data_3NAU
# 
_entry.id   3NAU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NAU         
RCSB  RCSB059597   
WWPDB D_1000059597 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3NAR 
_pdbx_database_related.details        'Crystal structure of ZHX1 HD4 (zinc-fingers and homeoboxes protein 1, homeodomain 4)' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3NAU 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ren, J.'                                   1 
'Bird, L.E.'                                2 
'Owens, R.J.'                               3 
'Stammers, D.K.'                            4 
'Oxford Protein Production Facility (OPPF)' 5 
# 
_citation.id                        primary 
_citation.title                     
'Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains' 
_citation.journal_abbrev            'Bmc Struct.Biol.' 
_citation.journal_volume            10 
_citation.page_first                13 
_citation.page_last                 13 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1472-6807 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20509910 
_citation.pdbx_database_id_DOI      10.1186/1472-6807-10-13 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bird, L.E.'       1 
primary 'Ren, J.'          2 
primary 'Nettleship, J.E.' 3 
primary 'Folkers, G.E.'    4 
primary 'Owens, R.J.'      5 
primary 'Stammers, D.K.'   6 
# 
_cell.entry_id           3NAU 
_cell.length_a           96.710 
_cell.length_b           60.670 
_cell.length_c           27.710 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.34 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NAU 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Zinc fingers and homeoboxes protein 2' 7975.167 2  ? ? 'HD2 domain, Homeobox 2, residues 444-501' ? 
2 non-polymer syn 'SULFATE ION'                           96.063   1  ? ? ?                                          ? 
3 water       nat water                                   18.015   24 ? ? ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'ZHX2, Zinc finger and homeodomain protein 2, Alpha-fetoprotein regulator 1, AFP regulator 1, Regulator of AFP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MAHHHHHHRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI 
_entity_poly.pdbx_seq_one_letter_code_can   MAHHHHHHRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  ARG n 
1 10 LYS n 
1 11 LYS n 
1 12 THR n 
1 13 LYS n 
1 14 GLU n 
1 15 GLN n 
1 16 ILE n 
1 17 ALA n 
1 18 HIS n 
1 19 LEU n 
1 20 LYS n 
1 21 ALA n 
1 22 SER n 
1 23 PHE n 
1 24 LEU n 
1 25 GLN n 
1 26 SER n 
1 27 GLN n 
1 28 PHE n 
1 29 PRO n 
1 30 ASP n 
1 31 ASP n 
1 32 ALA n 
1 33 GLU n 
1 34 VAL n 
1 35 TYR n 
1 36 ARG n 
1 37 LEU n 
1 38 ILE n 
1 39 GLU n 
1 40 VAL n 
1 41 THR n 
1 42 GLY n 
1 43 LEU n 
1 44 ALA n 
1 45 ARG n 
1 46 SER n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 LYS n 
1 51 TRP n 
1 52 PHE n 
1 53 SER n 
1 54 ASP n 
1 55 HIS n 
1 56 ARG n 
1 57 TYR n 
1 58 ARG n 
1 59 CYS n 
1 60 GLN n 
1 61 ARG n 
1 62 GLY n 
1 63 ILE n 
1 64 VAL n 
1 65 HIS n 
1 66 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 zhx2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'B834(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       OPPF2273 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ZHX2_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y6X8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI 
_struct_ref.pdbx_align_begin           444 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NAU A 9 ? 66 ? Q9Y6X8 444 ? 501 ? 444 501 
2 1 3NAU B 9 ? 66 ? Q9Y6X8 444 ? 501 ? 444 501 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NAU MET A 1 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 436 1  
1 3NAU ALA A 2 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 437 2  
1 3NAU HIS A 3 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 438 3  
1 3NAU HIS A 4 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 439 4  
1 3NAU HIS A 5 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 440 5  
1 3NAU HIS A 6 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 441 6  
1 3NAU HIS A 7 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 442 7  
1 3NAU HIS A 8 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 443 8  
2 3NAU MET B 1 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 436 9  
2 3NAU ALA B 2 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 437 10 
2 3NAU HIS B 3 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 438 11 
2 3NAU HIS B 4 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 439 12 
2 3NAU HIS B 5 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 440 13 
2 3NAU HIS B 6 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 441 14 
2 3NAU HIS B 7 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 442 15 
2 3NAU HIS B 8 ? UNP Q9Y6X8 ? ? 'EXPRESSION TAG' 443 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3NAU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    '20% PEG 6000, 0.2M LiCl, HEPES pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-11-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.976 
# 
_reflns.entry_id                     3NAU 
_reflns.observed_criterion_sigma_I   -1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   4459 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.111 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.451 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_redundancy        5.6 
_reflns_shell.percent_possible_obs   100 
_reflns_shell.number_unique_all      449 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3NAU 
_refine.ls_number_reflns_obs                     4214 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.38 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.20664 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20329 
_refine.ls_R_factor_R_free                       0.26684 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  240 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.892 
_refine.B_iso_mean                               35.638 
_refine.aniso_B[1][1]                            4.20 
_refine.aniso_B[2][2]                            -3.53 
_refine.aniso_B[3][3]                            -0.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.15 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2ecc' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.352 
_refine.overall_SU_ML                            0.163 
_refine.overall_SU_B                             15.766 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        938 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               967 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        28.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 963  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 694  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.902  1.933  ? 1292 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.784  3.002  ? 1666 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.841  5.000  ? 110  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       27.475 22.400 ? 50   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.407 15.000 ? 182  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.874 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.067  0.200  ? 136  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 1040 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 216  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.198  0.200  ? 225  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.156  0.200  ? 693  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.181  0.200  ? 462  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.084  0.200  ? 493  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.166  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.138  0.200  ? 15   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.249  0.200  ? 30   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.125  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.888  4.000  ? 736  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.674  4.000  ? 224  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.647  6.000  ? 896  'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.700  6.000  ? 476  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.397  10.000 ? 396  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 332 0.12 0.50  'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 484 0.88 5.00  'loose positional'  1 2 'X-RAY DIFFRACTION' ? ? ? 
1 A 332 2.77 20.00 'medium thermal'    1 3 'X-RAY DIFFRACTION' ? ? ? 
1 A 484 3.82 30.00 'loose thermal'     1 4 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             322 
_refine_ls_shell.R_factor_R_work                  0.257 
_refine_ls_shell.percent_reflns_obs               98.84 
_refine_ls_shell.R_factor_R_free                  0.309 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             19 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 446 A 501 1 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 446 B 501 1 5 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3NAU 
_struct.title                     'Crystal structure of ZHX2 HD2 (zinc-fingers and homeoboxes protein 2, homeodomain 2)' 
_struct.pdbx_descriptor           'Zinc fingers and homeoboxes protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NAU 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'ZHX2, corepressor, homeodomain, domain swapping, Structural Genomics, Oxford Protein Production Facility, OPPF, Transcription' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 12 ? GLN A 25 ? THR A 447 GLN A 460 1 ? 14 
HELX_P HELX_P2 2 SER A 26 ? PHE A 28 ? SER A 461 PHE A 463 5 ? 3  
HELX_P HELX_P3 3 ASP A 30 ? GLY A 42 ? ASP A 465 GLY A 477 1 ? 13 
HELX_P HELX_P4 4 ALA A 44 ? ILE A 66 ? ALA A 479 ILE A 501 1 ? 23 
HELX_P HELX_P5 5 THR B 12 ? GLN B 25 ? THR B 447 GLN B 460 1 ? 14 
HELX_P HELX_P6 6 SER B 26 ? PHE B 28 ? SER B 461 PHE B 463 5 ? 3  
HELX_P HELX_P7 7 ASP B 30 ? GLY B 42 ? ASP B 465 GLY B 477 1 ? 13 
HELX_P HELX_P8 8 ALA B 44 ? ILE B 66 ? ALA B 479 ILE B 501 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            59 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            59 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             494 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             494 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.055 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 TRP A 51 ? TRP A 486 . ? 1_555 ? 
2 AC1 4 HIS A 55 ? HIS A 490 . ? 1_555 ? 
3 AC1 4 ARG A 58 ? ARG A 493 . ? 1_555 ? 
4 AC1 4 ILE B 16 ? ILE B 451 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3NAU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3NAU 
_atom_sites.fract_transf_matrix[1][1]   0.010340 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000967 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016483 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.036245 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . LYS A 1 11 ? 10.224 10.295  16.539  1.00 51.66  ? 446 LYS A N   1 
ATOM   2   C CA  . LYS A 1 11 ? 11.521 10.060  15.833  1.00 47.22  ? 446 LYS A CA  1 
ATOM   3   C C   . LYS A 1 11 ? 11.619 10.890  14.562  1.00 46.14  ? 446 LYS A C   1 
ATOM   4   O O   . LYS A 1 11 ? 10.665 10.965  13.790  1.00 49.41  ? 446 LYS A O   1 
ATOM   5   C CB  . LYS A 1 11 ? 11.697 8.578   15.498  1.00 44.26  ? 446 LYS A CB  1 
ATOM   6   C CG  . LYS A 1 11 ? 12.060 7.736   16.696  1.00 45.27  ? 446 LYS A CG  1 
ATOM   7   C CD  . LYS A 1 11 ? 12.135 6.255   16.359  1.00 43.45  ? 446 LYS A CD  1 
ATOM   8   C CE  . LYS A 1 11 ? 12.320 5.434   17.628  1.00 45.62  ? 446 LYS A CE  1 
ATOM   9   N NZ  . LYS A 1 11 ? 11.801 4.055   17.488  1.00 48.23  ? 446 LYS A NZ  1 
ATOM   10  N N   . THR A 1 12 ? 12.779 11.505  14.352  1.00 44.19  ? 447 THR A N   1 
ATOM   11  C CA  . THR A 1 12 ? 13.002 12.367  13.195  1.00 42.78  ? 447 THR A CA  1 
ATOM   12  C C   . THR A 1 12 ? 13.214 11.511  11.953  1.00 41.66  ? 447 THR A C   1 
ATOM   13  O O   . THR A 1 12 ? 13.572 10.336  12.057  1.00 43.50  ? 447 THR A O   1 
ATOM   14  C CB  . THR A 1 12 ? 14.206 13.316  13.419  1.00 39.80  ? 447 THR A CB  1 
ATOM   15  O OG1 . THR A 1 12 ? 14.254 14.297  12.378  1.00 55.39  ? 447 THR A OG1 1 
ATOM   16  C CG2 . THR A 1 12 ? 15.511 12.553  13.442  1.00 38.20  ? 447 THR A CG2 1 
ATOM   17  N N   . LYS A 1 13 ? 12.975 12.095  10.781  1.00 42.55  ? 448 LYS A N   1 
ATOM   18  C CA  . LYS A 1 13 ? 13.184 11.388  9.516   1.00 44.00  ? 448 LYS A CA  1 
ATOM   19  C C   . LYS A 1 13 ? 14.619 10.882  9.398   1.00 39.30  ? 448 LYS A C   1 
ATOM   20  O O   . LYS A 1 13 ? 14.860 9.802   8.862   1.00 38.64  ? 448 LYS A O   1 
ATOM   21  C CB  . LYS A 1 13 ? 12.857 12.289  8.320   1.00 45.98  ? 448 LYS A CB  1 
ATOM   22  C CG  . LYS A 1 13 ? 11.379 12.647  8.186   1.00 56.75  ? 448 LYS A CG  1 
ATOM   23  C CD  . LYS A 1 13 ? 11.013 13.079  6.755   1.00 61.19  ? 448 LYS A CD  1 
ATOM   24  C CE  . LYS A 1 13 ? 10.767 11.869  5.837   1.00 65.27  ? 448 LYS A CE  1 
ATOM   25  N NZ  . LYS A 1 13 ? 10.525 12.238  4.406   1.00 59.83  ? 448 LYS A NZ  1 
ATOM   26  N N   . GLU A 1 14 ? 15.560 11.675  9.903   1.00 40.58  ? 449 GLU A N   1 
ATOM   27  C CA  . GLU A 1 14 ? 16.980 11.352  9.849   1.00 41.01  ? 449 GLU A CA  1 
ATOM   28  C C   . GLU A 1 14 ? 17.294 10.042  10.561  1.00 38.18  ? 449 GLU A C   1 
ATOM   29  O O   . GLU A 1 14 ? 17.830 9.113   9.953   1.00 32.59  ? 449 GLU A O   1 
ATOM   30  C CB  . GLU A 1 14 ? 17.790 12.498  10.465  1.00 45.85  ? 449 GLU A CB  1 
ATOM   31  C CG  . GLU A 1 14 ? 19.302 12.274  10.525  1.00 49.51  ? 449 GLU A CG  1 
ATOM   32  C CD  . GLU A 1 14 ? 20.052 13.479  11.078  1.00 51.25  ? 449 GLU A CD  1 
ATOM   33  O OE1 . GLU A 1 14 ? 21.155 13.298  11.639  1.00 52.17  ? 449 GLU A OE1 1 
ATOM   34  O OE2 . GLU A 1 14 ? 19.533 14.608  10.956  1.00 61.98  ? 449 GLU A OE2 1 
ATOM   35  N N   . GLN A 1 15 ? 16.961 9.965   11.847  1.00 40.74  ? 450 GLN A N   1 
ATOM   36  C CA  . GLN A 1 15 ? 17.238 8.753   12.620  1.00 39.38  ? 450 GLN A CA  1 
ATOM   37  C C   . GLN A 1 15 ? 16.466 7.538   12.095  1.00 41.56  ? 450 GLN A C   1 
ATOM   38  O O   . GLN A 1 15 ? 16.974 6.421   12.158  1.00 40.03  ? 450 GLN A O   1 
ATOM   39  C CB  . GLN A 1 15 ? 17.044 8.966   14.131  1.00 40.54  ? 450 GLN A CB  1 
ATOM   40  C CG  . GLN A 1 15 ? 15.667 9.436   14.611  1.00 46.48  ? 450 GLN A CG  1 
ATOM   41  C CD  . GLN A 1 15 ? 15.714 10.195  15.951  1.00 41.55  ? 450 GLN A CD  1 
ATOM   42  O OE1 . GLN A 1 15 ? 14.685 10.630  16.454  1.00 46.51  ? 450 GLN A OE1 1 
ATOM   43  N NE2 . GLN A 1 15 ? 16.905 10.355  16.519  1.00 33.43  ? 450 GLN A NE2 1 
ATOM   44  N N   . ILE A 1 16 ? 15.269 7.756   11.544  1.00 42.50  ? 451 ILE A N   1 
ATOM   45  C CA  . ILE A 1 16 ? 14.546 6.687   10.836  1.00 41.21  ? 451 ILE A CA  1 
ATOM   46  C C   . ILE A 1 16 ? 15.288 6.227   9.575   1.00 38.67  ? 451 ILE A C   1 
ATOM   47  O O   . ILE A 1 16 ? 15.292 5.039   9.262   1.00 44.86  ? 451 ILE A O   1 
ATOM   48  C CB  . ILE A 1 16 ? 13.095 7.093   10.474  1.00 41.21  ? 451 ILE A CB  1 
ATOM   49  C CG1 . ILE A 1 16 ? 12.243 7.160   11.740  1.00 41.06  ? 451 ILE A CG1 1 
ATOM   50  C CG2 . ILE A 1 16 ? 12.477 6.094   9.504   1.00 37.34  ? 451 ILE A CG2 1 
ATOM   51  C CD1 . ILE A 1 16 ? 10.768 7.333   11.471  1.00 47.81  ? 451 ILE A CD1 1 
ATOM   52  N N   . ALA A 1 17 ? 15.917 7.158   8.861   1.00 37.66  ? 452 ALA A N   1 
ATOM   53  C CA  . ALA A 1 17 ? 16.748 6.807   7.703   1.00 37.49  ? 452 ALA A CA  1 
ATOM   54  C C   . ALA A 1 17 ? 17.913 5.893   8.100   1.00 32.96  ? 452 ALA A C   1 
ATOM   55  O O   . ALA A 1 17 ? 18.217 4.933   7.402   1.00 35.90  ? 452 ALA A O   1 
ATOM   56  C CB  . ALA A 1 17 ? 17.269 8.069   7.004   1.00 35.23  ? 452 ALA A CB  1 
ATOM   57  N N   . HIS A 1 18 ? 18.545 6.185   9.231   1.00 35.11  ? 453 HIS A N   1 
ATOM   58  C CA  . HIS A 1 18 ? 19.657 5.370   9.730   1.00 33.97  ? 453 HIS A CA  1 
ATOM   59  C C   . HIS A 1 18 ? 19.237 3.961   10.117  1.00 32.93  ? 453 HIS A C   1 
ATOM   60  O O   . HIS A 1 18 ? 19.977 3.005   9.889   1.00 36.97  ? 453 HIS A O   1 
ATOM   61  C CB  . HIS A 1 18 ? 20.319 6.046   10.930  1.00 32.27  ? 453 HIS A CB  1 
ATOM   62  C CG  . HIS A 1 18 ? 21.121 7.248   10.563  1.00 31.50  ? 453 HIS A CG  1 
ATOM   63  N ND1 . HIS A 1 18 ? 22.180 7.187   9.687   1.00 29.16  ? 453 HIS A ND1 1 
ATOM   64  C CD2 . HIS A 1 18 ? 21.020 8.543   10.945  1.00 39.39  ? 453 HIS A CD2 1 
ATOM   65  C CE1 . HIS A 1 18 ? 22.700 8.392   9.547   1.00 38.37  ? 453 HIS A CE1 1 
ATOM   66  N NE2 . HIS A 1 18 ? 22.013 9.235   10.296  1.00 33.89  ? 453 HIS A NE2 1 
ATOM   67  N N   . LEU A 1 19 ? 18.055 3.837   10.711  1.00 34.87  ? 454 LEU A N   1 
ATOM   68  C CA  . LEU A 1 19 ? 17.549 2.536   11.137  1.00 33.76  ? 454 LEU A CA  1 
ATOM   69  C C   . LEU A 1 19 ? 17.246 1.647   9.918   1.00 30.76  ? 454 LEU A C   1 
ATOM   70  O O   . LEU A 1 19 ? 17.616 0.478   9.903   1.00 24.38  ? 454 LEU A O   1 
ATOM   71  C CB  . LEU A 1 19 ? 16.315 2.706   12.033  1.00 32.56  ? 454 LEU A CB  1 
ATOM   72  C CG  . LEU A 1 19 ? 16.565 3.481   13.340  1.00 32.94  ? 454 LEU A CG  1 
ATOM   73  C CD1 . LEU A 1 19 ? 15.269 3.997   13.940  1.00 25.32  ? 454 LEU A CD1 1 
ATOM   74  C CD2 . LEU A 1 19 ? 17.325 2.646   14.354  1.00 35.57  ? 454 LEU A CD2 1 
ATOM   75  N N   . LYS A 1 20 ? 16.612 2.213   8.891   1.00 30.73  ? 455 LYS A N   1 
ATOM   76  C CA  . LYS A 1 20 ? 16.264 1.452   7.688   1.00 34.25  ? 455 LYS A CA  1 
ATOM   77  C C   . LYS A 1 20 ? 17.514 0.992   6.960   1.00 34.05  ? 455 LYS A C   1 
ATOM   78  O O   . LYS A 1 20 ? 17.656 -0.192  6.644   1.00 28.41  ? 455 LYS A O   1 
ATOM   79  C CB  . LYS A 1 20 ? 15.396 2.274   6.734   1.00 36.32  ? 455 LYS A CB  1 
ATOM   80  C CG  . LYS A 1 20 ? 13.971 2.505   7.210   1.00 40.85  ? 455 LYS A CG  1 
ATOM   81  C CD  . LYS A 1 20 ? 13.119 3.110   6.091   1.00 46.07  ? 455 LYS A CD  1 
ATOM   82  C CE  . LYS A 1 20 ? 11.716 3.474   6.578   1.00 48.41  ? 455 LYS A CE  1 
ATOM   83  N NZ  . LYS A 1 20 ? 10.924 4.185   5.532   1.00 48.43  ? 455 LYS A NZ  1 
ATOM   84  N N   . ALA A 1 21 ? 18.415 1.938   6.699   1.00 36.06  ? 456 ALA A N   1 
ATOM   85  C CA  . ALA A 1 21 ? 19.717 1.640   6.105   1.00 29.71  ? 456 ALA A CA  1 
ATOM   86  C C   . ALA A 1 21 ? 20.326 0.413   6.771   1.00 27.01  ? 456 ALA A C   1 
ATOM   87  O O   . ALA A 1 21 ? 20.626 -0.569  6.101   1.00 29.46  ? 456 ALA A O   1 
ATOM   88  C CB  . ALA A 1 21 ? 20.648 2.833   6.251   1.00 30.62  ? 456 ALA A CB  1 
ATOM   89  N N   . SER A 1 22 ? 20.472 0.471   8.092   1.00 23.97  ? 457 SER A N   1 
ATOM   90  C CA  . SER A 1 22 ? 21.028 -0.641  8.879   1.00 27.22  ? 457 SER A CA  1 
ATOM   91  C C   . SER A 1 22 ? 20.211 -1.950  8.771   1.00 29.55  ? 457 SER A C   1 
ATOM   92  O O   . SER A 1 22 ? 20.773 -3.030  8.575   1.00 28.92  ? 457 SER A O   1 
ATOM   93  C CB  . SER A 1 22 ? 21.141 -0.227  10.351  1.00 22.60  ? 457 SER A CB  1 
ATOM   94  O OG  . SER A 1 22 ? 21.824 -1.209  11.098  1.00 21.09  ? 457 SER A OG  1 
ATOM   95  N N   . PHE A 1 23 ? 18.891 -1.833  8.905   1.00 28.77  ? 458 PHE A N   1 
ATOM   96  C CA  . PHE A 1 23 ? 17.974 -2.963  8.783   1.00 26.74  ? 458 PHE A CA  1 
ATOM   97  C C   . PHE A 1 23 ? 18.049 -3.645  7.415   1.00 27.80  ? 458 PHE A C   1 
ATOM   98  O O   . PHE A 1 23 ? 18.018 -4.868  7.334   1.00 33.51  ? 458 PHE A O   1 
ATOM   99  C CB  . PHE A 1 23 ? 16.546 -2.479  9.038   1.00 29.12  ? 458 PHE A CB  1 
ATOM   100 C CG  . PHE A 1 23 ? 15.514 -3.575  9.075   1.00 30.17  ? 458 PHE A CG  1 
ATOM   101 C CD1 . PHE A 1 23 ? 15.276 -4.285  10.243  1.00 30.64  ? 458 PHE A CD1 1 
ATOM   102 C CD2 . PHE A 1 23 ? 14.755 -3.870  7.951   1.00 27.35  ? 458 PHE A CD2 1 
ATOM   103 C CE1 . PHE A 1 23 ? 14.310 -5.287  10.284  1.00 35.60  ? 458 PHE A CE1 1 
ATOM   104 C CE2 . PHE A 1 23 ? 13.788 -4.856  7.987   1.00 29.85  ? 458 PHE A CE2 1 
ATOM   105 C CZ  . PHE A 1 23 ? 13.564 -5.571  9.155   1.00 30.93  ? 458 PHE A CZ  1 
ATOM   106 N N   . LEU A 1 24 ? 18.153 -2.854  6.350   1.00 26.45  ? 459 LEU A N   1 
ATOM   107 C CA  . LEU A 1 24 ? 18.110 -3.375  4.982   1.00 26.65  ? 459 LEU A CA  1 
ATOM   108 C C   . LEU A 1 24 ? 19.453 -3.868  4.415   1.00 27.50  ? 459 LEU A C   1 
ATOM   109 O O   . LEU A 1 24 ? 19.477 -4.474  3.341   1.00 26.53  ? 459 LEU A O   1 
ATOM   110 C CB  . LEU A 1 24 ? 17.521 -2.313  4.041   1.00 28.82  ? 459 LEU A CB  1 
ATOM   111 C CG  . LEU A 1 24 ? 16.050 -1.947  4.279   1.00 32.91  ? 459 LEU A CG  1 
ATOM   112 C CD1 . LEU A 1 24 ? 15.603 -0.857  3.318   1.00 18.42  ? 459 LEU A CD1 1 
ATOM   113 C CD2 . LEU A 1 24 ? 15.146 -3.171  4.164   1.00 28.25  ? 459 LEU A CD2 1 
ATOM   114 N N   . GLN A 1 25 ? 20.559 -3.621  5.119   1.00 28.29  ? 460 GLN A N   1 
ATOM   115 C CA  . GLN A 1 25 ? 21.899 -3.967  4.608   1.00 31.76  ? 460 GLN A CA  1 
ATOM   116 C C   . GLN A 1 25 ? 21.934 -5.309  3.880   1.00 32.59  ? 460 GLN A C   1 
ATOM   117 O O   . GLN A 1 25 ? 22.225 -5.369  2.675   1.00 35.61  ? 460 GLN A O   1 
ATOM   118 C CB  . GLN A 1 25 ? 22.934 -4.009  5.736   1.00 33.94  ? 460 GLN A CB  1 
ATOM   119 C CG  . GLN A 1 25 ? 23.308 -2.667  6.331   1.00 41.57  ? 460 GLN A CG  1 
ATOM   120 C CD  . GLN A 1 25 ? 24.342 -2.808  7.441   1.00 43.95  ? 460 GLN A CD  1 
ATOM   121 O OE1 . GLN A 1 25 ? 25.462 -3.267  7.202   1.00 53.34  ? 460 GLN A OE1 1 
ATOM   122 N NE2 . GLN A 1 25 ? 23.972 -2.411  8.659   1.00 36.96  ? 460 GLN A NE2 1 
ATOM   123 N N   . SER A 1 26 ? 21.619 -6.378  4.610   1.00 26.13  ? 461 SER A N   1 
ATOM   124 C CA  . SER A 1 26 ? 21.795 -7.734  4.100   1.00 28.86  ? 461 SER A CA  1 
ATOM   125 C C   . SER A 1 26 ? 20.731 -8.193  3.088   1.00 32.79  ? 461 SER A C   1 
ATOM   126 O O   . SER A 1 26 ? 20.753 -9.344  2.657   1.00 38.45  ? 461 SER A O   1 
ATOM   127 C CB  . SER A 1 26 ? 21.883 -8.725  5.264   1.00 28.68  ? 461 SER A CB  1 
ATOM   128 O OG  . SER A 1 26 ? 20.686 -8.765  6.012   1.00 30.08  ? 461 SER A OG  1 
ATOM   129 N N   . GLN A 1 27 ? 19.813 -7.305  2.709   1.00 36.13  ? 462 GLN A N   1 
ATOM   130 C CA  . GLN A 1 27 ? 18.861 -7.581  1.628   1.00 34.89  ? 462 GLN A CA  1 
ATOM   131 C C   . GLN A 1 27 ? 19.470 -7.215  0.270   1.00 37.67  ? 462 GLN A C   1 
ATOM   132 O O   . GLN A 1 27 ? 18.884 -7.497  -0.775  1.00 36.26  ? 462 GLN A O   1 
