O   . HOH L 6 .   ? 21.874  1.422   28.565  1.00 28.03  ? 645 HOH B O   1 
HETATM 8676 O  O   . HOH L 6 .   ? 14.182  7.512   -7.602  1.00 28.68  ? 646 HOH B O   1 
HETATM 8677 O  O   . HOH L 6 .   ? -3.240  -14.327 36.257  1.00 42.17  ? 647 HOH B O   1 
HETATM 8678 O  O   . HOH L 6 .   ? -10.250 -18.310 7.883   1.00 21.10  ? 648 HOH B O   1 
HETATM 8679 O  O   . HOH L 6 .   ? 4.628   2.397   29.683  1.00 31.19  ? 649 HOH B O   1 
HETATM 8680 O  O   . HOH L 6 .   ? -17.587 -4.518  32.266  1.00 31.13  ? 650 HOH B O   1 
HETATM 8681 O  O   . HOH L 6 .   ? -12.810 -18.038 7.093   1.00 33.65  ? 651 HOH B O   1 
HETATM 8682 O  O   . HOH L 6 .   ? 23.803  1.618   34.715  1.00 35.59  ? 652 HOH B O   1 
HETATM 8683 O  O   . HOH L 6 .   ? 32.003  -11.342 36.575  1.00 26.15  ? 653 HOH B O   1 
HETATM 8684 O  O   . HOH L 6 .   ? -15.675 -15.987 31.082  1.00 31.21  ? 654 HOH B O   1 
HETATM 8685 O  O   . HOH L 6 .   ? -0.197  -23.809 23.858  1.00 24.54  ? 655 HOH B O   1 
HETATM 8686 O  O   . HOH L 6 .   ? -21.571 -5.306  35.156  1.00 29.41  ? 656 HOH B O   1 
HETATM 8687 O  O   . HOH L 6 .   ? -3.023  9.458   2.927   1.00 27.25  ? 657 HOH B O   1 
HETATM 8688 O  O   . HOH L 6 .   ? 3.845   -3.770  7.858   1.00 30.03  ? 658 HOH B O   1 
HETATM 8689 O  O   . HOH L 6 .   ? 11.725  20.062  19.414  1.00 21.40  ? 659 HOH B O   1 
HETATM 8690 O  O   . HOH L 6 .   ? -12.890 5.193   21.228  1.00 24.36  ? 660 HOH B O   1 
HETATM 8691 O  O   . HOH L 6 .   ? 20.582  3.184   27.017  1.00 28.76  ? 661 HOH B O   1 
HETATM 8692 O  O   . HOH L 6 .   ? 26.901  -5.462  8.609   1.00 47.31  ? 662 HOH B O   1 
HETATM 8693 O  O   . HOH L 6 .   ? 18.213  27.587  9.487   1.00 26.46  ? 663 HOH B O   1 
HETATM 8694 O  O   . HOH L 6 .   ? -8.470  -23.681 19.264  1.00 36.46  ? 664 HOH B O   1 
HETATM 8695 O  O   . HOH L 6 .   ? -7.799  -11.458 38.182  1.00 42.95  ? 665 HOH B O   1 
HETATM 8696 O  O   . HOH L 6 .   ? -14.848 -17.547 12.584  1.00 26.22  ? 666 HOH B O   1 
HETATM 8697 O  O   . HOH L 6 .   ? -10.174 3.790   12.395  1.00 32.71  ? 667 HOH B O   1 
HETATM 8698 O  O   . HOH L 6 .   ? 13.846  9.391   38.882  1.00 28.69  ? 668 HOH B O   1 
HETATM 8699 O  O   . HOH L 6 .   ? -3.999  16.135  4.413   1.00 38.05  ? 669 HOH B O   1 
HETATM 8700 O  O   . HOH L 6 .   ? 18.602  -16.764 24.150  1.00 23.83  ? 670 HOH B O   1 
HETATM 8701 O  O   . HOH L 6 .   ? -15.349 -6.905  36.064  1.00 27.90  ? 671 HOH B O   1 
HETATM 8702 O  O   . HOH L 6 .   ? 24.901  -18.439 32.802  1.00 32.43  ? 672 HOH B O   1 
HETATM 8703 O  O   . HOH L 6 .   ? 4.980   -18.888 33.840  1.00 21.42  ? 673 HOH B O   1 
HETATM 8704 O  O   . HOH L 6 .   ? 12.177  26.505  30.348  1.00 37.93  ? 674 HOH B O   1 
HETATM 8705 O  O   . HOH L 6 .   ? 0.320   -19.616 32.508  1.00 30.84  ? 675 HOH B O   1 
HETATM 8706 O  O   . HOH L 6 .   ? -3.276  -9.347  -5.416  1.00 38.32  ? 676 HOH B O   1 
HETATM 8707 O  O   . HOH L 6 .   ? 4.499   14.366  24.622  1.00 41.88  ? 677 HOH B O   1 
HETATM 8708 O  O   . HOH L 6 .   ? 23.308  18.190  -4.995  1.00 38.15  ? 678 HOH B O   1 
HETATM 8709 O  O   . HOH L 6 .   ? 9.409   -7.074  38.482  1.00 34.37  ? 679 HOH B O   1 
HETATM 8710 O  O   . HOH L 6 .   ? -2.444  -3.251  -1.527  1.00 26.19  ? 680 HOH B O   1 
HETATM 8711 O  O   . HOH L 6 .   ? -3.015  -4.185  38.395  1.00 44.09  ? 681 HOH B O   1 
HETATM 8712 O  O   . HOH L 6 .   ? 25.263  8.088   14.990  1.00 36.21  ? 682 HOH B O   1 
HETATM 8713 O  O   . HOH L 6 .   ? 2.078   -9.934  41.692  1.00 30.44  ? 683 HOH B O   1 
HETATM 8714 O  O   . HOH L 6 .   ? 3.076   -30.024 22.134  1.00 37.96  ? 684 HOH B O   1 
HETATM 8715 O  O   . HOH L 6 .   ? -4.810  -20.255 6.495   1.00 41.30  ? 685 HOH B O   1 
HETATM 8716 O  O   . HOH L 6 .   ? -3.544  -22.097 31.191  1.00 54.57  ? 686 HOH B O   1 
HETATM 8717 O  O   . HOH L 6 .   ? 21.999  -19.108 17.799  1.00 39.55  ? 687 HOH B O   1 
HETATM 8718 O  O   . HOH L 6 .   ? 1.674   20.464  7.410   1.00 39.60  ? 688 HOH B O   1 
HETATM 8719 O  O   . HOH L 6 .   ? 2.567   -14.656 37.728  1.00 32.17  ? 689 HOH B O   1 
HETATM 8720 O  O   . HOH L 6 .   ? 20.490  -20.903 20.468  1.00 38.52  ? 690 HOH B O   1 
HETATM 8721 O  O   . HOH L 6 .   ? 16.152  -10.070 38.751  1.00 31.06  ? 691 HOH B O   1 
HETATM 8722 O  O   . HOH L 6 .   ? -14.371 -18.702 26.181  1.00 34.24  ? 692 HOH B O   1 
HETATM 8723 O  O   . HOH L 6 .   ? 4.138   -13.028 13.313  1.00 29.39  ? 693 HOH B O   1 
HETATM 8724 O  O   . HOH L 6 .   ? -4.292  12.940  22.130  1.00 34.56  ? 694 HOH B O   1 
HETATM 8725 O  O   . HOH L 6 .   ? 23.348  4.834   7.466   1.00 24.66  ? 695 HOH B O   1 
HETATM 8726 O  O   . HOH L 6 .   ? 30.348  -2.643  21.698  1.00 35.38  ? 696 HOH B O   1 
HETATM 8727 O  O   . HOH L 6 .   ? 21.555  15.234  11.384  1.00 30.13  ? 697 HOH B O   1 
HETATM 8728 O  O   . HOH L 6 .   ? 15.881  -17.798 35.149  1.00 30.79  ? 698 HOH B O   1 
HETATM 8729 O  O   . HOH L 6 .   ? -15.602 -12.123 15.472  1.00 31.50  ? 699 HOH B O   1 
HETATM 8730 O  O   . HOH L 6 .   ? 29.625  5.001   32.466  1.00 42.63  ? 700 HOH B O   1 
HETATM 8731 O  O   . HOH L 6 .   ? 13.988  -16.284 14.935  1.00 38.40  ? 701 HOH B O   1 
HETATM 8732 O  O   . HOH L 6 .   ? -2.995  1.062   -5.338  1.00 36.18  ? 702 HOH B O   1 
HETATM 8733 O  O   . HOH L 6 .   ? 23.651  25.273  19.835  1.00 43.64  ? 703 HOH B O   1 
HETATM 8734 O  O   . HOH L 6 .   ? -7.092  4.820   12.774  1.00 30.92  ? 704 HOH B O   1 
HETATM 8735 O  O   . HOH L 6 .   ? 29.451  3.796   19.392  1.00 29.79  ? 705 HOH B O   1 
HETATM 8736 O  O   . HOH L 6 .   ? 3.054   -17.161 37.414  1.00 35.84  ? 706 HOH B O   1 
HETATM 8737 O  O   . HOH L 6 .   ? 24.965  19.229  -3.210  1.00 35.35  ? 707 HOH B O   1 
HETATM 8738 O  O   . HOH L 6 .   ? 14.866  33.545  6.874   1.00 26.87  ? 708 HOH B O   1 
HETATM 8739 O  O   . HOH L 6 .   ? 2.132   -12.435 4.745   1.00 30.53  ? 709 HOH B O   1 
HETATM 8740 O  O   . HOH L 6 .   ? 34.146  -3.840  30.227  1.00 41.70  ? 710 HOH B O   1 
HETATM 8741 O  O   . HOH L 6 .   ? -9.916  -27.569 11.286  1.00 47.31  ? 711 HOH B O   1 
HETATM 8742 O  O   . HOH L 6 .   ? -2.880  -6.767  37.096  1.00 41.97  ? 712 HOH B O   1 
HETATM 8743 O  O   . HOH L 6 .   ? 15.479  -10.839 43.102  1.00 36.78  ? 713 HOH B O   1 
HETATM 8744 O  O   . HOH L 6 .   ? -2.254  17.520  19.029  1.00 37.17  ? 714 HOH B O   1 
HETATM 8745 O  O   . HOH L 6 .   ? -7.908  -4.315  0.223   1.00 39.91  ? 715 HOH B O   1 
HETATM 8746 O  O   . HOH L 6 .   ? 26.884  8.927   17.204  1.00 30.36  ? 716 HOH B O   1 
HETATM 8747 O  O   . HOH L 6 .   ? -11.698 -25.782 12.967  1.00 33.14  ? 717 HOH B O   1 
HETATM 8748 O  O   . HOH L 6 .   ? -4.319  -5.243  -2.583  1.00 29.09  ? 718 HOH B O   1 
HETATM 8749 O  O   . HOH L 6 .   ? 22.254  15.905  8.904   1.00 31.14  ? 719 HOH B O   1 
HETATM 8750 O  O   . HOH L 6 .   ? 2.137   3.353   30.606  1.00 38.27  ? 720 HOH B O   1 
HETATM 8751 O  O   . HOH L 6 .   ? 21.429  5.567   15.033  1.00 24.56  ? 721 HOH B O   1 
HETATM 8752 O  O   . HOH L 6 .   ? 19.817  4.758   16.935  1.00 13.59  ? 722 HOH B O   1 
HETATM 8753 O  O   . HOH L 6 .   ? 17.727  6.419   17.421  1.00 16.80  ? 723 HOH B O   1 
HETATM 8754 O  O   . HOH L 6 .   ? 20.586  13.472  16.576  1.00 15.28  ? 724 HOH B O   1 
HETATM 8755 O  O   . HOH L 6 .   ? 21.544  11.791  14.664  1.00 19.56  ? 725 HOH B O   1 
HETATM 8756 O  O   . HOH L 6 .   ? 22.135  13.491  18.902  1.00 26.87  ? 726 HOH B O   1 
HETATM 8757 O  O   . HOH L 6 .   ? 24.598  12.481  18.585  1.00 26.59  ? 727 HOH B O   1 
HETATM 8758 O  O   . HOH L 6 .   ? 22.285  16.187  19.786  1.00 26.24  ? 728 HOH B O   1 
HETATM 8759 O  O   . HOH L 6 .   ? 21.064  17.846  18.151  1.00 27.74  ? 729 HOH B O   1 
HETATM 8760 O  O   . HOH L 6 .   ? 20.536  16.206  15.847  1.00 29.75  ? 730 HOH B O   1 
HETATM 8761 O  O   . HOH L 6 .   ? 17.956  21.282  16.125  1.00 39.60  ? 731 HOH B O   1 
HETATM 8762 O  O   . HOH L 6 .   ? 22.088  20.680  16.863  1.00 45.17  ? 732 HOH B O   1 
HETATM 8763 O  O   . HOH L 6 .   ? 21.884  26.313  27.618  1.00 20.87  ? 733 HOH B O   1 
HETATM 8764 O  O   . HOH L 6 .   ? -14.639 -16.357 8.117   1.00 40.54  ? 734 HOH B O   1 
HETATM 8765 O  O   . HOH L 6 .   ? 1.809   -30.882 16.259  1.00 45.26  ? 735 HOH B O   1 
HETATM 8766 O  O   . HOH L 6 .   ? -24.027 -13.054 37.380  1.00 36.94  ? 736 HOH B O   1 
HETATM 8767 O  O   . HOH L 6 .   ? 25.687  15.844  3.792   1.00 32.46  ? 737 HOH B O   1 
HETATM 8768 O  O   . HOH L 6 .   ? 20.964  -21.767 28.471  1.00 39.41  ? 738 HOH B O   1 
HETATM 8769 O  O   . HOH L 6 .   ? 11.285  -19.214 16.601  1.00 35.34  ? 739 HOH B O   1 
HETATM 8770 O  O   . HOH L 6 .   ? -11.980 -21.864 21.374  1.00 38.64  ? 740 HOH B O   1 
HETATM 8771 O  O   . HOH L 6 .   ? 13.986  -27.555 17.907  1.00 44.18  ? 741 HOH B O   1 
HETATM 8772 O  O   . HOH L 6 .   ? 30.004  9.057   4.092   1.00 37.25  ? 742 HOH B O   1 
HETATM 8773 O  O   . HOH L 6 .   ? 27.183  -14.345 37.691  1.00 41.09  ? 743 HOH B O   1 
HETATM 8774 O  O   . HOH L 6 .   ? 22.183  15.472  22.409  1.00 31.24  ? 744 HOH B O   1 
HETATM 8775 O  O   . HOH L 6 .   ? -12.278 1.734   6.248   1.00 28.38  ? 745 HOH B O   1 
HETATM 8776 O  O   . HOH L 6 .   ? 5.077   19.124  22.802  1.00 38.17  ? 746 HOH B O   1 
HETATM 8777 O  O   . HOH L 6 .   ? 30.970  -16.754 23.708  1.00 41.95  ? 747 HOH B O   1 
HETATM 8778 O  O   . HOH L 6 .   ? 0.254   2.341   32.084  1.00 35.98  ? 748 HOH B O   1 
HETATM 8779 O  O   . HOH L 6 .   ? -4.645  -25.522 9.465   1.00 33.25  ? 749 HOH B O   1 
HETATM 8780 O  O   . HOH L 6 .   ? 32.681  -7.940  32.085  1.00 41.04  ? 750 HOH B O   1 
HETATM 8781 O  O   . HOH L 6 .   ? -19.621 -9.848  41.087  1.00 34.91  ? 751 HOH B O   1 
HETATM 8782 O  O   . HOH L 6 .   ? 22.184  19.596  29.543  1.00 45.82  ? 752 HOH B O   1 
HETATM 8783 O  O   . HOH L 6 .   ? -6.186  -8.723  -1.067  1.00 38.82  ? 753 HOH B O   1 
HETATM 8784 O  O   . HOH L 6 .   ? 28.308  -14.095 35.335  1.00 39.62  ? 754 HOH B O   1 
HETATM 8785 O  O   . HOH L 6 .   ? 11.237  -0.809  19.821  1.00 28.66  ? 755 HOH B O   1 
HETATM 8786 O  O   . HOH L 6 .   ? -15.183 7.632   17.667  1.00 40.82  ? 756 HOH B O   1 
HETATM 8787 O  O   . HOH M 6 .   ? -48.093 8.950   48.224  1.00 34.54  ? 353 HOH C O   1 
HETATM 8788 O  O   . HOH M 6 .   ? -41.284 17.608  68.431  1.00 37.83  ? 481 HOH C O   1 
HETATM 8789 O  O   . HOH M 6 .   ? -37.336 15.051  51.258  1.00 36.51  ? 491 HOH C O   1 
HETATM 8790 O  O   . HOH M 6 .   ? -45.176 18.710  54.638  1.00 41.82  ? 514 HOH C O   1 
HETATM 8791 O  O   . HOH M 6 .   ? -52.814 6.064   51.474  1.00 49.59  ? 529 HOH C O   1 
HETATM 8792 O  O   . HOH N 6 .   ? 24.787  -13.029 15.069  1.00 36.07  ? 216 HOH D O   1 
HETATM 8793 O  O   . HOH N 6 .   ? 8.986   -14.309 14.199  1.00 28.00  ? 283 HOH D O   1 
HETATM 8794 O  O   . HOH N 6 .   ? 7.531   -8.673  -2.694  1.00 59.27  ? 358 HOH D O   1 
HETATM 8795 O  O   . HOH N 6 .   ? 5.923   -8.877  3.103   1.00 33.38  ? 494 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   ?   ?   ?   A . n 
A 1 2   THR 2   3   ?   ?   ?   A . n 
A 1 3   ARG 3   4   ?   ?   ?   A . n 
A 1 4   SER 4   5   5   SER SER A . n 
A 1 5   PRO 5   6   6   PRO PRO A . n 
A 1 6   ARG 6   7   7   ARG ARG A . n 
A 1 7   PRO 7   8   8   PRO PRO A . n 
A 1 8   PHE 8   9   9   PHE PHE A . n 
A 1 9   ASN 9   10  10  ASN ASN A . n 
A 1 10  GLU 10  11  11  GLU GLU A . n 
A 1 11  ILE 11  12  12  ILE ILE A . n 
A 1 12  PRO 12  13  13  PRO PRO A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  GLY 15  16  16  GLY GLY A . n 
A 1 16  ASP 16  17  17  ASP ASP A . n 
A 1 17  ASN 17  18  18  ASN ASN A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  TRP 19  20  20  TRP TRP A . n 
A 1 20  LEU 20  21  21  LEU LEU A . n 
A 1 21  ASN 21  22  22  ASN ASN A . n 
