data_3NBN
# 
_entry.id   3NBN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NBN         
NDB   NA0616       
RCSB  RCSB059626   
WWPDB D_1000059626 
# 
_pdbx_database_status.entry_id                        3NBN 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arnett, K.L.'   1 
'Blacklow, S.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural and mechanistic insights into cooperative assembly of dimeric Notch transcription complexes.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                1312 
_citation.page_last                 1317 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20972443 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1938 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arnett, K.L.'   1 
primary 'Hass, M.'       2 
primary 'McArthur, D.G.' 3 
primary 'Ilagan, M.X.'   4 
primary 'Aster, J.C.'    5 
primary 'Kopan, R.'      6 
primary 'Blacklow, S.C.' 7 
# 
_cell.entry_id           3NBN 
_cell.length_a           295.112 
_cell.length_b           108.059 
_cell.length_c           87.239 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.52 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NBN 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Recombining binding protein suppressor of hairless' 49237.180 2 ? ? 'residues 23-448'    ? 
2 polymer man 'Neurogenic locus notch homolog protein 1'           27885.004 2 ? ? 'residues 1872-2126' ? 
3 polymer man 'Mastermind-like protein 1'                          7532.758  2 ? ? 'residues 13-74'     ? 
4 polymer syn 'DNA, HES1 promoter'                                 11526.458 1 ? ? ?                    ? 
5 polymer syn 'DNA, HES1 promoter'                                 11211.222 1 ? ? ?                    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'J kappa-recombination signal-binding protein, RBP-J kappa, RBP-JK, RBP-J, CBF-1, Renal carcinoma antigen NY-REN-30'         
2 'Notch 1, hN1, Translocation-associated notch protein TAN-1, Notch 1 extracellular truncation, Notch 1 intracellular domain' 
3 Mam-1                                                                                                                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCA
FIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCI
ASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPR
LIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFY
EGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQP
VQVPVTLVRNDGIIYSTSLTFTYTPEPHHHHHH
;
;MGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCA
FIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCI
ASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPR
LIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFY
EGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQP
VQVPVTLVRNDGIIYSTSLTFTYTPEPHHHHHH
;
A,D ? 
2 'polypeptide(L)'        no no 
;GMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEA
SADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKS
ALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHG
;
;GMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEA
SADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKS
ALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHG
;
B,E ? 
3 'polypeptide(L)'        no no GLPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKRAGKH 
GLPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKRAGKH C,F ? 
4 polydeoxyribonucleotide no no 
;(DT)(DA)(DC)(DT)(DG)(DT)(DG)(DG)(DG)(DA)(DA)(DA)(DG)(DA)(DA)(DA)(DG)(DT)(DT)(DT)
(DG)(DG)(DA)(DA)(DA)(DA)(DT)(DT)(DT)(DC)(DA)(DC)(DA)(DC)(DG)(DA)(DG)
;
TACTGTGGGAAAGAAAGTTTGGAAAATTTCACACGAG X   ? 
5 polydeoxyribonucleotide no no 
;(DA)(DC)(DT)(DC)(DG)(DT)(DG)(DT)(DG)(DA)(DA)(DA)(DC)(DT)(DT)(DC)(DC)(DC)(DA)(DA)
(DA)(DC)(DT)(DT)(DT)(DC)(DT)(DT)(DT)(DC)(DC)(DC)(DA)(DC)(DA)(DG)(DT)
;
ACTCGTGTGAAACTTCCCAAACTTTCTTTCCCACAGT Y   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   GLU n 
1 4   ARG n 
1 5   PRO n 
1 6   PRO n 
1 7   PRO n 
1 8   LYS n 
1 9   ARG n 
1 10  LEU n 
1 11  THR n 
1 12  ARG n 
1 13  GLU n 
1 14  ALA n 
1 15  MET n 
1 16  ARG n 
1 17  ASN n 
1 18  TYR n 
1 19  LEU n 
1 20  LYS n 
1 21  GLU n 
1 22  ARG n 
1 23  GLY n 
1 24  ASP n 
1 25  GLN n 
1 26  THR n 
1 27  VAL n 
1 28  LEU n 
1 29  ILE n 
1 30  LEU n 
1 31  HIS n 
1 32  ALA n 
1 33  LYS n 
1 34  VAL n 
1 35  ALA n 
1 36  GLN n 
1 37  LYS n 
1 38  SER n 
1 39  TYR n 
1 40  GLY n 
1 41  ASN n 
1 42  GLU n 
1 43  LYS n 
1 44  ARG n 
1 45  PHE n 
1 46  PHE n 
1 47  CYS n 
1 48  PRO n 
1 49  PRO n 
1 50  PRO n 
1 51  CYS n 
1 52  VAL n 
1 53  TYR n 
1 54  LEU n 
1 55  MET n 
1 56  GLY n 
1 57  SER n 
1 58  GLY n 
1 59  TRP n 
1 60  LYS n 
1 61  LYS n 
1 62  LYS n 
1 63  LYS n 
1 64  GLU n 
1 65  GLN n 
1 66  MET n 
1 67  GLU n 
1 68  ARG n 
1 69  ASP n 
1 70  GLY n 
1 71  CYS n 
1 72  SER n 
1 73  GLU n 
1 74  GLN n 
1 75  GLU n 
1 76  SER n 
1 77  GLN n 
1 78  PRO n 
1 79  CYS n 
1 80  ALA n 
1 81  PHE n 
1 82  ILE n 
1 83  GLY n 
1 84  ILE n 
1 85  GLY n 
1 86  ASN n 
1 87  SER n 
1 88  ASP n 
1 89  GLN n 
1 90  GLU n 
1 91  MET n 
1 92  GLN n 
1 93  GLN n 
1 94  LEU n 
1 95  ASN n 
1 96  LEU n 
1 97  GLU n 
1 98  GLY n 
1 99  LYS n 
1 100 ASN n 
1 101 TYR n 
1 102 CYS n 
1 103 THR n 
1 104 ALA n 
1 105 LYS n 
1 106 THR n 
1 107 LEU n 
1 108 TYR n 
1 109 ILE n 
1 110 SER n 
1 111 ASP n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 ARG n 
1 116 LYS n 
1 117 HIS n 
1 118 PHE n 
1 119 MET n 
1 120 LEU n 
1 121 SER n 
1 122 VAL n 
1 123 LYS n 
1 124 MET n 
1 125 PHE n 
1 126 TYR n 
1 127 GLY n 
1 128 ASN n 
1 129 SER n 
1 130 ASP n 
1 131 ASP n 
1 132 ILE n 
1 133 GLY n 
1 134 VAL n 
1 135 PHE n 
1 136 LEU n 
1 137 SER n 
1 138 LYS n 
1 139 ARG n 
1 140 ILE n 
1 141 LYS n 
1 142 VAL n 
1 143 ILE n 
1 144 SER n 
1 145 LYS n 
1 146 PRO n 
1 147 SER n 
1 148 LYS n 
1 149 LYS n 
1 150 LYS n 
1 151 GLN n 
1 152 SER n 
1 153 LEU n 
1 154 LYS n 
1 155 ASN n 
1 156 ALA n 
1 157 ASP n 
1 158 LEU n 
1 159 CYS n 
1 160 ILE n 
1 161 ALA n 
1 162 SER n 
1 163 GLY n 
1 164 THR n 
1 165 LYS n 
1 166 VAL n 
1 167 ALA n 
1 168 LEU n 
1 169 PHE n 
1 170 ASN n 
1 171 ARG n 
1 172 LEU n 
1 173 ARG n 
1 174 SER n 
1 175 GLN n 
1 176 THR n 
1 177 VAL n 
1 178 SER n 
1 179 THR n 
1 180 ARG n 
1 181 TYR n 
1 182 LEU n 
1 183 HIS n 
1 184 VAL n 
1 185 GLU n 
1 186 GLY n 
1 187 GLY n 
1 188 ASN n 
1 189 PHE n 
1 190 HIS n 
1 191 ALA n 
1 192 SER n 
1 193 SER n 
1 194 GLN n 
1 195 GLN n 
1 196 TRP n 
1 197 GLY n 
1 198 ALA n 
1 199 PHE n 
1 200 PHE n 
1 201 ILE n 
1 202 HIS n 
1 203 LEU n 
1 204 LEU n 
1 205 ASP n 
1 206 ASP n 
1 207 ASP n 
1 208 GLU n 
1 209 SER n 
1 210 GLU n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 THR n 
1 216 VAL n 
1 217 ARG n 
1 218 ASP n 
1 219 GLY n 
1 220 TYR n 
1 221 ILE n 
1 222 HIS n 
1 223 TYR n 
1 224 GLY n 
1 225 GLN n 
1 226 THR n 
1 227 VAL n 
1 228 LYS n 
1 229 LEU n 
1 230 VAL n 
1 231 CYS n 
1 232 SER n 
1 233 VAL n 
1 234 THR n 
1 235 GLY n 
1 236 MET n 
1 237 ALA n 
1 238 LEU n 
1 239 PRO n 
1 240 ARG n 
1 241 LEU n 
1 242 ILE n 
1 243 ILE n 
1 244 ARG n 
1 245 LYS n 
1 246 VAL n 
1 247 ASP n 
1 248 LYS n 
1 249 GLN n 
1 250 THR n 
1 251 ALA n 
1 252 LEU n 
1 253 LEU n 
1 254 ASP n 
1 255 ALA n 
1 256 ASP n 
1 257 ASP n 
1 258 PRO n 
1 259 VAL n 
1 260 SER n 
1 261 GLN n 
1 262 LEU n 
1 263 HIS n 
1 264 LYS n 
1 265 CYS n 
1 266 ALA n 
1 267 PHE n 
1 268 TYR n 
1 269 LEU n 
1 270 LYS n 
1 271 ASP n 
1 272 THR n 
1 273 GLU n 
1 274 ARG n 
1 275 MET n 
1 276 TYR n 
1 277 LEU n 
1 278 CYS n 
1 279 LEU n 
1 280 SER n 
1 281 GLN n 
1 282 GLU n 
1 283 ARG n 
1 284 ILE n 
1 285 ILE n 
1 286 GLN n 
1 287 PHE n 
1 288 GLN n 
1 289 ALA n 
1 290 THR n 
1 291 PRO n 
1 292 CYS n 
1 293 PRO n 
1 294 LYS n 
1 295 GLU n 
1 296 PRO n 
1 297 ASN n 
1 298 LYS n 
1 299 GLU n 
1 300 MET n 
1 301 ILE n 
1 302 ASN n 
1 303 ASP n 
1 304 GLY n 
1 305 ALA n 
1 306 SER n 
1 307 TRP n 
1 308 THR n 
1 309 ILE n 
1 310 ILE n 
1 311 SER n 
1 312 THR n 
1 313 ASP n 
1 314 LYS n 
1 315 ALA n 
1 316 GLU n 
1 317 TYR n 
1 318 THR n 
1 319 PHE n 
1 320 TYR n 
1 321 GLU n 
1 322 GLY n 
1 323 MET n 
1 324 GLY n 
1 325 PRO n 
1 326 VAL n 
1 327 LEU n 
1 328 ALA n 
1 329 PRO n 
1 330 VAL n 
1 331 THR n 
1 332 PRO n 
1 333 VAL n 
1 334 PRO n 
1 335 VAL n 
1 336 VAL n 
1 337 GLU n 
1 338 SER n 
1 339 LEU n 
1 340 GLN n 
1 341 LEU n 
1 342 ASN n 
1 343 GLY n 
1 344 GLY n 
1 345 GLY n 
1 346 ASP n 
1 347 VAL n 
1 348 ALA n 
1 349 MET n 
1 350 LEU n 
1 351 GLU n 
1 352 LEU n 
1 353 THR n 
1 354 GLY n 
1 355 GLN n 
1 356 ASN n 
1 357 PHE n 
1 358 THR n 
1 359 PRO n 
1 360 ASN n 
1 361 LEU n 
1 362 ARG n 
1 363 VAL n 
1 364 TRP n 
1 365 PHE n 
1 366 GLY n 
1 367 ASP n 
1 368 VAL n 
1 369 GLU n 
1 370 ALA n 
1 371 GLU n 
1 372 THR n 
1 373 MET n 
1 374 TYR n 
1 375 ARG n 
1 376 CYS n 
1 377 GLY n 
1 378 GLU n 
1 379 SER n 
1 380 MET n 
1 381 LEU n 
1 382 CYS n 
1 383 VAL n 
1 384 VAL n 
1 385 PRO n 
1 386 ASP n 
1 387 ILE n 
1 388 SER n 
1 389 ALA n 
1 390 PHE n 
1 391 ARG n 
1 392 GLU n 
1 393 GLY n 
1 394 TRP n 
1 395 ARG n 
1 396 TRP n 
1 397 VAL n 
1 398 ARG n 
1 399 GLN n 
1 400 PRO n 
1 401 VAL n 
1 402 GLN n 
1 403 VAL n 
1 404 PRO n 
1 405 VAL n 
1 406 THR n 
1 407 LEU n 
1 408 VAL n 
1 409 ARG n 
1 410 ASN n 
1 411 ASP n 
1 412 GLY n 
1 413 ILE n 
1 414 ILE n 
1 415 TYR n 
1 416 SER n 
1 417 THR n 
1 418 SER n 
1 419 LEU n 
1 420 THR n 
1 421 PHE n 
1 422 THR n 
1 423 TYR n 
1 424 THR n 
1 425 PRO n 
1 426 GLU n 
1 427 PRO n 
1 428 HIS n 
1 429 HIS n 
1 430 HIS n 
1 431 HIS n 
1 432 HIS n 
1 433 HIS n 
2 1   GLY n 
2 2   MET n 
2 3   ASP n 
2 4   VAL n 
2 5   ASN n 
2 6   VAL n 
2 7   ARG n 
2 8   GLY n 
2 9   PRO n 
2 10  ASP n 
2 11  GLY n 
2 12  PHE n 
2 13  THR n 
2 14  PRO n 
2 15  LEU n 
2 16  MET n 
2 17  ILE n 
2 18  ALA n 
2 19  SER n 
2 20  CYS n 
2 21  SER n 
2 22  GLY n 
2 23  GLY n 
2 24  GLY n 
2 25  LEU n 
2 26  GLU n 
2 27  THR n 
2 28  GLY n 
2 29  ASN n 
2 30  SER n 
2 31  GLU n 
2 32  GLU n 
2 33  GLU n 
2 34  GLU n 
2 35  ASP n 
2 36  ALA n 
2 37  PRO n 
2 38  ALA n 
2 39  VAL n 
2 40  ILE n 
2 41  SER n 
2 42  ASP n 
2 43  PHE n 
2 44  ILE n 
2 45  TYR n 
2 46  GLN n 
2 47  GLY n 
2 48  ALA n 
2 49  SER n 
2 50  LEU n 
2 51  HIS n 
2 52  ASN n 
2 53  GLN n 
2 54  THR n 
2 55  ASP n 
2 56  ARG n 
2 57  THR n 
2 58  GLY n 
2 59  GLU n 
2 60  THR n 
2 61  ALA n 
2 62  LEU n 
2 63  HIS n 
2 64  LEU n 
2 65  ALA n 
2 66  ALA n 
2 67  ARG n 
2 68  TYR n 
2 69  SER n 
2 70  ARG n 
2 71  SER n 
2 72  ASP n 
2 73  ALA n 
2 74  ALA n 
2 75  LYS n 
2 76  ARG n 
2 77  LEU n 
2 78  LEU n 
2 79  GLU n 
2 80  ALA n 
2 81  SER n 
2 82  ALA n 
2 83  ASP n 
2 84  ALA n 
2 85  ASN n 
2 86  ILE n 
2 87  GLN n 
2 88  ASP n 
2 89  ASN n 
2 90  MET n 
2 91  GLY n 
2 92  ARG n 
2 93  THR n 
2 94  PRO n 
2 95  LEU n 
2 96  HIS n 
2 97  ALA n 
2 98  ALA n 
2 99  VAL n 
2 100 SER n 
2 101 ALA n 
2 102 ASP n 
2 103 ALA n 
2 104 GLN n 
2 105 GLY n 
2 106 VAL n 
2 107 PHE n 
2 108 GLN n 
2 109 ILE n 
2 110 LEU n 
2 111 ILE n 
2 112 ARG n 
2 113 ASN n 
2 114 ARG n 
2 115 ALA n 
2 116 THR n 
2 117 ASP n 
2 118 LEU n 
2 119 ASP n 
2 120 ALA n 
2 121 ARG n 
2 122 MET n 
2 123 HIS n 
2 124 ASP n 
2 125 GLY n 
2 126 THR n 
2 127 THR n 
2 128 PRO n 
2 129 LEU n 
2 130 ILE n 
2 131 LEU n 
2 132 ALA n 
2 133 ALA n 
2 134 ARG n 
2 135 LEU n 
2 136 ALA n 
2 137 VAL n 
2 138 GLU n 
2 139 GLY n 
2 140 MET n 
2 141 LEU n 
2 142 GLU n 
2 143 ASP n 
2 144 LEU n 
2 145 ILE n 
2 146 ASN n 
2 147 SER n 
2 148 HIS n 
2 149 ALA n 
2 150 ASP n 
2 151 VAL n 
2 152 ASN n 
2 153 ALA n 
2 154 VAL n 
2 155 ASP n 
2 156 ASP n 
2 157 LEU n 
2 158 GLY n 
2 159 LYS n 
2 160 SER n 
2 161 ALA n 
2 162 LEU n 
2 163 HIS n 
2 164 TRP n 
2 165 ALA n 
2 166 ALA n 
2 167 ALA n 
2 168 VAL n 
2 169 ASN n 
2 170 ASN n 
2 171 VAL n 
2 172 ASP n 
2 173 ALA n 
2 174 ALA n 
2 175 VAL n 
2 176 VAL n 
2 177 LEU n 
2 178 LEU n 
2 179 LYS n 
2 180 ASN n 
2 181 GLY n 
2 182 ALA n 
2 183 ASN n 
2 184 LYS n 
2 185 ASP n 
2 186 MET n 
2 187 GLN n 
2 188 ASN n 
2 189 ASN n 
2 190 ARG n 
2 191 GLU n 
2 192 GLU n 
2 193 THR n 
2 194 PRO n 
2 195 LEU n 
2 196 PHE n 
2 197 LEU n 
2 198 ALA n 
2 199 ALA n 
2 200 ARG n 
2 201 GLU n 
2 202 GLY n 
2 203 SER n 
2 204 TYR n 
2 205 GLU n 
2 206 THR n 
2 207 ALA n 
2 208 LYS n 
2 209 VAL n 
2 210 LEU n 
2 211 LEU n 
2 212 ASP n 
2 213 HIS n 
2 214 PHE n 
2 215 ALA n 
2 216 ASN n 
2 217 ARG n 
2 218 ASP n 
2 219 ILE n 
2 220 THR n 
2 221 ASP n 
2 222 HIS n 
2 223 MET n 
2 224 ASP n 
2 225 ARG n 
2 226 LEU n 
2 227 PRO n 
2 228 ARG n 
2 229 ASP n 
2 230 ILE n 
2 231 ALA n 
2 232 GLN n 
2 233 GLU n 
2 234 ARG n 
2 235 MET n 
2 236 HIS n 
2 237 HIS n 
2 238 ASP n 
2 239 ILE n 
2 240 VAL n 
2 241 ARG n 
2 242 LEU n 
2 243 LEU n 
2 244 ASP n 
2 245 GLU n 
2 246 TYR n 
2 247 ASN n 
2 248 LEU n 
2 249 VAL n 
2 250 ARG n 
2 251 SER n 
2 252 PRO n 
2 253 GLN n 
2 254 LEU n 
2 255 HIS n 
2 256 GLY n 
3 1   GLY n 
3 2   LEU n 
3 3   PRO n 
3 4   ARG n 
3 5   HIS n 
3 6   SER n 
3 7   ALA n 
3 8   VAL n 
3 9   MET n 
3 10  GLU n 
3 11  ARG n 
3 12  LEU n 
3 13  ARG n 
3 14  ARG n 
3 15  ARG n 
3 16  ILE n 
3 17  GLU n 
3 18  LEU n 
3 19  CYS n 
3 20  ARG n 
3 21  ARG n 
3 22  HIS n 
3 23  HIS n 
3 24  SER n 
3 25  THR n 
3 26  CYS n 
3 27  GLU n 
3 28  ALA n 
3 29  ARG n 
3 30  TYR n 
3 31  GLU n 
3 32  ALA n 
3 33  VAL n 
3 34  SER n 
3 35  PRO n 
3 36  GLU n 
3 37  ARG n 
3 38  LEU n 
3 39  GLU n 
3 40  LEU n 
3 41  GLU n 
3 42  ARG n 
3 43  GLN n 
3 44  HIS n 
3 45  THR n 
3 46  PHE n 
3 47  ALA n 
3 48  LEU n 
3 49  HIS n 
3 50  GLN n 
3 51  ARG n 
3 52  CYS n 
3 53  ILE n 
3 54  GLN n 
3 55  ALA n 
3 56  LYS n 
3 57  ALA n 
3 58  LYS n 
3 59  ARG n 
3 60  ALA n 
3 61  GLY n 
3 62  LYS n 
3 63  HIS n 
4 1   DT  n 
4 2   DA  n 
4 3   DC  n 
4 4   DT  n 
4 5   DG  n 
4 6   DT  n 
4 7   DG  n 
4 8   DG  n 
4 9   DG  n 
4 10  DA  n 
4 11  DA  n 
4 12  DA  n 
4 13  DG  n 
4 14  DA  n 
4 15  DA  n 
4 16  DA  n 
4 17  DG  n 
4 18  DT  n 
4 19  DT  n 
4 20  DT  n 
4 21  DG  n 
4 22  DG  n 
4 23  DA  n 
4 24  DA  n 
4 25  DA  n 
4 26  DA  n 
4 27  DT  n 
4 28  DT  n 
4 29  DT  n 
4 30  DC  n 
4 31  DA  n 
4 32  DC  n 
4 33  DA  n 
4 34  DC  n 
4 35  DG  n 
4 36  DA  n 
4 37  DG  n 
5 1   DA  n 
5 2   DC  n 
5 3   DT  n 
5 4   DC  n 
5 5   DG  n 
5 6   DT  n 
5 7   DG  n 
5 8   DT  n 
5 9   DG  n 
5 10  DA  n 
5 11  DA  n 
5 12  DA  n 
5 13  DC  n 
5 14  DT  n 
5 15  DT  n 
5 16  DC  n 
5 17  DC  n 
5 18  DC  n 
5 19  DA  n 
5 20  DA  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DT  n 
5 25  DT  n 
5 26  DC  n 
5 27  DT  n 
5 28  DT  n 
5 29  DT  n 
5 30  DC  n 
5 31  DC  n 
5 32  DC  n 
5 33  DA  n 
5 34  DC  n 
5 35  DA  n 
5 36  DG  n 
5 37  DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'IGKJRB, IGKJRB1, RBPJ, RBPJK, RBPSUH' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'Rosetta II pLysS' ? ? ? ? ? ? ? plasmid ? ? ? pET28a  ? ? 
2 1 sample ? ? ? human ? 'NOTCH1, TAN1'                         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)pLysS'   ? ? ? ? ? ? ? plasmid ? ? ? PDEST15 ? ? 
3 1 sample ? ? ? human ? 'KIAA0200, MAML1'                      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)pLysS'   ? ? ? ? ? ? ? plasmid ? ? ? pRSET   ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
4 1 sample ? ? ? ? ? 'Sequence from mouse and human HES1 promoter region' 
5 1 sample ? ? ? ? ? 'Sequence from mouse and human HES1 promoter region' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SUH_HUMAN   Q06330 1 
;GERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAF
IGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIA
SGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRL
IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYE
GMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPV
QVPVTLVRNDGIIYSTSLTFTYTPEP
;
23   ? 
2 UNP NOTC1_HUMAN P46531 2 
;MDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEAS
ADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSA
LHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVR
LLDEYNLVRSPQLHG
;
1872 ? 
3 UNP MAML1_HUMAN Q92585 3 LPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKRAGKH 13   ? 
4 PDB 3NBN        3NBN   4 TACTGTGGGAAAGAAAGTTTGGAAAATTTCACACGAG 1    ? 
5 PDB 3NBN        3NBN   5 ACTCGTGTGAAACTTCCCAAACTTTCTTTCCCACAGT 1    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NBN A 2 ? 427 ? Q06330 23   ? 448  ? 9    434  
2 2 3NBN B 2 ? 256 ? P46531 1872 ? 2126 ? 1873 2127 
3 3 3NBN C 2 ? 63  ? Q92585 13   ? 74   ? 13   74   
4 1 3NBN D 2 ? 427 ? Q06330 23   ? 448  ? 9    434  
5 2 3NBN E 2 ? 256 ? P46531 1872 ? 2126 ? 1873 2127 
6 3 3NBN F 2 ? 63  ? Q92585 13   ? 74   ? 13   74   
7 4 3NBN X 1 ? 37  ? 3NBN   1    ? 37   ? 1    37   
8 5 3NBN Y 1 ? 37  ? 3NBN   1    ? 37   ? 1    37   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NBN MET A 1   ? UNP Q06330 ? ? 'EXPRESSION TAG' 8    1  
1 3NBN HIS A 428 ? UNP Q06330 ? ? 'EXPRESSION TAG' 435  2  
1 3NBN HIS A 429 ? UNP Q06330 ? ? 'EXPRESSION TAG' 436  3  
1 3NBN HIS A 430 ? UNP Q06330 ? ? 'EXPRESSION TAG' 437  4  
1 3NBN HIS A 431 ? UNP Q06330 ? ? 'EXPRESSION TAG' 438  5  
1 3NBN HIS A 432 ? UNP Q06330 ? ? 'EXPRESSION TAG' 439  6  
1 3NBN HIS A 433 ? UNP Q06330 ? ? 'EXPRESSION TAG' 440  7  
2 3NBN GLY B 1   ? UNP P46531 ? ? 'EXPRESSION TAG' 1872 8  
3 3NBN GLY C 1   ? UNP Q92585 ? ? 'EXPRESSION TAG' 12   9  
4 3NBN MET D 1   ? UNP Q06330 ? ? 'EXPRESSION TAG' 8    10 
4 3NBN HIS D 428 ? UNP Q06330 ? ? 'EXPRESSION TAG' 435  11 
4 3NBN HIS D 429 ? UNP Q06330 ? ? 'EXPRESSION TAG' 436  12 
4 3NBN HIS D 430 ? UNP Q06330 ? ? 'EXPRESSION TAG' 437  13 
4 3NBN HIS D 431 ? UNP Q06330 ? ? 'EXPRESSION TAG' 438  14 
4 3NBN HIS D 432 ? UNP Q06330 ? ? 'EXPRESSION TAG' 439  15 
4 3NBN HIS D 433 ? UNP Q06330 ? ? 'EXPRESSION TAG' 440  16 
5 3NBN GLY E 1   ? UNP P46531 ? ? 'EXPRESSION TAG' 1872 17 
6 3NBN GLY F 1   ? UNP Q92585 ? ? 'EXPRESSION TAG' 12   18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3NBN 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.87 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;3% PEG3350, 10% ethylene glycol, 0.15M NaCl, 0.1M magnesium chloride, 0.1M BIS-TRIS, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2007-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97926 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97926 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3NBN 
_reflns.d_resolution_high            3.450 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   35389 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_netI_over_sigmaI        12.400 
_reflns.pdbx_chi_squared             1.069 
_reflns.pdbx_redundancy              9.500 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
3.45 3.51  ? ? ? 0.396 ? ? 1.172 7.20  ? 1733 99.90  ? 1  
3.51 3.57  ? ? ? 0.365 ? ? 1.112 7.70  ? 1777 100.00 ? 2  
3.57 3.64  ? ? ? 0.320 ? ? 1.118 8.10  ? 1767 100.00 ? 3  
3.64 3.72  ? ? ? 0.279 ? ? 1.099 8.80  ? 1752 100.00 ? 4  
3.72 3.80  ? ? ? 0.249 ? ? 1.080 9.10  ? 1779 100.00 ? 5  
3.80 3.89  ? ? ? 0.218 ? ? 1.085 9.50  ? 1748 100.00 ? 6  
3.89 3.98  ? ? ? 0.168 ? ? 1.040 9.70  ? 1779 100.00 ? 7  
3.98 4.09  ? ? ? 0.132 ? ? 1.065 9.90  ? 1736 100.00 ? 8  
4.09 4.21  ? ? ? 0.111 ? ? 1.095 10.00 ? 1777 100.00 ? 9  
4.21 4.35  ? ? ? 0.093 ? ? 1.038 10.10 ? 1774 100.00 ? 10 
4.35 4.50  ? ? ? 0.084 ? ? 1.061 10.20 ? 1752 99.90  ? 11 
4.50 4.68  ? ? ? 0.070 ? ? 1.034 10.10 ? 1766 100.00 ? 12 
4.68 4.89  ? ? ? 0.070 ? ? 1.013 10.10 ? 1761 100.00 ? 13 
4.89 5.15  ? ? ? 0.070 ? ? 1.080 10.20 ? 1798 100.00 ? 14 
5.15 5.47  ? ? ? 0.073 ? ? 1.067 10.00 ? 1749 100.00 ? 15 
5.47 5.90  ? ? ? 0.075 ? ? 1.025 10.10 ? 1777 100.00 ? 16 
5.90 6.49  ? ? ? 0.061 ? ? 1.066 10.00 ? 1773 100.00 ? 17 
6.49 7.43  ? ? ? 0.047 ? ? 1.100 9.80  ? 1784 99.80  ? 18 
7.43 9.35  ? ? ? 0.031 ? ? 1.045 9.90  ? 1787 99.40  ? 19 
9.35 50.00 ? ? ? 0.029 ? ? 1.045 9.90  ? 1820 98.80  ? 20 
# 
_refine.entry_id                                 3NBN 
_refine.ls_d_res_high                            3.450 
_refine.ls_d_res_low                             45.020 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.550 
_refine.ls_number_reflns_obs                     35361 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS; U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.256 
_refine.ls_R_factor_R_work                       0.254 
_refine.ls_wR_factor_R_work                      0.252 
_refine.ls_R_factor_R_free                       0.298 
_refine.ls_wR_factor_R_free                      0.299 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1802 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               126.540 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.050 
_refine.aniso_B[2][2]                            -0.110 
_refine.aniso_B[3][3]                            0.070 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.020 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.920 
_refine.correlation_coeff_Fo_to_Fc_free          0.896 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        0.631 
_refine.pdbx_overall_ESU_R_Free                  0.631 
_refine.overall_SU_ML                            0.523 
_refine.overall_SU_B                             32.278 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'protein components of 2F8X' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.763 
_refine.B_iso_max                                221.64 
_refine.B_iso_min                                63.23 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10686 
_refine_hist.pdbx_number_atoms_nucleic_acid   1512 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12198 
_refine_hist.d_res_high                       3.450 
_refine_hist.d_res_low                        45.020 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       12593 0.014  0.021  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         8203  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    17339 1.609  2.113  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      19991 1.049  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 1342  8.693  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 532   36.411 23.684 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 1938  22.912 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 98    16.706 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         1917  0.081  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   12933 0.008  0.021  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     2362  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            6722  0.681  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         2714  0.073  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           10826 1.266  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            5871  1.039  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           6513  1.873  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ordinal 
'X-RAY DIFFRACTION' 1 1 'TIGHT POSITIONAL' A 5757 0.030 0.050 ? ? ? ? ? ? 1 
'X-RAY DIFFRACTION' 1 1 'TIGHT THERMAL'    A 5757 0.050 0.500 ? ? ? ? ? ? 2 
'X-RAY DIFFRACTION' 2 1 'TIGHT POSITIONAL' B 2524 0.030 0.050 ? ? ? ? ? ? 3 
'X-RAY DIFFRACTION' 2 1 'TIGHT THERMAL'    B 2524 0.200 0.500 ? ? ? ? ? ? 4 
'X-RAY DIFFRACTION' 3 1 'TIGHT POSITIONAL' C 833  0.020 0.050 ? ? ? ? ? ? 5 
'X-RAY DIFFRACTION' 3 1 'TIGHT THERMAL'    C 833  0.570 0.500 ? ? ? ? ? ? 6 
# 
_refine_ls_shell.d_res_high                       3.448 
_refine_ls_shell.d_res_low                        3.537 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.010 
_refine_ls_shell.number_reflns_R_work             2394 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.342 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             109 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2503 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 D 
2 1 B 
2 2 E 
3 1 C 
3 2 F 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 1 A 12   A 434  ? . . . . . . . . 
1 2 1 1 D 12   D 434  ? . . . . . . . . 
2 1 1 1 B 1921 B 2119 ? . . . . . . . . 
2 2 1 1 E 1921 E 2119 ? . . . . . . . . 
3 1 1 1 C 16   C 70   ? . . . . . . . . 
3 2 1 1 F 16   F 70   ? . . . . . . . . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  3NBN 
_struct.title                     'Crystal structure of a dimer of Notch Transcription Complex trimers on HES1 DNA' 
_struct.pdbx_descriptor           
'Recombining binding protein suppressor of hairless, Neurogenic locus notch homolog protein 1, Mastermind-like protein 1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NBN 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;Promoter Regions, Notch1, CSL, RBPJ, Mastermind, Transcription Factors, Transcription, Transcriptional Activation, TRANSCRIPTION-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 14  ? TYR A 18  ? ALA A 21   TYR A 25   5 ? 5  
HELX_P HELX_P2  2  GLY A 58  ? ARG A 68  ? GLY A 65   ARG A 75   1 ? 11 
HELX_P HELX_P3  3  GLN A 175 ? THR A 179 ? GLN A 182  THR A 186  5 ? 5  
HELX_P HELX_P4  4  ASN A 302 ? SER A 306 ? ASN A 309  SER A 313  5 ? 5  
HELX_P HELX_P5  5  ASP A 386 ? PHE A 390 ? ASP A 393  PHE A 397  5 ? 5  
HELX_P HELX_P6  6  THR B 60  ? SER B 69  ? THR B 1931 SER B 1940 1 ? 10 
HELX_P HELX_P7  7  ARG B 70  ? ALA B 80  ? ARG B 1941 ALA B 1951 1 ? 11 
HELX_P HELX_P8  8  THR B 93  ? ALA B 101 ? THR B 1964 ALA B 1972 1 ? 9  
HELX_P HELX_P9  9  ALA B 103 ? ASN B 113 ? ALA B 1974 ASN B 1984 1 ? 11 
HELX_P HELX_P10 10 THR B 127 ? LEU B 135 ? THR B 1998 LEU B 2006 1 ? 9  
HELX_P HELX_P11 11 GLY B 139 ? SER B 147 ? GLY B 2010 SER B 2018 1 ? 9  
HELX_P HELX_P12 12 SER B 160 ? VAL B 168 ? SER B 2031 VAL B 2039 1 ? 9  
HELX_P HELX_P13 13 ASN B 170 ? LYS B 179 ? ASN B 2041 LYS B 2050 1 ? 10 
HELX_P HELX_P14 14 THR B 193 ? GLY B 202 ? THR B 2064 GLY B 2073 1 ? 10 
HELX_P HELX_P15 15 SER B 203 ? HIS B 213 ? SER B 2074 HIS B 2084 1 ? 11 
HELX_P HELX_P16 16 LEU B 226 ? MET B 235 ? LEU B 2097 MET B 2106 1 ? 10 
HELX_P HELX_P17 17 HIS B 236 ? TYR B 246 ? HIS B 2107 TYR B 2117 1 ? 11 
HELX_P HELX_P18 18 VAL C 8   ? GLU C 27  ? VAL C 19   GLU C 38   1 ? 20 
HELX_P HELX_P19 19 ALA C 28  ? LEU C 48  ? ALA C 39   LEU C 59   1 ? 21 
HELX_P HELX_P20 20 LEU C 48  ? ILE C 53  ? LEU C 59   ILE C 64   1 ? 6  
HELX_P HELX_P21 21 ALA D 14  ? TYR D 18  ? ALA D 21   TYR D 25   5 ? 5  
HELX_P HELX_P22 22 GLY D 58  ? ARG D 68  ? GLY D 65   ARG D 75   1 ? 11 
HELX_P HELX_P23 23 GLN D 175 ? THR D 179 ? GLN D 182  THR D 186  5 ? 5  
HELX_P HELX_P24 24 ASN D 302 ? SER D 306 ? ASN D 309  SER D 313  5 ? 5  
HELX_P HELX_P25 25 ASP D 386 ? PHE D 390 ? ASP D 393  PHE D 397  5 ? 5  
HELX_P HELX_P26 26 THR E 60  ? SER E 69  ? THR E 1931 SER E 1940 1 ? 10 
HELX_P HELX_P27 27 ARG E 70  ? ALA E 80  ? ARG E 1941 ALA E 1951 1 ? 11 
HELX_P HELX_P28 28 THR E 93  ? ALA E 101 ? THR E 1964 ALA E 1972 1 ? 9  
HELX_P HELX_P29 29 ALA E 103 ? ASN E 113 ? ALA E 1974 ASN E 1984 1 ? 11 
HELX_P HELX_P30 30 THR E 127 ? LEU E 135 ? THR E 1998 LEU E 2006 1 ? 9  
HELX_P HELX_P31 31 GLY E 139 ? SER E 147 ? GLY E 2010 SER E 2018 1 ? 9  
HELX_P HELX_P32 32 SER E 160 ? VAL E 168 ? SER E 2031 VAL E 2039 1 ? 9  
HELX_P HELX_P33 33 ASN E 170 ? LYS E 179 ? ASN E 2041 LYS E 2050 1 ? 10 
HELX_P HELX_P34 34 THR E 193 ? GLY E 202 ? THR E 2064 GLY E 2073 1 ? 10 
HELX_P HELX_P35 35 SER E 203 ? HIS E 213 ? SER E 2074 HIS E 2084 1 ? 11 
HELX_P HELX_P36 36 LEU E 226 ? MET E 235 ? LEU E 2097 MET E 2106 1 ? 10 
HELX_P HELX_P37 37 HIS E 236 ? TYR E 246 ? HIS E 2107 TYR E 2117 1 ? 11 
HELX_P HELX_P38 38 VAL F 8   ? GLU F 27  ? VAL F 19   GLU F 38   1 ? 20 
HELX_P HELX_P39 39 ALA F 28  ? LEU F 48  ? ALA F 39   LEU F 59   1 ? 21 
HELX_P HELX_P40 40 LEU F 48  ? ILE F 53  ? LEU F 59   ILE F 64   1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 79 SG ? ? ? 1_555 C CYS 52 SG ? ? A CYS 86 C CYS 63 1_555 ? ? ? ? ? ? ?               2.033 ? 
disulf2  disulf ? ? D CYS 79 SG ? ? ? 1_555 F CYS 52 SG ? ? D CYS 86 F CYS 63 1_555 ? ? ? ? ? ? ?               2.041 ? 
hydrog1  hydrog ? ? G DA  2  N6 ? ? ? 1_555 H DT  37 O4 ? ? X DA  2  Y DT  37 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog2  hydrog ? ? G DC  3  N4 ? ? ? 1_555 H DG  36 O6 ? ? X DC  3  Y DG  36 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog3  hydrog ? ? G DT  4  N3 ? ? ? 1_555 H DA  35 N1 ? ? X DT  4  Y DA  35 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog4  hydrog ? ? G DG  5  O6 ? ? ? 1_555 H DA  33 N6 ? ? X DG  5  Y DA  33 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog5  hydrog ? ? G DG  5  N1 ? ? ? 1_555 H DC  34 N3 ? ? X DG  5  Y DC  34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? G DG  5  N2 ? ? ? 1_555 H DC  34 O2 ? ? X DG  5  Y DC  34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? G DG  5  O6 ? ? ? 1_555 H DC  34 N4 ? ? X DG  5  Y DC  34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? G DG  7  N2 ? ? ? 1_555 H DC  32 O2 ? ? X DG  7  Y DC  32 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog9  hydrog ? ? G DG  8  N1 ? ? ? 1_555 H DC  31 N3 ? ? X DG  8  Y DC  31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? G DG  8  N2 ? ? ? 1_555 H DC  31 O2 ? ? X DG  8  Y DC  31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? G DG  8  O6 ? ? ? 1_555 H DC  31 N4 ? ? X DG  8  Y DC  31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? G DG  9  N1 ? ? ? 1_555 H DC  30 N3 ? ? X DG  9  Y DC  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? G DG  9  N2 ? ? ? 1_555 H DC  30 O2 ? ? X DG  9  Y DC  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? G DG  9  O6 ? ? ? 1_555 H DC  30 N4 ? ? X DG  9  Y DC  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? G DA  10 N1 ? ? ? 1_555 H DT  29 N3 ? ? X DA  10 Y DT  29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? G DA  10 N6 ? ? ? 1_555 H DT  29 O4 ? ? X DA  10 Y DT  29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? G DA  11 N6 ? ? ? 1_555 H DT  27 O4 ? ? X DA  11 Y DT  27 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog18 hydrog ? ? G DA  12 N1 ? ? ? 1_555 H DT  27 N3 ? ? X DA  12 Y DT  27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? G DA  12 N6 ? ? ? 1_555 H DT  27 O4 ? ? X DA  12 Y DT  27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? G DG  13 N1 ? ? ? 1_555 H DC  26 O2 ? ? X DG  13 Y DC  26 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog21 hydrog ? ? G DA  14 N1 ? ? ? 1_555 H DT  25 N3 ? ? X DA  14 Y DT  25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? G DA  14 N6 ? ? ? 1_555 H DT  25 O4 ? ? X DA  14 Y DT  25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? G DA  16 N6 ? ? ? 1_555 H DT  24 O2 ? ? X DA  16 Y DT  24 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog24 hydrog ? ? G DG  17 N2 ? ? ? 1_555 H DC  22 O2 ? ? X DG  17 Y DC  22 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog25 hydrog ? ? G DT  19 O2 ? ? ? 1_555 H DA  19 N6 ? ? X DT  19 Y DA  19 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog26 hydrog ? ? G DT  19 O2 ? ? ? 1_555 H DA  20 N6 ? ? X DT  19 Y DA  20 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog27 hydrog ? ? G DG  21 N1 ? ? ? 1_555 H DC  18 N3 ? ? X DG  21 Y DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? G DG  21 N2 ? ? ? 1_555 H DC  18 O2 ? ? X DG  21 Y DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? G DG  21 O6 ? ? ? 1_555 H DC  18 N4 ? ? X DG  21 Y DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? G DG  22 N2 ? ? ? 1_555 H DC  17 N3 ? ? X DG  22 Y DC  17 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog31 hydrog ? ? G DG  22 N2 ? ? ? 1_555 H DC  18 O2 ? ? X DG  22 Y DC  18 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog32 hydrog ? ? G DA  23 N6 ? ? ? 1_555 H DC  16 N3 ? ? X DA  23 Y DC  16 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog33 hydrog ? ? G DA  24 N1 ? ? ? 1_555 H DT  15 N3 ? ? X DA  24 Y DT  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? G DA  24 N6 ? ? ? 1_555 H DT  15 O4 ? ? X DA  24 Y DT  15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? G DA  26 N6 ? ? ? 1_555 H DC  13 O2 ? ? X DA  26 Y DC  13 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog36 hydrog ? ? G DT  27 N3 ? ? ? 1_555 H DA  12 N1 ? ? X DT  27 Y DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ? ? G DT  27 O4 ? ? ? 1_555 H DA  12 N6 ? ? X DT  27 Y DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ? ? G DC  30 N3 ? ? ? 1_555 H DG  9  N1 ? ? X DC  30 Y DG  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ? ? G DC  30 N4 ? ? ? 1_555 H DG  9  O6 ? ? X DC  30 Y DG  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? G DC  30 O2 ? ? ? 1_555 H DG  9  N2 ? ? X DC  30 Y DG  9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41 hydrog ? ? G DC  32 N4 ? ? ? 1_555 H DT  6  O4 ? ? X DC  32 Y DT  6  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog42 hydrog ? ? G DC  32 O2 ? ? ? 1_555 H DG  7  N1 ? ? X DC  32 Y DG  7  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog43 hydrog ? ? G DA  33 N1 ? ? ? 1_555 H DG  5  N1 ? ? X DA  33 Y DG  5  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog44 hydrog ? ? G DA  33 N6 ? ? ? 1_555 H DG  5  O6 ? ? X DA  33 Y DG  5  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog45 hydrog ? ? G DA  33 N1 ? ? ? 1_555 H DT  6  N3 ? ? X DA  33 Y DT  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ? ? G DA  33 N6 ? ? ? 1_555 H DT  6  O4 ? ? X DA  33 Y DT  6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ? ? G DC  34 O2 ? ? ? 1_555 H DG  5  N2 ? ? X DC  34 Y DG  5  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog48 hydrog ? ? G DG  35 N1 ? ? ? 1_555 H DC  4  N3 ? ? X DG  35 Y DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ? ? G DG  35 N2 ? ? ? 1_555 H DC  4  O2 ? ? X DG  35 Y DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50 hydrog ? ? G DG  35 O6 ? ? ? 1_555 H DC  4  N4 ? ? X DG  35 Y DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51 hydrog ? ? G DA  36 N1 ? ? ? 1_555 H DT  3  N3 ? ? X DA  36 Y DT  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52 hydrog ? ? G DA  36 N6 ? ? ? 1_555 H DT  3  O4 ? ? X DA  36 Y DT  3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53 hydrog ? ? G DG  37 N1 ? ? ? 1_555 H DC  2  N3 ? ? X DG  37 Y DC  2  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 331 A . ? THR 338 A PRO 332 A ? PRO 339 A 1 1.87  
2 THR 331 D . ? THR 338 D PRO 332 D ? PRO 339 D 1 -3.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 4 ? 
H ? 4 ? 