ATOM   133 C CB  . GLN A 1 27 ? 17.551 -6.810  1.840   1.00 35.13  ? 462 GLN A CB  1 
ATOM   134 C CG  . GLN A 1 27 ? 16.947 -7.008  3.225   1.00 39.18  ? 462 GLN A CG  1 
ATOM   135 C CD  . GLN A 1 27 ? 15.485 -6.593  3.337   1.00 37.96  ? 462 GLN A CD  1 
ATOM   136 O OE1 . GLN A 1 27 ? 14.840 -6.268  2.347   1.00 38.75  ? 462 GLN A OE1 1 
ATOM   137 N NE2 . GLN A 1 27 ? 14.954 -6.620  4.561   1.00 33.15  ? 462 GLN A NE2 1 
ATOM   138 N N   . PHE A 1 28 ? 20.643 -6.584  0.293   1.00 37.65  ? 463 PHE A N   1 
ATOM   139 C CA  . PHE A 1 28 ? 21.392 -6.278  -0.921  1.00 35.45  ? 463 PHE A CA  1 
ATOM   140 C C   . PHE A 1 28 ? 22.791 -6.878  -0.788  1.00 33.96  ? 463 PHE A C   1 
ATOM   141 O O   . PHE A 1 28 ? 23.756 -6.155  -0.565  1.00 39.72  ? 463 PHE A O   1 
ATOM   142 C CB  . PHE A 1 28 ? 21.458 -4.757  -1.144  1.00 33.12  ? 463 PHE A CB  1 
ATOM   143 C CG  . PHE A 1 28 ? 20.108 -4.098  -1.200  1.00 33.92  ? 463 PHE A CG  1 
ATOM   144 C CD1 . PHE A 1 28 ? 19.567 -3.492  -0.071  1.00 33.32  ? 463 PHE A CD1 1 
ATOM   145 C CD2 . PHE A 1 28 ? 19.367 -4.100  -2.375  1.00 35.14  ? 463 PHE A CD2 1 
ATOM   146 C CE1 . PHE A 1 28 ? 18.309 -2.898  -0.114  1.00 33.90  ? 463 PHE A CE1 1 
ATOM   147 C CE2 . PHE A 1 28 ? 18.114 -3.503  -2.428  1.00 34.27  ? 463 PHE A CE2 1 
ATOM   148 C CZ  . PHE A 1 28 ? 17.584 -2.907  -1.294  1.00 35.49  ? 463 PHE A CZ  1 
ATOM   149 N N   . PRO A 1 29 ? 22.903 -8.213  -0.900  1.00 33.44  ? 464 PRO A N   1 
ATOM   150 C CA  . PRO A 1 29 ? 24.213 -8.863  -0.793  1.00 35.99  ? 464 PRO A CA  1 
ATOM   151 C C   . PRO A 1 29 ? 25.208 -8.428  -1.863  1.00 36.18  ? 464 PRO A C   1 
ATOM   152 O O   . PRO A 1 29 ? 24.851 -8.374  -3.036  1.00 40.47  ? 464 PRO A O   1 
ATOM   153 C CB  . PRO A 1 29 ? 23.886 -10.357 -0.954  1.00 33.73  ? 464 PRO A CB  1 
ATOM   154 C CG  . PRO A 1 29 ? 22.553 -10.406 -1.572  1.00 30.90  ? 464 PRO A CG  1 
ATOM   155 C CD  . PRO A 1 29 ? 21.826 -9.198  -1.091  1.00 32.59  ? 464 PRO A CD  1 
ATOM   156 N N   . ASP A 1 30 ? 26.440 -8.113  -1.453  1.00 37.13  ? 465 ASP A N   1 
ATOM   157 C CA  . ASP A 1 30 ? 27.523 -7.868  -2.413  1.00 38.04  ? 465 ASP A CA  1 
ATOM   158 C C   . ASP A 1 30 ? 27.912 -9.188  -3.064  1.00 36.84  ? 465 ASP A C   1 
ATOM   159 O O   . ASP A 1 30 ? 27.515 -10.257 -2.587  1.00 32.13  ? 465 ASP A O   1 
ATOM   160 C CB  . ASP A 1 30 ? 28.732 -7.167  -1.772  1.00 40.20  ? 465 ASP A CB  1 
ATOM   161 C CG  . ASP A 1 30 ? 29.329 -7.932  -0.601  1.00 39.11  ? 465 ASP A CG  1 
ATOM   162 O OD1 . ASP A 1 30 ? 30.210 -7.351  0.069   1.00 35.28  ? 465 ASP A OD1 1 
ATOM   163 O OD2 . ASP A 1 30 ? 28.942 -9.094  -0.350  1.00 35.32  ? 465 ASP A OD2 1 
ATOM   164 N N   . ASP A 1 31 ? 28.664 -9.132  -4.160  1.00 37.92  ? 466 ASP A N   1 
ATOM   165 C CA  . ASP A 1 31 ? 28.854 -10.355 -4.948  1.00 41.14  ? 466 ASP A CA  1 
ATOM   166 C C   . ASP A 1 31 ? 29.799 -11.387 -4.305  1.00 41.69  ? 466 ASP A C   1 
ATOM   167 O O   . ASP A 1 31 ? 29.874 -12.518 -4.778  1.00 42.65  ? 466 ASP A O   1 
ATOM   168 C CB  . ASP A 1 31 ? 29.175 -10.079 -6.433  1.00 43.00  ? 466 ASP A CB  1 
ATOM   169 C CG  . ASP A 1 31 ? 30.197 -8.997  -6.637  1.00 46.19  ? 466 ASP A CG  1 
ATOM   170 O OD1 . ASP A 1 31 ? 30.959 -8.703  -5.694  1.00 56.40  ? 466 ASP A OD1 1 
ATOM   171 O OD2 . ASP A 1 31 ? 30.240 -8.446  -7.761  1.00 43.55  ? 466 ASP A OD2 1 
ATOM   172 N N   . ALA A 1 32 ? 30.478 -11.018 -3.215  1.00 39.92  ? 467 ALA A N   1 
ATOM   173 C CA  . ALA A 1 32 ? 31.174 -12.006 -2.378  1.00 37.92  ? 467 ALA A CA  1 
ATOM   174 C C   . ALA A 1 32 ? 30.155 -12.850 -1.624  1.00 37.64  ? 467 ALA A C   1 
ATOM   175 O O   . ALA A 1 32 ? 30.323 -14.064 -1.470  1.00 36.07  ? 467 ALA A O   1 
ATOM   176 C CB  . ALA A 1 32 ? 32.115 -11.329 -1.398  1.00 32.75  ? 467 ALA A CB  1 
ATOM   177 N N   . GLU A 1 33 ? 29.097 -12.195 -1.149  1.00 36.75  ? 468 GLU A N   1 
ATOM   178 C CA  . GLU A 1 33 ? 28.010 -12.879 -0.458  1.00 33.40  ? 468 GLU A CA  1 
ATOM   179 C C   . GLU A 1 33 ? 27.190 -13.735 -1.425  1.00 34.35  ? 468 GLU A C   1 
ATOM   180 O O   . GLU A 1 33 ? 26.761 -14.830 -1.069  1.00 39.38  ? 468 GLU A O   1 
ATOM   181 C CB  . GLU A 1 33 ? 27.119 -11.864 0.267   1.00 30.99  ? 468 GLU A CB  1 
ATOM   182 C CG  . GLU A 1 33 ? 25.896 -12.443 0.978   1.00 33.53  ? 468 GLU A CG  1 
ATOM   183 C CD  . GLU A 1 33 ? 26.228 -13.437 2.081   1.00 33.00  ? 468 GLU A CD  1 
ATOM   184 O OE1 . GLU A 1 33 ? 25.274 -14.081 2.576   1.00 29.79  ? 468 GLU A OE1 1 
ATOM   185 O OE2 . GLU A 1 33 ? 27.417 -13.574 2.457   1.00 27.28  ? 468 GLU A OE2 1 
ATOM   186 N N   . VAL A 1 34 ? 26.980 -13.243 -2.642  1.00 32.65  ? 469 VAL A N   1 
ATOM   187 C CA  . VAL A 1 34 ? 26.245 -14.003 -3.651  1.00 35.15  ? 469 VAL A CA  1 
ATOM   188 C C   . VAL A 1 34 ? 27.030 -15.251 -4.067  1.00 36.58  ? 469 VAL A C   1 
ATOM   189 O O   . VAL A 1 34 ? 26.449 -16.317 -4.290  1.00 37.66  ? 469 VAL A O   1 
ATOM   190 C CB  . VAL A 1 34 ? 25.946 -13.145 -4.900  1.00 38.27  ? 469 VAL A CB  1 
ATOM   191 C CG1 . VAL A 1 34 ? 25.325 -14.000 -5.994  1.00 36.85  ? 469 VAL A CG1 1 
ATOM   192 C CG2 . VAL A 1 34 ? 25.033 -11.962 -4.539  1.00 27.06  ? 469 VAL A CG2 1 
ATOM   193 N N   . TYR A 1 35 ? 28.349 -15.101 -4.173  1.00 37.27  ? 470 TYR A N   1 
ATOM   194 C CA  . TYR A 1 35 ? 29.257 -16.216 -4.446  1.00 36.34  ? 470 TYR A CA  1 
ATOM   195 C C   . TYR A 1 35 ? 29.168 -17.259 -3.333  1.00 37.55  ? 470 TYR A C   1 
ATOM   196 O O   . TYR A 1 35 ? 29.030 -18.457 -3.601  1.00 31.84  ? 470 TYR A O   1 
ATOM   197 C CB  . TYR A 1 35 ? 30.698 -15.707 -4.553  1.00 36.43  ? 470 TYR A CB  1 
ATOM   198 C CG  . TYR A 1 35 ? 31.728 -16.807 -4.666  1.00 39.65  ? 470 TYR A CG  1 
ATOM   199 C CD1 . TYR A 1 35 ? 32.540 -17.145 -3.588  1.00 38.04  ? 470 TYR A CD1 1 
ATOM   200 C CD2 . TYR A 1 35 ? 31.877 -17.522 -5.852  1.00 42.11  ? 470 TYR A CD2 1 
ATOM   201 C CE1 . TYR A 1 35 ? 33.480 -18.158 -3.694  1.00 42.50  ? 470 TYR A CE1 1 
ATOM   202 C CE2 . TYR A 1 35 ? 32.806 -18.531 -5.966  1.00 39.78  ? 470 TYR A CE2 1 
ATOM   203 C CZ  . TYR A 1 35 ? 33.604 -18.846 -4.887  1.00 42.04  ? 470 TYR A CZ  1 
ATOM   204 O OH  . TYR A 1 35 ? 34.524 -19.852 -5.013  1.00 43.69  ? 470 TYR A OH  1 
ATOM   205 N N   . ARG A 1 36 ? 29.255 -16.781 -2.090  1.00 36.92  ? 471 ARG A N   1 
ATOM   206 C CA  . ARG A 1 36 ? 29.126 -17.624 -0.900  1.00 37.72  ? 471 ARG A CA  1 
ATOM   207 C C   . ARG A 1 36 ? 27.820 -18.406 -0.934  1.00 40.28  ? 471 ARG A C   1 
ATOM   208 O O   . ARG A 1 36 ? 27.792 -19.588 -0.579  1.00 46.65  ? 471 ARG A O   1 
ATOM   209 C CB  . ARG A 1 36 ? 29.167 -16.767 0.369   1.00 38.28  ? 471 ARG A CB  1 
ATOM   210 C CG  . ARG A 1 36 ? 29.258 -17.569 1.664   1.00 33.74  ? 471 ARG A CG  1 
ATOM   211 C CD  . ARG A 1 36 ? 28.656 -16.830 2.853   1.00 31.85  ? 471 ARG A CD  1 
ATOM   212 N NE  . ARG A 1 36 ? 27.808 -17.740 3.621   1.00 35.88  ? 471 ARG A NE  1 
ATOM   213 C CZ  . ARG A 1 36 ? 26.476 -17.699 3.693   1.00 36.97  ? 471 ARG A CZ  1 
ATOM   214 N NH1 . ARG A 1 36 ? 25.774 -16.757 3.074   1.00 39.72  ? 471 ARG A NH1 1 
ATOM   215 N NH2 . ARG A 1 36 ? 25.837 -18.607 4.420   1.00 42.98  ? 471 ARG A NH2 1 
ATOM   216 N N   . LEU A 1 37 ? 26.746 -17.741 -1.359  1.00 36.20  ? 472 LEU A N   1 
ATOM   217 C CA  . LEU A 1 37 ? 25.436 -18.387 -1.484  1.00 37.05  ? 472 LEU A CA  1 
ATOM   218 C C   . LEU A 1 37 ? 25.425 -19.455 -2.577  1.00 38.47  ? 472 LEU A C   1 
ATOM   219 O O   . LEU A 1 37 ? 24.924 -20.563 -2.361  1.00 39.63  ? 472 LEU A O   1 
ATOM   220 C CB  . LEU A 1 37 ? 24.334 -17.354 -1.738  1.00 35.53  ? 472 LEU A CB  1 
ATOM   221 C CG  . LEU A 1 37 ? 23.920 -16.567 -0.492  1.00 34.44  ? 472 LEU A CG  1 
ATOM   222 C CD1 . LEU A 1 37 ? 23.054 -15.369 -0.866  1.00 30.00  ? 472 LEU A CD1 1 
ATOM   223 C CD2 . LEU A 1 37 ? 23.204 -17.474 0.493   1.00 26.27  ? 472 LEU A CD2 1 
ATOM   224 N N   . ILE A 1 38 ? 25.984 -19.128 -3.739  1.00 34.12  ? 473 ILE A N   1 
ATOM   225 C CA  . ILE A 1 38 ? 26.098 -20.098 -4.825  1.00 34.23  ? 473 ILE A CA  1 
ATOM   226 C C   . ILE A 1 38 ? 26.744 -21.394 -4.331  1.00 37.56  ? 473 ILE A C   1 
ATOM   227 O O   . ILE A 1 38 ? 26.219 -22.482 -4.565  1.00 40.32  ? 473 ILE A O   1 
ATOM   228 C CB  . ILE A 1 38 ? 26.900 -19.530 -6.023  1.00 34.35  ? 473 ILE A CB  1 
ATOM   229 C CG1 . ILE A 1 38 ? 26.063 -18.486 -6.775  1.00 36.76  ? 473 ILE A CG1 1 
ATOM   230 C CG2 . ILE A 1 38 ? 27.312 -20.652 -6.976  1.00 27.87  ? 473 ILE A CG2 1 
ATOM   231 C CD1 . ILE A 1 38 ? 26.811 -17.749 -7.873  1.00 35.38  ? 473 ILE A CD1 1 
ATOM   232 N N   . GLU A 1 39 ? 27.864 -21.284 -3.623  1.00 38.86  ? 474 GLU A N   1 
ATOM   233 C CA  . GLU A 1 39 ? 28.599 -22.485 -3.219  1.00 38.82  ? 474 GLU A CA  1 
ATOM   234 C C   . GLU A 1 39 ? 27.915 -23.300 -2.108  1.00 36.76  ? 474 GLU A C   1 
ATOM   235 O O   . GLU A 1 39 ? 28.141 -24.501 -2.009  1.00 39.88  ? 474 GLU A O   1 
ATOM   236 C CB  . GLU A 1 39 ? 30.077 -22.174 -2.900  1.00 40.17  ? 474 GLU A CB  1 
ATOM   237 C CG  . GLU A 1 39 ? 30.343 -21.182 -1.793  1.00 41.16  ? 474 GLU A CG  1 
ATOM   238 C CD  . GLU A 1 39 ? 31.831 -20.856 -1.636  1.00 42.14  ? 474 GLU A CD  1 
ATOM   239 O OE1 . GLU A 1 39 ? 32.178 -20.081 -0.721  1.00 48.10  ? 474 GLU A OE1 1 
ATOM   240 O OE2 . GLU A 1 39 ? 32.655 -21.362 -2.420  1.00 32.37  ? 474 GLU A OE2 1 
ATOM   241 N N   . VAL A 1 40 ? 27.064 -22.667 -1.303  1.00 36.00  ? 475 VAL A N   1 
ATOM   242 C CA  . VAL A 1 40 ? 26.301 -23.386 -0.270  1.00 34.73  ? 475 VAL A CA  1 
ATOM   243 C C   . VAL A 1 40 ? 24.918 -23.852 -0.764  1.00 36.48  ? 475 VAL A C   1 
ATOM   244 O O   . VAL A 1 40 ? 24.373 -24.822 -0.244  1.00 33.82  ? 475 VAL A O   1 
ATOM   245 C CB  . VAL A 1 40 ? 26.132 -22.544 1.032   1.00 31.25  ? 475 VAL A CB  1 
ATOM   246 C CG1 . VAL A 1 40 ? 27.484 -22.172 1.602   1.00 28.89  ? 475 VAL A CG1 1 
ATOM   247 C CG2 . VAL A 1 40 ? 25.311 -21.304 0.778   1.00 30.04  ? 475 VAL A CG2 1 
ATOM   248 N N   . THR A 1 41 ? 24.356 -23.172 -1.764  1.00 38.00  ? 476 THR A N   1 
ATOM   249 C CA  . THR A 1 41 ? 23.036 -23.532 -2.299  1.00 37.20  ? 476 THR A CA  1 
ATOM   250 C C   . THR A 1 41 ? 23.087 -24.253 -3.653  1.00 38.87  ? 476 THR A C   1 
ATOM   251 O O   . THR A 1 41 ? 22.233 -25.094 -3.946  1.00 36.69  ? 476 THR A O   1 
ATOM   252 C CB  . THR A 1 41 ? 22.144 -22.291 -2.468  1.00 36.77  ? 476 THR A CB  1 
ATOM   253 O OG1 . THR A 1 41 ? 22.628 -21.486 -3.556  1.00 36.17  ? 476 THR A OG1 1 
ATOM   254 C CG2 . THR A 1 41 ? 22.119 -21.480 -1.182  1.00 37.79  ? 476 THR A CG2 1 
ATOM   255 N N   . GLY A 1 42 ? 24.065 -23.904 -4.483  1.00 33.67  ? 477 GLY A N   1 
ATOM   256 C CA  . GLY A 1 42 ? 24.133 -24.419 -5.844  1.00 35.70  ? 477 GLY A CA  1 
ATOM   257 C C   . GLY A 1 42 ? 23.129 -23.765 -6.776  1.00 36.67  ? 477 GLY A C   1 
ATOM   258 O O   . GLY A 1 42 ? 22.908 -24.245 -7.893  1.00 39.30  ? 477 GLY A O   1 
ATOM   259 N N   . LEU A 1 43 ? 22.525 -22.667 -6.324  1.00 35.73  ? 478 LEU A N   1 
ATOM   260 C CA  . LEU A 1 43 ? 21.583 -21.900 -7.133  1.00 35.84  ? 478 LEU A CA  1 
ATOM   261 C C   . LEU A 1 43 ? 22.355 -20.978 -8.061  1.00 38.62  ? 478 LEU A C   1 
ATOM   262 O O   . LEU A 1 43 ? 23.434 -20.487 -7.699  1.00 40.55  ? 478 LEU A O   1 
ATOM   263 C CB  . LEU A 1 43 ? 20.690 -21.037 -6.238  1.00 36.89  ? 478 LEU A CB  1 
ATOM   264 C CG  . LEU A 1 43 ? 19.717 -21.724 -5.274  1.00 35.61  ? 478 LEU A CG  1 
ATOM   265 C CD1 . LEU A 1 43 ? 19.249 -20.732 -4.224  1.00 25.68  ? 478 LEU A CD1 1 
ATOM   266 C CD2 . LEU A 1 43 ? 18.528 -22.321 -6.030  1.00 29.94  ? 478 LEU A CD2 1 
ATOM   267 N N   . ALA A 1 44 ? 21.800 -20.734 -9.246  1.00 36.23  ? 479 ALA A N   1 
ATOM   268 C CA  . ALA A 1 44 ? 22.337 -19.720 -10.160 1.00 37.02  ? 479 ALA A CA  1 
ATOM   269 C C   . ALA A 1 44 ? 22.330 -18.315 -9.538  1.00 36.27  ? 479 ALA A C   1 
ATOM   270 O O   . ALA A 1 44 ? 21.533 -18.014 -8.645  1.00 35.74  ? 479 ALA A O   1 
ATOM   271 C CB  . ALA A 1 44 ? 21.546 -19.709 -11.461 1.00 36.30  ? 479 ALA A CB  1 
ATOM   272 N N   . ARG A 1 45 ? 23.225 -17.462 -10.025 1.00 35.90  ? 480 ARG A N   1 
ATOM   273 C CA  . ARG A 1 45 ? 23.297 -16.075 -9.574  1.00 35.95  ? 480 ARG A CA  1 
ATOM   274 C C   . ARG A 1 45 ? 21.954 -15.381 -9.753  1.00 37.93  ? 480 ARG A C   1 
ATOM   275 O O   . ARG A 1 45 ? 21.449 -14.759 -8.822  1.00 40.19  ? 480 ARG A O   1 
ATOM   276 C CB  . ARG A 1 45 ? 24.377 -15.309 -10.346 1.00 35.24  ? 480 ARG A CB  1 
ATOM   277 C CG  . ARG A 1 45 ? 24.897 -14.091 -9.616  1.00 39.62  ? 480 ARG A CG  1 
ATOM   278 C CD  . ARG A 1 45 ? 26.242 -13.630 -10.160 1.00 40.40  ? 480 ARG A CD  1 
ATOM   279 N NE  . ARG A 1 45 ? 26.095 -12.979 -11.455 1.00 37.39  ? 480 ARG A NE  1 
ATOM   280 C CZ  . ARG A 1 45 ? 25.823 -11.687 -11.643 1.00 42.61  ? 480 ARG A CZ  1 
ATOM   281 N NH1 . ARG A 1 45 ? 25.668 -10.847 -10.621 1.00 39.26  ? 480 ARG A NH1 1 
ATOM   282 N NH2 . ARG A 1 45 ? 25.705 -11.234 -12.884 1.00 49.54  ? 480 ARG A NH2 1 
ATOM   283 N N   . SER A 1 46 ? 21.381 -15.501 -10.950 1.00 37.95  ? 481 SER A N   1 
ATOM   284 C CA  . SER A 1 46 ? 20.095 -14.882 -11.260 1.00 37.42  ? 481 SER A CA  1 
ATOM   285 C C   . SER A 1 46 ? 18.964 -15.495 -10.450 1.00 37.38  ? 481 SER A C   1 
ATOM   286 O O   . SER A 1 46 ? 17.984 -14.827 -10.150 1.00 37.76  ? 481 SER A O   1 
ATOM   287 C CB  . SER A 1 46 ? 19.778 -15.015 -12.749 1.00 38.67  ? 481 SER A CB  1 
ATOM   288 O OG  . SER A 1 46 ? 19.688 -16.369 -13.135 1.00 40.89  ? 481 SER A OG  1 
ATOM   289 N N   . GLU A 1 47 ? 19.099 -16.776 -10.119 1.00 41.47  ? 482 GLU A N   1 
ATOM   290 C CA  . GLU A 1 47 ? 18.138 -17.471 -9.262  1.00 41.28  ? 482 GLU A CA  1 
ATOM   291 C C   . GLU A 1 47 ? 18.131 -16.790 -7.885  1.00 39.98  ? 482 GLU A C   1 
ATOM   292 O O   . GLU A 1 47 ? 17.075 -16.424 -7.358  1.00 39.33  ? 482 GLU A O   1 
ATOM   293 C CB  . GLU A 1 47 ? 18.529 -18.950 -9.149  1.00 42.59  ? 482 GLU A CB  1 
ATOM   294 C CG  . GLU A 1 47 ? 17.376 -19.939 -9.031  1.00 51.07  ? 482 GLU A CG  1 
ATOM   295 C CD  . GLU A 1 47 ? 17.783 -21.379 -9.404  1.00 56.77  ? 482 GLU A CD  1 
ATOM   296 O OE1 . GLU A 1 47 ? 18.987 -21.717 -9.313  1.00 62.69  ? 482 GLU A OE1 1 
ATOM   297 O OE2 . GLU A 1 47 ? 16.894 -22.177 -9.785  1.00 60.73  ? 482 GLU A OE2 1 
ATOM   298 N N   . ILE A 1 48 ? 19.330 -16.596 -7.337  1.00 35.45  ? 483 ILE A N   1 
ATOM   299 C CA  . ILE A 1 48 ? 19.527 -15.931 -6.053  1.00 33.96  ? 483 ILE A CA  1 
ATOM   300 C C   . ILE A 1 48 ? 18.999 -14.494 -6.075  1.00 36.65  ? 483 ILE A C   1 
ATOM   301 O O   . ILE A 1 48 ? 18.277 -14.080 -5.172  1.00 40.88  ? 483 ILE A O   1 
ATOM   302 C CB  . ILE A 1 48 ? 21.033 -15.923 -5.668  1.00 32.74  ? 483 ILE A CB  1 
ATOM   303 C CG1 . ILE A 1 48 ? 21.516 -17.348 -5.368  1.00 30.76  ? 483 ILE A CG1 1 
ATOM   304 C CG2 . ILE A 1 48 ? 21.290 -15.024 -4.467  1.00 26.74  ? 483 ILE A CG2 1 
ATOM   305 C CD1 . ILE A 1 48 ? 22.997 -17.531 -5.558  1.00 27.76  ? 483 ILE A CD1 1 
ATOM   306 N N   . LYS A 1 49 ? 19.375 -13.741 -7.104  1.00 37.27  ? 484 LYS A N   1 
ATOM   307 C CA  . LYS A 1 49 ? 18.926 -12.354 -7.276  1.00 37.17  ? 484 LYS A CA  1 
ATOM   308 C C   . LYS A 1 49 ? 17.397 -12.208 -7.297  1.00 37.18  ? 484 LYS A C   1 
ATOM   309 O O   . LYS A 1 49 ? 16.839 -11.357 -6.605  1.00 36.89  ? 484 LYS A O   1 
ATOM   310 C CB  . LYS A 1 49 ? 19.500 -11.755 -8.574  1.00 41.16  ? 484 LYS A CB  1 
ATOM   311 C CG  . LYS A 1 49 ? 20.649 -10.777 -8.382  1.00 34.54  ? 484 LYS A CG  1 
ATOM   312 C CD  . LYS A 1 49 ? 21.980 -11.472 -8.217  1.00 37.03  ? 484 LYS A CD  1 
ATOM   313 C CE  . LYS A 1 49 ? 23.105 -10.453 -8.075  1.00 34.58  ? 484 LYS A CE  1 
ATOM   314 N NZ  . LYS A 1 49 ? 23.218 -9.601  -9.277  1.00 35.65  ? 484 LYS A NZ  1 
ATOM   315 N N   . LYS A 1 50 ? 16.729 -13.022 -8.107  1.00 34.97  ? 485 LYS A N   1 
ATOM   316 C CA  . LYS A 1 50 ? 15.271 -13.002 -8.182  1.00 38.86  ? 485 LYS A CA  1 
ATOM   317 C C   . LYS A 1 50 ? 14.643 -13.245 -6.803  1.00 37.44  ? 485 LYS A C   1 
ATOM   318 O O   . LYS A 1 50 ? 13.683 -12.576 -6.430  1.00 38.56  ? 485 LYS A O   1 
ATOM   319 C CB  . LYS A 1 50 ? 14.767 -14.048 -9.181  1.00 42.54  ? 485 LYS A CB  1 
ATOM   320 C CG  . LYS A 1 50 ? 15.080 -13.743 -10.652 1.00 47.88  ? 485 LYS A CG  1 
ATOM   321 C CD  . LYS A 1 50 ? 14.838 -14.972 -11.533 1.00 50.38  ? 485 LYS A CD  1 
ATOM   322 C CE  . LYS A 1 50 ? 15.648 -14.948 -12.821 1.00 54.77  ? 485 LYS A CE  1 
ATOM   323 N NZ  . LYS A 1 50 ? 15.052 -14.069 -13.864 1.00 63.88  ? 485 LYS A NZ  1 
ATOM   324 N N   . TRP A 1 51 ? 15.198 -14.193 -6.050  1.00 34.67  ? 486 TRP A N   1 
ATOM   325 C CA  . TRP A 1 51 ? 14.710 -14.511 -4.704  1.00 36.24  ? 486 TRP A CA  1 
ATOM   326 C C   . TRP A 1 51 ? 14.798 -13.295 -3.778  1.00 37.19  ? 486 TRP A C   1 
ATOM   327 O O   . TRP A 1 51 ? 13.824 -12.947 -3.105  1.00 40.78  ? 486 TRP A O   1 
ATOM   328 C CB  . TRP A 1 51 ? 15.511 -15.674 -4.115  1.00 35.08  ? 486 TRP A CB  1 
ATOM   329 C CG  . TRP A 1 51 ? 14.967 -16.255 -2.841  1.00 33.16  ? 486 TRP A CG  1 
ATOM   330 C CD1 . TRP A 1 51 ? 14.201 -17.372 -2.720  1.00 36.02  ? 486 TRP A CD1 1 
ATOM   331 C CD2 . TRP A 1 51 ? 15.184 -15.772 -1.508  1.00 34.79  ? 486 TRP A CD2 1 
ATOM   332 N NE1 . TRP A 1 51 ? 13.914 -17.610 -1.401  1.00 37.17  ? 486 TRP A NE1 1 
ATOM   333 C CE2 . TRP A 1 51 ? 14.501 -16.639 -0.635  1.00 33.89  ? 486 TRP A CE2 1 
ATOM   334 C CE3 . TRP A 1 51 ? 15.881 -14.683 -0.969  1.00 35.63  ? 486 TRP A CE3 1 
ATOM   335 C CZ2 . TRP A 1 51 ? 14.494 -16.456 0.749   1.00 33.93  ? 486 TRP A CZ2 1 
ATOM   336 C CZ3 . TRP A 1 51 ? 15.867 -14.498 0.406   1.00 33.45  ? 486 TRP A CZ3 1 
ATOM   337 C CH2 . TRP A 1 51 ? 15.180 -15.383 1.249   1.00 34.24  ? 486 TRP A CH2 1 
ATOM   338 N N   . PHE A 1 52 ? 15.963 -12.652 -3.751  1.00 35.58  ? 487 PHE A N   1 
ATOM   339 C CA  . PHE A 1 52 ? 16.177 -11.482 -2.894  1.00 34.30  ? 487 PHE A CA  1 
ATOM   340 C C   . PHE A 1 52 ? 15.235 -10.344 -3.236  1.00 33.46  ? 487 PHE A C   1 
ATOM   341 O O   . PHE A 1 52 ? 14.515 -9.864  -2.364  1.00 39.12  ? 487 PHE A O   1 
ATOM   342 C CB  . PHE A 1 52 ? 17.638 -11.011 -2.937  1.00 33.77  ? 487 PHE A CB  1 
ATOM   343 C CG  . PHE A 1 52 ? 18.490 -11.625 -1.862  1.00 27.48  ? 487 PHE A CG  1 
ATOM   344 C CD1 . PHE A 1 52 ? 18.894 -12.943 -1.954  1.00 27.84  ? 487 PHE A CD1 1 
ATOM   345 C CD2 . PHE A 1 52 ? 18.862 -10.893 -0.749  1.00 32.05  ? 487 PHE A CD2 1 
ATOM   346 C CE1 . PHE A 1 52 ? 19.674 -13.518 -0.958  1.00 32.96  ? 487 PHE A CE1 1 
ATOM   347 C CE2 . PHE A 1 52 ? 19.642 -11.456 0.248   1.00 30.83  ? 487 PHE A CE2 1 
ATOM   348 C CZ  . PHE A 1 52 ? 20.047 -12.774 0.144   1.00 29.76  ? 487 PHE A CZ  1 
ATOM   349 N N   . SER A 1 53 ? 15.228 -9.936  -4.501  1.00 35.48  ? 488 SER A N   1 
ATOM   350 C CA  . SER A 1 53 ? 14.302 -8.906  -4.997  1.00 39.54  ? 488 SER A CA  1 
ATOM   351 C C   . SER A 1 53 ? 12.846 -9.155  -4.593  1.00 39.31  ? 488 SER A C   1 
ATOM   352 O O   . SER A 1 53 ? 12.133 -8.232  -4.195  1.00 34.28  ? 488 SER A O   1 
ATOM   353 C CB  . SER A 1 53 ? 14.374 -8.825  -6.524  1.00 41.75  ? 488 SER A CB  1 
ATOM   354 O OG  . SER A 1 53 ? 15.716 -8.698  -6.953  1.00 50.51  ? 488 SER A OG  1 
ATOM   355 N N   . ASP A 1 54 ? 12.418 -10.407 -4.716  1.00 37.53  ? 489 ASP A N   1 
ATOM   356 C CA  . ASP A 1 54 ? 11.056 -10.795 -4.390  1.00 40.69  ? 489 ASP A CA  1 
ATOM   357 C C   . ASP A 1 54 ? 10.792 -10.619 -2.900  1.00 40.24  ? 489 ASP A C   1 
ATOM   358 O O   . ASP A 1 54 ? 9.735  -10.140 -2.499  1.00 45.94  ? 489 ASP A O   1 
ATOM   359 C CB  . ASP A 1 54 ? 10.818 -12.253 -4.790  1.00 41.25  ? 489 ASP A CB  1 
ATOM   360 C CG  . ASP A 1 54 ? 9.365  -12.653 -4.693  1.00 43.55  ? 489 ASP A CG  1 
ATOM   361 O OD1 . ASP A 1 54 ? 9.020  -13.427 -3.777  1.00 42.04  ? 489 ASP A OD1 1 
ATOM   362 O OD2 . ASP A 1 54 ? 8.563  -12.187 -5.530  1.00 63.76  ? 489 ASP A OD2 1 
ATOM   363 N N   . HIS A 1 55 ? 11.760 -11.011 -2.082  1.00 39.42  ? 490 HIS A N   1 
ATOM   364 C CA  . HIS A 1 55 ? 11.590 -10.979 -0.633  1.00 38.93  ? 490 HIS A CA  1 
ATOM   365 C C   . HIS A 1 55 ? 11.697 -9.566  -0.081  1.00 37.71  ? 490 HIS A C   1 
ATOM   366 O O   . HIS A 1 55 ? 11.043 -9.247  0.907   1.00 37.33  ? 490 HIS A O   1 
ATOM   367 C CB  . HIS A 1 55 ? 12.579 -11.930 0.051   1.00 40.93  ? 490 HIS A CB  1 
ATOM   368 C CG  . HIS A 1 55 ? 12.105 -13.350 0.089   1.00 45.05  ? 490 HIS A CG  1 
ATOM   369 N ND1 . HIS A 1 55 ? 11.614 -13.938 1.236   1.00 42.90  ? 490 HIS A ND1 1 
ATOM   370 C CD2 . HIS A 1 55 ? 12.011 -14.288 -0.884  1.00 44.98  ? 490 HIS A CD2 1 
ATOM   371 C CE1 . HIS A 1 55 ? 11.257 -15.181 0.971   1.00 44.92  ? 490 HIS A CE1 1 
ATOM   372 N NE2 . HIS A 1 55 ? 11.487 -15.419 -0.307  1.00 44.78  ? 490 HIS A NE2 1 
ATOM   373 N N   . ARG A 1 56 ? 12.507 -8.727  -0.726  1.00 37.34  ? 491 ARG A N   1 
ATOM   374 C CA  . ARG A 1 56 ? 12.548 -7.294  -0.419  1.00 37.23  ? 491 ARG A CA  1 
ATOM   375 C C   . ARG A 1 56 ? 11.173 -6.681  -0.639  1.00 39.19  ? 491 ARG A C   1 
ATOM   376 O O   . ARG A 1 56 ? 10.643 -5.984  0.229   1.00 42.77  ? 491 ARG A O   1 
ATOM   377 C CB  . ARG A 1 56 ? 13.562 -6.564  -1.306  1.00 37.78  ? 491 ARG A CB  1 
ATOM   378 C CG  . ARG A 1 56 ? 15.026 -6.903  -1.028  1.00 37.63  ? 491 ARG A CG  1 
ATOM   379 C CD  . ARG A 1 56 ? 15.956 -5.830  -1.577  1.00 39.04  ? 491 ARG A CD  1 
ATOM   380 N NE  . ARG A 1 56 ? 15.852 -5.692  -3.031  1.00 41.97  ? 491 ARG A NE  1 
ATOM   381 C CZ  . ARG A 1 56 ? 16.608 -6.326  -3.931  1.00 40.07  ? 491 ARG A CZ  1 
ATOM   382 N NH1 . ARG A 1 56 ? 17.563 -7.169  -3.564  1.00 39.56  ? 491 ARG A NH1 1 
ATOM   383 N NH2 . ARG A 1 56 ? 16.405 -6.109  -5.226  1.00 48.59  ? 491 ARG A NH2 1 
ATOM   384 N N   . TYR A 1 57 ? 10.609 -6.950  -1.811  1.00 39.19  ? 492 TYR A N   1 
ATOM   385 C CA  . TYR A 1 57 ? 9.279  -6.469  -2.174  1.00 43.20  ? 492 TYR A CA  1 
ATOM   386 C C   . TYR A 1 57 ? 8.229  -6.850  -1.128  1.00 42.41  ? 492 TYR A C   1 
ATOM   387 O O   . TYR A 1 57 ? 7.421  -6.018  -0.718  1.00 39.95  ? 492 TYR A O   1 
ATOM   388 C CB  . TYR A 1 57 ? 8.898  -7.011  -3.555  1.00 47.21  ? 492 TYR A CB  1 
ATOM   389 C CG  . TYR A 1 57 ? 7.437  -6.906  -3.912  1.00 51.23  ? 492 TYR A CG  1 
ATOM   390 C CD1 . TYR A 1 57 ? 6.601  -8.016  -3.830  1.00 56.88  ? 492 TYR A CD1 1 
ATOM   391 C CD2 . TYR A 1 57 ? 6.894  -5.706  -4.356  1.00 57.41  ? 492 TYR A CD2 1 
ATOM   392 C CE1 . TYR A 1 57 ? 5.265  -7.933  -4.170  1.00 58.81  ? 492 TYR A CE1 1 
ATOM   393 C CE2 . TYR A 1 57 ? 5.554  -5.611  -4.700  1.00 60.17  ? 492 TYR A CE2 1 