A 1 22  LEU 22  23  23  LEU LEU A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  HIS 24  25  25  HIS HIS A . n 
A 1 25  PHE 25  26  26  PHE PHE A . n 
A 1 26  TRP 26  27  27  TRP TRP A . n 
A 1 27  ARG 27  28  28  ARG ARG A . n 
A 1 28  GLU 28  29  29  GLU GLU A . n 
A 1 29  THR 29  30  30  THR THR A . n 
A 1 30  GLY 30  31  31  GLY GLY A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  HIS 32  33  33  HIS HIS A . n 
A 1 33  LYS 33  34  34  LYS LYS A . n 
A 1 34  VAL 34  35  35  VAL VAL A . n 
A 1 35  HIS 35  36  36  HIS HIS A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  HIS 37  38  38  HIS HIS A . n 
A 1 38  HIS 38  39  39  HIS HIS A . n 
A 1 39  VAL 39  40  40  VAL VAL A . n 
A 1 40  GLN 40  41  41  GLN GLN A . n 
A 1 41  ASN 41  42  42  ASN ASN A . n 
A 1 42  PHE 42  43  43  PHE PHE A . n 
A 1 43  GLN 43  44  44  GLN GLN A . n 
A 1 44  LYS 44  45  45  LYS LYS A . n 
A 1 45  TYR 45  46  46  TYR TYR A . n 
A 1 46  GLY 46  47  47  GLY GLY A . n 
A 1 47  PRO 47  48  48  PRO PRO A . n 
A 1 48  ILE 48  49  49  ILE ILE A . n 
A 1 49  TYR 49  50  50  TYR TYR A . n 
A 1 50  ARG 50  51  51  ARG ARG A . n 
A 1 51  GLU 51  52  52  GLU GLU A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  LEU 53  54  54  LEU LEU A . n 
A 1 54  GLY 54  55  55  GLY GLY A . n 
A 1 55  ASN 55  56  56  ASN ASN A . n 
A 1 56  VAL 56  57  57  VAL VAL A . n 
A 1 57  GLU 57  58  58  GLU GLU A . n 
A 1 58  SER 58  59  59  SER SER A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  TYR 60  61  61  TYR TYR A . n 
A 1 61  VAL 61  62  62  VAL VAL A . n 
A 1 62  ILE 62  63  63  ILE ILE A . n 
A 1 63  ASP 63  64  64  ASP ASP A . n 
A 1 64  PRO 64  65  65  PRO PRO A . n 
A 1 65  GLU 65  66  66  GLU GLU A . n 
A 1 66  ASP 66  67  67  ASP ASP A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  ALA 68  69  69  ALA ALA A . n 
A 1 69  LEU 69  70  70  LEU LEU A . n 
A 1 70  LEU 70  71  71  LEU LEU A . n 
A 1 71  PHE 71  72  72  PHE PHE A . n 
A 1 72  LYS 72  73  73  LYS LYS A . n 
A 1 73  SER 73  74  74  SER SER A . n 
A 1 74  GLU 74  75  75  GLU GLU A . n 
A 1 75  GLY 75  76  76  GLY GLY A . n 
A 1 76  PRO 76  77  77  PRO PRO A . n 
A 1 77  ASN 77  78  78  ASN ASN A . n 
A 1 78  PRO 78  79  79  PRO PRO A . n 
A 1 79  GLU 79  80  80  GLU GLU A . n 
A 1 80  ARG 80  81  81  ARG ARG A . n 
A 1 81  PHE 81  82  82  PHE PHE A . n 
A 1 82  LEU 82  83  83  LEU LEU A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  PRO 84  85  85  PRO PRO A . n 
A 1 85  PRO 85  86  86  PRO PRO A . n 
A 1 86  TRP 86  87  87  TRP TRP A . n 
A 1 87  VAL 87  88  88  VAL VAL A . n 
A 1 88  ALA 88  89  89  ALA ALA A . n 
A 1 89  TYR 89  90  90  TYR TYR A . n 
A 1 90  HIS 90  91  91  HIS HIS A . n 
A 1 91  GLN 91  92  92  GLN GLN A . n 
A 1 92  TYR 92  93  93  TYR TYR A . n 
A 1 93  TYR 93  94  94  TYR TYR A . n 
A 1 94  GLN 94  95  95  GLN GLN A . n 
A 1 95  ARG 95  96  96  ARG ARG A . n 
A 1 96  PRO 96  97  97  PRO PRO A . n 
A 1 97  ILE 97  98  98  ILE ILE A . n 
A 1 98  GLY 98  99  99  GLY GLY A . n 
A 1 99  VAL 99  100 100 VAL VAL A . n 
A 1 100 LEU 100 101 101 LEU LEU A . n 
A 1 101 LEU 101 102 102 LEU LEU A . n 
A 1 102 LYS 102 103 103 LYS LYS A . n 
A 1 103 LYS 103 104 104 LYS LYS A . n 
A 1 104 SER 104 105 105 SER SER A . n 
A 1 105 ALA 105 106 106 ALA ALA A . n 
A 1 106 ALA 106 107 107 ALA ALA A . n 
A 1 107 TRP 107 108 108 TRP TRP A . n 
A 1 108 LYS 108 109 109 LYS LYS A . n 
A 1 109 LYS 109 110 110 LYS LYS A . n 
A 1 110 ASP 110 111 111 ASP ASP A . n 
A 1 111 ARG 111 112 112 ARG ARG A . n 
A 1 112 VAL 112 113 113 VAL VAL A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 ASN 115 116 116 ASN ASN A . n 
A 1 116 GLN 116 117 117 GLN GLN A . n 
A 1 117 GLU 117 118 118 GLU GLU A . n 
A 1 118 VAL 118 119 119 VAL VAL A . n 
A 1 119 MET 119 120 120 MET MET A . n 
A 1 120 ALA 120 121 121 ALA ALA A . n 
A 1 121 PRO 121 122 122 PRO PRO A . n 
A 1 122 GLU 122 123 123 GLU GLU A . n 
A 1 123 ALA 123 124 124 ALA ALA A . n 
A 1 124 THR 124 125 125 THR THR A . n 
A 1 125 LYS 125 126 126 LYS LYS A . n 
A 1 126 ASN 126 127 127 ASN ASN A . n 
A 1 127 PHE 127 128 128 PHE PHE A . n 
A 1 128 LEU 128 129 129 LEU LEU A . n 
A 1 129 PRO 129 130 130 PRO PRO A . n 
A 1 130 LEU 130 131 131 LEU LEU A . n 
A 1 131 LEU 131 132 132 LEU LEU A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 ALA 133 134 134 ALA ALA A . n 
A 1 134 VAL 134 135 135 VAL VAL A . n 
A 1 135 SER 135 136 136 SER SER A . n 
A 1 136 ARG 136 137 137 ARG ARG A . n 
A 1 137 ASP 137 138 138 ASP ASP A . n 
A 1 138 PHE 138 139 139 PHE PHE A . n 
A 1 139 VAL 139 140 140 VAL VAL A . n 
A 1 140 SER 140 141 141 SER SER A . n 
A 1 141 VAL 141 142 142 VAL VAL A . n 
A 1 142 LEU 142 143 143 LEU LEU A . n 
A 1 143 HIS 143 144 144 HIS HIS A . n 
A 1 144 ARG 144 145 145 ARG ARG A . n 
A 1 145 ARG 145 146 146 ARG ARG A . n 
A 1 146 ILE 146 147 147 ILE ILE A . n 
A 1 147 LYS 147 148 148 LYS LYS A . n 
A 1 148 LYS 148 149 149 LYS LYS A . n 
A 1 149 ALA 149 150 150 ALA ALA A . n 
A 1 150 GLY 150 151 151 GLY GLY A . n 
A 1 151 SER 151 152 152 SER SER A . n 
A 1 152 GLY 152 153 153 GLY GLY A . n 
A 1 153 ASN 153 154 154 ASN ASN A . n 
A 1 154 TYR 154 155 155 TYR TYR A . n 
A 1 155 SER 155 156 156 SER SER A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 ASP 157 158 158 ASP ASP A . n 
A 1 158 ILE 158 159 159 ILE ILE A . n 
A 1 159 SER 159 160 160 SER SER A . n 
A 1 160 ASP 160 161 161 ASP ASP A . n 
A 1 161 ASP 161 162 162 ASP ASP A . n 
A 1 162 LEU 162 163 163 LEU LEU A . n 
A 1 163 PHE 163 164 164 PHE PHE A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 PHE 165 166 166 PHE PHE A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PHE 167 168 168 PHE PHE A . n 
A 1 168 GLU 168 169 169 GLU GLU A . n 
A 1 169 SER 169 170 170 SER SER A . n 
A 1 170 ILE 170 171 171 ILE ILE A . n 
A 1 171 THR 171 172 172 THR THR A . n 
A 1 172 ASN 172 173 173 ASN ASN A . n 
A 1 173 VAL 173 174 174 VAL VAL A . n 
A 1 174 ILE 174 175 175 ILE ILE A . n 
A 1 175 PHE 175 176 176 PHE PHE A . n 
A 1 176 GLY 176 177 177 GLY GLY A . n 
A 1 177 GLU 177 178 178 GLU GLU A . n 
A 1 178 ARG 178 179 179 ARG ARG A . n 
A 1 179 GLN 179 180 180 GLN GLN A . n 
A 1 180 GLY 180 181 181 GLY GLY A . n 
A 1 181 MET 181 182 182 MET MET A . n 
A 1 182 LEU 182 183 183 LEU LEU A . n 
A 1 183 GLU 183 184 184 GLU GLU A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 VAL 185 186 186 VAL VAL A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ASN 187 188 188 ASN ASN A . n 
A 1 188 PRO 188 189 189 PRO PRO A . n 
A 1 189 GLU 189 190 190 GLU GLU A . n 
A 1 190 ALA 190 191 191 ALA ALA A . n 
A 1 191 GLN 191 192 192 GLN GLN A . n 
A 1 192 ARG 192 193 193 ARG ARG A . n 
A 1 193 PHE 193 194 194 PHE PHE A . n 
A 1 194 ILE 194 195 195 ILE ILE A . n 
A 1 195 ASP 195 196 196 ASP ASP A . n 
A 1 196 ALA 196 197 197 ALA ALA A . n 
A 1 197 ILE 197 198 198 ILE ILE A . n 
A 1 198 TYR 198 199 199 TYR TYR A . n 
A 1 199 GLN 199 200 200 GLN GLN A . n 
A 1 200 MET 200 201 201 MET MET A . n 
A 1 201 PHE 201 202 202 PHE PHE A . n 
A 1 202 HIS 202 203 203 HIS HIS A . n 
A 1 203 THR 203 204 204 THR THR A . n 
A 1 204 SER 204 205 205 SER SER A . n 
A 1 205 VAL 205 206 206 VAL VAL A . n 
A 1 206 PRO 206 207 207 PRO PRO A . n 
A 1 207 MET 207 208 208 MET MET A . n 
A 1 208 LEU 208 209 209 LEU LEU A . n 
A 1 209 ASN 209 210 210 ASN ASN A . n 
A 1 210 LEU 210 211 211 LEU LEU A . n 
A 1 211 PRO 211 212 212 PRO PRO A . n 
A 1 212 PRO 212 213 213 PRO PRO A . n 
A 1 213 ASP 213 214 214 ASP ASP A . n 
A 1 214 LEU 214 215 215 LEU LEU A . n 
A 1 215 PHE 215 216 216 PHE PHE A . n 
A 1 216 ARG 216 217 217 ARG ARG A . n 
A 1 217 LEU 217 218 218 LEU LEU A . n 
A 1 218 PHE 218 219 219 PHE PHE A . n 
A 1 219 ARG 219 220 220 ARG ARG A . n 
A 1 220 THR 220 221 221 THR THR A . n 
A 1 221 LYS 221 222 222 LYS LYS A . n 
A 1 222 THR 222 223 223 THR THR A . n 
A 1 223 TRP 223 224 224 TRP TRP A . n 
A 1 224 LYS 224 225 225 LYS LYS A . n 
A 1 225 ASP 225 226 226 ASP ASP A . n 
A 1 226 HIS 226 227 227 HIS HIS A . n 
A 1 227 VAL 227 228 228 VAL VAL A . n 
A 1 228 ALA 228 229 229 ALA ALA A . n 
A 1 229 ALA 229 230 230 ALA ALA A . n 
A 1 230 TRP 230 231 231 TRP TRP A . n 
A 1 231 ASP 231 232 232 ASP ASP A . n 
A 1 232 VAL 232 233 233 VAL VAL A . n 
A 1 233 ILE 233 234 234 ILE ILE A . n 
A 1 234 PHE 234 235 235 PHE PHE A . n 
A 1 235 SER 235 236 236 SER SER A . n 
A 1 236 LYS 236 237 237 LYS LYS A . n 
A 1 237 ALA 237 238 238 ALA ALA A . n 
A 1 238 ASP 238 239 239 ASP ASP A . n 
A 1 239 ILE 239 240 240 ILE ILE A . n 
A 1 240 TYR 240 241 241 TYR TYR A . n 
A 1 241 THR 241 242 242 THR THR A . n 
A 1 242 GLN 242 243 243 GLN GLN A . n 
A 1 243 ASN 243 244 244 ASN ASN A . n 
A 1 244 PHE 244 245 245 PHE PHE A . n 
A 1 245 TYR 245 246 246 TYR TYR A . n 
A 1 246 TRP 246 247 247 TRP TRP A . n 
A 1 247 GLU 247 248 248 GLU GLU A . n 
A 1 248 LEU 248 249 249 LEU LEU A . n 
A 1 249 ARG 249 250 250 ARG ARG A . n 
A 1 250 GLN 250 251 251 GLN GLN A . n 
A 1 251 LYS 251 252 252 LYS LYS A . n 
A 1 252 GLY 252 253 253 GLY GLY A . n 
A 1 253 SER 253 254 254 SER SER A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 HIS 255 256 256 HIS HIS A . n 
A 1 256 HIS 256 257 257 HIS HIS A . n 
A 1 257 ASP 257 258 258 ASP ASP A . n 
A 1 258 TYR 258 259 259 TYR TYR A . n 
A 1 259 ARG 259 260 260 ARG ARG A . n 
A 1 260 GLY 260 261 261 GLY GLY A . n 
A 1 261 ILE 261 262 262 ILE ILE A . n 
A 1 262 LEU 262 263 263 LEU LEU A . n 
A 1 263 TYR 263 264 264 TYR TYR A . n 
A 1 264 ARG 264 265 265 ARG ARG A . n 
A 1 265 LEU 265 266 266 LEU LEU A . n 
A 1 266 LEU 266 267 267 LEU LEU A . n 
A 1 267 GLY 267 268 268 GLY GLY A . n 
A 1 268 ASP 268 269 269 ASP ASP A . n 
A 1 269 SER 269 270 270 SER SER A . n 
A 1 270 LYS 270 271 271 LYS LYS A . n 
A 1 271 MET 271 272 272 MET MET A . n 
A 1 272 SER 272 273 273 SER SER A . n 
A 1 273 PHE 273 274 274 PHE PHE A . n 
A 1 274 GLU 274 275 275 GLU GLU A . n 
A 1 275 ASP 275 276 276 ASP ASP A . n 
A 1 276 ILE 276 277 277 ILE ILE A . n 
A 1 277 LYS 277 278 278 LYS LYS A . n 
A 1 278 ALA 278 279 279 ALA ALA A . n 
A 1 279 ASN 279 280 280 ASN ASN A . n 
A 1 280 VAL 280 281 281 VAL VAL A . n 
A 1 281 THR 281 282 282 THR THR A . n 
A 1 282 GLU 282 283 283 GLU GLU A . n 
A 1 283 MET 283 284 284 MET MET A . n 
A 1 284 LEU 284 285 285 LEU LEU A . n 
A 1 285 ALA 285 286 286 ALA ALA A . n 
A 1 286 GLY 286 287 287 GLY GLY A . n 
A 1 287 GLY 287 288 288 GLY GLY A . n 
A 1 288 VAL 288 289 289 VAL VAL A . n 
A 1 289 ASP 289 290 290 ASP ASP A . n 
A 1 290 THR 290 291 291 THR THR A . n 
A 1 291 THR 291 292 292 THR THR A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 MET 293 294 294 MET MET A . n 
A 1 294 THR 294 295 295 THR THR A . n 
A 1 295 LEU 295 296 296 LEU LEU A . n 
A 1 296 GLN 296 297 297 GLN GLN A . n 
A 1 297 TRP 297 298 298 TRP TRP A . n 
A 1 298 HIS 298 299 299 HIS HIS A . n 
A 1 299 LEU 299 300 300 LEU LEU A . n 
A 1 300 TYR 300 301 301 TYR TYR A . n 
A 1 301 GLU 301 302 302 GLU GLU A . n 
A 1 302 MET 302 303 303 MET MET A . n 
A 1 303 ALA 303 304 304 ALA ALA A . n 
A 1 304 ARG 304 305 305 ARG ARG A . n 
A 1 305 ASN 305 306 306 ASN ASN A . n 
A 1 306 LEU 306 307 307 LEU LEU A . n 
A 1 307 LYS 307 308 308 LYS LYS A . n 
A 1 308 VAL 308 309 309 VAL VAL A . n 
A 1 309 GLN 309 310 310 GLN GLN A . n 
A 1 310 ASP 310 311 311 ASP ASP A . n 
A 1 311 MET 311 312 312 MET MET A . n 
A 1 312 LEU 312 313 313 LEU LEU A . n 
A 1 313 ARG 313 314 314 ARG ARG A . n 
A 1 314 ALA 314 315 315 ALA ALA A . n 
A 1 315 GLU 315 316 316 GLU GLU A . n 
A 1 316 VAL 316 317 317 VAL VAL A . n 
A 1 317 LEU 317 318 318 LEU LEU A . n 
A 1 318 ALA 318 319 319 ALA ALA A . n 
A 1 319 ALA 319 320 320 ALA ALA A . n 
A 1 320 ARG 320 321 321 ARG ARG A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLN 322 323 323 GLN GLN A . n 