I ? 6 ? 
J ? 7 ? 
K ? 6 ? 
L ? 2 ? 
M ? 2 ? 
N ? 2 ? 
O ? 4 ? 
P ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
K 5 6 ? anti-parallel 
L 1 2 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 188 ? SER A 192 ? ASN A 195 SER A 199 
A 2 ARG A 180 ? GLU A 185 ? ARG A 187 GLU A 192 
A 3 LYS A 165 ? ASN A 170 ? LYS A 172 ASN A 177 
A 4 TRP A 307 ? PHE A 319 ? TRP A 314 PHE A 326 
A 5 GLN A 25  ? ALA A 32  ? GLN A 32  ALA A 39  
A 6 CYS A 51  ? TYR A 53  ? CYS A 58  TYR A 60  
B 1 LEU A 229 ? CYS A 231 ? LEU A 236 CYS A 238 
B 2 PHE A 199 ? ILE A 201 ? PHE A 206 ILE A 208 
B 3 LYS A 165 ? ASN A 170 ? LYS A 172 ASN A 177 
B 4 TRP A 307 ? PHE A 319 ? TRP A 314 PHE A 326 
B 5 HIS A 263 ? LEU A 269 ? HIS A 270 LEU A 276 
B 6 LEU A 241 ? LYS A 245 ? LEU A 248 LYS A 252 
B 7 THR A 226 ? VAL A 227 ? THR A 233 VAL A 234 
C 1 CYS A 51  ? TYR A 53  ? CYS A 58  TYR A 60  
C 2 GLN A 25  ? ALA A 32  ? GLN A 32  ALA A 39  
C 3 TRP A 307 ? PHE A 319 ? TRP A 314 PHE A 326 
C 4 HIS A 263 ? LEU A 269 ? HIS A 270 LEU A 276 
C 5 TYR A 276 ? CYS A 278 ? TYR A 283 CYS A 285 
C 6 ILE A 285 ? PHE A 287 ? ILE A 292 PHE A 294 
D 1 VAL A 34  ? GLN A 36  ? VAL A 41  GLN A 43  
D 2 LYS A 141 ? ILE A 143 ? LYS A 148 ILE A 150 
E 1 PHE A 81  ? ILE A 82  ? PHE A 88  ILE A 89  
E 2 GLN A 92  ? GLN A 93  ? GLN A 99  GLN A 100 
F 1 THR A 250 ? ALA A 251 ? THR A 257 ALA A 258 
F 2 GLU A 299 ? MET A 300 ? GLU A 306 MET A 307 
G 1 VAL A 335 ? ASN A 342 ? VAL A 342 ASN A 349 
G 2 MET A 349 ? GLN A 355 ? MET A 356 GLN A 362 
G 3 SER A 379 ? CYS A 382 ? SER A 386 CYS A 389 
G 4 THR A 372 ? CYS A 376 ? THR A 379 CYS A 383 
H 1 VAL A 368 ? GLU A 369 ? VAL A 375 GLU A 376 
H 2 LEU A 361 ? PHE A 365 ? LEU A 368 PHE A 372 
H 3 VAL A 401 ? ARG A 409 ? VAL A 408 ARG A 416 
H 4 ILE A 414 ? TYR A 423 ? ILE A 421 TYR A 430 
I 1 ASN D 188 ? SER D 192 ? ASN D 195 SER D 199 
I 2 ARG D 180 ? GLU D 185 ? ARG D 187 GLU D 192 
I 3 LYS D 165 ? ASN D 170 ? LYS D 172 ASN D 177 
I 4 TRP D 307 ? PHE D 319 ? TRP D 314 PHE D 326 
I 5 GLN D 25  ? ALA D 32  ? GLN D 32  ALA D 39  
I 6 CYS D 51  ? TYR D 53  ? CYS D 58  TYR D 60  
J 1 LEU D 229 ? CYS D 231 ? LEU D 236 CYS D 238 
J 2 PHE D 199 ? ILE D 201 ? PHE D 206 ILE D 208 
J 3 LYS D 165 ? ASN D 170 ? LYS D 172 ASN D 177 
J 4 TRP D 307 ? PHE D 319 ? TRP D 314 PHE D 326 
J 5 HIS D 263 ? LEU D 269 ? HIS D 270 LEU D 276 
J 6 LEU D 241 ? LYS D 245 ? LEU D 248 LYS D 252 
J 7 THR D 226 ? VAL D 227 ? THR D 233 VAL D 234 
K 1 CYS D 51  ? TYR D 53  ? CYS D 58  TYR D 60  
K 2 GLN D 25  ? ALA D 32  ? GLN D 32  ALA D 39  
K 3 TRP D 307 ? PHE D 319 ? TRP D 314 PHE D 326 
K 4 HIS D 263 ? LEU D 269 ? HIS D 270 LEU D 276 
K 5 TYR D 276 ? CYS D 278 ? TYR D 283 CYS D 285 
K 6 ILE D 285 ? PHE D 287 ? ILE D 292 PHE D 294 
L 1 VAL D 34  ? GLN D 36  ? VAL D 41  GLN D 43  
L 2 LYS D 141 ? ILE D 143 ? LYS D 148 ILE D 150 
M 1 PHE D 81  ? ILE D 82  ? PHE D 88  ILE D 89  
M 2 GLN D 92  ? GLN D 93  ? GLN D 99  GLN D 100 
N 1 THR D 250 ? ALA D 251 ? THR D 257 ALA D 258 
N 2 GLU D 299 ? MET D 300 ? GLU D 306 MET D 307 
O 1 VAL D 335 ? GLN D 340 ? VAL D 342 GLN D 347 
O 2 LEU D 350 ? GLN D 355 ? LEU D 357 GLN D 362 
O 3 SER D 379 ? CYS D 382 ? SER D 386 CYS D 389 
O 4 THR D 372 ? CYS D 376 ? THR D 379 CYS D 383 
P 1 VAL D 368 ? GLU D 369 ? VAL D 375 GLU D 376 
P 2 LEU D 361 ? PHE D 365 ? LEU D 368 PHE D 372 
P 3 VAL D 401 ? ARG D 409 ? VAL D 408 ARG D 416 
P 4 ILE D 414 ? TYR D 423 ? ILE D 421 TYR D 430 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 190 ? O HIS A 197 N HIS A 183 ? N HIS A 190 
A 2 3 O ARG A 180 ? O ARG A 187 N ASN A 170 ? N ASN A 177 
A 3 4 N PHE A 169 ? N PHE A 176 O THR A 308 ? O THR A 315 
A 4 5 O ALA A 315 ? O ALA A 322 N ILE A 29  ? N ILE A 36  
A 5 6 N LEU A 28  ? N LEU A 35  O TYR A 53  ? O TYR A 60  
B 1 2 O VAL A 230 ? O VAL A 237 N PHE A 200 ? N PHE A 207 
B 2 3 O PHE A 199 ? O PHE A 206 N VAL A 166 ? N VAL A 173 
B 3 4 N PHE A 169 ? N PHE A 176 O THR A 308 ? O THR A 315 
B 4 5 O ILE A 309 ? O ILE A 316 N HIS A 263 ? N HIS A 270 
B 5 6 O ALA A 266 ? O ALA A 273 N ARG A 244 ? N ARG A 251 
B 6 7 O LEU A 241 ? O LEU A 248 N VAL A 227 ? N VAL A 234 
C 1 2 O TYR A 53  ? O TYR A 60  N LEU A 28  ? N LEU A 35  
C 2 3 N ILE A 29  ? N ILE A 36  O ALA A 315 ? O ALA A 322 
C 3 4 O ILE A 309 ? O ILE A 316 N HIS A 263 ? N HIS A 270 
C 4 5 N PHE A 267 ? N PHE A 274 O LEU A 277 ? O LEU A 284 
C 5 6 N TYR A 276 ? N TYR A 283 O PHE A 287 ? O PHE A 294 
D 1 2 N ALA A 35  ? N ALA A 42  O ILE A 143 ? O ILE A 150 
E 1 2 N ILE A 82  ? N ILE A 89  O GLN A 92  ? O GLN A 99  
F 1 2 N ALA A 251 ? N ALA A 258 O GLU A 299 ? O GLU A 306 
G 1 2 N GLN A 340 ? N GLN A 347 O GLU A 351 ? O GLU A 358 
G 2 3 N LEU A 352 ? N LEU A 359 O MET A 380 ? O MET A 387 
G 3 4 O LEU A 381 ? O LEU A 388 N MET A 373 ? N MET A 380 
H 1 2 O VAL A 368 ? O VAL A 375 N PHE A 365 ? N PHE A 372 
H 2 3 N TRP A 364 ? N TRP A 371 O THR A 406 ? O THR A 413 
H 3 4 N VAL A 403 ? N VAL A 410 O PHE A 421 ? O PHE A 428 
I 1 2 O SER D 192 ? O SER D 199 N TYR D 181 ? N TYR D 188 
I 2 3 O ARG D 180 ? O ARG D 187 N ASN D 170 ? N ASN D 177 
I 3 4 N PHE D 169 ? N PHE D 176 O THR D 308 ? O THR D 315 
I 4 5 O ALA D 315 ? O ALA D 322 N ILE D 29  ? N ILE D 36  
I 5 6 N LEU D 28  ? N LEU D 35  O TYR D 53  ? O TYR D 60  
J 1 2 O VAL D 230 ? O VAL D 237 N PHE D 200 ? N PHE D 207 
J 2 3 O PHE D 199 ? O PHE D 206 N VAL D 166 ? N VAL D 173 
J 3 4 N PHE D 169 ? N PHE D 176 O THR D 308 ? O THR D 315 
J 4 5 O ILE D 309 ? O ILE D 316 N HIS D 263 ? N HIS D 270 
J 5 6 O TYR D 268 ? O TYR D 275 N ILE D 242 ? N ILE D 249 
J 6 7 O LEU D 241 ? O LEU D 248 N VAL D 227 ? N VAL D 234 
K 1 2 O TYR D 53  ? O TYR D 60  N LEU D 28  ? N LEU D 35  
K 2 3 N ILE D 29  ? N ILE D 36  O ALA D 315 ? O ALA D 322 
K 3 4 O ILE D 309 ? O ILE D 316 N HIS D 263 ? N HIS D 270 
K 4 5 N PHE D 267 ? N PHE D 274 O LEU D 277 ? O LEU D 284 
K 5 6 N TYR D 276 ? N TYR D 283 O PHE D 287 ? O PHE D 294 
L 1 2 N ALA D 35  ? N ALA D 42  O LYS D 141 ? O LYS D 148 
M 1 2 N ILE D 82  ? N ILE D 89  O GLN D 92  ? O GLN D 99  
N 1 2 N ALA D 251 ? N ALA D 258 O GLU D 299 ? O GLU D 306 
O 1 2 N GLN D 340 ? N GLN D 347 O GLU D 351 ? O GLU D 358 
O 2 3 N LEU D 352 ? N LEU D 359 O MET D 380 ? O MET D 387 
O 3 4 O LEU D 381 ? O LEU D 388 N MET D 373 ? N MET D 380 
P 1 2 O VAL D 368 ? O VAL D 375 N PHE D 365 ? N PHE D 372 
P 2 3 N TRP D 364 ? N TRP D 371 O THR D 406 ? O THR D 413 
P 3 4 N VAL D 403 ? N VAL D 410 O PHE D 421 ? O PHE D 428 
# 
_atom_sites.entry_id                    3NBN 
_atom_sites.fract_transf_matrix[1][1]   0.003389 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000752 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009254 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011742 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . PRO A 1 5   ? -123.579 -33.479 -33.115  1.00 148.09 ? 12   PRO A N     1 
ATOM 2     C CA    . PRO A 1 5   ? -122.947 -33.863 -31.838  1.00 148.03 ? 12   PRO A CA    1 
ATOM 3     C C     . PRO A 1 5   ? -121.403 -33.972 -31.930  1.00 147.85 ? 12   PRO A C     1 
ATOM 4     O O     . PRO A 1 5   ? -120.910 -34.813 -32.700  1.00 148.08 ? 12   PRO A O     1 
ATOM 5     C CB    . PRO A 1 5   ? -123.577 -35.238 -31.530  1.00 148.04 ? 12   PRO A CB    1 
ATOM 6     C CG    . PRO A 1 5   ? -124.841 -35.304 -32.371  1.00 148.05 ? 12   PRO A CG    1 
ATOM 7     C CD    . PRO A 1 5   ? -124.559 -34.477 -33.593  1.00 148.13 ? 12   PRO A CD    1 
ATOM 8     N N     . PRO A 1 6   ? -120.644 -33.138 -31.156  1.00 147.40 ? 13   PRO A N     1 
ATOM 9     C CA    . PRO A 1 6   ? -119.151 -33.123 -31.174  1.00 146.77 ? 13   PRO A CA    1 
ATOM 10    C C     . PRO A 1 6   ? -118.464 -34.494 -30.894  1.00 145.82 ? 13   PRO A C     1 
ATOM 11    O O     . PRO A 1 6   ? -118.982 -35.268 -30.071  1.00 145.94 ? 13   PRO A O     1 
ATOM 12    C CB    . PRO A 1 6   ? -118.796 -32.085 -30.094  1.00 146.80 ? 13   PRO A CB    1 
ATOM 13    C CG    . PRO A 1 6   ? -119.975 -31.170 -30.062  1.00 147.17 ? 13   PRO A CG    1 
ATOM 14    C CD    . PRO A 1 6   ? -121.171 -32.072 -30.277  1.00 147.47 ? 13   PRO A CD    1 
ATOM 15    N N     . PRO A 1 7   ? -117.307 -34.780 -31.566  1.00 144.53 ? 14   PRO A N     1 
ATOM 16    C CA    . PRO A 1 7   ? -116.677 -36.111 -31.591  1.00 143.35 ? 14   PRO A CA    1 
ATOM 17    C C     . PRO A 1 7   ? -116.129 -36.572 -30.239  1.00 142.21 ? 14   PRO A C     1 
ATOM 18    O O     . PRO A 1 7   ? -115.443 -35.815 -29.556  1.00 141.91 ? 14   PRO A O     1 
ATOM 19    C CB    . PRO A 1 7   ? -115.532 -35.935 -32.595  1.00 143.43 ? 14   PRO A CB    1 
ATOM 20    C CG    . PRO A 1 7   ? -115.821 -34.661 -33.318  1.00 143.69 ? 14   PRO A CG    1 
ATOM 21    C CD    . PRO A 1 7   ? -116.488 -33.808 -32.314  1.00 144.31 ? 14   PRO A CD    1 
ATOM 22    N N     . LYS A 1 8   ? -116.429 -37.814 -29.871  1.00 141.15 ? 15   LYS A N     1 
ATOM 23    C CA    . LYS A 1 8   ? -116.088 -38.330 -28.537  1.00 140.34 ? 15   LYS A CA    1 
ATOM 24    C C     . LYS A 1 8   ? -114.957 -39.357 -28.571  1.00 139.29 ? 15   LYS A C     1 
ATOM 25    O O     . LYS A 1 8   ? -115.171 -40.509 -28.959  1.00 139.21 ? 15   LYS A O     1 
ATOM 26    C CB    . LYS A 1 8   ? -117.306 -38.988 -27.853  1.00 140.77 ? 15   LYS A CB    1 
ATOM 27    C CG    . LYS A 1 8   ? -118.703 -38.580 -28.353  1.00 141.44 ? 15   LYS A CG    1 
ATOM 28    C CD    . LYS A 1 8   ? -119.371 -37.554 -27.458  1.00 141.51 ? 15   LYS A CD    1 
ATOM 29    C CE    . LYS A 1 8   ? -120.743 -37.219 -27.994  1.00 142.02 ? 15   LYS A CE    1 
ATOM 30    N NZ    . LYS A 1 8   ? -120.873 -35.743 -28.147  1.00 142.83 ? 15   LYS A NZ    1 
ATOM 31    N N     . ARG A 1 9   ? -113.767 -38.949 -28.141  1.00 137.86 ? 16   ARG A N     1 
ATOM 32    C CA    . ARG A 1 9   ? -112.643 -39.867 -28.024  1.00 136.54 ? 16   ARG A CA    1 
ATOM 33    C C     . ARG A 1 9   ? -113.058 -41.085 -27.227  1.00 135.49 ? 16   ARG A C     1 
ATOM 34    O O     . ARG A 1 9   ? -113.754 -40.967 -26.234  1.00 135.33 ? 16   ARG A O     1 
ATOM 35    C CB    . ARG A 1 9   ? -111.463 -39.193 -27.343  1.00 136.72 ? 16   ARG A CB    1 
ATOM 36    C CG    . ARG A 1 9   ? -110.524 -38.375 -28.243  1.00 137.36 ? 16   ARG A CG    1 
ATOM 37    C CD    . ARG A 1 9   ? -109.216 -38.163 -27.499  1.00 138.24 ? 16   ARG A CD    1 
ATOM 38    N NE    . ARG A 1 9   ? -109.107 -39.182 -26.446  1.00 139.85 ? 16   ARG A NE    1 
ATOM 39    C CZ    . ARG A 1 9   ? -107.984 -39.596 -25.861  1.00 140.75 ? 16   ARG A CZ    1 
ATOM 40    N NH1   . ARG A 1 9   ? -106.802 -39.096 -26.210  1.00 142.07 ? 16   ARG A NH1   1 
ATOM 41    N NH2   . ARG A 1 9   ? -108.046 -40.537 -24.925  1.00 140.47 ? 16   ARG A NH2   1 
ATOM 42    N N     . LEU A 1 10  ? -112.638 -42.256 -27.677  1.00 134.58 ? 17   LEU A N     1 
ATOM 43    C CA    . LEU A 1 10  ? -113.024 -43.508 -27.041  1.00 133.75 ? 17   LEU A CA    1 
ATOM 44    C C     . LEU A 1 10  ? -112.555 -43.510 -25.607  1.00 133.35 ? 17   LEU A C     1 
ATOM 45    O O     . LEU A 1 10  ? -111.605 -42.819 -25.260  1.00 133.42 ? 17   LEU A O     1 
ATOM 46    C CB    . LEU A 1 10  ? -112.458 -44.708 -27.807  1.00 133.69 ? 17   LEU A CB    1 
ATOM 47    C CG    . LEU A 1 10  ? -112.865 -46.117 -27.350  1.00 133.57 ? 17   LEU A CG    1 
ATOM 48    C CD1   . LEU A 1 10  ? -113.279 -46.980 -28.515  1.00 133.56 ? 17   LEU A CD1   1 
ATOM 49    C CD2   . LEU A 1 10  ? -111.765 -46.800 -26.547  1.00 133.28 ? 17   LEU A CD2   1 
ATOM 50    N N     . THR A 1 11  ? -113.229 -44.284 -24.771  1.00 133.05 ? 18   THR A N     1 
ATOM 51    C CA    . THR A 1 11  ? -112.977 -44.255 -23.337  1.00 132.88 ? 18   THR A CA    1 
ATOM 52    C C     . THR A 1 11  ? -112.537 -45.584 -22.765  1.00 132.56 ? 18   THR A C     1 
ATOM 53    O O     . THR A 1 11  ? -112.921 -46.646 -23.246  1.00 132.36 ? 18   THR A O     1 
ATOM 54    C CB    . THR A 1 11  ? -114.230 -43.836 -22.566  1.00 132.96 ? 18   THR A CB    1 
ATOM 55    O OG1   . THR A 1 11  ? -115.295 -44.741 -22.886  1.00 133.34 ? 18   THR A OG1   1 
ATOM 56    C CG2   . THR A 1 11  ? -114.630 -42.393 -22.911  1.00 132.81 ? 18   THR A CG2   1 
ATOM 57    N N     . ARG A 1 12  ? -111.749 -45.505 -21.704  1.00 132.51 ? 19   ARG A N     1 
ATOM 58    C CA    . ARG A 1 12  ? -111.318 -46.670 -20.964  1.00 132.63 ? 19   ARG A CA    1 
ATOM 59    C C     . ARG A 1 12  ? -112.459 -47.689 -20.880  1.00 133.25 ? 19   ARG A C     1 
ATOM 60    O O     . ARG A 1 12  ? -112.233 -48.887 -20.765  1.00 133.16 ? 19   ARG A O     1 
ATOM 61    C CB    . ARG A 1 12  ? -110.871 -46.214 -19.574  1.00 132.46 ? 19   ARG A CB    1 
ATOM 62    C CG    . ARG A 1 12  ? -110.093 -47.221 -18.769  1.00 130.76 ? 19   ARG A CG    1 
ATOM 63    C CD    . ARG A 1 12  ? -108.663 -47.286 -19.196  1.00 127.74 ? 19   ARG A CD    1 
ATOM 64    N NE    . ARG A 1 12  ? -107.950 -48.341 -18.484  1.00 125.78 ? 19   ARG A NE    1 
ATOM 65    C CZ    . ARG A 1 12  ? -107.303 -48.171 -17.337  1.00 124.83 ? 19   ARG A CZ    1 
ATOM 66    N NH1   . ARG A 1 12  ? -106.680 -49.190 -16.774  1.00 123.79 ? 19   ARG A NH1   1 
ATOM 67    N NH2   . ARG A 1 12  ? -107.277 -46.983 -16.753  1.00 124.86 ? 19   ARG A NH2   1 
ATOM 68    N N     . GLU A 1 13  ? -113.687 -47.189 -20.973  1.00 134.09 ? 20   GLU A N     1 
ATOM 69    C CA    . GLU A 1 13  ? -114.883 -47.988 -20.770  1.00 134.89 ? 20   GLU A CA    1 
ATOM 70    C C     . GLU A 1 13  ? -115.313 -48.660 -22.065  1.00 134.81 ? 20   GLU A C     1 
ATOM 71    O O     . GLU A 1 13  ? -115.266 -49.892 -22.170  1.00 134.78 ? 20   GLU A O     1 
ATOM 72    C CB    . GLU A 1 13  ? -116.012 -47.113 -20.190  1.00 135.27 ? 20   GLU A CB    1 
ATOM 73    C CG    . GLU A 1 13  ? -117.172 -47.883 -19.522  1.00 137.52 ? 20   GLU A CG    1 
ATOM 74    C CD    . GLU A 1 13  ? -116.719 -48.928 -18.466  1.00 140.31 ? 20   GLU A CD    1 
ATOM 75    O OE1   . GLU A 1 13  ? -115.625 -48.778 -17.853  1.00 141.26 ? 20   GLU A OE1   1 
ATOM 76    O OE2   . GLU A 1 13  ? -117.475 -49.909 -18.246  1.00 140.85 ? 20   GLU A OE2   1 
ATOM 77    N N     . ALA A 1 14  ? -115.717 -47.840 -23.044  1.00 134.76 ? 21   ALA A N     1 
ATOM 78    C CA    . ALA A 1 14  ? -116.136 -48.300 -24.383  1.00 134.54 ? 21   ALA A CA    1 
ATOM 79    C C     . ALA A 1 14  ? -115.298 -49.483 -24.850  1.00 134.52 ? 21   ALA A C     1 
ATOM 80    O O     . ALA A 1 14  ? -115.812 -50.451 -25.415  1.00 134.27 ? 21   ALA A O     1 
ATOM 81    C CB    . ALA A 1 14  ? -116.046 -47.157 -25.387  1.00 134.15 ? 21   ALA A CB    1 
ATOM 82    N N     . MET A 1 15  ? -114.003 -49.389 -24.569  1.00 134.73 ? 22   MET A N     1 
ATOM 83    C CA    . MET A 1 15  ? -113.047 -50.414 -24.910  1.00 135.01 ? 22   MET A CA    1 
ATOM 84    C C     . MET A 1 15  ? -113.376 -51.737 -24.231  1.00 135.14 ? 22   MET A C     1 
ATOM 85    O O     . MET A 1 15  ? -113.741 -52.674 -24.926  1.00 135.36 ? 22   MET A O     1 
ATOM 86    C CB    . MET A 1 15  ? -111.616 -49.946 -24.610  1.00 135.10 ? 22   MET A CB    1 
ATOM 87    C CG    . MET A 1 15  ? -110.496 -50.966 -24.906  1.00 135.22 ? 22   MET A CG    1 
ATOM 88    S SD    . MET A 1 15  ? -110.299 -51.487 -26.635  1.00 134.80 ? 22   MET A SD    1 
ATOM 89    C CE    . MET A 1 15  ? -110.122 -49.908 -27.459  1.00 135.15 ? 22   MET A CE    1 
ATOM 90    N N     . ARG A 1 16  ? -113.275 -51.821 -22.900  1.00 135.22 ? 23   ARG A N     1 
ATOM 91    C CA    . ARG A 1 16  ? -113.421 -53.121 -22.194  1.00 135.34 ? 23   ARG A CA    1 
ATOM 92    C C     . ARG A 1 16  ? -114.700 -53.853 -22.613  1.00 135.26 ? 23   ARG A C     1 
ATOM 93    O O     . ARG A 1 16  ? -114.771 -55.084 -22.526  1.00 135.05 ? 23   ARG A O     1 
ATOM 94    C CB    . ARG A 1 16  ? -113.324 -52.977 -20.664  1.00 135.39 ? 23   ARG A CB    1 
ATOM 95    C CG    . ARG A 1 16  ? -114.481 -52.208 -20.034  1.00 136.90 ? 23   ARG A CG    1 
ATOM 96    C CD    . ARG A 1 16  ? -114.154 -51.597 -18.675  1.00 138.65 ? 23   ARG A CD    1 
ATOM 97    N NE    . ARG A 1 16  ? -113.125 -50.557 -18.746  1.00 140.03 ? 23   ARG A NE    1 
ATOM 98    C CZ    . ARG A 1 16  ? -111.940 -50.632 -18.139  1.00 141.16 ? 23   ARG A CZ    1 
ATOM 99    N NH1   . ARG A 1 16  ? -111.065 -49.645 -18.263  1.00 141.59 ? 23   ARG A NH1   1 
ATOM 100   N NH2   . ARG A 1 16  ? -111.625 -51.692 -17.401  1.00 141.30 ? 23   ARG A NH2   1 
ATOM 101   N N     . ASN A 1 17  ? -115.683 -53.071 -23.085  1.00 135.27 ? 24   ASN A N     1 
ATOM 102   C CA    . ASN A 1 17  ? -116.934 -53.562 -23.693  1.00 134.93 ? 24   ASN A CA    1 
ATOM 103   C C     . ASN A 1 17  ? -116.835 -53.604 -25.217  1.00 134.39 ? 24   ASN A C     1 
ATOM 104   O O     . ASN A 1 17  ? -117.772 -53.236 -25.929  1.00 134.36 ? 24   ASN A O     1 
ATOM 105   C CB    . ASN A 1 17  ? -118.123 -52.680 -23.277  1.00 135.11 ? 24   ASN A CB    1 
ATOM 106   C CG    . ASN A 1 17  ? -118.382 -52.702 -21.775  1.00 135.75 ? 24   ASN A CG    1 
ATOM 107   O OD1   . ASN A 1 17  ? -118.685 -51.662 -21.175  1.00 135.80 ? 24   ASN A OD1   1 
ATOM 108   N ND2   . ASN A 1 17  ? -118.265 -53.891 -21.157  1.00 135.95 ? 24   ASN A ND2   1 
ATOM 109   N N     . TYR A 1 18  ? -115.663 -54.007 -25.697  1.00 133.74 ? 25   TYR A N     1 
ATOM 110   C CA    . TYR A 1 18  ? -115.412 -54.343 -27.095  1.00 133.02 ? 25   TYR A CA    1 
ATOM 111   C C     . TYR A 1 18  ? -114.531 -55.589 -27.054  1.00 132.51 ? 25   TYR A C     1 
ATOM 112   O O     . TYR A 1 18  ? -114.639 -56.474 -27.899  1.00 132.38 ? 25   TYR A O     1 
ATOM 113   C CB    . TYR A 1 18  ? -114.734 -53.193 -27.883  1.00 132.90 ? 25   TYR A CB    1 
ATOM 114   C CG    . TYR A 1 18  ? -114.073 -53.682 -29.156  1.00 132.65 ? 25   TYR A CG    1 
ATOM 115   C CD1   . TYR A 1 18  ? -114.752 -53.681 -30.364  1.00 132.21 ? 25   TYR A CD1   1 
ATOM 116   C CD2   . TYR A 1 18  ? -112.777 -54.208 -29.137  1.00 133.09 ? 25   TYR A CD2   1 
ATOM 117   C CE1   . TYR A 1 18  ? -114.149 -54.171 -31.532  1.00 131.97 ? 25   TYR A CE1   1 
ATOM 118   C CE2   . TYR A 1 18  ? -112.172 -54.706 -30.300  1.00 132.06 ? 25   TYR A CE2   1 
ATOM 119   C CZ    . TYR A 1 18  ? -112.869 -54.677 -31.487  1.00 131.43 ? 25   TYR A CZ    1 
ATOM 120   O OH    . TYR A 1 18  ? -112.299 -55.160 -32.627  1.00 130.59 ? 25   TYR A OH    1 
ATOM 121   N N     . LEU A 1 19  ? -113.658 -55.664 -26.060  1.00 132.05 ? 26   LEU A N     1 
ATOM 122   C CA    . LEU A 1 19  ? -112.901 -56.887 -25.848  1.00 131.93 ? 26   LEU A CA    1 
ATOM 123   C C     . LEU A 1 19  ? -113.791 -58.016 -25.325  1.00 131.92 ? 26   LEU A C     1 
ATOM 124   O O     . LEU A 1 19  ? -113.355 -59.169 -25.258  1.00 131.82 ? 26   LEU A O     1 
ATOM 125   C CB    . LEU A 1 19  ? -111.712 -56.658 -24.917  1.00 132.05 ? 26   LEU A CB    1 
ATOM 126   C CG    . LEU A 1 19  ? -110.480 -55.919 -25.457  1.00 131.95 ? 26   LEU A CG    1 
ATOM 127   C CD1   . LEU A 1 19  ? -110.313 -56.123 -26.958  1.00 131.92 ? 26   LEU A CD1   1 
ATOM 128   C CD2   . LEU A 1 19  ? -110.524 -54.437 -25.122  1.00 131.17 ? 26   LEU A CD2   1 
ATOM 129   N N     . LYS A 1 20  ? -115.032 -57.682 -24.949  1.00 131.84 ? 27   LYS A N     1 
ATOM 130   C CA    . LYS A 1 20  ? -116.063 -58.702 -24.680  1.00 131.47 ? 27   LYS A CA    1 
ATOM 131   C C     . LYS A 1 20  ? -116.920 -58.926 -25.929  1.00 130.42 ? 27   LYS A C     1 
ATOM 132   O O     . LYS A 1 20  ? -116.976 -60.046 -26.433  1.00 130.09 ? 27   LYS A O     1 
ATOM 133   C CB    . LYS A 1 20  ? -116.939 -58.368 -23.452  1.00 131.96 ? 27   LYS A CB    1 
ATOM 134   C CG    . LYS A 1 20  ? -116.198 -57.994 -22.140  1.00 134.00 ? 27   LYS A CG    1 
ATOM 135   C CD    . LYS A 1 20  ? -115.271 -59.100 -21.570  1.00 136.75 ? 27   LYS A CD    1 
ATOM 136   C CE    . LYS A 1 20  ? -114.405 -58.578 -20.377  1.00 138.07 ? 27   LYS A CE    1 
ATOM 137   N NZ    . LYS A 1 20  ? -113.463 -57.416 -20.695  1.00 138.58 ? 27   LYS A NZ    1 
ATOM 138   N N     . GLU A 1 21  ? -117.548 -57.858 -26.435  1.00 129.43 ? 28   GLU A N     1 
ATOM 139   C CA    . GLU A 1 21  ? -118.330 -57.903 -27.693  1.00 128.74 ? 28   GLU A CA    1 
ATOM 140   C C     . GLU A 1 21  ? -117.510 -58.420 -28.900  1.00 127.83 ? 28   GLU A C     1 
ATOM 141   O O     . GLU A 1 21  ? -117.704 -59.565 -29.339  1.00 127.92 ? 28   GLU A O     1 
ATOM 142   C CB    . GLU A 1 21  ? -118.964 -56.534 -28.042  1.00 128.91 ? 28   GLU A CB    1 
ATOM 143   C CG    . GLU A 1 21  ? -119.443 -55.669 -26.845  1.00 130.20 ? 28   GLU A CG    1 
ATOM 144   C CD    . GLU A 1 21  ? -120.825 -56.052 -26.245  1.00 130.93 ? 28   GLU A CD    1 
ATOM 145   O OE1   . GLU A 1 21  ? -121.261 -57.227 -26.373  1.00 131.58 ? 28   GLU A OE1   1 
ATOM 146   O OE2   . GLU A 1 21  ? -121.461 -55.161 -25.621  1.00 129.60 ? 28   GLU A OE2   1 
ATOM 147   N N     . ARG A 1 22  ? -116.591 -57.584 -29.407  1.00 126.31 ? 29   ARG A N     1 
ATOM 148   C CA    . ARG A 1 22  ? -115.816 -57.861 -30.625  1.00 124.66 ? 29   ARG A CA    1 
ATOM 149   C C     . ARG A 1 22  ? -116.782 -57.865 -31.813  1.00 122.95 ? 29   ARG A C     1 
ATOM 150   O O     . ARG A 1 22  ? -116.657 -58.656 -32.750  1.00 122.70 ? 29   ARG A O     1 
ATOM 151   C CB    . ARG A 1 22  ? -114.974 -59.159 -30.495  1.00 125.04 ? 29   ARG A CB    1 
ATOM 152   C CG    . ARG A 1 22  ? -113.960 -59.452 -31.636  1.00 126.63 ? 29   ARG A CG    1 
ATOM 153   C CD    . ARG A 1 22  ? -112.930 -58.324 -31.861  1.00 129.16 ? 29   ARG A CD    1 
ATOM 154   N NE    . ARG A 1 22  ? -111.993 -58.155 -30.743  1.00 131.17 ? 29   ARG A NE    1 
ATOM 155   C CZ    . ARG A 1 22  ? -110.686 -58.420 -30.787  1.00 131.67 ? 29   ARG A CZ    1 
ATOM 156   N NH1   . ARG A 1 22  ? -110.124 -58.877 -31.901  1.00 131.89 ? 29   ARG A NH1   1 
ATOM 157   N NH2   . ARG A 1 22  ? -109.933 -58.231 -29.708  1.00 131.36 ? 29   ARG A NH2   1 
ATOM 158   N N     . GLY A 1 23  ? -117.749 -56.955 -31.760  1.00 121.00 ? 30   GLY A N     1 
ATOM 159   C CA    . GLY A 1 23  ? -118.788 -56.890 -32.776  1.00 118.96 ? 30   GLY A CA    1 
ATOM 160   C C     . GLY A 1 23  ? -118.350 -56.149 -34.020  1.00 117.39 ? 30   GLY A C     1 
ATOM 161   O O     . GLY A 1 23  ? -118.956 -55.140 -34.387  1.00 117.31 ? 30   GLY A O     1 
ATOM 162   N N     . ASP A 1 24  ? -117.318 -56.674 -34.679  1.00 115.88 ? 31   ASP A N     1 
ATOM 163   C CA    . ASP A 1 24  ? -116.633 -55.988 -35.784  1.00 114.42 ? 31   ASP A CA    1 
ATOM 164   C C     . ASP A 1 24  ? -117.437 -55.880 -37.052  1.00 113.13 ? 31   ASP A C     1 
ATOM 165   O O     . ASP A 1 24  ? -117.983 -56.883 -37.518  1.00 113.22 ? 31   ASP A O     1 
ATOM 166   C CB    . ASP A 1 24  ? -115.336 -56.712 -36.138  1.00 114.60 ? 31   ASP A CB    1 
ATOM 167   C CG    . ASP A 1 24  ? -114.147 -56.166 -35.404  1.00 114.89 ? 31   ASP A CG    1 
ATOM 168   O OD1   . ASP A 1 24  ? -113.990 -54.919 -35.386  1.00 114.69 ? 31   ASP A OD1   1 
ATOM 169   O OD2   . ASP A 1 24  ? -113.370 -56.989 -34.863  1.00 114.31 ? 31   ASP A OD2   1 
ATOM 170   N N     . GLN A 1 25  ? -117.506 -54.666 -37.605  1.00 111.39 ? 32   GLN A N     1 
ATOM 171   C CA    . GLN A 1 25  ? -117.799 -54.487 -39.026  1.00 109.84 ? 32   GLN A CA    1 
ATOM 172   C C     . GLN A 1 25  ? -116.489 -54.855 -39.697  1.00 108.84 ? 32   GLN A C     1 
ATOM 173   O O     . GLN A 1 25  ? -115.450 -54.760 -39.043  1.00 108.97 ? 32   GLN A O     1 
ATOM 174   C CB    . GLN A 1 25  ? -118.173 -53.037 -39.345  1.00 109.65 ? 32   GLN A CB    1 
ATOM 175   C CG    . GLN A 1 25  ? -119.651 -52.775 -39.550  1.00 109.38 ? 32   GLN A CG    1 
ATOM 176   C CD    . GLN A 1 25  ? -120.048 -51.322 -39.290  1.00 110.14 ? 32   GLN A CD    1 
ATOM 177   O OE1   . GLN A 1 25  ? -120.397 -50.598 -40.214  1.00 109.16 ? 32   GLN A OE1   1 
ATOM 178   N NE2   . GLN A 1 25  ? -120.005 -50.896 -38.021  1.00 110.96 ? 32   GLN A NE2   1 
ATOM 179   N N     . THR A 1 26  ? -116.545 -55.339 -40.951  1.00 107.24 ? 33   THR A N     1 
ATOM 180   C CA    . THR A 1 26  ? -115.352 -55.607 -41.803  1.00 105.18 ? 33   THR A CA    1 
ATOM 181   C C     . THR A 1 26  ? -115.672 -55.760 -43.311  1.00 104.37 ? 33   THR A C     1 
ATOM 182   O O     . THR A 1 26  ? -116.416 -56.654 -43.692  1.00 104.39 ? 33   THR A O     1 
ATOM 183   C CB    . THR A 1 26  ? -114.419 -56.792 -41.278  1.00 104.92 ? 33   THR A CB    1 
ATOM 184   O OG1   . THR A 1 26  ? -113.888 -57.510 -42.387  1.00 103.87 ? 33   THR A OG1   1 
ATOM 185   C CG2   . THR A 1 26  ? -115.139 -57.787 -40.386  1.00 103.98 ? 33   THR A CG2   1 
ATOM 186   N N     . VAL A 1 27  ? -115.125 -54.874 -44.153  1.00 103.40 ? 34   VAL A N     1 
ATOM 187   C CA    . VAL A 1 27  ? -115.108 -55.069 -45.621  1.00 102.43 ? 34   VAL A CA    1 
ATOM 188   C C     . VAL A 1 27  ? -114.099 -56.177 -45.941  1.00 102.35 ? 34   VAL A C     1 
ATOM 189   O O     . VAL A 1 27  ? -113.492 -56.739 -45.016  1.00 102.25 ? 34   VAL A O     1 
ATOM 190   C CB    . VAL A 1 27  ? -114.732 -53.779 -46.395  1.00 102.07 ? 34   VAL A CB    1 
ATOM 191   C CG1   . VAL A 1 27  ? -114.455 -54.089 -47.827  1.00 101.58 ? 34   VAL A CG1   1 
ATOM 192   C CG2   . VAL A 1 27  ? -115.841 -52.798 -46.356  1.00 101.71 ? 34   VAL A CG2   1 
ATOM 193   N N     . LEU A 1 28  ? -113.923 -56.496 -47.232  1.00 101.96 ? 35   LEU A N     1 
ATOM 194   C CA    . LEU A 1 28  ? -113.055 -57.604 -47.669  1.00 101.48 ? 35   LEU A CA    1 
ATOM 195   C C     . LEU A 1 28  ? -113.045 -57.776 -49.187  1.00 101.23 ? 35   LEU A C     1 
ATOM 196   O O     . LEU A 1 28  ? -113.663 -58.694 -49.693  1.00 101.50 ? 35   LEU A O     1 
ATOM 197   C CB    . LEU A 1 28  ? -113.521 -58.918 -47.030  1.00 101.13 ? 35   LEU A CB    1 
ATOM 198   C CG    . LEU A 1 28  ? -112.459 -59.879 -46.537  1.00 101.40 ? 35   LEU A CG    1 
ATOM 199   C CD1   . LEU A 1 28  ? -113.088 -60.997 -45.706  1.00 102.00 ? 35   LEU A CD1   1 
ATOM 200   C CD2   . LEU A 1 28  ? -111.685 -60.442 -47.701  1.00 102.42 ? 35   LEU A CD2   1 
ATOM 201   N N     . ILE A 1 29  ? -112.340 -56.921 -49.913  1.00 100.86 ? 36   ILE A N     1 
ATOM 202   C CA    . ILE A 1 29  ? -112.242 -57.053 -51.370  1.00 100.56 ? 36   ILE A CA    1 
ATOM 203   C C     . ILE A 1 29  ? -111.326 -58.210 -51.867  1.00 100.84 ? 36   ILE A C     1 
ATOM 204   O O     . ILE A 1 29  ? -110.142 -58.252 -51.532  1.00 100.82 ? 36   ILE A O     1 
ATOM 205   C CB    . ILE A 1 29  ? -111.755 -55.735 -51.978  1.00 100.36 ? 36   ILE A CB    1 
ATOM 206   C CG1   . ILE A 1 29  ? -112.535 -54.558 -51.382  1.00 99.88  ? 36   ILE A CG1   1 
ATOM 207   C CG2   . ILE A 1 29  ? -111.848 -55.784 -53.492  1.00 99.81  ? 36   ILE A CG2   1 
ATOM 208   C CD1   . ILE A 1 29  ? -111.923 -53.198 -51.622  1.00 98.78  ? 36   ILE A CD1   1 
ATOM 209   N N     . LEU A 1 30  ? -111.884 -59.134 -52.660  1.00 100.85 ? 37   LEU A N     1 
ATOM 210   C CA    . LEU A 1 30  ? -111.118 -60.158 -53.375  1.00 100.62 ? 37   LEU A CA    1 
ATOM 211   C C     . LEU A 1 30  ? -110.943 -59.697 -54.785  1.00 100.79 ? 37   LEU A C     1 
ATOM 212   O O     . LEU A 1 30  ? -111.770 -58.961 -55.253  1.00 100.80 ? 37   LEU A O     1 
ATOM 213   C CB    . LEU A 1 30  ? -111.868 -61.469 -53.399  1.00 100.31 ? 37   LEU A CB    1 
ATOM 214   C CG    . LEU A 1 30  ? -111.732 -62.463 -52.243  1.00 100.51 ? 37   LEU A CG    1 
ATOM 215   C CD1   . LEU A 1 30  ? -110.274 -62.818 -51.878  1.00 100.21 ? 37   LEU A CD1   1 
ATOM 216   C CD2   . LEU A 1 30  ? -112.481 -61.998 -51.030  1.00 100.27 ? 37   LEU A CD2   1 
ATOM 217   N N     . HIS A 1 31  ? -109.879 -60.115 -55.467  1.00 101.41 ? 38   HIS A N     1 
ATOM 218   C CA    . HIS A 1 31  ? -109.582 -59.630 -56.836  1.00 102.24 ? 38   HIS A CA    1 
ATOM 219   C C     . HIS A 1 31  ? -108.321 -60.213 -57.433  1.00 102.62 ? 38   HIS A C     1 
ATOM 220   O O     . HIS A 1 31  ? -107.392 -60.566 -56.717  1.00 102.67 ? 38   HIS A O     1 
ATOM 221   C CB    . HIS A 1 31  ? -109.392 -58.123 -56.856  1.00 102.28 ? 38   HIS A CB    1 
ATOM 222   C CG    . HIS A 1 31  ? -108.153 -57.671 -56.151  1.00 102.93 ? 38   HIS A CG    1 
ATOM 223   N ND1   . HIS A 1 31  ? -107.860 -58.042 -54.859  1.00 103.12 ? 38   HIS A ND1   1 
ATOM 224   C CD2   . HIS A 1 31  ? -107.141 -56.872 -56.551  1.00 102.96 ? 38   HIS A CD2   1 
ATOM 225   C CE1   . HIS A 1 31  ? -106.726 -57.483 -54.490  1.00 103.19 ? 38   HIS A CE1   1 
ATOM 226   N NE2   . HIS A 1 31  ? -106.274 -56.760 -55.496  1.00 103.34 ? 38   HIS A NE2   1 
ATOM 227   N N     . ALA A 1 32  ? -108.286 -60.254 -58.760  1.00 103.17 ? 39   ALA A N     1 
ATOM 228   C CA    . ALA A 1 32  ? -107.138 -60.748 -59.515  1.00 103.47 ? 39   ALA A CA    1 
ATOM 229   C C     . ALA A 1 32  ? -105.927 -59.780 -59.452  1.00 103.50 ? 39   ALA A C     1 
ATOM 230   O O     . ALA A 1 32  ? -106.112 -58.585 -59.208  1.00 103.68 ? 39   ALA A O     1 
ATOM 231   C CB    . ALA A 1 32  ? -107.567 -60.998 -60.952  1.00 103.63 ? 39   ALA A CB    1 
ATOM 232   N N     . LYS A 1 33  ? -104.711 -60.301 -59.667  1.00 103.18 ? 40   LYS A N     1 
ATOM 233   C CA    . LYS A 1 33  ? -103.474 -59.513 -59.604  1.00 102.96 ? 40   LYS A CA    1 