ATOM   394 C CZ  . TYR A 1 57 ? 4.746  -6.729  -4.605  1.00 64.04  ? 492 TYR A CZ  1 
ATOM   395 O OH  . TYR A 1 57 ? 3.415  -6.645  -4.940  1.00 70.91  ? 492 TYR A OH  1 
ATOM   396 N N   . ARG A 1 58 ? 8.259  -8.104  -0.690  1.00 41.77  ? 493 ARG A N   1 
ATOM   397 C CA  . ARG A 1 58 ? 7.308  -8.588  0.307   1.00 45.35  ? 493 ARG A CA  1 
ATOM   398 C C   . ARG A 1 58 ? 7.594  -8.016  1.696   1.00 42.08  ? 493 ARG A C   1 
ATOM   399 O O   . ARG A 1 58 ? 6.671  -7.633  2.415   1.00 40.75  ? 493 ARG A O   1 
ATOM   400 C CB  . ARG A 1 58 ? 7.305  -10.115 0.343   1.00 45.85  ? 493 ARG A CB  1 
ATOM   401 C CG  . ARG A 1 58 ? 6.713  -10.737 -0.917  1.00 51.89  ? 493 ARG A CG  1 
ATOM   402 C CD  . ARG A 1 58 ? 6.369  -12.207 -0.722  1.00 53.18  ? 493 ARG A CD  1 
ATOM   403 N NE  . ARG A 1 58 ? 7.495  -13.092 -1.017  1.00 45.31  ? 493 ARG A NE  1 
ATOM   404 C CZ  . ARG A 1 58 ? 7.588  -14.358 -0.615  1.00 49.75  ? 493 ARG A CZ  1 
ATOM   405 N NH1 . ARG A 1 58 ? 6.641  -14.911 0.132   1.00 50.65  ? 493 ARG A NH1 1 
ATOM   406 N NH2 . ARG A 1 58 ? 8.651  -15.076 -0.952  1.00 56.16  ? 493 ARG A NH2 1 
ATOM   407 N N   . CYS A 1 59 ? 8.869  -7.947  2.060   1.00 38.48  ? 494 CYS A N   1 
ATOM   408 C CA  . CYS A 1 59 ? 9.274  -7.357  3.333   1.00 39.94  ? 494 CYS A CA  1 
ATOM   409 C C   . CYS A 1 59 ? 8.794  -5.909  3.457   1.00 45.03  ? 494 CYS A C   1 
ATOM   410 O O   . CYS A 1 59 ? 8.207  -5.536  4.474   1.00 46.27  ? 494 CYS A O   1 
ATOM   411 C CB  . CYS A 1 59 ? 10.797 -7.421  3.492   1.00 35.16  ? 494 CYS A CB  1 
ATOM   412 S SG  . CYS A 1 59 ? 11.421 -6.792  5.066   1.00 36.48  ? 494 CYS A SG  1 
ATOM   413 N N   . GLN A 1 60 ? 9.039  -5.108  2.419   1.00 47.02  ? 495 GLN A N   1 
ATOM   414 C CA  . GLN A 1 60 ? 8.663  -3.685  2.409   1.00 46.61  ? 495 GLN A CA  1 
ATOM   415 C C   . GLN A 1 60 ? 7.148  -3.475  2.381   1.00 46.96  ? 495 GLN A C   1 
ATOM   416 O O   . GLN A 1 60 ? 6.632  -2.546  3.006   1.00 46.66  ? 495 GLN A O   1 
ATOM   417 C CB  . GLN A 1 60 ? 9.295  -2.963  1.209   1.00 50.18  ? 495 GLN A CB  1 
ATOM   418 C CG  . GLN A 1 60 ? 10.814 -2.874  1.251   1.00 54.52  ? 495 GLN A CG  1 
ATOM   419 C CD  . GLN A 1 60 ? 11.316 -1.987  2.371   1.00 62.00  ? 495 GLN A CD  1 
ATOM   420 O OE1 . GLN A 1 60 ? 12.129 -2.410  3.198   1.00 63.78  ? 495 GLN A OE1 1 
ATOM   421 N NE2 . GLN A 1 60 ? 10.826 -0.752  2.412   1.00 64.56  ? 495 GLN A NE2 1 
ATOM   422 N N   . ARG A 1 61 ? 6.438  -4.322  1.643   1.00 45.24  ? 496 ARG A N   1 
ATOM   423 C CA  . ARG A 1 61 ? 4.979  -4.262  1.629   1.00 54.11  ? 496 ARG A CA  1 
ATOM   424 C C   . ARG A 1 61 ? 4.405  -4.619  3.002   1.00 55.19  ? 496 ARG A C   1 
ATOM   425 O O   . ARG A 1 61 ? 3.340  -4.124  3.381   1.00 58.05  ? 496 ARG A O   1 
ATOM   426 C CB  . ARG A 1 61 ? 4.388  -5.173  0.548   1.00 55.73  ? 496 ARG A CB  1 
ATOM   427 C CG  . ARG A 1 61 ? 4.459  -4.591  -0.855  1.00 57.09  ? 496 ARG A CG  1 
ATOM   428 C CD  . ARG A 1 61 ? 3.393  -5.194  -1.752  1.00 64.55  ? 496 ARG A CD  1 
ATOM   429 N NE  . ARG A 1 61 ? 2.065  -4.653  -1.462  1.00 74.19  ? 496 ARG A NE  1 
ATOM   430 C CZ  . ARG A 1 61 ? 0.925  -5.110  -1.982  1.00 76.31  ? 496 ARG A CZ  1 
ATOM   431 N NH1 . ARG A 1 61 ? 0.924  -6.137  -2.826  1.00 78.86  ? 496 ARG A NH1 1 
ATOM   432 N NH2 . ARG A 1 61 ? -0.228 -4.539  -1.650  1.00 79.58  ? 496 ARG A NH2 1 
ATOM   433 N N   . GLY A 1 62 ? 5.112  -5.481  3.734   1.00 50.54  ? 497 GLY A N   1 
ATOM   434 C CA  . GLY A 1 62 ? 4.784  -5.759  5.125   1.00 50.54  ? 497 GLY A CA  1 
ATOM   435 C C   . GLY A 1 62 ? 4.934  -4.512  5.976   1.00 50.63  ? 497 GLY A C   1 
ATOM   436 O O   . GLY A 1 62 ? 4.010  -4.123  6.691   1.00 57.26  ? 497 GLY A O   1 
ATOM   437 N N   . ILE A 1 63 ? 6.095  -3.871  5.869   1.00 48.99  ? 498 ILE A N   1 
ATOM   438 C CA  . ILE A 1 63 ? 6.409  -2.663  6.641   1.00 48.82  ? 498 ILE A CA  1 
ATOM   439 C C   . ILE A 1 63 ? 5.472  -1.488  6.334   1.00 54.11  ? 498 ILE A C   1 
ATOM   440 O O   . ILE A 1 63 ? 5.063  -0.772  7.249   1.00 55.60  ? 498 ILE A O   1 
ATOM   441 C CB  . ILE A 1 63 ? 7.878  -2.218  6.415   1.00 45.82  ? 498 ILE A CB  1 
ATOM   442 C CG1 . ILE A 1 63 ? 8.843  -3.269  6.970   1.00 38.89  ? 498 ILE A CG1 1 
ATOM   443 C CG2 . ILE A 1 63 ? 8.146  -0.873  7.083   1.00 42.84  ? 498 ILE A CG2 1 
ATOM   444 C CD1 . ILE A 1 63 ? 10.292 -2.898  6.840   1.00 36.77  ? 498 ILE A CD1 1 
ATOM   445 N N   . VAL A 1 64 ? 5.131  -1.297  5.059   1.00 58.83  ? 499 VAL A N   1 
ATOM   446 C CA  . VAL A 1 64 ? 4.295  -0.163  4.644   1.00 61.77  ? 499 VAL A CA  1 
ATOM   447 C C   . VAL A 1 64 ? 2.835  -0.346  5.056   1.00 68.66  ? 499 VAL A C   1 
ATOM   448 O O   . VAL A 1 64 ? 2.188  0.604   5.498   1.00 71.64  ? 499 VAL A O   1 
ATOM   449 C CB  . VAL A 1 64 ? 4.386  0.100   3.113   1.00 62.14  ? 499 VAL A CB  1 
ATOM   450 C CG1 . VAL A 1 64 ? 3.606  -0.943  2.317   1.00 63.20  ? 499 VAL A CG1 1 
ATOM   451 C CG2 . VAL A 1 64 ? 3.885  1.497   2.786   1.00 62.36  ? 499 VAL A CG2 1 
ATOM   452 N N   . HIS A 1 65 ? 2.326  -1.568  4.917   1.00 75.38  ? 500 HIS A N   1 
ATOM   453 C CA  . HIS A 1 65 ? 0.933  -1.876  5.254   1.00 80.33  ? 500 HIS A CA  1 
ATOM   454 C C   . HIS A 1 65 ? 0.677  -1.719  6.753   1.00 83.94  ? 500 HIS A C   1 
ATOM   455 O O   . HIS A 1 65 ? -0.323 -1.120  7.159   1.00 88.54  ? 500 HIS A O   1 
ATOM   456 C CB  . HIS A 1 65 ? 0.579  -3.298  4.808   1.00 82.43  ? 500 HIS A CB  1 
ATOM   457 C CG  . HIS A 1 65 ? -0.659 -3.845  5.447   1.00 87.66  ? 500 HIS A CG  1 
ATOM   458 N ND1 . HIS A 1 65 ? -0.623 -4.647  6.567   1.00 91.24  ? 500 HIS A ND1 1 
ATOM   459 C CD2 . HIS A 1 65 ? -1.967 -3.703  5.128   1.00 96.68  ? 500 HIS A CD2 1 
ATOM   460 C CE1 . HIS A 1 65 ? -1.855 -4.977  6.910   1.00 97.33  ? 500 HIS A CE1 1 
ATOM   461 N NE2 . HIS A 1 65 ? -2.690 -4.417  6.054   1.00 100.53 ? 500 HIS A NE2 1 
ATOM   462 N N   . ILE A 1 66 ? 1.584  -2.266  7.563   1.00 83.09  ? 501 ILE A N   1 
ATOM   463 C CA  . ILE A 1 66 ? 1.486  -2.176  9.020   1.00 82.65  ? 501 ILE A CA  1 
ATOM   464 C C   . ILE A 1 66 ? 2.006  -0.814  9.478   1.00 80.06  ? 501 ILE A C   1 
ATOM   465 O O   . ILE A 1 66 ? 1.600  -0.303  10.520  1.00 82.06  ? 501 ILE A O   1 
ATOM   466 C CB  . ILE A 1 66 ? 2.289  -3.296  9.735   1.00 81.07  ? 501 ILE A CB  1 
ATOM   467 C CG1 . ILE A 1 66 ? 1.931  -4.682  9.175   1.00 82.83  ? 501 ILE A CG1 1 
ATOM   468 C CG2 . ILE A 1 66 ? 2.059  -3.239  11.249  1.00 81.66  ? 501 ILE A CG2 1 
ATOM   469 C CD1 . ILE A 1 66 ? 2.515  -5.847  9.971   1.00 81.28  ? 501 ILE A CD1 1 
ATOM   470 N N   . LYS B 1 11 ? 12.861 -25.797 -5.324  1.00 46.25  ? 446 LYS B N   1 
ATOM   471 C CA  . LYS B 1 11 ? 13.812 -25.244 -4.314  1.00 45.11  ? 446 LYS B CA  1 
ATOM   472 C C   . LYS B 1 11 ? 13.674 -26.003 -2.993  1.00 46.09  ? 446 LYS B C   1 
ATOM   473 O O   . LYS B 1 11 ? 12.569 -26.164 -2.477  1.00 47.91  ? 446 LYS B O   1 
ATOM   474 C CB  . LYS B 1 11 ? 13.536 -23.755 -4.105  1.00 44.53  ? 446 LYS B CB  1 
ATOM   475 C CG  . LYS B 1 11 ? 14.751 -22.934 -3.736  1.00 41.53  ? 446 LYS B CG  1 
ATOM   476 C CD  . LYS B 1 11 ? 14.508 -21.445 -3.974  1.00 41.86  ? 446 LYS B CD  1 
ATOM   477 C CE  . LYS B 1 11 ? 14.707 -21.069 -5.434  1.00 45.20  ? 446 LYS B CE  1 
ATOM   478 N NZ  . LYS B 1 11 ? 14.170 -19.716 -5.734  1.00 45.80  ? 446 LYS B NZ  1 
ATOM   479 N N   . THR B 1 12 ? 14.795 -26.467 -2.449  1.00 46.34  ? 447 THR B N   1 
ATOM   480 C CA  . THR B 1 12 ? 14.776 -27.267 -1.228  1.00 43.68  ? 447 THR B CA  1 
ATOM   481 C C   . THR B 1 12 ? 14.666 -26.388 0.011   1.00 42.43  ? 447 THR B C   1 
ATOM   482 O O   . THR B 1 12 ? 14.869 -25.174 -0.053  1.00 40.42  ? 447 THR B O   1 
ATOM   483 C CB  . THR B 1 12 ? 16.041 -28.122 -1.101  1.00 43.97  ? 447 THR B CB  1 
ATOM   484 O OG1 . THR B 1 12 ? 17.193 -27.274 -1.142  1.00 49.91  ? 447 THR B OG1 1 
ATOM   485 C CG2 . THR B 1 12 ? 16.122 -29.131 -2.229  1.00 45.28  ? 447 THR B CG2 1 
ATOM   486 N N   . LYS B 1 13 ? 14.353 -27.019 1.138   1.00 43.26  ? 448 LYS B N   1 
ATOM   487 C CA  . LYS B 1 13 ? 14.311 -26.337 2.428   1.00 43.79  ? 448 LYS B CA  1 
ATOM   488 C C   . LYS B 1 13 ? 15.724 -25.910 2.841   1.00 43.31  ? 448 LYS B C   1 
ATOM   489 O O   . LYS B 1 13 ? 15.908 -24.883 3.504   1.00 43.59  ? 448 LYS B O   1 
ATOM   490 C CB  . LYS B 1 13 ? 13.713 -27.253 3.503   1.00 46.38  ? 448 LYS B CB  1 
ATOM   491 C CG  . LYS B 1 13 ? 12.307 -27.777 3.199   1.00 49.84  ? 448 LYS B CG  1 
ATOM   492 C CD  . LYS B 1 13 ? 11.867 -28.819 4.233   1.00 56.95  ? 448 LYS B CD  1 
ATOM   493 C CE  . LYS B 1 13 ? 10.674 -29.652 3.756   1.00 57.73  ? 448 LYS B CE  1 
ATOM   494 N NZ  . LYS B 1 13 ? 9.392  -28.884 3.746   1.00 61.47  ? 448 LYS B NZ  1 
ATOM   495 N N   . GLU B 1 14 ? 16.719 -26.700 2.441   1.00 41.56  ? 449 GLU B N   1 
ATOM   496 C CA  . GLU B 1 14 ? 18.117 -26.398 2.737   1.00 42.27  ? 449 GLU B CA  1 
ATOM   497 C C   . GLU B 1 14 ? 18.528 -25.087 2.067   1.00 41.92  ? 449 GLU B C   1 
ATOM   498 O O   . GLU B 1 14 ? 19.080 -24.195 2.715   1.00 36.72  ? 449 GLU B O   1 
ATOM   499 C CB  . GLU B 1 14 ? 19.036 -27.535 2.270   1.00 46.55  ? 449 GLU B CB  1 
ATOM   500 C CG  . GLU B 1 14 ? 18.939 -28.830 3.095   1.00 54.57  ? 449 GLU B CG  1 
ATOM   501 C CD  . GLU B 1 14 ? 17.697 -29.671 2.780   1.00 59.50  ? 449 GLU B CD  1 
ATOM   502 O OE1 . GLU B 1 14 ? 17.100 -30.231 3.727   1.00 61.25  ? 449 GLU B OE1 1 
ATOM   503 O OE2 . GLU B 1 14 ? 17.314 -29.769 1.592   1.00 62.09  ? 449 GLU B OE2 1 
ATOM   504 N N   . GLN B 1 15 ? 18.245 -24.977 0.769   1.00 41.36  ? 450 GLN B N   1 
ATOM   505 C CA  . GLN B 1 15 ? 18.568 -23.772 -0.002  1.00 39.42  ? 450 GLN B CA  1 
ATOM   506 C C   . GLN B 1 15 ? 17.876 -22.527 0.551   1.00 38.10  ? 450 GLN B C   1 
ATOM   507 O O   . GLN B 1 15 ? 18.515 -21.494 0.753   1.00 36.32  ? 450 GLN B O   1 
ATOM   508 C CB  . GLN B 1 15 ? 18.182 -23.964 -1.469  1.00 41.35  ? 450 GLN B CB  1 
ATOM   509 C CG  . GLN B 1 15 ? 19.069 -24.952 -2.213  1.00 41.29  ? 450 GLN B CG  1 
ATOM   510 C CD  . GLN B 1 15 ? 18.561 -25.258 -3.607  1.00 42.00  ? 450 GLN B CD  1 
ATOM   511 O OE1 . GLN B 1 15 ? 17.361 -25.463 -3.816  1.00 38.97  ? 450 GLN B OE1 1 
ATOM   512 N NE2 . GLN B 1 15 ? 19.474 -25.293 -4.573  1.00 40.26  ? 450 GLN B NE2 1 
ATOM   513 N N   . ILE B 1 16 ? 16.574 -22.636 0.800   1.00 34.76  ? 451 ILE B N   1 
ATOM   514 C CA  . ILE B 1 16 ? 15.797 -21.536 1.379   1.00 34.27  ? 451 ILE B CA  1 
ATOM   515 C C   . ILE B 1 16 ? 16.348 -21.127 2.751   1.00 31.33  ? 451 ILE B C   1 
ATOM   516 O O   . ILE B 1 16 ? 16.288 -19.957 3.116   1.00 33.43  ? 451 ILE B O   1 
ATOM   517 C CB  . ILE B 1 16 ? 14.278 -21.898 1.490   1.00 35.80  ? 451 ILE B CB  1 
ATOM   518 C CG1 . ILE B 1 16 ? 13.659 -22.046 0.098   1.00 29.66  ? 451 ILE B CG1 1 
ATOM   519 C CG2 . ILE B 1 16 ? 13.508 -20.845 2.298   1.00 25.14  ? 451 ILE B CG2 1 
ATOM   520 C CD1 . ILE B 1 16 ? 12.337 -22.748 0.109   1.00 34.91  ? 451 ILE B CD1 1 
ATOM   521 N N   . ALA B 1 17 ? 16.891 -22.080 3.504   1.00 31.48  ? 452 ALA B N   1 
ATOM   522 C CA  . ALA B 1 17 ? 17.500 -21.764 4.804   1.00 34.98  ? 452 ALA B CA  1 
ATOM   523 C C   . ALA B 1 17 ? 18.700 -20.824 4.659   1.00 31.07  ? 452 ALA B C   1 
ATOM   524 O O   . ALA B 1 17 ? 18.845 -19.860 5.406   1.00 36.47  ? 452 ALA B O   1 
ATOM   525 C CB  . ALA B 1 17 ? 17.911 -23.038 5.527   1.00 38.53  ? 452 ALA B CB  1 
ATOM   526 N N   . HIS B 1 18 ? 19.554 -21.102 3.689   1.00 34.24  ? 453 HIS B N   1 
ATOM   527 C CA  . HIS B 1 18 ? 20.722 -20.258 3.444   1.00 35.89  ? 453 HIS B CA  1 
ATOM   528 C C   . HIS B 1 18 ? 20.345 -18.860 2.976   1.00 36.32  ? 453 HIS B C   1 
ATOM   529 O O   . HIS B 1 18 ? 20.984 -17.879 3.357   1.00 37.07  ? 453 HIS B O   1 
ATOM   530 C CB  . HIS B 1 18 ? 21.642 -20.912 2.415   1.00 35.53  ? 453 HIS B CB  1 
ATOM   531 C CG  . HIS B 1 18 ? 22.363 -22.111 2.939   1.00 33.08  ? 453 HIS B CG  1 
ATOM   532 N ND1 . HIS B 1 18 ? 23.308 -22.027 3.936   1.00 32.87  ? 453 HIS B ND1 1 
ATOM   533 C CD2 . HIS B 1 18 ? 22.280 -23.420 2.606   1.00 31.99  ? 453 HIS B CD2 1 
ATOM   534 C CE1 . HIS B 1 18 ? 23.781 -23.233 4.191   1.00 35.31  ? 453 HIS B CE1 1 
ATOM   535 N NE2 . HIS B 1 18 ? 23.174 -24.096 3.399   1.00 32.90  ? 453 HIS B NE2 1 
ATOM   536 N N   . LEU B 1 19 ? 19.313 -18.776 2.140   1.00 37.39  ? 454 LEU B N   1 
ATOM   537 C CA  . LEU B 1 19 ? 18.855 -17.489 1.620   1.00 34.26  ? 454 LEU B CA  1 
ATOM   538 C C   . LEU B 1 19 ? 18.237 -16.653 2.734   1.00 31.48  ? 454 LEU B C   1 
ATOM   539 O O   . LEU B 1 19 ? 18.453 -15.443 2.808   1.00 24.50  ? 454 LEU B O   1 
ATOM   540 C CB  . LEU B 1 19 ? 17.856 -17.698 0.479   1.00 31.22  ? 454 LEU B CB  1 
ATOM   541 C CG  . LEU B 1 19 ? 18.456 -18.406 -0.739  1.00 34.22  ? 454 LEU B CG  1 
ATOM   542 C CD1 . LEU B 1 19 ? 17.418 -18.619 -1.827  1.00 26.94  ? 454 LEU B CD1 1 
ATOM   543 C CD2 . LEU B 1 19 ? 19.651 -17.621 -1.267  1.00 33.58  ? 454 LEU B CD2 1 
ATOM   544 N N   . LYS B 1 20 ? 17.485 -17.320 3.604   1.00 34.71  ? 455 LYS B N   1 
ATOM   545 C CA  . LYS B 1 20 ? 16.811 -16.670 4.719   1.00 35.28  ? 455 LYS B CA  1 
ATOM   546 C C   . LYS B 1 20 ? 17.820 -16.185 5.758   1.00 33.91  ? 455 LYS B C   1 
ATOM   547 O O   . LYS B 1 20 ? 17.738 -15.047 6.226   1.00 30.46  ? 455 LYS B O   1 
ATOM   548 C CB  . LYS B 1 20 ? 15.811 -17.636 5.351   1.00 35.70  ? 455 LYS B CB  1 
ATOM   549 C CG  . LYS B 1 20 ? 14.801 -16.982 6.279   1.00 42.75  ? 455 LYS B CG  1 
ATOM   550 C CD  . LYS B 1 20 ? 13.702 -17.977 6.687   1.00 48.59  ? 455 LYS B CD  1 
ATOM   551 C CE  . LYS B 1 20 ? 12.495 -17.951 5.738   1.00 56.58  ? 455 LYS B CE  1 
ATOM   552 N NZ  . LYS B 1 20 ? 12.849 -17.814 4.289   1.00 53.18  ? 455 LYS B NZ  1 
ATOM   553 N N   . ALA B 1 21 ? 18.776 -17.048 6.104   1.00 33.39  ? 456 ALA B N   1 
ATOM   554 C CA  . ALA B 1 21 ? 19.844 -16.690 7.039   1.00 31.67  ? 456 ALA B CA  1 
ATOM   555 C C   . ALA B 1 21 ? 20.606 -15.444 6.573   1.00 28.94  ? 456 ALA B C   1 
ATOM   556 O O   . ALA B 1 21 ? 20.903 -14.560 7.373   1.00 32.97  ? 456 ALA B O   1 
ATOM   557 C CB  . ALA B 1 21 ? 20.796 -17.856 7.224   1.00 32.74  ? 456 ALA B CB  1 
ATOM   558 N N   . SER B 1 22 ? 20.899 -15.380 5.277   1.00 25.81  ? 457 SER B N   1 
ATOM   559 C CA  . SER B 1 22 ? 21.592 -14.239 4.673   1.00 28.06  ? 457 SER B CA  1 
ATOM   560 C C   . SER B 1 22 ? 20.736 -12.967 4.711   1.00 30.11  ? 457 SER B C   1 
ATOM   561 O O   . SER B 1 22 ? 21.176 -11.915 5.191   1.00 27.54  ? 457 SER B O   1 
ATOM   562 C CB  . SER B 1 22 ? 21.964 -14.571 3.221   1.00 26.84  ? 457 SER B CB  1 
ATOM   563 O OG  . SER B 1 22 ? 22.916 -13.659 2.706   1.00 30.03  ? 457 SER B OG  1 
ATOM   564 N N   . PHE B 1 23 ? 19.509 -13.090 4.204   1.00 33.72  ? 458 PHE B N   1 
ATOM   565 C CA  . PHE B 1 23 ? 18.538 -11.993 4.133   1.00 30.13  ? 458 PHE B CA  1 
ATOM   566 C C   . PHE B 1 23 ? 18.278 -11.344 5.490   1.00 29.91  ? 458 PHE B C   1 
ATOM   567 O O   . PHE B 1 23 ? 18.197 -10.122 5.589   1.00 27.73  ? 458 PHE B O   1 
ATOM   568 C CB  . PHE B 1 23 ? 17.221 -12.525 3.557   1.00 32.70  ? 458 PHE B CB  1 
ATOM   569 C CG  . PHE B 1 23 ? 16.177 -11.464 3.319   1.00 36.60  ? 458 PHE B CG  1 
ATOM   570 C CD1 . PHE B 1 23 ? 16.171 -10.728 2.139   1.00 40.84  ? 458 PHE B CD1 1 
ATOM   571 C CD2 . PHE B 1 23 ? 15.189 -11.217 4.260   1.00 32.94  ? 458 PHE B CD2 1 
ATOM   572 C CE1 . PHE B 1 23 ? 15.206 -9.755  1.913   1.00 38.89  ? 458 PHE B CE1 1 
ATOM   573 C CE2 . PHE B 1 23 ? 14.223 -10.253 4.037   1.00 34.70  ? 458 PHE B CE2 1 
ATOM   574 C CZ  . PHE B 1 23 ? 14.231 -9.521  2.862   1.00 38.37  ? 458 PHE B CZ  1 
ATOM   575 N N   . LEU B 1 24 ? 18.153 -12.172 6.526   1.00 31.41  ? 459 LEU B N   1 
ATOM   576 C CA  . LEU B 1 24 ? 17.840 -11.713 7.882   1.00 29.79  ? 459 LEU B CA  1 
ATOM   577 C C   . LEU B 1 24 ? 19.030 -11.192 8.708   1.00 28.71  ? 459 LEU B C   1 
ATOM   578 O O   . LEU B 1 24 ? 18.818 -10.619 9.776   1.00 32.31  ? 459 LEU B O   1 
ATOM   579 C CB  . LEU B 1 24 ? 17.151 -12.842 8.661   1.00 32.02  ? 459 LEU B CB  1 
ATOM   580 C CG  . LEU B 1 24 ? 15.769 -13.295 8.163   1.00 35.14  ? 459 LEU B CG  1 
ATOM   581 C CD1 . LEU B 1 24 ? 15.216 -14.379 9.074   1.00 20.62  ? 459 LEU B CD1 1 
ATOM   582 C CD2 . LEU B 1 24 ? 14.781 -12.127 8.052   1.00 29.33  ? 459 LEU B CD2 1 
ATOM   583 N N   . GLN B 1 25 ? 20.260 -11.385 8.229   1.00 27.68  ? 460 GLN B N   1 
ATOM   584 C CA  . GLN B 1 25 ? 21.474 -10.965 8.962   1.00 32.92  ? 460 GLN B CA  1 
ATOM   585 C C   . GLN B 1 25 ? 21.343 -9.632  9.706   1.00 32.35  ? 460 GLN B C   1 
ATOM   586 O O   . GLN B 1 25 ? 21.424 -9.583  10.935  1.00 34.31  ? 460 GLN B O   1 
ATOM   587 C CB  . GLN B 1 25 ? 22.671 -10.849 8.006   1.00 37.85  ? 460 GLN B CB  1 
ATOM   588 C CG  . GLN B 1 25 ? 23.402 -12.142 7.691   1.00 43.97  ? 460 GLN B CG  1 
ATOM   589 C CD  . GLN B 1 25 ? 24.428 -11.965 6.575   1.00 44.83  ? 460 GLN B CD  1 
ATOM   590 O OE1 . GLN B 1 25 ? 25.053 -10.910 6.456   1.00 57.55  ? 460 GLN B OE1 1 
ATOM   591 N NE2 . GLN B 1 25 ? 24.606 -12.998 5.755   1.00 50.98  ? 460 GLN B NE2 1 
ATOM   592 N N   . SER B 1 26 ? 21.141 -8.555  8.951   1.00 30.34  ? 461 SER B N   1 
ATOM   593 C CA  . SER B 1 26 ? 21.245 -7.199  9.492   1.00 31.35  ? 461 SER B CA  1 
ATOM   594 C C   . SER B 1 26 ? 20.002 -6.734  10.260  1.00 33.10  ? 461 SER B C   1 
ATOM   595 O O   . SER B 1 26 ? 19.914 -5.568  10.657  1.00 30.61  ? 461 SER B O   1 
ATOM   596 C CB  . SER B 1 26 ? 21.558 -6.219  8.360   1.00 31.19  ? 461 SER B CB  1 
ATOM   597 O OG  . SER B 1 26 ? 20.572 -6.290  7.350   1.00 32.47  ? 461 SER B OG  1 
ATOM   598 N N   . GLN B 1 27 ? 19.047 -7.642  10.462  1.00 32.81  ? 462 GLN B N   1 
ATOM   599 C CA  . GLN B 1 27 ? 17.881 -7.371  11.297  1.00 32.55  ? 462 GLN B CA  1 
ATOM   600 C C   . GLN B 1 27 ? 18.177 -7.739  12.751  1.00 32.84  ? 462 GLN B C   1 
ATOM   601 O O   . GLN B 1 27 ? 17.375 -7.474  13.644  1.00 26.27  ? 462 GLN B O   1 
ATOM   602 C CB  . GLN B 1 27 ? 16.665 -8.148  10.788  1.00 33.96  ? 462 GLN B CB  1 
ATOM   603 C CG  . GLN B 1 27 ? 16.366 -7.915  9.304   1.00 37.02  ? 462 GLN B CG  1 
ATOM   604 C CD  . GLN B 1 27 ? 14.998 -8.429  8.874   1.00 34.27  ? 462 GLN B CD  1 
ATOM   605 O OE1 . GLN B 1 27 ? 14.139 -8.713  9.704   1.00 39.54  ? 462 GLN B OE1 1 
ATOM   606 N NE2 . GLN B 1 27 ? 14.792 -8.536  7.569   1.00 33.94  ? 462 GLN B NE2 1 
ATOM   607 N N   . PHE B 1 28 ? 19.335 -8.351  12.981  1.00 32.47  ? 463 PHE B N   1 
ATOM   608 C CA  . PHE B 1 28 ? 19.793 -8.651  14.326  1.00 33.58  ? 463 PHE B CA  1 
ATOM   609 C C   . PHE B 1 28 ? 21.148 -7.984  14.535  1.00 31.97  ? 463 PHE B C   1 
ATOM   610 O O   . PHE B 1 28 ? 22.155 -8.659  14.688  1.00 35.23  ? 463 PHE B O   1 
ATOM   611 C CB  . PHE B 1 28 ? 19.867 -10.169 14.533  1.00 32.86  ? 463 PHE B CB  1 
ATOM   612 C CG  . PHE B 1 28 ? 18.566 -10.868 14.279  1.00 30.88  ? 463 PHE B CG  1 
ATOM   613 C CD1 . PHE B 1 28 ? 18.305 -11.452 13.047  1.00 33.11  ? 463 PHE B CD1 1 
ATOM   614 C CD2 . PHE B 1 28 ? 17.591 -10.920 15.263  1.00 32.08  ? 463 PHE B CD2 1 
ATOM   615 C CE1 . PHE B 1 28 ? 17.092 -12.082 12.804  1.00 30.37  ? 463 PHE B CE1 1 
ATOM   616 C CE2 . PHE B 1 28 ? 16.386 -11.553 15.035  1.00 27.51  ? 463 PHE B CE2 1 
ATOM   617 C CZ  . PHE B 1 28 ? 16.131 -12.125 13.800  1.00 33.40  ? 463 PHE B CZ  1 
ATOM   618 N N   . PRO B 1 29 ? 21.175 -6.644  14.556  1.00 33.45  ? 464 PRO B N   1 
ATOM   619 C CA  . PRO B 1 29 ? 22.445 -5.940  14.725  1.00 34.89  ? 464 PRO B CA  1 
ATOM   620 C C   . PRO B 1 29 ? 23.188 -6.375  15.982  1.00 34.50  ? 464 PRO B C   1 
ATOM   621 O O   . PRO B 1 29 ? 22.577 -6.454  17.055  1.00 33.39  ? 464 PRO B O   1 
ATOM   622 C CB  . PRO B 1 29 ? 22.023 -4.465  14.852  1.00 35.80  ? 464 PRO B CB  1 
ATOM   623 C CG  . PRO B 1 29 ? 20.566 -4.485  15.124  1.00 34.54  ? 464 PRO B CG  1 
ATOM   624 C CD  . PRO B 1 29 ? 20.046 -5.706  14.459  1.00 35.42  ? 464 PRO B CD  1 
ATOM   625 N N   . ASP B 1 30 ? 24.481 -6.678  15.841  1.00 32.23  ? 465 ASP B N   1 
ATOM   626 C CA  . ASP B 1 30 ? 25.336 -6.943  17.001  1.00 33.34  ? 465 ASP B CA  1 
ATOM   627 C C   . ASP B 1 30 ? 25.617 -5.623  17.676  1.00 31.78  ? 465 ASP B C   1 
ATOM   628 O O   . ASP B 1 30 ? 25.389 -4.573  17.083  1.00 34.59  ? 465 ASP B O   1 
ATOM   629 C CB  . ASP B 1 30 ? 26.632 -7.674  16.625  1.00 35.45  ? 465 ASP B CB  1 
ATOM   630 C CG  . ASP B 1 30 ? 27.495 -6.912  15.618  1.00 38.65  ? 465 ASP B CG  1 
ATOM   631 O OD1 . ASP B 1 30 ? 27.487 -5.660  15.584  1.00 39.41  ? 465 ASP B OD1 1 
ATOM   632 O OD2 . ASP B 1 30 ? 28.215 -7.595  14.866  1.00 31.95  ? 465 ASP B OD2 1 
ATOM   633 N N   . ASP B 1 31 ? 26.099 -5.652  18.913  1.00 39.28  ? 466 ASP B N   1 
ATOM   634 C CA  . ASP B 1 31 ? 26.149 -4.407  19.688  1.00 41.35  ? 466 ASP B CA  1 
ATOM   635 C C   . ASP B 1 31 ? 27.245 -3.415  19.244  1.00 39.11  ? 466 ASP B C   1 
ATOM   636 O O   . ASP B 1 31 ? 27.278 -2.295  19.728  1.00 42.37  ? 466 ASP B O   1 
ATOM   637 C CB  . ASP B 1 31 ? 26.127 -4.658  21.212  1.00 45.71  ? 466 ASP B CB  1 
ATOM   638 C CG  . ASP B 1 31 ? 27.142 -5.664  21.666  1.00 47.88  ? 466 ASP B CG  1 
ATOM   639 O OD1 . ASP B 1 31 ? 28.102 -5.914  20.914  1.00 59.97  ? 466 ASP B OD1 1 
ATOM   640 O OD2 . ASP B 1 31 ? 26.983 -6.194  22.790  1.00 48.75  ? 466 ASP B OD2 1 
ATOM   641 N N   . ALA B 1 32 ? 28.103 -3.808  18.302  1.00 39.95  ? 467 ALA B N   1 
ATOM   642 C CA  . ALA B 1 32 ? 28.928 -2.841  17.570  1.00 35.91  ? 467 ALA B CA  1 
ATOM   643 C C   . ALA B 1 32 ? 28.043 -2.039  16.624  1.00 35.48  ? 467 ALA B C   1 
ATOM   644 O O   . ALA B 1 32 ? 28.209 -0.825  16.476  1.00 36.15  ? 467 ALA B O   1 
ATOM   645 C CB  . ALA B 1 32 ? 30.023 -3.543  16.785  1.00 31.43  ? 467 ALA B CB  1 
ATOM   646 N N   . GLU B 1 33 ? 27.102 -2.727  15.979  1.00 36.16  ? 468 GLU B N   1 
ATOM   647 C CA  . GLU B 1 33 ? 26.172 -2.083  15.042  1.00 32.78  ? 468 GLU B CA  1 
ATOM   648 C C   . GLU B 1 33 ? 25.245 -1.124  15.774  1.00 30.30  ? 468 GLU B C   1 
ATOM   649 O O   . GLU B 1 33 ? 24.979 -0.021  15.292  1.00 27.81  ? 468 GLU B O   1 
ATOM   650 C CB  . GLU B 1 33 ? 25.319 -3.127  14.303  1.00 30.79  ? 468 GLU B CB  1 
ATOM   651 C CG  . GLU B 1 33 ? 25.259 -2.971  12.788  1.00 31.88  ? 468 GLU B CG  1 
ATOM   652 C CD  . GLU B 1 33 ? 25.087 -1.540  12.323  1.00 30.36  ? 468 GLU B CD  1 
ATOM   653 O OE1 . GLU B 1 33 ? 23.942 -1.054  12.257  1.00 34.89  ? 468 GLU B OE1 1 
ATOM   654 O OE2 . GLU B 1 33 ? 26.106 -0.908  11.995  1.00 30.14  ? 468 GLU B OE2 1 