A 1 323 ALA 323 324 324 ALA ALA A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 GLY 325 326 326 GLY GLY A . n 
A 1 326 ASP 326 327 327 ASP ASP A . n 
A 1 327 MET 327 328 328 MET MET A . n 
A 1 328 ALA 328 329 329 ALA ALA A . n 
A 1 329 THR 329 330 330 THR THR A . n 
A 1 330 MET 330 331 331 MET MET A . n 
A 1 331 LEU 331 332 332 LEU LEU A . n 
A 1 332 GLN 332 333 333 GLN GLN A . n 
A 1 333 LEU 333 334 334 LEU LEU A . n 
A 1 334 VAL 334 335 335 VAL VAL A . n 
A 1 335 PRO 335 336 336 PRO PRO A . n 
A 1 336 LEU 336 337 337 LEU LEU A . n 
A 1 337 LEU 337 338 338 LEU LEU A . n 
A 1 338 LYS 338 339 339 LYS LYS A . n 
A 1 339 ALA 339 340 340 ALA ALA A . n 
A 1 340 SER 340 341 341 SER SER A . n 
A 1 341 ILE 341 342 342 ILE ILE A . n 
A 1 342 LYS 342 343 343 LYS LYS A . n 
A 1 343 GLU 343 344 344 GLU GLU A . n 
A 1 344 THR 344 345 345 THR THR A . n 
A 1 345 LEU 345 346 346 LEU LEU A . n 
A 1 346 ARG 346 347 347 ARG ARG A . n 
A 1 347 LEU 347 348 348 LEU LEU A . n 
A 1 348 HIS 348 349 349 HIS HIS A . n 
A 1 349 PRO 349 350 350 PRO PRO A . n 
A 1 350 ILE 350 351 351 ILE ILE A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 VAL 352 353 353 VAL VAL A . n 
A 1 353 THR 353 354 354 THR THR A . n 
A 1 354 LEU 354 355 355 LEU LEU A . n 
A 1 355 GLN 355 356 356 GLN GLN A . n 
A 1 356 ARG 356 357 357 ARG ARG A . n 
A 1 357 TYR 357 358 358 TYR TYR A . n 
A 1 358 LEU 358 359 359 LEU LEU A . n 
A 1 359 VAL 359 360 360 VAL VAL A . n 
A 1 360 ASN 360 361 361 ASN ASN A . n 
A 1 361 ASP 361 362 362 ASP ASP A . n 
A 1 362 LEU 362 363 363 LEU LEU A . n 
A 1 363 VAL 363 364 364 VAL VAL A . n 
A 1 364 LEU 364 365 365 LEU LEU A . n 
A 1 365 ARG 365 366 366 ARG ARG A . n 
A 1 366 ASP 366 367 367 ASP ASP A . n 
A 1 367 TYR 367 368 368 TYR TYR A . n 
A 1 368 MET 368 369 369 MET MET A . n 
A 1 369 ILE 369 370 370 ILE ILE A . n 
A 1 370 PRO 370 371 371 PRO PRO A . n 
A 1 371 ALA 371 372 372 ALA ALA A . n 
A 1 372 LYS 372 373 373 LYS LYS A . n 
A 1 373 THR 373 374 374 THR THR A . n 
A 1 374 LEU 374 375 375 LEU LEU A . n 
A 1 375 VAL 375 376 376 VAL VAL A . n 
A 1 376 GLN 376 377 377 GLN GLN A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 ALA 378 379 379 ALA ALA A . n 
A 1 379 ILE 379 380 380 ILE ILE A . n 
A 1 380 TYR 380 381 381 TYR TYR A . n 
A 1 381 ALA 381 382 382 ALA ALA A . n 
A 1 382 LEU 382 383 383 LEU LEU A . n 
A 1 383 GLY 383 384 384 GLY GLY A . n 
A 1 384 ARG 384 385 385 ARG ARG A . n 
A 1 385 GLU 385 386 386 GLU GLU A . n 
A 1 386 PRO 386 387 387 PRO PRO A . n 
A 1 387 THR 387 388 388 THR THR A . n 
A 1 388 PHE 388 389 389 PHE PHE A . n 
A 1 389 PHE 389 390 390 PHE PHE A . n 
A 1 390 PHE 390 391 391 PHE PHE A . n 
A 1 391 ASP 391 392 392 ASP ASP A . n 
A 1 392 PRO 392 393 393 PRO PRO A . n 
A 1 393 GLU 393 394 394 GLU GLU A . n 
A 1 394 ASN 394 395 395 ASN ASN A . n 
A 1 395 PHE 395 396 396 PHE PHE A . n 
A 1 396 ASP 396 397 397 ASP ASP A . n 
A 1 397 PRO 397 398 398 PRO PRO A . n 
A 1 398 THR 398 399 399 THR THR A . n 
A 1 399 ARG 399 400 400 ARG ARG A . n 
A 1 400 TRP 400 401 401 TRP TRP A . n 
A 1 401 LEU 401 402 402 LEU LEU A . n 
A 1 402 SER 402 403 403 SER SER A . n 
A 1 403 LYS 403 404 404 LYS LYS A . n 
A 1 404 ASP 404 405 405 ASP ASP A . n 
A 1 405 LYS 405 406 406 LYS LYS A . n 
A 1 406 ASN 406 407 407 ASN ASN A . n 
A 1 407 ILE 407 408 408 ILE ILE A . n 
A 1 408 THR 408 409 409 THR THR A . n 
A 1 409 TYR 409 410 410 TYR TYR A . n 
A 1 410 PHE 410 411 411 PHE PHE A . n 
A 1 411 ARG 411 412 412 ARG ARG A . n 
A 1 412 ASN 412 413 413 ASN ASN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 GLY 414 415 415 GLY GLY A . n 
A 1 415 PHE 415 416 416 PHE PHE A . n 
A 1 416 GLY 416 417 417 GLY GLY A . n 
A 1 417 TRP 417 418 418 TRP TRP A . n 
A 1 418 GLY 418 419 419 GLY GLY A . n 
A 1 419 VAL 419 420 420 VAL VAL A . n 
A 1 420 ARG 420 421 421 ARG ARG A . n 
A 1 421 GLN 421 422 422 GLN GLN A . n 
A 1 422 CYS 422 423 423 CYS CYS A . n 
A 1 423 LEU 423 424 424 LEU LEU A . n 
A 1 424 GLY 424 425 425 GLY GLY A . n 
A 1 425 ARG 425 426 426 ARG ARG A . n 
A 1 426 ARG 426 427 427 ARG ARG A . n 
A 1 427 ILE 427 428 428 ILE ILE A . n 
A 1 428 ALA 428 429 429 ALA ALA A . n 
A 1 429 GLU 429 430 430 GLU GLU A . n 
A 1 430 LEU 430 431 431 LEU LEU A . n 
A 1 431 GLU 431 432 432 GLU GLU A . n 
A 1 432 MET 432 433 433 MET MET A . n 
A 1 433 THR 433 434 434 THR THR A . n 
A 1 434 ILE 434 435 435 ILE ILE A . n 
A 1 435 PHE 435 436 436 PHE PHE A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 ILE 437 438 438 ILE ILE A . n 
A 1 438 ASN 438 439 439 ASN ASN A . n 
A 1 439 MET 439 440 440 MET MET A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 GLU 441 442 442 GLU GLU A . n 
A 1 442 ASN 442 443 443 ASN ASN A . n 
A 1 443 PHE 443 444 444 PHE PHE A . n 
A 1 444 ARG 444 445 445 ARG ARG A . n 
A 1 445 VAL 445 446 446 VAL VAL A . n 
A 1 446 GLU 446 447 447 GLU GLU A . n 
A 1 447 ILE 447 448 448 ILE ILE A . n 
A 1 448 GLN 448 449 449 GLN GLN A . n 
A 1 449 HIS 449 450 450 HIS HIS A . n 
A 1 450 LEU 450 451 451 LEU LEU A . n 
A 1 451 SER 451 452 452 SER SER A . n 
A 1 452 ASP 452 453 453 ASP ASP A . n 
A 1 453 VAL 453 454 454 VAL VAL A . n 
A 1 454 GLY 454 455 455 GLY GLY A . n 
A 1 455 THR 455 456 456 THR THR A . n 
A 1 456 THR 456 457 457 THR THR A . n 
A 1 457 PHE 457 458 458 PHE PHE A . n 
A 1 458 ASN 458 459 459 ASN ASN A . n 
A 1 459 LEU 459 460 460 LEU LEU A . n 
A 1 460 ILE 460 461 461 ILE ILE A . n 
A 1 461 LEU 461 462 462 LEU LEU A . n 
A 1 462 MET 462 463 463 MET MET A . n 
A 1 463 PRO 463 464 464 PRO PRO A . n 
A 1 464 GLU 464 465 465 GLU GLU A . n 
A 1 465 LYS 465 466 466 LYS LYS A . n 
A 1 466 PRO 466 467 467 PRO PRO A . n 
A 1 467 ILE 467 468 468 ILE ILE A . n 
A 1 468 SER 468 469 469 SER SER A . n 
A 1 469 PHE 469 470 470 PHE PHE A . n 
A 1 470 THR 470 471 471 THR THR A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 TRP 472 473 473 TRP TRP A . n 
A 1 473 PRO 473 474 474 PRO PRO A . n 
A 1 474 PHE 474 475 475 PHE PHE A . n 
A 1 475 ASN 475 476 476 ASN ASN A . n 
A 1 476 GLN 476 477 ?   ?   ?   A . n 
A 1 477 GLU 477 478 ?   ?   ?   A . n 
A 1 478 ALA 478 479 ?   ?   ?   A . n 
A 1 479 THR 479 480 ?   ?   ?   A . n 
A 1 480 GLN 480 481 ?   ?   ?   A . n 
A 1 481 GLN 481 482 ?   ?   ?   A . n 
A 1 482 HIS 482 483 ?   ?   ?   A . n 
A 1 483 HIS 483 484 ?   ?   ?   A . n 
A 1 484 HIS 484 485 ?   ?   ?   A . n 
A 1 485 HIS 485 486 ?   ?   ?   A . n 
A 1 486 HIS 486 487 ?   ?   ?   A . n 
A 1 487 HIS 487 488 ?   ?   ?   A . n 
B 1 1   SER 1   2   ?   ?   ?   B . n 
B 1 2   THR 2   3   ?   ?   ?   B . n 
B 1 3   ARG 3   4   ?   ?   ?   B . n 
B 1 4   SER 4   5   ?   ?   ?   B . n 
B 1 5   PRO 5   6   6   PRO PRO B . n 
B 1 6   ARG 6   7   7   ARG ARG B . n 
B 1 7   PRO 7   8   8   PRO PRO B . n 
B 1 8   PHE 8   9   9   PHE PHE B . n 
B 1 9   ASN 9   10  10  ASN ASN B . n 
B 1 10  GLU 10  11  11  GLU GLU B . n 
B 1 11  ILE 11  12  12  ILE ILE B . n 
B 1 12  PRO 12  13  13  PRO PRO B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  GLY 15  16  16  GLY GLY B . n 
B 1 16  ASP 16  17  17  ASP ASP B . n 
B 1 17  ASN 17  18  18  ASN ASN B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  TRP 19  20  20  TRP TRP B . n 
B 1 20  LEU 20  21  21  LEU LEU B . n 
B 1 21  ASN 21  22  22  ASN ASN B . n 
B 1 22  LEU 22  23  23  LEU LEU B . n 
B 1 23  TYR 23  24  24  TYR TYR B . n 
B 1 24  HIS 24  25  25  HIS HIS B . n 
B 1 25  PHE 25  26  26  PHE PHE B . n 
B 1 26  TRP 26  27  27  TRP TRP B . n 
B 1 27  ARG 27  28  28  ARG ARG B . n 
B 1 28  GLU 28  29  29  GLU GLU B . n 
B 1 29  THR 29  30  30  THR THR B . n 
B 1 30  GLY 30  31  31  GLY GLY B . n 
B 1 31  THR 31  32  32  THR THR B . n 
B 1 32  HIS 32  33  33  HIS HIS B . n 
B 1 33  LYS 33  34  34  LYS LYS B . n 
B 1 34  VAL 34  35  35  VAL VAL B . n 
B 1 35  HIS 35  36  36  HIS HIS B . n 
B 1 36  LEU 36  37  37  LEU LEU B . n 
B 1 37  HIS 37  38  38  HIS HIS B . n 
B 1 38  HIS 38  39  39  HIS HIS B . n 
B 1 39  VAL 39  40  40  VAL VAL B . n 
B 1 40  GLN 40  41  41  GLN GLN B . n 
B 1 41  ASN 41  42  42  ASN ASN B . n 
B 1 42  PHE 42  43  43  PHE PHE B . n 
B 1 43  GLN 43  44  44  GLN GLN B . n 
B 1 44  LYS 44  45  45  LYS LYS B . n 
B 1 45  TYR 45  46  46  TYR TYR B . n 
B 1 46  GLY 46  47  47  GLY GLY B . n 
B 1 47  PRO 47  48  48  PRO PRO B . n 
B 1 48  ILE 48  49  49  ILE ILE B . n 
B 1 49  TYR 49  50  50  TYR TYR B . n 
B 1 50  ARG 50  51  51  ARG ARG B . n 
B 1 51  GLU 51  52  52  GLU GLU B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  LEU 53  54  54  LEU LEU B . n 
B 1 54  GLY 54  55  55  GLY GLY B . n 
B 1 55  ASN 55  56  56  ASN ASN B . n 
B 1 56  VAL 56  57  57  VAL VAL B . n 
B 1 57  GLU 57  58  58  GLU GLU B . n 
B 1 58  SER 58  59  59  SER SER B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  TYR 60  61  61  TYR TYR B . n 
B 1 61  VAL 61  62  62  VAL VAL B . n 
B 1 62  ILE 62  63  63  ILE ILE B . n 
B 1 63  ASP 63  64  64  ASP ASP B . n 
B 1 64  PRO 64  65  65  PRO PRO B . n 
B 1 65  GLU 65  66  66  GLU GLU B . n 
B 1 66  ASP 66  67  67  ASP ASP B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  ALA 68  69  69  ALA ALA B . n 
B 1 69  LEU 69  70  70  LEU LEU B . n 
B 1 70  LEU 70  71  71  LEU LEU B . n 
B 1 71  PHE 71  72  72  PHE PHE B . n 
B 1 72  LYS 72  73  73  LYS LYS B . n 
B 1 73  SER 73  74  74  SER SER B . n 
B 1 74  GLU 74  75  75  GLU GLU B . n 
B 1 75  GLY 75  76  76  GLY GLY B . n 
B 1 76  PRO 76  77  77  PRO PRO B . n 
B 1 77  ASN 77  78  78  ASN ASN B . n 
B 1 78  PRO 78  79  79  PRO PRO B . n 
B 1 79  GLU 79  80  80  GLU GLU B . n 
B 1 80  ARG 80  81  81  ARG ARG B . n 
B 1 81  PHE 81  82  82  PHE PHE B . n 
B 1 82  LEU 82  83  83  LEU LEU B . n 
B 1 83  ILE 83  84  84  ILE ILE B . n 
B 1 84  PRO 84  85  85  PRO PRO B . n 
B 1 85  PRO 85  86  86  PRO PRO B . n 
B 1 86  TRP 86  87  87  TRP TRP B . n 
B 1 87  VAL 87  88  88  VAL VAL B . n 
B 1 88  ALA 88  89  89  ALA ALA B . n 
B 1 89  TYR 89  90  90  TYR TYR B . n 
B 1 90  HIS 90  91  91  HIS HIS B . n 
B 1 91  GLN 91  92  92  GLN GLN B . n 
B 1 92  TYR 92  93  93  TYR TYR B . n 
B 1 93  TYR 93  94  94  TYR TYR B . n 
B 1 94  GLN 94  95  95  GLN GLN B . n 
B 1 95  ARG 95  96  96  ARG ARG B . n 
B 1 96  PRO 96  97  97  PRO PRO B . n 
B 1 97  ILE 97  98  98  ILE ILE B . n 
B 1 98  GLY 98  99  99  GLY GLY B . n 
B 1 99  VAL 99  100 100 VAL VAL B . n 
B 1 100 LEU 100 101 101 LEU LEU B . n 
B 1 101 LEU 101 102 102 LEU LEU B . n 
B 1 102 LYS 102 103 103 LYS LYS B . n 
B 1 103 LYS 103 104 104 LYS LYS B . n 
B 1 104 SER 104 105 105 SER SER B . n 
B 1 105 ALA 105 106 106 ALA ALA B . n 
B 1 106 ALA 106 107 107 ALA ALA B . n 
B 1 107 TRP 107 108 108 TRP TRP B . n 
B 1 108 LYS 108 109 109 LYS LYS B . n 
B 1 109 LYS 109 110 110 LYS LYS B . n 
B 1 110 ASP 110 111 111 ASP ASP B . n 
B 1 111 ARG 111 112 112 ARG ARG B . n 
B 1 112 VAL 112 113 113 VAL VAL B . n 
B 1 113 ALA 113 114 114 ALA ALA B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 ASN 115 116 116 ASN ASN B . n 
B 1 116 GLN 116 117 117 GLN GLN B . n 
B 1 117 GLU 117 118 118 GLU GLU B . n 
B 1 118 VAL 118 119 119 VAL VAL B . n 
B 1 119 MET 119 120 120 MET MET B . n 
B 1 120 ALA 120 121 121 ALA ALA B . n 
B 1 121 PRO 121 122 122 PRO PRO B . n 
B 1 122 GLU 122 123 123 GLU GLU B . n 
B 1 123 ALA 123 124 124 ALA ALA B . n 
B 1 124 THR 124 125 125 THR THR B . n 
B 1 125 LYS 125 126 126 LYS LYS B . n 
B 1 126 ASN 126 127 127 ASN ASN B . n 
B 1 127 PHE 127 128 128 PHE PHE B . n 
B 1 128 LEU 128 129 129 LEU LEU B . n 
B 1 129 PRO 129 130 130 PRO PRO B . n 
B 1 130 LEU 130 131 131 LEU LEU B . n 
B 1 131 LEU 131 132 132 LEU LEU B . n 
B 1 132 ASP 132 133 133 ASP ASP B . n 
B 1 133 ALA 133 134 134 ALA ALA B . n 
B 1 134 VAL 134 135 135 VAL VAL B . n 
B 1 135 SER 135 136 136 SER SER B . n 