ATOM 234   C C     . LYS A 1 33  ? -103.136 -58.784 -60.901  1.00 103.17 ? 40   LYS A C     1 
ATOM 235   O O     . LYS A 1 33  ? -102.358 -57.827 -60.915  1.00 102.77 ? 40   LYS A O     1 
ATOM 236   C CB    . LYS A 1 33  ? -102.309 -60.395 -59.170  1.00 102.71 ? 40   LYS A CB    1 
ATOM 237   C CG    . LYS A 1 33  ? -101.831 -60.149 -57.750  1.00 102.78 ? 40   LYS A CG    1 
ATOM 238   C CD    . LYS A 1 33  ? -100.781 -61.164 -57.332  1.00 102.99 ? 40   LYS A CD    1 
ATOM 239   C CE    . LYS A 1 33  ? -100.551 -61.157 -55.835  1.00 102.38 ? 40   LYS A CE    1 
ATOM 240   N NZ    . LYS A 1 33  ? -100.370 -62.546 -55.300  1.00 100.82 ? 40   LYS A NZ    1 
ATOM 241   N N     . VAL A 1 34  ? -103.729 -59.249 -61.991  1.00 103.90 ? 41   VAL A N     1 
ATOM 242   C CA    . VAL A 1 34  ? -103.524 -58.629 -63.292  1.00 104.82 ? 41   VAL A CA    1 
ATOM 243   C C     . VAL A 1 34  ? -104.850 -58.294 -63.989  1.00 105.26 ? 41   VAL A C     1 
ATOM 244   O O     . VAL A 1 34  ? -105.901 -58.855 -63.668  1.00 105.63 ? 41   VAL A O     1 
ATOM 245   C CB    . VAL A 1 34  ? -102.685 -59.527 -64.227  1.00 104.93 ? 41   VAL A CB    1 
ATOM 246   C CG1   . VAL A 1 34  ? -101.916 -58.672 -65.200  1.00 105.14 ? 41   VAL A CG1   1 
ATOM 247   C CG2   . VAL A 1 34  ? -101.705 -60.390 -63.462  1.00 105.07 ? 41   VAL A CG2   1 
ATOM 248   N N     . ALA A 1 35  ? -104.801 -57.384 -64.951  1.00 105.53 ? 42   ALA A N     1 
ATOM 249   C CA    . ALA A 1 35  ? -105.971 -57.098 -65.746  1.00 106.42 ? 42   ALA A CA    1 
ATOM 250   C C     . ALA A 1 35  ? -105.552 -56.814 -67.164  1.00 107.15 ? 42   ALA A C     1 
ATOM 251   O O     . ALA A 1 35  ? -104.738 -55.935 -67.367  1.00 107.36 ? 42   ALA A O     1 
ATOM 252   C CB    . ALA A 1 35  ? -106.685 -55.906 -65.178  1.00 106.26 ? 42   ALA A CB    1 
ATOM 253   N N     . GLN A 1 36  ? -106.102 -57.540 -68.138  1.00 108.01 ? 43   GLN A N     1 
ATOM 254   C CA    . GLN A 1 36  ? -105.807 -57.290 -69.547  1.00 108.78 ? 43   GLN A CA    1 
ATOM 255   C C     . GLN A 1 36  ? -106.300 -55.933 -70.087  1.00 109.64 ? 43   GLN A C     1 
ATOM 256   O O     . GLN A 1 36  ? -107.443 -55.530 -69.861  1.00 109.41 ? 43   GLN A O     1 
ATOM 257   C CB    . GLN A 1 36  ? -106.380 -58.405 -70.408  1.00 108.98 ? 43   GLN A CB    1 
ATOM 258   C CG    . GLN A 1 36  ? -105.364 -59.418 -70.912  1.00 108.73 ? 43   GLN A CG    1 
ATOM 259   C CD    . GLN A 1 36  ? -105.556 -59.818 -72.383  1.00 107.04 ? 43   GLN A CD    1 
ATOM 260   O OE1   . GLN A 1 36  ? -105.572 -58.972 -73.288  1.00 104.75 ? 43   GLN A OE1   1 
ATOM 261   N NE2   . GLN A 1 36  ? -105.671 -61.116 -72.617  1.00 105.24 ? 43   GLN A NE2   1 
ATOM 262   N N     . LYS A 1 37  ? -105.425 -55.256 -70.825  1.00 110.86 ? 44   LYS A N     1 
ATOM 263   C CA    . LYS A 1 37  ? -105.697 -53.957 -71.441  1.00 112.58 ? 44   LYS A CA    1 
ATOM 264   C C     . LYS A 1 37  ? -106.886 -54.101 -72.393  1.00 113.27 ? 44   LYS A C     1 
ATOM 265   O O     . LYS A 1 37  ? -107.181 -55.201 -72.813  1.00 113.66 ? 44   LYS A O     1 
ATOM 266   C CB    . LYS A 1 37  ? -104.423 -53.494 -72.174  1.00 112.76 ? 44   LYS A CB    1 
ATOM 267   C CG    . LYS A 1 37  ? -104.512 -52.216 -73.025  1.00 114.73 ? 44   LYS A CG    1 
ATOM 268   C CD    . LYS A 1 37  ? -103.723 -51.031 -72.456  1.00 117.90 ? 44   LYS A CD    1 
ATOM 269   C CE    . LYS A 1 37  ? -103.770 -49.836 -73.416  1.00 119.41 ? 44   LYS A CE    1 
ATOM 270   N NZ    . LYS A 1 37  ? -103.675 -48.524 -72.707  1.00 120.65 ? 44   LYS A NZ    1 
ATOM 271   N N     . SER A 1 38  ? -107.577 -53.012 -72.723  1.00 114.28 ? 45   SER A N     1 
ATOM 272   C CA    . SER A 1 38  ? -108.680 -53.084 -73.681  1.00 115.30 ? 45   SER A CA    1 
ATOM 273   C C     . SER A 1 38  ? -108.573 -52.040 -74.801  1.00 116.42 ? 45   SER A C     1 
ATOM 274   O O     . SER A 1 38  ? -109.161 -50.949 -74.693  1.00 116.61 ? 45   SER A O     1 
ATOM 275   C CB    . SER A 1 38  ? -110.024 -52.971 -72.965  1.00 115.08 ? 45   SER A CB    1 
ATOM 276   O OG    . SER A 1 38  ? -110.110 -53.916 -71.925  1.00 114.68 ? 45   SER A OG    1 
ATOM 277   N N     . TYR A 1 39  ? -107.854 -52.396 -75.877  1.00 117.43 ? 46   TYR A N     1 
ATOM 278   C CA    . TYR A 1 39  ? -107.537 -51.475 -76.994  1.00 118.50 ? 46   TYR A CA    1 
ATOM 279   C C     . TYR A 1 39  ? -108.726 -50.918 -77.789  1.00 118.88 ? 46   TYR A C     1 
ATOM 280   O O     . TYR A 1 39  ? -109.533 -51.664 -78.330  1.00 118.78 ? 46   TYR A O     1 
ATOM 281   C CB    . TYR A 1 39  ? -106.546 -52.117 -77.960  1.00 118.59 ? 46   TYR A CB    1 
ATOM 282   C CG    . TYR A 1 39  ? -105.262 -52.538 -77.308  1.00 119.62 ? 46   TYR A CG    1 
ATOM 283   C CD1   . TYR A 1 39  ? -105.160 -53.789 -76.700  1.00 120.76 ? 46   TYR A CD1   1 
ATOM 284   C CD2   . TYR A 1 39  ? -104.146 -51.696 -77.299  1.00 120.45 ? 46   TYR A CD2   1 
ATOM 285   C CE1   . TYR A 1 39  ? -103.981 -54.206 -76.091  1.00 121.75 ? 46   TYR A CE1   1 
ATOM 286   C CE2   . TYR A 1 39  ? -102.955 -52.097 -76.697  1.00 121.72 ? 46   TYR A CE2   1 
ATOM 287   C CZ    . TYR A 1 39  ? -102.882 -53.359 -76.091  1.00 122.56 ? 46   TYR A CZ    1 
ATOM 288   O OH    . TYR A 1 39  ? -101.723 -53.787 -75.479  1.00 122.66 ? 46   TYR A OH    1 
ATOM 289   N N     . GLY A 1 40  ? -108.800 -49.594 -77.869  1.00 119.54 ? 47   GLY A N     1 
ATOM 290   C CA    . GLY A 1 40  ? -109.844 -48.912 -78.629  1.00 120.53 ? 47   GLY A CA    1 
ATOM 291   C C     . GLY A 1 40  ? -111.259 -49.234 -78.174  1.00 121.07 ? 47   GLY A C     1 
ATOM 292   O O     . GLY A 1 40  ? -111.511 -49.419 -76.975  1.00 121.42 ? 47   GLY A O     1 
ATOM 293   N N     . ASN A 1 41  ? -112.174 -49.328 -79.137  1.00 121.27 ? 48   ASN A N     1 
ATOM 294   C CA    . ASN A 1 41  ? -113.609 -49.463 -78.846  1.00 121.46 ? 48   ASN A CA    1 
ATOM 295   C C     . ASN A 1 41  ? -114.050 -50.699 -78.030  1.00 120.97 ? 48   ASN A C     1 
ATOM 296   O O     . ASN A 1 41  ? -115.150 -50.706 -77.481  1.00 120.84 ? 48   ASN A O     1 
ATOM 297   C CB    . ASN A 1 41  ? -114.445 -49.324 -80.142  1.00 121.93 ? 48   ASN A CB    1 
ATOM 298   C CG    . ASN A 1 41  ? -114.542 -47.859 -80.657  1.00 122.88 ? 48   ASN A CG    1 
ATOM 299   O OD1   . ASN A 1 41  ? -113.913 -46.937 -80.117  1.00 123.39 ? 48   ASN A OD1   1 
ATOM 300   N ND2   . ASN A 1 41  ? -115.340 -47.657 -81.708  1.00 123.46 ? 48   ASN A ND2   1 
ATOM 301   N N     . GLU A 1 42  ? -113.192 -51.720 -77.937  1.00 120.61 ? 49   GLU A N     1 
ATOM 302   C CA    . GLU A 1 42  ? -113.518 -52.986 -77.228  1.00 120.00 ? 49   GLU A CA    1 
ATOM 303   C C     . GLU A 1 42  ? -113.678 -52.860 -75.705  1.00 119.62 ? 49   GLU A C     1 
ATOM 304   O O     . GLU A 1 42  ? -113.718 -51.749 -75.168  1.00 119.29 ? 49   GLU A O     1 
ATOM 305   C CB    . GLU A 1 42  ? -112.527 -54.116 -77.576  1.00 119.93 ? 49   GLU A CB    1 
ATOM 306   C CG    . GLU A 1 42  ? -111.051 -53.765 -77.412  1.00 119.15 ? 49   GLU A CG    1 
ATOM 307   C CD    . GLU A 1 42  ? -110.133 -54.986 -77.362  1.00 118.13 ? 49   GLU A CD    1 
ATOM 308   O OE1   . GLU A 1 42  ? -109.112 -55.023 -78.092  1.00 117.31 ? 49   GLU A OE1   1 
ATOM 309   O OE2   . GLU A 1 42  ? -110.424 -55.908 -76.574  1.00 117.60 ? 49   GLU A OE2   1 
ATOM 310   N N     . LYS A 1 43  ? -113.772 -54.005 -75.028  1.00 119.30 ? 50   LYS A N     1 
ATOM 311   C CA    . LYS A 1 43  ? -114.130 -54.042 -73.615  1.00 119.30 ? 50   LYS A CA    1 
ATOM 312   C C     . LYS A 1 43  ? -113.823 -55.370 -72.941  1.00 119.52 ? 50   LYS A C     1 
ATOM 313   O O     . LYS A 1 43  ? -114.748 -56.085 -72.592  1.00 119.47 ? 50   LYS A O     1 
ATOM 314   C CB    . LYS A 1 43  ? -115.634 -53.795 -73.456  1.00 119.20 ? 50   LYS A CB    1 
ATOM 315   C CG    . LYS A 1 43  ? -116.069 -52.466 -72.825  1.00 118.64 ? 50   LYS A CG    1 
ATOM 316   C CD    . LYS A 1 43  ? -117.505 -52.604 -72.257  1.00 117.58 ? 50   LYS A CD    1 
ATOM 317   C CE    . LYS A 1 43  ? -118.147 -51.296 -71.795  1.00 116.85 ? 50   LYS A CE    1 
ATOM 318   N NZ    . LYS A 1 43  ? -118.262 -50.285 -72.868  1.00 116.14 ? 50   LYS A NZ    1 
ATOM 319   N N     . ARG A 1 44  ? -112.553 -55.700 -72.720  1.00 119.97 ? 51   ARG A N     1 
ATOM 320   C CA    . ARG A 1 44  ? -112.216 -56.935 -71.984  1.00 120.47 ? 51   ARG A CA    1 
ATOM 321   C C     . ARG A 1 44  ? -112.486 -56.870 -70.478  1.00 120.77 ? 51   ARG A C     1 
ATOM 322   O O     . ARG A 1 44  ? -111.853 -56.105 -69.765  1.00 121.21 ? 51   ARG A O     1 
ATOM 323   C CB    . ARG A 1 44  ? -110.775 -57.340 -72.234  1.00 120.34 ? 51   ARG A CB    1 
ATOM 324   C CG    . ARG A 1 44  ? -110.619 -58.128 -73.481  1.00 120.92 ? 51   ARG A CG    1 
ATOM 325   C CD    . ARG A 1 44  ? -109.197 -58.158 -73.937  1.00 121.48 ? 51   ARG A CD    1 
ATOM 326   N NE    . ARG A 1 44  ? -109.068 -57.751 -75.334  1.00 121.29 ? 51   ARG A NE    1 
ATOM 327   C CZ    . ARG A 1 44  ? -109.103 -58.573 -76.379  1.00 121.10 ? 51   ARG A CZ    1 
ATOM 328   N NH1   . ARG A 1 44  ? -109.276 -59.881 -76.217  1.00 121.09 ? 51   ARG A NH1   1 
ATOM 329   N NH2   . ARG A 1 44  ? -108.971 -58.072 -77.595  1.00 120.71 ? 51   ARG A NH2   1 
ATOM 330   N N     . PHE A 1 45  ? -113.420 -57.682 -69.996  1.00 121.02 ? 52   PHE A N     1 
ATOM 331   C CA    . PHE A 1 45  ? -113.825 -57.635 -68.584  1.00 121.25 ? 52   PHE A CA    1 
ATOM 332   C C     . PHE A 1 45  ? -112.828 -58.368 -67.698  1.00 120.84 ? 52   PHE A C     1 
ATOM 333   O O     . PHE A 1 45  ? -112.138 -59.261 -68.171  1.00 120.63 ? 52   PHE A O     1 
ATOM 334   C CB    . PHE A 1 45  ? -115.242 -58.225 -68.381  1.00 121.83 ? 52   PHE A CB    1 
ATOM 335   C CG    . PHE A 1 45  ? -116.358 -57.452 -69.068  1.00 122.56 ? 52   PHE A CG    1 
ATOM 336   C CD1   . PHE A 1 45  ? -116.215 -56.106 -69.401  1.00 123.79 ? 52   PHE A CD1   1 
ATOM 337   C CD2   . PHE A 1 45  ? -117.560 -58.069 -69.344  1.00 123.40 ? 52   PHE A CD2   1 
ATOM 338   C CE1   . PHE A 1 45  ? -117.242 -55.394 -70.016  1.00 124.03 ? 52   PHE A CE1   1 
ATOM 339   C CE2   . PHE A 1 45  ? -118.590 -57.367 -69.954  1.00 124.48 ? 52   PHE A CE2   1 
ATOM 340   C CZ    . PHE A 1 45  ? -118.430 -56.025 -70.292  1.00 124.34 ? 52   PHE A CZ    1 
ATOM 341   N N     . PHE A 1 46  ? -112.777 -58.002 -66.417  1.00 120.55 ? 53   PHE A N     1 
ATOM 342   C CA    . PHE A 1 46  ? -111.865 -58.623 -65.449  1.00 120.51 ? 53   PHE A CA    1 
ATOM 343   C C     . PHE A 1 46  ? -112.323 -60.011 -65.118  1.00 120.24 ? 53   PHE A C     1 
ATOM 344   O O     . PHE A 1 46  ? -113.289 -60.172 -64.394  1.00 120.18 ? 53   PHE A O     1 
ATOM 345   C CB    . PHE A 1 46  ? -111.820 -57.825 -64.157  1.00 120.80 ? 53   PHE A CB    1 
ATOM 346   C CG    . PHE A 1 46  ? -111.142 -56.500 -64.281  1.00 121.01 ? 53   PHE A CG    1 
ATOM 347   C CD1   . PHE A 1 46  ? -110.921 -55.916 -65.522  1.00 121.47 ? 53   PHE A CD1   1 
ATOM 348   C CD2   . PHE A 1 46  ? -110.756 -55.814 -63.149  1.00 120.68 ? 53   PHE A CD2   1 
ATOM 349   C CE1   . PHE A 1 46  ? -110.315 -54.679 -65.634  1.00 121.30 ? 53   PHE A CE1   1 
ATOM 350   C CE2   . PHE A 1 46  ? -110.155 -54.573 -63.257  1.00 121.47 ? 53   PHE A CE2   1 
ATOM 351   C CZ    . PHE A 1 46  ? -109.933 -54.008 -64.508  1.00 121.33 ? 53   PHE A CZ    1 
ATOM 352   N N     . CYS A 1 47  ? -111.593 -61.006 -65.606  1.00 120.13 ? 54   CYS A N     1 
ATOM 353   C CA    . CYS A 1 47  ? -112.185 -62.321 -65.888  1.00 120.10 ? 54   CYS A CA    1 
ATOM 354   C C     . CYS A 1 47  ? -112.379 -63.283 -64.715  1.00 119.71 ? 54   CYS A C     1 
ATOM 355   O O     . CYS A 1 47  ? -113.083 -64.288 -64.875  1.00 119.74 ? 54   CYS A O     1 
ATOM 356   C CB    . CYS A 1 47  ? -111.544 -62.999 -67.113  1.00 120.41 ? 54   CYS A CB    1 
ATOM 357   S SG    . CYS A 1 47  ? -112.111 -62.344 -68.707  0.50 120.14 ? 54   CYS A SG    1 
ATOM 358   N N     . PRO A 1 48  ? -111.732 -63.010 -63.564  1.00 119.11 ? 55   PRO A N     1 
ATOM 359   C CA    . PRO A 1 48  ? -112.452 -63.293 -62.325  1.00 118.63 ? 55   PRO A CA    1 
ATOM 360   C C     . PRO A 1 48  ? -112.893 -61.923 -61.882  1.00 118.35 ? 55   PRO A C     1 
ATOM 361   O O     . PRO A 1 48  ? -112.084 -60.997 -61.947  1.00 118.20 ? 55   PRO A O     1 
ATOM 362   C CB    . PRO A 1 48  ? -111.388 -63.841 -61.387  1.00 118.41 ? 55   PRO A CB    1 
ATOM 363   C CG    . PRO A 1 48  ? -110.102 -63.781 -62.155  1.00 118.97 ? 55   PRO A CG    1 
ATOM 364   C CD    . PRO A 1 48  ? -110.292 -62.870 -63.322  1.00 119.07 ? 55   PRO A CD    1 
ATOM 365   N N     . PRO A 1 49  ? -114.182 -61.760 -61.516  1.00 118.26 ? 56   PRO A N     1 
ATOM 366   C CA    . PRO A 1 49  ? -114.654 -60.417 -61.248  1.00 118.19 ? 56   PRO A CA    1 
ATOM 367   C C     . PRO A 1 49  ? -114.426 -60.006 -59.795  1.00 118.13 ? 56   PRO A C     1 
ATOM 368   O O     . PRO A 1 49  ? -114.724 -60.769 -58.871  1.00 118.22 ? 56   PRO A O     1 
ATOM 369   C CB    . PRO A 1 49  ? -116.150 -60.488 -61.588  1.00 118.06 ? 56   PRO A CB    1 
ATOM 370   C CG    . PRO A 1 49  ? -116.441 -61.913 -61.928  1.00 117.80 ? 56   PRO A CG    1 
ATOM 371   C CD    . PRO A 1 49  ? -115.293 -62.719 -61.451  1.00 118.16 ? 56   PRO A CD    1 
ATOM 372   N N     . PRO A 1 50  ? -113.884 -58.806 -59.598  1.00 117.89 ? 57   PRO A N     1 
ATOM 373   C CA    . PRO A 1 50  ? -113.568 -58.316 -58.289  1.00 118.02 ? 57   PRO A CA    1 
ATOM 374   C C     . PRO A 1 50  ? -114.784 -58.426 -57.405  1.00 118.27 ? 57   PRO A C     1 
ATOM 375   O O     . PRO A 1 50  ? -115.847 -57.947 -57.751  1.00 118.37 ? 57   PRO A O     1 
ATOM 376   C CB    . PRO A 1 50  ? -113.195 -56.859 -58.538  1.00 118.09 ? 57   PRO A CB    1 
ATOM 377   C CG    . PRO A 1 50  ? -113.640 -56.557 -59.891  1.00 118.01 ? 57   PRO A CG    1 
ATOM 378   C CD    . PRO A 1 50  ? -113.598 -57.814 -60.637  1.00 117.93 ? 57   PRO A CD    1 
ATOM 379   N N     . CYS A 1 51  ? -114.603 -59.045 -56.256  1.00 118.77 ? 58   CYS A N     1 
ATOM 380   C CA    . CYS A 1 51  ? -115.695 -59.582 -55.494  1.00 119.57 ? 58   CYS A CA    1 
ATOM 381   C C     . CYS A 1 51  ? -115.722 -59.075 -54.049  1.00 119.61 ? 58   CYS A C     1 
ATOM 382   O O     . CYS A 1 51  ? -115.089 -59.650 -53.176  1.00 120.06 ? 58   CYS A O     1 
ATOM 383   C CB    . CYS A 1 51  ? -115.553 -61.092 -55.537  1.00 119.70 ? 58   CYS A CB    1 
ATOM 384   S SG    . CYS A 1 51  ? -116.886 -61.988 -54.845  1.00 122.14 ? 58   CYS A SG    1 
ATOM 385   N N     . VAL A 1 52  ? -116.484 -58.012 -53.808  1.00 119.49 ? 59   VAL A N     1 
ATOM 386   C CA    . VAL A 1 52  ? -116.521 -57.287 -52.523  1.00 119.21 ? 59   VAL A CA    1 
ATOM 387   C C     . VAL A 1 52  ? -117.312 -57.978 -51.406  1.00 119.26 ? 59   VAL A C     1 
ATOM 388   O O     . VAL A 1 52  ? -118.461 -57.625 -51.178  1.00 119.26 ? 59   VAL A O     1 
ATOM 389   C CB    . VAL A 1 52  ? -117.185 -55.893 -52.720  1.00 119.13 ? 59   VAL A CB    1 
ATOM 390   C CG1   . VAL A 1 52  ? -117.200 -55.095 -51.424  1.00 119.07 ? 59   VAL A CG1   1 
ATOM 391   C CG2   . VAL A 1 52  ? -116.515 -55.110 -53.835  1.00 118.86 ? 59   VAL A CG2   1 
ATOM 392   N N     . TYR A 1 53  ? -116.708 -58.921 -50.685  1.00 119.40 ? 60   TYR A N     1 
ATOM 393   C CA    . TYR A 1 53  ? -117.384 -59.555 -49.529  1.00 119.72 ? 60   TYR A CA    1 
ATOM 394   C C     . TYR A 1 53  ? -117.599 -58.564 -48.404  1.00 119.41 ? 60   TYR A C     1 
ATOM 395   O O     . TYR A 1 53  ? -117.310 -57.380 -48.560  1.00 119.27 ? 60   TYR A O     1 
ATOM 396   C CB    . TYR A 1 53  ? -116.623 -60.779 -49.012  1.00 120.07 ? 60   TYR A CB    1 
ATOM 397   C CG    . TYR A 1 53  ? -116.746 -61.998 -49.904  1.00 122.27 ? 60   TYR A CG    1 
ATOM 398   C CD1   . TYR A 1 53  ? -116.697 -61.870 -51.295  1.00 123.54 ? 60   TYR A CD1   1 
ATOM 399   C CD2   . TYR A 1 53  ? -116.887 -63.283 -49.363  1.00 124.08 ? 60   TYR A CD2   1 
ATOM 400   C CE1   . TYR A 1 53  ? -116.802 -62.972 -52.123  1.00 124.71 ? 60   TYR A CE1   1 
ATOM 401   C CE2   . TYR A 1 53  ? -116.995 -64.403 -50.191  1.00 125.01 ? 60   TYR A CE2   1 
ATOM 402   C CZ    . TYR A 1 53  ? -116.957 -64.233 -51.578  1.00 125.55 ? 60   TYR A CZ    1 
ATOM 403   O OH    . TYR A 1 53  ? -117.063 -65.310 -52.441  1.00 126.68 ? 60   TYR A OH    1 
ATOM 404   N N     . LEU A 1 54  ? -118.101 -59.043 -47.271  1.00 119.33 ? 61   LEU A N     1 
ATOM 405   C CA    . LEU A 1 54  ? -118.567 -58.138 -46.221  1.00 119.24 ? 61   LEU A CA    1 
ATOM 406   C C     . LEU A 1 54  ? -118.839 -58.878 -44.905  1.00 119.61 ? 61   LEU A C     1 
ATOM 407   O O     . LEU A 1 54  ? -119.941 -58.831 -44.364  1.00 119.33 ? 61   LEU A O     1 
ATOM 408   C CB    . LEU A 1 54  ? -119.811 -57.411 -46.723  1.00 118.80 ? 61   LEU A CB    1 
ATOM 409   C CG    . LEU A 1 54  ? -120.032 -55.968 -46.323  1.00 118.09 ? 61   LEU A CG    1 
ATOM 410   C CD1   . LEU A 1 54  ? -120.331 -55.104 -47.530  1.00 117.21 ? 61   LEU A CD1   1 
ATOM 411   C CD2   . LEU A 1 54  ? -121.191 -56.001 -45.416  1.00 118.42 ? 61   LEU A CD2   1 
ATOM 412   N N     . MET A 1 55  ? -117.803 -59.547 -44.401  1.00 120.25 ? 62   MET A N     1 
ATOM 413   C CA    . MET A 1 55  ? -117.878 -60.388 -43.207  1.00 121.17 ? 62   MET A CA    1 
ATOM 414   C C     . MET A 1 55  ? -118.008 -59.594 -41.905  1.00 121.18 ? 62   MET A C     1 
ATOM 415   O O     . MET A 1 55  ? -118.063 -58.359 -41.914  1.00 121.05 ? 62   MET A O     1 
ATOM 416   C CB    . MET A 1 55  ? -116.649 -61.311 -43.135  1.00 121.68 ? 62   MET A CB    1 
ATOM 417   C CG    . MET A 1 55  ? -116.379 -62.150 -44.405  1.00 124.32 ? 62   MET A CG    1 
ATOM 418   S SD    . MET A 1 55  ? -117.838 -62.934 -45.186  1.00 130.46 ? 62   MET A SD    1 
ATOM 419   C CE    . MET A 1 55  ? -118.397 -64.122 -43.926  1.00 128.42 ? 62   MET A CE    1 
ATOM 420   N N     . GLY A 1 56  ? -118.072 -60.310 -40.785  1.00 121.33 ? 63   GLY A N     1 
ATOM 421   C CA    . GLY A 1 56  ? -118.135 -59.667 -39.480  1.00 121.64 ? 63   GLY A CA    1 
ATOM 422   C C     . GLY A 1 56  ? -119.514 -59.549 -38.857  1.00 121.93 ? 63   GLY A C     1 
ATOM 423   O O     . GLY A 1 56  ? -120.404 -58.857 -39.370  1.00 121.66 ? 63   GLY A O     1 
ATOM 424   N N     . SER A 1 57  ? -119.669 -60.222 -37.719  1.00 122.44 ? 64   SER A N     1 
ATOM 425   C CA    . SER A 1 57  ? -120.917 -60.239 -36.951  1.00 122.61 ? 64   SER A CA    1 
ATOM 426   C C     . SER A 1 57  ? -121.152 -58.895 -36.285  1.00 122.66 ? 64   SER A C     1 
ATOM 427   O O     . SER A 1 57  ? -121.091 -58.780 -35.062  1.00 122.61 ? 64   SER A O     1 
ATOM 428   C CB    . SER A 1 57  ? -120.881 -61.363 -35.894  1.00 122.77 ? 64   SER A CB    1 
ATOM 429   O OG    . SER A 1 57  ? -120.096 -61.023 -34.751  1.00 122.08 ? 64   SER A OG    1 
ATOM 430   N N     . GLY A 1 58  ? -121.418 -57.880 -37.091  1.00 122.78 ? 65   GLY A N     1 
ATOM 431   C CA    . GLY A 1 58  ? -121.514 -56.538 -36.566  1.00 123.46 ? 65   GLY A CA    1 
ATOM 432   C C     . GLY A 1 58  ? -122.111 -55.622 -37.583  1.00 123.89 ? 65   GLY A C     1 
ATOM 433   O O     . GLY A 1 58  ? -122.393 -54.462 -37.301  1.00 123.88 ? 65   GLY A O     1 
ATOM 434   N N     . TRP A 1 59  ? -122.289 -56.153 -38.782  1.00 124.46 ? 66   TRP A N     1 
ATOM 435   C CA    . TRP A 1 59  ? -122.983 -55.434 -39.820  1.00 125.11 ? 66   TRP A CA    1 
ATOM 436   C C     . TRP A 1 59  ? -124.441 -55.461 -39.444  1.00 126.23 ? 66   TRP A C     1 
ATOM 437   O O     . TRP A 1 59  ? -125.164 -54.460 -39.600  1.00 126.24 ? 66   TRP A O     1 
ATOM 438   C CB    . TRP A 1 59  ? -122.759 -56.113 -41.158  1.00 124.76 ? 66   TRP A CB    1 
ATOM 439   C CG    . TRP A 1 59  ? -121.472 -55.702 -41.801  1.00 123.39 ? 66   TRP A CG    1 
ATOM 440   C CD1   . TRP A 1 59  ? -120.302 -56.406 -41.828  1.00 122.20 ? 66   TRP A CD1   1 
ATOM 441   C CD2   . TRP A 1 59  ? -121.221 -54.486 -42.494  1.00 121.81 ? 66   TRP A CD2   1 
ATOM 442   N NE1   . TRP A 1 59  ? -119.348 -55.708 -42.508  1.00 121.26 ? 66   TRP A NE1   1 
ATOM 443   C CE2   . TRP A 1 59  ? -119.890 -54.521 -42.922  1.00 121.39 ? 66   TRP A CE2   1 
ATOM 444   C CE3   . TRP A 1 59  ? -122.001 -53.372 -42.810  1.00 121.81 ? 66   TRP A CE3   1 
ATOM 445   C CZ2   . TRP A 1 59  ? -119.328 -53.495 -43.651  1.00 121.72 ? 66   TRP A CZ2   1 
ATOM 446   C CZ3   . TRP A 1 59  ? -121.435 -52.347 -43.524  1.00 121.47 ? 66   TRP A CZ3   1 
ATOM 447   C CH2   . TRP A 1 59  ? -120.117 -52.414 -43.940  1.00 121.48 ? 66   TRP A CH2   1 
ATOM 448   N N     . LYS A 1 60  ? -124.849 -56.622 -38.923  1.00 127.38 ? 67   LYS A N     1 
ATOM 449   C CA    . LYS A 1 60  ? -126.165 -56.801 -38.346  1.00 128.27 ? 67   LYS A CA    1 
ATOM 450   C C     . LYS A 1 60  ? -126.397 -55.773 -37.236  1.00 128.30 ? 67   LYS A C     1 
ATOM 451   O O     . LYS A 1 60  ? -127.355 -55.001 -37.316  1.00 128.32 ? 67   LYS A O     1 
ATOM 452   C CB    . LYS A 1 60  ? -126.348 -58.238 -37.855  1.00 128.57 ? 67   LYS A CB    1 
ATOM 453   C CG    . LYS A 1 60  ? -127.682 -58.859 -38.329  1.00 130.62 ? 67   LYS A CG    1 
ATOM 454   C CD    . LYS A 1 60  ? -127.970 -60.233 -37.703  1.00 132.33 ? 67   LYS A CD    1 
ATOM 455   C CE    . LYS A 1 60  ? -129.465 -60.553 -37.687  1.00 132.40 ? 67   LYS A CE    1 
ATOM 456   N NZ    . LYS A 1 60  ? -129.780 -61.544 -36.618  1.00 132.74 ? 67   LYS A NZ    1 
ATOM 457   N N     . LYS A 1 61  ? -125.503 -55.725 -36.242  1.00 128.46 ? 68   LYS A N     1 
ATOM 458   C CA    . LYS A 1 61  ? -125.582 -54.712 -35.171  1.00 128.62 ? 68   LYS A CA    1 
ATOM 459   C C     . LYS A 1 61  ? -125.819 -53.317 -35.718  1.00 128.44 ? 68   LYS A C     1 
ATOM 460   O O     . LYS A 1 61  ? -126.461 -52.497 -35.083  1.00 128.71 ? 68   LYS A O     1 
ATOM 461   C CB    . LYS A 1 61  ? -124.340 -54.699 -34.269  1.00 128.65 ? 68   LYS A CB    1 
ATOM 462   C CG    . LYS A 1 61  ? -124.313 -55.783 -33.209  1.00 129.64 ? 68   LYS A CG    1 
ATOM 463   C CD    . LYS A 1 61  ? -123.615 -57.022 -33.733  1.00 131.03 ? 68   LYS A CD    1 
ATOM 464   C CE    . LYS A 1 61  ? -124.482 -58.260 -33.598  1.00 131.92 ? 68   LYS A CE    1 
ATOM 465   N NZ    . LYS A 1 61  ? -124.571 -58.967 -34.924  1.00 132.63 ? 68   LYS A NZ    1 
ATOM 466   N N     . LYS A 1 62  ? -125.315 -53.042 -36.905  1.00 128.23 ? 69   LYS A N     1 
ATOM 467   C CA    . LYS A 1 62  ? -125.487 -51.711 -37.447  1.00 128.16 ? 69   LYS A CA    1 
ATOM 468   C C     . LYS A 1 62  ? -126.858 -51.516 -38.131  1.00 127.87 ? 69   LYS A C     1 
ATOM 469   O O     . LYS A 1 62  ? -127.395 -50.407 -38.143  1.00 127.80 ? 69   LYS A O     1 
ATOM 470   C CB    . LYS A 1 62  ? -124.308 -51.330 -38.350  1.00 128.36 ? 69   LYS A CB    1 
ATOM 471   C CG    . LYS A 1 62  ? -124.037 -49.825 -38.424  1.00 128.49 ? 69   LYS A CG    1 
ATOM 472   C CD    . LYS A 1 62  ? -123.485 -49.249 -37.123  1.00 128.64 ? 69   LYS A CD    1 
ATOM 473   C CE    . LYS A 1 62  ? -123.960 -47.806 -36.919  1.00 129.25 ? 69   LYS A CE    1 
ATOM 474   N NZ    . LYS A 1 62  ? -123.880 -46.939 -38.135  1.00 128.17 ? 69   LYS A NZ    1 
ATOM 475   N N     . LYS A 1 63  ? -127.424 -52.588 -38.690  1.00 127.29 ? 70   LYS A N     1 
ATOM 476   C CA    . LYS A 1 63  ? -128.828 -52.566 -39.147  1.00 126.51 ? 70   LYS A CA    1 
ATOM 477   C C     . LYS A 1 63  ? -129.764 -52.377 -37.943  1.00 125.44 ? 70   LYS A C     1 
ATOM 478   O O     . LYS A 1 63  ? -130.615 -51.475 -37.945  1.00 125.12 ? 70   LYS A O     1 
ATOM 479   C CB    . LYS A 1 63  ? -129.197 -53.847 -39.922  1.00 126.86 ? 70   LYS A CB    1 
ATOM 480   C CG    . LYS A 1 63  ? -129.164 -53.732 -41.456  1.00 127.70 ? 70   LYS A CG    1 
ATOM 481   C CD    . LYS A 1 63  ? -130.550 -53.927 -42.118  1.00 128.37 ? 70   LYS A CD    1 
ATOM 482   C CE    . LYS A 1 63  ? -130.402 -54.205 -43.635  1.00 128.85 ? 70   LYS A CE    1 
ATOM 483   N NZ    . LYS A 1 63  ? -131.683 -54.335 -44.405  1.00 128.48 ? 70   LYS A NZ    1 
ATOM 484   N N     . GLU A 1 64  ? -129.584 -53.223 -36.921  1.00 124.09 ? 71   GLU A N     1 
ATOM 485   C CA    . GLU A 1 64  ? -130.340 -53.124 -35.665  1.00 122.91 ? 71   GLU A CA    1 
ATOM 486   C C     . GLU A 1 64  ? -130.334 -51.695 -35.088  1.00 122.45 ? 71   GLU A C     1 
ATOM 487   O O     . GLU A 1 64  ? -131.367 -51.006 -35.136  1.00 122.20 ? 71   GLU A O     1 
ATOM 488   C CB    . GLU A 1 64  ? -129.889 -54.197 -34.658  1.00 122.36 ? 71   GLU A CB    1 
ATOM 489   C CG    . GLU A 1 64  ? -130.389 -55.587 -35.069  1.00 122.15 ? 71   GLU A CG    1 
ATOM 490   C CD    . GLU A 1 64  ? -129.629 -56.766 -34.455  1.00 122.12 ? 71   GLU A CD    1 
ATOM 491   O OE1   . GLU A 1 64  ? -128.956 -56.602 -33.408  1.00 121.89 ? 71   GLU A OE1   1 
ATOM 492   O OE2   . GLU A 1 64  ? -129.720 -57.877 -35.032  1.00 121.20 ? 71   GLU A OE2   1 
ATOM 493   N N     . GLN A 1 65  ? -129.171 -51.236 -34.613  1.00 121.85 ? 72   GLN A N     1 
ATOM 494   C CA    . GLN A 1 65  ? -129.013 -49.898 -34.011  1.00 121.20 ? 72   GLN A CA    1 
ATOM 495   C C     . GLN A 1 65  ? -129.620 -48.791 -34.860  1.00 120.55 ? 72   GLN A C     1 
ATOM 496   O O     . GLN A 1 65  ? -130.195 -47.844 -34.330  1.00 120.35 ? 72   GLN A O     1 
ATOM 497   C CB    . GLN A 1 65  ? -127.534 -49.590 -33.717  1.00 121.23 ? 72   GLN A CB    1 
ATOM 498   C CG    . GLN A 1 65  ? -127.275 -48.408 -32.728  1.00 122.32 ? 72   GLN A CG    1 
ATOM 499   C CD    . GLN A 1 65  ? -126.810 -47.058 -33.384  1.00 123.45 ? 72   GLN A CD    1 
ATOM 500   O OE1   . GLN A 1 65  ? -126.419 -47.002 -34.562  1.00 123.07 ? 72   GLN A OE1   1 
ATOM 501   N NE2   . GLN A 1 65  ? -126.844 -45.974 -32.587  1.00 122.95 ? 72   GLN A NE2   1 
ATOM 502   N N     . MET A 1 66  ? -129.500 -48.919 -36.175  1.00 119.92 ? 73   MET A N     1 
ATOM 503   C CA    . MET A 1 66  ? -129.957 -47.864 -37.078  1.00 119.40 ? 73   MET A CA    1 
ATOM 504   C C     . MET A 1 66  ? -131.469 -47.735 -37.100  1.00 119.26 ? 73   MET A C     1 
ATOM 505   O O     . MET A 1 66  ? -132.003 -46.661 -36.834  1.00 118.82 ? 73   MET A O     1 
ATOM 506   C CB    . MET A 1 66  ? -129.434 -48.088 -38.503  1.00 119.32 ? 73   MET A CB    1 
ATOM 507   C CG    . MET A 1 66  ? -127.977 -47.705 -38.697  1.00 117.89 ? 73   MET A CG    1 
ATOM 508   S SD    . MET A 1 66  ? -127.682 -47.232 -40.384  1.00 116.49 ? 73   MET A SD    1 
ATOM 509   C CE    . MET A 1 66  ? -127.777 -45.450 -40.256  1.00 114.14 ? 73   MET A CE    1 
ATOM 510   N N     . GLU A 1 67  ? -132.143 -48.841 -37.415  1.00 119.41 ? 74   GLU A N     1 
ATOM 511   C CA    . GLU A 1 67  ? -133.603 -48.863 -37.523  1.00 119.53 ? 74   GLU A CA    1 
ATOM 512   C C     . GLU A 1 67  ? -134.267 -48.484 -36.208  1.00 119.76 ? 74   GLU A C     1 
ATOM 513   O O     . GLU A 1 67  ? -135.245 -47.731 -36.230  1.00 119.49 ? 74   GLU A O     1 
ATOM 514   C CB    . GLU A 1 67  ? -134.099 -50.216 -38.026  1.00 119.33 ? 74   GLU A CB    1 
ATOM 515   C CG    . GLU A 1 67  ? -133.593 -50.553 -39.420  1.00 119.08 ? 74   GLU A CG    1 
ATOM 516   C CD    . GLU A 1 67  ? -134.329 -51.720 -40.063  1.00 119.46 ? 74   GLU A CD    1 
ATOM 517   O OE1   . GLU A 1 67  ? -134.388 -52.814 -39.447  1.00 119.33 ? 74   GLU A OE1   1 
ATOM 518   O OE2   . GLU A 1 67  ? -134.844 -51.543 -41.194  1.00 118.97 ? 74   GLU A OE2   1 
ATOM 519   N N     . ARG A 1 68  ? -133.704 -48.989 -35.092  1.00 120.11 ? 75   ARG A N     1 
ATOM 520   C CA    . ARG A 1 68  ? -134.090 -48.633 -33.704  1.00 120.48 ? 75   ARG A CA    1 
ATOM 521   C C     . ARG A 1 68  ? -133.810 -47.169 -33.344  1.00 120.64 ? 75   ARG A C     1 
ATOM 522   O O     . ARG A 1 68  ? -133.552 -46.848 -32.182  1.00 120.46 ? 75   ARG A O     1 
ATOM 523   C CB    . ARG A 1 68  ? -133.375 -49.527 -32.683  1.00 120.39 ? 75   ARG A CB    1 
ATOM 524   C CG    . ARG A 1 68  ? -133.874 -50.965 -32.586  1.00 121.90 ? 75   ARG A CG    1 
ATOM 525   C CD    . ARG A 1 68  ? -133.158 -51.736 -31.455  1.00 124.75 ? 75   ARG A CD    1 
ATOM 526   N NE    . ARG A 1 68  ? -131.721 -51.966 -31.710  1.00 127.33 ? 75   ARG A NE    1 
ATOM 527   C CZ    . ARG A 1 68  ? -130.709 -51.276 -31.162  1.00 127.98 ? 75   ARG A CZ    1 
ATOM 528   N NH1   . ARG A 1 68  ? -130.937 -50.278 -30.305  1.00 128.40 ? 75   ARG A NH1   1 
ATOM 529   N NH2   . ARG A 1 68  ? -129.453 -51.587 -31.478  1.00 127.59 ? 75   ARG A NH2   1 
ATOM 530   N N     . ASP A 1 69  ? -133.859 -46.306 -34.354  1.00 121.26 ? 76   ASP A N     1 
ATOM 531   C CA    . ASP A 1 69  ? -133.659 -44.870 -34.230  1.00 122.26 ? 76   ASP A CA    1 
ATOM 532   C C     . ASP A 1 69  ? -134.620 -44.153 -35.154  1.00 123.39 ? 76   ASP A C     1 
ATOM 533   O O     . ASP A 1 69  ? -134.721 -42.914 -35.131  1.00 123.55 ? 76   ASP A O     1 
ATOM 534   C CB    . ASP A 1 69  ? -132.255 -44.506 -34.674  1.00 121.99 ? 76   ASP A CB    1 
ATOM 535   C CG    . ASP A 1 69  ? -131.269 -44.579 -33.566  1.00 121.97 ? 76   ASP A CG    1 
ATOM 536   O OD1   . ASP A 1 69  ? -131.440 -43.807 -32.609  1.00 122.39 ? 76   ASP A OD1   1 
ATOM 537   O OD2   . ASP A 1 69  ? -130.318 -45.385 -33.650  1.00 121.62 ? 76   ASP A OD2   1 