ATOM   655 N N   . VAL B 1 34 ? 24.754 -1.558  16.932  1.00 28.29  ? 469 VAL B N   1 
ATOM   656 C CA  . VAL B 1 34 ? 23.845 -0.746  17.732  1.00 31.91  ? 469 VAL B CA  1 
ATOM   657 C C   . VAL B 1 34 ? 24.576 0.468   18.309  1.00 32.19  ? 469 VAL B C   1 
ATOM   658 O O   . VAL B 1 34 ? 24.010 1.557   18.381  1.00 34.54  ? 469 VAL B O   1 
ATOM   659 C CB  . VAL B 1 34 ? 23.192 -1.573  18.861  1.00 33.50  ? 469 VAL B CB  1 
ATOM   660 C CG1 . VAL B 1 34 ? 22.286 -0.693  19.714  1.00 36.66  ? 469 VAL B CG1 1 
ATOM   661 C CG2 . VAL B 1 34 ? 22.405 -2.742  18.272  1.00 23.07  ? 469 VAL B CG2 1 
ATOM   662 N N   . TYR B 1 35 ? 25.831 0.272   18.710  1.00 31.72  ? 470 TYR B N   1 
ATOM   663 C CA  . TYR B 1 35 ? 26.709 1.371   19.109  1.00 34.11  ? 470 TYR B CA  1 
ATOM   664 C C   . TYR B 1 35 ? 26.798 2.424   17.999  1.00 35.62  ? 470 TYR B C   1 
ATOM   665 O O   . TYR B 1 35 ? 26.651 3.619   18.253  1.00 35.95  ? 470 TYR B O   1 
ATOM   666 C CB  . TYR B 1 35 ? 28.104 0.826   19.427  1.00 36.07  ? 470 TYR B CB  1 
ATOM   667 C CG  . TYR B 1 35 ? 29.149 1.878   19.716  1.00 37.33  ? 470 TYR B CG  1 
ATOM   668 C CD1 . TYR B 1 35 ? 30.167 2.147   18.805  1.00 37.92  ? 470 TYR B CD1 1 
ATOM   669 C CD2 . TYR B 1 35 ? 29.126 2.600   20.906  1.00 45.52  ? 470 TYR B CD2 1 
ATOM   670 C CE1 . TYR B 1 35 ? 31.139 3.108   19.075  1.00 39.97  ? 470 TYR B CE1 1 
ATOM   671 C CE2 . TYR B 1 35 ? 30.088 3.565   21.181  1.00 43.87  ? 470 TYR B CE2 1 
ATOM   672 C CZ  . TYR B 1 35 ? 31.089 3.812   20.264  1.00 43.37  ? 470 TYR B CZ  1 
ATOM   673 O OH  . TYR B 1 35 ? 32.034 4.764   20.543  1.00 45.38  ? 470 TYR B OH  1 
ATOM   674 N N   . ARG B 1 36 ? 27.029 1.963   16.771  1.00 35.99  ? 471 ARG B N   1 
ATOM   675 C CA  . ARG B 1 36 ? 27.088 2.838   15.596  1.00 35.35  ? 471 ARG B CA  1 
ATOM   676 C C   . ARG B 1 36 ? 25.774 3.596   15.400  1.00 31.90  ? 471 ARG B C   1 
ATOM   677 O O   . ARG B 1 36 ? 25.779 4.759   15.010  1.00 28.50  ? 471 ARG B O   1 
ATOM   678 C CB  . ARG B 1 36 ? 27.396 2.025   14.336  1.00 35.46  ? 471 ARG B CB  1 
ATOM   679 C CG  . ARG B 1 36 ? 28.011 2.832   13.201  1.00 36.96  ? 471 ARG B CG  1 
ATOM   680 C CD  . ARG B 1 36 ? 27.604 2.302   11.816  1.00 44.12  ? 471 ARG B CD  1 
ATOM   681 N NE  . ARG B 1 36 ? 26.656 3.198   11.133  1.00 49.42  ? 471 ARG B NE  1 
ATOM   682 C CZ  . ARG B 1 36 ? 25.410 2.896   10.756  1.00 49.43  ? 471 ARG B CZ  1 
ATOM   683 N NH1 . ARG B 1 36 ? 24.883 1.695   10.969  1.00 50.64  ? 471 ARG B NH1 1 
ATOM   684 N NH2 . ARG B 1 36 ? 24.676 3.820   10.143  1.00 59.38  ? 471 ARG B NH2 1 
ATOM   685 N N   . LEU B 1 37 ? 24.653 2.932   15.674  1.00 33.74  ? 472 LEU B N   1 
ATOM   686 C CA  . LEU B 1 37 ? 23.330 3.554   15.535  1.00 33.59  ? 472 LEU B CA  1 
ATOM   687 C C   . LEU B 1 37 ? 23.072 4.606   16.617  1.00 36.61  ? 472 LEU B C   1 
ATOM   688 O O   . LEU B 1 37 ? 22.522 5.674   16.342  1.00 37.91  ? 472 LEU B O   1 
ATOM   689 C CB  . LEU B 1 37 ? 22.236 2.489   15.548  1.00 29.17  ? 472 LEU B CB  1 
ATOM   690 C CG  . LEU B 1 37 ? 22.180 1.667   14.258  1.00 30.76  ? 472 LEU B CG  1 
ATOM   691 C CD1 . LEU B 1 37 ? 21.573 0.284   14.498  1.00 23.88  ? 472 LEU B CD1 1 
ATOM   692 C CD2 . LEU B 1 37 ? 21.421 2.432   13.170  1.00 29.40  ? 472 LEU B CD2 1 
ATOM   693 N N   . ILE B 1 38 ? 23.480 4.307   17.844  1.00 35.99  ? 473 ILE B N   1 
ATOM   694 C CA  . ILE B 1 38 ? 23.394 5.277   18.924  1.00 36.61  ? 473 ILE B CA  1 
ATOM   695 C C   . ILE B 1 38 ? 24.116 6.555   18.524  1.00 40.85  ? 473 ILE B C   1 
ATOM   696 O O   . ILE B 1 38 ? 23.519 7.631   18.536  1.00 45.19  ? 473 ILE B O   1 
ATOM   697 C CB  . ILE B 1 38 ? 24.000 4.730   20.229  1.00 38.74  ? 473 ILE B CB  1 
ATOM   698 C CG1 . ILE B 1 38 ? 23.069 3.670   20.831  1.00 36.99  ? 473 ILE B CG1 1 
ATOM   699 C CG2 . ILE B 1 38 ? 24.256 5.867   21.219  1.00 31.71  ? 473 ILE B CG2 1 
ATOM   700 C CD1 . ILE B 1 38 ? 23.756 2.719   21.770  1.00 36.29  ? 473 ILE B CD1 1 
ATOM   701 N N   . GLU B 1 39 ? 25.385 6.432   18.139  1.00 39.92  ? 474 GLU B N   1 
ATOM   702 C CA  . GLU B 1 39 ? 26.196 7.617   17.852  1.00 40.37  ? 474 GLU B CA  1 
ATOM   703 C C   . GLU B 1 39 ? 25.796 8.338   16.557  1.00 38.44  ? 474 GLU B C   1 
ATOM   704 O O   . GLU B 1 39 ? 26.143 9.499   16.370  1.00 38.04  ? 474 GLU B O   1 
ATOM   705 C CB  . GLU B 1 39 ? 27.700 7.294   17.889  1.00 40.74  ? 474 GLU B CB  1 
ATOM   706 C CG  . GLU B 1 39 ? 28.225 6.406   16.781  1.00 42.89  ? 474 GLU B CG  1 
ATOM   707 C CD  . GLU B 1 39 ? 29.647 5.914   17.041  1.00 42.94  ? 474 GLU B CD  1 
ATOM   708 O OE1 . GLU B 1 39 ? 30.033 4.883   16.454  1.00 52.79  ? 474 GLU B OE1 1 
ATOM   709 O OE2 . GLU B 1 39 ? 30.379 6.547   17.829  1.00 45.33  ? 474 GLU B OE2 1 
ATOM   710 N N   . VAL B 1 40 ? 25.042 7.665   15.690  1.00 41.94  ? 475 VAL B N   1 
ATOM   711 C CA  . VAL B 1 40 ? 24.528 8.281   14.455  1.00 40.19  ? 475 VAL B CA  1 
ATOM   712 C C   . VAL B 1 40 ? 23.062 8.750   14.566  1.00 39.56  ? 475 VAL B C   1 
ATOM   713 O O   . VAL B 1 40 ? 22.637 9.593   13.785  1.00 38.69  ? 475 VAL B O   1 
ATOM   714 C CB  . VAL B 1 40 ? 24.662 7.306   13.261  1.00 37.31  ? 475 VAL B CB  1 
ATOM   715 C CG1 . VAL B 1 40 ? 23.406 6.461   13.113  1.00 33.74  ? 475 VAL B CG1 1 
ATOM   716 C CG2 . VAL B 1 40 ? 24.943 8.056   11.988  1.00 42.76  ? 475 VAL B CG2 1 
ATOM   717 N N   . THR B 1 41 ? 22.294 8.206   15.518  1.00 38.05  ? 476 THR B N   1 
ATOM   718 C CA  . THR B 1 41 ? 20.876 8.591   15.699  1.00 37.39  ? 476 THR B CA  1 
ATOM   719 C C   . THR B 1 41 ? 20.560 9.295   17.018  1.00 37.18  ? 476 THR B C   1 
ATOM   720 O O   . THR B 1 41 ? 19.591 10.048  17.101  1.00 34.07  ? 476 THR B O   1 
ATOM   721 C CB  . THR B 1 41 ? 19.931 7.375   15.643  1.00 35.52  ? 476 THR B CB  1 
ATOM   722 O OG1 . THR B 1 41 ? 20.079 6.586   16.835  1.00 30.67  ? 476 THR B OG1 1 
ATOM   723 C CG2 . THR B 1 41 ? 20.189 6.531   14.391  1.00 33.34  ? 476 THR B CG2 1 
ATOM   724 N N   . GLY B 1 42 ? 21.341 9.011   18.056  1.00 36.46  ? 477 GLY B N   1 
ATOM   725 C CA  . GLY B 1 42 ? 21.096 9.570   19.379  1.00 36.07  ? 477 GLY B CA  1 
ATOM   726 C C   . GLY B 1 42 ? 19.994 8.861   20.144  1.00 36.32  ? 477 GLY B C   1 
ATOM   727 O O   . GLY B 1 42 ? 19.613 9.304   21.231  1.00 29.60  ? 477 GLY B O   1 
ATOM   728 N N   . LEU B 1 43 ? 19.485 7.761   19.585  1.00 37.11  ? 478 LEU B N   1 
ATOM   729 C CA  . LEU B 1 43 ? 18.417 6.983   20.216  1.00 37.00  ? 478 LEU B CA  1 
ATOM   730 C C   . LEU B 1 43 ? 19.035 6.076   21.257  1.00 37.61  ? 478 LEU B C   1 
ATOM   731 O O   . LEU B 1 43 ? 20.203 5.700   21.131  1.00 39.57  ? 478 LEU B O   1 
ATOM   732 C CB  . LEU B 1 43 ? 17.691 6.114   19.185  1.00 36.81  ? 478 LEU B CB  1 
ATOM   733 C CG  . LEU B 1 43 ? 16.996 6.798   18.002  1.00 31.61  ? 478 LEU B CG  1 
ATOM   734 C CD1 . LEU B 1 43 ? 16.814 5.806   16.865  1.00 14.11  ? 478 LEU B CD1 1 
ATOM   735 C CD2 . LEU B 1 43 ? 15.656 7.389   18.433  1.00 29.36  ? 478 LEU B CD2 1 
ATOM   736 N N   . ALA B 1 44 ? 18.252 5.713   22.271  1.00 37.05  ? 479 ALA B N   1 
ATOM   737 C CA  . ALA B 1 44 ? 18.710 4.772   23.297  1.00 37.73  ? 479 ALA B CA  1 
ATOM   738 C C   . ALA B 1 44 ? 18.859 3.361   22.733  1.00 34.54  ? 479 ALA B C   1 
ATOM   739 O O   . ALA B 1 44 ? 18.226 3.004   21.748  1.00 34.49  ? 479 ALA B O   1 
ATOM   740 C CB  . ALA B 1 44 ? 17.753 4.760   24.482  1.00 39.21  ? 479 ALA B CB  1 
ATOM   741 N N   . ARG B 1 45 ? 19.711 2.570   23.372  1.00 39.69  ? 480 ARG B N   1 
ATOM   742 C CA  . ARG B 1 45 ? 19.881 1.158   23.040  1.00 39.35  ? 480 ARG B CA  1 
ATOM   743 C C   . ARG B 1 45 ? 18.527 0.459   22.943  1.00 36.30  ? 480 ARG B C   1 
ATOM   744 O O   . ARG B 1 45 ? 18.251 -0.219  21.964  1.00 35.29  ? 480 ARG B O   1 
ATOM   745 C CB  . ARG B 1 45 ? 20.758 0.478   24.105  1.00 41.73  ? 480 ARG B CB  1 
ATOM   746 C CG  . ARG B 1 45 ? 21.081 -0.998  23.870  1.00 42.45  ? 480 ARG B CG  1 
ATOM   747 C CD  . ARG B 1 45 ? 22.062 -1.501  24.935  1.00 51.37  ? 480 ARG B CD  1 
ATOM   748 N NE  . ARG B 1 45 ? 22.098 -2.961  25.070  1.00 55.99  ? 480 ARG B NE  1 
ATOM   749 C CZ  . ARG B 1 45 ? 22.709 -3.796  24.228  1.00 62.79  ? 480 ARG B CZ  1 
ATOM   750 N NH1 . ARG B 1 45 ? 23.338 -3.344  23.142  1.00 64.39  ? 480 ARG B NH1 1 
ATOM   751 N NH2 . ARG B 1 45 ? 22.681 -5.105  24.465  1.00 59.56  ? 480 ARG B NH2 1 
ATOM   752 N N   . SER B 1 46 ? 17.687 0.642   23.959  1.00 38.10  ? 481 SER B N   1 
ATOM   753 C CA  . SER B 1 46 ? 16.380 -0.020  24.015  1.00 38.06  ? 481 SER B CA  1 
ATOM   754 C C   . SER B 1 46 ? 15.416 0.498   22.956  1.00 35.58  ? 481 SER B C   1 
ATOM   755 O O   . SER B 1 46 ? 14.584 -0.246  22.453  1.00 37.59  ? 481 SER B O   1 
ATOM   756 C CB  . SER B 1 46 ? 15.750 0.145   25.402  1.00 37.26  ? 481 SER B CB  1 
ATOM   757 O OG  . SER B 1 46 ? 15.482 1.503   25.699  1.00 34.88  ? 481 SER B OG  1 
ATOM   758 N N   . GLU B 1 47 ? 15.524 1.779   22.626  1.00 40.78  ? 482 GLU B N   1 
ATOM   759 C CA  . GLU B 1 47 ? 14.658 2.379   21.614  1.00 40.05  ? 482 GLU B CA  1 
ATOM   760 C C   . GLU B 1 47 ? 14.971 1.801   20.232  1.00 38.51  ? 482 GLU B C   1 
ATOM   761 O O   . GLU B 1 47 ? 14.073 1.586   19.415  1.00 38.51  ? 482 GLU B O   1 
ATOM   762 C CB  . GLU B 1 47 ? 14.821 3.898   21.619  1.00 39.04  ? 482 GLU B CB  1 
ATOM   763 C CG  . GLU B 1 47 ? 13.678 4.651   20.961  1.00 49.54  ? 482 GLU B CG  1 
ATOM   764 C CD  . GLU B 1 47 ? 12.449 4.763   21.852  1.00 58.66  ? 482 GLU B CD  1 
ATOM   765 O OE1 . GLU B 1 47 ? 11.951 3.722   22.334  1.00 60.66  ? 482 GLU B OE1 1 
ATOM   766 O OE2 . GLU B 1 47 ? 11.973 5.900   22.064  1.00 65.24  ? 482 GLU B OE2 1 
ATOM   767 N N   . ILE B 1 48 ? 16.254 1.542   19.999  1.00 34.10  ? 483 ILE B N   1 
ATOM   768 C CA  . ILE B 1 48 ? 16.744 0.944   18.763  1.00 34.00  ? 483 ILE B CA  1 
ATOM   769 C C   . ILE B 1 48 ? 16.303 -0.520  18.652  1.00 34.43  ? 483 ILE B C   1 
ATOM   770 O O   . ILE B 1 48 ? 15.882 -0.967  17.586  1.00 35.76  ? 483 ILE B O   1 
ATOM   771 C CB  . ILE B 1 48 ? 18.303 1.045   18.696  1.00 35.51  ? 483 ILE B CB  1 
ATOM   772 C CG1 . ILE B 1 48 ? 18.737 2.510   18.542  1.00 30.99  ? 483 ILE B CG1 1 
ATOM   773 C CG2 . ILE B 1 48 ? 18.875 0.196   17.565  1.00 28.51  ? 483 ILE B CG2 1 
ATOM   774 C CD1 . ILE B 1 48 ? 20.150 2.781   19.001  1.00 26.50  ? 483 ILE B CD1 1 
ATOM   775 N N   . LYS B 1 49 ? 16.408 -1.257  19.756  1.00 36.30  ? 484 LYS B N   1 
ATOM   776 C CA  . LYS B 1 49 ? 15.983 -2.665  19.817  1.00 36.98  ? 484 LYS B CA  1 
ATOM   777 C C   . LYS B 1 49 ? 14.474 -2.843  19.558  1.00 39.00  ? 484 LYS B C   1 
ATOM   778 O O   . LYS B 1 49 ? 14.067 -3.756  18.835  1.00 40.09  ? 484 LYS B O   1 
ATOM   779 C CB  . LYS B 1 49 ? 16.347 -3.288  21.178  1.00 39.66  ? 484 LYS B CB  1 
ATOM   780 C CG  . LYS B 1 49 ? 17.531 -4.263  21.178  1.00 33.47  ? 484 LYS B CG  1 
ATOM   781 C CD  . LYS B 1 49 ? 18.865 -3.590  20.895  1.00 38.18  ? 484 LYS B CD  1 
ATOM   782 C CE  . LYS B 1 49 ? 19.998 -4.142  21.783  1.00 39.38  ? 484 LYS B CE  1 
ATOM   783 N NZ  . LYS B 1 49 ? 20.158 -5.618  21.727  1.00 37.83  ? 484 LYS B NZ  1 
ATOM   784 N N   . LYS B 1 50 ? 13.653 -1.980  20.154  1.00 39.64  ? 485 LYS B N   1 
ATOM   785 C CA  . LYS B 1 50 ? 12.204 -2.041  19.967  1.00 39.75  ? 485 LYS B CA  1 
ATOM   786 C C   . LYS B 1 50 ? 11.827 -1.757  18.513  1.00 39.17  ? 485 LYS B C   1 
ATOM   787 O O   . LYS B 1 50 ? 10.921 -2.383  17.980  1.00 41.20  ? 485 LYS B O   1 
ATOM   788 C CB  . LYS B 1 50 ? 11.491 -1.056  20.907  1.00 46.34  ? 485 LYS B CB  1 
ATOM   789 C CG  . LYS B 1 50 ? 9.948  -1.011  20.791  1.00 52.13  ? 485 LYS B CG  1 
ATOM   790 C CD  . LYS B 1 50 ? 9.312  -2.393  20.936  1.00 62.46  ? 485 LYS B CD  1 
ATOM   791 C CE  . LYS B 1 50 ? 7.788  -2.325  20.942  1.00 65.77  ? 485 LYS B CE  1 
ATOM   792 N NZ  . LYS B 1 50 ? 7.160  -3.669  21.152  1.00 68.95  ? 485 LYS B NZ  1 
ATOM   793 N N   . TRP B 1 51 ? 12.523 -0.815  17.882  1.00 34.67  ? 486 TRP B N   1 
ATOM   794 C CA  . TRP B 1 51 ? 12.279 -0.479  16.484  1.00 35.31  ? 486 TRP B CA  1 
ATOM   795 C C   . TRP B 1 51 ? 12.574 -1.677  15.584  1.00 37.98  ? 486 TRP B C   1 
ATOM   796 O O   . TRP B 1 51 ? 11.749 -2.063  14.749  1.00 38.19  ? 486 TRP B O   1 
ATOM   797 C CB  . TRP B 1 51 ? 13.146 0.713   16.065  1.00 33.64  ? 486 TRP B CB  1 
ATOM   798 C CG  . TRP B 1 51 ? 12.891 1.199   14.669  1.00 34.53  ? 486 TRP B CG  1 
ATOM   799 C CD1 . TRP B 1 51 ? 12.105 2.246   14.305  1.00 37.98  ? 486 TRP B CD1 1 
ATOM   800 C CD2 . TRP B 1 51 ? 13.432 0.658   13.450  1.00 28.44  ? 486 TRP B CD2 1 
ATOM   801 N NE1 . TRP B 1 51 ? 12.118 2.394   12.938  1.00 39.67  ? 486 TRP B NE1 1 
ATOM   802 C CE2 . TRP B 1 51 ? 12.921 1.429   12.390  1.00 29.36  ? 486 TRP B CE2 1 
ATOM   803 C CE3 . TRP B 1 51 ? 14.293 -0.404  13.156  1.00 34.03  ? 486 TRP B CE3 1 
ATOM   804 C CZ2 . TRP B 1 51 ? 13.246 1.178   11.056  1.00 31.45  ? 486 TRP B CZ2 1 
ATOM   805 C CZ3 . TRP B 1 51 ? 14.612 -0.659  11.833  1.00 35.65  ? 486 TRP B CZ3 1 
ATOM   806 C CH2 . TRP B 1 51 ? 14.093 0.134   10.797  1.00 36.29  ? 486 TRP B CH2 1 
ATOM   807 N N   . PHE B 1 52 ? 13.761 -2.255  15.750  1.00 38.13  ? 487 PHE B N   1 
ATOM   808 C CA  . PHE B 1 52 ? 14.164 -3.413  14.954  1.00 39.40  ? 487 PHE B CA  1 
ATOM   809 C C   . PHE B 1 52 ? 13.165 -4.554  15.102  1.00 42.36  ? 487 PHE B C   1 
ATOM   810 O O   . PHE B 1 52 ? 12.589 -4.999  14.108  1.00 48.08  ? 487 PHE B O   1 
ATOM   811 C CB  . PHE B 1 52 ? 15.586 -3.872  15.317  1.00 40.39  ? 487 PHE B CB  1 
ATOM   812 C CG  . PHE B 1 52 ? 16.654 -3.260  14.452  1.00 28.70  ? 487 PHE B CG  1 
ATOM   813 C CD1 . PHE B 1 52 ? 17.051 -1.949  14.640  1.00 35.60  ? 487 PHE B CD1 1 
ATOM   814 C CD2 . PHE B 1 52 ? 17.254 -3.998  13.446  1.00 30.43  ? 487 PHE B CD2 1 
ATOM   815 C CE1 . PHE B 1 52 ? 18.033 -1.378  13.839  1.00 40.33  ? 487 PHE B CE1 1 
ATOM   816 C CE2 . PHE B 1 52 ? 18.239 -3.442  12.644  1.00 34.60  ? 487 PHE B CE2 1 
ATOM   817 C CZ  . PHE B 1 52 ? 18.627 -2.127  12.837  1.00 39.24  ? 487 PHE B CZ  1 
ATOM   818 N N   . SER B 1 53 ? 12.936 -4.994  16.338  1.00 41.49  ? 488 SER B N   1 
ATOM   819 C CA  . SER B 1 53 ? 11.970 -6.062  16.616  1.00 42.21  ? 488 SER B CA  1 
ATOM   820 C C   . SER B 1 53 ? 10.623 -5.818  15.943  1.00 40.72  ? 488 SER B C   1 
ATOM   821 O O   . SER B 1 53 ? 10.056 -6.731  15.345  1.00 42.92  ? 488 SER B O   1 
ATOM   822 C CB  . SER B 1 53 ? 11.763 -6.223  18.120  1.00 44.77  ? 488 SER B CB  1 
ATOM   823 O OG  . SER B 1 53 ? 11.271 -5.024  18.689  1.00 54.88  ? 488 SER B OG  1 
ATOM   824 N N   . ASP B 1 54 ? 10.118 -4.590  16.045  1.00 40.78  ? 489 ASP B N   1 
ATOM   825 C CA  . ASP B 1 54 ? 8.862  -4.214  15.394  1.00 43.84  ? 489 ASP B CA  1 
ATOM   826 C C   . ASP B 1 54 ? 8.969  -4.401  13.888  1.00 42.55  ? 489 ASP B C   1 
ATOM   827 O O   . ASP B 1 54 ? 8.039  -4.892  13.251  1.00 47.68  ? 489 ASP B O   1 
ATOM   828 C CB  . ASP B 1 54 ? 8.483  -2.753  15.689  1.00 43.09  ? 489 ASP B CB  1 
ATOM   829 C CG  . ASP B 1 54 ? 8.001  -2.536  17.118  1.00 54.32  ? 489 ASP B CG  1 
ATOM   830 O OD1 . ASP B 1 54 ? 7.581  -3.511  17.780  1.00 62.58  ? 489 ASP B OD1 1 
ATOM   831 O OD2 . ASP B 1 54 ? 8.038  -1.375  17.582  1.00 53.35  ? 489 ASP B OD2 1 
ATOM   832 N N   . HIS B 1 55 ? 10.103 -4.013  13.319  1.00 39.15  ? 490 HIS B N   1 
ATOM   833 C CA  . HIS B 1 55 ? 10.273 -4.076  11.871  1.00 39.20  ? 490 HIS B CA  1 
ATOM   834 C C   . HIS B 1 55 ? 10.628 -5.477  11.389  1.00 39.73  ? 490 HIS B C   1 
ATOM   835 O O   . HIS B 1 55 ? 10.396 -5.798  10.224  1.00 46.23  ? 490 HIS B O   1 
ATOM   836 C CB  . HIS B 1 55 ? 11.272 -3.021  11.390  1.00 34.87  ? 490 HIS B CB  1 
ATOM   837 C CG  . HIS B 1 55 ? 10.695 -1.642  11.353  1.00 35.47  ? 490 HIS B CG  1 
ATOM   838 N ND1 . HIS B 1 55 ? 10.277 -0.982  12.490  1.00 39.67  ? 490 HIS B ND1 1 
ATOM   839 C CD2 . HIS B 1 55 ? 10.434 -0.809  10.317  1.00 35.05  ? 490 HIS B CD2 1 
ATOM   840 C CE1 . HIS B 1 55 ? 9.794  0.202   12.158  1.00 42.50  ? 490 HIS B CE1 1 
ATOM   841 N NE2 . HIS B 1 55 ? 9.879  0.333   10.845  1.00 45.60  ? 490 HIS B NE2 1 
ATOM   842 N N   . ARG B 1 56 ? 11.158 -6.311  12.282  1.00 36.31  ? 491 ARG B N   1 
ATOM   843 C CA  . ARG B 1 56 ? 11.314 -7.744  12.002  1.00 33.37  ? 491 ARG B CA  1 
ATOM   844 C C   . ARG B 1 56 ? 9.956  -8.413  11.876  1.00 31.15  ? 491 ARG B C   1 
ATOM   845 O O   . ARG B 1 56 ? 9.735  -9.230  10.981  1.00 32.12  ? 491 ARG B O   1 
ATOM   846 C CB  . ARG B 1 56 ? 12.108 -8.442  13.107  1.00 28.21  ? 491 ARG B CB  1 
ATOM   847 C CG  . ARG B 1 56 ? 13.579 -8.077  13.128  1.00 35.34  ? 491 ARG B CG  1 
ATOM   848 C CD  . ARG B 1 56 ? 14.424 -9.190  13.732  1.00 37.45  ? 491 ARG B CD  1 
ATOM   849 N NE  . ARG B 1 56 ? 14.024 -9.485  15.103  1.00 40.62  ? 491 ARG B NE  1 
ATOM   850 C CZ  . ARG B 1 56 ? 14.349 -8.754  16.167  1.00 40.93  ? 491 ARG B CZ  1 
ATOM   851 N NH1 . ARG B 1 56 ? 15.086 -7.656  16.041  1.00 38.52  ? 491 ARG B NH1 1 
ATOM   852 N NH2 . ARG B 1 56 ? 13.919 -9.118  17.373  1.00 45.44  ? 491 ARG B NH2 1 
ATOM   853 N N   . TYR B 1 57 ? 9.059  -8.062  12.790  1.00 34.55  ? 492 TYR B N   1 
ATOM   854 C CA  . TYR B 1 57 ? 7.704  -8.597  12.804  1.00 40.39  ? 492 TYR B CA  1 
ATOM   855 C C   . TYR B 1 57 ? 6.941  -8.204  11.540  1.00 41.26  ? 492 TYR B C   1 
ATOM   856 O O   . TYR B 1 57 ? 6.348  -9.057  10.880  1.00 39.64  ? 492 TYR B O   1 
ATOM   857 C CB  . TYR B 1 57 ? 6.960  -8.111  14.049  1.00 45.02  ? 492 TYR B CB  1 
ATOM   858 C CG  . TYR B 1 57 ? 5.490  -8.455  14.073  1.00 47.42  ? 492 TYR B CG  1 
ATOM   859 C CD1 . TYR B 1 57 ? 4.522  -7.473  13.875  1.00 54.77  ? 492 TYR B CD1 1 
ATOM   860 C CD2 . TYR B 1 57 ? 5.065  -9.760  14.299  1.00 54.54  ? 492 TYR B CD2 1 
ATOM   861 C CE1 . TYR B 1 57 ? 3.171  -7.779  13.904  1.00 58.64  ? 492 TYR B CE1 1 
ATOM   862 C CE2 . TYR B 1 57 ? 3.711  -10.079 14.328  1.00 58.64  ? 492 TYR B CE2 1 
ATOM   863 C CZ  . TYR B 1 57 ? 2.769  -9.085  14.130  1.00 61.51  ? 492 TYR B CZ  1 
ATOM   864 O OH  . TYR B 1 57 ? 1.427  -9.392  14.158  1.00 62.56  ? 492 TYR B OH  1 
ATOM   865 N N   . ARG B 1 58 ? 6.974  -6.921  11.196  1.00 41.55  ? 493 ARG B N   1 
ATOM   866 C CA  . ARG B 1 58 ? 6.299  -6.444  9.991   1.00 44.64  ? 493 ARG B CA  1 
ATOM   867 C C   . ARG B 1 58 ? 6.877  -7.083  8.729   1.00 42.60  ? 493 ARG B C   1 
ATOM   868 O O   . ARG B 1 58 ? 6.128  -7.472  7.833   1.00 38.55  ? 493 ARG B O   1 
ATOM   869 C CB  . ARG B 1 58 ? 6.387  -4.925  9.881   1.00 45.17  ? 493 ARG B CB  1 
ATOM   870 C CG  . ARG B 1 58 ? 5.655  -4.162  10.974  1.00 47.07  ? 493 ARG B CG  1 
ATOM   871 C CD  . ARG B 1 58 ? 5.658  -2.679  10.655  1.00 54.34  ? 493 ARG B CD  1 
ATOM   872 N NE  . ARG B 1 58 ? 5.851  -1.836  11.826  1.00 59.28  ? 493 ARG B NE  1 
ATOM   873 C CZ  . ARG B 1 58 ? 5.990  -0.514  11.776  1.00 64.25  ? 493 ARG B CZ  1 
ATOM   874 N NH1 . ARG B 1 58 ? 5.943  0.130   10.610  1.00 67.28  ? 493 ARG B NH1 1 
ATOM   875 N NH2 . ARG B 1 58 ? 6.172  0.169   12.901  1.00 66.87  ? 493 ARG B NH2 1 
ATOM   876 N N   . CYS B 1 59 ? 8.206  -7.190  8.672   1.00 39.90  ? 494 CYS B N   1 
ATOM   877 C CA  . CYS B 1 59 ? 8.890  -7.805  7.537   1.00 38.79  ? 494 CYS B CA  1 
ATOM   878 C C   . CYS B 1 59 ? 8.398  -9.227  7.323   1.00 40.27  ? 494 CYS B C   1 
ATOM   879 O O   . CYS B 1 59 ? 7.924  -9.570  6.241   1.00 39.66  ? 494 CYS B O   1 
ATOM   880 C CB  . CYS B 1 59 ? 10.408 -7.816  7.761   1.00 37.87  ? 494 CYS B CB  1 
ATOM   881 S SG  . CYS B 1 59 ? 11.390 -8.398  6.347   1.00 36.01  ? 494 CYS B SG  1 
ATOM   882 N N   . GLN B 1 60 ? 8.501  -10.041 8.371   1.00 43.62  ? 495 GLN B N   1 
ATOM   883 C CA  . GLN B 1 60 ? 8.119  -11.458 8.308   1.00 45.82  ? 495 GLN B CA  1 
ATOM   884 C C   . GLN B 1 60 ? 6.643  -11.674 7.977   1.00 48.90  ? 495 GLN B C   1 
ATOM   885 O O   . GLN B 1 60 ? 6.301  -12.645 7.305   1.00 53.60  ? 495 GLN B O   1 
ATOM   886 C CB  . GLN B 1 60 ? 8.460  -12.179 9.623   1.00 47.20  ? 495 GLN B CB  1 
ATOM   887 C CG  . GLN B 1 60 ? 9.887  -12.708 9.689   1.00 53.68  ? 495 GLN B CG  1 
ATOM   888 C CD  . GLN B 1 60 ? 10.041 -14.078 9.042   1.00 59.12  ? 495 GLN B CD  1 
ATOM   889 O OE1 . GLN B 1 60 ? 9.472  -14.352 7.982   1.00 54.72  ? 495 GLN B OE1 1 
ATOM   890 N NE2 . GLN B 1 60 ? 10.818 -14.947 9.682   1.00 64.52  ? 495 GLN B NE2 1 
ATOM   891 N N   . ARG B 1 61 ? 5.773  -10.793 8.463   1.00 49.96  ? 496 ARG B N   1 
ATOM   892 C CA  . ARG B 1 61 ? 4.355  -10.873 8.122   1.00 54.24  ? 496 ARG B CA  1 
ATOM   893 C C   . ARG B 1 61 ? 4.154  -10.594 6.635   1.00 51.44  ? 496 ARG B C   1 
ATOM   894 O O   . ARG B 1 61 ? 3.363  -11.269 5.974   1.00 50.49  ? 496 ARG B O   1 
ATOM   895 C CB  . ARG B 1 61 ? 3.519  -9.910  8.975   1.00 63.53  ? 496 ARG B CB  1 
ATOM   896 C CG  . ARG B 1 61 ? 3.445  -10.288 10.459  1.00 73.09  ? 496 ARG B CG  1 
ATOM   897 C CD  . ARG B 1 61 ? 2.670  -11.593 10.703  1.00 84.97  ? 496 ARG B CD  1 
ATOM   898 N NE  . ARG B 1 61 ? 2.978  -12.193 12.005  1.00 87.68  ? 496 ARG B NE  1 
ATOM   899 C CZ  . ARG B 1 61 ? 4.115  -12.823 12.312  1.00 87.38  ? 496 ARG B CZ  1 
ATOM   900 N NH1 . ARG B 1 61 ? 5.098  -12.945 11.419  1.00 83.14  ? 496 ARG B NH1 1 
ATOM   901 N NH2 . ARG B 1 61 ? 4.276  -13.329 13.532  1.00 86.76  ? 496 ARG B NH2 1 
ATOM   902 N N   . GLY B 1 62 ? 4.883  -9.610  6.113   1.00 46.15  ? 497 GLY B N   1 
ATOM   903 C CA  . GLY B 1 62 ? 4.901  -9.347  4.682   1.00 46.36  ? 497 GLY B CA  1 
ATOM   904 C C   . GLY B 1 62 ? 5.299  -10.581 3.891   1.00 45.58  ? 497 GLY B C   1 
ATOM   905 O O   . GLY B 1 62 ? 4.600  -10.986 2.962   1.00 47.67  ? 497 GLY B O   1 
ATOM   906 N N   . ILE B 1 63 ? 6.415  -11.190 4.282   1.00 39.44  ? 498 ILE B N   1 
ATOM   907 C CA  . ILE B 1 63 ? 6.912  -12.403 3.637   1.00 40.84  ? 498 ILE B CA  1 
ATOM   908 C C   . ILE B 1 63 ? 5.938  -13.585 3.769   1.00 43.56  ? 498 ILE B C   1 
ATOM   909 O O   . ILE B 1 63 ? 5.800  -14.385 2.842   1.00 44.74  ? 498 ILE B O   1 
ATOM   910 C CB  . ILE B 1 63 ? 8.307  -12.795 4.195   1.00 39.22  ? 498 ILE B CB  1 
ATOM   911 C CG1 . ILE B 1 63 ? 9.353  -11.771 3.733   1.00 38.08  ? 498 ILE B CG1 1 
ATOM   912 C CG2 . ILE B 1 63 ? 8.705  -14.199 3.744   1.00 29.71  ? 498 ILE B CG2 1 
ATOM   913 C CD1 . ILE B 1 63 ? 10.741 -11.999 4.287   1.00 35.13  ? 498 ILE B CD1 1 
ATOM   914 N N   . VAL B 1 64 ? 5.263  -13.684 4.910   1.00 44.28  ? 499 VAL B N   1 
ATOM   915 C CA  . VAL B 1 64 ? 4.344  -14.792 5.180   1.00 45.75  ? 499 VAL B CA  1 