B 1 136 ARG 136 137 137 ARG ARG B . n 
B 1 137 ASP 137 138 138 ASP ASP B . n 
B 1 138 PHE 138 139 139 PHE PHE B . n 
B 1 139 VAL 139 140 140 VAL VAL B . n 
B 1 140 SER 140 141 141 SER SER B . n 
B 1 141 VAL 141 142 142 VAL VAL B . n 
B 1 142 LEU 142 143 143 LEU LEU B . n 
B 1 143 HIS 143 144 144 HIS HIS B . n 
B 1 144 ARG 144 145 145 ARG ARG B . n 
B 1 145 ARG 145 146 146 ARG ARG B . n 
B 1 146 ILE 146 147 147 ILE ILE B . n 
B 1 147 LYS 147 148 148 LYS LYS B . n 
B 1 148 LYS 148 149 149 LYS LYS B . n 
B 1 149 ALA 149 150 150 ALA ALA B . n 
B 1 150 GLY 150 151 151 GLY GLY B . n 
B 1 151 SER 151 152 152 SER SER B . n 
B 1 152 GLY 152 153 153 GLY GLY B . n 
B 1 153 ASN 153 154 154 ASN ASN B . n 
B 1 154 TYR 154 155 155 TYR TYR B . n 
B 1 155 SER 155 156 156 SER SER B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 ASP 157 158 158 ASP ASP B . n 
B 1 158 ILE 158 159 159 ILE ILE B . n 
B 1 159 SER 159 160 160 SER SER B . n 
B 1 160 ASP 160 161 161 ASP ASP B . n 
B 1 161 ASP 161 162 162 ASP ASP B . n 
B 1 162 LEU 162 163 163 LEU LEU B . n 
B 1 163 PHE 163 164 164 PHE PHE B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 PHE 165 166 166 PHE PHE B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PHE 167 168 168 PHE PHE B . n 
B 1 168 GLU 168 169 169 GLU GLU B . n 
B 1 169 SER 169 170 170 SER SER B . n 
B 1 170 ILE 170 171 171 ILE ILE B . n 
B 1 171 THR 171 172 172 THR THR B . n 
B 1 172 ASN 172 173 173 ASN ASN B . n 
B 1 173 VAL 173 174 174 VAL VAL B . n 
B 1 174 ILE 174 175 175 ILE ILE B . n 
B 1 175 PHE 175 176 176 PHE PHE B . n 
B 1 176 GLY 176 177 177 GLY GLY B . n 
B 1 177 GLU 177 178 178 GLU GLU B . n 
B 1 178 ARG 178 179 179 ARG ARG B . n 
B 1 179 GLN 179 180 180 GLN GLN B . n 
B 1 180 GLY 180 181 181 GLY GLY B . n 
B 1 181 MET 181 182 182 MET MET B . n 
B 1 182 LEU 182 183 183 LEU LEU B . n 
B 1 183 GLU 183 184 184 GLU GLU B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 VAL 185 186 186 VAL VAL B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ASN 187 188 188 ASN ASN B . n 
B 1 188 PRO 188 189 189 PRO PRO B . n 
B 1 189 GLU 189 190 190 GLU GLU B . n 
B 1 190 ALA 190 191 191 ALA ALA B . n 
B 1 191 GLN 191 192 192 GLN GLN B . n 
B 1 192 ARG 192 193 193 ARG ARG B . n 
B 1 193 PHE 193 194 194 PHE PHE B . n 
B 1 194 ILE 194 195 195 ILE ILE B . n 
B 1 195 ASP 195 196 196 ASP ASP B . n 
B 1 196 ALA 196 197 197 ALA ALA B . n 
B 1 197 ILE 197 198 198 ILE ILE B . n 
B 1 198 TYR 198 199 199 TYR TYR B . n 
B 1 199 GLN 199 200 200 GLN GLN B . n 
B 1 200 MET 200 201 201 MET MET B . n 
B 1 201 PHE 201 202 202 PHE PHE B . n 
B 1 202 HIS 202 203 203 HIS HIS B . n 
B 1 203 THR 203 204 204 THR THR B . n 
B 1 204 SER 204 205 205 SER SER B . n 
B 1 205 VAL 205 206 206 VAL VAL B . n 
B 1 206 PRO 206 207 207 PRO PRO B . n 
B 1 207 MET 207 208 208 MET MET B . n 
B 1 208 LEU 208 209 209 LEU LEU B . n 
B 1 209 ASN 209 210 210 ASN ASN B . n 
B 1 210 LEU 210 211 211 LEU LEU B . n 
B 1 211 PRO 211 212 212 PRO PRO B . n 
B 1 212 PRO 212 213 213 PRO PRO B . n 
B 1 213 ASP 213 214 214 ASP ASP B . n 
B 1 214 LEU 214 215 215 LEU LEU B . n 
B 1 215 PHE 215 216 216 PHE PHE B . n 
B 1 216 ARG 216 217 217 ARG ARG B . n 
B 1 217 LEU 217 218 218 LEU LEU B . n 
B 1 218 PHE 218 219 219 PHE PHE B . n 
B 1 219 ARG 219 220 220 ARG ARG B . n 
B 1 220 THR 220 221 221 THR THR B . n 
B 1 221 LYS 221 222 222 LYS LYS B . n 
B 1 222 THR 222 223 223 THR THR B . n 
B 1 223 TRP 223 224 224 TRP TRP B . n 
B 1 224 LYS 224 225 225 LYS LYS B . n 
B 1 225 ASP 225 226 226 ASP ASP B . n 
B 1 226 HIS 226 227 227 HIS HIS B . n 
B 1 227 VAL 227 228 228 VAL VAL B . n 
B 1 228 ALA 228 229 229 ALA ALA B . n 
B 1 229 ALA 229 230 230 ALA ALA B . n 
B 1 230 TRP 230 231 231 TRP TRP B . n 
B 1 231 ASP 231 232 232 ASP ASP B . n 
B 1 232 VAL 232 233 233 VAL VAL B . n 
B 1 233 ILE 233 234 234 ILE ILE B . n 
B 1 234 PHE 234 235 235 PHE PHE B . n 
B 1 235 SER 235 236 236 SER SER B . n 
B 1 236 LYS 236 237 237 LYS LYS B . n 
B 1 237 ALA 237 238 238 ALA ALA B . n 
B 1 238 ASP 238 239 239 ASP ASP B . n 
B 1 239 ILE 239 240 240 ILE ILE B . n 
B 1 240 TYR 240 241 241 TYR TYR B . n 
B 1 241 THR 241 242 242 THR THR B . n 
B 1 242 GLN 242 243 243 GLN GLN B . n 
B 1 243 ASN 243 244 244 ASN ASN B . n 
B 1 244 PHE 244 245 245 PHE PHE B . n 
B 1 245 TYR 245 246 246 TYR TYR B . n 
B 1 246 TRP 246 247 247 TRP TRP B . n 
B 1 247 GLU 247 248 248 GLU GLU B . n 
B 1 248 LEU 248 249 249 LEU LEU B . n 
B 1 249 ARG 249 250 250 ARG ARG B . n 
B 1 250 GLN 250 251 251 GLN GLN B . n 
B 1 251 LYS 251 252 252 LYS LYS B . n 
B 1 252 GLY 252 253 253 GLY GLY B . n 
B 1 253 SER 253 254 254 SER SER B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 HIS 255 256 256 HIS HIS B . n 
B 1 256 HIS 256 257 257 HIS HIS B . n 
B 1 257 ASP 257 258 258 ASP ASP B . n 
B 1 258 TYR 258 259 259 TYR TYR B . n 
B 1 259 ARG 259 260 260 ARG ARG B . n 
B 1 260 GLY 260 261 261 GLY GLY B . n 
B 1 261 ILE 261 262 262 ILE ILE B . n 
B 1 262 LEU 262 263 263 LEU LEU B . n 
B 1 263 TYR 263 264 264 TYR TYR B . n 
B 1 264 ARG 264 265 265 ARG ARG B . n 
B 1 265 LEU 265 266 266 LEU LEU B . n 
B 1 266 LEU 266 267 267 LEU LEU B . n 
B 1 267 GLY 267 268 268 GLY GLY B . n 
B 1 268 ASP 268 269 269 ASP ASP B . n 
B 1 269 SER 269 270 270 SER SER B . n 
B 1 270 LYS 270 271 271 LYS LYS B . n 
B 1 271 MET 271 272 272 MET MET B . n 
B 1 272 SER 272 273 273 SER SER B . n 
B 1 273 PHE 273 274 274 PHE PHE B . n 
B 1 274 GLU 274 275 275 GLU GLU B . n 
B 1 275 ASP 275 276 276 ASP ASP B . n 
B 1 276 ILE 276 277 277 ILE ILE B . n 
B 1 277 LYS 277 278 278 LYS LYS B . n 
B 1 278 ALA 278 279 279 ALA ALA B . n 
B 1 279 ASN 279 280 280 ASN ASN B . n 
B 1 280 VAL 280 281 281 VAL VAL B . n 
B 1 281 THR 281 282 282 THR THR B . n 
B 1 282 GLU 282 283 283 GLU GLU B . n 
B 1 283 MET 283 284 284 MET MET B . n 
B 1 284 LEU 284 285 285 LEU LEU B . n 
B 1 285 ALA 285 286 286 ALA ALA B . n 
B 1 286 GLY 286 287 287 GLY GLY B . n 
B 1 287 GLY 287 288 288 GLY GLY B . n 
B 1 288 VAL 288 289 289 VAL VAL B . n 
B 1 289 ASP 289 290 290 ASP ASP B . n 
B 1 290 THR 290 291 291 THR THR B . n 
B 1 291 THR 291 292 292 THR THR B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 MET 293 294 294 MET MET B . n 
B 1 294 THR 294 295 295 THR THR B . n 
B 1 295 LEU 295 296 296 LEU LEU B . n 
B 1 296 GLN 296 297 297 GLN GLN B . n 
B 1 297 TRP 297 298 298 TRP TRP B . n 
B 1 298 HIS 298 299 299 HIS HIS B . n 
B 1 299 LEU 299 300 300 LEU LEU B . n 
B 1 300 TYR 300 301 301 TYR TYR B . n 
B 1 301 GLU 301 302 302 GLU GLU B . n 
B 1 302 MET 302 303 303 MET MET B . n 
B 1 303 ALA 303 304 304 ALA ALA B . n 
B 1 304 ARG 304 305 305 ARG ARG B . n 
B 1 305 ASN 305 306 306 ASN ASN B . n 
B 1 306 LEU 306 307 307 LEU LEU B . n 
B 1 307 LYS 307 308 308 LYS LYS B . n 
B 1 308 VAL 308 309 309 VAL VAL B . n 
B 1 309 GLN 309 310 310 GLN GLN B . n 
B 1 310 ASP 310 311 311 ASP ASP B . n 
B 1 311 MET 311 312 312 MET MET B . n 
B 1 312 LEU 312 313 313 LEU LEU B . n 
B 1 313 ARG 313 314 314 ARG ARG B . n 
B 1 314 ALA 314 315 315 ALA ALA B . n 
B 1 315 GLU 315 316 316 GLU GLU B . n 
B 1 316 VAL 316 317 317 VAL VAL B . n 
B 1 317 LEU 317 318 318 LEU LEU B . n 
B 1 318 ALA 318 319 319 ALA ALA B . n 
B 1 319 ALA 319 320 320 ALA ALA B . n 
B 1 320 ARG 320 321 321 ARG ARG B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLN 322 323 323 GLN GLN B . n 
B 1 323 ALA 323 324 324 ALA ALA B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 GLY 325 326 326 GLY GLY B . n 
B 1 326 ASP 326 327 327 ASP ASP B . n 
B 1 327 MET 327 328 328 MET MET B . n 
B 1 328 ALA 328 329 329 ALA ALA B . n 
B 1 329 THR 329 330 330 THR THR B . n 
B 1 330 MET 330 331 331 MET MET B . n 
B 1 331 LEU 331 332 332 LEU LEU B . n 
B 1 332 GLN 332 333 333 GLN GLN B . n 
B 1 333 LEU 333 334 334 LEU LEU B . n 
B 1 334 VAL 334 335 335 VAL VAL B . n 
B 1 335 PRO 335 336 336 PRO PRO B . n 
B 1 336 LEU 336 337 337 LEU LEU B . n 
B 1 337 LEU 337 338 338 LEU LEU B . n 
B 1 338 LYS 338 339 339 LYS LYS B . n 
B 1 339 ALA 339 340 340 ALA ALA B . n 
B 1 340 SER 340 341 341 SER SER B . n 
B 1 341 ILE 341 342 342 ILE ILE B . n 
B 1 342 LYS 342 343 343 LYS LYS B . n 
B 1 343 GLU 343 344 344 GLU GLU B . n 
B 1 344 THR 344 345 345 THR THR B . n 
B 1 345 LEU 345 346 346 LEU LEU B . n 
B 1 346 ARG 346 347 347 ARG ARG B . n 
B 1 347 LEU 347 348 348 LEU LEU B . n 
B 1 348 HIS 348 349 349 HIS HIS B . n 
B 1 349 PRO 349 350 350 PRO PRO B . n 
B 1 350 ILE 350 351 351 ILE ILE B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 VAL 352 353 353 VAL VAL B . n 
B 1 353 THR 353 354 354 THR THR B . n 
B 1 354 LEU 354 355 355 LEU LEU B . n 
B 1 355 GLN 355 356 356 GLN GLN B . n 
B 1 356 ARG 356 357 357 ARG ARG B . n 
B 1 357 TYR 357 358 358 TYR TYR B . n 
B 1 358 LEU 358 359 359 LEU LEU B . n 
B 1 359 VAL 359 360 360 VAL VAL B . n 
B 1 360 ASN 360 361 361 ASN ASN B . n 
B 1 361 ASP 361 362 362 ASP ASP B . n 
B 1 362 LEU 362 363 363 LEU LEU B . n 
B 1 363 VAL 363 364 364 VAL VAL B . n 
B 1 364 LEU 364 365 365 LEU LEU B . n 
B 1 365 ARG 365 366 366 ARG ARG B . n 
B 1 366 ASP 366 367 367 ASP ASP B . n 
B 1 367 TYR 367 368 368 TYR TYR B . n 
B 1 368 MET 368 369 369 MET MET B . n 
B 1 369 ILE 369 370 370 ILE ILE B . n 
B 1 370 PRO 370 371 371 PRO PRO B . n 
B 1 371 ALA 371 372 372 ALA ALA B . n 
B 1 372 LYS 372 373 373 LYS LYS B . n 
B 1 373 THR 373 374 374 THR THR B . n 
B 1 374 LEU 374 375 375 LEU LEU B . n 
B 1 375 VAL 375 376 376 VAL VAL B . n 
B 1 376 GLN 376 377 377 GLN GLN B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 ALA 378 379 379 ALA ALA B . n 
B 1 379 ILE 379 380 380 ILE ILE B . n 
B 1 380 TYR 380 381 381 TYR TYR B . n 
B 1 381 ALA 381 382 382 ALA ALA B . n 
B 1 382 LEU 382 383 383 LEU LEU B . n 
B 1 383 GLY 383 384 384 GLY GLY B . n 
B 1 384 ARG 384 385 385 ARG ARG B . n 
B 1 385 GLU 385 386 386 GLU GLU B . n 
B 1 386 PRO 386 387 387 PRO PRO B . n 
B 1 387 THR 387 388 388 THR THR B . n 
B 1 388 PHE 388 389 389 PHE PHE B . n 
B 1 389 PHE 389 390 390 PHE PHE B . n 
B 1 390 PHE 390 391 391 PHE PHE B . n 
B 1 391 ASP 391 392 392 ASP ASP B . n 
B 1 392 PRO 392 393 393 PRO PRO B . n 
B 1 393 GLU 393 394 394 GLU GLU B . n 
B 1 394 ASN 394 395 395 ASN ASN B . n 
B 1 395 PHE 395 396 396 PHE PHE B . n 
B 1 396 ASP 396 397 397 ASP ASP B . n 
B 1 397 PRO 397 398 398 PRO PRO B . n 
B 1 398 THR 398 399 399 THR THR B . n 
B 1 399 ARG 399 400 400 ARG ARG B . n 
B 1 400 TRP 400 401 401 TRP TRP B . n 
B 1 401 LEU 401 402 402 LEU LEU B . n 
B 1 402 SER 402 403 403 SER SER B . n 
B 1 403 LYS 403 404 404 LYS LYS B . n 
B 1 404 ASP 404 405 405 ASP ASP B . n 
B 1 405 LYS 405 406 406 LYS LYS B . n 
B 1 406 ASN 406 407 407 ASN ASN B . n 
B 1 407 ILE 407 408 408 ILE ILE B . n 
B 1 408 THR 408 409 409 THR THR B . n 
B 1 409 TYR 409 410 410 TYR TYR B . n 
B 1 410 PHE 410 411 411 PHE PHE B . n 
B 1 411 ARG 411 412 412 ARG ARG B . n 
B 1 412 ASN 412 413 413 ASN ASN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 GLY 414 415 415 GLY GLY B . n 
B 1 415 PHE 415 416 416 PHE PHE B . n 
B 1 416 GLY 416 417 417 GLY GLY B . n 
B 1 417 TRP 417 418 418 TRP TRP B . n 
B 1 418 GLY 418 419 419 GLY GLY B . n 
B 1 419 VAL 419 420 420 VAL VAL B . n 
B 1 420 ARG 420 421 421 ARG ARG B . n 
B 1 421 GLN 421 422 422 GLN GLN B . n 
B 1 422 CYS 422 423 423 CYS CYS B . n 
B 1 423 LEU 423 424 424 LEU LEU B . n 
B 1 424 GLY 424 425 425 GLY GLY B . n 
B 1 425 ARG 425 426 426 ARG ARG B . n 
B 1 426 ARG 426 427 427 ARG ARG B . n 
B 1 427 ILE 427 428 428 ILE ILE B . n 
B 1 428 ALA 428 429 429 ALA ALA B . n 
B 1 429 GLU 429 430 430 GLU GLU B . n 
B 1 430 LEU 430 431 431 LEU LEU B . n 
B 1 431 GLU 431 432 432 GLU GLU B . n 
B 1 432 MET 432 433 433 MET MET B . n 
B 1 433 THR 433 434 434 THR THR B . n 
B 1 434 ILE 434 435 435 ILE ILE B . n 