ATOM 538   N N     . GLY A 1 70  ? -135.293 -44.951 -35.989  1.00 124.59 ? 77   GLY A N     1 
ATOM 539   C CA    . GLY A 1 70  ? -136.154 -44.462 -37.068  1.00 125.85 ? 77   GLY A CA    1 
ATOM 540   C C     . GLY A 1 70  ? -135.471 -44.577 -38.418  1.00 126.67 ? 77   GLY A C     1 
ATOM 541   O O     . GLY A 1 70  ? -135.138 -43.563 -39.029  1.00 126.34 ? 77   GLY A O     1 
ATOM 542   N N     . CYS A 1 71  ? -135.259 -45.811 -38.882  1.00 127.95 ? 78   CYS A N     1 
ATOM 543   C CA    . CYS A 1 71  ? -134.580 -46.051 -40.176  1.00 129.41 ? 78   CYS A CA    1 
ATOM 544   C C     . CYS A 1 71  ? -135.209 -47.152 -41.043  1.00 130.00 ? 78   CYS A C     1 
ATOM 545   O O     . CYS A 1 71  ? -135.493 -48.255 -40.562  1.00 129.51 ? 78   CYS A O     1 
ATOM 546   C CB    . CYS A 1 71  ? -133.070 -46.326 -39.981  1.00 129.49 ? 78   CYS A CB    1 
ATOM 547   S SG    . CYS A 1 71  ? -132.046 -44.922 -39.379  1.00 130.65 ? 78   CYS A SG    1 
ATOM 548   N N     . SER A 1 72  ? -135.394 -46.836 -42.325  1.00 131.38 ? 79   SER A N     1 
ATOM 549   C CA    . SER A 1 72  ? -135.999 -47.744 -43.305  1.00 133.29 ? 79   SER A CA    1 
ATOM 550   C C     . SER A 1 72  ? -135.223 -49.047 -43.463  1.00 134.93 ? 79   SER A C     1 
ATOM 551   O O     . SER A 1 72  ? -134.050 -49.133 -43.098  1.00 135.24 ? 79   SER A O     1 
ATOM 552   C CB    . SER A 1 72  ? -136.099 -47.090 -44.699  1.00 133.01 ? 79   SER A CB    1 
ATOM 553   O OG    . SER A 1 72  ? -136.520 -45.738 -44.679  1.00 132.82 ? 79   SER A OG    1 
ATOM 554   N N     . GLU A 1 73  ? -135.883 -50.055 -44.028  1.00 137.04 ? 80   GLU A N     1 
ATOM 555   C CA    . GLU A 1 73  ? -135.194 -51.231 -44.533  1.00 139.29 ? 80   GLU A CA    1 
ATOM 556   C C     . GLU A 1 73  ? -134.396 -50.787 -45.745  1.00 140.62 ? 80   GLU A C     1 
ATOM 557   O O     . GLU A 1 73  ? -133.457 -51.456 -46.180  1.00 140.77 ? 80   GLU A O     1 
ATOM 558   C CB    . GLU A 1 73  ? -136.200 -52.300 -44.949  1.00 139.46 ? 80   GLU A CB    1 
ATOM 559   C CG    . GLU A 1 73  ? -135.721 -53.720 -44.681  1.00 140.56 ? 80   GLU A CG    1 
ATOM 560   C CD    . GLU A 1 73  ? -135.550 -53.993 -43.189  1.00 141.57 ? 80   GLU A CD    1 
ATOM 561   O OE1   . GLU A 1 73  ? -134.389 -53.958 -42.709  1.00 141.95 ? 80   GLU A OE1   1 
ATOM 562   O OE2   . GLU A 1 73  ? -136.577 -54.217 -42.499  1.00 141.75 ? 80   GLU A OE2   1 
ATOM 563   N N     . GLN A 1 74  ? -134.819 -49.648 -46.286  1.00 142.43 ? 81   GLN A N     1 
ATOM 564   C CA    . GLN A 1 74  ? -134.170 -48.969 -47.397  1.00 144.12 ? 81   GLN A CA    1 
ATOM 565   C C     . GLN A 1 74  ? -133.008 -48.109 -46.892  1.00 144.86 ? 81   GLN A C     1 
ATOM 566   O O     . GLN A 1 74  ? -132.075 -47.834 -47.638  1.00 145.22 ? 81   GLN A O     1 
ATOM 567   C CB    . GLN A 1 74  ? -135.192 -48.092 -48.153  1.00 144.30 ? 81   GLN A CB    1 
ATOM 568   C CG    . GLN A 1 74  ? -135.953 -48.768 -49.325  1.00 145.32 ? 81   GLN A CG    1 
ATOM 569   C CD    . GLN A 1 74  ? -137.209 -49.581 -48.923  1.00 146.29 ? 81   GLN A CD    1 
ATOM 570   O OE1   . GLN A 1 74  ? -137.473 -49.840 -47.741  1.00 146.64 ? 81   GLN A OE1   1 
ATOM 571   N NE2   . GLN A 1 74  ? -137.980 -49.990 -49.929  1.00 146.08 ? 81   GLN A NE2   1 
ATOM 572   N N     . GLU A 1 75  ? -133.064 -47.692 -45.630  1.00 145.82 ? 82   GLU A N     1 
ATOM 573   C CA    . GLU A 1 75  ? -132.056 -46.787 -45.078  1.00 146.76 ? 82   GLU A CA    1 
ATOM 574   C C     . GLU A 1 75  ? -130.829 -47.539 -44.587  1.00 146.81 ? 82   GLU A C     1 
ATOM 575   O O     . GLU A 1 75  ? -129.713 -47.137 -44.883  1.00 146.89 ? 82   GLU A O     1 
ATOM 576   C CB    . GLU A 1 75  ? -132.623 -45.924 -43.940  1.00 147.18 ? 82   GLU A CB    1 
ATOM 577   C CG    . GLU A 1 75  ? -133.333 -44.624 -44.348  1.00 148.55 ? 82   GLU A CG    1 
ATOM 578   C CD    . GLU A 1 75  ? -133.841 -43.856 -43.124  1.00 150.81 ? 82   GLU A CD    1 
ATOM 579   O OE1   . GLU A 1 75  ? -135.041 -44.006 -42.784  1.00 151.62 ? 82   GLU A OE1   1 
ATOM 580   O OE2   . GLU A 1 75  ? -133.037 -43.133 -42.478  1.00 151.42 ? 82   GLU A OE2   1 
ATOM 581   N N     . SER A 1 76  ? -131.028 -48.619 -43.837  1.00 146.95 ? 83   SER A N     1 
ATOM 582   C CA    . SER A 1 76  ? -129.897 -49.382 -43.319  1.00 147.22 ? 83   SER A CA    1 
ATOM 583   C C     . SER A 1 76  ? -129.407 -50.352 -44.375  1.00 147.38 ? 83   SER A C     1 
ATOM 584   O O     . SER A 1 76  ? -128.966 -51.458 -44.073  1.00 147.50 ? 83   SER A O     1 
ATOM 585   C CB    . SER A 1 76  ? -130.255 -50.112 -42.023  1.00 147.38 ? 83   SER A CB    1 
ATOM 586   O OG    . SER A 1 76  ? -131.268 -51.083 -42.238  1.00 147.30 ? 83   SER A OG    1 
ATOM 587   N N     . GLN A 1 77  ? -129.498 -49.912 -45.624  1.00 147.54 ? 84   GLN A N     1 
ATOM 588   C CA    . GLN A 1 77  ? -129.002 -50.656 -46.778  1.00 147.73 ? 84   GLN A CA    1 
ATOM 589   C C     . GLN A 1 77  ? -127.592 -50.157 -47.182  1.00 147.20 ? 84   GLN A C     1 
ATOM 590   O O     . GLN A 1 77  ? -127.462 -49.103 -47.828  1.00 147.36 ? 84   GLN A O     1 
ATOM 591   C CB    . GLN A 1 77  ? -129.999 -50.519 -47.944  1.00 148.04 ? 84   GLN A CB    1 
ATOM 592   C CG    . GLN A 1 77  ? -129.610 -51.212 -49.250  1.00 149.60 ? 84   GLN A CG    1 
ATOM 593   C CD    . GLN A 1 77  ? -130.038 -52.677 -49.313  1.00 151.38 ? 84   GLN A CD    1 
ATOM 594   O OE1   . GLN A 1 77  ? -131.200 -52.987 -49.608  1.00 151.85 ? 84   GLN A OE1   1 
ATOM 595   N NE2   . GLN A 1 77  ? -129.090 -53.586 -49.064  1.00 151.69 ? 84   GLN A NE2   1 
ATOM 596   N N     . PRO A 1 78  ? -126.531 -50.904 -46.793  1.00 146.42 ? 85   PRO A N     1 
ATOM 597   C CA    . PRO A 1 78  ? -125.197 -50.577 -47.280  1.00 145.74 ? 85   PRO A CA    1 
ATOM 598   C C     . PRO A 1 78  ? -125.227 -50.401 -48.800  1.00 145.26 ? 85   PRO A C     1 
ATOM 599   O O     . PRO A 1 78  ? -125.758 -51.252 -49.509  1.00 145.30 ? 85   PRO A O     1 
ATOM 600   C CB    . PRO A 1 78  ? -124.391 -51.810 -46.893  1.00 145.69 ? 85   PRO A CB    1 
ATOM 601   C CG    . PRO A 1 78  ? -125.065 -52.323 -45.683  1.00 145.83 ? 85   PRO A CG    1 
ATOM 602   C CD    . PRO A 1 78  ? -126.514 -52.090 -45.912  1.00 146.30 ? 85   PRO A CD    1 
ATOM 603   N N     . CYS A 1 79  ? -124.691 -49.296 -49.297  1.00 144.71 ? 86   CYS A N     1 
ATOM 604   C CA    . CYS A 1 79  ? -124.837 -48.973 -50.708  1.00 144.53 ? 86   CYS A CA    1 
ATOM 605   C C     . CYS A 1 79  ? -123.502 -48.715 -51.428  1.00 143.57 ? 86   CYS A C     1 
ATOM 606   O O     . CYS A 1 79  ? -123.039 -47.578 -51.474  1.00 143.53 ? 86   CYS A O     1 
ATOM 607   C CB    . CYS A 1 79  ? -125.799 -47.792 -50.876  1.00 145.01 ? 86   CYS A CB    1 
ATOM 608   S SG    . CYS A 1 79  ? -126.623 -47.772 -52.487  1.00 147.83 ? 86   CYS A SG    1 
ATOM 609   N N     . ALA A 1 80  ? -122.928 -49.770 -52.022  1.00 142.47 ? 87   ALA A N     1 
ATOM 610   C CA    . ALA A 1 80  ? -121.565 -49.775 -52.598  1.00 141.15 ? 87   ALA A CA    1 
ATOM 611   C C     . ALA A 1 80  ? -121.440 -49.467 -54.082  1.00 140.35 ? 87   ALA A C     1 
ATOM 612   O O     . ALA A 1 80  ? -122.296 -49.812 -54.873  1.00 140.23 ? 87   ALA A O     1 
ATOM 613   C CB    . ALA A 1 80  ? -120.909 -51.100 -52.323  1.00 141.09 ? 87   ALA A CB    1 
ATOM 614   N N     . PHE A 1 81  ? -120.332 -48.840 -54.445  1.00 139.82 ? 88   PHE A N     1 
ATOM 615   C CA    . PHE A 1 81  ? -119.986 -48.553 -55.829  1.00 139.66 ? 88   PHE A CA    1 
ATOM 616   C C     . PHE A 1 81  ? -118.512 -48.895 -56.016  1.00 139.93 ? 88   PHE A C     1 
ATOM 617   O O     . PHE A 1 81  ? -117.699 -48.558 -55.165  1.00 139.98 ? 88   PHE A O     1 
ATOM 618   C CB    . PHE A 1 81  ? -120.170 -47.065 -56.119  1.00 139.31 ? 88   PHE A CB    1 
ATOM 619   C CG    . PHE A 1 81  ? -121.595 -46.625 -56.218  1.00 138.35 ? 88   PHE A CG    1 
ATOM 620   C CD1   . PHE A 1 81  ? -122.428 -46.648 -55.116  1.00 137.96 ? 88   PHE A CD1   1 
ATOM 621   C CD2   . PHE A 1 81  ? -122.096 -46.145 -57.411  1.00 137.74 ? 88   PHE A CD2   1 
ATOM 622   C CE1   . PHE A 1 81  ? -123.745 -46.235 -55.211  1.00 137.50 ? 88   PHE A CE1   1 
ATOM 623   C CE2   . PHE A 1 81  ? -123.414 -45.726 -57.514  1.00 137.31 ? 88   PHE A CE2   1 
ATOM 624   C CZ    . PHE A 1 81  ? -124.237 -45.774 -56.410  1.00 137.10 ? 88   PHE A CZ    1 
ATOM 625   N N     . ILE A 1 82  ? -118.159 -49.572 -57.108  1.00 140.21 ? 89   ILE A N     1 
ATOM 626   C CA    . ILE A 1 82  ? -116.754 -49.870 -57.391  1.00 140.47 ? 89   ILE A CA    1 
ATOM 627   C C     . ILE A 1 82  ? -116.270 -49.010 -58.537  1.00 141.26 ? 89   ILE A C     1 
ATOM 628   O O     . ILE A 1 82  ? -117.066 -48.336 -59.172  1.00 141.50 ? 89   ILE A O     1 
ATOM 629   C CB    . ILE A 1 82  ? -116.519 -51.351 -57.712  1.00 140.15 ? 89   ILE A CB    1 
ATOM 630   C CG1   . ILE A 1 82  ? -115.030 -51.693 -57.588  1.00 139.51 ? 89   ILE A CG1   1 
ATOM 631   C CG2   . ILE A 1 82  ? -117.036 -51.679 -59.090  1.00 140.12 ? 89   ILE A CG2   1 
ATOM 632   C CD1   . ILE A 1 82  ? -114.728 -53.118 -57.192  1.00 137.82 ? 89   ILE A CD1   1 
ATOM 633   N N     . GLY A 1 83  ? -114.969 -49.023 -58.792  1.00 142.20 ? 90   GLY A N     1 
ATOM 634   C CA    . GLY A 1 83  ? -114.392 -48.251 -59.880  1.00 143.73 ? 90   GLY A CA    1 
ATOM 635   C C     . GLY A 1 83  ? -112.886 -48.363 -59.907  1.00 144.83 ? 90   GLY A C     1 
ATOM 636   O O     . GLY A 1 83  ? -112.250 -48.512 -58.872  1.00 144.89 ? 90   GLY A O     1 
ATOM 637   N N     . ILE A 1 84  ? -112.311 -48.294 -61.099  1.00 145.94 ? 91   ILE A N     1 
ATOM 638   C CA    . ILE A 1 84  ? -110.866 -48.288 -61.246  1.00 147.05 ? 91   ILE A CA    1 
ATOM 639   C C     . ILE A 1 84  ? -110.271 -46.961 -60.786  1.00 148.06 ? 91   ILE A C     1 
ATOM 640   O O     . ILE A 1 84  ? -109.069 -46.848 -60.620  1.00 147.83 ? 91   ILE A O     1 
ATOM 641   C CB    . ILE A 1 84  ? -110.441 -48.618 -62.695  1.00 146.92 ? 91   ILE A CB    1 
ATOM 642   C CG1   . ILE A 1 84  ? -111.470 -48.101 -63.705  1.00 147.41 ? 91   ILE A CG1   1 
ATOM 643   C CG2   . ILE A 1 84  ? -110.336 -50.103 -62.878  1.00 146.56 ? 91   ILE A CG2   1 
ATOM 644   C CD1   . ILE A 1 84  ? -111.082 -46.817 -64.431  1.00 148.38 ? 91   ILE A CD1   1 
ATOM 645   N N     . GLY A 1 85  ? -111.129 -45.969 -60.554  1.00 149.62 ? 92   GLY A N     1 
ATOM 646   C CA    . GLY A 1 85  ? -110.700 -44.601 -60.259  1.00 151.69 ? 92   GLY A CA    1 
ATOM 647   C C     . GLY A 1 85  ? -110.049 -43.976 -61.481  1.00 153.22 ? 92   GLY A C     1 
ATOM 648   O O     . GLY A 1 85  ? -109.649 -44.689 -62.393  1.00 153.21 ? 92   GLY A O     1 
ATOM 649   N N     . ASN A 1 86  ? -109.933 -42.649 -61.499  1.00 154.98 ? 93   ASN A N     1 
ATOM 650   C CA    . ASN A 1 86  ? -109.371 -41.906 -62.654  1.00 156.82 ? 93   ASN A CA    1 
ATOM 651   C C     . ASN A 1 86  ? -110.011 -42.264 -64.015  1.00 157.89 ? 93   ASN A C     1 
ATOM 652   O O     . ASN A 1 86  ? -109.399 -42.925 -64.874  1.00 158.00 ? 93   ASN A O     1 
ATOM 653   C CB    . ASN A 1 86  ? -107.823 -41.988 -62.705  1.00 156.81 ? 93   ASN A CB    1 
ATOM 654   C CG    . ASN A 1 86  ? -107.217 -41.206 -63.881  1.00 156.82 ? 93   ASN A CG    1 
ATOM 655   O OD1   . ASN A 1 86  ? -107.178 -39.974 -63.868  1.00 156.44 ? 93   ASN A OD1   1 
ATOM 656   N ND2   . ASN A 1 86  ? -106.739 -41.931 -64.895  1.00 156.73 ? 93   ASN A ND2   1 
ATOM 657   N N     . SER A 1 87  ? -111.252 -41.822 -64.191  1.00 159.18 ? 94   SER A N     1 
ATOM 658   C CA    . SER A 1 87  ? -111.975 -42.037 -65.442  1.00 160.39 ? 94   SER A CA    1 
ATOM 659   C C     . SER A 1 87  ? -113.126 -41.038 -65.624  1.00 161.07 ? 94   SER A C     1 
ATOM 660   O O     . SER A 1 87  ? -113.505 -40.322 -64.683  1.00 161.29 ? 94   SER A O     1 
ATOM 661   C CB    . SER A 1 87  ? -112.472 -43.493 -65.546  1.00 160.39 ? 94   SER A CB    1 
ATOM 662   O OG    . SER A 1 87  ? -112.923 -43.988 -64.296  1.00 160.40 ? 94   SER A OG    1 
ATOM 663   N N     . ASP A 1 88  ? -113.645 -40.976 -66.851  1.00 161.71 ? 95   ASP A N     1 
ATOM 664   C CA    . ASP A 1 88  ? -114.895 -40.273 -67.134  1.00 162.20 ? 95   ASP A CA    1 
ATOM 665   C C     . ASP A 1 88  ? -116.045 -41.278 -67.224  1.00 162.32 ? 95   ASP A C     1 
ATOM 666   O O     . ASP A 1 88  ? -117.208 -40.879 -67.351  1.00 162.37 ? 95   ASP A O     1 
ATOM 667   C CB    . ASP A 1 88  ? -114.791 -39.423 -68.414  1.00 162.32 ? 95   ASP A CB    1 
ATOM 668   C CG    . ASP A 1 88  ? -114.202 -38.031 -68.157  1.00 162.63 ? 95   ASP A CG    1 
ATOM 669   O OD1   . ASP A 1 88  ? -114.575 -37.392 -67.151  1.00 162.70 ? 95   ASP A OD1   1 
ATOM 670   O OD2   . ASP A 1 88  ? -113.373 -37.570 -68.972  1.00 162.76 ? 95   ASP A OD2   1 
ATOM 671   N N     . GLN A 1 89  ? -115.709 -42.573 -67.136  1.00 162.42 ? 96   GLN A N     1 
ATOM 672   C CA    . GLN A 1 89  ? -116.694 -43.667 -67.175  1.00 162.45 ? 96   GLN A CA    1 
ATOM 673   C C     . GLN A 1 89  ? -117.649 -43.618 -65.983  1.00 162.37 ? 96   GLN A C     1 
ATOM 674   O O     . GLN A 1 89  ? -118.705 -44.267 -66.002  1.00 162.49 ? 96   GLN A O     1 
ATOM 675   C CB    . GLN A 1 89  ? -116.005 -45.044 -67.223  1.00 162.54 ? 96   GLN A CB    1 
ATOM 676   C CG    . GLN A 1 89  ? -115.343 -45.485 -65.898  1.00 162.63 ? 96   GLN A CG    1 
ATOM 677   C CD    . GLN A 1 89  ? -115.172 -47.003 -65.752  1.00 162.79 ? 96   GLN A CD    1 
ATOM 678   O OE1   . GLN A 1 89  ? -114.809 -47.700 -66.703  1.00 162.95 ? 96   GLN A OE1   1 
ATOM 679   N NE2   . GLN A 1 89  ? -115.419 -47.512 -64.544  1.00 162.16 ? 96   GLN A NE2   1 
ATOM 680   N N     . GLU A 1 90  ? -117.269 -42.832 -64.968  1.00 162.00 ? 97   GLU A N     1 
ATOM 681   C CA    . GLU A 1 90  ? -117.921 -42.816 -63.656  1.00 161.61 ? 97   GLU A CA    1 
ATOM 682   C C     . GLU A 1 90  ? -117.836 -44.188 -63.012  1.00 161.03 ? 97   GLU A C     1 
ATOM 683   O O     . GLU A 1 90  ? -117.068 -45.038 -63.448  1.00 161.07 ? 97   GLU A O     1 
ATOM 684   C CB    . GLU A 1 90  ? -119.373 -42.308 -63.724  1.00 161.74 ? 97   GLU A CB    1 
ATOM 685   C CG    . GLU A 1 90  ? -119.517 -40.791 -63.548  1.00 162.66 ? 97   GLU A CG    1 
ATOM 686   C CD    . GLU A 1 90  ? -119.348 -40.311 -62.094  1.00 163.83 ? 97   GLU A CD    1 
ATOM 687   O OE1   . GLU A 1 90  ? -118.628 -40.962 -61.293  1.00 163.91 ? 97   GLU A OE1   1 
ATOM 688   O OE2   . GLU A 1 90  ? -119.938 -39.259 -61.755  1.00 164.11 ? 97   GLU A OE2   1 
ATOM 689   N N     . MET A 1 91  ? -118.619 -44.412 -61.975  1.00 160.29 ? 98   MET A N     1 
ATOM 690   C CA    . MET A 1 91  ? -118.507 -45.653 -61.244  1.00 159.61 ? 98   MET A CA    1 
ATOM 691   C C     . MET A 1 91  ? -119.674 -46.570 -61.546  1.00 159.42 ? 98   MET A C     1 
ATOM 692   O O     . MET A 1 91  ? -120.599 -46.192 -62.254  1.00 159.36 ? 98   MET A O     1 
ATOM 693   C CB    . MET A 1 91  ? -118.378 -45.360 -59.757  1.00 159.53 ? 98   MET A CB    1 
ATOM 694   C CG    . MET A 1 91  ? -117.280 -44.353 -59.469  1.00 158.92 ? 98   MET A CG    1 
ATOM 695   S SD    . MET A 1 91  ? -116.841 -44.187 -57.742  1.00 157.50 ? 98   MET A SD    1 
ATOM 696   C CE    . MET A 1 91  ? -115.928 -45.691 -57.444  1.00 157.61 ? 98   MET A CE    1 
ATOM 697   N N     . GLN A 1 92  ? -119.617 -47.787 -61.027  1.00 159.28 ? 99   GLN A N     1 
ATOM 698   C CA    . GLN A 1 92  ? -120.651 -48.766 -61.282  1.00 159.35 ? 99   GLN A CA    1 
ATOM 699   C C     . GLN A 1 92  ? -121.149 -49.317 -59.970  1.00 159.45 ? 99   GLN A C     1 
ATOM 700   O O     . GLN A 1 92  ? -120.367 -49.701 -59.113  1.00 159.32 ? 99   GLN A O     1 
ATOM 701   C CB    . GLN A 1 92  ? -120.124 -49.877 -62.187  1.00 159.37 ? 99   GLN A CB    1 
ATOM 702   C CG    . GLN A 1 92  ? -119.970 -49.450 -63.646  1.00 159.22 ? 99   GLN A CG    1 
ATOM 703   C CD    . GLN A 1 92  ? -119.027 -50.337 -64.433  1.00 158.60 ? 99   GLN A CD    1 
ATOM 704   O OE1   . GLN A 1 92  ? -118.947 -51.543 -64.204  1.00 157.99 ? 99   GLN A OE1   1 
ATOM 705   N NE2   . GLN A 1 92  ? -118.310 -49.739 -65.375  1.00 158.77 ? 99   GLN A NE2   1 
ATOM 706   N N     . GLN A 1 93  ? -122.464 -49.337 -59.817  1.00 159.74 ? 100  GLN A N     1 
ATOM 707   C CA    . GLN A 1 93  ? -123.080 -49.710 -58.563  1.00 160.13 ? 100  GLN A CA    1 
ATOM 708   C C     . GLN A 1 93  ? -122.929 -51.192 -58.345  1.00 160.39 ? 100  GLN A C     1 
ATOM 709   O O     . GLN A 1 93  ? -122.790 -51.941 -59.297  1.00 160.39 ? 100  GLN A O     1 
ATOM 710   C CB    . GLN A 1 93  ? -124.561 -49.339 -58.589  1.00 160.17 ? 100  GLN A CB    1 
ATOM 711   C CG    . GLN A 1 93  ? -125.207 -49.245 -57.212  1.00 160.44 ? 100  GLN A CG    1 
ATOM 712   C CD    . GLN A 1 93  ? -126.601 -48.651 -57.244  1.00 160.73 ? 100  GLN A CD    1 
ATOM 713   O OE1   . GLN A 1 93  ? -127.028 -48.068 -58.244  1.00 160.53 ? 100  GLN A OE1   1 
ATOM 714   N NE2   . GLN A 1 93  ? -127.318 -48.793 -56.140  1.00 160.77 ? 100  GLN A NE2   1 
ATOM 715   N N     . LEU A 1 94  ? -122.944 -51.610 -57.089  1.00 161.07 ? 101  LEU A N     1 
ATOM 716   C CA    . LEU A 1 94  ? -123.053 -53.026 -56.773  1.00 161.99 ? 101  LEU A CA    1 
ATOM 717   C C     . LEU A 1 94  ? -124.372 -53.328 -56.083  1.00 162.57 ? 101  LEU A C     1 
ATOM 718   O O     . LEU A 1 94  ? -124.815 -52.565 -55.221  1.00 162.59 ? 101  LEU A O     1 
ATOM 719   C CB    . LEU A 1 94  ? -121.891 -53.497 -55.894  1.00 162.07 ? 101  LEU A CB    1 
ATOM 720   C CG    . LEU A 1 94  ? -120.568 -53.935 -56.530  1.00 162.21 ? 101  LEU A CG    1 
ATOM 721   C CD1   . LEU A 1 94  ? -120.764 -54.769 -57.801  1.00 162.68 ? 101  LEU A CD1   1 
ATOM 722   C CD2   . LEU A 1 94  ? -119.722 -52.727 -56.821  1.00 162.40 ? 101  LEU A CD2   1 
ATOM 723   N N     . ASN A 1 95  ? -124.996 -54.439 -56.468  1.00 163.38 ? 102  ASN A N     1 
ATOM 724   C CA    . ASN A 1 95  ? -126.224 -54.876 -55.811  1.00 164.18 ? 102  ASN A CA    1 
ATOM 725   C C     . ASN A 1 95  ? -125.956 -55.710 -54.560  1.00 164.47 ? 102  ASN A C     1 
ATOM 726   O O     . ASN A 1 95  ? -125.920 -56.951 -54.603  1.00 164.49 ? 102  ASN A O     1 
ATOM 727   C CB    . ASN A 1 95  ? -127.164 -55.610 -56.769  1.00 164.37 ? 102  ASN A CB    1 
ATOM 728   C CG    . ASN A 1 95  ? -128.509 -55.903 -56.134  1.00 164.78 ? 102  ASN A CG    1 
ATOM 729   O OD1   . ASN A 1 95  ? -128.823 -57.052 -55.822  1.00 165.24 ? 102  ASN A OD1   1 
ATOM 730   N ND2   . ASN A 1 95  ? -129.294 -54.855 -55.899  1.00 164.86 ? 102  ASN A ND2   1 
ATOM 731   N N     . LEU A 1 96  ? -125.773 -55.000 -53.450  1.00 164.78 ? 103  LEU A N     1 
ATOM 732   C CA    . LEU A 1 96  ? -125.533 -55.613 -52.155  1.00 165.04 ? 103  LEU A CA    1 
ATOM 733   C C     . LEU A 1 96  ? -126.836 -56.032 -51.485  1.00 165.15 ? 103  LEU A C     1 
ATOM 734   O O     . LEU A 1 96  ? -126.844 -56.406 -50.305  1.00 165.36 ? 103  LEU A O     1 
ATOM 735   C CB    . LEU A 1 96  ? -124.761 -54.657 -51.245  1.00 165.10 ? 103  LEU A CB    1 
ATOM 736   C CG    . LEU A 1 96  ? -123.256 -54.534 -51.453  1.00 165.16 ? 103  LEU A CG    1 
ATOM 737   C CD1   . LEU A 1 96  ? -122.690 -53.665 -50.351  1.00 165.06 ? 103  LEU A CD1   1 
ATOM 738   C CD2   . LEU A 1 96  ? -122.581 -55.901 -51.461  1.00 165.43 ? 103  LEU A CD2   1 
ATOM 739   N N     . GLU A 1 97  ? -127.930 -55.967 -52.242  1.00 165.04 ? 104  GLU A N     1 
ATOM 740   C CA    . GLU A 1 97  ? -129.241 -56.395 -51.756  1.00 164.92 ? 104  GLU A CA    1 
ATOM 741   C C     . GLU A 1 97  ? -129.275 -57.923 -51.569  1.00 164.44 ? 104  GLU A C     1 
ATOM 742   O O     . GLU A 1 97  ? -128.487 -58.648 -52.193  1.00 164.48 ? 104  GLU A O     1 
ATOM 743   C CB    . GLU A 1 97  ? -130.339 -55.916 -52.718  1.00 165.12 ? 104  GLU A CB    1 
ATOM 744   C CG    . GLU A 1 97  ? -131.664 -55.538 -52.036  1.00 166.17 ? 104  GLU A CG    1 
ATOM 745   C CD    . GLU A 1 97  ? -132.502 -54.540 -52.840  1.00 167.47 ? 104  GLU A CD    1 
ATOM 746   O OE1   . GLU A 1 97  ? -132.622 -54.703 -54.076  1.00 167.68 ? 104  GLU A OE1   1 
ATOM 747   O OE2   . GLU A 1 97  ? -133.053 -53.594 -52.228  1.00 167.98 ? 104  GLU A OE2   1 
ATOM 748   N N     . GLY A 1 98  ? -130.162 -58.398 -50.691  1.00 163.78 ? 105  GLY A N     1 
ATOM 749   C CA    . GLY A 1 98  ? -130.323 -59.833 -50.436  1.00 162.87 ? 105  GLY A CA    1 
ATOM 750   C C     . GLY A 1 98  ? -129.095 -60.449 -49.795  1.00 162.20 ? 105  GLY A C     1 
ATOM 751   O O     . GLY A 1 98  ? -128.929 -60.384 -48.575  1.00 162.25 ? 105  GLY A O     1 
ATOM 752   N N     . LYS A 1 99  ? -128.237 -61.046 -50.626  1.00 161.47 ? 106  LYS A N     1 
ATOM 753   C CA    . LYS A 1 99  ? -126.937 -61.587 -50.180  1.00 160.56 ? 106  LYS A CA    1 
ATOM 754   C C     . LYS A 1 99  ? -125.931 -60.474 -49.836  1.00 159.67 ? 106  LYS A C     1 
ATOM 755   O O     . LYS A 1 99  ? -126.045 -59.351 -50.345  1.00 159.46 ? 106  LYS A O     1 
ATOM 756   C CB    . LYS A 1 99  ? -126.340 -62.609 -51.186  1.00 160.68 ? 106  LYS A CB    1 
ATOM 757   C CG    . LYS A 1 99  ? -126.886 -62.585 -52.637  1.00 160.78 ? 106  LYS A CG    1 
ATOM 758   C CD    . LYS A 1 99  ? -126.278 -61.478 -53.492  1.00 160.38 ? 106  LYS A CD    1 
ATOM 759   C CE    . LYS A 1 99  ? -127.011 -61.334 -54.812  1.00 159.61 ? 106  LYS A CE    1 
ATOM 760   N NZ    . LYS A 1 99  ? -126.719 -60.021 -55.437  1.00 158.92 ? 106  LYS A NZ    1 
ATOM 761   N N     . ASN A 1 100 ? -124.964 -60.799 -48.968  1.00 158.47 ? 107  ASN A N     1 
ATOM 762   C CA    . ASN A 1 100 ? -123.966 -59.837 -48.461  1.00 157.10 ? 107  ASN A CA    1 
ATOM 763   C C     . ASN A 1 100 ? -122.730 -59.589 -49.355  1.00 156.22 ? 107  ASN A C     1 
ATOM 764   O O     . ASN A 1 100 ? -122.121 -58.529 -49.286  1.00 156.08 ? 107  ASN A O     1 
ATOM 765   C CB    . ASN A 1 100 ? -123.540 -60.216 -47.041  1.00 157.06 ? 107  ASN A CB    1 
ATOM 766   C CG    . ASN A 1 100 ? -122.991 -61.626 -46.951  1.00 156.63 ? 107  ASN A CG    1 
ATOM 767   O OD1   . ASN A 1 100 ? -121.829 -61.870 -47.253  1.00 156.20 ? 107  ASN A OD1   1 
ATOM 768   N ND2   . ASN A 1 100 ? -123.825 -62.557 -46.521  1.00 156.34 ? 107  ASN A ND2   1 
ATOM 769   N N     . TYR A 1 101 ? -122.371 -60.560 -50.189  1.00 155.10 ? 108  TYR A N     1 
ATOM 770   C CA    . TYR A 1 101 ? -121.300 -60.395 -51.166  1.00 154.03 ? 108  TYR A CA    1 
ATOM 771   C C     . TYR A 1 101 ? -121.813 -59.711 -52.433  1.00 152.90 ? 108  TYR A C     1 
ATOM 772   O O     . TYR A 1 101 ? -122.980 -59.351 -52.517  1.00 152.78 ? 108  TYR A O     1 
ATOM 773   C CB    . TYR A 1 101 ? -120.683 -61.757 -51.503  1.00 154.40 ? 108  TYR A CB    1 
ATOM 774   C CG    . TYR A 1 101 ? -121.597 -62.676 -52.282  1.00 155.71 ? 108  TYR A CG    1 
ATOM 775   C CD1   . TYR A 1 101 ? -122.562 -63.450 -51.636  1.00 156.82 ? 108  TYR A CD1   1 
ATOM 776   C CD2   . TYR A 1 101 ? -121.495 -62.774 -53.671  1.00 157.33 ? 108  TYR A CD2   1 
ATOM 777   C CE1   . TYR A 1 101 ? -123.415 -64.295 -52.360  1.00 158.06 ? 108  TYR A CE1   1 
ATOM 778   C CE2   . TYR A 1 101 ? -122.339 -63.616 -54.407  1.00 158.43 ? 108  TYR A CE2   1 
ATOM 779   C CZ    . TYR A 1 101 ? -123.296 -64.374 -53.748  1.00 158.59 ? 108  TYR A CZ    1 
ATOM 780   O OH    . TYR A 1 101 ? -124.122 -65.201 -54.487  1.00 158.84 ? 108  TYR A OH    1 
ATOM 781   N N     . CYS A 1 102 ? -120.929 -59.527 -53.412  1.00 151.61 ? 109  CYS A N     1 
ATOM 782   C CA    . CYS A 1 102 ? -121.290 -58.988 -54.732  1.00 150.36 ? 109  CYS A CA    1 
ATOM 783   C C     . CYS A 1 102 ? -120.105 -59.000 -55.694  1.00 149.10 ? 109  CYS A C     1 
ATOM 784   O O     . CYS A 1 102 ? -118.964 -59.061 -55.258  1.00 149.11 ? 109  CYS A O     1 
ATOM 785   C CB    . CYS A 1 102 ? -121.838 -57.570 -54.626  1.00 150.41 ? 109  CYS A CB    1 
ATOM 786   S SG    . CYS A 1 102 ? -122.848 -57.142 -56.043  1.00 151.68 ? 109  CYS A SG    1 
ATOM 787   N N     . THR A 1 103 ? -120.383 -58.932 -56.995  1.00 147.53 ? 110  THR A N     1 
ATOM 788   C CA    . THR A 1 103 ? -119.353 -59.029 -58.034  1.00 145.98 ? 110  THR A CA    1 
ATOM 789   C C     . THR A 1 103 ? -119.584 -58.009 -59.149  1.00 144.91 ? 110  THR A C     1 
ATOM 790   O O     . THR A 1 103 ? -120.723 -57.732 -59.521  1.00 144.95 ? 110  THR A O     1 
ATOM 791   C CB    . THR A 1 103 ? -119.290 -60.458 -58.651  1.00 145.99 ? 110  THR A CB    1 
ATOM 792   O OG1   . THR A 1 103 ? -120.611 -60.931 -58.919  1.00 146.47 ? 110  THR A OG1   1 
ATOM 793   C CG2   . THR A 1 103 ? -118.636 -61.442 -57.715  1.00 145.45 ? 110  THR A CG2   1 
ATOM 794   N N     . ALA A 1 104 ? -118.504 -57.455 -59.686  1.00 143.40 ? 111  ALA A N     1 
ATOM 795   C CA    . ALA A 1 104 ? -118.606 -56.474 -60.757  1.00 142.00 ? 111  ALA A CA    1 
ATOM 796   C C     . ALA A 1 104 ? -118.044 -57.022 -62.063  1.00 140.88 ? 111  ALA A C     1 
ATOM 797   O O     . ALA A 1 104 ? -116.886 -56.810 -62.389  1.00 140.81 ? 111  ALA A O     1 
ATOM 798   C CB    . ALA A 1 104 ? -117.906 -55.202 -60.355  1.00 141.93 ? 111  ALA A CB    1 
ATOM 799   N N     . LYS A 1 105 ? -118.880 -57.714 -62.820  1.00 139.48 ? 112  LYS A N     1 
ATOM 800   C CA    . LYS A 1 105 ? -118.400 -58.483 -63.961  1.00 138.28 ? 112  LYS A CA    1 
ATOM 801   C C     . LYS A 1 105 ? -118.302 -57.724 -65.281  1.00 137.38 ? 112  LYS A C     1 
ATOM 802   O O     . LYS A 1 105 ? -117.992 -58.317 -66.309  1.00 137.28 ? 112  LYS A O     1 
ATOM 803   C CB    . LYS A 1 105 ? -119.202 -59.782 -64.118  1.00 138.34 ? 112  LYS A CB    1 
ATOM 804   C CG    . LYS A 1 105 ? -120.562 -59.757 -63.443  1.00 138.68 ? 112  LYS A CG    1 
ATOM 805   C CD    . LYS A 1 105 ? -120.945 -61.126 -62.890  1.00 139.04 ? 112  LYS A CD    1 
ATOM 806   C CE    . LYS A 1 105 ? -122.018 -61.010 -61.796  1.00 139.11 ? 112  LYS A CE    1 
ATOM 807   N NZ    . LYS A 1 105 ? -122.057 -62.215 -60.897  1.00 138.69 ? 112  LYS A NZ    1 
ATOM 808   N N     . THR A 1 106 ? -118.549 -56.420 -65.261  1.00 136.20 ? 113  THR A N     1 
ATOM 809   C CA    . THR A 1 106 ? -118.333 -55.601 -66.455  1.00 135.08 ? 113  THR A CA    1 
ATOM 810   C C     . THR A 1 106 ? -117.376 -54.442 -66.176  1.00 134.22 ? 113  THR A C     1 
ATOM 811   O O     . THR A 1 106 ? -117.697 -53.279 -66.451  1.00 133.98 ? 113  THR A O     1 
ATOM 812   C CB    . THR A 1 106 ? -119.643 -55.025 -67.047  1.00 135.21 ? 113  THR A CB    1 
ATOM 813   O OG1   . THR A 1 106 ? -120.176 -54.048 -66.151  1.00 135.62 ? 113  THR A OG1   1 
ATOM 814   C CG2   . THR A 1 106 ? -120.689 -56.104 -67.304  1.00 135.40 ? 113  THR A CG2   1 
ATOM 815   N N     . LEU A 1 107 ? -116.202 -54.768 -65.631  1.00 133.07 ? 114  LEU A N     1 
ATOM 816   C CA    . LEU A 1 107 ? -115.138 -53.791 -65.389  1.00 131.70 ? 114  LEU A CA    1 
ATOM 817   C C     . LEU A 1 107 ? -113.993 -53.976 -66.356  1.00 131.09 ? 114  LEU A C     1 
ATOM 818   O O     . LEU A 1 107 ? -113.569 -55.096 -66.589  1.00 130.96 ? 114  LEU A O     1 
ATOM 819   C CB    . LEU A 1 107 ? -114.622 -53.933 -63.976  1.00 131.40 ? 114  LEU A CB    1 
ATOM 820   C CG    . LEU A 1 107 ? -115.472 -53.240 -62.938  1.00 130.65 ? 114  LEU A CG    1 
ATOM 821   C CD1   . LEU A 1 107 ? -114.922 -53.541 -61.599  1.00 129.89 ? 114  LEU A CD1   1 
ATOM 822   C CD2   . LEU A 1 107 ? -115.450 -51.752 -63.192  1.00 130.70 ? 114  LEU A CD2   1 
ATOM 823   N N     . TYR A 1 108 ? -113.495 -52.882 -66.918  1.00 130.36 ? 115  TYR A N     1 
ATOM 824   C CA    . TYR A 1 108 ? -112.471 -52.964 -67.957  1.00 129.96 ? 115  TYR A CA    1 
ATOM 825   C C     . TYR A 1 108 ? -111.469 -51.833 -67.821  1.00 129.97 ? 115  TYR A C     1 
ATOM 826   O O     . TYR A 1 108 ? -111.486 -51.130 -66.828  1.00 130.16 ? 115  TYR A O     1 
ATOM 827   C CB    . TYR A 1 108 ? -113.105 -53.001 -69.360  1.00 129.78 ? 115  TYR A CB    1 
ATOM 828   C CG    . TYR A 1 108 ? -113.764 -51.714 -69.822  1.00 129.04 ? 115  TYR A CG    1 
ATOM 829   C CD1   . TYR A 1 108 ? -113.252 -50.999 -70.904  1.00 128.12 ? 115  TYR A CD1   1 
ATOM 830   C CD2   . TYR A 1 108 ? -114.906 -51.217 -69.191  1.00 128.27 ? 115  TYR A CD2   1 
ATOM 831   C CE1   . TYR A 1 108 ? -113.846 -49.816 -71.339  1.00 127.04 ? 115  TYR A CE1   1 
ATOM 832   C CE2   . TYR A 1 108 ? -115.507 -50.030 -69.616  1.00 127.81 ? 115  TYR A CE2   1 
ATOM 833   C CZ    . TYR A 1 108 ? -114.967 -49.342 -70.693  1.00 127.21 ? 115  TYR A CZ    1 
ATOM 834   O OH    . TYR A 1 108 ? -115.544 -48.176 -71.124  1.00 127.06 ? 115  TYR A OH    1 
ATOM 835   N N     . ILE A 1 109 ? -110.600 -51.658 -68.809  1.00 129.89 ? 116  ILE A N     1 
ATOM 836   C CA    . ILE A 1 109 ? -109.556 -50.642 -68.743  1.00 130.00 ? 116  ILE A CA    1 
ATOM 837   C C     . ILE A 1 109 ? -109.184 -50.154 -70.157  1.00 130.16 ? 116  ILE A C     1 
ATOM 838   O O     . ILE A 1 109 ? -108.589 -50.888 -70.939  1.00 130.32 ? 116  ILE A O     1 
ATOM 839   C CB    . ILE A 1 109 ? -108.330 -51.173 -67.905  1.00 130.05 ? 116  ILE A CB    1 
ATOM 840   C CG1   . ILE A 1 109 ? -107.154 -50.186 -67.875  1.00 130.12 ? 116  ILE A CG1   1 
ATOM 841   C CG2   . ILE A 1 109 ? -107.897 -52.560 -68.359  1.00 130.29 ? 116  ILE A CG2   1 