ATOM   916 C C   . VAL B 1 64 ? 3.013  -14.643 4.427   1.00 48.64  ? 499 VAL B C   1 
ATOM   917 O O   . VAL B 1 64 ? 2.453  -15.630 3.953   1.00 46.70  ? 499 VAL B O   1 
ATOM   918 C CB  . VAL B 1 64 ? 4.090  -14.936 6.713   1.00 46.84  ? 499 VAL B CB  1 
ATOM   919 C CG1 . VAL B 1 64 ? 2.875  -15.806 7.001   1.00 49.74  ? 499 VAL B CG1 1 
ATOM   920 C CG2 . VAL B 1 64 ? 5.326  -15.502 7.400   1.00 35.84  ? 499 VAL B CG2 1 
ATOM   921 N N   . HIS B 1 65 ? 2.526  -13.411 4.301   1.00 53.48  ? 500 HIS B N   1 
ATOM   922 C CA  . HIS B 1 65 ? 1.184  -13.153 3.767   1.00 57.19  ? 500 HIS B CA  1 
ATOM   923 C C   . HIS B 1 65 ? 1.118  -12.683 2.304   1.00 58.73  ? 500 HIS B C   1 
ATOM   924 O O   . HIS B 1 65 ? 0.019  -12.528 1.782   1.00 62.83  ? 500 HIS B O   1 
ATOM   925 C CB  . HIS B 1 65 ? 0.461  -12.123 4.643   1.00 59.11  ? 500 HIS B CB  1 
ATOM   926 C CG  . HIS B 1 65 ? 0.331  -12.530 6.079   1.00 67.43  ? 500 HIS B CG  1 
ATOM   927 N ND1 . HIS B 1 65 ? -0.185 -13.750 6.466   1.00 72.60  ? 500 HIS B ND1 1 
ATOM   928 C CD2 . HIS B 1 65 ? 0.630  -11.869 7.222   1.00 67.85  ? 500 HIS B CD2 1 
ATOM   929 C CE1 . HIS B 1 65 ? -0.184 -13.827 7.785   1.00 70.51  ? 500 HIS B CE1 1 
ATOM   930 N NE2 . HIS B 1 65 ? 0.305  -12.698 8.268   1.00 70.14  ? 500 HIS B NE2 1 
ATOM   931 N N   . ILE B 1 66 ? 2.257  -12.455 1.645   1.00 56.81  ? 501 ILE B N   1 
ATOM   932 C CA  . ILE B 1 66 ? 2.253  -11.946 0.258   1.00 57.06  ? 501 ILE B CA  1 
ATOM   933 C C   . ILE B 1 66 ? 2.818  -12.933 -0.768  1.00 55.80  ? 501 ILE B C   1 
ATOM   934 O O   . ILE B 1 66 ? 3.598  -13.818 -0.438  1.00 57.77  ? 501 ILE B O   1 
ATOM   935 C CB  . ILE B 1 66 ? 3.006  -10.609 0.140   1.00 55.86  ? 501 ILE B CB  1 
ATOM   936 C CG1 . ILE B 1 66 ? 2.256  -9.520  0.910   1.00 57.44  ? 501 ILE B CG1 1 
ATOM   937 C CG2 . ILE B 1 66 ? 3.148  -10.204 -1.319  1.00 57.43  ? 501 ILE B CG2 1 
ATOM   938 C CD1 . ILE B 1 66 ? 2.921  -8.165  0.864   1.00 55.32  ? 501 ILE B CD1 1 
HETATM 939 S S   . SO4 C 2 .  ? 10.732 -18.668 -0.428  1.00 83.59  ? 302 SO4 A S   1 
HETATM 940 O O1  . SO4 C 2 .  ? 11.183 -19.985 -0.872  1.00 76.83  ? 302 SO4 A O1  1 
HETATM 941 O O2  . SO4 C 2 .  ? 10.928 -17.697 -1.510  1.00 80.02  ? 302 SO4 A O2  1 
HETATM 942 O O3  . SO4 C 2 .  ? 11.495 -18.277 0.758   1.00 75.66  ? 302 SO4 A O3  1 
HETATM 943 O O4  . SO4 C 2 .  ? 9.310  -18.730 -0.087  1.00 88.26  ? 302 SO4 A O4  1 
HETATM 944 O O   . HOH D 3 .  ? 13.820 15.477  6.380   1.00 49.97  ? 1   HOH A O   1 
HETATM 945 O O   . HOH D 3 .  ? 15.776 11.585  19.532  1.00 49.41  ? 2   HOH A O   1 
HETATM 946 O O   . HOH D 3 .  ? 13.023 8.487   6.871   1.00 40.83  ? 4   HOH A O   1 
HETATM 947 O O   . HOH D 3 .  ? 12.895 -0.656  6.553   1.00 32.58  ? 5   HOH A O   1 
HETATM 948 O O   . HOH D 3 .  ? 20.009 -9.093  -5.125  1.00 21.09  ? 8   HOH A O   1 
HETATM 949 O O   . HOH D 3 .  ? 26.717 -8.229  1.410   1.00 29.37  ? 9   HOH A O   1 
HETATM 950 O O   . HOH D 3 .  ? 26.529 -5.789  1.427   1.00 35.97  ? 10  HOH A O   1 
HETATM 951 O O   . HOH D 3 .  ? 28.450 -13.304 -7.492  1.00 38.13  ? 11  HOH A O   1 
HETATM 952 O O   . HOH D 3 .  ? 33.080 -17.856 -0.172  1.00 35.25  ? 12  HOH A O   1 
HETATM 953 O O   . HOH D 3 .  ? 10.489 -8.466  -7.066  1.00 47.38  ? 15  HOH A O   1 
HETATM 954 O O   . HOH D 3 .  ? 11.448 -3.451  -3.103  1.00 36.63  ? 16  HOH A O   1 
HETATM 955 O O   . HOH E 3 .  ? 9.713  4.334   11.741  1.00 34.82  ? 3   HOH B O   1 
HETATM 956 O O   . HOH E 3 .  ? 21.805 -3.890  11.486  1.00 31.62  ? 6   HOH B O   1 
HETATM 957 O O   . HOH E 3 .  ? 17.171 -7.544  6.248   1.00 24.62  ? 7   HOH B O   1 
HETATM 958 O O   . HOH E 3 .  ? 21.026 -27.860 -7.078  1.00 51.69  ? 13  HOH B O   1 
HETATM 959 O O   . HOH E 3 .  ? 18.203 -26.341 -7.436  1.00 42.11  ? 14  HOH B O   1 
HETATM 960 O O   . HOH E 3 .  ? 12.895 -14.487 4.404   1.00 48.05  ? 17  HOH B O   1 
HETATM 961 O O   . HOH E 3 .  ? 25.342 -6.521  12.895  1.00 32.02  ? 18  HOH B O   1 
HETATM 962 O O   . HOH E 3 .  ? 28.364 -2.034  12.562  1.00 28.39  ? 20  HOH B O   1 
HETATM 963 O O   . HOH E 3 .  ? 18.144 -5.809  17.853  1.00 27.62  ? 21  HOH B O   1 
HETATM 964 O O   . HOH E 3 .  ? 30.124 8.605   19.524  1.00 43.02  ? 23  HOH B O   1 
HETATM 965 O O   . HOH E 3 .  ? 33.724 6.212   17.709  1.00 41.53  ? 24  HOH B O   1 
HETATM 966 O O   . HOH E 3 .  ? 5.077  -4.703  15.734  1.00 51.96  ? 25  HOH B O   1 
HETATM 967 O O   . HOH E 3 .  ? 10.874 -9.732  16.830  1.00 33.38  ? 26  HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . LYS A 11 ? 0.6685 0.6268 0.6675 0.0622  0.1000  -0.0031 446 LYS A N   
2   C CA  . LYS A 11 ? 0.6292 0.5682 0.5969 0.0556  0.0856  0.0161  446 LYS A CA  
3   C C   . LYS A 11 ? 0.6237 0.5421 0.5874 0.0722  0.0674  0.0223  446 LYS A C   
4   O O   . LYS A 11 ? 0.6531 0.5831 0.6413 0.0907  0.0560  0.0165  446 LYS A O   
5   C CB  . LYS A 11 ? 0.5838 0.5425 0.5554 0.0445  0.0839  0.0244  446 LYS A CB  
6   C CG  . LYS A 11 ? 0.6047 0.5615 0.5539 0.0277  0.0999  0.0248  446 LYS A CG  
7   C CD  . LYS A 11 ? 0.5770 0.5463 0.5274 0.0183  0.0996  0.0326  446 LYS A CD  
8   C CE  . LYS A 11 ? 0.6205 0.5752 0.5375 0.0054  0.1178  0.0327  446 LYS A CE  
9   N NZ  . LYS A 11 ? 0.6476 0.6116 0.5732 -0.0041 0.1287  0.0341  446 LYS A NZ  
10  N N   . THR A 12 ? 0.6212 0.5062 0.5518 0.0659  0.0653  0.0318  447 THR A N   
11  C CA  . THR A 12 ? 0.6223 0.4704 0.5328 0.0785  0.0548  0.0395  447 THR A CA  
12  C C   . THR A 12 ? 0.6080 0.4607 0.5144 0.0797  0.0420  0.0516  447 THR A C   
13  O O   . THR A 12 ? 0.6187 0.4993 0.5347 0.0657  0.0428  0.0553  447 THR A O   
14  C CB  . THR A 12 ? 0.6084 0.4165 0.4872 0.0657  0.0643  0.0417  447 THR A CB  
15  O OG1 . THR A 12 ? 0.8317 0.5901 0.6825 0.0785  0.0606  0.0485  447 THR A OG1 
16  C CG2 . THR A 12 ? 0.5877 0.4051 0.4588 0.0431  0.0671  0.0469  447 THR A CG2 
17  N N   . LYS A 13 ? 0.6368 0.4567 0.5230 0.0985  0.0298  0.0576  448 LYS A N   
18  C CA  . LYS A 13 ? 0.6609 0.4769 0.5339 0.1018  0.0173  0.0687  448 LYS A CA  
19  C C   . LYS A 13 ? 0.6093 0.4192 0.4645 0.0755  0.0281  0.0786  448 LYS A C   
20  O O   . LYS A 13 ? 0.5920 0.4229 0.4533 0.0693  0.0224  0.0840  448 LYS A O   
21  C CB  . LYS A 13 ? 0.7169 0.4796 0.5507 0.1279  0.0038  0.0746  448 LYS A CB  
22  C CG  . LYS A 13 ? 0.8421 0.6161 0.6979 0.1617  -0.0161 0.0609  448 LYS A CG  
23  C CD  . LYS A 13 ? 0.9295 0.6548 0.7408 0.1937  -0.0397 0.0673  448 LYS A CD  
24  C CE  . LYS A 13 ? 0.9665 0.7234 0.7902 0.1983  -0.0579 0.0680  448 LYS A CE  
25  N NZ  . LYS A 13 ? 0.9347 0.6367 0.7019 0.2304  -0.0824 0.0750  448 LYS A NZ  
26  N N   . GLU A 14 ? 0.6403 0.4235 0.4779 0.0606  0.0435  0.0773  449 GLU A N   
27  C CA  . GLU A 14 ? 0.6492 0.4301 0.4787 0.0361  0.0542  0.0792  449 GLU A CA  
28  C C   . GLU A 14 ? 0.5870 0.4189 0.4446 0.0238  0.0508  0.0756  449 GLU A C   
29  O O   . GLU A 14 ? 0.5114 0.3563 0.3705 0.0166  0.0469  0.0809  449 GLU A O   
30  C CB  . GLU A 14 ? 0.7243 0.4756 0.5421 0.0226  0.0709  0.0703  449 GLU A CB  
31  C CG  . GLU A 14 ? 0.7676 0.5240 0.5895 -0.0035 0.0824  0.0632  449 GLU A CG  
32  C CD  . GLU A 14 ? 0.8008 0.5290 0.6174 -0.0180 0.0999  0.0490  449 GLU A CD  
33  O OE1 . GLU A 14 ? 0.7982 0.5490 0.6351 -0.0374 0.1050  0.0331  449 GLU A OE1 
34  O OE2 . GLU A 14 ? 0.9595 0.6428 0.7528 -0.0086 0.1070  0.0511  449 GLU A OE2 
35  N N   . GLN A 15 ? 0.6067 0.4611 0.4802 0.0225  0.0531  0.0666  450 GLN A N   
36  C CA  . GLN A 15 ? 0.5741 0.4626 0.4597 0.0135  0.0508  0.0642  450 GLN A CA  
37  C C   . GLN A 15 ? 0.5890 0.5015 0.4885 0.0194  0.0431  0.0713  450 GLN A C   
38  O O   . GLN A 15 ? 0.5637 0.4925 0.4645 0.0114  0.0399  0.0741  450 GLN A O   
39  C CB  . GLN A 15 ? 0.5866 0.4818 0.4720 0.0117  0.0573  0.0535  450 GLN A CB  
40  C CG  . GLN A 15 ? 0.6577 0.5548 0.5535 0.0237  0.0633  0.0488  450 GLN A CG  
41  C CD  . GLN A 15 ? 0.6016 0.4896 0.4876 0.0213  0.0732  0.0365  450 GLN A CD  
42  O OE1 . GLN A 15 ? 0.6608 0.5504 0.5561 0.0296  0.0810  0.0295  450 GLN A OE1 
43  N NE2 . GLN A 15 ? 0.5064 0.3871 0.3767 0.0108  0.0720  0.0305  450 GLN A NE2 
44  N N   . ILE A 16 ? 0.5962 0.5106 0.5078 0.0344  0.0387  0.0716  451 ILE A N   
45  C CA  . ILE A 16 ? 0.5658 0.5040 0.4960 0.0399  0.0299  0.0739  451 ILE A CA  
46  C C   . ILE A 16 ? 0.5417 0.4705 0.4571 0.0378  0.0208  0.0843  451 ILE A C   
47  O O   . ILE A 16 ? 0.6097 0.5592 0.5354 0.0332  0.0164  0.0868  451 ILE A O   
48  C CB  . ILE A 16 ? 0.5548 0.5025 0.5086 0.0600  0.0227  0.0649  451 ILE A CB  
49  C CG1 . ILE A 16 ? 0.5377 0.5059 0.5165 0.0581  0.0363  0.0510  451 ILE A CG1 
50  C CG2 . ILE A 16 ? 0.4911 0.4624 0.4653 0.0666  0.0096  0.0637  451 ILE A CG2 
51  C CD1 . ILE A 16 ? 0.6022 0.5940 0.6204 0.0762  0.0303  0.0346  451 ILE A CD1 
52  N N   . ALA A 17 ? 0.5499 0.4429 0.4381 0.0399  0.0213  0.0895  452 ALA A N   
53  C CA  . ALA A 17 ? 0.5598 0.4370 0.4277 0.0348  0.0191  0.0980  452 ALA A CA  
54  C C   . ALA A 17 ? 0.4927 0.3906 0.3690 0.0152  0.0243  0.0967  452 ALA A C   
55  O O   . ALA A 17 ? 0.5258 0.4346 0.4037 0.0121  0.0192  0.1008  452 ALA A O   
56  C CB  . ALA A 17 ? 0.5615 0.3856 0.3914 0.0364  0.0271  0.1024  452 ALA A CB  
57  N N   . HIS A 18 ? 0.5165 0.4196 0.3980 0.0048  0.0320  0.0888  453 HIS A N   
58  C CA  . HIS A 18 ? 0.4929 0.4157 0.3822 -0.0079 0.0315  0.0832  453 HIS A CA  
59  C C   . HIS A 18 ? 0.4678 0.4165 0.3669 -0.0053 0.0234  0.0861  453 HIS A C   
60  O O   . HIS A 18 ? 0.5143 0.4745 0.4158 -0.0102 0.0183  0.0860  453 HIS A O   
61  C CB  . HIS A 18 ? 0.4713 0.3931 0.3616 -0.0148 0.0366  0.0702  453 HIS A CB  
62  C CG  . HIS A 18 ? 0.4716 0.3688 0.3565 -0.0244 0.0484  0.0626  453 HIS A CG  
63  N ND1 . HIS A 18 ? 0.4430 0.3350 0.3299 -0.0366 0.0552  0.0585  453 HIS A ND1 
64  C CD2 . HIS A 18 ? 0.5821 0.4551 0.4595 -0.0256 0.0582  0.0567  453 HIS A CD2 
65  C CE1 . HIS A 18 ? 0.5713 0.4349 0.4516 -0.0471 0.0715  0.0500  453 HIS A CE1 
66  N NE2 . HIS A 18 ? 0.5214 0.3717 0.3947 -0.0400 0.0725  0.0495  453 HIS A NE2 
67  N N   . LEU A 19 ? 0.4882 0.4436 0.3932 0.0015  0.0247  0.0868  454 LEU A N   
68  C CA  . LEU A 19 ? 0.4670 0.4382 0.3775 0.0007  0.0240  0.0885  454 LEU A CA  
69  C C   . LEU A 19 ? 0.4218 0.4035 0.3433 0.0024  0.0169  0.0942  454 LEU A C   
70  O O   . LEU A 19 ? 0.3394 0.3279 0.2591 -0.0021 0.0142  0.0965  454 LEU A O   
71  C CB  . LEU A 19 ? 0.4482 0.4228 0.3662 0.0038  0.0342  0.0836  454 LEU A CB  
72  C CG  . LEU A 19 ? 0.4627 0.4245 0.3642 0.0024  0.0420  0.0772  454 LEU A CG  
73  C CD1 . LEU A 19 ? 0.3611 0.3258 0.2751 0.0065  0.0546  0.0701  454 LEU A CD1 
74  C CD2 . LEU A 19 ? 0.5076 0.4614 0.3824 -0.0021 0.0415  0.0766  454 LEU A CD2 
75  N N   . LYS A 20 ? 0.4202 0.3991 0.3483 0.0113  0.0120  0.0955  455 LYS A N   
76  C CA  . LYS A 20 ? 0.4594 0.4470 0.3949 0.0157  0.0022  0.0983  455 LYS A CA  
77  C C   . LYS A 20 ? 0.4645 0.4446 0.3847 0.0086  -0.0004 0.1038  455 LYS A C   
78  O O   . LYS A 20 ? 0.3868 0.3795 0.3131 0.0049  -0.0043 0.1049  455 LYS A O   
79  C CB  . LYS A 20 ? 0.4886 0.4674 0.4241 0.0324  -0.0074 0.0967  455 LYS A CB  
80  C CG  . LYS A 20 ? 0.5298 0.5276 0.4948 0.0427  -0.0086 0.0850  455 LYS A CG  
81  C CD  . LYS A 20 ? 0.5979 0.5893 0.5632 0.0659  -0.0268 0.0801  455 LYS A CD  
82  C CE  . LYS A 20 ? 0.6065 0.6224 0.6106 0.0789  -0.0296 0.0621  455 LYS A CE  
83  N NZ  . LYS A 20 ? 0.6110 0.6173 0.6117 0.1085  -0.0535 0.0544  455 LYS A NZ  
84  N N   . ALA A 21 ? 0.5031 0.4617 0.4052 0.0055  0.0045  0.1049  456 ALA A N   
85  C CA  . ALA A 21 ? 0.4271 0.3808 0.3208 -0.0045 0.0076  0.1047  456 ALA A CA  
86  C C   . ALA A 21 ? 0.3807 0.3577 0.2880 -0.0106 0.0038  0.1007  456 ALA A C   
87  O O   . ALA A 21 ? 0.4081 0.3932 0.3181 -0.0120 -0.0008 0.1020  456 ALA A O   
88  C CB  . ALA A 21 ? 0.4493 0.3818 0.3322 -0.0129 0.0200  0.0994  456 ALA A CB  
89  N N   . SER A 22 ? 0.3394 0.3219 0.2494 -0.0119 0.0047  0.0955  457 SER A N   
90  C CA  . SER A 22 ? 0.3771 0.3701 0.2869 -0.0125 -0.0016 0.0918  457 SER A CA  
91  C C   . SER A 22 ? 0.4052 0.4025 0.3152 -0.0098 -0.0043 0.0989  457 SER A C   
92  O O   . SER A 22 ? 0.3967 0.3973 0.3050 -0.0098 -0.0105 0.0987  457 SER A O   
93  C CB  . SER A 22 ? 0.3237 0.3117 0.2235 -0.0106 -0.0010 0.0855  457 SER A CB  
94  O OG  . SER A 22 ? 0.3083 0.2968 0.1963 -0.0064 -0.0107 0.0810  457 SER A OG  
95  N N   . PHE A 23 ? 0.3932 0.3908 0.3089 -0.0080 0.0014  0.1020  458 PHE A N   
96  C CA  . PHE A 23 ? 0.3630 0.3662 0.2869 -0.0093 0.0038  0.1038  458 PHE A CA  
97  C C   . PHE A 23 ? 0.3700 0.3823 0.3040 -0.0089 -0.0045 0.1055  458 PHE A C   
98  O O   . PHE A 23 ? 0.4418 0.4550 0.3765 -0.0120 -0.0049 0.1061  458 PHE A O   
99  C CB  . PHE A 23 ? 0.3849 0.3951 0.3263 -0.0080 0.0124  0.0995  458 PHE A CB  
100 C CG  . PHE A 23 ? 0.3896 0.4086 0.3482 -0.0135 0.0206  0.0950  458 PHE A CG  
101 C CD1 . PHE A 23 ? 0.4059 0.4090 0.3493 -0.0218 0.0370  0.0946  458 PHE A CD1 
102 C CD2 . PHE A 23 ? 0.3378 0.3766 0.3248 -0.0108 0.0133  0.0889  458 PHE A CD2 
103 C CE1 . PHE A 23 ? 0.4622 0.4684 0.4220 -0.0315 0.0514  0.0880  458 PHE A CE1 
104 C CE2 . PHE A 23 ? 0.3574 0.4081 0.3687 -0.0187 0.0229  0.0793  458 PHE A CE2 
105 C CZ  . PHE A 23 ? 0.3804 0.4146 0.3803 -0.0313 0.0448  0.0786  458 PHE A CZ  
106 N N   . LEU A 24 ? 0.3524 0.3648 0.2877 -0.0045 -0.0099 0.1062  459 LEU A N   
107 C CA  . LEU A 24 ? 0.3531 0.3691 0.2904 -0.0019 -0.0179 0.1071  459 LEU A CA  
108 C C   . LEU A 24 ? 0.3687 0.3807 0.2954 -0.0067 -0.0193 0.1080  459 LEU A C   
109 O O   . LEU A 24 ? 0.3564 0.3700 0.2818 -0.0055 -0.0244 0.1081  459 LEU A O   
110 C CB  . LEU A 24 ? 0.3860 0.3926 0.3163 0.0087  -0.0236 0.1075  459 LEU A CB  
111 C CG  . LEU A 24 ? 0.4271 0.4454 0.3777 0.0183  -0.0276 0.1007  459 LEU A CG  
112 C CD1 . LEU A 24 ? 0.2551 0.2557 0.1889 0.0352  -0.0386 0.1008  459 LEU A CD1 
113 C CD2 . LEU A 24 ? 0.3500 0.3932 0.3300 0.0161  -0.0310 0.0918  459 LEU A CD2 
114 N N   . GLN A 25 ? 0.3810 0.3905 0.3034 -0.0112 -0.0154 0.1051  460 GLN A N   
115 C CA  . GLN A 25 ? 0.4240 0.4362 0.3465 -0.0157 -0.0156 0.0994  460 GLN A CA  
116 C C   . GLN A 25 ? 0.4312 0.4500 0.3571 -0.0147 -0.0217 0.0999  460 GLN A C   
117 O O   . GLN A 25 ? 0.4719 0.4878 0.3933 -0.0163 -0.0201 0.0992  460 GLN A O   
118 C CB  . GLN A 25 ? 0.4478 0.4665 0.3753 -0.0165 -0.0178 0.0900  460 GLN A CB  
119 C CG  . GLN A 25 ? 0.5455 0.5602 0.4737 -0.0201 -0.0112 0.0837  460 GLN A CG  
120 C CD  . GLN A 25 ? 0.5699 0.5950 0.5051 -0.0176 -0.0191 0.0693  460 GLN A CD  
121 O OE1 . GLN A 25 ? 0.6790 0.7183 0.6292 -0.0181 -0.0240 0.0556  460 GLN A OE1 
122 N NE2 . GLN A 25 ? 0.4873 0.5056 0.4116 -0.0131 -0.0216 0.0694  460 GLN A NE2 
123 N N   . SER A 26 ? 0.3480 0.3690 0.2759 -0.0124 -0.0264 0.1011  461 SER A N   
124 C CA  . SER A 26 ? 0.3812 0.4042 0.3111 -0.0116 -0.0316 0.1000  461 SER A CA  
125 C C   . SER A 26 ? 0.4281 0.4541 0.3636 -0.0125 -0.0327 0.1024  461 SER A C   
126 O O   . SER A 26 ? 0.4988 0.5252 0.4368 -0.0130 -0.0361 0.1005  461 SER A O   
127 C CB  . SER A 26 ? 0.3861 0.3978 0.3058 -0.0080 -0.0345 0.1006  461 SER A CB  
128 O OG  . SER A 26 ? 0.4091 0.4106 0.3233 -0.0107 -0.0267 0.1060  461 SER A OG  
129 N N   . GLN A 27 ? 0.4692 0.4967 0.4068 -0.0105 -0.0323 0.1041  462 GLN A N   
130 C CA  . GLN A 27 ? 0.4495 0.4828 0.3932 -0.0067 -0.0393 0.1013  462 GLN A CA  
131 C C   . GLN A 27 ? 0.4948 0.5179 0.4184 -0.0029 -0.0427 0.1019  462 GLN A C   
132 O O   . GLN A 27 ? 0.4785 0.5015 0.3977 0.0031  -0.0519 0.0986  462 GLN A O   
133 C CB  . GLN A 27 ? 0.4465 0.4862 0.4021 -0.0010 -0.0415 0.0986  462 GLN A CB  
134 C CG  . GLN A 27 ? 0.4905 0.5358 0.4623 -0.0072 -0.0313 0.0968  462 GLN A CG  
135 C CD  . GLN A 27 ? 0.4609 0.5222 0.4591 -0.0032 -0.0319 0.0869  462 GLN A CD  
136 O OE1 . GLN A 27 ? 0.4648 0.5357 0.4718 0.0076  -0.0455 0.0796  462 GLN A OE1 
137 N NE2 . GLN A 27 ? 0.3957 0.4586 0.4054 -0.0105 -0.0174 0.0841  462 GLN A NE2 
138 N N   . PHE A 28 ? 0.5027 0.5152 0.4128 -0.0071 -0.0339 0.1036  463 PHE A N   
139 C CA  . PHE A 28 ? 0.4881 0.4841 0.3748 -0.0083 -0.0285 0.1027  463 PHE A CA  
140 C C   . PHE A 28 ? 0.4624 0.4676 0.3605 -0.0172 -0.0205 0.0951  463 PHE A C   
141 O O   . PHE A 28 ? 0.5361 0.5381 0.4350 -0.0243 -0.0084 0.0900  463 PHE A O   
142 C CB  . PHE A 28 ? 0.4763 0.4456 0.3366 -0.0071 -0.0194 0.1072  463 PHE A CB  
143 C CG  . PHE A 28 ? 0.4925 0.4530 0.3434 0.0066  -0.0309 0.1119  463 PHE A CG  
144 C CD1 . PHE A 28 ? 0.4763 0.4455 0.3443 0.0081  -0.0311 0.1128  463 PHE A CD1 
145 C CD2 . PHE A 28 ? 0.5218 0.4662 0.3473 0.0203  -0.0435 0.1124  463 PHE A CD2 
146 C CE1 . PHE A 28 ? 0.4850 0.4511 0.3519 0.0225  -0.0423 0.1128  463 PHE A CE1 
147 C CE2 . PHE A 28 ? 0.5129 0.4537 0.3354 0.0375  -0.0590 0.1115  463 PHE A CE2 
148 C CZ  . PHE A 28 ? 0.5159 0.4698 0.3628 0.0382  -0.0577 0.1110  463 PHE A CZ  
149 N N   . PRO A 29 ? 0.4473 0.4653 0.3581 -0.0164 -0.0275 0.0911  464 PRO A N   
150 C CA  . PRO A 29 ? 0.4712 0.5000 0.3960 -0.0201 -0.0240 0.0804  464 PRO A CA  
151 C C   . PRO A 29 ? 0.4789 0.5007 0.3948 -0.0276 -0.0089 0.0719  464 PRO A C   
152 O O   . PRO A 29 ? 0.5478 0.5520 0.4380 -0.0273 -0.0053 0.0756  464 PRO A O   
153 C CB  . PRO A 29 ? 0.4388 0.4727 0.3702 -0.0158 -0.0345 0.0795  464 PRO A CB  
154 C CG  . PRO A 29 ? 0.4082 0.4361 0.3298 -0.0133 -0.0401 0.0859  464 PRO A CG  
155 C CD  . PRO A 29 ? 0.4328 0.4562 0.3494 -0.0117 -0.0389 0.0928  464 PRO A CD  
156 N N   . ASP A 30 ? 0.4802 0.5144 0.4163 -0.0341 0.0008  0.0579  465 ASP A N   
157 C CA  . ASP A 30 ? 0.4925 0.5238 0.4292 -0.0453 0.0213  0.0437  465 ASP A CA  
158 C C   . ASP A 30 ? 0.4703 0.5131 0.4163 -0.0418 0.0165  0.0351  465 ASP A C   
159 O O   . ASP A 30 ? 0.4040 0.4571 0.3597 -0.0309 -0.0030 0.0387  465 ASP A O   
160 C CB  . ASP A 30 ? 0.5032 0.5525 0.4718 -0.0551 0.0341  0.0236  465 ASP A CB  
161 C CG  . ASP A 30 ? 0.4650 0.5483 0.4728 -0.0445 0.0138  0.0093  465 ASP A CG  
162 O OD1 . ASP A 30 ? 0.4001 0.5028 0.4377 -0.0488 0.0175  -0.0102 465 ASP A OD1 
163 O OD2 . ASP A 30 ? 0.4163 0.5032 0.4224 -0.0312 -0.0058 0.0157  465 ASP A OD2 
164 N N   . ASP A 31 ? 0.4886 0.5242 0.4280 -0.0517 0.0369  0.0236  466 ASP A N   
165 C CA  . ASP A 31 ? 0.5272 0.5682 0.4680 -0.0476 0.0330  0.0171  466 ASP A CA  
166 C C   . ASP A 31 ? 0.5067 0.5829 0.4946 -0.0408 0.0218  -0.0028 466 ASP A C   
167 O O   . ASP A 31 ? 0.5166 0.5967 0.5075 -0.0344 0.0145  -0.0074 466 ASP A O   
168 C CB  . ASP A 31 ? 0.5711 0.5850 0.4777 -0.0584 0.0584  0.0129  466 ASP A CB  
169 C CG  . ASP A 31 ? 0.6128 0.6190 0.5230 -0.0769 0.0919  -0.0019 466 ASP A CG  
170 O OD1 . ASP A 31 ? 0.7162 0.7531 0.6734 -0.0816 0.0937  -0.0181 466 ASP A OD1 
171 O OD2 . ASP A 31 ? 0.6089 0.5744 0.4716 -0.0869 0.1174  0.0010  466 ASP A OD2 
172 N N   . ALA A 32 ? 0.4653 0.5645 0.4871 -0.0392 0.0173  -0.0156 467 ALA A N   
173 C CA  . ALA A 32 ? 0.4191 0.5453 0.4765 -0.0237 -0.0038 -0.0322 467 ALA A CA  
174 C C   . ALA A 32 ? 0.4282 0.5382 0.4636 -0.0080 -0.0289 -0.0111 467 ALA A C   
175 O O   . ALA A 32 ? 0.4068 0.5170 0.4465 0.0056  -0.0443 -0.0155 467 ALA A O   
176 C CB  . ALA A 32 ? 0.3319 0.4853 0.4272 -0.0230 -0.0062 -0.0542 467 ALA A CB  
177 N N   . GLU A 33 ? 0.4309 0.5235 0.4421 -0.0106 -0.0304 0.0102  468 GLU A N   
178 C CA  . GLU A 33 ? 0.4013 0.4758 0.3920 -0.0012 -0.0459 0.0287  468 GLU A CA  
179 C C   . GLU A 33 ? 0.4232 0.4841 0.3978 -0.0030 -0.0455 0.0378  468 GLU A C   
180 O O   . GLU A 33 ? 0.4930 0.5420 0.4613 0.0044  -0.0561 0.0424  468 GLU A O   
181 C CB  . GLU A 33 ? 0.3788 0.4436 0.3552 -0.0050 -0.0441 0.0439  468 GLU A CB  
182 C CG  . GLU A 33 ? 0.4234 0.4693 0.3813 -0.0002 -0.0525 0.0604  468 GLU A CG  
183 C CD  . GLU A 33 ? 0.4231 0.4568 0.3741 0.0133  -0.0660 0.0582  468 GLU A CD  
184 O OE1 . GLU A 33 ? 0.3967 0.4070 0.3282 0.0142  -0.0667 0.0702  468 GLU A OE1 
185 O OE2 . GLU A 33 ? 0.3430 0.3875 0.3062 0.0237  -0.0755 0.0426  468 GLU A OE2 
186 N N   . VAL A 34 ? 0.4064 0.4641 0.3701 -0.0124 -0.0330 0.0391  469 VAL A N   
187 C CA  . VAL A 34 ? 0.4466 0.4936 0.3951 -0.0126 -0.0354 0.0433  469 VAL A CA  
188 C C   . VAL A 34 ? 0.4588 0.5115 0.4197 -0.0079 -0.0382 0.0294  469 VAL A C   
189 O O   . VAL A 34 ? 0.4769 0.5208 0.4330 -0.0044 -0.0465 0.0317  469 VAL A O   
190 C CB  . VAL A 34 ? 0.4994 0.5336 0.4213 -0.0192 -0.0237 0.0465  469 VAL A CB  
191 C CG1 . VAL A 34 ? 0.4897 0.5148 0.3954 -0.0165 -0.0299 0.0457  469 VAL A CG1 
192 C CG2 . VAL A 34 ? 0.3658 0.3898 0.2724 -0.0195 -0.0245 0.0600  469 VAL A CG2 
193 N N   . TYR A 35 ? 0.4555 0.5241 0.4363 -0.0085 -0.0300 0.0119  470 TYR A N   
194 C CA  . TYR A 35 ? 0.4338 0.5127 0.4341 -0.0011 -0.0337 -0.0061 470 TYR A CA  
195 C C   . TYR A 35 ? 0.4502 0.5218 0.4547 0.0151  -0.0550 -0.0038 470 TYR A C   
196 O O   . TYR A 35 ? 0.3838 0.4430 0.3832 0.0220  -0.0623 -0.0053 470 TYR A O   
197 C CB  . TYR A 35 ? 0.4155 0.5205 0.4481 -0.0047 -0.0208 -0.0312 470 TYR A CB  
198 C CG  . TYR A 35 ? 0.4404 0.5630 0.5031 0.0070  -0.0277 -0.0553 470 TYR A CG  
199 C CD1 . TYR A 35 ? 0.4037 0.5447 0.4970 0.0245  -0.0465 -0.0718 470 TYR A CD1 
200 C CD2 . TYR A 35 ? 0.4745 0.5932 0.5323 0.0038  -0.0181 -0.0634 470 TYR A CD2 
201 C CE1 . TYR A 35 ? 0.4456 0.6021 0.5670 0.0400  -0.0567 -0.0965 470 TYR A CE1 
202 C CE2 . TYR A 35 ? 0.4297 0.5646 0.5170 0.0161  -0.0245 -0.0872 470 TYR A CE2 
203 C CZ  . TYR A 35 ? 0.4409 0.5952 0.5614 0.0350  -0.0445 -0.1041 470 TYR A CZ  
204 O OH  . TYR A 35 ? 0.4466 0.6164 0.5970 0.0515  -0.0543 -0.1302 470 TYR A OH  
205 N N   . ARG A 36 ? 0.4408 0.5136 0.4483 0.0216  -0.0638 -0.0003 471 ARG A N   
206 C CA  . ARG A 36 ? 0.4621 0.5140 0.4569 0.0385  -0.0825 0.0049  471 ARG A CA  
207 C C   . ARG A 36 ? 0.5146 0.5344 0.4813 0.0344  -0.0819 0.0239  471 ARG A C   
208 O O   . ARG A 36 ? 0.6091 0.6023 0.5611 0.0455  -0.0908 0.0245  471 ARG A O   
209 C CB  . ARG A 36 ? 0.4703 0.5226 0.4614 0.0432  -0.0890 0.0089  471 ARG A CB  
210 C CG  . ARG A 36 ? 0.4308 0.4536 0.3975 0.0647  -0.1089 0.0117  471 ARG A CG  
211 C CD  . ARG A 36 ? 0.4201 0.4268 0.3634 0.0644  -0.1102 0.0258  471 ARG A CD  
212 N NE  . ARG A 36 ? 0.5030 0.4592 0.4012 0.0708  -0.1127 0.0433  471 ARG A NE  
213 C CZ  . ARG A 36 ? 0.5296 0.4655 0.4097 0.0548  -0.0969 0.0619  471 ARG A CZ  
214 N NH1 . ARG A 36 ? 0.5491 0.5108 0.4495 0.0359  -0.0830 0.0669  471 ARG A NH1 
215 N NH2 . ARG A 36 ? 0.6360 0.5216 0.4754 0.0586  -0.0942 0.0736  471 ARG A NH2 
216 N N   . LEU A 37 ? 0.4649 0.4856 0.4248 0.0191  -0.0713 0.0365  472 LEU A N   
217 C CA  . LEU A 37 ? 0.4872 0.4873 0.4331 0.0122  -0.0690 0.0476  472 LEU A CA  