B 1 435 PHE 435 436 436 PHE PHE B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 ILE 437 438 438 ILE ILE B . n 
B 1 438 ASN 438 439 439 ASN ASN B . n 
B 1 439 MET 439 440 440 MET MET B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 GLU 441 442 442 GLU GLU B . n 
B 1 442 ASN 442 443 443 ASN ASN B . n 
B 1 443 PHE 443 444 444 PHE PHE B . n 
B 1 444 ARG 444 445 445 ARG ARG B . n 
B 1 445 VAL 445 446 446 VAL VAL B . n 
B 1 446 GLU 446 447 447 GLU GLU B . n 
B 1 447 ILE 447 448 448 ILE ILE B . n 
B 1 448 GLN 448 449 449 GLN GLN B . n 
B 1 449 HIS 449 450 450 HIS HIS B . n 
B 1 450 LEU 450 451 451 LEU LEU B . n 
B 1 451 SER 451 452 452 SER SER B . n 
B 1 452 ASP 452 453 453 ASP ASP B . n 
B 1 453 VAL 453 454 454 VAL VAL B . n 
B 1 454 GLY 454 455 455 GLY GLY B . n 
B 1 455 THR 455 456 456 THR THR B . n 
B 1 456 THR 456 457 457 THR THR B . n 
B 1 457 PHE 457 458 458 PHE PHE B . n 
B 1 458 ASN 458 459 459 ASN ASN B . n 
B 1 459 LEU 459 460 460 LEU LEU B . n 
B 1 460 ILE 460 461 461 ILE ILE B . n 
B 1 461 LEU 461 462 462 LEU LEU B . n 
B 1 462 MET 462 463 463 MET MET B . n 
B 1 463 PRO 463 464 464 PRO PRO B . n 
B 1 464 GLU 464 465 465 GLU GLU B . n 
B 1 465 LYS 465 466 466 LYS LYS B . n 
B 1 466 PRO 466 467 467 PRO PRO B . n 
B 1 467 ILE 467 468 468 ILE ILE B . n 
B 1 468 SER 468 469 469 SER SER B . n 
B 1 469 PHE 469 470 470 PHE PHE B . n 
B 1 470 THR 470 471 471 THR THR B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 TRP 472 473 473 TRP TRP B . n 
B 1 473 PRO 473 474 474 PRO PRO B . n 
B 1 474 PHE 474 475 475 PHE PHE B . n 
B 1 475 ASN 475 476 476 ASN ASN B . n 
B 1 476 GLN 476 477 ?   ?   ?   B . n 
B 1 477 GLU 477 478 ?   ?   ?   B . n 
B 1 478 ALA 478 479 ?   ?   ?   B . n 
B 1 479 THR 479 480 ?   ?   ?   B . n 
B 1 480 GLN 480 481 ?   ?   ?   B . n 
B 1 481 GLN 481 482 ?   ?   ?   B . n 
B 1 482 HIS 482 483 ?   ?   ?   B . n 
B 1 483 HIS 483 484 ?   ?   ?   B . n 
B 1 484 HIS 484 485 ?   ?   ?   B . n 
B 1 485 HIS 485 486 ?   ?   ?   B . n 
B 1 486 HIS 486 487 ?   ?   ?   B . n 
B 1 487 HIS 487 488 ?   ?   ?   B . n 
C 2 1   SER 1   2   ?   ?   ?   C . n 
C 2 2   SER 2   3   ?   ?   ?   C . n 
C 2 3   GLU 3   4   ?   ?   ?   C . n 
C 2 4   ASP 4   5   ?   ?   ?   C . n 
C 2 5   LYS 5   6   ?   ?   ?   C . n 
C 2 6   ILE 6   7   ?   ?   ?   C . n 
C 2 7   THR 7   8   ?   ?   ?   C . n 
C 2 8   VAL 8   9   ?   ?   ?   C . n 
C 2 9   HIS 9   10  ?   ?   ?   C . n 
C 2 10  PHE 10  11  ?   ?   ?   C . n 
C 2 11  ILE 11  12  ?   ?   ?   C . n 
C 2 12  ASN 12  13  ?   ?   ?   C . n 
C 2 13  ARG 13  14  ?   ?   ?   C . n 
C 2 14  ASP 14  15  ?   ?   ?   C . n 
C 2 15  GLY 15  16  ?   ?   ?   C . n 
C 2 16  GLU 16  17  ?   ?   ?   C . n 
C 2 17  THR 17  18  ?   ?   ?   C . n 
C 2 18  LEU 18  19  ?   ?   ?   C . n 
C 2 19  THR 19  20  ?   ?   ?   C . n 
C 2 20  THR 20  21  ?   ?   ?   C . n 
C 2 21  LYS 21  22  ?   ?   ?   C . n 
C 2 22  GLY 22  23  ?   ?   ?   C . n 
C 2 23  LYS 23  24  ?   ?   ?   C . n 
C 2 24  VAL 24  25  ?   ?   ?   C . n 
C 2 25  GLY 25  26  ?   ?   ?   C . n 
C 2 26  ASP 26  27  ?   ?   ?   C . n 
C 2 27  SER 27  28  ?   ?   ?   C . n 
C 2 28  LEU 28  29  ?   ?   ?   C . n 
C 2 29  LEU 29  30  ?   ?   ?   C . n 
C 2 30  ASP 30  31  ?   ?   ?   C . n 
C 2 31  VAL 31  32  ?   ?   ?   C . n 
C 2 32  VAL 32  33  ?   ?   ?   C . n 
C 2 33  VAL 33  34  ?   ?   ?   C . n 
C 2 34  GLU 34  35  ?   ?   ?   C . n 
C 2 35  ASN 35  36  ?   ?   ?   C . n 
C 2 36  ASN 36  37  ?   ?   ?   C . n 
C 2 37  LEU 37  38  ?   ?   ?   C . n 
C 2 38  ASP 38  39  ?   ?   ?   C . n 
C 2 39  ILE 39  40  ?   ?   ?   C . n 
C 2 40  ASP 40  41  ?   ?   ?   C . n 
C 2 41  GLY 41  42  ?   ?   ?   C . n 
C 2 42  PHE 42  43  ?   ?   ?   C . n 
C 2 43  GLY 43  44  44  GLY GLY C . n 
C 2 44  ALA 44  45  45  ALA ALA C . n 
C 2 45  CYS 45  46  46  CYS CYS C . n 
C 2 46  GLU 46  47  47  GLU GLU C . n 
C 2 47  GLY 47  48  48  GLY GLY C . n 
C 2 48  THR 48  49  49  THR THR C . n 
C 2 49  LEU 49  50  50  LEU LEU C . n 
C 2 50  ALA 50  51  51  ALA ALA C . n 
C 2 51  CYS 51  52  52  CYS CYS C . n 
C 2 52  SER 52  53  53  SER SER C . n 
C 2 53  THR 53  54  54  THR THR C . n 
C 2 54  CYS 54  55  55  CYS CYS C . n 
C 2 55  HIS 55  56  ?   ?   ?   C . n 
C 2 56  LEU 56  57  ?   ?   ?   C . n 
C 2 57  ILE 57  58  ?   ?   ?   C . n 
C 2 58  PHE 58  59  ?   ?   ?   C . n 
C 2 59  GLU 59  60  ?   ?   ?   C . n 
C 2 60  ASP 60  61  ?   ?   ?   C . n 
C 2 61  HIS 61  62  ?   ?   ?   C . n 
C 2 62  ILE 62  63  ?   ?   ?   C . n 
C 2 63  TYR 63  64  ?   ?   ?   C . n 
C 2 64  GLU 64  65  ?   ?   ?   C . n 
C 2 65  LYS 65  66  ?   ?   ?   C . n 
C 2 66  LEU 66  67  ?   ?   ?   C . n 
C 2 67  ASP 67  68  ?   ?   ?   C . n 
C 2 68  ALA 68  69  ?   ?   ?   C . n 
C 2 69  ILE 69  70  ?   ?   ?   C . n 
C 2 70  THR 70  71  ?   ?   ?   C . n 
C 2 71  ASP 71  72  72  ASP ASP C . n 
C 2 72  GLU 72  73  73  GLU GLU C . n 
C 2 73  GLU 73  74  74  GLU GLU C . n 
C 2 74  ASN 74  75  75  ASN ASN C . n 
C 2 75  ASP 75  76  76  ASP ASP C . n 
C 2 76  MET 76  77  77  MET MET C . n 
C 2 77  LEU 77  78  78  LEU LEU C . n 
C 2 78  ASP 78  79  79  ASP ASP C . n 
C 2 79  LEU 79  80  80  LEU LEU C . n 
C 2 80  ALA 80  81  81  ALA ALA C . n 
C 2 81  TYR 81  82  ?   ?   ?   C . n 
C 2 82  GLY 82  83  ?   ?   ?   C . n 
C 2 83  LEU 83  84  ?   ?   ?   C . n 
C 2 84  THR 84  85  ?   ?   ?   C . n 
C 2 85  ASP 85  86  ?   ?   ?   C . n 
C 2 86  ARG 86  87  ?   ?   ?   C . n 
C 2 87  SER 87  88  ?   ?   ?   C . n 
C 2 88  ARG 88  89  ?   ?   ?   C . n 
C 2 89  LEU 89  90  90  LEU LEU C . n 
C 2 90  GLY 90  91  91  GLY GLY C . n 
C 2 91  CYS 91  92  92  CYS CYS C . n 
C 2 92  GLN 92  93  93  GLN GLN C . n 
C 2 93  ILE 93  94  ?   ?   ?   C . n 
C 2 94  CYS 94  95  ?   ?   ?   C . n 
C 2 95  LEU 95  96  ?   ?   ?   C . n 
C 2 96  THR 96  97  ?   ?   ?   C . n 
C 2 97  LYS 97  98  ?   ?   ?   C . n 
C 2 98  SER 98  99  ?   ?   ?   C . n 
C 2 99  MET 99  100 ?   ?   ?   C . n 
C 2 100 ASP 100 101 ?   ?   ?   C . n 
C 2 101 ASN 101 102 ?   ?   ?   C . n 
C 2 102 MET 102 103 ?   ?   ?   C . n 
C 2 103 THR 103 104 ?   ?   ?   C . n 
C 2 104 VAL 104 105 ?   ?   ?   C . n 
C 2 105 ARG 105 106 ?   ?   ?   C . n 
C 2 106 VAL 106 107 ?   ?   ?   C . n 
C 2 107 PRO 107 108 ?   ?   ?   C . n 
C 2 108 GLU 108 109 ?   ?   ?   C . n 
C 2 109 THR 109 110 ?   ?   ?   C . n 
C 2 110 VAL 110 111 ?   ?   ?   C . n 
C 2 111 ALA 111 112 ?   ?   ?   C . n 
C 2 112 ASP 112 113 ?   ?   ?   C . n 
C 2 113 ALA 113 114 ?   ?   ?   C . n 
C 2 114 ARG 114 115 ?   ?   ?   C . n 
C 2 115 GLN 115 116 ?   ?   ?   C . n 
C 2 116 SER 116 117 ?   ?   ?   C . n 
C 2 117 ILE 117 118 ?   ?   ?   C . n 
C 2 118 ASP 118 119 ?   ?   ?   C . n 
C 2 119 VAL 119 120 ?   ?   ?   C . n 
C 2 120 GLY 120 121 ?   ?   ?   C . n 
C 2 121 LYS 121 122 ?   ?   ?   C . n 
C 2 122 THR 122 123 ?   ?   ?   C . n 
C 2 123 SER 123 124 ?   ?   ?   C . n 
D 2 1   SER 1   2   ?   ?   ?   D . n 
D 2 2   SER 2   3   ?   ?   ?   D . n 
D 2 3   GLU 3   4   ?   ?   ?   D . n 
D 2 4   ASP 4   5   ?   ?   ?   D . n 
D 2 5   LYS 5   6   ?   ?   ?   D . n 
D 2 6   ILE 6   7   ?   ?   ?   D . n 
D 2 7   THR 7   8   ?   ?   ?   D . n 
D 2 8   VAL 8   9   ?   ?   ?   D . n 
D 2 9   HIS 9   10  ?   ?   ?   D . n 
D 2 10  PHE 10  11  ?   ?   ?   D . n 
D 2 11  ILE 11  12  ?   ?   ?   D . n 
D 2 12  ASN 12  13  ?   ?   ?   D . n 
D 2 13  ARG 13  14  ?   ?   ?   D . n 
D 2 14  ASP 14  15  ?   ?   ?   D . n 
D 2 15  GLY 15  16  ?   ?   ?   D . n 
D 2 16  GLU 16  17  ?   ?   ?   D . n 
D 2 17  THR 17  18  ?   ?   ?   D . n 
D 2 18  LEU 18  19  ?   ?   ?   D . n 
D 2 19  THR 19  20  ?   ?   ?   D . n 
D 2 20  THR 20  21  ?   ?   ?   D . n 
D 2 21  LYS 21  22  ?   ?   ?   D . n 
D 2 22  GLY 22  23  ?   ?   ?   D . n 
D 2 23  LYS 23  24  ?   ?   ?   D . n 
D 2 24  VAL 24  25  ?   ?   ?   D . n 
D 2 25  GLY 25  26  ?   ?   ?   D . n 
D 2 26  ASP 26  27  ?   ?   ?   D . n 
D 2 27  SER 27  28  ?   ?   ?   D . n 
D 2 28  LEU 28  29  ?   ?   ?   D . n 
D 2 29  LEU 29  30  ?   ?   ?   D . n 
D 2 30  ASP 30  31  ?   ?   ?   D . n 
D 2 31  VAL 31  32  ?   ?   ?   D . n 
D 2 32  VAL 32  33  ?   ?   ?   D . n 
D 2 33  VAL 33  34  ?   ?   ?   D . n 
D 2 34  GLU 34  35  ?   ?   ?   D . n 
D 2 35  ASN 35  36  ?   ?   ?   D . n 
D 2 36  ASN 36  37  ?   ?   ?   D . n 
D 2 37  LEU 37  38  ?   ?   ?   D . n 
D 2 38  ASP 38  39  ?   ?   ?   D . n 
D 2 39  ILE 39  40  ?   ?   ?   D . n 
D 2 40  ASP 40  41  ?   ?   ?   D . n 
D 2 41  GLY 41  42  ?   ?   ?   D . n 
D 2 42  PHE 42  43  ?   ?   ?   D . n 
D 2 43  GLY 43  44  ?   ?   ?   D . n 
D 2 44  ALA 44  45  45  ALA ALA D . n 
D 2 45  CYS 45  46  46  CYS CYS D . n 
D 2 46  GLU 46  47  47  GLU GLU D . n 
D 2 47  GLY 47  48  48  GLY GLY D . n 
D 2 48  THR 48  49  49  THR THR D . n 
D 2 49  LEU 49  50  50  LEU LEU D . n 
D 2 50  ALA 50  51  51  ALA ALA D . n 
D 2 51  CYS 51  52  52  CYS CYS D . n 
D 2 52  SER 52  53  53  SER SER D . n 
D 2 53  THR 53  54  54  THR THR D . n 
D 2 54  CYS 54  55  55  CYS CYS D . n 
D 2 55  HIS 55  56  ?   ?   ?   D . n 
D 2 56  LEU 56  57  ?   ?   ?   D . n 
D 2 57  ILE 57  58  ?   ?   ?   D . n 
D 2 58  PHE 58  59  ?   ?   ?   D . n 
D 2 59  GLU 59  60  ?   ?   ?   D . n 
D 2 60  ASP 60  61  ?   ?   ?   D . n 
D 2 61  HIS 61  62  ?   ?   ?   D . n 
D 2 62  ILE 62  63  ?   ?   ?   D . n 
D 2 63  TYR 63  64  ?   ?   ?   D . n 
D 2 64  GLU 64  65  ?   ?   ?   D . n 
D 2 65  LYS 65  66  ?   ?   ?   D . n 
D 2 66  LEU 66  67  ?   ?   ?   D . n 
D 2 67  ASP 67  68  ?   ?   ?   D . n 
D 2 68  ALA 68  69  ?   ?   ?   D . n 
D 2 69  ILE 69  70  ?   ?   ?   D . n 
D 2 70  THR 70  71  ?   ?   ?   D . n 
D 2 71  ASP 71  72  ?   ?   ?   D . n 
D 2 72  GLU 72  73  73  GLU GLU D . n 
D 2 73  GLU 73  74  74  GLU GLU D . n 
D 2 74  ASN 74  75  75  ASN ASN D . n 
D 2 75  ASP 75  76  76  ASP ASP D . n 
D 2 76  MET 76  77  77  MET MET D . n 
D 2 77  LEU 77  78  78  LEU LEU D . n 
D 2 78  ASP 78  79  79  ASP ASP D . n 
D 2 79  LEU 79  80  80  LEU LEU D . n 
D 2 80  ALA 80  81  81  ALA ALA D . n 
D 2 81  TYR 81  82  ?   ?   ?   D . n 
D 2 82  GLY 82  83  ?   ?   ?   D . n 
D 2 83  LEU 83  84  ?   ?   ?   D . n 
D 2 84  THR 84  85  ?   ?   ?   D . n 
D 2 85  ASP 85  86  ?   ?   ?   D . n 
D 2 86  ARG 86  87  ?   ?   ?   D . n 
D 2 87  SER 87  88  ?   ?   ?   D . n 
D 2 88  ARG 88  89  ?   ?   ?   D . n 
D 2 89  LEU 89  90  90  LEU LEU D . n 
D 2 90  GLY 90  91  91  GLY GLY D . n 
D 2 91  CYS 91  92  92  CYS CYS D . n 
D 2 92  GLN 92  93  93  GLN GLN D . n 
D 2 93  ILE 93  94  ?   ?   ?   D . n 
D 2 94  CYS 94  95  ?   ?   ?   D . n 
D 2 95  LEU 95  96  ?   ?   ?   D . n 
D 2 96  THR 96  97  ?   ?   ?   D . n 
D 2 97  LYS 97  98  ?   ?   ?   D . n 
D 2 98  SER 98  99  ?   ?   ?   D . n 
D 2 99  MET 99  100 ?   ?   ?   D . n 
D 2 100 ASP 100 101 ?   ?   ?   D . n 
D 2 101 ASN 101 102 ?   ?   ?   D . n 
D 2 102 MET 102 103 ?   ?   ?   D . n 
D 2 103 THR 103 104 ?   ?   ?   D . n 
D 2 104 VAL 104 105 ?   ?   ?   D . n 
D 2 105 ARG 105 106 ?   ?   ?   D . n 
D 2 106 VAL 106 107 ?   ?   ?   D . n 
D 2 107 PRO 107 108 ?   ?   ?   D . n 
D 2 108 GLU 108 109 ?   ?   ?   D . n 
D 2 109 THR 109 110 ?   ?   ?   D . n 
D 2 110 VAL 110 111 ?   ?   ?   D . n 
D 2 111 ALA 111 112 ?   ?   ?   D . n 
D 2 112 ASP 112 113 ?   ?   ?   D . n 
D 2 113 ALA 113 114 ?   ?   ?   D . n 
D 2 114 ARG 114 115 ?   ?   ?   D . n 
D 2 115 GLN 115 116 ?   ?   ?   D . n 
D 2 116 SER 116 117 ?   ?   ?   D . n 
D 2 117 ILE 117 118 ?   ?   ?   D . n 
D 2 118 ASP 118 119 ?   ?   ?   D . n 
D 2 119 VAL 119 120 ?   ?   ?   D . n 
D 2 120 GLY 120 121 ?   ?   ?   D . n 
D 2 121 LYS 121 122 ?   ?   ?   D . n 
D 2 122 THR 122 123 ?   ?   ?   D . n 
D 2 123 SER 123 124 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HEM 1   601 601 HEM HEM A . 