ATOM 842   C CD1   . ILE A 1 109 ? -107.020 -49.401 -66.580  1.00 129.49 ? 116  ILE A CD1   1 
ATOM 843   N N     . SER A 1 110 ? -109.546 -48.915 -70.480  1.00 130.35 ? 117  SER A N     1 
ATOM 844   C CA    . SER A 1 110 ? -109.400 -48.369 -71.836  1.00 130.85 ? 117  SER A CA    1 
ATOM 845   C C     . SER A 1 110 ? -107.988 -48.418 -72.401  1.00 131.11 ? 117  SER A C     1 
ATOM 846   O O     . SER A 1 110 ? -107.022 -48.640 -71.686  1.00 131.21 ? 117  SER A O     1 
ATOM 847   C CB    . SER A 1 110 ? -109.847 -46.910 -71.871  1.00 130.95 ? 117  SER A CB    1 
ATOM 848   O OG    . SER A 1 110 ? -111.004 -46.696 -71.094  1.00 132.02 ? 117  SER A OG    1 
ATOM 849   N N     . ASP A 1 111 ? -107.876 -48.187 -73.703  1.00 131.60 ? 118  ASP A N     1 
ATOM 850   C CA    . ASP A 1 111 ? -106.583 -47.900 -74.320  1.00 131.88 ? 118  ASP A CA    1 
ATOM 851   C C     . ASP A 1 111 ? -106.114 -46.524 -73.865  1.00 131.60 ? 118  ASP A C     1 
ATOM 852   O O     . ASP A 1 111 ? -104.917 -46.252 -73.864  1.00 131.68 ? 118  ASP A O     1 
ATOM 853   C CB    . ASP A 1 111 ? -106.648 -47.974 -75.865  1.00 132.39 ? 118  ASP A CB    1 
ATOM 854   C CG    . ASP A 1 111 ? -107.586 -46.898 -76.505  1.00 133.54 ? 118  ASP A CG    1 
ATOM 855   O OD1   . ASP A 1 111 ? -108.666 -46.582 -75.939  1.00 134.69 ? 118  ASP A OD1   1 
ATOM 856   O OD2   . ASP A 1 111 ? -107.243 -46.383 -77.602  1.00 134.16 ? 118  ASP A OD2   1 
ATOM 857   N N     . SER A 1 112 ? -107.079 -45.677 -73.488  1.00 131.08 ? 119  SER A N     1 
ATOM 858   C CA    . SER A 1 112 ? -106.842 -44.313 -73.038  1.00 130.58 ? 119  SER A CA    1 
ATOM 859   C C     . SER A 1 112 ? -106.674 -44.262 -71.534  1.00 130.15 ? 119  SER A C     1 
ATOM 860   O O     . SER A 1 112 ? -107.236 -43.390 -70.861  1.00 130.55 ? 119  SER A O     1 
ATOM 861   C CB    . SER A 1 112 ? -107.990 -43.400 -73.463  1.00 130.68 ? 119  SER A CB    1 
ATOM 862   O OG    . SER A 1 112 ? -107.676 -42.738 -74.668  1.00 131.25 ? 119  SER A OG    1 
ATOM 863   N N     . ASP A 1 113 ? -105.916 -45.216 -71.009  1.00 129.30 ? 120  ASP A N     1 
ATOM 864   C CA    . ASP A 1 113 ? -105.496 -45.209 -69.617  1.00 128.27 ? 120  ASP A CA    1 
ATOM 865   C C     . ASP A 1 113 ? -104.027 -45.610 -69.630  1.00 127.57 ? 120  ASP A C     1 
ATOM 866   O O     . ASP A 1 113 ? -103.685 -46.801 -69.572  1.00 127.54 ? 120  ASP A O     1 
ATOM 867   C CB    . ASP A 1 113 ? -106.352 -46.173 -68.790  1.00 128.11 ? 120  ASP A CB    1 
ATOM 868   C CG    . ASP A 1 113 ? -106.728 -45.610 -67.434  1.00 127.97 ? 120  ASP A CG    1 
ATOM 869   O OD1   . ASP A 1 113 ? -106.243 -44.513 -67.066  1.00 128.10 ? 120  ASP A OD1   1 
ATOM 870   O OD2   . ASP A 1 113 ? -107.518 -46.268 -66.733  1.00 127.02 ? 120  ASP A OD2   1 
ATOM 871   N N     . LYS A 1 114 ? -103.163 -44.608 -69.750  1.00 126.40 ? 121  LYS A N     1 
ATOM 872   C CA    . LYS A 1 114 ? -101.741 -44.845 -69.929  1.00 125.61 ? 121  LYS A CA    1 
ATOM 873   C C     . LYS A 1 114 ? -101.085 -45.628 -68.787  1.00 124.51 ? 121  LYS A C     1 
ATOM 874   O O     . LYS A 1 114 ? -100.091 -46.330 -68.999  1.00 124.64 ? 121  LYS A O     1 
ATOM 875   C CB    . LYS A 1 114 ? -101.014 -43.522 -70.148  1.00 126.03 ? 121  LYS A CB    1 
ATOM 876   C CG    . LYS A 1 114 ? -100.519 -43.297 -71.592  1.00 128.02 ? 121  LYS A CG    1 
ATOM 877   C CD    . LYS A 1 114 ? -101.366 -42.293 -72.417  1.00 130.45 ? 121  LYS A CD    1 
ATOM 878   C CE    . LYS A 1 114 ? -102.401 -42.977 -73.301  1.00 131.45 ? 121  LYS A CE    1 
ATOM 879   N NZ    . LYS A 1 114 ? -103.593 -43.405 -72.506  1.00 132.06 ? 121  LYS A NZ    1 
ATOM 880   N N     . ARG A 1 115 ? -101.663 -45.520 -67.591  1.00 122.86 ? 122  ARG A N     1 
ATOM 881   C CA    . ARG A 1 115 ? -101.081 -46.053 -66.349  1.00 121.06 ? 122  ARG A CA    1 
ATOM 882   C C     . ARG A 1 115 ? -100.792 -47.542 -66.349  1.00 119.34 ? 122  ARG A C     1 
ATOM 883   O O     . ARG A 1 115 ? -101.704 -48.348 -66.416  1.00 118.91 ? 122  ARG A O     1 
ATOM 884   C CB    . ARG A 1 115 ? -101.961 -45.695 -65.150  1.00 121.38 ? 122  ARG A CB    1 
ATOM 885   C CG    . ARG A 1 115 ? -103.393 -45.417 -65.506  1.00 122.15 ? 122  ARG A CG    1 
ATOM 886   C CD    . ARG A 1 115 ? -104.164 -44.916 -64.325  1.00 123.03 ? 122  ARG A CD    1 
ATOM 887   N NE    . ARG A 1 115 ? -104.667 -46.022 -63.536  1.00 123.67 ? 122  ARG A NE    1 
ATOM 888   C CZ    . ARG A 1 115 ? -105.831 -45.991 -62.924  1.00 124.69 ? 122  ARG A CZ    1 
ATOM 889   N NH1   . ARG A 1 115 ? -106.581 -44.910 -63.031  1.00 125.19 ? 122  ARG A NH1   1 
ATOM 890   N NH2   . ARG A 1 115 ? -106.244 -47.028 -62.215  1.00 124.88 ? 122  ARG A NH2   1 
ATOM 891   N N     . LYS A 1 116 ? -99.511  -47.884 -66.240  1.00 117.36 ? 123  LYS A N     1 
ATOM 892   C CA    . LYS A 1 116 ? -99.060  -49.272 -66.271  1.00 115.50 ? 123  LYS A CA    1 
ATOM 893   C C     . LYS A 1 116 ? -99.364  -50.063 -64.984  1.00 113.78 ? 123  LYS A C     1 
ATOM 894   O O     . LYS A 1 116 ? -98.981  -51.211 -64.868  1.00 113.32 ? 123  LYS A O     1 
ATOM 895   C CB    . LYS A 1 116 ? -97.573  -49.339 -66.682  1.00 115.88 ? 123  LYS A CB    1 
ATOM 896   C CG    . LYS A 1 116 ? -97.291  -49.006 -68.185  1.00 116.93 ? 123  LYS A CG    1 
ATOM 897   C CD    . LYS A 1 116 ? -97.221  -50.298 -69.078  1.00 119.83 ? 123  LYS A CD    1 
ATOM 898   C CE    . LYS A 1 116 ? -98.087  -50.236 -70.392  1.00 119.88 ? 123  LYS A CE    1 
ATOM 899   N NZ    . LYS A 1 116 ? -98.793  -51.532 -70.771  1.00 117.46 ? 123  LYS A NZ    1 
ATOM 900   N N     . HIS A 1 117 ? -100.068 -49.436 -64.042  1.00 112.13 ? 124  HIS A N     1 
ATOM 901   C CA    . HIS A 1 117 ? -100.658 -50.093 -62.850  1.00 110.83 ? 124  HIS A CA    1 
ATOM 902   C C     . HIS A 1 117 ? -101.908 -49.335 -62.377  1.00 109.80 ? 124  HIS A C     1 
ATOM 903   O O     . HIS A 1 117 ? -102.126 -48.205 -62.795  1.00 109.68 ? 124  HIS A O     1 
ATOM 904   C CB    . HIS A 1 117 ? -99.696  -50.080 -61.685  1.00 111.15 ? 124  HIS A CB    1 
ATOM 905   C CG    . HIS A 1 117 ? -98.622  -51.113 -61.748  1.00 111.37 ? 124  HIS A CG    1 
ATOM 906   N ND1   . HIS A 1 117 ? -98.773  -52.377 -61.218  1.00 111.46 ? 124  HIS A ND1   1 
ATOM 907   C CD2   . HIS A 1 117 ? -97.353  -51.045 -62.209  1.00 111.48 ? 124  HIS A CD2   1 
ATOM 908   C CE1   . HIS A 1 117 ? -97.655  -53.058 -61.381  1.00 111.57 ? 124  HIS A CE1   1 
ATOM 909   N NE2   . HIS A 1 117 ? -96.779  -52.272 -61.982  1.00 112.34 ? 124  HIS A NE2   1 
ATOM 910   N N     . PHE A 1 118 ? -102.712 -49.930 -61.494  1.00 108.52 ? 125  PHE A N     1 
ATOM 911   C CA    . PHE A 1 118 ? -103.992 -49.323 -61.095  1.00 107.85 ? 125  PHE A CA    1 
ATOM 912   C C     . PHE A 1 118 ? -104.575 -49.962 -59.851  1.00 107.97 ? 125  PHE A C     1 
ATOM 913   O O     . PHE A 1 118 ? -104.105 -51.027 -59.422  1.00 107.80 ? 125  PHE A O     1 
ATOM 914   C CB    . PHE A 1 118 ? -105.029 -49.369 -62.238  1.00 107.64 ? 125  PHE A CB    1 
ATOM 915   C CG    . PHE A 1 118 ? -105.756 -50.706 -62.386  1.00 106.85 ? 125  PHE A CG    1 
ATOM 916   C CD1   . PHE A 1 118 ? -106.975 -50.931 -61.765  1.00 105.36 ? 125  PHE A CD1   1 
ATOM 917   C CD2   . PHE A 1 118 ? -105.233 -51.723 -63.176  1.00 105.46 ? 125  PHE A CD2   1 
ATOM 918   C CE1   . PHE A 1 118 ? -107.626 -52.140 -61.896  1.00 102.87 ? 125  PHE A CE1   1 
ATOM 919   C CE2   . PHE A 1 118 ? -105.893 -52.923 -63.304  1.00 103.64 ? 125  PHE A CE2   1 
ATOM 920   C CZ    . PHE A 1 118 ? -107.081 -53.125 -62.660  1.00 102.69 ? 125  PHE A CZ    1 
ATOM 921   N N     . MET A 1 119 ? -105.612 -49.319 -59.293  1.00 108.13 ? 126  MET A N     1 
ATOM 922   C CA    . MET A 1 119 ? -106.312 -49.796 -58.079  1.00 108.24 ? 126  MET A CA    1 
ATOM 923   C C     . MET A 1 119 ? -107.836 -49.635 -58.056  1.00 107.50 ? 126  MET A C     1 
ATOM 924   O O     . MET A 1 119 ? -108.375 -48.599 -58.459  1.00 107.53 ? 126  MET A O     1 
ATOM 925   C CB    . MET A 1 119 ? -105.739 -49.101 -56.854  1.00 108.88 ? 126  MET A CB    1 
ATOM 926   C CG    . MET A 1 119 ? -104.579 -49.830 -56.227  1.00 111.45 ? 126  MET A CG    1 
ATOM 927   S SD    . MET A 1 119 ? -103.548 -48.739 -55.241  1.00 116.00 ? 126  MET A SD    1 
ATOM 928   C CE    . MET A 1 119 ? -104.248 -48.975 -53.610  1.00 115.56 ? 126  MET A CE    1 
ATOM 929   N N     . LEU A 1 120 ? -108.512 -50.659 -57.546  1.00 106.68 ? 127  LEU A N     1 
ATOM 930   C CA    . LEU A 1 120 ? -109.959 -50.668 -57.413  1.00 106.40 ? 127  LEU A CA    1 
ATOM 931   C C     . LEU A 1 120 ? -110.397 -49.947 -56.157  1.00 106.41 ? 127  LEU A C     1 
ATOM 932   O O     . LEU A 1 120 ? -109.983 -50.330 -55.075  1.00 106.70 ? 127  LEU A O     1 
ATOM 933   C CB    . LEU A 1 120 ? -110.450 -52.095 -57.272  1.00 106.29 ? 127  LEU A CB    1 
ATOM 934   C CG    . LEU A 1 120 ? -110.233 -53.096 -58.384  1.00 106.32 ? 127  LEU A CG    1 
ATOM 935   C CD1   . LEU A 1 120 ? -110.685 -54.443 -57.879  1.00 105.50 ? 127  LEU A CD1   1 
ATOM 936   C CD2   . LEU A 1 120 ? -110.994 -52.685 -59.648  1.00 106.86 ? 127  LEU A CD2   1 
ATOM 937   N N     . SER A 1 121 ? -111.265 -48.945 -56.277  1.00 106.20 ? 128  SER A N     1 
ATOM 938   C CA    . SER A 1 121 ? -111.774 -48.226 -55.104  1.00 105.92 ? 128  SER A CA    1 
ATOM 939   C C     . SER A 1 121 ? -113.266 -48.458 -54.887  1.00 105.41 ? 128  SER A C     1 
ATOM 940   O O     . SER A 1 121 ? -114.068 -48.177 -55.755  1.00 105.46 ? 128  SER A O     1 
ATOM 941   C CB    . SER A 1 121 ? -111.423 -46.724 -55.161  1.00 106.10 ? 128  SER A CB    1 
ATOM 942   O OG    . SER A 1 121 ? -111.915 -46.071 -56.327  1.00 107.40 ? 128  SER A OG    1 
ATOM 943   N N     . VAL A 1 122 ? -113.624 -48.966 -53.719  1.00 105.16 ? 129  VAL A N     1 
ATOM 944   C CA    . VAL A 1 122 ? -114.979 -49.389 -53.429  1.00 105.42 ? 129  VAL A CA    1 
ATOM 945   C C     . VAL A 1 122 ? -115.654 -48.419 -52.471  1.00 106.01 ? 129  VAL A C     1 
ATOM 946   O O     . VAL A 1 122 ? -115.709 -48.661 -51.273  1.00 105.75 ? 129  VAL A O     1 
ATOM 947   C CB    . VAL A 1 122 ? -114.971 -50.801 -52.820  1.00 105.41 ? 129  VAL A CB    1 
ATOM 948   C CG1   . VAL A 1 122 ? -116.340 -51.395 -52.779  1.00 105.64 ? 129  VAL A CG1   1 
ATOM 949   C CG2   . VAL A 1 122 ? -114.095 -51.703 -53.617  1.00 105.42 ? 129  VAL A CG2   1 
ATOM 950   N N     . LYS A 1 123 ? -116.164 -47.318 -53.022  1.00 107.11 ? 130  LYS A N     1 
ATOM 951   C CA    . LYS A 1 123 ? -116.916 -46.271 -52.299  1.00 107.99 ? 130  LYS A CA    1 
ATOM 952   C C     . LYS A 1 123 ? -118.156 -46.839 -51.611  1.00 108.89 ? 130  LYS A C     1 
ATOM 953   O O     . LYS A 1 123 ? -118.742 -47.782 -52.112  1.00 109.41 ? 130  LYS A O     1 
ATOM 954   C CB    . LYS A 1 123 ? -117.314 -45.198 -53.301  1.00 107.64 ? 130  LYS A CB    1 
ATOM 955   C CG    . LYS A 1 123 ? -118.175 -44.097 -52.774  1.00 108.23 ? 130  LYS A CG    1 
ATOM 956   C CD    . LYS A 1 123 ? -117.503 -43.358 -51.671  1.00 109.27 ? 130  LYS A CD    1 
ATOM 957   C CE    . LYS A 1 123 ? -118.521 -42.790 -50.717  1.00 109.45 ? 130  LYS A CE    1 
ATOM 958   N NZ    . LYS A 1 123 ? -117.928 -42.331 -49.435  1.00 109.23 ? 130  LYS A NZ    1 
ATOM 959   N N     . MET A 1 124 ? -118.553 -46.296 -50.462  1.00 110.04 ? 131  MET A N     1 
ATOM 960   C CA    . MET A 1 124 ? -119.690 -46.859 -49.700  1.00 111.29 ? 131  MET A CA    1 
ATOM 961   C C     . MET A 1 124 ? -120.301 -45.892 -48.700  1.00 112.57 ? 131  MET A C     1 
ATOM 962   O O     . MET A 1 124 ? -119.591 -45.095 -48.074  1.00 112.86 ? 131  MET A O     1 
ATOM 963   C CB    . MET A 1 124 ? -119.294 -48.095 -48.897  1.00 110.88 ? 131  MET A CB    1 
ATOM 964   C CG    . MET A 1 124 ? -118.958 -49.313 -49.665  1.00 110.57 ? 131  MET A CG    1 
ATOM 965   S SD    . MET A 1 124 ? -119.042 -50.782 -48.645  1.00 112.13 ? 131  MET A SD    1 
ATOM 966   C CE    . MET A 1 124 ? -118.621 -50.181 -47.026  1.00 112.20 ? 131  MET A CE    1 
ATOM 967   N N     . PHE A 1 125 ? -121.617 -46.030 -48.517  1.00 113.88 ? 132  PHE A N     1 
ATOM 968   C CA    . PHE A 1 125 ? -122.409 -45.259 -47.563  1.00 114.89 ? 132  PHE A CA    1 
ATOM 969   C C     . PHE A 1 125 ? -123.716 -45.965 -47.257  1.00 115.75 ? 132  PHE A C     1 
ATOM 970   O O     . PHE A 1 125 ? -124.201 -46.760 -48.061  1.00 116.43 ? 132  PHE A O     1 
ATOM 971   C CB    . PHE A 1 125 ? -122.720 -43.882 -48.130  1.00 114.77 ? 132  PHE A CB    1 
ATOM 972   C CG    . PHE A 1 125 ? -123.299 -43.904 -49.506  1.00 114.71 ? 132  PHE A CG    1 
ATOM 973   C CD1   . PHE A 1 125 ? -124.669 -43.964 -49.691  1.00 115.70 ? 132  PHE A CD1   1 
ATOM 974   C CD2   . PHE A 1 125 ? -122.475 -43.823 -50.617  1.00 115.04 ? 132  PHE A CD2   1 
ATOM 975   C CE1   . PHE A 1 125 ? -125.212 -43.950 -50.970  1.00 117.36 ? 132  PHE A CE1   1 
ATOM 976   C CE2   . PHE A 1 125 ? -122.999 -43.812 -51.899  1.00 116.32 ? 132  PHE A CE2   1 
ATOM 977   C CZ    . PHE A 1 125 ? -124.371 -43.872 -52.082  1.00 117.40 ? 132  PHE A CZ    1 
ATOM 978   N N     . TYR A 1 126 ? -124.303 -45.662 -46.110  1.00 116.47 ? 133  TYR A N     1 
ATOM 979   C CA    . TYR A 1 126 ? -125.666 -46.093 -45.854  1.00 117.26 ? 133  TYR A CA    1 
ATOM 980   C C     . TYR A 1 126 ? -126.667 -45.208 -46.611  1.00 117.92 ? 133  TYR A C     1 
ATOM 981   O O     . TYR A 1 126 ? -126.419 -44.009 -46.779  1.00 118.23 ? 133  TYR A O     1 
ATOM 982   C CB    . TYR A 1 126 ? -125.939 -46.058 -44.362  1.00 117.28 ? 133  TYR A CB    1 
ATOM 983   C CG    . TYR A 1 126 ? -124.961 -46.869 -43.575  1.00 116.88 ? 133  TYR A CG    1 
ATOM 984   C CD1   . TYR A 1 126 ? -124.041 -46.252 -42.757  1.00 116.73 ? 133  TYR A CD1   1 
ATOM 985   C CD2   . TYR A 1 126 ? -124.958 -48.256 -43.653  1.00 116.29 ? 133  TYR A CD2   1 
ATOM 986   C CE1   . TYR A 1 126 ? -123.152 -46.983 -42.035  1.00 116.91 ? 133  TYR A CE1   1 
ATOM 987   C CE2   . TYR A 1 126 ? -124.063 -48.995 -42.934  1.00 116.55 ? 133  TYR A CE2   1 
ATOM 988   C CZ    . TYR A 1 126 ? -123.159 -48.349 -42.131  1.00 116.96 ? 133  TYR A CZ    1 
ATOM 989   O OH    . TYR A 1 126 ? -122.248 -49.059 -41.405  1.00 118.38 ? 133  TYR A OH    1 
ATOM 990   N N     . GLY A 1 127 ? -127.782 -45.799 -47.056  1.00 118.33 ? 134  GLY A N     1 
ATOM 991   C CA    . GLY A 1 127 ? -128.849 -45.095 -47.793  1.00 118.88 ? 134  GLY A CA    1 
ATOM 992   C C     . GLY A 1 127 ? -129.148 -43.666 -47.363  1.00 119.21 ? 134  GLY A C     1 
ATOM 993   O O     . GLY A 1 127 ? -129.385 -42.787 -48.191  1.00 119.25 ? 134  GLY A O     1 
ATOM 994   N N     . ASN A 1 128 ? -129.103 -43.433 -46.062  1.00 119.48 ? 135  ASN A N     1 
ATOM 995   C CA    . ASN A 1 128 ? -129.388 -42.129 -45.491  1.00 119.99 ? 135  ASN A CA    1 
ATOM 996   C C     . ASN A 1 128 ? -128.412 -41.001 -45.815  1.00 120.17 ? 135  ASN A C     1 
ATOM 997   O O     . ASN A 1 128 ? -128.480 -39.949 -45.173  1.00 120.56 ? 135  ASN A O     1 
ATOM 998   C CB    . ASN A 1 128 ? -129.531 -42.246 -43.964  1.00 120.36 ? 135  ASN A CB    1 
ATOM 999   C CG    . ASN A 1 128 ? -128.651 -43.346 -43.353  1.00 120.74 ? 135  ASN A CG    1 
ATOM 1000  O OD1   . ASN A 1 128 ? -128.814 -44.537 -43.633  1.00 120.99 ? 135  ASN A OD1   1 
ATOM 1001  N ND2   . ASN A 1 128 ? -127.760 -42.945 -42.475  1.00 120.62 ? 135  ASN A ND2   1 
ATOM 1002  N N     . SER A 1 129 ? -127.546 -41.208 -46.816  1.00 120.21 ? 136  SER A N     1 
ATOM 1003  C CA    . SER A 1 129 ? -126.327 -40.381 -47.085  1.00 120.03 ? 136  SER A CA    1 
ATOM 1004  C C     . SER A 1 129 ? -125.212 -40.499 -46.026  1.00 119.83 ? 136  SER A C     1 
ATOM 1005  O O     . SER A 1 129 ? -124.113 -39.993 -46.243  1.00 119.73 ? 136  SER A O     1 
ATOM 1006  C CB    . SER A 1 129 ? -126.635 -38.900 -47.380  1.00 119.97 ? 136  SER A CB    1 
ATOM 1007  O OG    . SER A 1 129 ? -127.406 -38.765 -48.553  1.00 119.86 ? 136  SER A OG    1 
ATOM 1008  N N     . ASP A 1 130 ? -125.500 -41.154 -44.897  1.00 119.68 ? 137  ASP A N     1 
ATOM 1009  C CA    . ASP A 1 130 ? -124.501 -41.435 -43.856  1.00 119.56 ? 137  ASP A CA    1 
ATOM 1010  C C     . ASP A 1 130 ? -123.327 -42.199 -44.433  1.00 118.94 ? 137  ASP A C     1 
ATOM 1011  O O     . ASP A 1 130 ? -123.482 -43.354 -44.861  1.00 119.21 ? 137  ASP A O     1 
ATOM 1012  C CB    . ASP A 1 130 ? -125.099 -42.269 -42.724  1.00 120.07 ? 137  ASP A CB    1 
ATOM 1013  C CG    . ASP A 1 130 ? -125.574 -41.426 -41.557  1.00 121.61 ? 137  ASP A CG    1 
ATOM 1014  O OD1   . ASP A 1 130 ? -125.676 -41.983 -40.432  1.00 122.86 ? 137  ASP A OD1   1 
ATOM 1015  O OD2   . ASP A 1 130 ? -125.854 -40.219 -41.764  1.00 123.23 ? 137  ASP A OD2   1 
ATOM 1016  N N     . ASP A 1 131 ? -122.155 -41.562 -44.406  1.00 117.80 ? 138  ASP A N     1 
ATOM 1017  C CA    . ASP A 1 131 ? -120.974 -42.029 -45.135  1.00 116.24 ? 138  ASP A CA    1 
ATOM 1018  C C     . ASP A 1 131 ? -120.206 -43.172 -44.449  1.00 114.92 ? 138  ASP A C     1 
ATOM 1019  O O     . ASP A 1 131 ? -120.242 -43.311 -43.231  1.00 114.51 ? 138  ASP A O     1 
ATOM 1020  C CB    . ASP A 1 131 ? -120.061 -40.832 -45.419  1.00 116.44 ? 138  ASP A CB    1 
ATOM 1021  C CG    . ASP A 1 131 ? -119.217 -41.023 -46.665  1.00 117.31 ? 138  ASP A CG    1 
ATOM 1022  O OD1   . ASP A 1 131 ? -118.905 -40.032 -47.366  1.00 118.58 ? 138  ASP A OD1   1 
ATOM 1023  O OD2   . ASP A 1 131 ? -118.860 -42.179 -46.947  1.00 118.00 ? 138  ASP A OD2   1 
ATOM 1024  N N     . ILE A 1 132 ? -119.537 -44.004 -45.245  1.00 113.66 ? 139  ILE A N     1 
ATOM 1025  C CA    . ILE A 1 132 ? -118.612 -45.011 -44.698  1.00 112.75 ? 139  ILE A CA    1 
ATOM 1026  C C     . ILE A 1 132 ? -117.238 -45.089 -45.367  1.00 112.06 ? 139  ILE A C     1 
ATOM 1027  O O     . ILE A 1 132 ? -116.359 -45.789 -44.877  1.00 111.92 ? 139  ILE A O     1 
ATOM 1028  C CB    . ILE A 1 132 ? -119.217 -46.428 -44.597  1.00 112.77 ? 139  ILE A CB    1 
ATOM 1029  C CG1   . ILE A 1 132 ? -119.927 -46.800 -45.895  1.00 111.98 ? 139  ILE A CG1   1 
ATOM 1030  C CG2   . ILE A 1 132 ? -120.089 -46.534 -43.344  1.00 112.71 ? 139  ILE A CG2   1 
ATOM 1031  C CD1   . ILE A 1 132 ? -120.809 -47.998 -45.822  1.00 111.46 ? 139  ILE A CD1   1 
ATOM 1032  N N     . GLY A 1 133 ? -117.061 -44.380 -46.478  1.00 111.21 ? 140  GLY A N     1 
ATOM 1033  C CA    . GLY A 1 133 ? -115.724 -44.107 -47.022  1.00 110.08 ? 140  GLY A CA    1 
ATOM 1034  C C     . GLY A 1 133 ? -115.226 -45.063 -48.080  1.00 109.18 ? 140  GLY A C     1 
ATOM 1035  O O     . GLY A 1 133 ? -115.851 -46.082 -48.326  1.00 109.13 ? 140  GLY A O     1 
ATOM 1036  N N     . VAL A 1 134 ? -114.087 -44.728 -48.687  1.00 108.34 ? 141  VAL A N     1 
ATOM 1037  C CA    . VAL A 1 134 ? -113.512 -45.480 -49.806  1.00 107.23 ? 141  VAL A CA    1 
ATOM 1038  C C     . VAL A 1 134 ? -112.619 -46.625 -49.334  1.00 106.95 ? 141  VAL A C     1 
ATOM 1039  O O     . VAL A 1 134 ? -111.885 -46.459 -48.387  1.00 106.68 ? 141  VAL A O     1 
ATOM 1040  C CB    . VAL A 1 134 ? -112.700 -44.548 -50.711  1.00 106.85 ? 141  VAL A CB    1 
ATOM 1041  C CG1   . VAL A 1 134 ? -112.059 -45.319 -51.821  1.00 106.55 ? 141  VAL A CG1   1 
ATOM 1042  C CG2   . VAL A 1 134 ? -113.590 -43.470 -51.296  1.00 106.44 ? 141  VAL A CG2   1 
ATOM 1043  N N     . PHE A 1 135 ? -112.700 -47.783 -49.986  1.00 106.83 ? 142  PHE A N     1 
ATOM 1044  C CA    . PHE A 1 135 ? -111.826 -48.925 -49.687  1.00 107.10 ? 142  PHE A CA    1 
ATOM 1045  C C     . PHE A 1 135 ? -110.995 -49.301 -50.899  1.00 107.16 ? 142  PHE A C     1 
ATOM 1046  O O     . PHE A 1 135 ? -111.487 -49.230 -52.017  1.00 107.75 ? 142  PHE A O     1 
ATOM 1047  C CB    . PHE A 1 135 ? -112.636 -50.124 -49.237  1.00 107.05 ? 142  PHE A CB    1 
ATOM 1048  C CG    . PHE A 1 135 ? -113.312 -49.913 -47.950  1.00 108.49 ? 142  PHE A CG    1 
ATOM 1049  C CD1   . PHE A 1 135 ? -114.439 -49.123 -47.874  1.00 110.03 ? 142  PHE A CD1   1 
ATOM 1050  C CD2   . PHE A 1 135 ? -112.810 -50.472 -46.795  1.00 110.58 ? 142  PHE A CD2   1 
ATOM 1051  C CE1   . PHE A 1 135 ? -115.063 -48.892 -46.660  1.00 112.14 ? 142  PHE A CE1   1 
ATOM 1052  C CE2   . PHE A 1 135 ? -113.436 -50.254 -45.566  1.00 112.04 ? 142  PHE A CE2   1 
ATOM 1053  C CZ    . PHE A 1 135 ? -114.558 -49.461 -45.498  1.00 112.34 ? 142  PHE A CZ    1 
ATOM 1054  N N     . LEU A 1 136 ? -109.741 -49.699 -50.690  1.00 106.93 ? 143  LEU A N     1 
ATOM 1055  C CA    . LEU A 1 136 ? -108.828 -49.871 -51.804  1.00 106.45 ? 143  LEU A CA    1 
ATOM 1056  C C     . LEU A 1 136 ? -108.318 -51.297 -51.944  1.00 106.81 ? 143  LEU A C     1 
ATOM 1057  O O     . LEU A 1 136 ? -108.092 -51.996 -50.961  1.00 106.70 ? 143  LEU A O     1 
ATOM 1058  C CB    . LEU A 1 136 ? -107.696 -48.847 -51.722  1.00 106.21 ? 143  LEU A CB    1 
ATOM 1059  C CG    . LEU A 1 136 ? -108.050 -47.404 -52.113  1.00 105.42 ? 143  LEU A CG    1 
ATOM 1060  C CD1   . LEU A 1 136 ? -107.092 -46.356 -51.562  1.00 104.63 ? 143  LEU A CD1   1 
ATOM 1061  C CD2   . LEU A 1 136 ? -108.149 -47.268 -53.615  1.00 105.13 ? 143  LEU A CD2   1 
ATOM 1062  N N     . SER A 1 137 ? -108.179 -51.730 -53.190  1.00 107.36 ? 144  SER A N     1 
ATOM 1063  C CA    . SER A 1 137 ? -107.678 -53.056 -53.517  1.00 107.88 ? 144  SER A CA    1 
ATOM 1064  C C     . SER A 1 137 ? -106.169 -53.052 -53.525  1.00 108.37 ? 144  SER A C     1 
ATOM 1065  O O     . SER A 1 137 ? -105.511 -52.005 -53.614  1.00 108.41 ? 144  SER A O     1 
ATOM 1066  C CB    . SER A 1 137 ? -108.164 -53.489 -54.890  1.00 107.78 ? 144  SER A CB    1 
ATOM 1067  O OG    . SER A 1 137 ? -107.606 -52.658 -55.887  1.00 107.91 ? 144  SER A OG    1 
ATOM 1068  N N     . LYS A 1 138 ? -105.614 -54.243 -53.457  1.00 108.81 ? 145  LYS A N     1 
ATOM 1069  C CA    . LYS A 1 138 ? -104.200 -54.349 -53.274  1.00 109.60 ? 145  LYS A CA    1 
ATOM 1070  C C     . LYS A 1 138 ? -103.460 -54.319 -54.621  1.00 110.48 ? 145  LYS A C     1 
ATOM 1071  O O     . LYS A 1 138 ? -103.063 -55.376 -55.127  1.00 110.85 ? 145  LYS A O     1 
ATOM 1072  C CB    . LYS A 1 138 ? -103.904 -55.612 -52.473  1.00 109.24 ? 145  LYS A CB    1 
ATOM 1073  C CG    . LYS A 1 138 ? -102.592 -55.569 -51.728  1.00 109.75 ? 145  LYS A CG    1 
ATOM 1074  C CD    . LYS A 1 138 ? -102.396 -56.793 -50.863  1.00 110.29 ? 145  LYS A CD    1 
ATOM 1075  C CE    . LYS A 1 138 ? -103.150 -56.664 -49.563  1.00 110.78 ? 145  LYS A CE    1 
ATOM 1076  N NZ    . LYS A 1 138 ? -102.804 -57.807 -48.670  1.00 111.08 ? 145  LYS A NZ    1 
ATOM 1077  N N     . ARG A 1 139 ? -103.296 -53.118 -55.202  1.00 111.38 ? 146  ARG A N     1 
ATOM 1078  C CA    . ARG A 1 139 ? -102.492 -52.882 -56.446  1.00 112.16 ? 146  ARG A CA    1 
ATOM 1079  C C     . ARG A 1 139 ? -102.676 -53.888 -57.593  1.00 112.07 ? 146  ARG A C     1 
ATOM 1080  O O     . ARG A 1 139 ? -102.398 -55.080 -57.442  1.00 111.85 ? 146  ARG A O     1 
ATOM 1081  C CB    . ARG A 1 139 ? -101.003 -52.761 -56.092  1.00 112.70 ? 146  ARG A CB    1 
ATOM 1082  C CG    . ARG A 1 139 ? -100.021 -52.677 -57.283  1.00 114.97 ? 146  ARG A CG    1 
ATOM 1083  C CD    . ARG A 1 139 ? -98.552  -52.512 -56.779  1.00 119.40 ? 146  ARG A CD    1 
ATOM 1084  N NE    . ARG A 1 139 ? -97.508  -52.535 -57.826  1.00 121.42 ? 146  ARG A NE    1 
ATOM 1085  C CZ    . ARG A 1 139 ? -96.499  -53.420 -57.884  1.00 123.36 ? 146  ARG A CZ    1 
ATOM 1086  N NH1   . ARG A 1 139 ? -96.368  -54.380 -56.961  1.00 123.59 ? 146  ARG A NH1   1 
ATOM 1087  N NH2   . ARG A 1 139 ? -95.601  -53.352 -58.866  1.00 123.85 ? 146  ARG A NH2   1 
ATOM 1088  N N     . ILE A 1 140 ? -103.127 -53.417 -58.746  1.00 112.24 ? 147  ILE A N     1 
ATOM 1089  C CA    . ILE A 1 140 ? -103.273 -54.328 -59.882  1.00 112.71 ? 147  ILE A CA    1 
ATOM 1090  C C     . ILE A 1 140 ? -102.440 -53.889 -61.104  1.00 113.21 ? 147  ILE A C     1 
ATOM 1091  O O     . ILE A 1 140 ? -102.272 -52.691 -61.345  1.00 113.44 ? 147  ILE A O     1 
ATOM 1092  C CB    . ILE A 1 140 ? -104.748 -54.560 -60.269  1.00 112.54 ? 147  ILE A CB    1 
ATOM 1093  C CG1   . ILE A 1 140 ? -105.600 -54.946 -59.061  1.00 112.02 ? 147  ILE A CG1   1 
ATOM 1094  C CG2   . ILE A 1 140 ? -104.848 -55.671 -61.284  1.00 113.12 ? 147  ILE A CG2   1 
ATOM 1095  C CD1   . ILE A 1 140 ? -107.083 -55.155 -59.392  1.00 111.00 ? 147  ILE A CD1   1 
ATOM 1096  N N     . LYS A 1 141 ? -101.925 -54.865 -61.860  1.00 113.60 ? 148  LYS A N     1 
ATOM 1097  C CA    . LYS A 1 141 ? -100.981 -54.619 -62.960  1.00 114.23 ? 148  LYS A CA    1 
ATOM 1098  C C     . LYS A 1 141 ? -101.567 -54.827 -64.370  1.00 114.59 ? 148  LYS A C     1 
ATOM 1099  O O     . LYS A 1 141 ? -101.935 -55.942 -64.743  1.00 114.72 ? 148  LYS A O     1 
ATOM 1100  C CB    . LYS A 1 141 ? -99.755  -55.523 -62.780  1.00 114.35 ? 148  LYS A CB    1 
ATOM 1101  C CG    . LYS A 1 141 ? -98.664  -55.397 -63.852  1.00 114.93 ? 148  LYS A CG    1 
ATOM 1102  C CD    . LYS A 1 141 ? -97.509  -56.373 -63.592  1.00 116.09 ? 148  LYS A CD    1 
ATOM 1103  C CE    . LYS A 1 141 ? -96.586  -56.553 -64.803  1.00 116.77 ? 148  LYS A CE    1 
ATOM 1104  N NZ    . LYS A 1 141 ? -95.824  -55.322 -65.166  1.00 117.05 ? 148  LYS A NZ    1 
ATOM 1105  N N     . VAL A 1 142 ? -101.641 -53.755 -65.156  1.00 114.82 ? 149  VAL A N     1 
ATOM 1106  C CA    . VAL A 1 142 ? -102.055 -53.856 -66.548  1.00 115.22 ? 149  VAL A CA    1 
ATOM 1107  C C     . VAL A 1 142 ? -101.100 -54.794 -67.248  1.00 116.19 ? 149  VAL A C     1 
ATOM 1108  O O     . VAL A 1 142 ? -99.905  -54.705 -67.033  1.00 116.62 ? 149  VAL A O     1 
ATOM 1109  C CB    . VAL A 1 142 ? -102.008 -52.469 -67.244  1.00 115.02 ? 149  VAL A CB    1 
ATOM 1110  C CG1   . VAL A 1 142 ? -101.664 -52.569 -68.737  1.00 114.45 ? 149  VAL A CG1   1 
ATOM 1111  C CG2   . VAL A 1 142 ? -103.309 -51.737 -67.061  1.00 114.91 ? 149  VAL A CG2   1 
ATOM 1112  N N     . ILE A 1 143 ? -101.621 -55.728 -68.042  1.00 117.37 ? 150  ILE A N     1 
ATOM 1113  C CA    . ILE A 1 143 ? -100.831 -56.372 -69.111  1.00 118.12 ? 150  ILE A CA    1 
ATOM 1114  C C     . ILE A 1 143 ? -101.481 -56.203 -70.483  1.00 119.48 ? 150  ILE A C     1 
ATOM 1115  O O     . ILE A 1 143 ? -102.622 -55.775 -70.595  1.00 119.72 ? 150  ILE A O     1 
ATOM 1116  C CB    . ILE A 1 143 ? -100.479 -57.846 -68.842  1.00 117.49 ? 150  ILE A CB    1 
ATOM 1117  C CG1   . ILE A 1 143 ? -101.704 -58.720 -68.760  1.00 116.08 ? 150  ILE A CG1   1 
ATOM 1118  C CG2   . ILE A 1 143 ? -99.671  -57.967 -67.595  1.00 117.31 ? 150  ILE A CG2   1 
ATOM 1119  C CD1   . ILE A 1 143 ? -101.351 -60.144 -68.605  1.00 115.06 ? 150  ILE A CD1   1 
ATOM 1120  N N     . SER A 1 144 ? -100.742 -56.528 -71.526  1.00 121.26 ? 151  SER A N     1 
ATOM 1121  C CA    . SER A 1 144 ? -101.225 -56.324 -72.877  1.00 123.28 ? 151  SER A CA    1 
ATOM 1122  C C     . SER A 1 144 ? -101.836 -57.601 -73.442  1.00 124.63 ? 151  SER A C     1 
ATOM 1123  O O     . SER A 1 144 ? -102.697 -57.543 -74.320  1.00 124.88 ? 151  SER A O     1 
ATOM 1124  C CB    . SER A 1 144 ? -100.090 -55.816 -73.762  1.00 123.13 ? 151  SER A CB    1 
ATOM 1125  O OG    . SER A 1 144 ? -98.965  -56.666 -73.655  1.00 123.61 ? 151  SER A OG    1 
ATOM 1126  N N     . LYS A 1 145 ? -101.412 -58.737 -72.895  1.00 126.38 ? 152  LYS A N     1 
ATOM 1127  C CA    . LYS A 1 145 ? -101.775 -60.060 -73.384  1.00 128.39 ? 152  LYS A CA    1 
ATOM 1128  C C     . LYS A 1 145 ? -101.079 -61.111 -72.512  1.00 129.86 ? 152  LYS A C     1 
ATOM 1129  O O     . LYS A 1 145 ? -99.919  -60.936 -72.141  1.00 130.02 ? 152  LYS A O     1 
ATOM 1130  C CB    . LYS A 1 145 ? -101.332 -60.200 -74.849  1.00 128.59 ? 152  LYS A CB    1 
ATOM 1131  C CG    . LYS A 1 145 ? -101.398 -61.614 -75.443  1.00 129.38 ? 152  LYS A CG    1 
ATOM 1132  C CD    . LYS A 1 145 ? -101.011 -61.633 -76.916  1.00 130.30 ? 152  LYS A CD    1 
ATOM 1133  C CE    . LYS A 1 145 ? -102.049 -60.941 -77.772  1.00 130.34 ? 152  LYS A CE    1 
ATOM 1134  N NZ    . LYS A 1 145 ? -102.087 -61.596 -79.097  1.00 131.06 ? 152  LYS A NZ    1 
ATOM 1135  N N     . PRO A 1 146 ? -101.776 -62.203 -72.165  1.00 131.46 ? 153  PRO A N     1 
ATOM 1136  C CA    . PRO A 1 146 ? -101.113 -63.268 -71.420  1.00 133.12 ? 153  PRO A CA    1 
ATOM 1137  C C     . PRO A 1 146 ? -99.794  -63.660 -72.070  1.00 135.06 ? 153  PRO A C     1 
ATOM 1138  O O     . PRO A 1 146 ? -99.763  -64.089 -73.229  1.00 135.20 ? 153  PRO A O     1 
ATOM 1139  C CB    . PRO A 1 146 ? -102.112 -64.417 -71.493  1.00 132.82 ? 153  PRO A CB    1 
ATOM 1140  C CG    . PRO A 1 146 ? -103.423 -63.737 -71.526  1.00 132.27 ? 153  PRO A CG    1 
ATOM 1141  C CD    . PRO A 1 146 ? -103.220 -62.452 -72.295  1.00 131.59 ? 153  PRO A CD    1 
ATOM 1142  N N     . SER A 1 147 ? -98.714  -63.495 -71.312  1.00 137.35 ? 154  SER A N     1 
ATOM 1143  C CA    . SER A 1 147 ? -97.359  -63.638 -71.832  1.00 139.49 ? 154  SER A CA    1 
ATOM 1144  C C     . SER A 1 147 ? -96.812  -65.054 -71.732  1.00 141.01 ? 154  SER A C     1 
ATOM 1145  O O     . SER A 1 147 ? -96.397  -65.487 -70.659  1.00 141.18 ? 154  SER A O     1 