218 C C   . LEU A 37 ? 0.5056 0.5021 0.4539 0.0111  -0.0691 0.0392  472 LEU A C   
219 O O   . LEU A 37 ? 0.5316 0.5034 0.4709 0.0117  -0.0705 0.0410  472 LEU A O   
220 C CB  . LEU A 37 ? 0.4650 0.4742 0.4106 0.0004  -0.0620 0.0568  472 LEU A CB  
221 C CG  . LEU A 37 ? 0.4548 0.4590 0.3948 0.0001  -0.0605 0.0670  472 LEU A CG  
222 C CD1 . LEU A 37 ? 0.3930 0.4103 0.3364 -0.0078 -0.0555 0.0724  472 LEU A CD1 
223 C CD2 . LEU A 37 ? 0.3661 0.3405 0.2915 0.0000  -0.0588 0.0737  472 LEU A CD2 
224 N N   . ILE A 38 ? 0.4411 0.4573 0.3980 0.0083  -0.0648 0.0293  473 ILE A N   
225 C CA  . ILE A 38 ? 0.4433 0.4567 0.4005 0.0081  -0.0646 0.0189  473 ILE A CA  
226 C C   . ILE A 38 ? 0.4902 0.4871 0.4499 0.0207  -0.0726 0.0114  473 ILE A C   
227 O O   . ILE A 38 ? 0.5344 0.5107 0.4867 0.0199  -0.0743 0.0108  473 ILE A O   
228 C CB  . ILE A 38 ? 0.4381 0.4691 0.3978 0.0045  -0.0548 0.0072  473 ILE A CB  
229 C CG1 . ILE A 38 ? 0.4755 0.5058 0.4156 -0.0046 -0.0489 0.0156  473 ILE A CG1 
230 C CG2 . ILE A 38 ? 0.3566 0.3844 0.3178 0.0073  -0.0544 -0.0071 473 ILE A CG2 
231 C CD1 . ILE A 38 ? 0.4618 0.4942 0.3882 -0.0097 -0.0334 0.0075  473 ILE A CD1 
232 N N   . GLU A 39 ? 0.5011 0.5047 0.4705 0.0339  -0.0789 0.0038  474 GLU A N   
233 C CA  . GLU A 39 ? 0.5071 0.4925 0.4753 0.0525  -0.0910 -0.0063 474 GLU A CA  
234 C C   . GLU A 39 ? 0.5076 0.4452 0.4437 0.0599  -0.0979 0.0083  474 GLU A C   
235 O O   . GLU A 39 ? 0.5624 0.4686 0.4843 0.0723  -0.1047 0.0040  474 GLU A O   
236 C CB  . GLU A 39 ? 0.5065 0.5187 0.5010 0.0684  -0.0997 -0.0266 474 GLU A CB  
237 C CG  . GLU A 39 ? 0.5147 0.5371 0.5123 0.0734  -0.1060 -0.0240 474 GLU A CG  
238 C CD  . GLU A 39 ? 0.5017 0.5610 0.5384 0.0872  -0.1144 -0.0527 474 GLU A CD  
239 O OE1 . GLU A 39 ? 0.5708 0.6421 0.6149 0.0932  -0.1225 -0.0564 474 GLU A OE1 
240 O OE2 . GLU A 39 ? 0.3624 0.4415 0.4262 0.0917  -0.1126 -0.0752 474 GLU A OE2 
241 N N   . VAL A 40 ? 0.5068 0.4334 0.4276 0.0515  -0.0932 0.0248  475 VAL A N   
242 C CA  . VAL A 40 ? 0.5205 0.3946 0.4046 0.0533  -0.0913 0.0388  475 VAL A CA  
243 C C   . VAL A 40 ? 0.5476 0.4079 0.4304 0.0313  -0.0752 0.0448  475 VAL A C   
244 O O   . VAL A 40 ? 0.5391 0.3508 0.3951 0.0291  -0.0678 0.0502  475 VAL A O   
245 C CB  . VAL A 40 ? 0.4862 0.3499 0.3511 0.0567  -0.0925 0.0507  475 VAL A CB  
246 C CG1 . VAL A 40 ? 0.4506 0.3279 0.3193 0.0803  -0.1119 0.0396  475 VAL A CG1 
247 C CG2 . VAL A 40 ? 0.4529 0.3505 0.3381 0.0367  -0.0807 0.0572  475 VAL A CG2 
248 N N   . THR A 41 ? 0.5447 0.4445 0.4547 0.0158  -0.0696 0.0413  476 THR A N   
249 C CA  . THR A 41 ? 0.5323 0.4301 0.4511 -0.0028 -0.0592 0.0399  476 THR A CA  
250 C C   . THR A 41 ? 0.5454 0.4541 0.4775 -0.0056 -0.0618 0.0256  476 THR A C   
251 O O   . THR A 41 ? 0.5214 0.4150 0.4575 -0.0170 -0.0554 0.0194  476 THR A O   
252 C CB  . THR A 41 ? 0.5102 0.4406 0.4462 -0.0143 -0.0557 0.0434  476 THR A CB  
253 O OG1 . THR A 41 ? 0.4874 0.4526 0.4344 -0.0112 -0.0626 0.0378  476 THR A OG1 
254 C CG2 . THR A 41 ? 0.5297 0.4525 0.4538 -0.0119 -0.0524 0.0561  476 THR A CG2 
255 N N   . GLY A 42 ? 0.4685 0.4028 0.4081 0.0029  -0.0688 0.0179  477 GLY A N   
256 C CA  . GLY A 42 ? 0.4881 0.4334 0.4349 0.0004  -0.0701 0.0039  477 GLY A CA  
257 C C   . GLY A 42 ? 0.4905 0.4588 0.4438 -0.0107 -0.0704 0.0008  477 GLY A C   
258 O O   . GLY A 42 ? 0.5222 0.4950 0.4762 -0.0131 -0.0733 -0.0118 477 GLY A O   
259 N N   . LEU A 43 ? 0.4737 0.4547 0.4292 -0.0147 -0.0698 0.0105  478 LEU A N   
260 C CA  . LEU A 43 ? 0.4676 0.4684 0.4257 -0.0190 -0.0749 0.0069  478 LEU A CA  
261 C C   . LEU A 43 ? 0.5058 0.5166 0.4449 -0.0124 -0.0758 0.0071  478 LEU A C   
262 O O   . LEU A 43 ? 0.5314 0.5430 0.4662 -0.0088 -0.0689 0.0123  478 LEU A O   
263 C CB  . LEU A 43 ? 0.4754 0.4834 0.4428 -0.0234 -0.0734 0.0162  478 LEU A CB  
264 C CG  . LEU A 43 ? 0.4575 0.4536 0.4421 -0.0344 -0.0655 0.0150  478 LEU A CG  
265 C CD1 . LEU A 43 ? 0.3288 0.3298 0.3172 -0.0366 -0.0601 0.0261  478 LEU A CD1 
266 C CD2 . LEU A 43 ? 0.3736 0.3818 0.3820 -0.0434 -0.0695 -0.0044 478 LEU A CD2 
267 N N   . ALA A 44 ? 0.4786 0.4939 0.4041 -0.0108 -0.0833 -0.0009 479 ALA A N   
268 C CA  . ALA A 44 ? 0.5009 0.5122 0.3936 -0.0054 -0.0804 0.0012  479 ALA A CA  
269 C C   . ALA A 44 ? 0.4934 0.5059 0.3788 -0.0046 -0.0761 0.0154  479 ALA A C   
270 O O   . ALA A 44 ? 0.4778 0.4986 0.3817 -0.0059 -0.0809 0.0217  479 ALA A O   
271 C CB  . ALA A 44 ? 0.5017 0.5081 0.3697 0.0007  -0.0939 -0.0094 479 ALA A CB  
272 N N   . ARG A 45 ? 0.5013 0.5031 0.3595 -0.0040 -0.0636 0.0187  480 ARG A N   
273 C CA  . ARG A 45 ? 0.5077 0.5044 0.3539 -0.0044 -0.0567 0.0306  480 ARG A CA  
274 C C   . ARG A 45 ? 0.5394 0.5313 0.3706 0.0037  -0.0727 0.0355  480 ARG A C   
275 O O   . ARG A 45 ? 0.5597 0.5600 0.4072 0.0038  -0.0754 0.0435  480 ARG A O   
276 C CB  . ARG A 45 ? 0.5166 0.4937 0.3288 -0.0080 -0.0361 0.0295  480 ARG A CB  
277 C CG  . ARG A 45 ? 0.5720 0.5472 0.3862 -0.0136 -0.0217 0.0377  480 ARG A CG  
278 C CD  . ARG A 45 ? 0.5907 0.5538 0.3907 -0.0239 0.0066  0.0293  480 ARG A CD  
279 N NE  . ARG A 45 ? 0.5881 0.5086 0.3238 -0.0230 0.0179  0.0322  480 ARG A NE  
280 C CZ  . ARG A 45 ? 0.6805 0.5664 0.3722 -0.0222 0.0262  0.0436  480 ARG A CZ  
281 N NH1 . ARG A 45 ? 0.6286 0.5230 0.3401 -0.0242 0.0256  0.0521  480 ARG A NH1 
282 N NH2 . ARG A 45 ? 0.8089 0.6445 0.4288 -0.0181 0.0355  0.0463  480 ARG A NH2 
283 N N   . SER A 46 ? 0.5546 0.5331 0.3544 0.0128  -0.0851 0.0281  481 SER A N   
284 C CA  . SER A 46 ? 0.5535 0.5289 0.3391 0.0265  -0.1066 0.0268  481 SER A CA  
285 C C   . SER A 46 ? 0.5233 0.5325 0.3646 0.0244  -0.1209 0.0182  481 SER A C   
286 O O   . SER A 46 ? 0.5216 0.5401 0.3731 0.0324  -0.1337 0.0171  481 SER A O   
287 C CB  . SER A 46 ? 0.5936 0.5457 0.3300 0.0404  -0.1212 0.0165  481 SER A CB  
288 O OG  . SER A 46 ? 0.6086 0.5769 0.3682 0.0365  -0.1278 0.0007  481 SER A OG  
289 N N   . GLU A 47 ? 0.5583 0.5826 0.4347 0.0134  -0.1165 0.0103  482 GLU A N   
290 C CA  . GLU A 47 ? 0.5312 0.5791 0.4583 0.0054  -0.1203 0.0017  482 GLU A CA  
291 C C   . GLU A 47 ? 0.5074 0.5599 0.4517 -0.0003 -0.1087 0.0159  482 GLU A C   
292 O O   . GLU A 47 ? 0.4854 0.5538 0.4553 -0.0002 -0.1140 0.0113  482 GLU A O   
293 C CB  . GLU A 47 ? 0.5416 0.5886 0.4882 -0.0058 -0.1121 -0.0058 482 GLU A CB  
294 C CG  . GLU A 47 ? 0.6301 0.6928 0.6174 -0.0141 -0.1178 -0.0251 482 GLU A CG  
295 C CD  . GLU A 47 ? 0.7043 0.7564 0.6963 -0.0215 -0.1128 -0.0355 482 GLU A CD  
296 O OE1 . GLU A 47 ? 0.7917 0.8258 0.7644 -0.0212 -0.1023 -0.0251 482 GLU A OE1 
297 O OE2 . GLU A 47 ? 0.7419 0.8051 0.7606 -0.0273 -0.1198 -0.0571 482 GLU A OE2 
298 N N   . ILE A 48 ? 0.4583 0.4986 0.3900 -0.0043 -0.0935 0.0299  483 ILE A N   
299 C CA  . ILE A 48 ? 0.4362 0.4773 0.3769 -0.0081 -0.0836 0.0427  483 ILE A CA  
300 C C   . ILE A 48 ? 0.4740 0.5158 0.4026 -0.0004 -0.0885 0.0485  483 ILE A C   
301 O O   . ILE A 48 ? 0.5177 0.5692 0.4664 -0.0021 -0.0878 0.0506  483 ILE A O   
302 C CB  . ILE A 48 ? 0.4274 0.4590 0.3575 -0.0101 -0.0712 0.0502  483 ILE A CB  
303 C CG1 . ILE A 48 ? 0.3998 0.4268 0.3423 -0.0134 -0.0688 0.0449  483 ILE A CG1 
304 C CG2 . ILE A 48 ? 0.3500 0.3822 0.2838 -0.0112 -0.0643 0.0609  483 ILE A CG2 
305 C CD1 . ILE A 48 ? 0.3651 0.3890 0.3008 -0.0105 -0.0628 0.0422  483 ILE A CD1 
306 N N   . LYS A 49 ? 0.5000 0.5255 0.3905 0.0082  -0.0914 0.0508  484 LYS A N   
307 C CA  . LYS A 49 ? 0.5109 0.5243 0.3769 0.0188  -0.0968 0.0570  484 LYS A CA  
308 C C   . LYS A 49 ? 0.4984 0.5292 0.3852 0.0297  -0.1174 0.0461  484 LYS A C   
309 O O   . LYS A 49 ? 0.4890 0.5254 0.3870 0.0335  -0.1188 0.0496  484 LYS A O   
310 C CB  . LYS A 49 ? 0.5924 0.5713 0.4000 0.0272  -0.0952 0.0598  484 LYS A CB  
311 C CG  . LYS A 49 ? 0.5255 0.4805 0.3066 0.0199  -0.0721 0.0716  484 LYS A CG  
312 C CD  . LYS A 49 ? 0.5489 0.5121 0.3459 0.0052  -0.0530 0.0683  484 LYS A CD  
313 C CE  . LYS A 49 ? 0.5297 0.4747 0.3094 -0.0042 -0.0285 0.0729  484 LYS A CE  
314 N NZ  . LYS A 49 ? 0.5802 0.4785 0.2957 -0.0002 -0.0183 0.0765  484 LYS A NZ  
315 N N   . LYS A 50 ? 0.4637 0.5055 0.3593 0.0352  -0.1339 0.0293  485 LYS A N   
316 C CA  . LYS A 50 ? 0.4936 0.5611 0.4217 0.0455  -0.1555 0.0103  485 LYS A CA  
317 C C   . LYS A 50 ? 0.4466 0.5430 0.4329 0.0308  -0.1434 0.0062  485 LYS A C   
318 O O   . LYS A 50 ? 0.4470 0.5608 0.4574 0.0385  -0.1519 -0.0023 485 LYS A O   
319 C CB  . LYS A 50 ? 0.5328 0.6127 0.4709 0.0496  -0.1731 -0.0121 485 LYS A CB  
320 C CG  . LYS A 50 ? 0.6325 0.6807 0.5058 0.0693  -0.1899 -0.0127 485 LYS A CG  
321 C CD  . LYS A 50 ? 0.6572 0.7167 0.5404 0.0690  -0.2028 -0.0341 485 LYS A CD  
322 C CE  . LYS A 50 ? 0.7507 0.7691 0.5612 0.0795  -0.2053 -0.0287 485 LYS A CE  
323 N NZ  . LYS A 50 ? 0.8942 0.8858 0.6470 0.1103  -0.2345 -0.0349 485 LYS A NZ  
324 N N   . TRP A 51 ? 0.4058 0.5020 0.4096 0.0112  -0.1230 0.0117  486 TRP A N   
325 C CA  . TRP A 51 ? 0.4083 0.5171 0.4516 -0.0044 -0.1060 0.0103  486 TRP A CA  
326 C C   . TRP A 51 ? 0.4245 0.5286 0.4600 -0.0015 -0.0983 0.0248  486 TRP A C   
327 O O   . TRP A 51 ? 0.4531 0.5754 0.5210 -0.0035 -0.0956 0.0157  486 TRP A O   
328 C CB  . TRP A 51 ? 0.4000 0.4919 0.4409 -0.0203 -0.0871 0.0180  486 TRP A CB  
329 C CG  . TRP A 51 ? 0.3672 0.4576 0.4352 -0.0370 -0.0669 0.0156  486 TRP A CG  
330 C CD1 . TRP A 51 ? 0.3915 0.4861 0.4909 -0.0518 -0.0571 -0.0018 486 TRP A CD1 
331 C CD2 . TRP A 51 ? 0.3953 0.4721 0.4546 -0.0419 -0.0506 0.0302  486 TRP A CD2 
332 N NE1 . TRP A 51 ? 0.4092 0.4880 0.5149 -0.0665 -0.0324 0.0025  486 TRP A NE1 
333 C CE2 . TRP A 51 ? 0.3802 0.4480 0.4595 -0.0592 -0.0299 0.0225  486 TRP A CE2 
334 C CE3 . TRP A 51 ? 0.4170 0.4853 0.4515 -0.0340 -0.0503 0.0474  486 TRP A CE3 
335 C CZ2 . TRP A 51 ? 0.3917 0.4383 0.4590 -0.0668 -0.0096 0.0332  486 TRP A CZ2 
336 C CZ3 . TRP A 51 ? 0.3956 0.4500 0.4254 -0.0408 -0.0338 0.0561  486 TRP A CZ3 
337 C CH2 . TRP A 51 ? 0.4057 0.4474 0.4479 -0.0560 -0.0141 0.0499  486 TRP A CH2 
338 N N   . PHE A 52 ? 0.4246 0.5060 0.4212 0.0020  -0.0933 0.0440  487 PHE A N   
339 C CA  . PHE A 52 ? 0.4139 0.4882 0.4010 0.0039  -0.0855 0.0567  487 PHE A CA  
340 C C   . PHE A 52 ? 0.4008 0.4817 0.3886 0.0194  -0.0999 0.0508  487 PHE A C   
341 O O   . PHE A 52 ? 0.4598 0.5538 0.4727 0.0184  -0.0957 0.0474  487 PHE A O   
342 C CB  . PHE A 52 ? 0.4266 0.4784 0.3780 0.0032  -0.0769 0.0721  487 PHE A CB  
343 C CG  . PHE A 52 ? 0.3462 0.3943 0.3035 -0.0078 -0.0631 0.0784  487 PHE A CG  
344 C CD1 . PHE A 52 ? 0.3499 0.3958 0.3121 -0.0132 -0.0613 0.0745  487 PHE A CD1 
345 C CD2 . PHE A 52 ? 0.4067 0.4501 0.3612 -0.0098 -0.0544 0.0866  487 PHE A CD2 
346 C CE1 . PHE A 52 ? 0.4191 0.4545 0.3788 -0.0174 -0.0531 0.0795  487 PHE A CE1 
347 C CE2 . PHE A 52 ? 0.3939 0.4302 0.3471 -0.0146 -0.0471 0.0902  487 PHE A CE2 
348 C CZ  . PHE A 52 ? 0.3821 0.4126 0.3358 -0.0168 -0.0476 0.0869  487 PHE A CZ  
349 N N   . SER A 53 ? 0.4413 0.5091 0.3976 0.0355  -0.1170 0.0485  488 SER A N   
350 C CA  . SER A 53 ? 0.4963 0.5625 0.4434 0.0577  -0.1375 0.0410  488 SER A CA  
351 C C   . SER A 53 ? 0.4597 0.5671 0.4668 0.0609  -0.1486 0.0171  488 SER A C   
352 O O   . SER A 53 ? 0.3890 0.5043 0.4092 0.0725  -0.1551 0.0120  488 SER A O   
353 C CB  . SER A 53 ? 0.5485 0.5901 0.4476 0.0765  -0.1577 0.0377  488 SER A CB  
354 O OG  . SER A 53 ? 0.6888 0.6935 0.5370 0.0694  -0.1414 0.0555  488 SER A OG  
355 N N   . ASP A 54 ? 0.4155 0.5488 0.4614 0.0498  -0.1490 -0.0004 489 ASP A N   
356 C CA  . ASP A 54 ? 0.4191 0.5953 0.5314 0.0474  -0.1544 -0.0298 489 ASP A CA  
357 C C   . ASP A 54 ? 0.3989 0.5857 0.5444 0.0298  -0.1276 -0.0266 489 ASP A C   
358 O O   . ASP A 54 ? 0.4475 0.6624 0.6357 0.0349  -0.1310 -0.0458 489 ASP A O   
359 C CB  . ASP A 54 ? 0.4097 0.6040 0.5534 0.0331  -0.1531 -0.0485 489 ASP A CB  
360 C CG  . ASP A 54 ? 0.3980 0.6403 0.6163 0.0303  -0.1597 -0.0871 489 ASP A CG  
361 O OD1 . ASP A 54 ? 0.3599 0.6155 0.6220 0.0037  -0.1316 -0.0960 489 ASP A OD1 
362 O OD2 . ASP A 54 ? 0.6420 0.9065 0.8740 0.0554  -0.1926 -0.1107 489 ASP A OD2 
363 N N   . HIS A 55 ? 0.4036 0.5665 0.5276 0.0109  -0.1021 -0.0044 490 HIS A N   
364 C CA  . HIS A 55 ? 0.3913 0.5541 0.5336 -0.0059 -0.0753 -0.0001 490 HIS A CA  
365 C C   . HIS A 55 ? 0.3845 0.5391 0.5094 0.0052  -0.0756 0.0120  490 HIS A C   
366 O O   . HIS A 55 ? 0.3667 0.5329 0.5187 -0.0014 -0.0609 0.0050  490 HIS A O   
367 C CB  . HIS A 55 ? 0.4344 0.5686 0.5521 -0.0243 -0.0531 0.0174  490 HIS A CB  
368 C CG  . HIS A 55 ? 0.4757 0.6144 0.6214 -0.0421 -0.0404 0.0020  490 HIS A CG  
369 N ND1 . HIS A 55 ? 0.4458 0.5757 0.6084 -0.0626 -0.0111 -0.0029 490 HIS A ND1 
370 C CD2 . HIS A 55 ? 0.4686 0.6149 0.6255 -0.0436 -0.0504 -0.0110 490 HIS A CD2 
371 C CE1 . HIS A 55 ? 0.4647 0.5940 0.6478 -0.0773 -0.0017 -0.0178 490 HIS A CE1 
372 N NE2 . HIS A 55 ? 0.4586 0.6009 0.6419 -0.0659 -0.0267 -0.0237 490 HIS A NE2 
373 N N   . ARG A 56 ? 0.4028 0.5343 0.4816 0.0206  -0.0891 0.0284  491 ARG A N   
374 C CA  . ARG A 56 ? 0.4119 0.5311 0.4715 0.0333  -0.0918 0.0375  491 ARG A CA  
375 C C   . ARG A 56 ? 0.4163 0.5618 0.5110 0.0510  -0.1091 0.0149  491 ARG A C   
376 O O   . ARG A 56 ? 0.4516 0.6066 0.5671 0.0518  -0.1010 0.0105  491 ARG A O   
377 C CB  . ARG A 56 ? 0.4499 0.5336 0.4518 0.0454  -0.1008 0.0548  491 ARG A CB  
378 C CG  . ARG A 56 ? 0.4646 0.5269 0.4382 0.0300  -0.0836 0.0728  491 ARG A CG  
379 C CD  . ARG A 56 ? 0.5106 0.5378 0.4350 0.0370  -0.0824 0.0865  491 ARG A CD  
380 N NE  . ARG A 56 ? 0.5659 0.5732 0.4556 0.0526  -0.0984 0.0845  491 ARG A NE  
381 C CZ  . ARG A 56 ? 0.5546 0.5485 0.4195 0.0488  -0.0970 0.0868  491 ARG A CZ  
382 N NH1 . ARG A 56 ? 0.5413 0.5436 0.4180 0.0311  -0.0822 0.0899  491 ARG A NH1 
383 N NH2 . ARG A 56 ? 0.6844 0.6533 0.5084 0.0654  -0.1118 0.0846  491 ARG A NH2 
384 N N   . TYR A 57 ? 0.4098 0.5677 0.5113 0.0672  -0.1348 -0.0020 492 TYR A N   
385 C CA  . TYR A 57 ? 0.4379 0.6261 0.5776 0.0898  -0.1594 -0.0305 492 TYR A CA  
386 C C   . TYR A 57 ? 0.3870 0.6209 0.6034 0.0737  -0.1419 -0.0557 492 TYR A C   
387 O O   . TYR A 57 ? 0.3397 0.5924 0.5856 0.0863  -0.1469 -0.0706 492 TYR A O   
388 C CB  . TYR A 57 ? 0.4862 0.6835 0.6239 0.1075  -0.1906 -0.0490 492 TYR A CB  
389 C CG  . TYR A 57 ? 0.5021 0.7455 0.6987 0.1289  -0.2191 -0.0895 492 TYR A CG  
390 C CD1 . TYR A 57 ? 0.5315 0.8263 0.8035 0.1133  -0.2158 -0.1233 492 TYR A CD1 
391 C CD2 . TYR A 57 ? 0.5898 0.8239 0.7675 0.1660  -0.2499 -0.0972 492 TYR A CD2 
392 C CE1 . TYR A 57 ? 0.5171 0.8627 0.8548 0.1327  -0.2429 -0.1679 492 TYR A CE1 
393 C CE2 . TYR A 57 ? 0.5892 0.8706 0.8265 0.1906  -0.2814 -0.1399 492 TYR A CE2 
394 C CZ  . TYR A 57 ? 0.5897 0.9315 0.9119 0.1732  -0.2780 -0.1772 492 TYR A CZ  
395 O OH  . TYR A 57 ? 0.6346 1.0319 1.0278 0.1969  -0.3097 -0.2267 492 TYR A OH  
396 N N   . ARG A 58 ? 0.3650 0.6118 0.6102 0.0453  -0.1186 -0.0610 493 ARG A N   
397 C CA  . ARG A 58 ? 0.3769 0.6576 0.6884 0.0239  -0.0928 -0.0852 493 ARG A CA  
398 C C   . ARG A 58 ? 0.3469 0.6081 0.6439 0.0109  -0.0627 -0.0671 493 ARG A C   
399 O O   . ARG A 58 ? 0.3061 0.5931 0.6491 0.0076  -0.0500 -0.0877 493 ARG A O   
400 C CB  . ARG A 58 ? 0.3743 0.6596 0.7080 -0.0036 -0.0729 -0.0943 493 ARG A CB  
401 C CG  . ARG A 58 ? 0.4291 0.7457 0.7966 0.0067  -0.1010 -0.1237 493 ARG A CG  
402 C CD  . ARG A 58 ? 0.4275 0.7563 0.8367 -0.0243 -0.0758 -0.1431 493 ARG A CD  
403 N NE  . ARG A 58 ? 0.3590 0.6474 0.7151 -0.0344 -0.0698 -0.1166 493 ARG A NE  
404 C CZ  . ARG A 58 ? 0.4173 0.6911 0.7820 -0.0628 -0.0410 -0.1190 493 ARG A CZ  
405 N NH1 . ARG A 58 ? 0.4043 0.6954 0.8247 -0.0883 -0.0098 -0.1452 493 ARG A NH1 
406 N NH2 . ARG A 58 ? 0.5271 0.7644 0.8422 -0.0660 -0.0409 -0.0959 493 ARG A NH2 
407 N N   . CYS A 59 ? 0.3365 0.5541 0.5716 0.0047  -0.0523 -0.0322 494 CYS A N   
408 C CA  . CYS A 59 ? 0.3700 0.5652 0.5823 -0.0041 -0.0290 -0.0148 494 CYS A CA  
409 C C   . CYS A 59 ? 0.4292 0.6333 0.6483 0.0163  -0.0408 -0.0198 494 CYS A C   
410 O O   . CYS A 59 ? 0.4335 0.6475 0.6771 0.0091  -0.0213 -0.0291 494 CYS A O   
411 C CB  . CYS A 59 ? 0.3448 0.4978 0.4935 -0.0077 -0.0255 0.0179  494 CYS A CB  
412 S SG  . CYS A 59 ? 0.3819 0.5061 0.4980 -0.0166 -0.0016 0.0365  494 CYS A SG  
413 N N   . GLN A 60 ? 0.4665 0.6612 0.6588 0.0420  -0.0710 -0.0140 495 GLN A N   
414 C CA  . GLN A 60 ? 0.4644 0.6554 0.6511 0.0658  -0.0853 -0.0164 495 GLN A CA  
415 C C   . GLN A 60 ? 0.4307 0.6684 0.6852 0.0793  -0.0966 -0.0537 495 GLN A C   
416 O O   . GLN A 60 ? 0.4191 0.6636 0.6902 0.0883  -0.0932 -0.0617 495 GLN A O   
417 C CB  . GLN A 60 ? 0.5407 0.6964 0.6695 0.0903  -0.1126 -0.0007 495 GLN A CB  
418 C CG  . GLN A 60 ? 0.6306 0.7425 0.6986 0.0782  -0.0994 0.0311  495 GLN A CG  
419 C CD  . GLN A 60 ? 0.7371 0.8299 0.7888 0.0705  -0.0799 0.0449  495 GLN A CD  
420 O OE1 . GLN A 60 ? 0.7652 0.8505 0.8077 0.0496  -0.0590 0.0572  495 GLN A OE1 
421 N NE2 . GLN A 60 ? 0.7746 0.8576 0.8210 0.0898  -0.0889 0.0411  495 GLN A NE2 
422 N N   . ARG A 61 ? 0.3829 0.6555 0.6807 0.0815  -0.1110 -0.0800 496 ARG A N   
423 C CA  . ARG A 61 ? 0.4500 0.7780 0.8278 0.0921  -0.1213 -0.1241 496 ARG A CA  
424 C C   . ARG A 61 ? 0.4373 0.7904 0.8692 0.0614  -0.0786 -0.1397 496 ARG A C   
425 O O   . ARG A 61 ? 0.4404 0.8324 0.9328 0.0692  -0.0775 -0.1718 496 ARG A O   
426 C CB  . ARG A 61 ? 0.4459 0.8087 0.8629 0.0987  -0.1456 -0.1536 496 ARG A CB  
427 C CG  . ARG A 61 ? 0.4830 0.8288 0.8575 0.1398  -0.1951 -0.1528 496 ARG A CG  
428 C CD  . ARG A 61 ? 0.5391 0.9372 0.9763 0.1557  -0.2267 -0.1989 496 ARG A CD  
429 N NE  . ARG A 61 ? 0.6160 1.0691 1.1336 0.1738  -0.2399 -0.2438 496 ARG A NE  
430 C CZ  . ARG A 61 ? 0.5947 1.1107 1.1941 0.1858  -0.2644 -0.2969 496 ARG A CZ  
431 N NH1 . ARG A 61 ? 0.6191 1.1490 1.2283 0.1808  -0.2784 -0.3108 496 ARG A NH1 
432 N NH2 . ARG A 61 ? 0.5927 1.1613 1.2698 0.2032  -0.2753 -0.3401 496 ARG A NH2 
433 N N   . GLY A 62 ? 0.3956 0.7226 0.8019 0.0283  -0.0432 -0.1183 497 GLY A N   
434 C CA  . GLY A 62 ? 0.3879 0.7157 0.8165 -0.0009 0.0019  -0.1239 497 GLY A CA  
435 C C   . GLY A 62 ? 0.4030 0.7132 0.8073 0.0084  0.0090  -0.1109 497 GLY A C   
436 O O   . GLY A 62 ? 0.4617 0.7990 0.9148 0.0047  0.0267  -0.1362 497 GLY A O   
437 N N   . ILE A 63 ? 0.4208 0.6872 0.7534 0.0199  -0.0040 -0.0746 498 ILE A N   
438 C CA  . ILE A 63 ? 0.4365 0.6799 0.7387 0.0280  0.0017  -0.0600 498 ILE A CA  
439 C C   . ILE A 63 ? 0.4825 0.7523 0.8212 0.0572  -0.0205 -0.0832 498 ILE A C   
440 O O   . ILE A 63 ? 0.4951 0.7689 0.8485 0.0567  -0.0040 -0.0912 498 ILE A O   
441 C CB  . ILE A 63 ? 0.4405 0.6350 0.6656 0.0339  -0.0092 -0.0219 498 ILE A CB  
442 C CG1 . ILE A 63 ? 0.3734 0.5413 0.5629 0.0086  0.0125  -0.0014 498 ILE A CG1 
443 C CG2 . ILE A 63 ? 0.4188 0.5913 0.6176 0.0438  -0.0064 -0.0116 498 ILE A CG2 
444 C CD1 . ILE A 63 ? 0.3801 0.5095 0.5077 0.0121  0.0041  0.0282  498 ILE A CD1 
445 N N   . VAL A 64 ? 0.5340 0.8182 0.8831 0.0849  -0.0589 -0.0951 499 VAL A N   
446 C CA  . VAL A 64 ? 0.5578 0.8584 0.9307 0.1209  -0.0881 -0.1167 499 VAL A CA  
447 C C   . VAL A 64 ? 0.5914 0.9565 1.0610 0.1200  -0.0805 -0.1652 499 VAL A C   
448 O O   . VAL A 64 ? 0.6152 0.9944 1.1123 0.1366  -0.0826 -0.1828 499 VAL A O   
449 C CB  . VAL A 64 ? 0.5782 0.8640 0.9189 0.1559  -0.1350 -0.1149 499 VAL A CB  
450 C CG1 . VAL A 64 ? 0.5563 0.8907 0.9542 0.1583  -0.1529 -0.1479 499 VAL A CG1 
451 C CG2 . VAL A 64 ? 0.5889 0.8620 0.9184 0.1974  -0.1651 -0.1238 499 VAL A CG2 
452 N N   . HIS A 65 ? 0.6453 1.0495 1.1694 0.0992  -0.0693 -0.1895 500 HIS A N   
453 C CA  . HIS A 65 ? 0.6512 1.1225 1.2785 0.0925  -0.0569 -0.2426 500 HIS A CA  
454 C C   . HIS A 65 ? 0.6902 1.1620 1.3371 0.0643  -0.0062 -0.2466 500 HIS A C   
455 O O   . HIS A 65 ? 0.7133 1.2259 1.4250 0.0739  -0.0019 -0.2830 500 HIS A O   
456 C CB  . HIS A 65 ? 0.6506 1.1552 1.3261 0.0696  -0.0491 -0.2659 500 HIS A CB  
457 C CG  . HIS A 65 ? 0.6622 1.2273 1.4413 0.0451  -0.0156 -0.3177 500 HIS A CG  
458 N ND1 . HIS A 65 ? 0.7106 1.2617 1.4944 -0.0015 0.0443  -0.3145 500 HIS A ND1 
459 C CD2 . HIS A 65 ? 0.7180 1.3559 1.5997 0.0605  -0.0318 -0.3771 500 HIS A CD2 
460 C CE1 . HIS A 65 ? 0.7342 1.3447 1.6191 -0.0181 0.0693  -0.3688 500 HIS A CE1 
461 N NE2 . HIS A 65 ? 0.7323 1.4023 1.6852 0.0188  0.0230  -0.4100 500 HIS A NE2 
462 N N   . ILE A 66 ? 0.7147 1.1393 1.3030 0.0317  0.0310  -0.2112 501 ILE A N   
463 C CA  . ILE A 66 ? 0.7155 1.1249 1.3001 0.0049  0.0803  -0.2095 501 ILE A CA  
464 C C   . ILE A 66 ? 0.7107 1.0871 1.2440 0.0254  0.0707  -0.1855 501 ILE A C   
465 O O   . ILE A 66 ? 0.7309 1.1090 1.2779 0.0173  0.0991  -0.1961 501 ILE A O   
466 C CB  . ILE A 66 ? 0.7299 1.0914 1.2588 -0.0328 0.1197  -0.1808 501 ILE A CB  
467 C CG1 . ILE A 66 ? 0.7321 1.1148 1.3002 -0.0532 0.1280  -0.1996 501 ILE A CG1 
468 C CG2 . ILE A 66 ? 0.7479 1.0880 1.2669 -0.0588 0.1718  -0.1829 501 ILE A CG2 
469 C CD1 . ILE A 66 ? 0.7467 1.0779 1.2635 -0.0900 0.1716  -0.1775 501 ILE A CD1 
470 N N   . LYS B 11 ? 0.6354 0.5619 0.5600 -0.0509 -0.1075 -0.0190 446 LYS B N   
471 C CA  . LYS B 11 ? 0.6223 0.5502 0.5415 -0.0474 -0.0918 -0.0109 446 LYS B CA  
472 C C   . LYS B 11 ? 0.6366 0.5537 0.5610 -0.0577 -0.0826 -0.0085 446 LYS B C   
473 O O   . LYS B 11 ? 0.6503 0.5739 0.5961 -0.0711 -0.0792 -0.0103 446 LYS B O   
474 C CB  . LYS B 11 ? 0.6040 0.5516 0.5363 -0.0436 -0.0879 -0.0055 446 LYS B CB  
475 C CG  . LYS B 11 ? 0.5707 0.5184 0.4886 -0.0364 -0.0760 0.0003  446 LYS B CG  
476 C CD  . LYS B 11 ? 0.5711 0.5289 0.4904 -0.0317 -0.0761 0.0047  446 LYS B CD  
477 C CE  . LYS B 11 ? 0.6286 0.5713 0.5176 -0.0264 -0.0854 0.0021  446 LYS B CE  
478 N NZ  . LYS B 11 ? 0.6386 0.5795 0.5221 -0.0214 -0.0924 0.0060  446 LYS B NZ  
479 N N   . THR B 12 ? 0.6534 0.5511 0.5564 -0.0519 -0.0789 -0.0068 447 THR B N   
480 C CA  . THR B 12 ? 0.6326 0.5035 0.5234 -0.0601 -0.0740 -0.0039 447 THR B CA  
481 C C   . THR B 12 ? 0.6123 0.4901 0.5098 -0.0640 -0.0607 0.0039  447 THR B C   
482 O O   . THR B 12 ? 0.5734 0.4771 0.4853 -0.0568 -0.0565 0.0068  447 THR B O   
483 C CB  . THR B 12 ? 0.6556 0.4970 0.5179 -0.0478 -0.0818 -0.0078 447 THR B CB  
484 O OG1 . THR B 12 ? 0.7238 0.5828 0.5898 -0.0324 -0.0798 -0.0096 447 THR B OG1 
485 C CG2 . THR B 12 ? 0.6791 0.5090 0.5322 -0.0449 -0.0939 -0.0169 447 THR B CG2 
486 N N   . LYS B 13 ? 0.6383 0.4864 0.5189 -0.0764 -0.0536 0.0070  448 LYS B N   
487 C CA  . LYS B 13 ? 0.6476 0.4919 0.5242 -0.0811 -0.0402 0.0138  448 LYS B CA  