F 4 HCD 1   602 602 HCD HCD A . 
G 3 HEM 1   601 601 HEM HEM B . 
H 4 HCD 1   602 602 HCD HCD B . 
I 5 FES 1   150 150 FES FES C . 
J 5 FES 1   151 151 FES FES D . 
K 6 HOH 1   1   1   HOH HOH A . 
K 6 HOH 2   489 3   HOH HOH A . 
K 6 HOH 3   490 7   HOH HOH A . 
K 6 HOH 4   491 11  HOH HOH A . 
K 6 HOH 5   492 12  HOH HOH A . 
K 6 HOH 6   493 15  HOH HOH A . 
K 6 HOH 7   494 17  HOH HOH A . 
K 6 HOH 8   495 18  HOH HOH A . 
K 6 HOH 9   496 19  HOH HOH A . 
K 6 HOH 10  497 20  HOH HOH A . 
K 6 HOH 11  498 24  HOH HOH A . 
K 6 HOH 12  499 25  HOH HOH A . 
K 6 HOH 13  500 29  HOH HOH A . 
K 6 HOH 14  501 31  HOH HOH A . 
K 6 HOH 15  502 32  HOH HOH A . 
K 6 HOH 16  503 36  HOH HOH A . 
K 6 HOH 17  504 37  HOH HOH A . 
K 6 HOH 18  505 38  HOH HOH A . 
K 6 HOH 19  506 40  HOH HOH A . 
K 6 HOH 20  507 42  HOH HOH A . 
K 6 HOH 21  516 516 HOH HOH A . 
K 6 HOH 22  517 517 HOH HOH A . 
K 6 HOH 23  518 518 HOH HOH A . 
K 6 HOH 24  519 519 HOH HOH A . 
K 6 HOH 25  520 520 HOH HOH A . 
K 6 HOH 26  521 521 HOH HOH A . 
K 6 HOH 27  522 522 HOH HOH A . 
K 6 HOH 28  523 523 HOH HOH A . 
K 6 HOH 29  524 524 HOH HOH A . 
K 6 HOH 30  525 525 HOH HOH A . 
K 6 HOH 31  526 526 HOH HOH A . 
K 6 HOH 32  527 527 HOH HOH A . 
K 6 HOH 33  528 528 HOH HOH A . 
K 6 HOH 34  529 529 HOH HOH A . 
K 6 HOH 35  530 530 HOH HOH A . 
K 6 HOH 36  531 531 HOH HOH A . 
K 6 HOH 37  532 532 HOH HOH A . 
K 6 HOH 38  533 533 HOH HOH A . 
K 6 HOH 39  534 534 HOH HOH A . 
K 6 HOH 40  535 535 HOH HOH A . 
K 6 HOH 41  536 536 HOH HOH A . 
K 6 HOH 42  537 537 HOH HOH A . 
K 6 HOH 43  538 538 HOH HOH A . 
K 6 HOH 44  539 539 HOH HOH A . 
K 6 HOH 45  540 540 HOH HOH A . 
K 6 HOH 46  541 541 HOH HOH A . 
K 6 HOH 47  542 542 HOH HOH A . 
K 6 HOH 48  543 543 HOH HOH A . 
K 6 HOH 49  544 544 HOH HOH A . 
K 6 HOH 50  545 545 HOH HOH A . 
K 6 HOH 51  546 546 HOH HOH A . 
K 6 HOH 52  547 547 HOH HOH A . 
K 6 HOH 53  548 548 HOH HOH A . 
K 6 HOH 54  549 549 HOH HOH A . 
K 6 HOH 55  550 550 HOH HOH A . 
K 6 HOH 56  551 551 HOH HOH A . 
K 6 HOH 57  552 552 HOH HOH A . 
K 6 HOH 58  553 553 HOH HOH A . 
K 6 HOH 59  554 554 HOH HOH A . 
K 6 HOH 60  555 555 HOH HOH A . 
K 6 HOH 61  556 556 HOH HOH A . 
K 6 HOH 62  557 557 HOH HOH A . 
K 6 HOH 63  558 558 HOH HOH A . 
K 6 HOH 64  559 559 HOH HOH A . 
K 6 HOH 65  560 560 HOH HOH A . 
K 6 HOH 66  561 561 HOH HOH A . 
K 6 HOH 67  562 562 HOH HOH A . 
K 6 HOH 68  563 563 HOH HOH A . 
K 6 HOH 69  564 564 HOH HOH A . 
K 6 HOH 70  565 565 HOH HOH A . 
K 6 HOH 71  566 566 HOH HOH A . 
K 6 HOH 72  567 567 HOH HOH A . 
K 6 HOH 73  568 568 HOH HOH A . 
K 6 HOH 74  569 569 HOH HOH A . 
K 6 HOH 75  570 570 HOH HOH A . 
K 6 HOH 76  571 571 HOH HOH A . 
K 6 HOH 77  572 572 HOH HOH A . 
K 6 HOH 78  573 573 HOH HOH A . 
K 6 HOH 79  574 574 HOH HOH A . 
K 6 HOH 80  575 575 HOH HOH A . 
K 6 HOH 81  576 576 HOH HOH A . 
K 6 HOH 82  577 577 HOH HOH A . 
K 6 HOH 83  578 578 HOH HOH A . 
K 6 HOH 84  579 579 HOH HOH A . 
K 6 HOH 85  580 580 HOH HOH A . 
K 6 HOH 86  581 581 HOH HOH A . 
K 6 HOH 87  582 582 HOH HOH A . 
K 6 HOH 88  583 583 HOH HOH A . 
K 6 HOH 89  584 584 HOH HOH A . 
K 6 HOH 90  585 585 HOH HOH A . 
K 6 HOH 91  586 586 HOH HOH A . 
K 6 HOH 92  587 587 HOH HOH A . 
K 6 HOH 93  588 588 HOH HOH A . 
K 6 HOH 94  589 589 HOH HOH A . 
K 6 HOH 95  590 590 HOH HOH A . 
K 6 HOH 96  591 591 HOH HOH A . 
K 6 HOH 97  592 592 HOH HOH A . 
K 6 HOH 98  593 593 HOH HOH A . 
K 6 HOH 99  594 594 HOH HOH A . 
K 6 HOH 100 595 595 HOH HOH A . 
K 6 HOH 101 596 596 HOH HOH A . 
K 6 HOH 102 597 597 HOH HOH A . 
K 6 HOH 103 598 598 HOH HOH A . 
K 6 HOH 104 599 599 HOH HOH A . 
K 6 HOH 105 600 600 HOH HOH A . 
K 6 HOH 106 603 603 HOH HOH A . 
K 6 HOH 107 604 604 HOH HOH A . 
K 6 HOH 108 605 605 HOH HOH A . 
K 6 HOH 109 606 606 HOH HOH A . 
K 6 HOH 110 607 607 HOH HOH A . 
K 6 HOH 111 608 608 HOH HOH A . 
K 6 HOH 112 609 609 HOH HOH A . 
K 6 HOH 113 610 610 HOH HOH A . 
K 6 HOH 114 611 611 HOH HOH A . 
K 6 HOH 115 612 612 HOH HOH A . 
K 6 HOH 116 613 613 HOH HOH A . 
K 6 HOH 117 614 614 HOH HOH A . 
K 6 HOH 118 615 615 HOH HOH A . 
K 6 HOH 119 616 616 HOH HOH A . 
K 6 HOH 120 617 617 HOH HOH A . 
K 6 HOH 121 618 618 HOH HOH A . 
K 6 HOH 122 619 619 HOH HOH A . 
K 6 HOH 123 620 620 HOH HOH A . 
K 6 HOH 124 621 621 HOH HOH A . 
K 6 HOH 125 622 622 HOH HOH A . 
K 6 HOH 126 623 623 HOH HOH A . 
K 6 HOH 127 624 624 HOH HOH A . 
K 6 HOH 128 625 625 HOH HOH A . 
K 6 HOH 129 626 626 HOH HOH A . 
K 6 HOH 130 627 627 HOH HOH A . 
K 6 HOH 131 628 628 HOH HOH A . 
K 6 HOH 132 629 629 HOH HOH A . 
K 6 HOH 133 630 630 HOH HOH A . 
K 6 HOH 134 631 631 HOH HOH A . 
K 6 HOH 135 632 632 HOH HOH A . 
K 6 HOH 136 633 633 HOH HOH A . 
K 6 HOH 137 634 634 HOH HOH A . 
K 6 HOH 138 635 635 HOH HOH A . 
K 6 HOH 139 636 636 HOH HOH A . 
K 6 HOH 140 637 637 HOH HOH A . 
K 6 HOH 141 638 638 HOH HOH A . 
K 6 HOH 142 639 639 HOH HOH A . 
K 6 HOH 143 640 640 HOH HOH A . 
K 6 HOH 144 641 641 HOH HOH A . 
K 6 HOH 145 642 642 HOH HOH A . 
K 6 HOH 146 643 643 HOH HOH A . 
K 6 HOH 147 644 644 HOH HOH A . 
K 6 HOH 148 645 645 HOH HOH A . 
K 6 HOH 149 646 646 HOH HOH A . 
K 6 HOH 150 647 647 HOH HOH A . 
K 6 HOH 151 648 648 HOH HOH A . 
K 6 HOH 152 649 649 HOH HOH A . 
K 6 HOH 153 650 650 HOH HOH A . 
K 6 HOH 154 651 651 HOH HOH A . 
K 6 HOH 155 652 652 HOH HOH A . 
K 6 HOH 156 653 653 HOH HOH A . 
K 6 HOH 157 654 654 HOH HOH A . 
K 6 HOH 158 655 655 HOH HOH A . 
K 6 HOH 159 656 656 HOH HOH A . 
K 6 HOH 160 657 657 HOH HOH A . 
K 6 HOH 161 658 658 HOH HOH A . 
K 6 HOH 162 659 659 HOH HOH A . 
K 6 HOH 163 660 660 HOH HOH A . 
K 6 HOH 164 661 661 HOH HOH A . 
K 6 HOH 165 662 662 HOH HOH A . 
K 6 HOH 166 663 663 HOH HOH A . 
K 6 HOH 167 664 664 HOH HOH A . 
K 6 HOH 168 665 665 HOH HOH A . 
K 6 HOH 169 666 666 HOH HOH A . 
K 6 HOH 170 667 667 HOH HOH A . 
K 6 HOH 171 668 668 HOH HOH A . 
K 6 HOH 172 669 669 HOH HOH A . 
K 6 HOH 173 670 670 HOH HOH A . 
K 6 HOH 174 671 671 HOH HOH A . 
K 6 HOH 175 672 672 HOH HOH A . 
K 6 HOH 176 673 673 HOH HOH A . 
K 6 HOH 177 674 674 HOH HOH A . 
K 6 HOH 178 675 675 HOH HOH A . 
K 6 HOH 179 676 676 HOH HOH A . 
K 6 HOH 180 677 677 HOH HOH A . 
K 6 HOH 181 678 678 HOH HOH A . 
K 6 HOH 182 679 679 HOH HOH A . 
K 6 HOH 183 680 680 HOH HOH A . 
K 6 HOH 184 681 681 HOH HOH A . 
K 6 HOH 185 682 682 HOH HOH A . 
K 6 HOH 186 683 683 HOH HOH A . 
K 6 HOH 187 684 684 HOH HOH A . 
K 6 HOH 188 685 685 HOH HOH A . 
K 6 HOH 189 686 686 HOH HOH A . 
K 6 HOH 190 687 687 HOH HOH A . 
K 6 HOH 191 688 688 HOH HOH A . 
K 6 HOH 192 689 689 HOH HOH A . 
K 6 HOH 193 690 690 HOH HOH A . 
K 6 HOH 194 691 691 HOH HOH A . 
K 6 HOH 195 692 692 HOH HOH A . 
K 6 HOH 196 693 693 HOH HOH A . 
K 6 HOH 197 694 694 HOH HOH A . 
K 6 HOH 198 695 695 HOH HOH A . 
K 6 HOH 199 696 696 HOH HOH A . 
K 6 HOH 200 697 697 HOH HOH A . 
K 6 HOH 201 698 698 HOH HOH A . 
K 6 HOH 202 699 699 HOH HOH A . 
K 6 HOH 203 700 700 HOH HOH A . 
K 6 HOH 204 701 701 HOH HOH A . 
K 6 HOH 205 702 702 HOH HOH A . 
K 6 HOH 206 703 703 HOH HOH A . 
K 6 HOH 207 704 704 HOH HOH A . 
K 6 HOH 208 705 705 HOH HOH A . 
K 6 HOH 209 706 706 HOH HOH A . 
K 6 HOH 210 707 707 HOH HOH A . 
K 6 HOH 211 708 708 HOH HOH A . 
K 6 HOH 212 709 709 HOH HOH A . 
K 6 HOH 213 710 710 HOH HOH A . 
K 6 HOH 214 711 711 HOH HOH A . 
K 6 HOH 215 712 712 HOH HOH A . 
K 6 HOH 216 713 713 HOH HOH A . 
K 6 HOH 217 714 714 HOH HOH A . 
K 6 HOH 218 715 715 HOH HOH A . 
K 6 HOH 219 716 716 HOH HOH A . 
K 6 HOH 220 717 717 HOH HOH A . 
K 6 HOH 221 718 718 HOH HOH A . 
K 6 HOH 222 720 720 HOH HOH A . 
K 6 HOH 223 721 721 HOH HOH A . 
K 6 HOH 224 722 722 HOH HOH A . 
K 6 HOH 225 723 723 HOH HOH A . 
K 6 HOH 226 724 724 HOH HOH A . 
K 6 HOH 227 725 725 HOH HOH A . 
K 6 HOH 228 726 726 HOH HOH A . 
K 6 HOH 229 727 727 HOH HOH A . 
K 6 HOH 230 728 728 HOH HOH A . 
K 6 HOH 231 729 729 HOH HOH A . 
K 6 HOH 232 730 730 HOH HOH A . 
K 6 HOH 233 731 731 HOH HOH A . 
K 6 HOH 234 732 732 HOH HOH A . 
K 6 HOH 235 733 733 HOH HOH A . 
K 6 HOH 236 734 734 HOH HOH A . 
K 6 HOH 237 735 735 HOH HOH A . 
K 6 HOH 238 736 736 HOH HOH A . 
K 6 HOH 239 737 737 HOH HOH A . 
K 6 HOH 240 738 738 HOH HOH A . 
K 6 HOH 241 739 739 HOH HOH A . 
K 6 HOH 242 740 740 HOH HOH A . 
K 6 HOH 243 741 741 HOH HOH A . 
K 6 HOH 244 742 742 HOH HOH A . 
K 6 HOH 245 743 743 HOH HOH A . 
K 6 HOH 246 744 744 HOH HOH A . 
K 6 HOH 247 745 745 HOH HOH A . 
K 6 HOH 248 746 746 HOH HOH A . 
K 6 HOH 249 747 747 HOH HOH A . 
K 6 HOH 250 748 748 HOH HOH A . 
K 6 HOH 251 749 749 HOH HOH A . 
K 6 HOH 252 750 750 HOH HOH A . 
K 6 HOH 253 751 751 HOH HOH A . 
K 6 HOH 254 752 752 HOH HOH A . 
K 6 HOH 255 753 753 HOH HOH A . 
K 6 HOH 256 754 754 HOH HOH A . 
K 6 HOH 257 755 755 HOH HOH A . 
K 6 HOH 258 756 756 HOH HOH A . 
K 6 HOH 259 757 757 HOH HOH A . 
K 6 HOH 260 758 758 HOH HOH A . 
K 6 HOH 261 759 759 HOH HOH A . 
L 6 HOH 1   489 2   HOH HOH B . 
L 6 HOH 2   490 4   HOH HOH B . 
L 6 HOH 3   491 5   HOH HOH B . 