ATOM 1146  C CB    . SER A 1 147 ? -96.423  -62.654 -71.128  1.00 139.35 ? 154  SER A CB    1 
ATOM 1147  O OG    . SER A 1 147 ? -96.614  -61.342 -71.633  1.00 139.64 ? 154  SER A OG    1 
ATOM 1148  N N     . LYS A 1 148 ? -96.810  -65.753 -72.868  1.00 143.12 ? 155  LYS A N     1 
ATOM 1149  C CA    . LYS A 1 148 ? -96.235  -67.107 -73.003  1.00 145.25 ? 155  LYS A CA    1 
ATOM 1150  C C     . LYS A 1 148 ? -94.690  -67.073 -73.070  1.00 146.47 ? 155  LYS A C     1 
ATOM 1151  O O     . LYS A 1 148 ? -94.105  -66.993 -74.159  1.00 146.51 ? 155  LYS A O     1 
ATOM 1152  C CB    . LYS A 1 148 ? -96.820  -67.814 -74.244  1.00 145.30 ? 155  LYS A CB    1 
ATOM 1153  C CG    . LYS A 1 148 ? -98.337  -68.083 -74.185  1.00 145.82 ? 155  LYS A CG    1 
ATOM 1154  C CD    . LYS A 1 148 ? -99.046  -67.681 -75.488  1.00 145.64 ? 155  LYS A CD    1 
ATOM 1155  C CE    . LYS A 1 148 ? -100.571 -67.660 -75.327  1.00 144.58 ? 155  LYS A CE    1 
ATOM 1156  N NZ    . LYS A 1 148 ? -101.207 -66.615 -76.184  1.00 143.41 ? 155  LYS A NZ    1 
ATOM 1157  N N     . LYS A 1 149 ? -94.043  -67.130 -71.899  1.00 148.10 ? 156  LYS A N     1 
ATOM 1158  C CA    . LYS A 1 149 ? -92.583  -66.933 -71.773  1.00 149.58 ? 156  LYS A CA    1 
ATOM 1159  C C     . LYS A 1 149 ? -91.854  -68.122 -71.160  1.00 150.43 ? 156  LYS A C     1 
ATOM 1160  O O     . LYS A 1 149 ? -92.208  -68.597 -70.066  1.00 150.48 ? 156  LYS A O     1 
ATOM 1161  C CB    . LYS A 1 149 ? -92.246  -65.670 -70.957  1.00 149.69 ? 156  LYS A CB    1 
ATOM 1162  C CG    . LYS A 1 149 ? -93.023  -64.412 -71.356  1.00 150.87 ? 156  LYS A CG    1 
ATOM 1163  C CD    . LYS A 1 149 ? -92.877  -64.067 -72.847  1.00 152.36 ? 156  LYS A CD    1 
ATOM 1164  C CE    . LYS A 1 149 ? -94.214  -63.631 -73.431  1.00 153.12 ? 156  LYS A CE    1 
ATOM 1165  N NZ    . LYS A 1 149 ? -94.151  -63.108 -74.819  1.00 154.27 ? 156  LYS A NZ    1 
ATOM 1166  N N     . LYS A 1 150 ? -90.824  -68.581 -71.873  1.00 151.61 ? 157  LYS A N     1 
ATOM 1167  C CA    . LYS A 1 150 ? -89.957  -69.673 -71.417  1.00 152.65 ? 157  LYS A CA    1 
ATOM 1168  C C     . LYS A 1 150 ? -88.983  -69.171 -70.324  1.00 153.38 ? 157  LYS A C     1 
ATOM 1169  O O     . LYS A 1 150 ? -88.906  -67.963 -70.061  1.00 153.57 ? 157  LYS A O     1 
ATOM 1170  C CB    . LYS A 1 150 ? -89.222  -70.306 -72.610  1.00 152.56 ? 157  LYS A CB    1 
ATOM 1171  C CG    . LYS A 1 150 ? -89.012  -71.827 -72.525  1.00 152.23 ? 157  LYS A CG    1 
ATOM 1172  C CD    . LYS A 1 150 ? -90.105  -72.612 -73.247  1.00 150.91 ? 157  LYS A CD    1 
ATOM 1173  C CE    . LYS A 1 150 ? -89.529  -73.827 -73.977  1.00 150.04 ? 157  LYS A CE    1 
ATOM 1174  N NZ    . LYS A 1 150 ? -88.780  -74.760 -73.090  1.00 149.10 ? 157  LYS A NZ    1 
ATOM 1175  N N     . GLN A 1 151 ? -88.215  -70.100 -69.749  1.00 154.19 ? 158  GLN A N     1 
ATOM 1176  C CA    . GLN A 1 151 ? -87.643  -70.017 -68.377  1.00 154.93 ? 158  GLN A CA    1 
ATOM 1177  C C     . GLN A 1 151 ? -86.915  -68.777 -67.819  1.00 155.31 ? 158  GLN A C     1 
ATOM 1178  O O     . GLN A 1 151 ? -86.467  -68.799 -66.663  1.00 155.50 ? 158  GLN A O     1 
ATOM 1179  C CB    . GLN A 1 151 ? -86.805  -71.274 -68.088  1.00 154.94 ? 158  GLN A CB    1 
ATOM 1180  C CG    . GLN A 1 151 ? -86.873  -71.726 -66.633  1.00 155.06 ? 158  GLN A CG    1 
ATOM 1181  C CD    . GLN A 1 151 ? -87.173  -73.199 -66.504  1.00 155.64 ? 158  GLN A CD    1 
ATOM 1182  O OE1   . GLN A 1 151 ? -87.899  -73.771 -67.321  1.00 156.07 ? 158  GLN A OE1   1 
ATOM 1183  N NE2   . GLN A 1 151 ? -86.619  -73.828 -65.475  1.00 155.45 ? 158  GLN A NE2   1 
ATOM 1184  N N     . SER A 1 152 ? -86.817  -67.696 -68.592  1.00 155.55 ? 159  SER A N     1 
ATOM 1185  C CA    . SER A 1 152 ? -86.300  -66.433 -68.051  1.00 155.73 ? 159  SER A CA    1 
ATOM 1186  C C     . SER A 1 152 ? -87.294  -65.764 -67.061  1.00 155.72 ? 159  SER A C     1 
ATOM 1187  O O     . SER A 1 152 ? -88.328  -65.208 -67.463  1.00 155.86 ? 159  SER A O     1 
ATOM 1188  C CB    . SER A 1 152 ? -85.902  -65.488 -69.187  1.00 155.78 ? 159  SER A CB    1 
ATOM 1189  O OG    . SER A 1 152 ? -84.812  -64.662 -68.811  1.00 156.19 ? 159  SER A OG    1 
ATOM 1190  N N     . LEU A 1 153 ? -86.974  -65.844 -65.767  1.00 155.55 ? 160  LEU A N     1 
ATOM 1191  C CA    . LEU A 1 153 ? -87.806  -65.271 -64.692  1.00 155.26 ? 160  LEU A CA    1 
ATOM 1192  C C     . LEU A 1 153 ? -87.538  -63.754 -64.528  1.00 154.91 ? 160  LEU A C     1 
ATOM 1193  O O     . LEU A 1 153 ? -87.373  -63.250 -63.408  1.00 154.89 ? 160  LEU A O     1 
ATOM 1194  C CB    . LEU A 1 153 ? -87.568  -66.037 -63.365  1.00 155.33 ? 160  LEU A CB    1 
ATOM 1195  C CG    . LEU A 1 153 ? -88.234  -67.380 -62.992  1.00 154.89 ? 160  LEU A CG    1 
ATOM 1196  C CD1   . LEU A 1 153 ? -88.681  -68.222 -64.178  1.00 154.62 ? 160  LEU A CD1   1 
ATOM 1197  C CD2   . LEU A 1 153 ? -87.306  -68.189 -62.093  1.00 154.25 ? 160  LEU A CD2   1 
ATOM 1198  N N     . LYS A 1 154 ? -87.509  -63.043 -65.656  1.00 154.28 ? 161  LYS A N     1 
ATOM 1199  C CA    . LYS A 1 154 ? -87.135  -61.626 -65.692  1.00 153.65 ? 161  LYS A CA    1 
ATOM 1200  C C     . LYS A 1 154 ? -88.182  -60.676 -65.096  1.00 153.14 ? 161  LYS A C     1 
ATOM 1201  O O     . LYS A 1 154 ? -87.821  -59.780 -64.332  1.00 153.02 ? 161  LYS A O     1 
ATOM 1202  C CB    . LYS A 1 154 ? -86.735  -61.184 -67.116  1.00 153.85 ? 161  LYS A CB    1 
ATOM 1203  C CG    . LYS A 1 154 ? -87.874  -61.142 -68.169  1.00 153.70 ? 161  LYS A CG    1 
ATOM 1204  C CD    . LYS A 1 154 ? -87.358  -60.777 -69.561  1.00 153.13 ? 161  LYS A CD    1 
ATOM 1205  C CE    . LYS A 1 154 ? -86.651  -61.960 -70.210  1.00 152.81 ? 161  LYS A CE    1 
ATOM 1206  N NZ    . LYS A 1 154 ? -86.153  -61.677 -71.585  1.00 152.56 ? 161  LYS A NZ    1 
ATOM 1207  N N     . ASN A 1 155 ? -89.458  -60.862 -65.453  1.00 152.45 ? 162  ASN A N     1 
ATOM 1208  C CA    . ASN A 1 155 ? -90.549  -60.047 -64.891  1.00 151.68 ? 162  ASN A CA    1 
ATOM 1209  C C     . ASN A 1 155 ? -90.988  -60.539 -63.504  1.00 150.96 ? 162  ASN A C     1 
ATOM 1210  O O     . ASN A 1 155 ? -91.349  -59.722 -62.644  1.00 150.92 ? 162  ASN A O     1 
ATOM 1211  C CB    . ASN A 1 155 ? -91.747  -59.947 -65.853  1.00 151.79 ? 162  ASN A CB    1 
ATOM 1212  C CG    . ASN A 1 155 ? -92.639  -58.715 -65.576  1.00 152.06 ? 162  ASN A CG    1 
ATOM 1213  O OD1   . ASN A 1 155 ? -93.201  -58.560 -64.487  1.00 151.77 ? 162  ASN A OD1   1 
ATOM 1214  N ND2   . ASN A 1 155 ? -92.783  -57.851 -66.581  1.00 152.39 ? 162  ASN A ND2   1 
ATOM 1215  N N     . ALA A 1 156 ? -90.953  -61.862 -63.299  1.00 149.88 ? 163  ALA A N     1 
ATOM 1216  C CA    . ALA A 1 156 ? -91.168  -62.489 -61.985  1.00 148.77 ? 163  ALA A CA    1 
ATOM 1217  C C     . ALA A 1 156 ? -92.549  -62.212 -61.372  1.00 147.96 ? 163  ALA A C     1 
ATOM 1218  O O     . ALA A 1 156 ? -93.175  -63.112 -60.807  1.00 147.79 ? 163  ALA A O     1 
ATOM 1219  C CB    . ALA A 1 156 ? -90.044  -62.096 -61.009  1.00 148.85 ? 163  ALA A CB    1 
ATOM 1220  N N     . ASP A 1 157 ? -92.998  -60.959 -61.487  1.00 146.97 ? 164  ASP A N     1 
ATOM 1221  C CA    . ASP A 1 157 ? -94.326  -60.496 -61.052  1.00 145.99 ? 164  ASP A CA    1 
ATOM 1222  C C     . ASP A 1 157 ? -95.442  -61.298 -61.742  1.00 144.97 ? 164  ASP A C     1 
ATOM 1223  O O     . ASP A 1 157 ? -96.491  -61.563 -61.145  1.00 144.68 ? 164  ASP A O     1 
ATOM 1224  C CB    . ASP A 1 157 ? -94.475  -58.984 -61.358  1.00 146.30 ? 164  ASP A CB    1 
ATOM 1225  C CG    . ASP A 1 157 ? -95.219  -58.198 -60.253  1.00 146.61 ? 164  ASP A CG    1 
ATOM 1226  O OD1   . ASP A 1 157 ? -95.510  -58.771 -59.179  1.00 146.74 ? 164  ASP A OD1   1 
ATOM 1227  O OD2   . ASP A 1 157 ? -95.504  -56.990 -60.457  1.00 146.62 ? 164  ASP A OD2   1 
ATOM 1228  N N     . LEU A 1 158 ? -95.187  -61.685 -62.993  1.00 143.80 ? 165  LEU A N     1 
ATOM 1229  C CA    . LEU A 1 158 ? -96.133  -62.435 -63.818  1.00 142.49 ? 165  LEU A CA    1 
ATOM 1230  C C     . LEU A 1 158 ? -96.131  -63.928 -63.528  1.00 141.82 ? 165  LEU A C     1 
ATOM 1231  O O     . LEU A 1 158 ? -97.145  -64.582 -63.691  1.00 141.64 ? 165  LEU A O     1 
ATOM 1232  C CB    . LEU A 1 158 ? -95.866  -62.186 -65.304  1.00 142.28 ? 165  LEU A CB    1 
ATOM 1233  C CG    . LEU A 1 158 ? -96.181  -60.779 -65.835  1.00 142.04 ? 165  LEU A CG    1 
ATOM 1234  C CD1   . LEU A 1 158 ? -95.462  -60.459 -67.144  1.00 141.94 ? 165  LEU A CD1   1 
ATOM 1235  C CD2   . LEU A 1 158 ? -97.659  -60.599 -66.014  1.00 141.48 ? 165  LEU A CD2   1 
ATOM 1236  N N     . CYS A 1 159 ? -94.996  -64.465 -63.097  1.00 141.19 ? 166  CYS A N     1 
ATOM 1237  C CA    . CYS A 1 159 ? -94.893  -65.895 -62.807  1.00 140.57 ? 166  CYS A CA    1 
ATOM 1238  C C     . CYS A 1 159 ? -95.653  -66.232 -61.532  1.00 139.79 ? 166  CYS A C     1 
ATOM 1239  O O     . CYS A 1 159 ? -95.487  -65.555 -60.530  1.00 139.69 ? 166  CYS A O     1 
ATOM 1240  C CB    . CYS A 1 159 ? -93.426  -66.319 -62.701  1.00 140.64 ? 166  CYS A CB    1 
ATOM 1241  S SG    . CYS A 1 159 ? -92.375  -65.646 -64.010  1.00 141.61 ? 166  CYS A SG    1 
ATOM 1242  N N     . ILE A 1 160 ? -96.512  -67.248 -61.586  1.00 139.15 ? 167  ILE A N     1 
ATOM 1243  C CA    . ILE A 1 160 ? -97.239  -67.706 -60.405  1.00 138.70 ? 167  ILE A CA    1 
ATOM 1244  C C     . ILE A 1 160 ? -96.275  -68.480 -59.563  1.00 138.55 ? 167  ILE A C     1 
ATOM 1245  O O     . ILE A 1 160 ? -95.810  -69.534 -59.970  1.00 138.58 ? 167  ILE A O     1 
ATOM 1246  C CB    . ILE A 1 160 ? -98.447  -68.624 -60.727  1.00 138.65 ? 167  ILE A CB    1 
ATOM 1247  C CG1   . ILE A 1 160 ? -99.648  -67.810 -61.191  1.00 138.67 ? 167  ILE A CG1   1 
ATOM 1248  C CG2   . ILE A 1 160 ? -98.857  -69.447 -59.520  1.00 137.97 ? 167  ILE A CG2   1 
ATOM 1249  C CD1   . ILE A 1 160 ? -99.824  -67.810 -62.685  1.00 139.32 ? 167  ILE A CD1   1 
ATOM 1250  N N     . ALA A 1 161 ? -95.972  -67.931 -58.392  1.00 138.47 ? 168  ALA A N     1 
ATOM 1251  C CA    . ALA A 1 161 ? -95.030  -68.525 -57.451  1.00 138.22 ? 168  ALA A CA    1 
ATOM 1252  C C     . ALA A 1 161 ? -95.764  -69.524 -56.570  1.00 138.09 ? 168  ALA A C     1 
ATOM 1253  O O     . ALA A 1 161 ? -96.994  -69.564 -56.577  1.00 138.13 ? 168  ALA A O     1 
ATOM 1254  C CB    . ALA A 1 161 ? -94.383  -67.439 -56.611  1.00 138.25 ? 168  ALA A CB    1 
ATOM 1255  N N     . SER A 1 162 ? -95.017  -70.341 -55.826  1.00 137.84 ? 169  SER A N     1 
ATOM 1256  C CA    . SER A 1 162 ? -95.616  -71.298 -54.899  1.00 137.45 ? 169  SER A CA    1 
ATOM 1257  C C     . SER A 1 162 ? -96.350  -70.550 -53.804  1.00 137.23 ? 169  SER A C     1 
ATOM 1258  O O     . SER A 1 162 ? -96.207  -69.340 -53.686  1.00 137.23 ? 169  SER A O     1 
ATOM 1259  C CB    . SER A 1 162 ? -94.547  -72.189 -54.286  1.00 137.39 ? 169  SER A CB    1 
ATOM 1260  O OG    . SER A 1 162 ? -95.119  -72.951 -53.243  1.00 137.42 ? 169  SER A OG    1 
ATOM 1261  N N     . GLY A 1 163 ? -97.148  -71.259 -53.015  1.00 137.11 ? 170  GLY A N     1 
ATOM 1262  C CA    . GLY A 1 163 ? -97.853  -70.644 -51.885  1.00 137.05 ? 170  GLY A CA    1 
ATOM 1263  C C     . GLY A 1 163 ? -98.943  -69.608 -52.168  1.00 136.90 ? 170  GLY A C     1 
ATOM 1264  O O     . GLY A 1 163 ? -99.869  -69.478 -51.367  1.00 136.92 ? 170  GLY A O     1 
ATOM 1265  N N     . THR A 1 164 ? -98.847  -68.870 -53.282  1.00 136.67 ? 171  THR A N     1 
ATOM 1266  C CA    . THR A 1 164 ? -99.815  -67.807 -53.586  1.00 136.51 ? 171  THR A CA    1 
ATOM 1267  C C     . THR A 1 164 ? -101.211 -68.383 -53.814  1.00 136.70 ? 171  THR A C     1 
ATOM 1268  O O     . THR A 1 164 ? -101.354 -69.469 -54.370  1.00 136.69 ? 171  THR A O     1 
ATOM 1269  C CB    . THR A 1 164 ? -99.418  -66.901 -54.811  1.00 136.46 ? 171  THR A CB    1 
ATOM 1270  O OG1   . THR A 1 164 ? -100.189 -67.248 -55.968  1.00 136.11 ? 171  THR A OG1   1 
ATOM 1271  C CG2   . THR A 1 164 ? -97.936  -66.960 -55.133  1.00 136.05 ? 171  THR A CG2   1 
ATOM 1272  N N     . LYS A 1 165 ? -102.237 -67.664 -53.367  1.00 136.81 ? 172  LYS A N     1 
ATOM 1273  C CA    . LYS A 1 165 ? -103.601 -68.052 -53.679  1.00 136.69 ? 172  LYS A CA    1 
ATOM 1274  C C     . LYS A 1 165 ? -103.926 -67.677 -55.128  1.00 136.71 ? 172  LYS A C     1 
ATOM 1275  O O     . LYS A 1 165 ? -103.548 -66.607 -55.615  1.00 136.46 ? 172  LYS A O     1 
ATOM 1276  C CB    . LYS A 1 165 ? -104.623 -67.500 -52.665  1.00 136.70 ? 172  LYS A CB    1 
ATOM 1277  C CG    . LYS A 1 165 ? -104.716 -65.980 -52.517  1.00 137.00 ? 172  LYS A CG    1 
ATOM 1278  C CD    . LYS A 1 165 ? -104.141 -65.467 -51.197  1.00 137.02 ? 172  LYS A CD    1 
ATOM 1279  C CE    . LYS A 1 165 ? -104.436 -63.970 -51.016  1.00 136.39 ? 172  LYS A CE    1 
ATOM 1280  N NZ    . LYS A 1 165 ? -103.768 -63.366 -49.823  1.00 135.26 ? 172  LYS A NZ    1 
ATOM 1281  N N     . VAL A 1 166 ? -104.580 -68.599 -55.824  1.00 136.87 ? 173  VAL A N     1 
ATOM 1282  C CA    . VAL A 1 166 ? -104.971 -68.405 -57.217  1.00 136.93 ? 173  VAL A CA    1 
ATOM 1283  C C     . VAL A 1 166 ? -106.405 -68.876 -57.433  1.00 137.16 ? 173  VAL A C     1 
ATOM 1284  O O     . VAL A 1 166 ? -106.877 -69.808 -56.778  1.00 136.93 ? 173  VAL A O     1 
ATOM 1285  C CB    . VAL A 1 166 ? -104.012 -69.113 -58.224  1.00 136.73 ? 173  VAL A CB    1 
ATOM 1286  C CG1   . VAL A 1 166 ? -102.578 -68.657 -58.025  1.00 136.60 ? 173  VAL A CG1   1 
ATOM 1287  C CG2   . VAL A 1 166 ? -104.105 -70.623 -58.112  1.00 136.59 ? 173  VAL A CG2   1 
ATOM 1288  N N     . ALA A 1 167 ? -107.093 -68.203 -58.343  1.00 137.61 ? 174  ALA A N     1 
ATOM 1289  C CA    . ALA A 1 167 ? -108.423 -68.589 -58.740  1.00 138.19 ? 174  ALA A CA    1 
ATOM 1290  C C     . ALA A 1 167 ? -108.324 -68.940 -60.190  1.00 138.80 ? 174  ALA A C     1 
ATOM 1291  O O     . ALA A 1 167 ? -107.637 -68.253 -60.941  1.00 138.95 ? 174  ALA A O     1 
ATOM 1292  C CB    . ALA A 1 167 ? -109.362 -67.452 -58.563  1.00 138.23 ? 174  ALA A CB    1 
ATOM 1293  N N     . LEU A 1 168 ? -108.998 -70.020 -60.575  1.00 139.58 ? 175  LEU A N     1 
ATOM 1294  C CA    . LEU A 1 168 ? -109.032 -70.484 -61.967  1.00 140.12 ? 175  LEU A CA    1 
ATOM 1295  C C     . LEU A 1 168 ? -110.461 -70.651 -62.499  1.00 140.85 ? 175  LEU A C     1 
ATOM 1296  O O     . LEU A 1 168 ? -111.341 -71.179 -61.819  1.00 140.69 ? 175  LEU A O     1 
ATOM 1297  C CB    . LEU A 1 168 ? -108.197 -71.753 -62.160  1.00 139.69 ? 175  LEU A CB    1 
ATOM 1298  C CG    . LEU A 1 168 ? -107.978 -72.649 -60.945  1.00 139.10 ? 175  LEU A CG    1 
ATOM 1299  C CD1   . LEU A 1 168 ? -109.190 -73.492 -60.629  1.00 138.42 ? 175  LEU A CD1   1 
ATOM 1300  C CD2   . LEU A 1 168 ? -106.791 -73.530 -61.173  1.00 138.72 ? 175  LEU A CD2   1 
ATOM 1301  N N     . PHE A 1 169 ? -110.671 -70.179 -63.723  1.00 141.98 ? 176  PHE A N     1 
ATOM 1302  C CA    . PHE A 1 169 ? -111.988 -70.137 -64.331  1.00 143.09 ? 176  PHE A CA    1 
ATOM 1303  C C     . PHE A 1 169 ? -112.056 -70.884 -65.657  1.00 144.41 ? 176  PHE A C     1 
ATOM 1304  O O     . PHE A 1 169 ? -111.042 -71.053 -66.342  1.00 144.59 ? 176  PHE A O     1 
ATOM 1305  C CB    . PHE A 1 169 ? -112.456 -68.689 -64.508  1.00 142.66 ? 176  PHE A CB    1 
ATOM 1306  C CG    . PHE A 1 169 ? -111.688 -67.895 -65.534  1.00 141.46 ? 176  PHE A CG    1 
ATOM 1307  C CD1   . PHE A 1 169 ? -111.937 -68.045 -66.885  1.00 140.66 ? 176  PHE A CD1   1 
ATOM 1308  C CD2   . PHE A 1 169 ? -110.765 -66.951 -65.142  1.00 140.50 ? 176  PHE A CD2   1 
ATOM 1309  C CE1   . PHE A 1 169 ? -111.255 -67.296 -67.823  1.00 140.59 ? 176  PHE A CE1   1 
ATOM 1310  C CE2   . PHE A 1 169 ? -110.080 -66.202 -66.077  1.00 140.40 ? 176  PHE A CE2   1 
ATOM 1311  C CZ    . PHE A 1 169 ? -110.329 -66.373 -67.420  1.00 140.35 ? 176  PHE A CZ    1 
ATOM 1312  N N     . ASN A 1 170 ? -113.265 -71.321 -66.007  1.00 146.03 ? 177  ASN A N     1 
ATOM 1313  C CA    . ASN A 1 170 ? -113.527 -71.961 -67.292  1.00 147.52 ? 177  ASN A CA    1 
ATOM 1314  C C     . ASN A 1 170 ? -114.599 -71.281 -68.140  1.00 148.44 ? 177  ASN A C     1 
ATOM 1315  O O     . ASN A 1 170 ? -115.742 -71.127 -67.720  1.00 148.62 ? 177  ASN A O     1 
ATOM 1316  C CB    . ASN A 1 170 ? -113.891 -73.422 -67.123  1.00 147.51 ? 177  ASN A CB    1 
ATOM 1317  C CG    . ASN A 1 170 ? -114.200 -74.066 -68.433  1.00 148.07 ? 177  ASN A CG    1 
ATOM 1318  O OD1   . ASN A 1 170 ? -115.356 -74.200 -68.804  1.00 148.57 ? 177  ASN A OD1   1 
ATOM 1319  N ND2   . ASN A 1 170 ? -113.163 -74.412 -69.178  1.00 148.98 ? 177  ASN A ND2   1 
ATOM 1320  N N     . ARG A 1 171 ? -114.202 -70.895 -69.343  1.00 149.66 ? 178  ARG A N     1 
ATOM 1321  C CA    . ARG A 1 171 ? -115.075 -70.278 -70.315  1.00 151.08 ? 178  ARG A CA    1 
ATOM 1322  C C     . ARG A 1 171 ? -114.928 -71.161 -71.534  1.00 151.69 ? 178  ARG A C     1 
ATOM 1323  O O     . ARG A 1 171 ? -113.890 -71.791 -71.694  1.00 151.89 ? 178  ARG A O     1 
ATOM 1324  C CB    . ARG A 1 171 ? -114.629 -68.840 -70.616  1.00 151.28 ? 178  ARG A CB    1 
ATOM 1325  C CG    . ARG A 1 171 ? -114.477 -67.902 -69.363  1.00 153.28 ? 178  ARG A CG    1 
ATOM 1326  C CD    . ARG A 1 171 ? -114.103 -66.429 -69.683  1.00 155.64 ? 178  ARG A CD    1 
ATOM 1327  N NE    . ARG A 1 171 ? -113.626 -66.364 -71.049  1.00 158.39 ? 178  ARG A NE    1 
ATOM 1328  C CZ    . ARG A 1 171 ? -114.433 -66.210 -72.091  1.00 160.29 ? 178  ARG A CZ    1 
ATOM 1329  N NH1   . ARG A 1 171 ? -113.940 -66.217 -73.310  1.00 161.12 ? 178  ARG A NH1   1 
ATOM 1330  N NH2   . ARG A 1 171 ? -115.741 -66.050 -71.918  1.00 161.58 ? 178  ARG A NH2   1 
ATOM 1331  N N     . LEU A 1 172 ? -115.957 -71.229 -72.379  1.00 152.64 ? 179  LEU A N     1 
ATOM 1332  C CA    . LEU A 1 172 ? -116.012 -72.232 -73.458  1.00 153.16 ? 179  LEU A CA    1 
ATOM 1333  C C     . LEU A 1 172 ? -116.249 -71.703 -74.870  1.00 153.44 ? 179  LEU A C     1 
ATOM 1334  O O     . LEU A 1 172 ? -117.060 -70.802 -75.106  1.00 153.15 ? 179  LEU A O     1 
ATOM 1335  C CB    . LEU A 1 172 ? -117.043 -73.328 -73.151  1.00 153.20 ? 179  LEU A CB    1 
ATOM 1336  C CG    . LEU A 1 172 ? -116.923 -74.128 -71.848  1.00 153.76 ? 179  LEU A CG    1 
ATOM 1337  C CD1   . LEU A 1 172 ? -117.793 -73.530 -70.733  1.00 154.18 ? 179  LEU A CD1   1 
ATOM 1338  C CD2   . LEU A 1 172 ? -117.288 -75.593 -72.078  1.00 154.16 ? 179  LEU A CD2   1 
ATOM 1339  N N     . ARG A 1 173 ? -115.510 -72.307 -75.794  1.00 154.15 ? 180  ARG A N     1 
ATOM 1340  C CA    . ARG A 1 173 ? -115.647 -72.120 -77.242  1.00 154.91 ? 180  ARG A CA    1 
ATOM 1341  C C     . ARG A 1 173 ? -115.486 -70.670 -77.708  1.00 155.02 ? 180  ARG A C     1 
ATOM 1342  O O     . ARG A 1 173 ? -115.455 -70.408 -78.910  1.00 155.11 ? 180  ARG A O     1 
ATOM 1343  C CB    . ARG A 1 173 ? -116.946 -72.767 -77.760  1.00 155.18 ? 180  ARG A CB    1 
ATOM 1344  C CG    . ARG A 1 173 ? -116.819 -73.494 -79.116  1.00 155.94 ? 180  ARG A CG    1 
ATOM 1345  C CD    . ARG A 1 173 ? -117.959 -74.495 -79.373  1.00 157.06 ? 180  ARG A CD    1 
ATOM 1346  N NE    . ARG A 1 173 ? -119.286 -73.949 -79.068  1.00 158.47 ? 180  ARG A NE    1 
ATOM 1347  C CZ    . ARG A 1 173 ? -120.106 -74.430 -78.132  1.00 159.10 ? 180  ARG A CZ    1 
ATOM 1348  N NH1   . ARG A 1 173 ? -119.754 -75.487 -77.410  1.00 159.53 ? 180  ARG A NH1   1 
ATOM 1349  N NH2   . ARG A 1 173 ? -121.288 -73.861 -77.926  1.00 159.03 ? 180  ARG A NH2   1 
ATOM 1350  N N     . SER A 1 174 ? -115.357 -69.752 -76.748  1.00 155.15 ? 181  SER A N     1 
ATOM 1351  C CA    . SER A 1 174 ? -115.039 -68.329 -76.980  1.00 155.25 ? 181  SER A CA    1 
ATOM 1352  C C     . SER A 1 174 ? -116.261 -67.425 -76.782  1.00 155.35 ? 181  SER A C     1 
ATOM 1353  O O     . SER A 1 174 ? -116.377 -66.365 -77.405  1.00 155.36 ? 181  SER A O     1 
ATOM 1354  C CB    . SER A 1 174 ? -114.347 -68.095 -78.342  1.00 155.19 ? 181  SER A CB    1 
ATOM 1355  O OG    . SER A 1 174 ? -113.865 -66.771 -78.473  1.00 154.83 ? 181  SER A OG    1 
ATOM 1356  N N     . GLN A 1 175 ? -117.155 -67.839 -75.887  1.00 155.41 ? 182  GLN A N     1 
ATOM 1357  C CA    . GLN A 1 175 ? -118.351 -67.045 -75.618  1.00 155.41 ? 182  GLN A CA    1 
ATOM 1358  C C     . GLN A 1 175 ? -118.496 -66.489 -74.190  1.00 155.30 ? 182  GLN A C     1 
ATOM 1359  O O     . GLN A 1 175 ? -118.594 -67.235 -73.208  1.00 155.25 ? 182  GLN A O     1 
ATOM 1360  C CB    . GLN A 1 175 ? -119.626 -67.765 -76.086  1.00 155.36 ? 182  GLN A CB    1 
ATOM 1361  C CG    . GLN A 1 175 ? -120.638 -66.802 -76.686  1.00 155.25 ? 182  GLN A CG    1 
ATOM 1362  C CD    . GLN A 1 175 ? -119.995 -65.831 -77.675  1.00 155.32 ? 182  GLN A CD    1 
ATOM 1363  O OE1   . GLN A 1 175 ? -119.251 -66.244 -78.577  1.00 154.67 ? 182  GLN A OE1   1 
ATOM 1364  N NE2   . GLN A 1 175 ? -120.270 -64.533 -77.502  1.00 155.63 ? 182  GLN A NE2   1 
ATOM 1365  N N     . THR A 1 176 ? -118.528 -65.158 -74.130  1.00 155.09 ? 183  THR A N     1 
ATOM 1366  C CA    . THR A 1 176 ? -118.660 -64.336 -72.910  1.00 154.82 ? 183  THR A CA    1 
ATOM 1367  C C     . THR A 1 176 ? -119.499 -64.857 -71.729  1.00 154.43 ? 183  THR A C     1 
ATOM 1368  O O     . THR A 1 176 ? -119.116 -64.688 -70.572  1.00 154.30 ? 183  THR A O     1 
ATOM 1369  C CB    . THR A 1 176 ? -119.154 -62.887 -73.274  1.00 154.98 ? 183  THR A CB    1 
ATOM 1370  O OG1   . THR A 1 176 ? -119.571 -62.203 -72.085  1.00 155.21 ? 183  THR A OG1   1 
ATOM 1371  C CG2   . THR A 1 176 ? -120.319 -62.897 -74.314  1.00 154.86 ? 183  THR A CG2   1 
ATOM 1372  N N     . VAL A 1 177 ? -120.631 -65.483 -72.035  1.00 154.06 ? 184  VAL A N     1 
ATOM 1373  C CA    . VAL A 1 177 ? -121.671 -65.783 -71.044  1.00 153.46 ? 184  VAL A CA    1 
ATOM 1374  C C     . VAL A 1 177 ? -121.474 -67.075 -70.236  1.00 153.16 ? 184  VAL A C     1 
ATOM 1375  O O     . VAL A 1 177 ? -121.944 -67.171 -69.099  1.00 152.99 ? 184  VAL A O     1 
ATOM 1376  C CB    . VAL A 1 177 ? -123.079 -65.772 -71.702  1.00 153.40 ? 184  VAL A CB    1 
ATOM 1377  C CG1   . VAL A 1 177 ? -123.589 -64.341 -71.861  1.00 152.80 ? 184  VAL A CG1   1 
ATOM 1378  C CG2   . VAL A 1 177 ? -123.050 -66.491 -73.048  1.00 153.06 ? 184  VAL A CG2   1 
ATOM 1379  N N     . SER A 1 178 ? -120.775 -68.047 -70.821  1.00 152.79 ? 185  SER A N     1 
ATOM 1380  C CA    . SER A 1 178 ? -120.619 -69.393 -70.242  1.00 152.39 ? 185  SER A CA    1 
ATOM 1381  C C     . SER A 1 178 ? -119.807 -69.448 -68.948  1.00 152.15 ? 185  SER A C     1 
ATOM 1382  O O     . SER A 1 178 ? -120.057 -70.301 -68.094  1.00 152.08 ? 185  SER A O     1 
ATOM 1383  C CB    . SER A 1 178 ? -119.980 -70.329 -71.263  1.00 152.34 ? 185  SER A CB    1 
ATOM 1384  O OG    . SER A 1 178 ? -118.698 -69.862 -71.624  1.00 151.90 ? 185  SER A OG    1 
ATOM 1385  N N     . THR A 1 179 ? -118.839 -68.535 -68.842  1.00 151.82 ? 186  THR A N     1 
ATOM 1386  C CA    . THR A 1 179 ? -117.878 -68.412 -67.735  1.00 151.26 ? 186  THR A CA    1 
ATOM 1387  C C     . THR A 1 179 ? -118.333 -69.041 -66.423  1.00 151.13 ? 186  THR A C     1 
ATOM 1388  O O     . THR A 1 179 ? -119.349 -68.650 -65.855  1.00 151.12 ? 186  THR A O     1 
ATOM 1389  C CB    . THR A 1 179 ? -117.519 -66.925 -67.489  1.00 151.17 ? 186  THR A CB    1 
ATOM 1390  O OG1   . THR A 1 179 ? -117.329 -66.254 -68.738  1.00 150.91 ? 186  THR A OG1   1 
ATOM 1391  C CG2   . THR A 1 179 ? -116.260 -66.800 -66.701  1.00 151.19 ? 186  THR A CG2   1 
ATOM 1392  N N     . ARG A 1 180 ? -117.573 -70.024 -65.957  1.00 151.01 ? 187  ARG A N     1 
ATOM 1393  C CA    . ARG A 1 180 ? -117.857 -70.714 -64.698  1.00 151.09 ? 187  ARG A CA    1 
ATOM 1394  C C     . ARG A 1 180 ? -116.540 -70.979 -63.953  1.00 150.88 ? 187  ARG A C     1 
ATOM 1395  O O     . ARG A 1 180 ? -115.591 -71.474 -64.550  1.00 150.84 ? 187  ARG A O     1 
ATOM 1396  C CB    . ARG A 1 180 ? -118.646 -72.012 -64.956  1.00 151.24 ? 187  ARG A CB    1 
ATOM 1397  C CG    . ARG A 1 180 ? -120.026 -71.803 -65.620  1.00 152.20 ? 187  ARG A CG    1 
ATOM 1398  C CD    . ARG A 1 180 ? -120.764 -73.102 -65.954  1.00 154.17 ? 187  ARG A CD    1 
ATOM 1399  N NE    . ARG A 1 180 ? -121.503 -73.635 -64.802  1.00 155.82 ? 187  ARG A NE    1 
ATOM 1400  C CZ    . ARG A 1 180 ? -122.186 -74.784 -64.784  1.00 156.22 ? 187  ARG A CZ    1 
ATOM 1401  N NH1   . ARG A 1 180 ? -122.244 -75.563 -65.864  1.00 156.24 ? 187  ARG A NH1   1 
ATOM 1402  N NH2   . ARG A 1 180 ? -122.815 -75.157 -63.671  1.00 155.80 ? 187  ARG A NH2   1 
ATOM 1403  N N     . TYR A 1 181 ? -116.484 -70.635 -62.662  1.00 150.77 ? 188  TYR A N     1 
ATOM 1404  C CA    . TYR A 1 181 ? -115.240 -70.673 -61.870  1.00 150.58 ? 188  TYR A CA    1 
ATOM 1405  C C     . TYR A 1 181 ? -115.264 -71.749 -60.805  1.00 151.10 ? 188  TYR A C     1 
ATOM 1406  O O     . TYR A 1 181 ? -116.266 -71.923 -60.130  1.00 150.97 ? 188  TYR A O     1 
ATOM 1407  C CB    . TYR A 1 181 ? -114.993 -69.342 -61.154  1.00 150.13 ? 188  TYR A CB    1 
ATOM 1408  C CG    . TYR A 1 181 ? -115.451 -68.110 -61.889  1.00 148.47 ? 188  TYR A CG    1 
ATOM 1409  C CD1   . TYR A 1 181 ? -116.649 -67.478 -61.553  1.00 147.44 ? 188  TYR A CD1   1 
ATOM 1410  C CD2   . TYR A 1 181 ? -114.687 -67.567 -62.910  1.00 146.77 ? 188  TYR A CD2   1 
ATOM 1411  C CE1   . TYR A 1 181 ? -117.077 -66.338 -62.235  1.00 146.55 ? 188  TYR A CE1   1 
ATOM 1412  C CE2   . TYR A 1 181 ? -115.100 -66.432 -63.593  1.00 145.84 ? 188  TYR A CE2   1 
ATOM 1413  C CZ    . TYR A 1 181 ? -116.294 -65.821 -63.257  1.00 145.92 ? 188  TYR A CZ    1 
ATOM 1414  O OH    . TYR A 1 181 ? -116.695 -64.696 -63.947  1.00 145.26 ? 188  TYR A OH    1 
ATOM 1415  N N     . LEU A 1 182 ? -114.143 -72.438 -60.622  1.00 152.01 ? 189  LEU A N     1 
ATOM 1416  C CA    . LEU A 1 182 ? -114.070 -73.470 -59.603  1.00 153.08 ? 189  LEU A CA    1 
ATOM 1417  C C     . LEU A 1 182 ? -114.361 -72.833 -58.265  1.00 154.01 ? 189  LEU A C     1 
ATOM 1418  O O     . LEU A 1 182 ? -113.542 -72.098 -57.729  1.00 154.04 ? 189  LEU A O     1 
ATOM 1419  C CB    . LEU A 1 182 ? -112.698 -74.152 -59.569  1.00 152.89 ? 189  LEU A CB    1 
ATOM 1420  C CG    . LEU A 1 182 ? -112.533 -75.597 -59.058  1.00 152.37 ? 189  LEU A CG    1 
ATOM 1421  C CD1   . LEU A 1 182 ? -111.120 -75.805 -58.582  1.00 151.92 ? 189  LEU A CD1   1 
ATOM 1422  C CD2   . LEU A 1 182 ? -113.478 -75.995 -57.945  1.00 152.36 ? 189  LEU A CD2   1 
ATOM 1423  N N     . HIS A 1 183 ? -115.551 -73.108 -57.750  1.00 155.31 ? 190  HIS A N     1 
ATOM 1424  C CA    . HIS A 1 183 ? -115.931 -72.677 -56.422  1.00 156.71 ? 190  HIS A CA    1 
ATOM 1425  C C     . HIS A 1 183 ? -116.400 -73.861 -55.588  1.00 157.74 ? 190  HIS A C     1 
ATOM 1426  O O     . HIS A 1 183 ? -116.734 -74.919 -56.119  1.00 157.65 ? 190  HIS A O     1 
ATOM 1427  C CB    . HIS A 1 183 ? -117.015 -71.593 -56.485  1.00 156.68 ? 190  HIS A CB    1 
ATOM 1428  C CG    . HIS A 1 183 ? -117.439 -71.086 -55.140  1.00 156.73 ? 190  HIS A CG    1 
ATOM 1429  N ND1   . HIS A 1 183 ? -118.729 -71.209 -54.673  1.00 156.33 ? 190  HIS A ND1   1 
ATOM 1430  C CD2   . HIS A 1 183 ? -116.737 -70.483 -54.151  1.00 156.67 ? 190  HIS A CD2   1 
ATOM 1431  C CE1   . HIS A 1 183 ? -118.808 -70.686 -53.463  1.00 156.50 ? 190  HIS A CE1   1 
ATOM 1432  N NE2   . HIS A 1 183 ? -117.612 -70.243 -53.120  1.00 156.78 ? 190  HIS A NE2   1 
ATOM 1433  N N     . VAL A 1 184 ? -116.408 -73.662 -54.274  1.00 159.28 ? 191  VAL A N     1 
ATOM 1434  C CA    . VAL A 1 184 ? -116.845 -74.661 -53.308  1.00 160.70 ? 191  VAL A CA    1 
ATOM 1435  C C     . VAL A 1 184 ? -118.194 -74.279 -52.679  1.00 161.72 ? 191  VAL A C     1 
ATOM 1436  O O     . VAL A 1 184 ? -118.296 -73.263 -51.985  1.00 161.98 ? 191  VAL A O     1 
ATOM 1437  C CB    . VAL A 1 184 ? -115.780 -74.856 -52.196  1.00 160.68 ? 191  VAL A CB    1 
ATOM 1438  C CG1   . VAL A 1 184 ? -114.692 -75.805 -52.660  1.00 160.62 ? 191  VAL A CG1   1 
ATOM 1439  C CG2   . VAL A 1 184 ? -115.170 -73.508 -51.770  1.00 160.76 ? 191  VAL A CG2   1 
ATOM 1440  N N     . GLU A 1 185 ? -119.223 -75.088 -52.941  1.00 162.91 ? 192  GLU A N     1 
ATOM 1441  C CA    . GLU A 1 185 ? -120.543 -74.926 -52.304  1.00 163.83 ? 192  GLU A CA    1 
ATOM 1442  C C     . GLU A 1 185 ? -120.733 -75.849 -51.087  1.00 164.45 ? 192  GLU A C     1 
ATOM 1443  O O     . GLU A 1 185 ? -121.189 -76.995 -51.213  1.00 164.29 ? 192  GLU A O     1 
ATOM 1444  C CB    . GLU A 1 185 ? -121.690 -75.086 -53.319  1.00 163.75 ? 192  GLU A CB    1 
ATOM 1445  C CG    . GLU A 1 185 ? -122.029 -73.792 -54.069  1.00 163.88 ? 192  GLU A CG    1 
ATOM 1446  C CD    . GLU A 1 185 ? -123.516 -73.635 -54.416  1.00 163.95 ? 192  GLU A CD    1 
ATOM 1447  O OE1   . GLU A 1 185 ? -123.856 -72.651 -55.121  1.00 163.44 ? 192  GLU A OE1   1 
ATOM 1448  O OE2   . GLU A 1 185 ? -124.342 -74.479 -53.988  1.00 164.19 ? 192  GLU A OE2   1 
ATOM 1449  N N     . GLY A 1 186 ? -120.354 -75.331 -49.918  1.00 165.30 ? 193  GLY A N     1 