488 C C   . LYS B 13 ? 0.6498 0.4866 0.5093 -0.0618 -0.0462 0.0164  448 LYS B C   
489 O O   . LYS B 13 ? 0.6464 0.4970 0.5130 -0.0588 -0.0382 0.0209  448 LYS B O   
490 C CB  . LYS B 13 ? 0.7048 0.5051 0.5524 -0.1017 -0.0300 0.0157  448 LYS B CB  
491 C CG  . LYS B 13 ? 0.7387 0.5472 0.6077 -0.1255 -0.0206 0.0085  448 LYS B CG  
492 C CD  . LYS B 13 ? 0.8612 0.6138 0.6890 -0.1499 -0.0073 0.0096  448 LYS B CD  
493 C CE  . LYS B 13 ? 0.8641 0.6189 0.7103 -0.1747 -0.0002 -0.0014 448 LYS B CE  
494 N NZ  . LYS B 13 ? 0.8739 0.6826 0.7793 -0.1909 0.0171  -0.0126 448 LYS B NZ  
495 N N   . GLU B 14 ? 0.6404 0.4575 0.4813 -0.0482 -0.0609 0.0107  449 GLU B N   
496 C CA  . GLU B 14 ? 0.6519 0.4677 0.4863 -0.0285 -0.0691 0.0063  449 GLU B CA  
497 C C   . GLU B 14 ? 0.6212 0.4845 0.4869 -0.0214 -0.0623 0.0042  449 GLU B C   
498 O O   . GLU B 14 ? 0.5501 0.4239 0.4212 -0.0157 -0.0579 0.0056  449 GLU B O   
499 C CB  . GLU B 14 ? 0.7194 0.5117 0.5375 -0.0142 -0.0871 -0.0054 449 GLU B CB  
500 C CG  . GLU B 14 ? 0.8569 0.5863 0.6303 -0.0167 -0.0987 -0.0038 449 GLU B CG  
501 C CD  . GLU B 14 ? 0.9298 0.6392 0.6919 -0.0383 -0.0930 0.0009  449 GLU B CD  
502 O OE1 . GLU B 14 ? 0.9795 0.6418 0.7059 -0.0539 -0.0884 0.0079  449 GLU B OE1 
503 O OE2 . GLU B 14 ? 0.9451 0.6827 0.7312 -0.0411 -0.0925 -0.0038 449 GLU B OE2 
504 N N   . GLN B 15 ? 0.6020 0.4876 0.4821 -0.0229 -0.0619 0.0007  450 GLN B N   
505 C CA  . GLN B 15 ? 0.5610 0.4791 0.4576 -0.0192 -0.0550 -0.0007 450 GLN B CA  
506 C C   . GLN B 15 ? 0.5346 0.4690 0.4441 -0.0255 -0.0450 0.0094  450 GLN B C   
507 O O   . GLN B 15 ? 0.5057 0.4539 0.4205 -0.0207 -0.0385 0.0098  450 GLN B O   
508 C CB  . GLN B 15 ? 0.5833 0.5083 0.4796 -0.0215 -0.0585 -0.0049 450 GLN B CB  
509 C CG  . GLN B 15 ? 0.5894 0.5044 0.4749 -0.0136 -0.0654 -0.0181 450 GLN B CG  
510 C CD  . GLN B 15 ? 0.6012 0.5154 0.4791 -0.0172 -0.0698 -0.0216 450 GLN B CD  
511 O OE1 . GLN B 15 ? 0.5634 0.4738 0.4435 -0.0254 -0.0757 -0.0158 450 GLN B OE1 
512 N NE2 . GLN B 15 ? 0.5810 0.4986 0.4502 -0.0117 -0.0666 -0.0336 450 GLN B NE2 
513 N N   . ILE B 16 ? 0.4900 0.4237 0.4072 -0.0367 -0.0432 0.0148  451 ILE B N   
514 C CA  . ILE B 16 ? 0.4724 0.4230 0.4068 -0.0418 -0.0343 0.0207  451 ILE B CA  
515 C C   . ILE B 16 ? 0.4408 0.3826 0.3670 -0.0403 -0.0261 0.0253  451 ILE B C   
516 O O   . ILE B 16 ? 0.4587 0.4160 0.3955 -0.0387 -0.0192 0.0289  451 ILE B O   
517 C CB  . ILE B 16 ? 0.4840 0.4396 0.4366 -0.0556 -0.0323 0.0191  451 ILE B CB  
518 C CG1 . ILE B 16 ? 0.3984 0.3658 0.3627 -0.0544 -0.0447 0.0130  451 ILE B CG1 
519 C CG2 . ILE B 16 ? 0.3355 0.3095 0.3099 -0.0604 -0.0213 0.0210  451 ILE B CG2 
520 C CD1 . ILE B 16 ? 0.4560 0.4283 0.4419 -0.0683 -0.0455 0.0058  451 ILE B CD1 
521 N N   . ALA B 17 ? 0.4605 0.3723 0.3635 -0.0396 -0.0295 0.0246  452 ALA B N   
522 C CA  . ALA B 17 ? 0.5156 0.4107 0.4027 -0.0358 -0.0267 0.0277  452 ALA B CA  
523 C C   . ALA B 17 ? 0.4562 0.3711 0.3533 -0.0218 -0.0289 0.0235  452 ALA B C   
524 O O   . ALA B 17 ? 0.5212 0.4428 0.4217 -0.0208 -0.0224 0.0271  452 ALA B O   
525 C CB  . ALA B 17 ? 0.5885 0.4364 0.4391 -0.0345 -0.0363 0.0263  452 ALA B CB  
526 N N   . HIS B 18 ? 0.4912 0.4160 0.3939 -0.0130 -0.0360 0.0140  453 HIS B N   
527 C CA  . HIS B 18 ? 0.5005 0.4468 0.4165 -0.0041 -0.0339 0.0055  453 HIS B CA  
528 C C   . HIS B 18 ? 0.4939 0.4638 0.4224 -0.0102 -0.0214 0.0115  453 HIS B C   
529 O O   . HIS B 18 ? 0.4974 0.4784 0.4327 -0.0079 -0.0154 0.0096  453 HIS B O   
530 C CB  . HIS B 18 ? 0.4920 0.4452 0.4129 0.0033  -0.0395 -0.0099 453 HIS B CB  
531 C CG  . HIS B 18 ? 0.4717 0.4020 0.3831 0.0154  -0.0560 -0.0208 453 HIS B CG  
532 N ND1 . HIS B 18 ? 0.4709 0.3945 0.3835 0.0277  -0.0655 -0.0296 453 HIS B ND1 
533 C CD2 . HIS B 18 ? 0.4700 0.3778 0.3677 0.0190  -0.0680 -0.0255 453 HIS B CD2 
534 C CE1 . HIS B 18 ? 0.5158 0.4115 0.4142 0.0402  -0.0848 -0.0398 453 HIS B CE1 
535 N NE2 . HIS B 18 ? 0.4922 0.3773 0.3806 0.0346  -0.0857 -0.0369 453 HIS B NE2 
536 N N   . LEU B 19 ? 0.5057 0.4798 0.4352 -0.0171 -0.0200 0.0173  454 LEU B N   
537 C CA  . LEU B 19 ? 0.4604 0.4469 0.3942 -0.0202 -0.0139 0.0225  454 LEU B CA  
538 C C   . LEU B 19 ? 0.4214 0.4113 0.3635 -0.0221 -0.0086 0.0304  454 LEU B C   
539 O O   . LEU B 19 ? 0.3303 0.3269 0.2738 -0.0210 -0.0029 0.0328  454 LEU B O   
540 C CB  . LEU B 19 ? 0.4232 0.4085 0.3545 -0.0234 -0.0206 0.0240  454 LEU B CB  
541 C CG  . LEU B 19 ? 0.4680 0.4469 0.3853 -0.0222 -0.0242 0.0159  454 LEU B CG  
542 C CD1 . LEU B 19 ? 0.3800 0.3530 0.2908 -0.0243 -0.0345 0.0170  454 LEU B CD1 
543 C CD2 . LEU B 19 ? 0.4627 0.4442 0.3691 -0.0221 -0.0136 0.0096  454 LEU B CD2 
544 N N   . LYS B 20 ? 0.4642 0.4461 0.4086 -0.0266 -0.0087 0.0334  455 LYS B N   
545 C CA  . LYS B 20 ? 0.4685 0.4522 0.4197 -0.0306 -0.0004 0.0383  455 LYS B CA  
546 C C   . LYS B 20 ? 0.4572 0.4332 0.3979 -0.0256 0.0031  0.0391  455 LYS B C   
547 O O   . LYS B 20 ? 0.4088 0.3931 0.3556 -0.0248 0.0094  0.0419  455 LYS B O   
548 C CB  . LYS B 20 ? 0.4779 0.4498 0.4285 -0.0416 0.0034  0.0384  455 LYS B CB  
549 C CG  . LYS B 20 ? 0.5602 0.5398 0.5243 -0.0496 0.0162  0.0392  455 LYS B CG  
550 C CD  . LYS B 20 ? 0.6361 0.6069 0.6031 -0.0661 0.0249  0.0351  455 LYS B CD  
551 C CE  . LYS B 20 ? 0.7150 0.7150 0.7196 -0.0701 0.0215  0.0264  455 LYS B CE  
552 N NZ  . LYS B 20 ? 0.6673 0.6775 0.6760 -0.0575 0.0033  0.0263  455 LYS B NZ  
553 N N   . ALA B 21 ? 0.4616 0.4202 0.3869 -0.0206 -0.0040 0.0346  456 ALA B N   
554 C CA  . ALA B 21 ? 0.4451 0.3958 0.3623 -0.0128 -0.0068 0.0311  456 ALA B CA  
555 C C   . ALA B 21 ? 0.3968 0.3721 0.3307 -0.0092 -0.0021 0.0268  456 ALA B C   
556 O O   . ALA B 21 ? 0.4472 0.4237 0.3818 -0.0075 0.0015  0.0277  456 ALA B O   
557 C CB  . ALA B 21 ? 0.4705 0.4002 0.3731 -0.0035 -0.0215 0.0221  456 ALA B CB  
558 N N   . SER B 22 ? 0.3494 0.3394 0.2918 -0.0099 -0.0008 0.0218  457 SER B N   
559 C CA  . SER B 22 ? 0.3703 0.3759 0.3200 -0.0117 0.0076  0.0170  457 SER B CA  
560 C C   . SER B 22 ? 0.3967 0.4032 0.3443 -0.0163 0.0147  0.0281  457 SER B C   
561 O O   . SER B 22 ? 0.3625 0.3719 0.3119 -0.0168 0.0206  0.0278  457 SER B O   
562 C CB  . SER B 22 ? 0.3536 0.3648 0.3014 -0.0147 0.0099  0.0093  457 SER B CB  
563 O OG  . SER B 22 ? 0.3901 0.4109 0.3400 -0.0199 0.0217  0.0002  457 SER B OG  
564 N N   . PHE B 23 ? 0.4439 0.4476 0.3899 -0.0186 0.0118  0.0355  458 PHE B N   
565 C CA  . PHE B 23 ? 0.3977 0.4019 0.3452 -0.0190 0.0130  0.0426  458 PHE B CA  
566 C C   . PHE B 23 ? 0.3919 0.3978 0.3467 -0.0179 0.0182  0.0459  458 PHE B C   
567 O O   . PHE B 23 ? 0.3650 0.3702 0.3185 -0.0166 0.0213  0.0484  458 PHE B O   
568 C CB  . PHE B 23 ? 0.4274 0.4332 0.3821 -0.0193 0.0048  0.0442  458 PHE B CB  
569 C CG  . PHE B 23 ? 0.4740 0.4815 0.4351 -0.0156 -0.0001 0.0464  458 PHE B CG  
570 C CD1 . PHE B 23 ? 0.5390 0.5323 0.4803 -0.0123 -0.0080 0.0475  458 PHE B CD1 
571 C CD2 . PHE B 23 ? 0.4164 0.4354 0.4000 -0.0150 0.0025  0.0454  458 PHE B CD2 
572 C CE1 . PHE B 23 ? 0.5152 0.5035 0.4589 -0.0048 -0.0186 0.0479  458 PHE B CE1 
573 C CE2 . PHE B 23 ? 0.4331 0.4565 0.4289 -0.0082 -0.0051 0.0430  458 PHE B CE2 
574 C CZ  . PHE B 23 ? 0.4917 0.4986 0.4675 -0.0012 -0.0184 0.0444  458 PHE B CZ  
575 N N   . LEU B 24 ? 0.4118 0.4136 0.3679 -0.0191 0.0193  0.0457  459 LEU B N   
576 C CA  . LEU B 24 ? 0.3931 0.3902 0.3487 -0.0199 0.0261  0.0481  459 LEU B CA  
577 C C   . LEU B 24 ? 0.3849 0.3752 0.3308 -0.0158 0.0267  0.0460  459 LEU B C   
578 O O   . LEU B 24 ? 0.4341 0.4181 0.3755 -0.0160 0.0320  0.0481  459 LEU B O   
579 C CB  . LEU B 24 ? 0.4278 0.4121 0.3768 -0.0265 0.0291  0.0486  459 LEU B CB  
580 C CG  . LEU B 24 ? 0.4578 0.4529 0.4244 -0.0337 0.0317  0.0469  459 LEU B CG  
581 C CD1 . LEU B 24 ? 0.2846 0.2606 0.2383 -0.0455 0.0403  0.0461  459 LEU B CD1 
582 C CD2 . LEU B 24 ? 0.3690 0.3847 0.3607 -0.0318 0.0353  0.0446  459 LEU B CD2 
583 N N   . GLN B 25 ? 0.3710 0.3641 0.3164 -0.0125 0.0216  0.0391  460 GLN B N   
584 C CA  . GLN B 25 ? 0.4380 0.4299 0.3828 -0.0079 0.0193  0.0315  460 GLN B CA  
585 C C   . GLN B 25 ? 0.4312 0.4226 0.3754 -0.0087 0.0261  0.0351  460 GLN B C   
586 O O   . GLN B 25 ? 0.4640 0.4420 0.3976 -0.0057 0.0241  0.0354  460 GLN B O   
587 C CB  . GLN B 25 ? 0.4911 0.4986 0.4483 -0.0081 0.0196  0.0190  460 GLN B CB  
588 C CG  . GLN B 25 ? 0.5666 0.5756 0.5286 -0.0025 0.0096  0.0072  460 GLN B CG  
589 C CD  . GLN B 25 ? 0.5653 0.5946 0.5435 -0.0064 0.0162  -0.0081 460 GLN B CD  
590 O OE1 . GLN B 25 ? 0.7198 0.7601 0.7067 -0.0126 0.0265  -0.0147 460 GLN B OE1 
591 N NE2 . GLN B 25 ? 0.6412 0.6736 0.6220 -0.0048 0.0125  -0.0152 460 GLN B NE2 
592 N N   . SER B 26 ? 0.4013 0.4009 0.3505 -0.0126 0.0330  0.0378  461 SER B N   
593 C CA  . SER B 26 ? 0.4154 0.4125 0.3631 -0.0131 0.0384  0.0391  461 SER B CA  
594 C C   . SER B 26 ? 0.4404 0.4316 0.3858 -0.0112 0.0417  0.0469  461 SER B C   
595 O O   . SER B 26 ? 0.4106 0.3982 0.3543 -0.0104 0.0455  0.0481  461 SER B O   
596 C CB  . SER B 26 ? 0.4146 0.4119 0.3587 -0.0191 0.0441  0.0384  461 SER B CB  
597 O OG  . SER B 26 ? 0.4345 0.4270 0.3722 -0.0193 0.0418  0.0453  461 SER B OG  
598 N N   . GLN B 27 ? 0.4364 0.4269 0.3834 -0.0118 0.0417  0.0498  462 GLN B N   
599 C CA  . GLN B 27 ? 0.4326 0.4216 0.3827 -0.0128 0.0490  0.0518  462 GLN B CA  
600 C C   . GLN B 27 ? 0.4491 0.4192 0.3794 -0.0144 0.0529  0.0511  462 GLN B C   
601 O O   . GLN B 27 ? 0.3691 0.3335 0.2957 -0.0176 0.0633  0.0509  462 GLN B O   
602 C CB  . GLN B 27 ? 0.4424 0.4410 0.4067 -0.0165 0.0503  0.0512  462 GLN B CB  
603 C CG  . GLN B 27 ? 0.4735 0.4832 0.4498 -0.0130 0.0414  0.0513  462 GLN B CG  
604 C CD  . GLN B 27 ? 0.4267 0.4501 0.4251 -0.0145 0.0398  0.0469  462 GLN B CD  
605 O OE1 . GLN B 27 ? 0.4871 0.5169 0.4984 -0.0199 0.0498  0.0420  462 GLN B OE1 
606 N NE2 . GLN B 27 ? 0.4203 0.4470 0.4223 -0.0109 0.0280  0.0465  462 GLN B NE2 
607 N N   . PHE B 28 ? 0.4533 0.4112 0.3690 -0.0115 0.0436  0.0485  463 PHE B N   
608 C CA  . PHE B 28 ? 0.4861 0.4162 0.3737 -0.0096 0.0405  0.0470  463 PHE B CA  
609 C C   . PHE B 28 ? 0.4641 0.3964 0.3543 -0.0019 0.0301  0.0398  463 PHE B C   
610 O O   . PHE B 28 ? 0.5105 0.4339 0.3941 0.0047  0.0155  0.0322  463 PHE B O   
611 C CB  . PHE B 28 ? 0.4931 0.3984 0.3571 -0.0108 0.0331  0.0471  463 PHE B CB  
612 C CG  . PHE B 28 ? 0.4680 0.3727 0.3328 -0.0220 0.0453  0.0515  463 PHE B CG  
613 C CD1 . PHE B 28 ? 0.4825 0.4069 0.3687 -0.0234 0.0423  0.0514  463 PHE B CD1 
614 C CD2 . PHE B 28 ? 0.4960 0.3815 0.3415 -0.0327 0.0614  0.0533  463 PHE B CD2 
615 C CE1 . PHE B 28 ? 0.4447 0.3719 0.3374 -0.0343 0.0524  0.0524  463 PHE B CE1 
616 C CE2 . PHE B 28 ? 0.4339 0.3239 0.2875 -0.0460 0.0753  0.0528  463 PHE B CE2 
617 C CZ  . PHE B 28 ? 0.4922 0.4048 0.3721 -0.0462 0.0695  0.0520  463 PHE B CZ  
618 N N   . PRO B 29 ? 0.4752 0.4190 0.3768 -0.0023 0.0364  0.0397  464 PRO B N   
619 C CA  . PRO B 29 ? 0.4896 0.4381 0.3981 0.0016  0.0291  0.0303  464 PRO B CA  
620 C C   . PRO B 29 ? 0.5001 0.4242 0.3866 0.0094  0.0150  0.0233  464 PRO B C   
621 O O   . PRO B 29 ? 0.5053 0.4016 0.3617 0.0093  0.0177  0.0290  464 PRO B O   
622 C CB  . PRO B 29 ? 0.4986 0.4507 0.4111 -0.0013 0.0395  0.0339  464 PRO B CB  
623 C CG  . PRO B 29 ? 0.4865 0.4333 0.3927 -0.0032 0.0498  0.0426  464 PRO B CG  
624 C CD  . PRO B 29 ? 0.4947 0.4464 0.4046 -0.0057 0.0492  0.0455  464 PRO B CD  
625 N N   . ASP B 30 ? 0.4641 0.3963 0.3642 0.0161  -0.0003 0.0087  465 ASP B N   
626 C CA  . ASP B 30 ? 0.4922 0.4006 0.3741 0.0275  -0.0208 -0.0023 465 ASP B CA  
627 C C   . ASP B 30 ? 0.4714 0.3807 0.3554 0.0265  -0.0178 -0.0058 465 ASP B C   
628 O O   . ASP B 30 ? 0.4930 0.4241 0.3972 0.0173  -0.0016 -0.0025 465 ASP B O   
629 C CB  . ASP B 30 ? 0.5062 0.4287 0.4120 0.0378  -0.0414 -0.0228 465 ASP B CB  
630 C CG  . ASP B 30 ? 0.5148 0.4833 0.4705 0.0311  -0.0327 -0.0381 465 ASP B CG  
631 O OD1 . ASP B 30 ? 0.5173 0.4971 0.4828 0.0217  -0.0188 -0.0367 465 ASP B OD1 
632 O OD2 . ASP B 30 ? 0.4138 0.4037 0.3963 0.0341  -0.0390 -0.0534 465 ASP B OD2 
633 N N   . ASP B 31 ? 0.5851 0.4647 0.4428 0.0363  -0.0351 -0.0126 466 ASP B N   
634 C CA  . ASP B 31 ? 0.6154 0.4889 0.4669 0.0346  -0.0310 -0.0136 466 ASP B CA  
635 C C   . ASP B 31 ? 0.5606 0.4692 0.4564 0.0322  -0.0327 -0.0309 466 ASP B C   
636 O O   . ASP B 31 ? 0.6033 0.5092 0.4973 0.0288  -0.0273 -0.0317 466 ASP B O   
637 C CB  . ASP B 31 ? 0.7056 0.5275 0.5037 0.0438  -0.0463 -0.0132 466 ASP B CB  
638 C CG  . ASP B 31 ? 0.7455 0.5443 0.5294 0.0602  -0.0796 -0.0283 466 ASP B CG  
639 O OD1 . ASP B 31 ? 0.8718 0.7056 0.7013 0.0658  -0.0919 -0.0455 466 ASP B OD1 
640 O OD2 . ASP B 31 ? 0.7954 0.5374 0.5196 0.0676  -0.0939 -0.0248 466 ASP B OD2 
641 N N   . ALA B 32 ? 0.5472 0.4883 0.4823 0.0317  -0.0370 -0.0460 467 ALA B N   
642 C CA  . ALA B 32 ? 0.4697 0.4471 0.4478 0.0205  -0.0265 -0.0613 467 ALA B CA  
643 C C   . ALA B 32 ? 0.4629 0.4464 0.4385 0.0044  0.0012  -0.0434 467 ALA B C   
644 O O   . ALA B 32 ? 0.4677 0.4556 0.4502 -0.0064 0.0133  -0.0452 467 ALA B O   
645 C CB  . ALA B 32 ? 0.3877 0.3984 0.4082 0.0219  -0.0341 -0.0852 467 ALA B CB  
646 N N   . GLU B 33 ? 0.4770 0.4567 0.4403 0.0034  0.0086  -0.0272 468 GLU B N   
647 C CA  . GLU B 33 ? 0.4355 0.4165 0.3936 -0.0075 0.0284  -0.0114 468 GLU B CA  
648 C C   . GLU B 33 ? 0.4183 0.3787 0.3543 -0.0066 0.0344  0.0015  468 GLU B C   
649 O O   . GLU B 33 ? 0.3880 0.3461 0.3227 -0.0142 0.0454  0.0060  468 GLU B O   
650 C CB  . GLU B 33 ? 0.4120 0.3937 0.3642 -0.0063 0.0306  0.0002  468 GLU B CB  
651 C CG  . GLU B 33 ? 0.4183 0.4129 0.3799 -0.0169 0.0427  0.0020  468 GLU B CG  
652 C CD  . GLU B 33 ? 0.4046 0.3908 0.3583 -0.0271 0.0554  0.0067  468 GLU B CD  
653 O OE1 . GLU B 33 ? 0.4723 0.4438 0.4097 -0.0247 0.0581  0.0210  468 GLU B OE1 
654 O OE2 . GLU B 33 ? 0.3961 0.3890 0.3599 -0.0380 0.0624  -0.0063 468 GLU B OE2 
655 N N   . VAL B 34 ? 0.4066 0.3475 0.3208 0.0023  0.0273  0.0062  469 VAL B N   
656 C CA  . VAL B 34 ? 0.4652 0.3879 0.3595 0.0034  0.0349  0.0151  469 VAL B CA  
657 C C   . VAL B 34 ? 0.4700 0.3877 0.3653 0.0024  0.0327  0.0063  469 VAL B C   
658 O O   . VAL B 34 ? 0.5040 0.4146 0.3938 0.0000  0.0421  0.0117  469 VAL B O   
659 C CB  . VAL B 34 ? 0.5040 0.4014 0.3676 0.0091  0.0323  0.0201  469 VAL B CB  
660 C CG1 . VAL B 34 ? 0.5551 0.4367 0.4010 0.0087  0.0440  0.0250  469 VAL B CG1 
661 C CG2 . VAL B 34 ? 0.3707 0.2720 0.2340 0.0069  0.0368  0.0279  469 VAL B CG2 
662 N N   . TYR B 35 ? 0.4597 0.3813 0.3643 0.0051  0.0184  -0.0094 470 TYR B N   
663 C CA  . TYR B 35 ? 0.4861 0.4092 0.4006 0.0018  0.0154  -0.0224 470 TYR B CA  
664 C C   . TYR B 35 ? 0.4956 0.4312 0.4265 -0.0131 0.0322  -0.0218 470 TYR B C   
665 O O   . TYR B 35 ? 0.5073 0.4297 0.4290 -0.0175 0.0386  -0.0199 470 TYR B O   
666 C CB  . TYR B 35 ? 0.4997 0.4354 0.4356 0.0072  -0.0046 -0.0454 470 TYR B CB  
667 C CG  . TYR B 35 ? 0.5050 0.4506 0.4627 0.0013  -0.0079 -0.0647 470 TYR B CG  
668 C CD1 . TYR B 35 ? 0.4874 0.4659 0.4874 -0.0119 -0.0010 -0.0839 470 TYR B CD1 
669 C CD2 . TYR B 35 ? 0.6243 0.5456 0.5599 0.0069  -0.0161 -0.0659 470 TYR B CD2 
670 C CE1 . TYR B 35 ? 0.5019 0.4912 0.5257 -0.0209 -0.0016 -0.1050 470 TYR B CE1 
671 C CE2 . TYR B 35 ? 0.5930 0.5234 0.5503 0.0005  -0.0200 -0.0852 470 TYR B CE2 
672 C CZ  . TYR B 35 ? 0.5597 0.5252 0.5630 -0.0140 -0.0125 -0.1052 470 TYR B CZ  
673 O OH  . TYR B 35 ? 0.5735 0.5494 0.6013 -0.0236 -0.0139 -0.1271 470 TYR B OH  
674 N N   . ARG B 36 ? 0.4882 0.4427 0.4366 -0.0211 0.0391  -0.0234 471 ARG B N   
675 C CA  . ARG B 36 ? 0.4794 0.4341 0.4296 -0.0373 0.0559  -0.0215 471 ARG B CA  
676 C C   . ARG B 36 ? 0.4533 0.3830 0.3757 -0.0352 0.0629  -0.0017 471 ARG B C   
677 O O   . ARG B 36 ? 0.4205 0.3324 0.3300 -0.0447 0.0713  0.0001  471 ARG B O   
678 C CB  . ARG B 36 ? 0.4698 0.4430 0.4344 -0.0450 0.0623  -0.0252 471 ARG B CB  
679 C CG  . ARG B 36 ? 0.4891 0.4608 0.4544 -0.0670 0.0808  -0.0326 471 ARG B CG  
680 C CD  . ARG B 36 ? 0.5843 0.5537 0.5384 -0.0735 0.0902  -0.0242 471 ARG B CD  
681 N NE  . ARG B 36 ? 0.6768 0.6096 0.5915 -0.0780 0.0970  -0.0057 471 ARG B NE  
682 C CZ  . ARG B 36 ? 0.6877 0.6070 0.5836 -0.0663 0.0901  0.0121  471 ARG B CZ  
683 N NH1 . ARG B 36 ? 0.6915 0.6303 0.6022 -0.0527 0.0803  0.0162  471 ARG B NH1 
684 N NH2 . ARG B 36 ? 0.8374 0.7205 0.6984 -0.0683 0.0917  0.0243  471 ARG B NH2 
685 N N   . LEU B 37 ? 0.4806 0.4075 0.3941 -0.0230 0.0589  0.0107  472 LEU B N   
686 C CA  . LEU B 37 ? 0.4893 0.3998 0.3870 -0.0175 0.0628  0.0239  472 LEU B CA  
687 C C   . LEU B 37 ? 0.5372 0.4304 0.4231 -0.0125 0.0626  0.0231  472 LEU B C   
688 O O   . LEU B 37 ? 0.5637 0.4389 0.4379 -0.0117 0.0653  0.0275  472 LEU B O   
689 C CB  . LEU B 37 ? 0.4296 0.3487 0.3301 -0.0086 0.0612  0.0318  472 LEU B CB  
690 C CG  . LEU B 37 ? 0.4434 0.3741 0.3514 -0.0126 0.0613  0.0350  472 LEU B CG  
691 C CD1 . LEU B 37 ? 0.3502 0.2926 0.2645 -0.0070 0.0585  0.0379  472 LEU B CD1 
692 C CD2 . LEU B 37 ? 0.4342 0.3511 0.3318 -0.0130 0.0626  0.0423  472 LEU B CD2 
693 N N   . ILE B 38 ? 0.5299 0.4233 0.4143 -0.0079 0.0573  0.0166  473 ILE B N   
694 C CA  . ILE B 38 ? 0.5483 0.4237 0.4189 -0.0040 0.0570  0.0137  473 ILE B CA  
695 C C   . ILE B 38 ? 0.6056 0.4708 0.4758 -0.0140 0.0593  0.0083  473 ILE B C   
696 O O   . ILE B 38 ? 0.6717 0.5170 0.5283 -0.0120 0.0628  0.0126  473 ILE B O   
697 C CB  . ILE B 38 ? 0.5800 0.4502 0.4418 0.0011  0.0473  0.0054  473 ILE B CB  
698 C CG1 . ILE B 38 ? 0.5651 0.4291 0.4111 0.0083  0.0491  0.0123  473 ILE B CG1 
699 C CG2 . ILE B 38 ? 0.5021 0.3527 0.3499 0.0026  0.0453  -0.0008 473 ILE B CG2 
700 C CD1 . ILE B 38 ? 0.5666 0.4175 0.3947 0.0131  0.0355  0.0059  473 ILE B CD1 
701 N N   . GLU B 39 ? 0.5844 0.4621 0.4702 -0.0254 0.0581  -0.0032 474 GLU B N   
702 C CA  . GLU B 39 ? 0.5940 0.4608 0.4792 -0.0401 0.0639  -0.0120 474 GLU B CA  
703 C C   . GLU B 39 ? 0.5824 0.4285 0.4496 -0.0509 0.0751  -0.0025 474 GLU B C   
704 O O   . GLU B 39 ? 0.5907 0.4122 0.4424 -0.0629 0.0813  -0.0055 474 GLU B O   
705 C CB  . GLU B 39 ? 0.5809 0.4719 0.4953 -0.0510 0.0612  -0.0335 474 GLU B CB  
706 C CG  . GLU B 39 ? 0.5925 0.5086 0.5286 -0.0602 0.0670  -0.0395 474 GLU B CG  
707 C CD  . GLU B 39 ? 0.5692 0.5174 0.5449 -0.0649 0.0600  -0.0667 474 GLU B CD  
708 O OE1 . GLU B 39 ? 0.6782 0.6516 0.6762 -0.0648 0.0590  -0.0744 474 GLU B OE1 
709 O OE2 . GLU B 39 ? 0.5953 0.5444 0.5826 -0.0674 0.0538  -0.0828 474 GLU B OE2 
710 N N   . VAL B 40 ? 0.6267 0.4764 0.4903 -0.0464 0.0760  0.0087  475 VAL B N   
711 C CA  . VAL B 40 ? 0.6232 0.4438 0.4600 -0.0526 0.0812  0.0187  475 VAL B CA  
712 C C   . VAL B 40 ? 0.6279 0.4276 0.4477 -0.0340 0.0726  0.0307  475 VAL B C   
713 O O   . VAL B 40 ? 0.6390 0.4021 0.4290 -0.0350 0.0707  0.0370  475 VAL B O   
714 C CB  . VAL B 40 ? 0.5807 0.4149 0.4221 -0.0597 0.0856  0.0206  475 VAL B CB  
715 C CG1 . VAL B 40 ? 0.5307 0.3749 0.3764 -0.0416 0.0763  0.0319  475 VAL B CG1 
716 C CG2 . VAL B 40 ? 0.6732 0.4711 0.4803 -0.0780 0.0959  0.0229  475 VAL B CG2 
717 N N   . THR B 41 ? 0.5964 0.4160 0.4332 -0.0175 0.0673  0.0316  476 THR B N   
718 C CA  . THR B 41 ? 0.5925 0.4025 0.4257 0.0002  0.0612  0.0364  476 THR B CA  
719 C C   . THR B 41 ? 0.5921 0.3959 0.4247 0.0093  0.0614  0.0311  476 THR B C   
720 O O   . THR B 41 ? 0.5594 0.3482 0.3869 0.0223  0.0568  0.0307  476 THR B O   
721 C CB  . THR B 41 ? 0.5519 0.3907 0.4070 0.0100  0.0599  0.0388  476 THR B CB  
722 O OG1 . THR B 41 ? 0.4793 0.3389 0.3472 0.0110  0.0648  0.0346  476 THR B OG1 
723 C CG2 . THR B 41 ? 0.5211 0.3680 0.3778 0.0024  0.0589  0.0435  476 THR B CG2 
724 N N   . GLY B 42 ? 0.5778 0.3922 0.4152 0.0046  0.0647  0.0250  477 GLY B N   
725 C CA  . GLY B 42 ? 0.5779 0.3836 0.4090 0.0123  0.0655  0.0194  477 GLY B CA  
726 C C   . GLY B 42 ? 0.5733 0.3940 0.4128 0.0235  0.0704  0.0185  477 GLY B C   
727 O O   . GLY B 42 ? 0.4940 0.3056 0.3252 0.0296  0.0745  0.0128  477 GLY B O   
728 N N   . LEU B 43 ? 0.5713 0.4130 0.4255 0.0239  0.0723  0.0226  478 LEU B N   
729 C CA  . LEU B 43 ? 0.5622 0.4184 0.4254 0.0294  0.0812  0.0199  478 LEU B CA  
730 C C   . LEU B 43 ? 0.5766 0.4293 0.4232 0.0234  0.0844  0.0189  478 LEU B C   
731 O O   . LEU B 43 ? 0.6038 0.4546 0.4449 0.0178  0.0756  0.0201  478 LEU B O   
732 C CB  . LEU B 43 ? 0.5455 0.4233 0.4299 0.0302  0.0808  0.0236  478 LEU B CB  
733 C CG  . LEU B 43 ? 0.4760 0.3527 0.3725 0.0388  0.0717  0.0243  478 LEU B CG  
734 C CD1 . LEU B 43 ? 0.2447 0.1375 0.1538 0.0360  0.0673  0.0296  478 LEU B CD1 
735 C CD2 . LEU B 43 ? 0.4394 0.3223 0.3539 0.0525  0.0745  0.0130  478 LEU B CD2 
736 N N   . ALA B 44 ? 0.5739 0.4228 0.4109 0.0246  0.0965  0.0144  479 ALA B N   
737 C CA  . ALA B 44 ? 0.5983 0.4300 0.4051 0.0192  0.0983  0.0142  479 ALA B CA  
738 C C   . ALA B 44 ? 0.5534 0.3950 0.3639 0.0140  0.0952  0.0200  479 ALA B C   
739 O O   . ALA B 44 ? 0.5361 0.4009 0.3733 0.0133  0.0983  0.0229  479 ALA B O   
740 C CB  . ALA B 44 ? 0.6287 0.4459 0.4151 0.0177  0.1171  0.0075  479 ALA B CB  
741 N N   . ARG B 45 ? 0.6356 0.4559 0.4168 0.0120  0.0860  0.0205  480 ARG B N   
742 C CA  . ARG B 45 ? 0.6330 0.4532 0.4088 0.0085  0.0812  0.0247  480 ARG B CA  
743 C C   . ARG B 45 ? 0.5908 0.4180 0.3704 0.0014  0.1009  0.0267  480 ARG B C   
744 O O   . ARG B 45 ? 0.5628 0.4118 0.3663 -0.0008 0.1004  0.0303  480 ARG B O   
745 C CB  . ARG B 45 ? 0.6913 0.4728 0.4215 0.0105  0.0672  0.0223  480 ARG B CB  
746 C CG  . ARG B 45 ? 0.7085 0.4795 0.4249 0.0096  0.0568  0.0253  480 ARG B CG  
747 C CD  . ARG B 45 ? 0.8529 0.5782 0.5206 0.0167  0.0346  0.0202  480 ARG B CD  
748 N NE  . ARG B 45 ? 0.9333 0.6279 0.5663 0.0162  0.0262  0.0236  480 ARG B NE  
749 C CZ  . ARG B 45 ? 1.0064 0.7175 0.6618 0.0211  0.0099  0.0221  480 ARG B CZ  
750 N NH1 . ARG B 45 ? 0.9909 0.7513 0.7042 0.0246  0.0037  0.0169  480 ARG B NH1 
751 N NH2 . ARG B 45 ? 0.9913 0.6649 0.6067 0.0213  0.0013  0.0251  480 ARG B NH2 
752 N N   . SER B 46 ? 0.6268 0.4365 0.3843 -0.0034 0.1197  0.0220  481 SER B N   
753 C CA  . SER B 46 ? 0.6218 0.4392 0.3852 -0.0141 0.1434  0.0185  481 SER B CA  
754 C C   . SER B 46 ? 0.5550 0.4192 0.3778 -0.0102 0.1492  0.0135  481 SER B C   
755 O O   . SER B 46 ? 0.5664 0.4503 0.4116 -0.0170 0.1592  0.0107  481 SER B O   
756 C CB  . SER B 46 ? 0.6349 0.4214 0.3595 -0.0228 0.1665  0.0105  481 SER B CB  
757 O OG  . SER B 46 ? 0.5953 0.3929 0.3369 -0.0151 0.1714  0.0024  481 SER B OG  
758 N N   . GLU B 47 ? 0.6090 0.4865 0.4542 0.0012  0.1409  0.0110  482 GLU B N   