L 6 HOH 4   492 6   HOH HOH B . 
L 6 HOH 5   493 8   HOH HOH B . 
L 6 HOH 6   494 9   HOH HOH B . 
L 6 HOH 7   495 10  HOH HOH B . 
L 6 HOH 8   496 13  HOH HOH B . 
L 6 HOH 9   497 14  HOH HOH B . 
L 6 HOH 10  498 16  HOH HOH B . 
L 6 HOH 11  499 21  HOH HOH B . 
L 6 HOH 12  500 22  HOH HOH B . 
L 6 HOH 13  501 23  HOH HOH B . 
L 6 HOH 14  502 26  HOH HOH B . 
L 6 HOH 15  503 27  HOH HOH B . 
L 6 HOH 16  504 28  HOH HOH B . 
L 6 HOH 17  505 30  HOH HOH B . 
L 6 HOH 18  506 34  HOH HOH B . 
L 6 HOH 19  507 35  HOH HOH B . 
L 6 HOH 20  508 39  HOH HOH B . 
L 6 HOH 21  509 41  HOH HOH B . 
L 6 HOH 22  510 43  HOH HOH B . 
L 6 HOH 23  516 516 HOH HOH B . 
L 6 HOH 24  517 517 HOH HOH B . 
L 6 HOH 25  518 518 HOH HOH B . 
L 6 HOH 26  519 519 HOH HOH B . 
L 6 HOH 27  520 520 HOH HOH B . 
L 6 HOH 28  521 521 HOH HOH B . 
L 6 HOH 29  522 522 HOH HOH B . 
L 6 HOH 30  523 523 HOH HOH B . 
L 6 HOH 31  524 524 HOH HOH B . 
L 6 HOH 32  525 525 HOH HOH B . 
L 6 HOH 33  526 526 HOH HOH B . 
L 6 HOH 34  527 527 HOH HOH B . 
L 6 HOH 35  528 528 HOH HOH B . 
L 6 HOH 36  529 529 HOH HOH B . 
L 6 HOH 37  530 530 HOH HOH B . 
L 6 HOH 38  531 531 HOH HOH B . 
L 6 HOH 39  532 532 HOH HOH B . 
L 6 HOH 40  533 533 HOH HOH B . 
L 6 HOH 41  534 534 HOH HOH B . 
L 6 HOH 42  535 535 HOH HOH B . 
L 6 HOH 43  536 536 HOH HOH B . 
L 6 HOH 44  537 537 HOH HOH B . 
L 6 HOH 45  538 538 HOH HOH B . 
L 6 HOH 46  539 539 HOH HOH B . 
L 6 HOH 47  540 540 HOH HOH B . 
L 6 HOH 48  541 541 HOH HOH B . 
L 6 HOH 49  542 542 HOH HOH B . 
L 6 HOH 50  543 543 HOH HOH B . 
L 6 HOH 51  544 544 HOH HOH B . 
L 6 HOH 52  545 545 HOH HOH B . 
L 6 HOH 53  546 546 HOH HOH B . 
L 6 HOH 54  547 547 HOH HOH B . 
L 6 HOH 55  548 548 HOH HOH B . 
L 6 HOH 56  549 549 HOH HOH B . 
L 6 HOH 57  550 550 HOH HOH B . 
L 6 HOH 58  551 551 HOH HOH B . 
L 6 HOH 59  552 552 HOH HOH B . 
L 6 HOH 60  553 553 HOH HOH B . 
L 6 HOH 61  554 554 HOH HOH B . 
L 6 HOH 62  555 555 HOH HOH B . 
L 6 HOH 63  556 556 HOH HOH B . 
L 6 HOH 64  557 557 HOH HOH B . 
L 6 HOH 65  558 558 HOH HOH B . 
L 6 HOH 66  559 559 HOH HOH B . 
L 6 HOH 67  560 560 HOH HOH B . 
L 6 HOH 68  561 561 HOH HOH B . 
L 6 HOH 69  562 562 HOH HOH B . 
L 6 HOH 70  563 563 HOH HOH B . 
L 6 HOH 71  564 564 HOH HOH B . 
L 6 HOH 72  565 565 HOH HOH B . 
L 6 HOH 73  566 566 HOH HOH B . 
L 6 HOH 74  567 567 HOH HOH B . 
L 6 HOH 75  568 568 HOH HOH B . 
L 6 HOH 76  569 569 HOH HOH B . 
L 6 HOH 77  570 570 HOH HOH B . 
L 6 HOH 78  571 571 HOH HOH B . 
L 6 HOH 79  572 572 HOH HOH B . 
L 6 HOH 80  573 573 HOH HOH B . 
L 6 HOH 81  574 574 HOH HOH B . 
L 6 HOH 82  575 575 HOH HOH B . 
L 6 HOH 83  576 576 HOH HOH B . 
L 6 HOH 84  577 577 HOH HOH B . 
L 6 HOH 85  578 578 HOH HOH B . 
L 6 HOH 86  579 579 HOH HOH B . 
L 6 HOH 87  580 580 HOH HOH B . 
L 6 HOH 88  581 581 HOH HOH B . 
L 6 HOH 89  582 582 HOH HOH B . 
L 6 HOH 90  583 583 HOH HOH B . 
L 6 HOH 91  584 584 HOH HOH B . 
L 6 HOH 92  585 585 HOH HOH B . 
L 6 HOH 93  586 586 HOH HOH B . 
L 6 HOH 94  587 587 HOH HOH B . 
L 6 HOH 95  588 588 HOH HOH B . 
L 6 HOH 96  589 589 HOH HOH B . 
L 6 HOH 97  590 590 HOH HOH B . 
L 6 HOH 98  591 591 HOH HOH B . 
L 6 HOH 99  592 592 HOH HOH B . 
L 6 HOH 100 593 593 HOH HOH B . 
L 6 HOH 101 594 594 HOH HOH B . 
L 6 HOH 102 595 595 HOH HOH B . 
L 6 HOH 103 596 596 HOH HOH B . 
L 6 HOH 104 597 597 HOH HOH B . 
L 6 HOH 105 598 598 HOH HOH B . 
L 6 HOH 106 599 599 HOH HOH B . 
L 6 HOH 107 600 600 HOH HOH B . 
L 6 HOH 108 603 603 HOH HOH B . 
L 6 HOH 109 604 604 HOH HOH B . 
L 6 HOH 110 605 605 HOH HOH B . 
L 6 HOH 111 606 606 HOH HOH B . 
L 6 HOH 112 607 607 HOH HOH B . 
L 6 HOH 113 608 608 HOH HOH B . 
L 6 HOH 114 609 609 HOH HOH B . 
L 6 HOH 115 610 610 HOH HOH B . 
L 6 HOH 116 611 611 HOH HOH B . 
L 6 HOH 117 612 612 HOH HOH B . 
L 6 HOH 118 613 613 HOH HOH B . 
L 6 HOH 119 614 614 HOH HOH B . 
L 6 HOH 120 615 615 HOH HOH B . 
L 6 HOH 121 616 616 HOH HOH B . 
L 6 HOH 122 617 617 HOH HOH B . 
L 6 HOH 123 618 618 HOH HOH B . 
L 6 HOH 124 619 619 HOH HOH B . 
L 6 HOH 125 620 620 HOH HOH B . 
L 6 HOH 126 621 621 HOH HOH B . 
L 6 HOH 127 622 622 HOH HOH B . 
L 6 HOH 128 623 623 HOH HOH B . 
L 6 HOH 129 624 624 HOH HOH B . 
L 6 HOH 130 625 625 HOH HOH B . 
L 6 HOH 131 626 626 HOH HOH B . 
L 6 HOH 132 627 627 HOH HOH B . 
L 6 HOH 133 628 628 HOH HOH B . 
L 6 HOH 134 629 629 HOH HOH B . 
L 6 HOH 135 630 630 HOH HOH B . 
L 6 HOH 136 631 631 HOH HOH B . 
L 6 HOH 137 632 632 HOH HOH B . 
L 6 HOH 138 633 633 HOH HOH B . 
L 6 HOH 139 634 634 HOH HOH B . 
L 6 HOH 140 635 635 HOH HOH B . 
L 6 HOH 141 636 636 HOH HOH B . 
L 6 HOH 142 637 637 HOH HOH B . 
L 6 HOH 143 638 638 HOH HOH B . 
L 6 HOH 144 639 639 HOH HOH B . 
L 6 HOH 145 640 640 HOH HOH B . 
L 6 HOH 146 641 641 HOH HOH B . 
L 6 HOH 147 642 642 HOH HOH B . 
L 6 HOH 148 643 643 HOH HOH B . 
L 6 HOH 149 644 644 HOH HOH B . 
L 6 HOH 150 645 645 HOH HOH B . 
L 6 HOH 151 646 646 HOH HOH B . 
L 6 HOH 152 647 647 HOH HOH B . 
L 6 HOH 153 648 648 HOH HOH B . 
L 6 HOH 154 649 649 HOH HOH B . 
L 6 HOH 155 650 650 HOH HOH B . 
L 6 HOH 156 651 651 HOH HOH B . 
L 6 HOH 157 652 652 HOH HOH B . 
L 6 HOH 158 653 653 HOH HOH B . 
L 6 HOH 159 654 654 HOH HOH B . 
L 6 HOH 160 655 655 HOH HOH B . 
L 6 HOH 161 656 656 HOH HOH B . 
L 6 HOH 162 657 657 HOH HOH B . 
L 6 HOH 163 658 658 HOH HOH B . 
L 6 HOH 164 659 659 HOH HOH B . 
L 6 HOH 165 660 660 HOH HOH B . 
L 6 HOH 166 661 661 HOH HOH B . 
L 6 HOH 167 662 662 HOH HOH B . 
L 6 HOH 168 663 663 HOH HOH B . 
L 6 HOH 169 664 664 HOH HOH B . 
L 6 HOH 170 665 665 HOH HOH B . 
L 6 HOH 171 666 666 HOH HOH B . 
L 6 HOH 172 667 667 HOH HOH B . 
L 6 HOH 173 668 668 HOH HOH B . 
L 6 HOH 174 669 669 HOH HOH B . 
L 6 HOH 175 670 670 HOH HOH B . 
L 6 HOH 176 671 671 HOH HOH B . 
L 6 HOH 177 672 672 HOH HOH B . 
L 6 HOH 178 673 673 HOH HOH B . 
L 6 HOH 179 674 674 HOH HOH B . 
L 6 HOH 180 675 675 HOH HOH B . 
L 6 HOH 181 676 676 HOH HOH B . 
L 6 HOH 182 677 677 HOH HOH B . 
L 6 HOH 183 678 678 HOH HOH B . 
L 6 HOH 184 679 679 HOH HOH B . 
L 6 HOH 185 680 680 HOH HOH B . 
L 6 HOH 186 681 681 HOH HOH B . 
L 6 HOH 187 682 682 HOH HOH B . 
L 6 HOH 188 683 683 HOH HOH B . 
L 6 HOH 189 684 684 HOH HOH B . 
L 6 HOH 190 685 685 HOH HOH B . 
L 6 HOH 191 686 686 HOH HOH B . 
L 6 HOH 192 687 687 HOH HOH B . 
L 6 HOH 193 688 688 HOH HOH B . 
L 6 HOH 194 689 689 HOH HOH B . 
L 6 HOH 195 690 690 HOH HOH B . 
L 6 HOH 196 691 691 HOH HOH B . 
L 6 HOH 197 692 692 HOH HOH B . 
L 6 HOH 198 693 693 HOH HOH B . 
L 6 HOH 199 694 694 HOH HOH B . 
L 6 HOH 200 695 695 HOH HOH B . 
L 6 HOH 201 696 696 HOH HOH B . 
L 6 HOH 202 697 697 HOH HOH B . 
L 6 HOH 203 698 698 HOH HOH B . 
L 6 HOH 204 699 699 HOH HOH B . 
L 6 HOH 205 700 700 HOH HOH B . 
L 6 HOH 206 701 701 HOH HOH B . 
L 6 HOH 207 702 702 HOH HOH B . 
L 6 HOH 208 703 703 HOH HOH B . 
L 6 HOH 209 704 704 HOH HOH B . 
L 6 HOH 210 705 705 HOH HOH B . 
L 6 HOH 211 706 706 HOH HOH B . 
L 6 HOH 212 707 707 HOH HOH B . 
L 6 HOH 213 708 708 HOH HOH B . 
L 6 HOH 214 709 709 HOH HOH B . 
L 6 HOH 215 710 710 HOH HOH B . 
L 6 HOH 216 711 711 HOH HOH B . 
L 6 HOH 217 712 712 HOH HOH B . 
L 6 HOH 218 713 713 HOH HOH B . 
L 6 HOH 219 714 714 HOH HOH B . 
L 6 HOH 220 715 715 HOH HOH B . 
L 6 HOH 221 716 716 HOH HOH B . 
L 6 HOH 222 717 717 HOH HOH B . 
L 6 HOH 223 718 718 HOH HOH B . 
L 6 HOH 224 719 719 HOH HOH B . 
L 6 HOH 225 720 720 HOH HOH B . 
L 6 HOH 226 721 721 HOH HOH B . 
L 6 HOH 227 722 722 HOH HOH B . 
L 6 HOH 228 723 723 HOH HOH B . 
L 6 HOH 229 724 724 HOH HOH B . 
L 6 HOH 230 725 725 HOH HOH B . 
L 6 HOH 231 726 726 HOH HOH B . 
L 6 HOH 232 727 727 HOH HOH B . 
L 6 HOH 233 728 728 HOH HOH B . 
L 6 HOH 234 729 729 HOH HOH B . 
L 6 HOH 235 730 730 HOH HOH B . 
L 6 HOH 236 731 731 HOH HOH B . 
L 6 HOH 237 732 732 HOH HOH B . 
L 6 HOH 238 733 733 HOH HOH B . 
L 6 HOH 239 734 734 HOH HOH B . 
L 6 HOH 240 735 735 HOH HOH B . 
L 6 HOH 241 736 736 HOH HOH B . 
L 6 HOH 242 737 737 HOH HOH B . 
L 6 HOH 243 738 738 HOH HOH B . 
L 6 HOH 244 739 739 HOH HOH B . 
L 6 HOH 245 740 740 HOH HOH B . 
L 6 HOH 246 741 741 HOH HOH B . 
L 6 HOH 247 742 742 HOH HOH B . 
L 6 HOH 248 743 743 HOH HOH B . 
L 6 HOH 249 744 744 HOH HOH B . 
L 6 HOH 250 745 745 HOH HOH B . 
L 6 HOH 251 746 746 HOH HOH B . 
L 6 HOH 252 747 747 HOH HOH B . 
L 6 HOH 253 748 748 HOH HOH B . 
L 6 HOH 254 749 749 HOH HOH B . 
L 6 HOH 255 750 750 HOH HOH B . 
L 6 HOH 256 751 751 HOH HOH B . 
L 6 HOH 257 752 752 HOH HOH B . 
L 6 HOH 258 753 753 HOH HOH B . 
L 6 HOH 259 754 754 HOH HOH B . 
L 6 HOH 260 755 755 HOH HOH B . 
L 6 HOH 261 756 756 HOH HOH B . 
M 6 HOH 1   353 353 HOH HOH C . 
M 6 HOH 2   481 481 HOH HOH C . 
M 6 HOH 3   491 491 HOH HOH C . 
M 6 HOH 4   514 514 HOH HOH C . 
M 6 HOH 5   529 529 HOH HOH C . 
N 6 HOH 1   216 216 HOH HOH D . 
N 6 HOH 2   283 283 HOH HOH D . 
N 6 HOH 3   358 358 HOH HOH D . 
N 6 HOH 4   494 494 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,I,K,M 
2 1 B,D,G,H,J,L,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? C CYS 45 ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .   ? C FES 150 ? 1_555 110.5 ? 
2  SG ? C CYS 45 ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .   ? C FES 150 ? 1_555 112.7 ? 
3  S1 ? I FES .  ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .   ? C FES 150 ? 1_555 91.2  ? 
4  SG ? C CYS 45 ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51  ? C CYS 52  ? 1_555 112.1 ? 
5  S1 ? I FES .  ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51  ? C CYS 52  ? 1_555 108.3 ? 
6  S2 ? I FES .  ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51  ? C CYS 52  ? 1_555 119.8 ? 
7  SG ? D CYS 54 ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S1 ? J FES .   ? D FES 151 ? 1_555 120.7 ? 
8  SG ? D CYS 54 ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .   ? D FES 151 ? 1_555 112.7 ? 
9  S1 ? J FES .  ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .   ? D FES 151 ? 1_555 89.9  ? 
10 SG ? D CYS 45 ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S1 ? J FES .   ? D FES 151 ? 1_555 122.4 ? 
11 SG ? D CYS 45 ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .   ? D FES 151 ? 1_555 115.7 ? 
12 S1 ? J FES .  ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .   ? D FES 151 ? 1_555 89.9  ? 
13 O  ? K HOH .  ? A HOH 759 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NA ? E HEM .   ? A HEM 601 ? 1_555 99.3  ? 
14 O  ? K HOH .  ? A HOH 759 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .   ? A HEM 601 ? 1_555 81.6  ? 
15 NA ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .   ? A HEM 601 ? 1_555 91.8  ? 
16 O  ? K HOH .  ? A HOH 759 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .   ? A HEM 601 ? 1_555 76.9  ? 
17 NA ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .   ? A HEM 601 ? 1_555 176.2 ? 
18 NB ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .   ? A HEM 601 ? 1_555 87.8  ? 
19 O  ? K HOH .  ? A HOH 759 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .   ? A HEM 601 ? 1_555 95.2  ? 
20 NA ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .   ? A HEM 601 ? 1_555 88.9  ? 
21 NB ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .   ? A HEM 601 ? 1_555 176.8 ? 
22 NC ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .   ? A HEM 601 ? 1_555 91.3  ? 
23 O  ? K HOH .  ? A HOH 759 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 SG ? A CYS 422 ? A CYS 423 ? 1_555 159.5 ? 