ATOM 1450  C CA    . GLY A 1 186 ? -120.507 -76.031 -48.638  1.00 166.47 ? 193  GLY A CA    1 
ATOM 1451  C C     . GLY A 1 186 ? -119.461 -77.095 -48.331  1.00 167.26 ? 193  GLY A C     1 
ATOM 1452  O O     . GLY A 1 186 ? -119.176 -77.383 -47.159  1.00 167.39 ? 193  GLY A O     1 
ATOM 1453  N N     . GLY A 1 187 ? -118.891 -77.677 -49.384  1.00 167.85 ? 194  GLY A N     1 
ATOM 1454  C CA    . GLY A 1 187 ? -117.960 -78.803 -49.268  1.00 168.41 ? 194  GLY A CA    1 
ATOM 1455  C C     . GLY A 1 187 ? -117.907 -79.610 -50.557  1.00 168.76 ? 194  GLY A C     1 
ATOM 1456  O O     . GLY A 1 187 ? -117.084 -80.519 -50.693  1.00 168.78 ? 194  GLY A O     1 
ATOM 1457  N N     . ASN A 1 188 ? -118.791 -79.272 -51.500  1.00 169.05 ? 195  ASN A N     1 
ATOM 1458  C CA    . ASN A 1 188 ? -118.810 -79.901 -52.822  1.00 169.33 ? 195  ASN A CA    1 
ATOM 1459  C C     . ASN A 1 188 ? -118.491 -78.968 -53.990  1.00 169.65 ? 195  ASN A C     1 
ATOM 1460  O O     . ASN A 1 188 ? -119.327 -78.169 -54.428  1.00 169.68 ? 195  ASN A O     1 
ATOM 1461  C CB    . ASN A 1 188 ? -120.122 -80.643 -53.062  1.00 169.22 ? 195  ASN A CB    1 
ATOM 1462  C CG    . ASN A 1 188 ? -119.982 -82.137 -52.880  1.00 169.03 ? 195  ASN A CG    1 
ATOM 1463  O OD1   . ASN A 1 188 ? -118.942 -82.632 -52.440  1.00 168.61 ? 195  ASN A OD1   1 
ATOM 1464  N ND2   . ASN A 1 188 ? -121.030 -82.870 -53.226  1.00 168.95 ? 195  ASN A ND2   1 
ATOM 1465  N N     . PHE A 1 189 ? -117.262 -79.101 -54.482  1.00 169.97 ? 196  PHE A N     1 
ATOM 1466  C CA    . PHE A 1 189 ? -116.721 -78.327 -55.600  1.00 170.30 ? 196  PHE A CA    1 
ATOM 1467  C C     . PHE A 1 189 ? -117.697 -78.269 -56.775  1.00 170.11 ? 196  PHE A C     1 
ATOM 1468  O O     . PHE A 1 189 ? -118.225 -79.297 -57.195  1.00 170.28 ? 196  PHE A O     1 
ATOM 1469  C CB    . PHE A 1 189 ? -115.388 -78.948 -56.065  1.00 170.54 ? 196  PHE A CB    1 
ATOM 1470  C CG    . PHE A 1 189 ? -114.454 -79.338 -54.934  1.00 171.67 ? 196  PHE A CG    1 
ATOM 1471  C CD1   . PHE A 1 189 ? -114.626 -80.545 -54.240  1.00 172.62 ? 196  PHE A CD1   1 
ATOM 1472  C CD2   . PHE A 1 189 ? -113.395 -78.508 -54.575  1.00 172.54 ? 196  PHE A CD2   1 
ATOM 1473  C CE1   . PHE A 1 189 ? -113.767 -80.907 -53.192  1.00 172.96 ? 196  PHE A CE1   1 
ATOM 1474  C CE2   . PHE A 1 189 ? -112.532 -78.859 -53.528  1.00 173.13 ? 196  PHE A CE2   1 
ATOM 1475  C CZ    . PHE A 1 189 ? -112.719 -80.063 -52.837  1.00 173.17 ? 196  PHE A CZ    1 
ATOM 1476  N N     . HIS A 1 190 ? -117.944 -77.067 -57.292  1.00 169.87 ? 197  HIS A N     1 
ATOM 1477  C CA    . HIS A 1 190 ? -118.801 -76.896 -58.472  1.00 169.58 ? 197  HIS A CA    1 
ATOM 1478  C C     . HIS A 1 190 ? -118.231 -75.832 -59.414  1.00 169.01 ? 197  HIS A C     1 
ATOM 1479  O O     . HIS A 1 190 ? -117.051 -75.498 -59.320  1.00 168.87 ? 197  HIS A O     1 
ATOM 1480  C CB    . HIS A 1 190 ? -120.258 -76.605 -58.059  1.00 169.88 ? 197  HIS A CB    1 
ATOM 1481  C CG    . HIS A 1 190 ? -120.534 -75.171 -57.711  1.00 170.71 ? 197  HIS A CG    1 
ATOM 1482  N ND1   . HIS A 1 190 ? -121.667 -74.513 -58.139  1.00 171.20 ? 197  HIS A ND1   1 
ATOM 1483  C CD2   . HIS A 1 190 ? -119.827 -74.268 -56.988  1.00 171.49 ? 197  HIS A CD2   1 
ATOM 1484  C CE1   . HIS A 1 190 ? -121.650 -73.270 -57.690  1.00 171.40 ? 197  HIS A CE1   1 
ATOM 1485  N NE2   . HIS A 1 190 ? -120.539 -73.092 -56.997  1.00 171.62 ? 197  HIS A NE2   1 
ATOM 1486  N N     . ALA A 1 191 ? -119.059 -75.311 -60.317  1.00 168.47 ? 198  ALA A N     1 
ATOM 1487  C CA    . ALA A 1 191 ? -118.640 -74.241 -61.219  1.00 168.00 ? 198  ALA A CA    1 
ATOM 1488  C C     . ALA A 1 191 ? -119.695 -73.147 -61.365  1.00 167.69 ? 198  ALA A C     1 
ATOM 1489  O O     . ALA A 1 191 ? -120.455 -73.137 -62.330  1.00 167.63 ? 198  ALA A O     1 
ATOM 1490  C CB    . ALA A 1 191 ? -118.286 -74.807 -62.564  1.00 168.01 ? 198  ALA A CB    1 
ATOM 1491  N N     . SER A 1 192 ? -119.724 -72.228 -60.403  1.00 167.34 ? 199  SER A N     1 
ATOM 1492  C CA    . SER A 1 192 ? -120.685 -71.128 -60.391  1.00 167.02 ? 199  SER A CA    1 
ATOM 1493  C C     . SER A 1 192 ? -120.364 -70.092 -61.457  1.00 166.77 ? 199  SER A C     1 
ATOM 1494  O O     . SER A 1 192 ? -119.227 -69.976 -61.893  1.00 166.63 ? 199  SER A O     1 
ATOM 1495  C CB    . SER A 1 192 ? -120.705 -70.458 -59.015  1.00 167.04 ? 199  SER A CB    1 
ATOM 1496  O OG    . SER A 1 192 ? -121.709 -69.461 -58.943  1.00 167.31 ? 199  SER A OG    1 
ATOM 1497  N N     . SER A 1 193 ? -121.378 -69.352 -61.884  1.00 166.63 ? 200  SER A N     1 
ATOM 1498  C CA    . SER A 1 193 ? -121.158 -68.184 -62.721  1.00 166.61 ? 200  SER A CA    1 
ATOM 1499  C C     . SER A 1 193 ? -121.452 -66.942 -61.892  1.00 166.64 ? 200  SER A C     1 
ATOM 1500  O O     . SER A 1 193 ? -121.715 -65.863 -62.426  1.00 166.55 ? 200  SER A O     1 
ATOM 1501  C CB    . SER A 1 193 ? -122.009 -68.242 -63.992  1.00 166.61 ? 200  SER A CB    1 
ATOM 1502  O OG    . SER A 1 193 ? -123.319 -68.699 -63.721  1.00 166.44 ? 200  SER A OG    1 
ATOM 1503  N N     . GLN A 1 194 ? -121.392 -67.123 -60.575  1.00 166.76 ? 201  GLN A N     1 
ATOM 1504  C CA    . GLN A 1 194 ? -121.605 -66.060 -59.596  1.00 166.99 ? 201  GLN A CA    1 
ATOM 1505  C C     . GLN A 1 194 ? -120.490 -66.019 -58.561  1.00 166.89 ? 201  GLN A C     1 
ATOM 1506  O O     . GLN A 1 194 ? -120.051 -64.944 -58.148  1.00 166.95 ? 201  GLN A O     1 
ATOM 1507  C CB    . GLN A 1 194 ? -122.942 -66.262 -58.872  1.00 167.21 ? 201  GLN A CB    1 
ATOM 1508  C CG    . GLN A 1 194 ? -123.971 -65.133 -59.054  1.00 167.69 ? 201  GLN A CG    1 
ATOM 1509  C CD    . GLN A 1 194 ? -124.394 -64.925 -60.503  1.00 168.10 ? 201  GLN A CD    1 
ATOM 1510  O OE1   . GLN A 1 194 ? -124.360 -63.805 -61.010  1.00 168.22 ? 201  GLN A OE1   1 
ATOM 1511  N NE2   . GLN A 1 194 ? -124.789 -66.006 -61.174  1.00 168.12 ? 201  GLN A NE2   1 
ATOM 1512  N N     . GLN A 1 195 ? -120.045 -67.199 -58.143  1.00 166.77 ? 202  GLN A N     1 
ATOM 1513  C CA    . GLN A 1 195 ? -119.075 -67.332 -57.067  1.00 166.76 ? 202  GLN A CA    1 
ATOM 1514  C C     . GLN A 1 195 ? -117.732 -67.898 -57.526  1.00 166.56 ? 202  GLN A C     1 
ATOM 1515  O O     . GLN A 1 195 ? -117.688 -68.865 -58.285  1.00 166.80 ? 202  GLN A O     1 
ATOM 1516  C CB    . GLN A 1 195 ? -119.660 -68.232 -55.980  1.00 166.90 ? 202  GLN A CB    1 
ATOM 1517  C CG    . GLN A 1 195 ? -120.478 -67.503 -54.935  1.00 167.62 ? 202  GLN A CG    1 
ATOM 1518  C CD    . GLN A 1 195 ? -119.606 -66.687 -53.997  1.00 168.45 ? 202  GLN A CD    1 
ATOM 1519  O OE1   . GLN A 1 195 ? -119.127 -65.612 -54.360  1.00 168.84 ? 202  GLN A OE1   1 
ATOM 1520  N NE2   . GLN A 1 195 ? -119.393 -67.197 -52.786  1.00 168.45 ? 202  GLN A NE2   1 
ATOM 1521  N N     . TRP A 1 196 ? -116.637 -67.299 -57.064  1.00 166.19 ? 203  TRP A N     1 
ATOM 1522  C CA    . TRP A 1 196 ? -115.313 -67.885 -57.277  1.00 165.76 ? 203  TRP A CA    1 
ATOM 1523  C C     . TRP A 1 196 ? -114.504 -67.925 -55.997  1.00 165.83 ? 203  TRP A C     1 
ATOM 1524  O O     . TRP A 1 196 ? -114.423 -66.932 -55.283  1.00 165.84 ? 203  TRP A O     1 
ATOM 1525  C CB    . TRP A 1 196 ? -114.538 -67.172 -58.384  1.00 165.52 ? 203  TRP A CB    1 
ATOM 1526  C CG    . TRP A 1 196 ? -114.318 -65.706 -58.188  1.00 164.63 ? 203  TRP A CG    1 
ATOM 1527  C CD1   . TRP A 1 196 ? -115.119 -64.695 -58.618  1.00 164.14 ? 203  TRP A CD1   1 
ATOM 1528  C CD2   . TRP A 1 196 ? -113.207 -65.086 -57.549  1.00 163.65 ? 203  TRP A CD2   1 
ATOM 1529  N NE1   . TRP A 1 196 ? -114.584 -63.484 -58.278  1.00 163.09 ? 203  TRP A NE1   1 
ATOM 1530  C CE2   . TRP A 1 196 ? -113.408 -63.699 -57.618  1.00 163.18 ? 203  TRP A CE2   1 
ATOM 1531  C CE3   . TRP A 1 196 ? -112.061 -65.570 -56.915  1.00 163.69 ? 203  TRP A CE3   1 
ATOM 1532  C CZ2   . TRP A 1 196 ? -112.513 -62.793 -57.073  1.00 163.26 ? 203  TRP A CZ2   1 
ATOM 1533  C CZ3   . TRP A 1 196 ? -111.168 -64.666 -56.375  1.00 162.99 ? 203  TRP A CZ3   1 
ATOM 1534  C CH2   . TRP A 1 196 ? -111.399 -63.295 -56.456  1.00 163.04 ? 203  TRP A CH2   1 
ATOM 1535  N N     . GLY A 1 197 ? -113.931 -69.091 -55.712  1.00 165.96 ? 204  GLY A N     1 
ATOM 1536  C CA    . GLY A 1 197 ? -113.077 -69.298 -54.541  1.00 166.10 ? 204  GLY A CA    1 
ATOM 1537  C C     . GLY A 1 197 ? -111.605 -69.150 -54.888  1.00 166.18 ? 204  GLY A C     1 
ATOM 1538  O O     . GLY A 1 197 ? -111.209 -69.290 -56.051  1.00 166.06 ? 204  GLY A O     1 
ATOM 1539  N N     . ALA A 1 198 ? -110.793 -68.856 -53.877  1.00 166.33 ? 205  ALA A N     1 
ATOM 1540  C CA    . ALA A 1 198 ? -109.368 -68.673 -54.074  1.00 166.57 ? 205  ALA A CA    1 
ATOM 1541  C C     . ALA A 1 198 ? -108.623 -69.785 -53.364  1.00 166.91 ? 205  ALA A C     1 
ATOM 1542  O O     . ALA A 1 198 ? -108.808 -70.003 -52.162  1.00 166.85 ? 205  ALA A O     1 
ATOM 1543  C CB    . ALA A 1 198 ? -108.925 -67.313 -53.575  1.00 166.50 ? 205  ALA A CB    1 
ATOM 1544  N N     . PHE A 1 199 ? -107.789 -70.487 -54.127  1.00 167.39 ? 206  PHE A N     1 
ATOM 1545  C CA    . PHE A 1 199 ? -107.062 -71.655 -53.641  1.00 167.82 ? 206  PHE A CA    1 
ATOM 1546  C C     . PHE A 1 199 ? -105.567 -71.377 -53.582  1.00 168.16 ? 206  PHE A C     1 
ATOM 1547  O O     . PHE A 1 199 ? -105.033 -70.688 -54.450  1.00 168.13 ? 206  PHE A O     1 
ATOM 1548  C CB    . PHE A 1 199 ? -107.301 -72.852 -54.562  1.00 167.77 ? 206  PHE A CB    1 
ATOM 1549  C CG    . PHE A 1 199 ? -108.743 -73.082 -54.914  1.00 167.51 ? 206  PHE A CG    1 
ATOM 1550  C CD1   . PHE A 1 199 ? -109.271 -72.569 -56.086  1.00 167.58 ? 206  PHE A CD1   1 
ATOM 1551  C CD2   . PHE A 1 199 ? -109.562 -73.831 -54.089  1.00 167.31 ? 206  PHE A CD2   1 
ATOM 1552  C CE1   . PHE A 1 199 ? -110.592 -72.787 -56.424  1.00 167.49 ? 206  PHE A CE1   1 
ATOM 1553  C CE2   . PHE A 1 199 ? -110.881 -74.054 -54.422  1.00 167.50 ? 206  PHE A CE2   1 
ATOM 1554  C CZ    . PHE A 1 199 ? -111.397 -73.529 -55.593  1.00 167.45 ? 206  PHE A CZ    1 
ATOM 1555  N N     . PHE A 1 200 ? -104.897 -71.919 -52.566  1.00 168.58 ? 207  PHE A N     1 
ATOM 1556  C CA    . PHE A 1 200 ? -103.446 -71.806 -52.466  1.00 169.03 ? 207  PHE A CA    1 
ATOM 1557  C C     . PHE A 1 200 ? -102.801 -72.860 -53.366  1.00 169.35 ? 207  PHE A C     1 
ATOM 1558  O O     . PHE A 1 200 ? -103.228 -74.016 -53.389  1.00 169.21 ? 207  PHE A O     1 
ATOM 1559  C CB    . PHE A 1 200 ? -102.966 -71.930 -51.008  1.00 169.05 ? 207  PHE A CB    1 
ATOM 1560  C CG    . PHE A 1 200 ? -103.527 -70.878 -50.091  1.00 169.02 ? 207  PHE A CG    1 
ATOM 1561  C CD1   . PHE A 1 200 ? -103.013 -69.585 -50.095  1.00 169.01 ? 207  PHE A CD1   1 
ATOM 1562  C CD2   . PHE A 1 200 ? -104.581 -71.179 -49.232  1.00 169.40 ? 207  PHE A CD2   1 
ATOM 1563  C CE1   . PHE A 1 200 ? -103.541 -68.602 -49.264  1.00 169.25 ? 207  PHE A CE1   1 
ATOM 1564  C CE2   . PHE A 1 200 ? -105.120 -70.208 -48.392  1.00 169.64 ? 207  PHE A CE2   1 
ATOM 1565  C CZ    . PHE A 1 200 ? -104.598 -68.914 -48.409  1.00 169.74 ? 207  PHE A CZ    1 
ATOM 1566  N N     . ILE A 1 201 ? -101.786 -72.440 -54.118  1.00 169.87 ? 208  ILE A N     1 
ATOM 1567  C CA    . ILE A 1 201 ? -101.114 -73.304 -55.088  1.00 170.36 ? 208  ILE A CA    1 
ATOM 1568  C C     . ILE A 1 201 ? -99.749  -73.782 -54.548  1.00 171.11 ? 208  ILE A C     1 
ATOM 1569  O O     . ILE A 1 201 ? -98.683  -73.324 -54.980  1.00 171.20 ? 208  ILE A O     1 
ATOM 1570  C CB    . ILE A 1 201 ? -101.042 -72.625 -56.509  1.00 170.12 ? 208  ILE A CB    1 
ATOM 1571  C CG1   . ILE A 1 201 ? -100.714 -73.637 -57.604  1.00 169.52 ? 208  ILE A CG1   1 
ATOM 1572  C CG2   . ILE A 1 201 ? -100.090 -71.444 -56.543  1.00 170.04 ? 208  ILE A CG2   1 
ATOM 1573  C CD1   . ILE A 1 201 ? -101.920 -74.197 -58.285  1.00 168.69 ? 208  ILE A CD1   1 
ATOM 1574  N N     . HIS A 1 202 ? -99.804  -74.698 -53.581  1.00 171.88 ? 209  HIS A N     1 
ATOM 1575  C CA    . HIS A 1 202 ? -98.609  -75.259 -52.942  1.00 172.62 ? 209  HIS A CA    1 
ATOM 1576  C C     . HIS A 1 202 ? -97.894  -76.231 -53.883  1.00 173.17 ? 209  HIS A C     1 
ATOM 1577  O O     . HIS A 1 202 ? -98.546  -76.972 -54.603  1.00 173.14 ? 209  HIS A O     1 
ATOM 1578  C CB    . HIS A 1 202 ? -98.983  -75.990 -51.646  1.00 172.60 ? 209  HIS A CB    1 
ATOM 1579  C CG    . HIS A 1 202 ? -99.704  -75.143 -50.641  1.00 172.37 ? 209  HIS A CG    1 
ATOM 1580  N ND1   . HIS A 1 202 ? -99.207  -73.943 -50.178  1.00 172.37 ? 209  HIS A ND1   1 
ATOM 1581  C CD2   . HIS A 1 202 ? -100.871 -75.344 -49.986  1.00 171.94 ? 209  HIS A CD2   1 
ATOM 1582  C CE1   . HIS A 1 202 ? -100.046 -73.434 -49.293  1.00 172.49 ? 209  HIS A CE1   1 
ATOM 1583  N NE2   . HIS A 1 202 ? -101.064 -74.265 -49.157  1.00 172.10 ? 209  HIS A NE2   1 
ATOM 1584  N N     . LEU A 1 203 ? -96.562  -76.232 -53.859  1.00 174.10 ? 210  LEU A N     1 
ATOM 1585  C CA    . LEU A 1 203 ? -95.743  -77.107 -54.713  1.00 175.10 ? 210  LEU A CA    1 
ATOM 1586  C C     . LEU A 1 203 ? -95.381  -78.412 -54.010  1.00 176.07 ? 210  LEU A C     1 
ATOM 1587  O O     . LEU A 1 203 ? -95.381  -78.462 -52.783  1.00 176.38 ? 210  LEU A O     1 
ATOM 1588  C CB    . LEU A 1 203 ? -94.461  -76.386 -55.116  1.00 174.92 ? 210  LEU A CB    1 
ATOM 1589  C CG    . LEU A 1 203 ? -93.730  -76.909 -56.346  1.00 174.66 ? 210  LEU A CG    1 
ATOM 1590  C CD1   . LEU A 1 203 ? -94.436  -76.414 -57.577  1.00 174.83 ? 210  LEU A CD1   1 
ATOM 1591  C CD2   . LEU A 1 203 ? -92.299  -76.438 -56.346  1.00 174.56 ? 210  LEU A CD2   1 
ATOM 1592  N N     . LEU A 1 204 ? -95.063  -79.458 -54.776  1.00 177.24 ? 211  LEU A N     1 
ATOM 1593  C CA    . LEU A 1 204 ? -94.741  -80.779 -54.196  1.00 178.50 ? 211  LEU A CA    1 
ATOM 1594  C C     . LEU A 1 204 ? -93.578  -81.523 -54.876  1.00 179.39 ? 211  LEU A C     1 
ATOM 1595  O O     . LEU A 1 204 ? -92.975  -81.019 -55.824  1.00 179.48 ? 211  LEU A O     1 
ATOM 1596  C CB    . LEU A 1 204 ? -95.982  -81.683 -54.162  1.00 178.46 ? 211  LEU A CB    1 
ATOM 1597  C CG    . LEU A 1 204 ? -97.251  -81.295 -53.389  1.00 178.65 ? 211  LEU A CG    1 
ATOM 1598  C CD1   . LEU A 1 204 ? -98.395  -82.206 -53.796  1.00 178.90 ? 211  LEU A CD1   1 
ATOM 1599  C CD2   . LEU A 1 204 ? -97.065  -81.324 -51.871  1.00 178.82 ? 211  LEU A CD2   1 
ATOM 1600  N N     . ASP A 1 205 ? -93.287  -82.729 -54.378  1.00 180.60 ? 212  ASP A N     1 
ATOM 1601  C CA    . ASP A 1 205 ? -92.193  -83.581 -54.873  1.00 181.79 ? 212  ASP A CA    1 
ATOM 1602  C C     . ASP A 1 205 ? -92.601  -84.447 -56.080  1.00 182.63 ? 212  ASP A C     1 
ATOM 1603  O O     . ASP A 1 205 ? -93.690  -85.030 -56.083  1.00 182.74 ? 212  ASP A O     1 
ATOM 1604  C CB    . ASP A 1 205 ? -91.703  -84.512 -53.750  1.00 181.74 ? 212  ASP A CB    1 
ATOM 1605  C CG    . ASP A 1 205 ? -91.075  -83.766 -52.582  1.00 181.54 ? 212  ASP A CG    1 
ATOM 1606  O OD1   . ASP A 1 205 ? -91.649  -83.814 -51.472  1.00 181.07 ? 212  ASP A OD1   1 
ATOM 1607  O OD2   . ASP A 1 205 ? -90.002  -83.150 -52.769  1.00 181.25 ? 212  ASP A OD2   1 
ATOM 1608  N N     . ASP A 1 206 ? -91.716  -84.549 -57.080  1.00 183.63 ? 213  ASP A N     1 
ATOM 1609  C CA    . ASP A 1 206 ? -91.946  -85.398 -58.265  1.00 184.55 ? 213  ASP A CA    1 
ATOM 1610  C C     . ASP A 1 206 ? -92.199  -86.858 -57.881  1.00 185.47 ? 213  ASP A C     1 
ATOM 1611  O O     . ASP A 1 206 ? -93.149  -87.468 -58.372  1.00 185.68 ? 213  ASP A O     1 
ATOM 1612  C CB    . ASP A 1 206 ? -90.796  -85.290 -59.288  1.00 184.29 ? 213  ASP A CB    1 
ATOM 1613  C CG    . ASP A 1 206 ? -90.955  -84.104 -60.249  1.00 183.85 ? 213  ASP A CG    1 
ATOM 1614  O OD1   . ASP A 1 206 ? -91.765  -83.194 -59.980  1.00 183.41 ? 213  ASP A OD1   1 
ATOM 1615  O OD2   . ASP A 1 206 ? -90.257  -84.076 -61.283  1.00 182.93 ? 213  ASP A OD2   1 
ATOM 1616  N N     . ASP A 1 207 ? -91.353  -87.406 -57.005  1.00 186.55 ? 214  ASP A N     1 
ATOM 1617  C CA    . ASP A 1 207 ? -91.561  -88.743 -56.430  1.00 187.50 ? 214  ASP A CA    1 
ATOM 1618  C C     . ASP A 1 207 ? -92.404  -88.635 -55.157  1.00 188.13 ? 214  ASP A C     1 
ATOM 1619  O O     . ASP A 1 207 ? -92.177  -87.747 -54.337  1.00 188.22 ? 214  ASP A O     1 
ATOM 1620  C CB    . ASP A 1 207 ? -90.221  -89.440 -56.153  1.00 187.52 ? 214  ASP A CB    1 
ATOM 1621  C CG    . ASP A 1 207 ? -89.692  -90.226 -57.361  1.00 187.63 ? 214  ASP A CG    1 
ATOM 1622  O OD1   . ASP A 1 207 ? -89.763  -89.723 -58.505  1.00 187.36 ? 214  ASP A OD1   1 
ATOM 1623  O OD2   . ASP A 1 207 ? -89.189  -91.353 -57.158  1.00 187.85 ? 214  ASP A OD2   1 
ATOM 1624  N N     . GLU A 1 208 ? -93.359  -89.551 -54.991  1.00 189.03 ? 215  GLU A N     1 
ATOM 1625  C CA    . GLU A 1 208 ? -94.459  -89.368 -54.025  1.00 189.92 ? 215  GLU A CA    1 
ATOM 1626  C C     . GLU A 1 208 ? -94.623  -90.432 -52.919  1.00 190.36 ? 215  GLU A C     1 
ATOM 1627  O O     . GLU A 1 208 ? -94.408  -91.626 -53.152  1.00 190.42 ? 215  GLU A O     1 
ATOM 1628  C CB    . GLU A 1 208 ? -95.791  -89.228 -54.786  1.00 190.01 ? 215  GLU A CB    1 
ATOM 1629  C CG    . GLU A 1 208 ? -96.005  -87.892 -55.508  1.00 190.26 ? 215  GLU A CG    1 
ATOM 1630  C CD    . GLU A 1 208 ? -96.399  -86.749 -54.574  1.00 190.59 ? 215  GLU A CD    1 
ATOM 1631  O OE1   . GLU A 1 208 ? -96.726  -85.663 -55.090  1.00 190.80 ? 215  GLU A OE1   1 
ATOM 1632  O OE2   . GLU A 1 208 ? -96.387  -86.923 -53.334  1.00 190.70 ? 215  GLU A OE2   1 
ATOM 1633  N N     . SER A 1 209 ? -95.017  -89.982 -51.724  1.00 190.91 ? 216  SER A N     1 
ATOM 1634  C CA    . SER A 1 209 ? -95.523  -90.876 -50.671  1.00 191.44 ? 216  SER A CA    1 
ATOM 1635  C C     . SER A 1 209 ? -97.060  -90.803 -50.662  1.00 191.77 ? 216  SER A C     1 
ATOM 1636  O O     . SER A 1 209 ? -97.658  -90.535 -51.705  1.00 191.93 ? 216  SER A O     1 
ATOM 1637  C CB    . SER A 1 209 ? -94.922  -90.530 -49.304  1.00 191.47 ? 216  SER A CB    1 
ATOM 1638  O OG    . SER A 1 209 ? -95.543  -89.390 -48.732  1.00 191.49 ? 216  SER A OG    1 
ATOM 1639  N N     . GLU A 1 210 ? -97.701  -91.024 -49.510  1.00 192.11 ? 217  GLU A N     1 
ATOM 1640  C CA    . GLU A 1 210 ? -99.180  -91.057 -49.446  1.00 192.46 ? 217  GLU A CA    1 
ATOM 1641  C C     . GLU A 1 210 ? -99.873  -89.714 -49.796  1.00 192.49 ? 217  GLU A C     1 
ATOM 1642  O O     . GLU A 1 210 ? -99.204  -88.690 -49.969  1.00 192.46 ? 217  GLU A O     1 
ATOM 1643  C CB    . GLU A 1 210 ? -99.695  -91.662 -48.115  1.00 192.54 ? 217  GLU A CB    1 
ATOM 1644  C CG    . GLU A 1 210 ? -99.350  -90.899 -46.830  1.00 193.08 ? 217  GLU A CG    1 
ATOM 1645  C CD    . GLU A 1 210 ? -97.973  -91.233 -46.288  1.00 193.84 ? 217  GLU A CD    1 
ATOM 1646  O OE1   . GLU A 1 210 ? -97.571  -92.418 -46.354  1.00 194.20 ? 217  GLU A OE1   1 
ATOM 1647  O OE2   . GLU A 1 210 ? -97.295  -90.306 -45.792  1.00 193.87 ? 217  GLU A OE2   1 
ATOM 1648  N N     . GLY A 1 211 ? -101.204 -89.741 -49.919  1.00 192.47 ? 218  GLY A N     1 
ATOM 1649  C CA    . GLY A 1 211 ? -101.993 -88.565 -50.305  1.00 192.50 ? 218  GLY A CA    1 
ATOM 1650  C C     . GLY A 1 211 ? -102.281 -87.534 -49.214  1.00 192.59 ? 218  GLY A C     1 
ATOM 1651  O O     . GLY A 1 211 ? -103.098 -86.626 -49.421  1.00 192.74 ? 218  GLY A O     1 
ATOM 1652  N N     . GLU A 1 212 ? -101.623 -87.673 -48.056  1.00 192.46 ? 219  GLU A N     1 
ATOM 1653  C CA    . GLU A 1 212 ? -101.687 -86.687 -46.948  1.00 192.17 ? 219  GLU A CA    1 
ATOM 1654  C C     . GLU A 1 212 ? -100.278 -86.165 -46.554  1.00 191.93 ? 219  GLU A C     1 
ATOM 1655  O O     . GLU A 1 212 ? -99.379  -86.116 -47.400  1.00 191.92 ? 219  GLU A O     1 
ATOM 1656  C CB    . GLU A 1 212 ? -102.431 -87.273 -45.728  1.00 192.20 ? 219  GLU A CB    1 
ATOM 1657  C CG    . GLU A 1 212 ? -103.960 -87.333 -45.857  1.00 191.76 ? 219  GLU A CG    1 
ATOM 1658  C CD    . GLU A 1 212 ? -104.653 -86.015 -45.527  1.00 191.22 ? 219  GLU A CD    1 
ATOM 1659  O OE1   . GLU A 1 212 ? -104.276 -84.966 -46.098  1.00 190.97 ? 219  GLU A OE1   1 
ATOM 1660  O OE2   . GLU A 1 212 ? -105.592 -86.034 -44.703  1.00 190.85 ? 219  GLU A OE2   1 
ATOM 1661  N N     . GLU A 1 213 ? -100.100 -85.772 -45.284  1.00 191.50 ? 220  GLU A N     1 
ATOM 1662  C CA    . GLU A 1 213 ? -98.805  -85.297 -44.718  1.00 190.93 ? 220  GLU A CA    1 
ATOM 1663  C C     . GLU A 1 213 ? -98.089  -84.256 -45.601  1.00 190.37 ? 220  GLU A C     1 
ATOM 1664  O O     . GLU A 1 213 ? -96.855  -84.139 -45.579  1.00 190.35 ? 220  GLU A O     1 
ATOM 1665  C CB    . GLU A 1 213 ? -97.847  -86.465 -44.369  1.00 191.02 ? 220  GLU A CB    1 
ATOM 1666  C CG    . GLU A 1 213 ? -98.492  -87.817 -43.978  1.00 191.39 ? 220  GLU A CG    1 
ATOM 1667  C CD    . GLU A 1 213 ? -99.537  -87.718 -42.871  1.00 191.93 ? 220  GLU A CD    1 
ATOM 1668  O OE1   . GLU A 1 213 ? -99.308  -86.978 -41.886  1.00 192.23 ? 220  GLU A OE1   1 
ATOM 1669  O OE2   . GLU A 1 213 ? -100.587 -88.392 -42.992  1.00 192.04 ? 220  GLU A OE2   1 
ATOM 1670  N N     . PHE A 1 214 ? -98.901  -83.503 -46.348  1.00 189.58 ? 221  PHE A N     1 
ATOM 1671  C CA    . PHE A 1 214 ? -98.490  -82.504 -47.352  1.00 188.79 ? 221  PHE A CA    1 
ATOM 1672  C C     . PHE A 1 214 ? -97.326  -81.572 -46.956  1.00 188.03 ? 221  PHE A C     1 
ATOM 1673  O O     . PHE A 1 214 ? -97.537  -80.559 -46.280  1.00 188.10 ? 221  PHE A O     1 
ATOM 1674  C CB    . PHE A 1 214 ? -99.728  -81.694 -47.823  1.00 188.93 ? 221  PHE A CB    1 
ATOM 1675  C CG    . PHE A 1 214 ? -100.797 -81.503 -46.749  1.00 189.41 ? 221  PHE A CG    1 
ATOM 1676  C CD1   . PHE A 1 214 ? -101.736 -82.512 -46.478  1.00 189.59 ? 221  PHE A CD1   1 
ATOM 1677  C CD2   . PHE A 1 214 ? -100.872 -80.312 -46.017  1.00 189.71 ? 221  PHE A CD2   1 
ATOM 1678  C CE1   . PHE A 1 214 ? -102.720 -82.342 -45.488  1.00 189.54 ? 221  PHE A CE1   1 
ATOM 1679  C CE2   . PHE A 1 214 ? -101.855 -80.133 -45.023  1.00 189.67 ? 221  PHE A CE2   1 
ATOM 1680  C CZ    . PHE A 1 214 ? -102.780 -81.151 -44.762  1.00 189.56 ? 221  PHE A CZ    1 
ATOM 1681  N N     . THR A 1 215 ? -96.107  -81.917 -47.384  1.00 186.97 ? 222  THR A N     1 
ATOM 1682  C CA    . THR A 1 215 ? -94.916  -81.073 -47.139  1.00 185.87 ? 222  THR A CA    1 
ATOM 1683  C C     . THR A 1 215 ? -94.550  -80.208 -48.371  1.00 184.88 ? 222  THR A C     1 
ATOM 1684  O O     . THR A 1 215 ? -94.314  -80.732 -49.463  1.00 184.83 ? 222  THR A O     1 
ATOM 1685  C CB    . THR A 1 215 ? -93.677  -81.891 -46.610  1.00 185.95 ? 222  THR A CB    1 
ATOM 1686  O OG1   . THR A 1 215 ? -93.327  -82.918 -47.541  1.00 186.22 ? 222  THR A OG1   1 
ATOM 1687  C CG2   . THR A 1 215 ? -93.958  -82.531 -45.242  1.00 185.74 ? 222  THR A CG2   1 
ATOM 1688  N N     . VAL A 1 216 ? -94.501  -78.889 -48.167  1.00 183.52 ? 223  VAL A N     1 
ATOM 1689  C CA    . VAL A 1 216 ? -94.390  -77.890 -49.249  1.00 182.07 ? 223  VAL A CA    1 
ATOM 1690  C C     . VAL A 1 216 ? -92.950  -77.567 -49.692  1.00 181.06 ? 223  VAL A C     1 
ATOM 1691  O O     . VAL A 1 216 ? -91.998  -77.932 -49.004  1.00 181.09 ? 223  VAL A O     1 
ATOM 1692  C CB    . VAL A 1 216 ? -95.127  -76.581 -48.861  1.00 182.13 ? 223  VAL A CB    1 
ATOM 1693  C CG1   . VAL A 1 216 ? -96.622  -76.827 -48.766  1.00 181.90 ? 223  VAL A CG1   1 
ATOM 1694  C CG2   . VAL A 1 216 ? -94.595  -76.017 -47.540  1.00 182.01 ? 223  VAL A CG2   1 
ATOM 1695  N N     . ARG A 1 217 ? -92.805  -76.888 -50.837  1.00 179.59 ? 224  ARG A N     1 
ATOM 1696  C CA    . ARG A 1 217 ? -91.492  -76.452 -51.364  1.00 178.15 ? 224  ARG A CA    1 
ATOM 1697  C C     . ARG A 1 217 ? -91.422  -74.964 -51.712  1.00 176.98 ? 224  ARG A C     1 
ATOM 1698  O O     . ARG A 1 217 ? -92.415  -74.252 -51.611  1.00 176.88 ? 224  ARG A O     1 
ATOM 1699  C CB    . ARG A 1 217 ? -91.081  -77.255 -52.599  1.00 178.25 ? 224  ARG A CB    1 
ATOM 1700  C CG    . ARG A 1 217 ? -90.042  -78.327 -52.353  1.00 178.42 ? 224  ARG A CG    1 
ATOM 1701  C CD    . ARG A 1 217 ? -90.654  -79.695 -52.549  1.00 179.08 ? 224  ARG A CD    1 
ATOM 1702  N NE    . ARG A 1 217 ? -89.893  -80.500 -53.506  1.00 179.43 ? 224  ARG A NE    1 
ATOM 1703  C CZ    . ARG A 1 217 ? -89.970  -80.381 -54.831  1.00 179.36 ? 224  ARG A CZ    1 
ATOM 1704  N NH1   . ARG A 1 217 ? -89.236  -81.171 -55.602  1.00 179.60 ? 224  ARG A NH1   1 
ATOM 1705  N NH2   . ARG A 1 217 ? -90.766  -79.478 -55.394  1.00 179.10 ? 224  ARG A NH2   1 
ATOM 1706  N N     . ASP A 1 218 ? -90.240  -74.515 -52.134  1.00 175.52 ? 225  ASP A N     1 
ATOM 1707  C CA    . ASP A 1 218 ? -89.993  -73.105 -52.453  1.00 174.18 ? 225  ASP A CA    1 
ATOM 1708  C C     . ASP A 1 218 ? -90.119  -72.831 -53.955  1.00 173.02 ? 225  ASP A C     1 
ATOM 1709  O O     . ASP A 1 218 ? -90.653  -73.660 -54.694  1.00 173.05 ? 225  ASP A O     1 
ATOM 1710  C CB    . ASP A 1 218 ? -88.605  -72.674 -51.947  1.00 174.30 ? 225  ASP A CB    1 
ATOM 1711  C CG    . ASP A 1 218 ? -88.531  -72.555 -50.424  1.00 174.38 ? 225  ASP A CG    1 
ATOM 1712  O OD1   . ASP A 1 218 ? -89.311  -71.777 -49.824  1.00 174.21 ? 225  ASP A OD1   1 
ATOM 1713  O OD2   . ASP A 1 218 ? -87.667  -73.230 -49.827  1.00 174.43 ? 225  ASP A OD2   1 
ATOM 1714  N N     . GLY A 1 219 ? -89.647  -71.660 -54.389  1.00 171.49 ? 226  GLY A N     1 
ATOM 1715  C CA    . GLY A 1 219 ? -89.527  -71.323 -55.808  1.00 169.52 ? 226  GLY A CA    1 
ATOM 1716  C C     . GLY A 1 219 ? -90.829  -71.146 -56.569  1.00 168.22 ? 226  GLY A C     1 
ATOM 1717  O O     . GLY A 1 219 ? -91.923  -71.316 -56.023  1.00 168.08 ? 226  GLY A O     1 
ATOM 1718  N N     . TYR A 1 220 ? -90.697  -70.803 -57.847  1.00 166.77 ? 227  TYR A N     1 
ATOM 1719  C CA    . TYR A 1 220 ? -91.835  -70.606 -58.732  1.00 165.25 ? 227  TYR A CA    1 
ATOM 1720  C C     . TYR A 1 220 ? -92.427  -71.941 -59.160  1.00 164.05 ? 227  TYR A C     1 
ATOM 1721  O O     . TYR A 1 220 ? -91.840  -72.988 -58.911  1.00 164.03 ? 227  TYR A O     1 
ATOM 1722  C CB    . TYR A 1 220 ? -91.405  -69.802 -59.961  1.00 165.53 ? 227  TYR A CB    1 
ATOM 1723  C CG    . TYR A 1 220 ? -91.118  -68.342 -59.679  1.00 165.92 ? 227  TYR A CG    1 
ATOM 1724  C CD1   . TYR A 1 220 ? -89.816  -67.867 -59.628  1.00 166.47 ? 227  TYR A CD1   1 
ATOM 1725  C CD2   . TYR A 1 220 ? -92.153  -67.437 -59.466  1.00 166.10 ? 227  TYR A CD2   1 
ATOM 1726  C CE1   . TYR A 1 220 ? -89.552  -66.528 -59.372  1.00 166.66 ? 227  TYR A CE1   1 
ATOM 1727  C CE2   . TYR A 1 220 ? -91.898  -66.100 -59.206  1.00 166.29 ? 227  TYR A CE2   1 
ATOM 1728  C CZ    . TYR A 1 220 ? -90.598  -65.655 -59.162  1.00 166.54 ? 227  TYR A CZ    1 
ATOM 1729  O OH    . TYR A 1 220 ? -90.339  -64.335 -58.907  1.00 166.74 ? 227  TYR A OH    1 
ATOM 1730  N N     . ILE A 1 221 ? -93.590  -71.901 -59.806  1.00 162.53 ? 228  ILE A N     1 
ATOM 1731  C CA    . ILE A 1 221 ? -94.246  -73.113 -60.279  1.00 160.92 ? 228  ILE A CA    1 
ATOM 1732  C C     . ILE A 1 221 ? -94.102  -73.241 -61.779  1.00 160.11 ? 228  ILE A C     1 
ATOM 1733  O O     . ILE A 1 221 ? -94.405  -72.312 -62.521  1.00 159.86 ? 228  ILE A O     1 
ATOM 1734  C CB    . ILE A 1 221 ? -95.729  -73.174 -59.886  1.00 160.76 ? 228  ILE A CB    1 
ATOM 1735  C CG1   . ILE A 1 221 ? -95.889  -72.968 -58.385  1.00 160.60 ? 228  ILE A CG1   1 
ATOM 1736  C CG2   . ILE A 1 221 ? -96.306  -74.514 -60.244  1.00 160.66 ? 228  ILE A CG2   1 
ATOM 1737  C CD1   . ILE A 1 221 ? -97.228  -73.354 -57.841  1.00 159.97 ? 228  ILE A CD1   1 
ATOM 1738  N N     . HIS A 1 222 ? -93.621  -74.407 -62.202  1.00 159.20 ? 229  HIS A N     1 
ATOM 1739  C CA    . HIS A 1 222 ? -93.416  -74.735 -63.610  1.00 158.22 ? 229  HIS A CA    1 
ATOM 1740  C C     . HIS A 1 222 ? -94.380  -75.850 -64.019  1.00 157.56 ? 229  HIS A C     1 
ATOM 1741  O O     . HIS A 1 222 ? -94.717  -76.721 -63.213  1.00 157.25 ? 229  HIS A O     1 
ATOM 1742  C CB    . HIS A 1 222 ? -91.961  -75.178 -63.855  1.00 158.28 ? 229  HIS A CB    1 
ATOM 1743  C CG    . HIS A 1 222 ? -90.925  -74.169 -63.444  1.00 157.78 ? 229  HIS A CG    1 
ATOM 1744  N ND1   . HIS A 1 222 ? -90.425  -74.091 -62.161  1.00 157.24 ? 229  HIS A ND1   1 
ATOM 1745  C CD2   . HIS A 1 222 ? -90.277  -73.215 -64.155  1.00 157.21 ? 229  HIS A CD2   1 
ATOM 1746  C CE1   . HIS A 1 222 ? -89.531  -73.119 -62.095  1.00 157.19 ? 229  HIS A CE1   1 
ATOM 1747  N NE2   . HIS A 1 222 ? -89.426  -72.569 -63.291  1.00 157.11 ? 229  HIS A NE2   1 
ATOM 1748  N N     . TYR A 1 223 ? -94.824  -75.816 -65.271  1.00 156.91 ? 230  TYR A N     1 
ATOM 1749  C CA    . TYR A 1 223 ? -95.744  -76.823 -65.782  1.00 156.31 ? 230  TYR A CA    1 
ATOM 1750  C C     . TYR A 1 223 ? -95.150  -78.202 -65.629  1.00 156.09 ? 230  TYR A C     1 
ATOM 1751  O O     . TYR A 1 223 ? -93.982  -78.420 -65.919  1.00 156.09 ? 230  TYR A O     1 
ATOM 1752  C CB    . TYR A 1 223 ? -96.046  -76.601 -67.259  1.00 156.23 ? 230  TYR A CB    1 
ATOM 1753  C CG    . TYR A 1 223 ? -96.977  -75.463 -67.576  1.00 155.58 ? 230  TYR A CG    1 