759 C CA  . GLU B 47 ? 0.5721 0.4838 0.4658 0.0093  0.1393  0.0054  482 GLU B CA  
760 C C   . GLU B 47 ? 0.5408 0.4689 0.4535 0.0107  0.1236  0.0142  482 GLU B C   
761 O O   . GLU B 47 ? 0.5211 0.4746 0.4676 0.0130  0.1238  0.0095  482 GLU B O   
762 C CB  . GLU B 47 ? 0.5588 0.4665 0.4582 0.0216  0.1307  0.0021  482 GLU B CB  
763 C CG  . GLU B 47 ? 0.6694 0.6018 0.6109 0.0333  0.1293  -0.0091 482 GLU B CG  
764 C CD  . GLU B 47 ? 0.7742 0.7206 0.7341 0.0324  0.1519  -0.0283 482 GLU B CD  
765 O OE1 . GLU B 47 ? 0.7975 0.7510 0.7564 0.0183  0.1720  -0.0334 482 GLU B OE1 
766 O OE2 . GLU B 47 ? 0.8518 0.8006 0.8266 0.0448  0.1507  -0.0402 482 GLU B OE2 
767 N N   . ILE B 48 ? 0.4966 0.4106 0.3886 0.0094  0.1098  0.0241  483 ILE B N   
768 C CA  . ILE B 48 ? 0.4875 0.4132 0.3912 0.0088  0.0972  0.0312  483 ILE B CA  
769 C C   . ILE B 48 ? 0.4905 0.4225 0.3953 0.0009  0.1031  0.0324  483 ILE B C   
770 O O   . ILE B 48 ? 0.4932 0.4443 0.4210 0.0011  0.0990  0.0336  483 ILE B O   
771 C CB  . ILE B 48 ? 0.5169 0.4292 0.4030 0.0081  0.0840  0.0355  483 ILE B CB  
772 C CG1 . ILE B 48 ? 0.4615 0.3675 0.3485 0.0123  0.0791  0.0340  483 ILE B CG1 
773 C CG2 . ILE B 48 ? 0.4212 0.3453 0.3169 0.0052  0.0751  0.0396  483 ILE B CG2 
774 C CD1 . ILE B 48 ? 0.4139 0.3070 0.2860 0.0096  0.0712  0.0315  483 ILE B CD1 
775 N N   . LYS B 49 ? 0.5321 0.4414 0.4058 -0.0066 0.1118  0.0320  484 LYS B N   
776 C CA  . LYS B 49 ? 0.5461 0.4495 0.4094 -0.0169 0.1195  0.0331  484 LYS B CA  
777 C C   . LYS B 49 ? 0.5521 0.4814 0.4484 -0.0235 0.1374  0.0243  484 LYS B C   
778 O O   . LYS B 49 ? 0.5560 0.4989 0.4684 -0.0288 0.1373  0.0246  484 LYS B O   
779 C CB  . LYS B 49 ? 0.6132 0.4720 0.4219 -0.0243 0.1252  0.0341  484 LYS B CB  
780 C CG  . LYS B 49 ? 0.5541 0.3862 0.3314 -0.0217 0.1052  0.0403  484 LYS B CG  
781 C CD  . LYS B 49 ? 0.6088 0.4471 0.3948 -0.0090 0.0828  0.0401  484 LYS B CD  
782 C CE  . LYS B 49 ? 0.6525 0.4499 0.3939 -0.0036 0.0641  0.0385  484 LYS B CE  
783 N NZ  . LYS B 49 ? 0.6496 0.4227 0.3651 -0.0055 0.0554  0.0412  484 LYS B NZ  
784 N N   . LYS B 50 ? 0.5529 0.4907 0.4627 -0.0228 0.1523  0.0134  485 LYS B N   
785 C CA  . LYS B 50 ? 0.5294 0.4992 0.4817 -0.0277 0.1691  -0.0021 485 LYS B CA  
786 C C   . LYS B 50 ? 0.4943 0.4991 0.4949 -0.0151 0.1506  -0.0040 485 LYS B C   
787 O O   . LYS B 50 ? 0.5004 0.5307 0.5345 -0.0199 0.1553  -0.0134 485 LYS B O   
788 C CB  . LYS B 50 ? 0.6085 0.5825 0.5696 -0.0266 0.1873  -0.0174 485 LYS B CB  
789 C CG  . LYS B 50 ? 0.6495 0.6646 0.6666 -0.0304 0.2059  -0.0413 485 LYS B CG  
790 C CD  . LYS B 50 ? 0.7794 0.7973 0.7965 -0.0535 0.2281  -0.0474 485 LYS B CD  
791 C CE  . LYS B 50 ? 0.7851 0.8490 0.8651 -0.0602 0.2504  -0.0775 485 LYS B CE  
792 N NZ  . LYS B 50 ? 0.8262 0.8898 0.9039 -0.0881 0.2771  -0.0856 485 LYS B NZ  
793 N N   . TRP B 51 ? 0.4389 0.4400 0.4384 -0.0002 0.1296  0.0038  486 TRP B N   
794 C CA  . TRP B 51 ? 0.4316 0.4505 0.4597 0.0119  0.1095  0.0040  486 TRP B CA  
795 C C   . TRP B 51 ? 0.4649 0.4872 0.4910 0.0055  0.1019  0.0124  486 TRP B C   
796 O O   . TRP B 51 ? 0.4499 0.4942 0.5071 0.0077  0.0962  0.0053  486 TRP B O   
797 C CB  . TRP B 51 ? 0.4227 0.4226 0.4328 0.0235  0.0923  0.0126  486 TRP B CB  
798 C CG  . TRP B 51 ? 0.4285 0.4314 0.4521 0.0356  0.0713  0.0134  486 TRP B CG  
799 C CD1 . TRP B 51 ? 0.4655 0.4701 0.5073 0.0515  0.0591  0.0035  486 TRP B CD1 
800 C CD2 . TRP B 51 ? 0.3569 0.3541 0.3697 0.0335  0.0582  0.0236  486 TRP B CD2 
801 N NE1 . TRP B 51 ? 0.4925 0.4863 0.5287 0.0596  0.0373  0.0084  486 TRP B NE1 
802 C CE2 . TRP B 51 ? 0.3691 0.3593 0.3873 0.0474  0.0386  0.0208  486 TRP B CE2 
803 C CE3 . TRP B 51 ? 0.4339 0.4284 0.4308 0.0224  0.0601  0.0333  486 TRP B CE3 
804 C CZ2 . TRP B 51 ? 0.4053 0.3822 0.4073 0.0479  0.0236  0.0288  486 TRP B CZ2 
805 C CZ3 . TRP B 51 ? 0.4586 0.4477 0.4481 0.0231  0.0470  0.0393  486 TRP B CZ3 
806 C CH2 . TRP B 51 ? 0.4703 0.4490 0.4595 0.0345  0.0302  0.0377  486 TRP B CH2 
807 N N   . PHE B 52 ? 0.4856 0.4864 0.4770 -0.0010 0.0997  0.0250  487 PHE B N   
808 C CA  . PHE B 52 ? 0.5029 0.5043 0.4898 -0.0061 0.0923  0.0318  487 PHE B CA  
809 C C   . PHE B 52 ? 0.5315 0.5447 0.5331 -0.0172 0.1049  0.0248  487 PHE B C   
810 O O   . PHE B 52 ? 0.5891 0.6214 0.6164 -0.0162 0.0978  0.0214  487 PHE B O   
811 C CB  . PHE B 52 ? 0.5351 0.5128 0.4868 -0.0093 0.0876  0.0410  487 PHE B CB  
812 C CG  . PHE B 52 ? 0.3887 0.3647 0.3371 -0.0032 0.0734  0.0460  487 PHE B CG  
813 C CD1 . PHE B 52 ? 0.4800 0.4489 0.4237 0.0019  0.0714  0.0457  487 PHE B CD1 
814 C CD2 . PHE B 52 ? 0.4094 0.3889 0.3578 -0.0048 0.0646  0.0493  487 PHE B CD2 
815 C CE1 . PHE B 52 ? 0.5437 0.5074 0.4812 0.0025  0.0631  0.0484  487 PHE B CE1 
816 C CE2 . PHE B 52 ? 0.4645 0.4417 0.4084 -0.0035 0.0572  0.0508  487 PHE B CE2 
817 C CZ  . PHE B 52 ? 0.5282 0.4968 0.4660 -0.0014 0.0576  0.0503  487 PHE B CZ  
818 N N   . SER B 53 ? 0.5322 0.5301 0.5142 -0.0292 0.1242  0.0213  488 SER B N   
819 C CA  . SER B 53 ? 0.5370 0.5398 0.5268 -0.0456 0.1424  0.0128  488 SER B CA  
820 C C   . SER B 53 ? 0.4842 0.5299 0.5330 -0.0437 0.1453  -0.0042 488 SER B C   
821 O O   . SER B 53 ? 0.5004 0.5607 0.5695 -0.0516 0.1461  -0.0093 488 SER B O   
822 C CB  . SER B 53 ? 0.5904 0.5651 0.5456 -0.0604 0.1674  0.0085  488 SER B CB  
823 O OG  . SER B 53 ? 0.7080 0.6961 0.6811 -0.0549 0.1774  -0.0022 488 SER B OG  
824 N N   . ASP B 54 ? 0.4692 0.5339 0.5463 -0.0317 0.1444  -0.0149 489 ASP B N   
825 C CA  . ASP B 54 ? 0.4739 0.5801 0.6119 -0.0237 0.1401  -0.0354 489 ASP B CA  
826 C C   . ASP B 54 ? 0.4499 0.5650 0.6019 -0.0115 0.1116  -0.0296 489 ASP B C   
827 O O   . ASP B 54 ? 0.4917 0.6349 0.6848 -0.0124 0.1076  -0.0439 489 ASP B O   
828 C CB  . ASP B 54 ? 0.4535 0.5706 0.6131 -0.0071 0.1364  -0.0470 489 ASP B CB  
829 C CG  . ASP B 54 ? 0.5957 0.7136 0.7548 -0.0193 0.1679  -0.0611 489 ASP B CG  
830 O OD1 . ASP B 54 ? 0.7022 0.8194 0.8561 -0.0424 0.1953  -0.0682 489 ASP B OD1 
831 O OD2 . ASP B 54 ? 0.5845 0.6990 0.7437 -0.0071 0.1665  -0.0656 489 ASP B OD2 
832 N N   . HIS B 55 ? 0.4267 0.5169 0.5440 -0.0017 0.0928  -0.0106 490 HIS B N   
833 C CA  . HIS B 55 ? 0.4266 0.5167 0.5461 0.0088  0.0675  -0.0047 490 HIS B CA  
834 C C   . HIS B 55 ? 0.4387 0.5250 0.5459 -0.0033 0.0680  0.0032  490 HIS B C   
835 O O   . HIS B 55 ? 0.5152 0.6080 0.6332 0.0021  0.0509  0.0023  490 HIS B O   
836 C CB  . HIS B 55 ? 0.3916 0.4548 0.4783 0.0207  0.0514  0.0089  490 HIS B CB  
837 C CG  . HIS B 55 ? 0.3944 0.4578 0.4955 0.0375  0.0404  -0.0005 490 HIS B CG  
838 N ND1 . HIS B 55 ? 0.4403 0.5117 0.5553 0.0390  0.0545  -0.0109 490 HIS B ND1 
839 C CD2 . HIS B 55 ? 0.3937 0.4450 0.4932 0.0546  0.0152  -0.0022 490 HIS B CD2 
840 C CE1 . HIS B 55 ? 0.4734 0.5414 0.6000 0.0576  0.0375  -0.0195 490 HIS B CE1 
841 N NE2 . HIS B 55 ? 0.5218 0.5744 0.6364 0.0678  0.0122  -0.0138 490 HIS B NE2 
842 N N   . ARG B 56 ? 0.4092 0.4802 0.4902 -0.0185 0.0854  0.0098  491 ARG B N   
843 C CA  . ARG B 56 ? 0.3777 0.4424 0.4477 -0.0307 0.0874  0.0139  491 ARG B CA  
844 C C   . ARG B 56 ? 0.3273 0.4186 0.4376 -0.0407 0.0966  -0.0030 491 ARG B C   
845 O O   . ARG B 56 ? 0.3335 0.4322 0.4547 -0.0429 0.0869  -0.0041 491 ARG B O   
846 C CB  . ARG B 56 ? 0.3377 0.3704 0.3639 -0.0428 0.1009  0.0227  491 ARG B CB  
847 C CG  . ARG B 56 ? 0.4467 0.4569 0.4392 -0.0337 0.0887  0.0357  491 ARG B CG  
848 C CD  . ARG B 56 ? 0.4976 0.4755 0.4498 -0.0410 0.0895  0.0424  491 ARG B CD  
849 N NE  . ARG B 56 ? 0.5545 0.5080 0.4808 -0.0533 0.1081  0.0398  491 ARG B NE  
850 C CZ  . ARG B 56 ? 0.5718 0.5077 0.4758 -0.0515 0.1142  0.0403  491 ARG B CZ  
851 N NH1 . ARG B 56 ? 0.5368 0.4802 0.4464 -0.0380 0.1030  0.0430  491 ARG B NH1 
852 N NH2 . ARG B 56 ? 0.6495 0.5560 0.5212 -0.0654 0.1332  0.0375  491 ARG B NH2 
853 N N   . TYR B 57 ? 0.3573 0.4640 0.4913 -0.0479 0.1167  -0.0185 492 TYR B N   
854 C CA  . TYR B 57 ? 0.4046 0.5435 0.5866 -0.0606 0.1307  -0.0413 492 TYR B CA  
855 C C   . TYR B 57 ? 0.3861 0.5606 0.6209 -0.0431 0.1051  -0.0552 492 TYR B C   
856 O O   . TYR B 57 ? 0.3511 0.5428 0.6123 -0.0497 0.1007  -0.0648 492 TYR B O   
857 C CB  . TYR B 57 ? 0.4538 0.6042 0.6528 -0.0712 0.1599  -0.0589 492 TYR B CB  
858 C CG  . TYR B 57 ? 0.4483 0.6423 0.7111 -0.0845 0.1773  -0.0901 492 TYR B CG  
859 C CD1 . TYR B 57 ? 0.5045 0.7437 0.8327 -0.0691 0.1707  -0.1163 492 TYR B CD1 
860 C CD2 . TYR B 57 ? 0.5412 0.7306 0.8006 -0.1127 0.1999  -0.0965 492 TYR B CD2 
861 C CE1 . TYR B 57 ? 0.5144 0.8013 0.9123 -0.0809 0.1865  -0.1512 492 TYR B CE1 
862 C CE2 . TYR B 57 ? 0.5566 0.7904 0.8809 -0.1286 0.2192  -0.1296 492 TYR B CE2 
863 C CZ  . TYR B 57 ? 0.5509 0.8375 0.9489 -0.1123 0.2126  -0.1585 492 TYR B CZ  
864 O OH  . TYR B 57 ? 0.5220 0.8600 0.9950 -0.1275 0.2312  -0.1971 492 TYR B OH  
865 N N   . ARG B 58 ? 0.3849 0.5642 0.6298 -0.0202 0.0858  -0.0565 493 ARG B N   
866 C CA  . ARG B 58 ? 0.4043 0.6046 0.6872 0.0006  0.0549  -0.0691 493 ARG B CA  
867 C C   . ARG B 58 ? 0.3939 0.5752 0.6496 0.0044  0.0321  -0.0536 493 ARG B C   
868 O O   . ARG B 58 ? 0.3254 0.5258 0.6136 0.0097  0.0145  -0.0671 493 ARG B O   
869 C CB  . ARG B 58 ? 0.4148 0.6066 0.6950 0.0247  0.0364  -0.0696 493 ARG B CB  
870 C CG  . ARG B 58 ? 0.4190 0.6343 0.7350 0.0260  0.0542  -0.0904 493 ARG B CG  
871 C CD  . ARG B 58 ? 0.5158 0.7190 0.8298 0.0536  0.0285  -0.0925 493 ARG B CD  
872 N NE  . ARG B 58 ? 0.5834 0.7805 0.8883 0.0530  0.0476  -0.0935 493 ARG B NE  
873 C CZ  . ARG B 58 ? 0.6561 0.8351 0.9499 0.0740  0.0300  -0.0931 493 ARG B CZ  
874 N NH1 . ARG B 58 ? 0.7039 0.8636 0.9890 0.0971  -0.0074 -0.0912 493 ARG B NH1 
875 N NH2 . ARG B 58 ? 0.6940 0.8676 0.9790 0.0716  0.0494  -0.0947 493 ARG B NH2 
876 N N   . CYS B 59 ? 0.3906 0.5359 0.5894 0.0017  0.0326  -0.0282 494 CYS B N   
877 C CA  . CYS B 59 ? 0.3929 0.5188 0.5621 0.0032  0.0159  -0.0145 494 CYS B CA  
878 C C   . CYS B 59 ? 0.4010 0.5409 0.5882 -0.0116 0.0217  -0.0214 494 CYS B C   
879 O O   . CYS B 59 ? 0.3854 0.5333 0.5881 -0.0054 0.0019  -0.0282 494 CYS B O   
880 C CB  . CYS B 59 ? 0.4100 0.5034 0.5257 -0.0011 0.0224  0.0074  494 CYS B CB  
881 S SG  . CYS B 59 ? 0.4062 0.4764 0.4854 0.0008  0.0055  0.0208  494 CYS B SG  
882 N N   . GLN B 60 ? 0.4469 0.5839 0.6265 -0.0315 0.0480  -0.0201 495 GLN B N   
883 C CA  . GLN B 60 ? 0.4714 0.6117 0.6578 -0.0497 0.0573  -0.0252 495 GLN B CA  
884 C C   . GLN B 60 ? 0.4762 0.6566 0.7251 -0.0535 0.0560  -0.0518 495 GLN B C   
885 O O   . GLN B 60 ? 0.5300 0.7161 0.7905 -0.0608 0.0496  -0.0571 495 GLN B O   
886 C CB  . GLN B 60 ? 0.5071 0.6240 0.6621 -0.0710 0.0861  -0.0193 495 GLN B CB  
887 C CG  . GLN B 60 ? 0.6221 0.6984 0.7189 -0.0702 0.0812  0.0025  495 GLN B CG  
888 C CD  . GLN B 60 ? 0.6998 0.7630 0.7834 -0.0784 0.0750  0.0055  495 GLN B CD  
889 O OE1 . GLN B 60 ? 0.6278 0.7114 0.7400 -0.0753 0.0616  -0.0023 495 GLN B OE1 
890 N NE2 . GLN B 60 ? 0.7964 0.8214 0.8338 -0.0874 0.0818  0.0158  495 GLN B NE2 
891 N N   . ARG B 61 ? 0.4652 0.6751 0.7580 -0.0485 0.0619  -0.0712 496 ARG B N   
892 C CA  . ARG B 61 ? 0.4800 0.7363 0.8447 -0.0487 0.0575  -0.1032 496 ARG B CA  
893 C C   . ARG B 61 ? 0.4379 0.6996 0.8168 -0.0241 0.0155  -0.1067 496 ARG B C   
894 O O   . ARG B 61 ? 0.4048 0.6904 0.8231 -0.0272 0.0046  -0.1249 496 ARG B O   
895 C CB  . ARG B 61 ? 0.5709 0.8597 0.9831 -0.0456 0.0717  -0.1271 496 ARG B CB  
896 C CG  . ARG B 61 ? 0.6972 0.9814 1.0985 -0.0746 0.1174  -0.1304 496 ARG B CG  
897 C CD  . ARG B 61 ? 0.8341 1.1337 1.2605 -0.1067 0.1440  -0.1483 496 ARG B CD  
898 N NE  . ARG B 61 ? 0.8960 1.1613 1.2740 -0.1374 0.1853  -0.1396 496 ARG B NE  
899 C CZ  . ARG B 61 ? 0.9378 1.1460 1.2364 -0.1450 0.1884  -0.1086 496 ARG B CZ  
900 N NH1 . ARG B 61 ? 0.9030 1.0884 1.1676 -0.1260 0.1567  -0.0844 496 ARG B NH1 
901 N NH2 . ARG B 61 ? 0.9584 1.1290 1.2092 -0.1716 0.2229  -0.1039 496 ARG B NH2 
902 N N   . GLY B 62 ? 0.3925 0.6269 0.7341 -0.0014 -0.0077 -0.0897 497 GLY B N   
903 C CA  . GLY B 62 ? 0.4038 0.6238 0.7337 0.0202  -0.0469 -0.0874 497 GLY B CA  
904 C C   . GLY B 62 ? 0.4074 0.6124 0.7122 0.0095  -0.0515 -0.0769 497 GLY B C   
905 O O   . GLY B 62 ? 0.4211 0.6385 0.7516 0.0159  -0.0745 -0.0914 497 GLY B O   
906 N N   . ILE B 63 ? 0.3547 0.5329 0.6110 -0.0055 -0.0313 -0.0538 498 ILE B N   
907 C CA  . ILE B 63 ? 0.3869 0.5483 0.6164 -0.0156 -0.0335 -0.0439 498 ILE B CA  
908 C C   . ILE B 63 ? 0.3981 0.5864 0.6705 -0.0337 -0.0237 -0.0626 498 ILE B C   
909 O O   . ILE B 63 ? 0.4145 0.5996 0.6860 -0.0346 -0.0389 -0.0652 498 ILE B O   
910 C CB  . ILE B 63 ? 0.3951 0.5247 0.5702 -0.0258 -0.0148 -0.0202 498 ILE B CB  
911 C CG1 . ILE B 63 ? 0.4036 0.5066 0.5368 -0.0105 -0.0263 -0.0042 498 ILE B CG1 
912 C CG2 . ILE B 63 ? 0.2861 0.4015 0.4410 -0.0374 -0.0140 -0.0146 498 ILE B CG2 
913 C CD1 . ILE B 63 ? 0.3881 0.4675 0.4793 -0.0176 -0.0107 0.0130  498 ILE B CD1 
914 N N   . VAL B 64 ? 0.3877 0.5999 0.6950 -0.0501 0.0032  -0.0769 499 VAL B N   
915 C CA  . VAL B 64 ? 0.3859 0.6208 0.7317 -0.0740 0.0204  -0.0966 499 VAL B CA  
916 C C   . VAL B 64 ? 0.3830 0.6635 0.8015 -0.0652 -0.0008 -0.1289 499 VAL B C   
917 O O   . VAL B 64 ? 0.3460 0.6393 0.7891 -0.0777 -0.0035 -0.1424 499 VAL B O   
918 C CB  . VAL B 64 ? 0.3971 0.6353 0.7474 -0.0991 0.0620  -0.1026 499 VAL B CB  
919 C CG1 . VAL B 64 ? 0.4061 0.6751 0.8088 -0.1262 0.0835  -0.1315 499 VAL B CG1 
920 C CG2 . VAL B 64 ? 0.3000 0.4863 0.5755 -0.1105 0.0784  -0.0740 499 VAL B CG2 
921 N N   . HIS B 65 ? 0.4255 0.7285 0.8780 -0.0422 -0.0187 -0.1428 500 HIS B N   
922 C CA  . HIS B 65 ? 0.4302 0.7810 0.9616 -0.0304 -0.0410 -0.1802 500 HIS B CA  
923 C C   . HIS B 65 ? 0.4567 0.7945 0.9803 0.0020  -0.0931 -0.1810 500 HIS B C   
924 O O   . HIS B 65 ? 0.4752 0.8492 1.0628 0.0153  -0.1189 -0.2139 500 HIS B O   
925 C CB  . HIS B 65 ? 0.4243 0.8121 1.0093 -0.0243 -0.0293 -0.2043 500 HIS B CB  
926 C CG  . HIS B 65 ? 0.5225 0.9226 1.1169 -0.0574 0.0229  -0.2095 500 HIS B CG  
927 N ND1 . HIS B 65 ? 0.5753 0.9907 1.1926 -0.0920 0.0533  -0.2239 500 HIS B ND1 
928 C CD2 . HIS B 65 ? 0.5358 0.9287 1.1134 -0.0626 0.0503  -0.2030 500 HIS B CD2 
929 C CE1 . HIS B 65 ? 0.5531 0.9651 1.1608 -0.1178 0.0981  -0.2249 500 HIS B CE1 
930 N NE2 . HIS B 65 ? 0.5601 0.9600 1.1449 -0.0997 0.0964  -0.2126 500 HIS B NE2 
931 N N   . ILE B 66 ? 0.4757 0.7610 0.9217 0.0141  -0.1089 -0.1484 501 ILE B N   
932 C CA  . ILE B 66 ? 0.4962 0.7547 0.9171 0.0428  -0.1563 -0.1471 501 ILE B CA  
933 C C   . ILE B 66 ? 0.5067 0.7332 0.8802 0.0374  -0.1676 -0.1314 501 ILE B C   
934 O O   . ILE B 66 ? 0.5469 0.7597 0.8884 0.0158  -0.1405 -0.1126 501 ILE B O   
935 C CB  . ILE B 66 ? 0.5135 0.7304 0.8787 0.0639  -0.1692 -0.1269 501 ILE B CB  
936 C CG1 . ILE B 66 ? 0.5062 0.7534 0.9227 0.0772  -0.1699 -0.1481 501 ILE B CG1 
937 C CG2 . ILE B 66 ? 0.5648 0.7360 0.8811 0.0881  -0.2140 -0.1210 501 ILE B CG2 
938 C CD1 . ILE B 66 ? 0.5117 0.7157 0.8746 0.0969  -0.1824 -0.1302 501 ILE B CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  436 ?   ?   ?   A . n 
A 1 2  ALA 2  437 ?   ?   ?   A . n 
A 1 3  HIS 3  438 ?   ?   ?   A . n 
A 1 4  HIS 4  439 ?   ?   ?   A . n 
A 1 5  HIS 5  440 ?   ?   ?   A . n 
A 1 6  HIS 6  441 ?   ?   ?   A . n 
A 1 7  HIS 7  442 ?   ?   ?   A . n 
A 1 8  HIS 8  443 ?   ?   ?   A . n 
A 1 9  ARG 9  444 ?   ?   ?   A . n 
A 1 10 LYS 10 445 ?   ?   ?   A . n 
A 1 11 LYS 11 446 446 LYS LYS A . n 
A 1 12 THR 12 447 447 THR THR A . n 
A 1 13 LYS 13 448 448 LYS LYS A . n 
A 1 14 GLU 14 449 449 GLU GLU A . n 
A 1 15 GLN 15 450 450 GLN GLN A . n 
A 1 16 ILE 16 451 451 ILE ILE A . n 
A 1 17 ALA 17 452 452 ALA ALA A . n 
A 1 18 HIS 18 453 453 HIS HIS A . n 
A 1 19 LEU 19 454 454 LEU LEU A . n 
A 1 20 LYS 20 455 455 LYS LYS A . n 
A 1 21 ALA 21 456 456 ALA ALA A . n 
A 1 22 SER 22 457 457 SER SER A . n 
A 1 23 PHE 23 458 458 PHE PHE A . n 
A 1 24 LEU 24 459 459 LEU LEU A . n 
A 1 25 GLN 25 460 460 GLN GLN A . n 
A 1 26 SER 26 461 461 SER SER A . n 
A 1 27 GLN 27 462 462 GLN GLN A . n 
A 1 28 PHE 28 463 463 PHE PHE A . n 
A 1 29 PRO 29 464 464 PRO PRO A . n 
A 1 30 ASP 30 465 465 ASP ASP A . n 
A 1 31 ASP 31 466 466 ASP ASP A . n 
A 1 32 ALA 32 467 467 ALA ALA A . n 
A 1 33 GLU 33 468 468 GLU GLU A . n 
A 1 34 VAL 34 469 469 VAL VAL A . n 
A 1 35 TYR 35 470 470 TYR TYR A . n 
A 1 36 ARG 36 471 471 ARG ARG A . n 
A 1 37 LEU 37 472 472 LEU LEU A . n 
A 1 38 ILE 38 473 473 ILE ILE A . n 
A 1 39 GLU 39 474 474 GLU GLU A . n 
A 1 40 VAL 40 475 475 VAL VAL A . n 
A 1 41 THR 41 476 476 THR THR A . n 
A 1 42 GLY 42 477 477 GLY GLY A . n 
A 1 43 LEU 43 478 478 LEU LEU A . n 
A 1 44 ALA 44 479 479 ALA ALA A . n 
A 1 45 ARG 45 480 480 ARG ARG A . n 
A 1 46 SER 46 481 481 SER SER A . n 
A 1 47 GLU 47 482 482 GLU GLU A . n 
A 1 48 ILE 48 483 483 ILE ILE A . n 
A 1 49 LYS 49 484 484 LYS LYS A . n 
A 1 50 LYS 50 485 485 LYS LYS A . n 
A 1 51 TRP 51 486 486 TRP TRP A . n 
A 1 52 PHE 52 487 487 PHE PHE A . n 
A 1 53 SER 53 488 488 SER SER A . n 
A 1 54 ASP 54 489 489 ASP ASP A . n 
A 1 55 HIS 55 490 490 HIS HIS A . n 
A 1 56 ARG 56 491 491 ARG ARG A . n 
A 1 57 TYR 57 492 492 TYR TYR A . n 
A 1 58 ARG 58 493 493 ARG ARG A . n 
A 1 59 CYS 59 494 494 CYS CYS A . n 
A 1 60 GLN 60 495 495 GLN GLN A . n 
A 1 61 ARG 61 496 496 ARG ARG A . n 
A 1 62 GLY 62 497 497 GLY GLY A . n 
A 1 63 ILE 63 498 498 ILE ILE A . n 
A 1 64 VAL 64 499 499 VAL VAL A . n 
A 1 65 HIS 65 500 500 HIS HIS A . n 
A 1 66 ILE 66 501 501 ILE ILE A . n 
B 1 1  MET 1  436 ?   ?   ?   B . n 
B 1 2  ALA 2  437 ?   ?   ?   B . n 
B 1 3  HIS 3  438 ?   ?   ?   B . n 
B 1 4  HIS 4  439 ?   ?   ?   B . n 
B 1 5  HIS 5  440 ?   ?   ?   B . n 
B 1 6  HIS 6  441 ?   ?   ?   B . n 
B 1 7  HIS 7  442 ?   ?   ?   B . n 
B 1 8  HIS 8  443 ?   ?   ?   B . n 
B 1 9  ARG 9  444 ?   ?   ?   B . n 
B 1 10 LYS 10 445 ?   ?   ?   B . n 
B 1 11 LYS 11 446 446 LYS LYS B . n 
B 1 12 THR 12 447 447 THR THR B . n 
B 1 13 LYS 13 448 448 LYS LYS B . n 
B 1 14 GLU 14 449 449 GLU GLU B . n 
B 1 15 GLN 15 450 450 GLN GLN B . n 
B 1 16 ILE 16 451 451 ILE ILE B . n 
B 1 17 ALA 17 452 452 ALA ALA B . n 
B 1 18 HIS 18 453 453 HIS HIS B . n 
B 1 19 LEU 19 454 454 LEU LEU B . n 
B 1 20 LYS 20 455 455 LYS LYS B . n 
B 1 21 ALA 21 456 456 ALA ALA B . n 
B 1 22 SER 22 457 457 SER SER B . n 
B 1 23 PHE 23 458 458 PHE PHE B . n 
B 1 24 LEU 24 459 459 LEU LEU B . n 
B 1 25 GLN 25 460 460 GLN GLN B . n 
B 1 26 SER 26 461 461 SER SER B . n 
B 1 27 GLN 27 462 462 GLN GLN B . n 
B 1 28 PHE 28 463 463 PHE PHE B . n 
B 1 29 PRO 29 464 464 PRO PRO B . n 
B 1 30 ASP 30 465 465 ASP ASP B . n 
B 1 31 ASP 31 466 466 ASP ASP B . n 
B 1 32 ALA 32 467 467 ALA ALA B . n 
B 1 33 GLU 33 468 468 GLU GLU B . n 
B 1 34 VAL 34 469 469 VAL VAL B . n 
B 1 35 TYR 35 470 470 TYR TYR B . n 
B 1 36 ARG 36 471 471 ARG ARG B . n 
B 1 37 LEU 37 472 472 LEU LEU B . n 
B 1 38 ILE 38 473 473 ILE ILE B . n 
B 1 39 GLU 39 474 474 GLU GLU B . n 
B 1 40 VAL 40 475 475 VAL VAL B . n 
B 1 41 THR 41 476 476 THR THR B . n 
B 1 42 GLY 42 477 477 GLY GLY B . n 
B 1 43 LEU 43 478 478 LEU LEU B . n 
B 1 44 ALA 44 479 479 ALA ALA B . n 
B 1 45 ARG 45 480 480 ARG ARG B . n 
B 1 46 SER 46 481 481 SER SER B . n 
B 1 47 GLU 47 482 482 GLU GLU B . n 
B 1 48 ILE 48 483 483 ILE ILE B . n 
B 1 49 LYS 49 484 484 LYS LYS B . n 
B 1 50 LYS 50 485 485 LYS LYS B . n 
B 1 51 TRP 51 486 486 TRP TRP B . n 
B 1 52 PHE 52 487 487 PHE PHE B . n 
B 1 53 SER 53 488 488 SER SER B . n 
B 1 54 ASP 54 489 489 ASP ASP B . n 
B 1 55 HIS 55 490 490 HIS HIS B . n 
B 1 56 ARG 56 491 491 ARG ARG B . n 
B 1 57 TYR 57 492 492 TYR TYR B . n 
B 1 58 ARG 58 493 493 ARG ARG B . n 
B 1 59 CYS 59 494 494 CYS CYS B . n 
B 1 60 GLN 60 495 495 GLN GLN B . n 
B 1 61 ARG 61 496 496 ARG ARG B . n 
B 1 62 GLY 62 497 497 GLY GLY B . n 
B 1 63 ILE 63 498 498 ILE ILE B . n 
B 1 64 VAL 64 499 499 VAL VAL B . n 
B 1 65 HIS 65 500 500 HIS HIS B . n 
B 1 66 ILE 66 501 501 ILE ILE B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Oxford Protein Production Facility' 
_pdbx_SG_project.initial_of_center     OPPF 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2930 ? 
1 MORE         -20  ? 
1 'SSA (A^2)'  6930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-07 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 17.3076 -7.5503 0.8968  -0.1081 -0.0629 -0.1486 0.0009  -0.0494 0.0938 1.7197 5.8478 4.0053 
-0.9483 -0.8592 3.6115 0.0927 0.1760  -0.0996 -0.2302 -0.2184 0.4656 -0.1803 -0.3018 0.1257 
'X-RAY DIFFRACTION' 2 ? refined 16.2038 -7.5369 11.5906 -0.0815 -0.0836 -0.1151 -0.0166 0.0578  0.0499 0.8606 5.3732 3.6529 0.4172 
0.6560  3.1419 0.0464 -0.0101 0.0303  0.2630  -0.0987 0.4100 0.1062  -0.2589 0.0523 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 446 ? ? A 501 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 446 ? ? B 501 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP    phasing          .        ? 1 
REFMAC    refinement       5.2.0019 ? 2 
HKL-2000  'data reduction' .        ? 3 
SCALEPACK 'data scaling'   .        ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 436 ? A MET 1  
2  1 Y 1 A ALA 437 ? A ALA 2  
3  1 Y 1 A HIS 438 ? A HIS 3  
4  1 Y 1 A HIS 439 ? A HIS 4  
5  1 Y 1 A HIS 440 ? A HIS 5  
6  1 Y 1 A HIS 441 ? A HIS 6  
7  1 Y 1 A HIS 442 ? A HIS 7  
8  1 Y 1 A HIS 443 ? A HIS 8  
9  1 Y 1 A ARG 444 ? A ARG 9  
10 1 Y 1 A LYS 445 ? A LYS 10 
11 1 Y 1 B MET 436 ? B MET 1  
12 1 Y 1 B ALA 437 ? B ALA 2  
13 1 Y 1 B HIS 438 ? B HIS 3  
14 1 Y 1 B HIS 439 ? B HIS 4  
15 1 Y 1 B HIS 440 ? B HIS 5  
16 1 Y 1 B HIS 441 ? B HIS 6  
17 1 Y 1 B HIS 442 ? B HIS 7  
18 1 Y 1 B HIS 443 ? B HIS 8  
19 1 Y 1 B ARG 444 ? B ARG 9  
20 1 Y 1 B LYS 445 ? B LYS 10 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1  302 302 SO4 SO4 A . 
D 3 HOH 1  1   1   HOH HOH A . 
D 3 HOH 2  2   2   HOH HOH A . 
D 3 HOH 3  4   4   HOH HOH A . 
D 3 HOH 4  5   5   HOH HOH A . 
D 3 HOH 5  8   8   HOH HOH A . 
D 3 HOH 6  9   9   HOH HOH A . 
D 3 HOH 7  10  10  HOH HOH A . 
D 3 HOH 8  11  11  HOH HOH A . 
D 3 HOH 9  12  12  HOH HOH A . 
D 3 HOH 10 15  15  HOH HOH A . 
D 3 HOH 11 16  16  HOH HOH A . 
E 3 HOH 1  3   3   HOH HOH B . 
E 3 HOH 2  6   6   HOH HOH B . 
E 3 HOH 3  7   7   HOH HOH B . 
E 3 HOH 4  13  13  HOH HOH B . 
E 3 HOH 5  14  14  HOH HOH B . 
E 3 HOH 6  17  17  HOH HOH B . 
E 3 HOH 7  18  18  HOH HOH B . 
E 3 HOH 8  20  20  HOH HOH B . 
E 3 HOH 9  21  21  HOH HOH B . 
E 3 HOH 10 23  23  HOH HOH B . 
E 3 HOH 11 24  24  HOH HOH B . 
E 3 HOH 12 25  25  HOH HOH B . 
E 3 HOH 13 26  26  HOH HOH B . 
#