24 NA ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 SG ? A CYS 422 ? A CYS 423 ? 1_555 96.2  ? 
25 NB ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 SG ? A CYS 422 ? A CYS 423 ? 1_555 84.6  ? 
26 NC ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 SG ? A CYS 422 ? A CYS 423 ? 1_555 87.6  ? 
27 ND ? E HEM .  ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 SG ? A CYS 422 ? A CYS 423 ? 1_555 98.4  ? 
28 O  ? L HOH .  ? B HOH 755 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NA ? G HEM .   ? B HEM 601 ? 1_555 99.3  ? 
29 O  ? L HOH .  ? B HOH 755 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .   ? B HEM 601 ? 1_555 83.5  ? 
30 NA ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .   ? B HEM 601 ? 1_555 91.2  ? 
31 O  ? L HOH .  ? B HOH 755 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .   ? B HEM 601 ? 1_555 77.2  ? 
32 NA ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .   ? B HEM 601 ? 1_555 176.5 ? 
33 NB ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .   ? B HEM 601 ? 1_555 88.5  ? 
34 O  ? L HOH .  ? B HOH 755 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .   ? B HEM 601 ? 1_555 93.2  ? 
35 NA ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .   ? B HEM 601 ? 1_555 88.8  ? 
36 NB ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .   ? B HEM 601 ? 1_555 176.6 ? 
37 NC ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .   ? B HEM 601 ? 1_555 91.3  ? 
38 O  ? L HOH .  ? B HOH 755 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 SG ? B CYS 422 ? B CYS 423 ? 1_555 162.5 ? 
39 NA ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 SG ? B CYS 422 ? B CYS 423 ? 1_555 94.9  ? 
40 NB ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 SG ? B CYS 422 ? B CYS 423 ? 1_555 85.9  ? 
41 NC ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 SG ? B CYS 422 ? B CYS 423 ? 1_555 88.6  ? 
42 ND ? G HEM .  ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 SG ? B CYS 422 ? B CYS 423 ? 1_555 97.5  ? 
43 SG ? C CYS 54 ? C CYS 55  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .   ? C FES 150 ? 1_555 105.9 ? 
44 SG ? C CYS 54 ? C CYS 55  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .   ? C FES 150 ? 1_555 100.5 ? 
45 S1 ? I FES .  ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .   ? C FES 150 ? 1_555 91.2  ? 
46 SG ? C CYS 54 ? C CYS 55  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 91  ? C CYS 92  ? 1_555 123.1 ? 
47 S1 ? I FES .  ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 91  ? C CYS 92  ? 1_555 111.9 ? 
48 S2 ? I FES .  ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 91  ? C CYS 92  ? 1_555 119.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.5.0102 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.100    'May. 21, 2010' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              460 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              460 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              460 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                100.98 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -14.32 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 105 ? ? 37.21   -137.09 
2  1 ASP A 269 ? ? -164.37 82.05   
3  1 LYS A 373 ? ? 80.57   1.66    
4  1 ASN A 459 ? ? -118.98 55.11   
5  1 LEU A 460 ? ? 71.01   -58.77  
6  1 ILE B 63  ? ? -131.76 -31.47  
7  1 SER B 105 ? ? 39.52   -136.62 
8  1 SER B 254 ? ? -72.04  27.39   
9  1 ASP B 269 ? ? -155.58 74.92   
10 1 LYS B 373 ? ? 76.78   -4.23   
11 1 GLN B 422 ? ? -59.74  170.70  
12 1 LEU B 451 ? ? -73.39  -90.56  
13 1 SER B 452 ? ? 52.62   89.80   
14 1 LEU B 460 ? ? 66.89   -54.70  
15 1 GLU C 47  ? ? 70.38   50.15   
16 1 CYS C 52  ? ? -169.09 -164.02 
17 1 SER C 53  ? ? -148.59 37.42   
18 1 LEU C 80  ? ? -93.32  42.91   
19 1 GLU D 47  ? ? 70.39   61.63   
20 1 LEU D 50  ? ? 72.75   43.19   
21 1 CYS D 52  ? ? -164.65 -168.01 
22 1 SER D 53  ? ? -143.13 34.02   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A SER 2   ? A SER 1   
2   1 Y 1 A THR 3   ? A THR 2   
3   1 Y 1 A ARG 4   ? A ARG 3   
4   1 Y 1 A GLN 477 ? A GLN 476 
5   1 Y 1 A GLU 478 ? A GLU 477 
6   1 Y 1 A ALA 479 ? A ALA 478 
7   1 Y 1 A THR 480 ? A THR 479 
8   1 Y 1 A GLN 481 ? A GLN 480 
9   1 Y 1 A GLN 482 ? A GLN 481 
10  1 Y 1 A HIS 483 ? A HIS 482 
11  1 Y 1 A HIS 484 ? A HIS 483 
12  1 Y 1 A HIS 485 ? A HIS 484 
13  1 Y 1 A HIS 486 ? A HIS 485 
14  1 Y 1 A HIS 487 ? A HIS 486 
15  1 Y 1 A HIS 488 ? A HIS 487 
16  1 Y 1 B SER 2   ? B SER 1   
17  1 Y 1 B THR 3   ? B THR 2   
18  1 Y 1 B ARG 4   ? B ARG 3   
19  1 Y 1 B SER 5   ? B SER 4   
20  1 Y 1 B GLN 477 ? B GLN 476 
21  1 Y 1 B GLU 478 ? B GLU 477 
22  1 Y 1 B ALA 479 ? B ALA 478 
23  1 Y 1 B THR 480 ? B THR 479 
24  1 Y 1 B GLN 481 ? B GLN 480 
25  1 Y 1 B GLN 482 ? B GLN 481 
26  1 Y 1 B HIS 483 ? B HIS 482 
27  1 Y 1 B HIS 484 ? B HIS 483 
28  1 Y 1 B HIS 485 ? B HIS 484 
29  1 Y 1 B HIS 486 ? B HIS 485 
30  1 Y 1 B HIS 487 ? B HIS 486 
31  1 Y 1 B HIS 488 ? B HIS 487 
32  1 Y 1 C SER 2   ? C SER 1   
33  1 Y 1 C SER 3   ? C SER 2   
34  1 Y 1 C GLU 4   ? C GLU 3   
35  1 Y 1 C ASP 5   ? C ASP 4   
36  1 Y 1 C LYS 6   ? C LYS 5   
37  1 Y 1 C ILE 7   ? C ILE 6   
38  1 Y 1 C THR 8   ? C THR 7   
39  1 Y 1 C VAL 9   ? C VAL 8   
40  1 Y 1 C HIS 10  ? C HIS 9   
41  1 Y 1 C PHE 11  ? C PHE 10  
42  1 Y 1 C ILE 12  ? C ILE 11  
43  1 Y 1 C ASN 13  ? C ASN 12  
44  1 Y 1 C ARG 14  ? C ARG 13  
45  1 Y 1 C ASP 15  ? C ASP 14  
46  1 Y 1 C GLY 16  ? C GLY 15  
47  1 Y 1 C GLU 17  ? C GLU 16  
48  1 Y 1 C THR 18  ? C THR 17  
49  1 Y 1 C LEU 19  ? C LEU 18  
50  1 Y 1 C THR 20  ? C THR 19  
51  1 Y 1 C THR 21  ? C THR 20  
52  1 Y 1 C LYS 22  ? C LYS 21  
53  1 Y 1 C GLY 23  ? C GLY 22  
54  1 Y 1 C LYS 24  ? C LYS 23  
55  1 Y 1 C VAL 25  ? C VAL 24  
56  1 Y 1 C GLY 26  ? C GLY 25  
57  1 Y 1 C ASP 27  ? C ASP 26  
58  1 Y 1 C SER 28  ? C SER 27  
59  1 Y 1 C LEU 29  ? C LEU 28  
60  1 Y 1 C LEU 30  ? C LEU 29  
61  1 Y 1 C ASP 31  ? C ASP 30  
62  1 Y 1 C VAL 32  ? C VAL 31  
63  1 Y 1 C VAL 33  ? C VAL 32  
64  1 Y 1 C VAL 34  ? C VAL 33  
65  1 Y 1 C GLU 35  ? C GLU 34  
66  1 Y 1 C ASN 36  ? C ASN 35  
67  1 Y 1 C ASN 37  ? C ASN 36  
68  1 Y 1 C LEU 38  ? C LEU 37  
69  1 Y 1 C ASP 39  ? C ASP 38  
70  1 Y 1 C ILE 40  ? C ILE 39  
71  1 Y 1 C ASP 41  ? C ASP 40  
72  1 Y 1 C GLY 42  ? C GLY 41  
73  1 Y 1 C PHE 43  ? C PHE 42  
74  1 Y 1 C HIS 56  ? C HIS 55  
75  1 Y 1 C LEU 57  ? C LEU 56  
76  1 Y 1 C ILE 58  ? C ILE 57  
77  1 Y 1 C PHE 59  ? C PHE 58  
78  1 Y 1 C GLU 60  ? C GLU 59  
79  1 Y 1 C ASP 61  ? C ASP 60  
80  1 Y 1 C HIS 62  ? C HIS 61  
81  1 Y 1 C ILE 63  ? C ILE 62  
82  1 Y 1 C TYR 64  ? C TYR 63  
83  1 Y 1 C GLU 65  ? C GLU 64  
84  1 Y 1 C LYS 66  ? C LYS 65  
85  1 Y 1 C LEU 67  ? C LEU 66  
86  1 Y 1 C ASP 68  ? C ASP 67  
87  1 Y 1 C ALA 69  ? C ALA 68  
88  1 Y 1 C ILE 70  ? C ILE 69  
89  1 Y 1 C THR 71  ? C THR 70  
90  1 Y 1 C TYR 82  ? C TYR 81  
91  1 Y 1 C GLY 83  ? C GLY 82  
92  1 Y 1 C LEU 84  ? C LEU 83  
93  1 Y 1 C THR 85  ? C THR 84  
94  1 Y 1 C ASP 86  ? C ASP 85  
95  1 Y 1 C ARG 87  ? C ARG 86  
96  1 Y 1 C SER 88  ? C SER 87  
97  1 Y 1 C ARG 89  ? C ARG 88  
98  1 Y 1 C ILE 94  ? C ILE 93  
99  1 Y 1 C CYS 95  ? C CYS 94  
100 1 Y 1 C LEU 96  ? C LEU 95  
101 1 Y 1 C THR 97  ? C THR 96  
102 1 Y 1 C LYS 98  ? C LYS 97  
103 1 Y 1 C SER 99  ? C SER 98  
104 1 Y 1 C MET 100 ? C MET 99  
105 1 Y 1 C ASP 101 ? C ASP 100 
106 1 Y 1 C ASN 102 ? C ASN 101 
107 1 Y 1 C MET 103 ? C MET 102 
108 1 Y 1 C THR 104 ? C THR 103 
109 1 Y 1 C VAL 105 ? C VAL 104 
110 1 Y 1 C ARG 106 ? C ARG 105 
111 1 Y 1 C VAL 107 ? C VAL 106 
112 1 Y 1 C PRO 108 ? C PRO 107 
113 1 Y 1 C GLU 109 ? C GLU 108 
114 1 Y 1 C THR 110 ? C THR 109 
115 1 Y 1 C VAL 111 ? C VAL 110 
116 1 Y 1 C ALA 112 ? C ALA 111 
117 1 Y 1 C ASP 113 ? C ASP 112 
118 1 Y 1 C ALA 114 ? C ALA 113 
119 1 Y 1 C ARG 115 ? C ARG 114 
120 1 Y 1 C GLN 116 ? C GLN 115 
121 1 Y 1 C SER 117 ? C SER 116 
122 1 Y 1 C ILE 118 ? C ILE 117 
123 1 Y 1 C ASP 119 ? C ASP 118 
124 1 Y 1 C VAL 120 ? C VAL 119 
125 1 Y 1 C GLY 121 ? C GLY 120 
126 1 Y 1 C LYS 122 ? C LYS 121 
127 1 Y 1 C THR 123 ? C THR 122 
128 1 Y 1 C SER 124 ? C SER 123 
129 1 Y 1 D SER 2   ? D SER 1   
130 1 Y 1 D SER 3   ? D SER 2   
131 1 Y 1 D GLU 4   ? D GLU 3   
132 1 Y 1 D ASP 5   ? D ASP 4   
133 1 Y 1 D LYS 6   ? D LYS 5   
134 1 Y 1 D ILE 7   ? D ILE 6   
135 1 Y 1 D THR 8   ? D THR 7   
136 1 Y 1 D VAL 9   ? D VAL 8   
137 1 Y 1 D HIS 10  ? D HIS 9   
138 1 Y 1 D PHE 11  ? D PHE 10  
139 1 Y 1 D ILE 12  ? D ILE 11  
140 1 Y 1 D ASN 13  ? D ASN 12  
141 1 Y 1 D ARG 14  ? D ARG 13  
142 1 Y 1 D ASP 15  ? D ASP 14  
143 1 Y 1 D GLY 16  ? D GLY 15  
144 1 Y 1 D GLU 17  ? D GLU 16  
145 1 Y 1 D THR 18  ? D THR 17  
146 1 Y 1 D LEU 19  ? D LEU 18  
147 1 Y 1 D THR 20  ? D THR 19  
148 1 Y 1 D THR 21  ? D THR 20  
149 1 Y 1 D LYS 22  ? D LYS 21  
150 1 Y 1 D GLY 23  ? D GLY 22  
151 1 Y 1 D LYS 24  ? D LYS 23  
152 1 Y 1 D VAL 25  ? D VAL 24  
153 1 Y 1 D GLY 26  ? D GLY 25  
154 1 Y 1 D ASP 27  ? D ASP 26  
155 1 Y 1 D SER 28  ? D SER 27  
156 1 Y 1 D LEU 29  ? D LEU 28  
157 1 Y 1 D LEU 30  ? D LEU 29  
158 1 Y 1 D ASP 31  ? D ASP 30  
159 1 Y 1 D VAL 32  ? D VAL 31  
160 1 Y 1 D VAL 33  ? D VAL 32  
161 1 Y 1 D VAL 34  ? D VAL 33  
162 1 Y 1 D GLU 35  ? D GLU 34  
163 1 Y 1 D ASN 36  ? D ASN 35  
164 1 Y 1 D ASN 37  ? D ASN 36  
165 1 Y 1 D LEU 38  ? D LEU 37  
166 1 Y 1 D ASP 39  ? D ASP 38  
167 1 Y 1 D ILE 40  ? D ILE 39  
168 1 Y 1 D ASP 41  ? D ASP 40  
169 1 Y 1 D GLY 42  ? D GLY 41  
170 1 Y 1 D PHE 43  ? D PHE 42  
171 1 Y 1 D GLY 44  ? D GLY 43  
172 1 Y 1 D HIS 56  ? D HIS 55  
173 1 Y 1 D LEU 57  ? D LEU 56  
174 1 Y 1 D ILE 58  ? D ILE 57  
175 1 Y 1 D PHE 59  ? D PHE 58  
176 1 Y 1 D GLU 60  ? D GLU 59  
177 1 Y 1 D ASP 61  ? D ASP 60  
178 1 Y 1 D HIS 62  ? D HIS 61  
179 1 Y 1 D ILE 63  ? D ILE 62  
180 1 Y 1 D TYR 64  ? D TYR 63  
181 1 Y 1 D GLU 65  ? D GLU 64  
182 1 Y 1 D LYS 66  ? D LYS 65  
183 1 Y 1 D LEU 67  ? D LEU 66  
184 1 Y 1 D ASP 68  ? D ASP 67  
185 1 Y 1 D ALA 69  ? D ALA 68  
186 1 Y 1 D ILE 70  ? D ILE 69  
187 1 Y 1 D THR 71  ? D THR 70  
188 1 Y 1 D ASP 72  ? D ASP 71  
189 1 Y 1 D TYR 82  ? D TYR 81  
190 1 Y 1 D GLY 83  ? D GLY 82  
191 1 Y 1 D LEU 84  ? D LEU 83  
192 1 Y 1 D THR 85  ? D THR 84  
193 1 Y 1 D ASP 86  ? D ASP 85  
194 1 Y 1 D ARG 87  ? D ARG 86  
195 1 Y 1 D SER 88  ? D SER 87  
196 1 Y 1 D ARG 89  ? D ARG 88  
197 1 Y 1 D ILE 94  ? D ILE 93  
198 1 Y 1 D CYS 95  ? D CYS 94  
199 1 Y 1 D LEU 96  ? D LEU 95  
200 1 Y 1 D THR 97  ? D THR 96  
201 1 Y 1 D LYS 98  ? D LYS 97  
202 1 Y 1 D SER 99  ? D SER 98  
203 1 Y 1 D MET 100 ? D MET 99  
204 1 Y 1 D ASP 101 ? D ASP 100 
205 1 Y 1 D ASN 102 ? D ASN 101 
206 1 Y 1 D MET 103 ? D MET 102 
207 1 Y 1 D THR 104 ? D THR 103 
208 1 Y 1 D VAL 105 ? D VAL 104 
209 1 Y 1 D ARG 106 ? D ARG 105 
210 1 Y 1 D VAL 107 ? D VAL 106 
211 1 Y 1 D PRO 108 ? D PRO 107 
212 1 Y 1 D GLU 109 ? D GLU 108 
213 1 Y 1 D THR 110 ? D THR 109 
214 1 Y 1 D VAL 111 ? D VAL 110 
215 1 Y 1 D ALA 112 ? D ALA 111 
216 1 Y 1 D ASP 113 ? D ASP 112 
217 1 Y 1 D ALA 114 ? D ALA 113 
218 1 Y 1 D ARG 115 ? D ARG 114 
219 1 Y 1 D GLN 116 ? D GLN 115 
220 1 Y 1 D SER 117 ? D SER 116 
221 1 Y 1 D ILE 118 ? D ILE 117 
222 1 Y 1 D ASP 119 ? D ASP 118 
223 1 Y 1 D VAL 120 ? D VAL 119 
224 1 Y 1 D GLY 121 ? D GLY 120 
225 1 Y 1 D LYS 122 ? D LYS 121 
226 1 Y 1 D THR 123 ? D THR 122 
227 1 Y 1 D SER 124 ? D SER 123 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE'         HEM 
4 '(3alpha,8alpha)-cholest-5-ene-3,20-diol' HCD 
5 'FE2/S2 (INORGANIC) CLUSTER'              FES 
6 water                                     HOH 
#