ATOM 1754  C CD1   . TYR A 1 223 ? -96.536  -74.382 -68.332  1.00 155.29 ? 230  TYR A CD1   1 
ATOM 1755  C CD2   . TYR A 1 223 ? -98.302  -75.478 -67.150  1.00 155.16 ? 230  TYR A CD2   1 
ATOM 1756  C CE1   . TYR A 1 223 ? -97.380  -73.335 -68.646  1.00 155.31 ? 230  TYR A CE1   1 
ATOM 1757  C CE2   . TYR A 1 223 ? -99.157  -74.430 -67.452  1.00 155.17 ? 230  TYR A CE2   1 
ATOM 1758  C CZ    . TYR A 1 223 ? -98.687  -73.360 -68.205  1.00 155.20 ? 230  TYR A CZ    1 
ATOM 1759  O OH    . TYR A 1 223 ? -99.509  -72.307 -68.524  1.00 154.55 ? 230  TYR A OH    1 
ATOM 1760  N N     . GLY A 1 224 ? -95.963  -79.139 -65.187  1.00 155.86 ? 231  GLY A N     1 
ATOM 1761  C CA    . GLY A 1 224 ? -95.503  -80.496 -65.031  1.00 155.67 ? 231  GLY A CA    1 
ATOM 1762  C C     . GLY A 1 224 ? -95.439  -80.853 -63.572  1.00 155.56 ? 231  GLY A C     1 
ATOM 1763  O O     . GLY A 1 224 ? -95.607  -82.004 -63.225  1.00 155.58 ? 231  GLY A O     1 
ATOM 1764  N N     . GLN A 1 225 ? -95.206  -79.867 -62.713  1.00 155.62 ? 232  GLN A N     1 
ATOM 1765  C CA    . GLN A 1 225 ? -95.115  -80.121 -61.275  1.00 155.84 ? 232  GLN A CA    1 
ATOM 1766  C C     . GLN A 1 225 ? -96.386  -80.721 -60.685  1.00 155.94 ? 232  GLN A C     1 
ATOM 1767  O O     . GLN A 1 225 ? -97.449  -80.667 -61.295  1.00 155.93 ? 232  GLN A O     1 
ATOM 1768  C CB    . GLN A 1 225 ? -94.763  -78.843 -60.514  1.00 155.90 ? 232  GLN A CB    1 
ATOM 1769  C CG    . GLN A 1 225 ? -93.395  -78.852 -59.862  1.00 155.93 ? 232  GLN A CG    1 
ATOM 1770  C CD    . GLN A 1 225 ? -92.458  -77.846 -60.472  1.00 156.06 ? 232  GLN A CD    1 
ATOM 1771  O OE1   . GLN A 1 225 ? -91.988  -78.025 -61.584  1.00 156.73 ? 232  GLN A OE1   1 
ATOM 1772  N NE2   . GLN A 1 225 ? -92.176  -76.779 -59.743  1.00 156.06 ? 232  GLN A NE2   1 
ATOM 1773  N N     . THR A 1 226 ? -96.261  -81.302 -59.497  1.00 156.17 ? 233  THR A N     1 
ATOM 1774  C CA    . THR A 1 226 ? -97.417  -81.753 -58.739  1.00 156.56 ? 233  THR A CA    1 
ATOM 1775  C C     . THR A 1 226 ? -97.805  -80.684 -57.728  1.00 156.98 ? 233  THR A C     1 
ATOM 1776  O O     . THR A 1 226 ? -96.964  -80.223 -56.956  1.00 157.22 ? 233  THR A O     1 
ATOM 1777  C CB    . THR A 1 226 ? -97.126  -83.058 -58.017  1.00 156.46 ? 233  THR A CB    1 
ATOM 1778  O OG1   . THR A 1 226 ? -96.689  -84.024 -58.974  1.00 156.53 ? 233  THR A OG1   1 
ATOM 1779  C CG2   . THR A 1 226 ? -98.372  -83.574 -57.306  1.00 156.35 ? 233  THR A CG2   1 
ATOM 1780  N N     . VAL A 1 227 ? -99.079  -80.298 -57.744  1.00 157.29 ? 234  VAL A N     1 
ATOM 1781  C CA    . VAL A 1 227 ? -99.591  -79.207 -56.918  1.00 157.54 ? 234  VAL A CA    1 
ATOM 1782  C C     . VAL A 1 227 ? -100.965 -79.520 -56.312  1.00 157.99 ? 234  VAL A C     1 
ATOM 1783  O O     . VAL A 1 227 ? -101.951 -79.681 -57.029  1.00 158.12 ? 234  VAL A O     1 
ATOM 1784  C CB    . VAL A 1 227 ? -99.688  -77.893 -57.725  1.00 157.40 ? 234  VAL A CB    1 
ATOM 1785  C CG1   . VAL A 1 227 ? -98.316  -77.289 -57.962  1.00 157.51 ? 234  VAL A CG1   1 
ATOM 1786  C CG2   . VAL A 1 227 ? -100.382 -78.128 -59.046  1.00 157.55 ? 234  VAL A CG2   1 
ATOM 1787  N N     . LYS A 1 228 ? -101.024 -79.620 -54.988  1.00 158.51 ? 235  LYS A N     1 
ATOM 1788  C CA    . LYS A 1 228 ? -102.297 -79.714 -54.280  1.00 159.01 ? 235  LYS A CA    1 
ATOM 1789  C C     . LYS A 1 228 ? -102.842 -78.285 -54.166  1.00 159.33 ? 235  LYS A C     1 
ATOM 1790  O O     . LYS A 1 228 ? -102.067 -77.319 -54.220  1.00 159.47 ? 235  LYS A O     1 
ATOM 1791  C CB    . LYS A 1 228 ? -102.075 -80.328 -52.894  1.00 158.98 ? 235  LYS A CB    1 
ATOM 1792  C CG    . LYS A 1 228 ? -103.218 -81.183 -52.364  1.00 159.39 ? 235  LYS A CG    1 
ATOM 1793  C CD    . LYS A 1 228 ? -102.822 -81.883 -51.063  1.00 160.12 ? 235  LYS A CD    1 
ATOM 1794  C CE    . LYS A 1 228 ? -103.999 -82.616 -50.415  1.00 160.48 ? 235  LYS A CE    1 
ATOM 1795  N NZ    . LYS A 1 228 ? -104.251 -83.959 -51.008  1.00 160.38 ? 235  LYS A NZ    1 
ATOM 1796  N N     . LEU A 1 229 ? -104.161 -78.135 -54.048  1.00 159.62 ? 236  LEU A N     1 
ATOM 1797  C CA    . LEU A 1 229 ? -104.748 -76.811 -53.772  1.00 159.77 ? 236  LEU A CA    1 
ATOM 1798  C C     . LEU A 1 229 ? -105.756 -76.811 -52.622  1.00 159.95 ? 236  LEU A C     1 
ATOM 1799  O O     . LEU A 1 229 ? -106.765 -77.507 -52.676  1.00 159.95 ? 236  LEU A O     1 
ATOM 1800  C CB    . LEU A 1 229 ? -105.317 -76.126 -55.036  1.00 159.63 ? 236  LEU A CB    1 
ATOM 1801  C CG    . LEU A 1 229 ? -105.489 -76.792 -56.408  1.00 159.27 ? 236  LEU A CG    1 
ATOM 1802  C CD1   . LEU A 1 229 ? -106.329 -75.932 -57.320  1.00 158.90 ? 236  LEU A CD1   1 
ATOM 1803  C CD2   . LEU A 1 229 ? -104.160 -77.022 -57.071  1.00 159.43 ? 236  LEU A CD2   1 
ATOM 1804  N N     . VAL A 1 230 ? -105.457 -76.042 -51.578  1.00 160.21 ? 237  VAL A N     1 
ATOM 1805  C CA    . VAL A 1 230 ? -106.342 -75.922 -50.423  1.00 160.62 ? 237  VAL A CA    1 
ATOM 1806  C C     . VAL A 1 230 ? -107.121 -74.613 -50.523  1.00 160.98 ? 237  VAL A C     1 
ATOM 1807  O O     . VAL A 1 230 ? -106.545 -73.556 -50.795  1.00 161.01 ? 237  VAL A O     1 
ATOM 1808  C CB    . VAL A 1 230 ? -105.565 -76.022 -49.064  1.00 160.62 ? 237  VAL A CB    1 
ATOM 1809  C CG1   . VAL A 1 230 ? -106.431 -75.593 -47.871  1.00 160.53 ? 237  VAL A CG1   1 
ATOM 1810  C CG2   . VAL A 1 230 ? -105.042 -77.431 -48.842  1.00 160.42 ? 237  VAL A CG2   1 
ATOM 1811  N N     . CYS A 1 231 ? -108.434 -74.703 -50.324  1.00 161.37 ? 238  CYS A N     1 
ATOM 1812  C CA    . CYS A 1 231 ? -109.307 -73.537 -50.315  1.00 161.69 ? 238  CYS A CA    1 
ATOM 1813  C C     . CYS A 1 231 ? -109.239 -72.877 -48.944  1.00 162.10 ? 238  CYS A C     1 
ATOM 1814  O O     . CYS A 1 231 ? -109.357 -73.548 -47.921  1.00 162.28 ? 238  CYS A O     1 
ATOM 1815  C CB    . CYS A 1 231 ? -110.750 -73.947 -50.640  1.00 161.55 ? 238  CYS A CB    1 
ATOM 1816  S SG    . CYS A 1 231 ? -111.764 -72.660 -51.427  1.00 160.95 ? 238  CYS A SG    1 
ATOM 1817  N N     . SER A 1 232 ? -109.024 -71.568 -48.921  1.00 162.52 ? 239  SER A N     1 
ATOM 1818  C CA    . SER A 1 232 ? -109.163 -70.808 -47.687  1.00 162.88 ? 239  SER A CA    1 
ATOM 1819  C C     . SER A 1 232 ? -110.635 -70.782 -47.261  1.00 163.10 ? 239  SER A C     1 
ATOM 1820  O O     . SER A 1 232 ? -110.929 -70.772 -46.060  1.00 162.86 ? 239  SER A O     1 
ATOM 1821  C CB    . SER A 1 232 ? -108.612 -69.394 -47.863  1.00 162.94 ? 239  SER A CB    1 
ATOM 1822  O OG    . SER A 1 232 ? -109.007 -68.848 -49.112  1.00 163.09 ? 239  SER A OG    1 
ATOM 1823  N N     . VAL A 1 233 ? -111.538 -70.802 -48.257  1.00 163.61 ? 240  VAL A N     1 
ATOM 1824  C CA    . VAL A 1 233 ? -113.010 -70.734 -48.038  1.00 163.93 ? 240  VAL A CA    1 
ATOM 1825  C C     . VAL A 1 233 ? -113.594 -71.910 -47.226  1.00 164.22 ? 240  VAL A C     1 
ATOM 1826  O O     . VAL A 1 233 ? -114.019 -71.692 -46.089  1.00 164.33 ? 240  VAL A O     1 
ATOM 1827  C CB    . VAL A 1 233 ? -113.887 -70.303 -49.329  1.00 163.86 ? 240  VAL A CB    1 
ATOM 1828  C CG1   . VAL A 1 233 ? -113.219 -70.620 -50.665  1.00 163.64 ? 240  VAL A CG1   1 
ATOM 1829  C CG2   . VAL A 1 233 ? -115.318 -70.845 -49.275  1.00 163.49 ? 240  VAL A CG2   1 
ATOM 1830  N N     . THR A 1 234 ? -113.603 -73.134 -47.769  1.00 164.47 ? 241  THR A N     1 
ATOM 1831  C CA    . THR A 1 234 ? -114.087 -74.295 -46.979  1.00 164.71 ? 241  THR A CA    1 
ATOM 1832  C C     . THR A 1 234 ? -112.986 -75.032 -46.185  1.00 164.60 ? 241  THR A C     1 
ATOM 1833  O O     . THR A 1 234 ? -113.293 -75.818 -45.281  1.00 164.69 ? 241  THR A O     1 
ATOM 1834  C CB    . THR A 1 234 ? -114.992 -75.323 -47.787  1.00 164.83 ? 241  THR A CB    1 
ATOM 1835  O OG1   . THR A 1 234 ? -114.259 -75.903 -48.875  1.00 165.29 ? 241  THR A OG1   1 
ATOM 1836  C CG2   . THR A 1 234 ? -116.293 -74.675 -48.304  1.00 164.67 ? 241  THR A CG2   1 
ATOM 1837  N N     . GLY A 1 235 ? -111.720 -74.759 -46.503  1.00 164.42 ? 242  GLY A N     1 
ATOM 1838  C CA    . GLY A 1 235 ? -110.599 -75.474 -45.888  1.00 164.13 ? 242  GLY A CA    1 
ATOM 1839  C C     . GLY A 1 235 ? -110.234 -76.722 -46.678  1.00 164.02 ? 242  GLY A C     1 
ATOM 1840  O O     . GLY A 1 235 ? -109.110 -77.215 -46.574  1.00 164.02 ? 242  GLY A O     1 
ATOM 1841  N N     . MET A 1 236 ? -111.192 -77.208 -47.478  1.00 163.87 ? 243  MET A N     1 
ATOM 1842  C CA    . MET A 1 236 ? -111.084 -78.451 -48.268  1.00 163.67 ? 243  MET A CA    1 
ATOM 1843  C C     . MET A 1 236 ? -109.917 -78.435 -49.256  1.00 163.21 ? 243  MET A C     1 
ATOM 1844  O O     . MET A 1 236 ? -109.406 -77.373 -49.611  1.00 163.25 ? 243  MET A O     1 
ATOM 1845  C CB    . MET A 1 236 ? -112.400 -78.747 -49.026  1.00 163.84 ? 243  MET A CB    1 
ATOM 1846  C CG    . MET A 1 236 ? -113.613 -79.198 -48.167  1.00 164.94 ? 243  MET A CG    1 
ATOM 1847  S SD    . MET A 1 236 ? -113.573 -80.898 -47.485  1.00 167.13 ? 243  MET A SD    1 
ATOM 1848  C CE    . MET A 1 236 ? -115.216 -81.069 -46.778  1.00 166.59 ? 243  MET A CE    1 
ATOM 1849  N N     . ALA A 1 237 ? -109.512 -79.625 -49.695  1.00 162.65 ? 244  ALA A N     1 
ATOM 1850  C CA    . ALA A 1 237 ? -108.408 -79.792 -50.636  1.00 162.04 ? 244  ALA A CA    1 
ATOM 1851  C C     . ALA A 1 237 ? -108.764 -80.809 -51.717  1.00 161.60 ? 244  ALA A C     1 
ATOM 1852  O O     . ALA A 1 237 ? -109.434 -81.806 -51.433  1.00 161.63 ? 244  ALA A O     1 
ATOM 1853  C CB    . ALA A 1 237 ? -107.152 -80.231 -49.898  1.00 162.10 ? 244  ALA A CB    1 
ATOM 1854  N N     . LEU A 1 238 ? -108.320 -80.548 -52.949  1.00 160.91 ? 245  LEU A N     1 
ATOM 1855  C CA    . LEU A 1 238 ? -108.478 -81.491 -54.063  1.00 160.31 ? 245  LEU A CA    1 
ATOM 1856  C C     . LEU A 1 238 ? -107.292 -82.449 -54.105  1.00 160.00 ? 245  LEU A C     1 
ATOM 1857  O O     . LEU A 1 238 ? -106.188 -82.052 -53.725  1.00 159.99 ? 245  LEU A O     1 
ATOM 1858  C CB    . LEU A 1 238 ? -108.583 -80.748 -55.402  1.00 160.24 ? 245  LEU A CB    1 
ATOM 1859  C CG    . LEU A 1 238 ? -109.932 -80.197 -55.876  1.00 159.95 ? 245  LEU A CG    1 
ATOM 1860  C CD1   . LEU A 1 238 ? -109.760 -79.425 -57.176  1.00 159.24 ? 245  LEU A CD1   1 
ATOM 1861  C CD2   . LEU A 1 238 ? -110.976 -81.301 -56.037  1.00 159.60 ? 245  LEU A CD2   1 
ATOM 1862  N N     . PRO A 1 239 ? -107.507 -83.707 -54.571  1.00 159.61 ? 246  PRO A N     1 
ATOM 1863  C CA    . PRO A 1 239 ? -106.435 -84.693 -54.700  1.00 159.31 ? 246  PRO A CA    1 
ATOM 1864  C C     . PRO A 1 239 ? -105.226 -84.145 -55.447  1.00 159.04 ? 246  PRO A C     1 
ATOM 1865  O O     . PRO A 1 239 ? -105.329 -83.134 -56.130  1.00 159.07 ? 246  PRO A O     1 
ATOM 1866  C CB    . PRO A 1 239 ? -107.087 -85.802 -55.514  1.00 159.23 ? 246  PRO A CB    1 
ATOM 1867  C CG    . PRO A 1 239 ? -108.481 -85.751 -55.120  1.00 159.32 ? 246  PRO A CG    1 
ATOM 1868  C CD    . PRO A 1 239 ? -108.803 -84.296 -54.950  1.00 159.59 ? 246  PRO A CD    1 
ATOM 1869  N N     . ARG A 1 240 ? -104.087 -84.810 -55.306  1.00 158.63 ? 247  ARG A N     1 
ATOM 1870  C CA    . ARG A 1 240 ? -102.832 -84.311 -55.863  1.00 158.11 ? 247  ARG A CA    1 
ATOM 1871  C C     . ARG A 1 240 ? -102.962 -84.216 -57.381  1.00 157.78 ? 247  ARG A C     1 
ATOM 1872  O O     . ARG A 1 240 ? -103.231 -85.214 -58.038  1.00 157.97 ? 247  ARG A O     1 
ATOM 1873  C CB    . ARG A 1 240 ? -101.670 -85.220 -55.434  1.00 158.02 ? 247  ARG A CB    1 
ATOM 1874  C CG    . ARG A 1 240 ? -101.880 -85.869 -54.045  1.00 157.73 ? 247  ARG A CG    1 
ATOM 1875  C CD    . ARG A 1 240 ? -100.599 -86.407 -53.425  1.00 157.15 ? 247  ARG A CD    1 
ATOM 1876  N NE    . ARG A 1 240 ? -100.167 -87.657 -54.042  0.50 156.50 ? 247  ARG A NE    1 
ATOM 1877  C CZ    . ARG A 1 240 ? -99.238  -88.471 -53.548  0.50 155.89 ? 247  ARG A CZ    1 
ATOM 1878  N NH1   . ARG A 1 240 ? -98.623  -88.178 -52.412  0.50 155.81 ? 247  ARG A NH1   1 
ATOM 1879  N NH2   . ARG A 1 240 ? -98.925  -89.585 -54.195  0.50 155.32 ? 247  ARG A NH2   1 
ATOM 1880  N N     . LEU A 1 241 ? -102.825 -83.010 -57.927  1.00 157.18 ? 248  LEU A N     1 
ATOM 1881  C CA    . LEU A 1 241 ? -102.983 -82.789 -59.371  1.00 156.57 ? 248  LEU A CA    1 
ATOM 1882  C C     . LEU A 1 241 ? -101.651 -82.490 -60.045  1.00 156.11 ? 248  LEU A C     1 
ATOM 1883  O O     . LEU A 1 241 ? -100.688 -82.136 -59.384  1.00 156.27 ? 248  LEU A O     1 
ATOM 1884  C CB    . LEU A 1 241 ? -103.945 -81.631 -59.653  1.00 156.66 ? 248  LEU A CB    1 
ATOM 1885  C CG    . LEU A 1 241 ? -105.381 -81.529 -59.125  1.00 156.88 ? 248  LEU A CG    1 
ATOM 1886  C CD1   . LEU A 1 241 ? -106.098 -82.867 -59.141  1.00 157.14 ? 248  LEU A CD1   1 
ATOM 1887  C CD2   . LEU A 1 241 ? -105.422 -80.905 -57.737  1.00 157.25 ? 248  LEU A CD2   1 
ATOM 1888  N N     . ILE A 1 242 ? -101.597 -82.624 -61.363  1.00 155.50 ? 249  ILE A N     1 
ATOM 1889  C CA    . ILE A 1 242 ? -100.392 -82.291 -62.111  1.00 154.96 ? 249  ILE A CA    1 
ATOM 1890  C C     . ILE A 1 242 ? -100.743 -81.279 -63.188  1.00 154.82 ? 249  ILE A C     1 
ATOM 1891  O O     . ILE A 1 242 ? -101.492 -81.579 -64.109  1.00 154.78 ? 249  ILE A O     1 
ATOM 1892  C CB    . ILE A 1 242 ? -99.726  -83.551 -62.722  1.00 154.93 ? 249  ILE A CB    1 
ATOM 1893  C CG1   . ILE A 1 242 ? -99.124  -84.432 -61.616  1.00 154.74 ? 249  ILE A CG1   1 
ATOM 1894  C CG2   . ILE A 1 242 ? -98.662  -83.159 -63.743  1.00 154.79 ? 249  ILE A CG2   1 
ATOM 1895  C CD1   . ILE A 1 242 ? -98.837  -85.879 -62.008  1.00 153.95 ? 249  ILE A CD1   1 
ATOM 1896  N N     . ILE A 1 243 ? -100.210 -80.071 -63.057  1.00 154.71 ? 250  ILE A N     1 
ATOM 1897  C CA    . ILE A 1 243 ? -100.496 -78.994 -64.003  1.00 154.65 ? 250  ILE A CA    1 
ATOM 1898  C C     . ILE A 1 243 ? -99.711  -79.147 -65.287  1.00 154.69 ? 250  ILE A C     1 
ATOM 1899  O O     . ILE A 1 243 ? -98.499  -79.278 -65.259  1.00 154.74 ? 250  ILE A O     1 
ATOM 1900  C CB    . ILE A 1 243 ? -100.186 -77.592 -63.421  1.00 154.58 ? 250  ILE A CB    1 
ATOM 1901  C CG1   . ILE A 1 243 ? -98.961  -77.645 -62.511  1.00 154.52 ? 250  ILE A CG1   1 
ATOM 1902  C CG2   . ILE A 1 243 ? -101.391 -77.032 -62.691  1.00 154.10 ? 250  ILE A CG2   1 
ATOM 1903  C CD1   . ILE A 1 243 ? -98.295  -76.329 -62.319  1.00 154.64 ? 250  ILE A CD1   1 
ATOM 1904  N N     . ARG A 1 244 ? -100.406 -79.123 -66.416  1.00 154.80 ? 251  ARG A N     1 
ATOM 1905  C CA    . ARG A 1 244 ? -99.735  -79.136 -67.713  1.00 155.16 ? 251  ARG A CA    1 
ATOM 1906  C C     . ARG A 1 244 ? -100.334 -78.076 -68.640  1.00 155.13 ? 251  ARG A C     1 
ATOM 1907  O O     . ARG A 1 244 ? -101.518 -77.771 -68.537  1.00 155.10 ? 251  ARG A O     1 
ATOM 1908  C CB    . ARG A 1 244 ? -99.795  -80.532 -68.353  1.00 155.28 ? 251  ARG A CB    1 
ATOM 1909  C CG    . ARG A 1 244 ? -99.733  -81.694 -67.357  1.00 155.78 ? 251  ARG A CG    1 
ATOM 1910  C CD    . ARG A 1 244 ? -99.251  -83.006 -67.978  1.00 156.03 ? 251  ARG A CD    1 
ATOM 1911  N NE    . ARG A 1 244 ? -99.862  -84.164 -67.321  1.00 155.73 ? 251  ARG A NE    1 
ATOM 1912  C CZ    . ARG A 1 244 ? -99.304  -85.366 -67.219  1.00 155.36 ? 251  ARG A CZ    1 
ATOM 1913  N NH1   . ARG A 1 244 ? -98.094  -85.598 -67.723  1.00 155.36 ? 251  ARG A NH1   1 
ATOM 1914  N NH2   . ARG A 1 244 ? -99.961  -86.336 -66.598  1.00 154.81 ? 251  ARG A NH2   1 
ATOM 1915  N N     . LYS A 1 245 ? -99.515  -77.526 -69.536  1.00 155.15 ? 252  LYS A N     1 
ATOM 1916  C CA    . LYS A 1 245 ? -99.933  -76.478 -70.468  1.00 155.39 ? 252  LYS A CA    1 
ATOM 1917  C C     . LYS A 1 245 ? -101.055 -76.975 -71.384  1.00 155.81 ? 252  LYS A C     1 
ATOM 1918  O O     . LYS A 1 245 ? -101.410 -78.147 -71.336  1.00 155.87 ? 252  LYS A O     1 
ATOM 1919  C CB    . LYS A 1 245 ? -98.730  -76.006 -71.287  1.00 155.25 ? 252  LYS A CB    1 
ATOM 1920  C CG    . LYS A 1 245 ? -98.843  -74.598 -71.826  1.00 155.30 ? 252  LYS A CG    1 
ATOM 1921  C CD    . LYS A 1 245 ? -97.536  -74.113 -72.424  1.00 155.65 ? 252  LYS A CD    1 
ATOM 1922  C CE    . LYS A 1 245 ? -97.748  -72.801 -73.157  1.00 156.21 ? 252  LYS A CE    1 
ATOM 1923  N NZ    . LYS A 1 245 ? -96.480  -72.076 -73.416  1.00 156.39 ? 252  LYS A NZ    1 
ATOM 1924  N N     . VAL A 1 246 ? -101.636 -76.086 -72.189  1.00 156.36 ? 253  VAL A N     1 
ATOM 1925  C CA    . VAL A 1 246 ? -102.603 -76.499 -73.213  1.00 156.78 ? 253  VAL A CA    1 
ATOM 1926  C C     . VAL A 1 246 ? -102.577 -75.614 -74.465  1.00 157.27 ? 253  VAL A C     1 
ATOM 1927  O O     . VAL A 1 246 ? -102.583 -74.388 -74.375  1.00 157.16 ? 253  VAL A O     1 
ATOM 1928  C CB    . VAL A 1 246 ? -104.045 -76.696 -72.643  1.00 156.60 ? 253  VAL A CB    1 
ATOM 1929  C CG1   . VAL A 1 246 ? -104.606 -75.423 -72.127  1.00 156.57 ? 253  VAL A CG1   1 
ATOM 1930  C CG2   . VAL A 1 246 ? -104.965 -77.245 -73.696  1.00 156.83 ? 253  VAL A CG2   1 
ATOM 1931  N N     . ASP A 1 247 ? -102.515 -76.265 -75.625  1.00 158.06 ? 254  ASP A N     1 
ATOM 1932  C CA    . ASP A 1 247 ? -102.601 -75.610 -76.931  1.00 158.73 ? 254  ASP A CA    1 
ATOM 1933  C C     . ASP A 1 247 ? -103.672 -76.314 -77.778  1.00 159.21 ? 254  ASP A C     1 
ATOM 1934  O O     . ASP A 1 247 ? -103.596 -77.528 -77.993  1.00 159.29 ? 254  ASP A O     1 
ATOM 1935  C CB    . ASP A 1 247 ? -101.242 -75.648 -77.640  1.00 158.61 ? 254  ASP A CB    1 
ATOM 1936  C CG    . ASP A 1 247 ? -101.182 -74.731 -78.858  1.00 158.56 ? 254  ASP A CG    1 
ATOM 1937  O OD1   . ASP A 1 247 ? -100.096 -74.641 -79.472  1.00 158.48 ? 254  ASP A OD1   1 
ATOM 1938  O OD2   . ASP A 1 247 ? -102.205 -74.097 -79.207  1.00 158.11 ? 254  ASP A OD2   1 
ATOM 1939  N N     . LYS A 1 248 ? -104.659 -75.543 -78.246  1.00 159.65 ? 255  LYS A N     1 
ATOM 1940  C CA    . LYS A 1 248 ? -105.814 -76.067 -78.995  1.00 159.99 ? 255  LYS A CA    1 
ATOM 1941  C C     . LYS A 1 248 ? -106.396 -77.352 -78.383  1.00 160.24 ? 255  LYS A C     1 
ATOM 1942  O O     . LYS A 1 248 ? -106.347 -78.417 -78.998  1.00 160.32 ? 255  LYS A O     1 
ATOM 1943  C CB    . LYS A 1 248 ? -105.464 -76.267 -80.482  1.00 159.98 ? 255  LYS A CB    1 
ATOM 1944  C CG    . LYS A 1 248 ? -106.135 -75.298 -81.461  1.00 160.04 ? 255  LYS A CG    1 
ATOM 1945  C CD    . LYS A 1 248 ? -105.241 -74.134 -81.847  1.00 160.04 ? 255  LYS A CD    1 
ATOM 1946  C CE    . LYS A 1 248 ? -105.433 -72.945 -80.925  1.00 159.99 ? 255  LYS A CE    1 
ATOM 1947  N NZ    . LYS A 1 248 ? -104.648 -71.772 -81.394  1.00 160.06 ? 255  LYS A NZ    1 
ATOM 1948  N N     . GLN A 1 249 ? -106.945 -77.233 -77.173  1.00 160.55 ? 256  GLN A N     1 
ATOM 1949  C CA    . GLN A 1 249 ? -107.473 -78.366 -76.376  1.00 160.88 ? 256  GLN A CA    1 
ATOM 1950  C C     . GLN A 1 249 ? -106.661 -79.674 -76.426  1.00 161.07 ? 256  GLN A C     1 
ATOM 1951  O O     . GLN A 1 249 ? -107.230 -80.771 -76.459  1.00 160.89 ? 256  GLN A O     1 
ATOM 1952  C CB    . GLN A 1 249 ? -108.978 -78.607 -76.624  1.00 160.90 ? 256  GLN A CB    1 
ATOM 1953  C CG    . GLN A 1 249 ? -109.366 -79.198 -77.988  1.00 161.27 ? 256  GLN A CG    1 
ATOM 1954  C CD    . GLN A 1 249 ? -109.869 -78.152 -78.981  1.00 161.30 ? 256  GLN A CD    1 
ATOM 1955  O OE1   . GLN A 1 249 ? -109.228 -77.877 -79.997  1.00 161.12 ? 256  GLN A OE1   1 
ATOM 1956  N NE2   . GLN A 1 249 ? -111.022 -77.569 -78.687  1.00 161.31 ? 256  GLN A NE2   1 
ATOM 1957  N N     . THR A 1 250 ? -105.331 -79.537 -76.431  1.00 161.42 ? 257  THR A N     1 
ATOM 1958  C CA    . THR A 1 250 ? -104.397 -80.667 -76.285  1.00 161.65 ? 257  THR A CA    1 
ATOM 1959  C C     . THR A 1 250 ? -103.396 -80.372 -75.171  1.00 161.57 ? 257  THR A C     1 
ATOM 1960  O O     . THR A 1 250 ? -102.697 -79.363 -75.221  1.00 161.79 ? 257  THR A O     1 
ATOM 1961  C CB    . THR A 1 250 ? -103.613 -81.000 -77.601  1.00 161.76 ? 257  THR A CB    1 
ATOM 1962  O OG1   . THR A 1 250 ? -102.792 -79.891 -77.991  1.00 161.75 ? 257  THR A OG1   1 
ATOM 1963  C CG2   . THR A 1 250 ? -104.561 -81.365 -78.746  1.00 162.13 ? 257  THR A CG2   1 
ATOM 1964  N N     . ALA A 1 251 ? -103.321 -81.253 -74.179  1.00 161.40 ? 258  ALA A N     1 
ATOM 1965  C CA    . ALA A 1 251 ? -102.503 -81.017 -72.984  1.00 161.29 ? 258  ALA A CA    1 
ATOM 1966  C C     . ALA A 1 251 ? -101.069 -81.573 -73.050  1.00 161.21 ? 258  ALA A C     1 
ATOM 1967  O O     . ALA A 1 251 ? -100.812 -82.681 -72.577  1.00 161.06 ? 258  ALA A O     1 
ATOM 1968  C CB    . ALA A 1 251 ? -103.223 -81.554 -71.755  1.00 161.35 ? 258  ALA A CB    1 
ATOM 1969  N N     . LEU A 1 252 ? -100.142 -80.785 -73.601  1.00 161.22 ? 259  LEU A N     1 
ATOM 1970  C CA    . LEU A 1 252 ? -98.733  -81.198 -73.772  1.00 161.46 ? 259  LEU A CA    1 
ATOM 1971  C C     . LEU A 1 252 ? -98.056  -81.646 -72.449  1.00 161.77 ? 259  LEU A C     1 
ATOM 1972  O O     . LEU A 1 252 ? -97.827  -80.826 -71.556  1.00 162.01 ? 259  LEU A O     1 
ATOM 1973  C CB    . LEU A 1 252 ? -97.897  -80.085 -74.437  1.00 161.19 ? 259  LEU A CB    1 
ATOM 1974  C CG    . LEU A 1 252 ? -98.458  -78.784 -75.020  1.00 160.75 ? 259  LEU A CG    1 
ATOM 1975  C CD1   . LEU A 1 252 ? -97.302  -77.911 -75.468  1.00 160.83 ? 259  LEU A CD1   1 
ATOM 1976  C CD2   . LEU A 1 252 ? -99.410  -78.996 -76.172  1.00 160.54 ? 259  LEU A CD2   1 
ATOM 1977  N N     . LEU A 1 253 ? -97.731  -82.938 -72.330  1.00 161.94 ? 260  LEU A N     1 
ATOM 1978  C CA    . LEU A 1 253 ? -97.214  -83.495 -71.068  1.00 161.96 ? 260  LEU A CA    1 
ATOM 1979  C C     . LEU A 1 253 ? -95.837  -82.967 -70.698  1.00 161.93 ? 260  LEU A C     1 
ATOM 1980  O O     . LEU A 1 253 ? -95.503  -82.852 -69.516  1.00 161.89 ? 260  LEU A O     1 
ATOM 1981  C CB    . LEU A 1 253 ? -97.179  -85.031 -71.090  1.00 162.02 ? 260  LEU A CB    1 
ATOM 1982  C CG    . LEU A 1 253 ? -98.401  -85.927 -71.356  1.00 162.19 ? 260  LEU A CG    1 
ATOM 1983  C CD1   . LEU A 1 253 ? -98.110  -87.333 -70.848  1.00 162.25 ? 260  LEU A CD1   1 
ATOM 1984  C CD2   . LEU A 1 253 ? -99.705  -85.412 -70.753  1.00 162.66 ? 260  LEU A CD2   1 
ATOM 1985  N N     . ASP A 1 254 ? -95.046  -82.646 -71.715  1.00 161.98 ? 261  ASP A N     1 
ATOM 1986  C CA    . ASP A 1 254 ? -93.677  -82.198 -71.509  1.00 162.18 ? 261  ASP A CA    1 
ATOM 1987  C C     . ASP A 1 254 ? -93.516  -80.689 -71.658  1.00 162.14 ? 261  ASP A C     1 
ATOM 1988  O O     . ASP A 1 254 ? -92.812  -80.219 -72.559  1.00 162.21 ? 261  ASP A O     1 
ATOM 1989  C CB    . ASP A 1 254 ? -92.732  -82.926 -72.466  1.00 162.32 ? 261  ASP A CB    1 
ATOM 1990  C CG    . ASP A 1 254 ? -92.658  -84.406 -72.192  1.00 162.92 ? 261  ASP A CG    1 
ATOM 1991  O OD1   . ASP A 1 254 ? -92.656  -85.187 -73.166  1.00 163.66 ? 261  ASP A OD1   1 
ATOM 1992  O OD2   . ASP A 1 254 ? -92.606  -84.790 -71.003  1.00 163.52 ? 261  ASP A OD2   1 
ATOM 1993  N N     . ALA A 1 255 ? -94.171  -79.937 -70.773  1.00 161.99 ? 262  ALA A N     1 
ATOM 1994  C CA    . ALA A 1 255 ? -94.005  -78.486 -70.711  1.00 161.67 ? 262  ALA A CA    1 
ATOM 1995  C C     . ALA A 1 255 ? -93.110  -78.122 -69.527  1.00 161.53 ? 262  ALA A C     1 
ATOM 1996  O O     . ALA A 1 255 ? -93.516  -78.228 -68.368  1.00 161.51 ? 262  ALA A O     1 
ATOM 1997  C CB    . ALA A 1 255 ? -95.345  -77.803 -70.611  1.00 161.65 ? 262  ALA A CB    1 
ATOM 1998  N N     . ASP A 1 256 ? -91.882  -77.712 -69.839  1.00 161.26 ? 263  ASP A N     1 
ATOM 1999  C CA    . ASP A 1 256 ? -90.839  -77.464 -68.834  1.00 160.79 ? 263  ASP A CA    1 
ATOM 2000  C C     . ASP A 1 256 ? -90.723  -75.991 -68.441  1.00 160.24 ? 263  ASP A C     1 
ATOM 2001  O O     . ASP A 1 256 ? -89.857  -75.636 -67.641  1.00 160.27 ? 263  ASP A O     1 
ATOM 2002  C CB    . ASP A 1 256 ? -89.466  -78.017 -69.298  1.00 160.94 ? 263  ASP A CB    1 
ATOM 2003  C CG    . ASP A 1 256 ? -89.007  -77.452 -70.665  1.00 161.22 ? 263  ASP A CG    1 
ATOM 2004  O OD1   . ASP A 1 256 ? -88.831  -76.219 -70.801  1.00 161.66 ? 263  ASP A OD1   1 
ATOM 2005  O OD2   . ASP A 1 256 ? -88.797  -78.253 -71.604  1.00 160.85 ? 263  ASP A OD2   1 
ATOM 2006  N N     . ASP A 1 257 ? -91.584  -75.144 -69.011  1.00 159.44 ? 264  ASP A N     1 
ATOM 2007  C CA    . ASP A 1 257 ? -91.587  -73.702 -68.712  1.00 158.59 ? 264  ASP A CA    1 
ATOM 2008  C C     . ASP A 1 257 ? -92.441  -73.366 -67.466  1.00 157.88 ? 264  ASP A C     1 
ATOM 2009  O O     . ASP A 1 257 ? -93.245  -74.200 -67.024  1.00 157.77 ? 264  ASP A O     1 
ATOM 2010  C CB    . ASP A 1 257 ? -91.992  -72.858 -69.944  1.00 158.52 ? 264  ASP A CB    1 
ATOM 2011  C CG    . ASP A 1 257 ? -93.202  -73.412 -70.670  1.00 158.32 ? 264  ASP A CG    1 
ATOM 2012  O OD1   . ASP A 1 257 ? -93.080  -74.493 -71.282  1.00 159.02 ? 264  ASP A OD1   1 
ATOM 2013  O OD2   . ASP A 1 257 ? -94.267  -72.762 -70.644  1.00 157.21 ? 264  ASP A OD2   1 
ATOM 2014  N N     . PRO A 1 258 ? -92.247  -72.158 -66.885  1.00 157.06 ? 265  PRO A N     1 
ATOM 2015  C CA    . PRO A 1 258 ? -92.984  -71.743 -65.693  1.00 156.27 ? 265  PRO A CA    1 
ATOM 2016  C C     . PRO A 1 258 ? -94.346  -71.120 -66.014  1.00 155.44 ? 265  PRO A C     1 
ATOM 2017  O O     . PRO A 1 258 ? -94.460  -70.324 -66.957  1.00 155.36 ? 265  PRO A O     1 
ATOM 2018  C CB    . PRO A 1 258 ? -92.063  -70.692 -65.054  1.00 156.42 ? 265  PRO A CB    1 
ATOM 2019  C CG    . PRO A 1 258 ? -90.901  -70.502 -66.014  1.00 156.80 ? 265  PRO A CG    1 
ATOM 2020  C CD    . PRO A 1 258 ? -91.293  -71.116 -67.304  1.00 157.03 ? 265  PRO A CD    1 
ATOM 2021  N N     . VAL A 1 259 ? -95.359  -71.483 -65.223  1.00 154.37 ? 266  VAL A N     1 
ATOM 2022  C CA    . VAL A 1 259 ? -96.734  -71.003 -65.391  1.00 153.21 ? 266  VAL A CA    1 
ATOM 2023  C C     . VAL A 1 259 ? -96.778  -69.484 -65.335  1.00 152.91 ? 266  VAL A C     1 
ATOM 2024  O O     . VAL A 1 259 ? -96.565  -68.902 -64.281  1.00 153.11 ? 266  VAL A O     1 
ATOM 2025  C CB    . VAL A 1 259 ? -97.668  -71.542 -64.281  1.00 152.92 ? 266  VAL A CB    1 
ATOM 2026  C CG1   . VAL A 1 259 ? -99.081  -71.077 -64.505  1.00 152.48 ? 266  VAL A CG1   1 
ATOM 2027  C CG2   . VAL A 1 259 ? -97.623  -73.037 -64.209  1.00 152.35 ? 266  VAL A CG2   1 
ATOM 2028  N N     . SER A 1 260 ? -97.038  -68.843 -66.468  1.00 152.38 ? 267  SER A N     1 
ATOM 2029  C CA    . SER A 1 260 ? -97.199  -67.392 -66.494  1.00 151.80 ? 267  SER A CA    1 
ATOM 2030  C C     . SER A 1 260 ? -98.660  -67.026 -66.224  1.00 151.51 ? 267  SER A C     1 
ATOM 2031  O O     . SER A 1 260 ? -99.510  -67.906 -66.097  1.00 151.47 ? 267  SER A O     1 
ATOM 2032  C CB    . SER A 1 260 ? -96.692  -66.815 -67.816  1.00 151.85 ? 267  SER A CB    1 
ATOM 2033  O OG    . SER A 1 260 ? -96.810  -65.406 -67.851  1.00 151.59 ? 267  SER A OG    1 
ATOM 2034  N N     . GLN A 1 261 ? -98.946  -65.733 -66.127  1.00 151.22 ? 268  GLN A N     1 
ATOM 2035  C CA    . GLN A 1 261 ? -100.245 -65.261 -65.649  1.00 150.90 ? 268  GLN A CA    1 
ATOM 2036  C C     . GLN A 1 261 ? -101.285 -65.276 -66.747  1.00 151.00 ? 268  GLN A C     1 
ATOM 2037  O O     . GLN A 1 261 ? -101.005 -64.855 -67.865  1.00 150.92 ? 268  GLN A O     1 
ATOM 2038  C CB    . GLN A 1 261 ? -100.115 -63.853 -65.059  1.00 150.83 ? 268  GLN A CB    1 
ATOM 2039  C CG    . GLN A 1 261 ? -101.203 -63.458 -64.064  1.00 149.68 ? 268  GLN A CG    1 
ATOM 2040  C CD    . GLN A 1 261 ? -100.973 -63.938 -62.629  1.00 148.40 ? 268  GLN A CD    1 
ATOM 2041  O OE1   . GLN A 1 261 ? -101.858 -63.830 -61.794  1.00 147.81 ? 268  GLN A OE1   1 
ATOM 2042  N NE2   . GLN A 1 261 ? -99.793  -64.460 -62.343  1.00 148.38 ? 268  GLN A NE2   1 
ATOM 2043  N N     . LEU A 1 262 ? -102.483 -65.749 -66.396  1.00 151.31 ? 269  LEU A N     1 
ATOM 2044  C CA    . LEU A 1 262 ? -103.623 -65.944 -67.317  1.00 151.71 ? 269  LEU A CA    1 
ATOM 2045  C C     . LEU A 1 262 ? -103.328 -66.981 -68.402  1.00 152.28 ? 269  LEU A C     1 
ATOM 2046  O O     . LEU A 1 262 ? -103.448 -66.701 -69.598  1.00 152.50 ? 269  LEU A O     1 
ATOM 2047  C CB    . LEU A 1 262 ? -104.122 -64.619 -67.938  1.00 151.49 ? 269  LEU A CB    1 
ATOM 2048  C CG    . LEU A 1 262 ? -105.146 -63.705 -67.247  1.00 150.82 ? 269  LEU A CG    1 
ATOM 2049  C CD1   . LEU A 1 262 ? -105.517 -62.543 -68.150  1.00 150.43 ? 269  LEU A CD1   1 
ATOM 2050  C CD2   . LEU A 1 262 ? -106.403 -64.446 -66.833  1.00 150.12 ? 269  LEU A CD2   1 
ATOM 2051  N N     . HIS A 1 263 ? -102.943 -68.179 -67.979  1.00 152.77 ? 270  HIS A N     1 
ATOM 2052  C CA    . HIS A 1 263 ? -102.526 -69.224 -68.909  1.00 153.28 ? 270  HIS A CA    1 
ATOM 2053  C C     . HIS A 1 263 ? -103.513 -70.377 -68.867  1.00 153.71 ? 270  HIS A C     1 
ATOM 2054  O O     . HIS A 1 263 ? -104.003 -70.739 -67.802  1.00 153.86 ? 270  HIS A O     1 
ATOM 2055  C CB    . HIS A 1 263 ? -101.123 -69.722 -68.541  1.00 153.26 ? 270  HIS A CB    1 
ATOM 2056  C CG    . HIS A 1 263 ? -100.016 -69.114 -69.348  1.00 153.10 ? 270  HIS A CG    1 
ATOM 2057  N ND1   . HIS A 1 263 ? -98.770  -69.693 -69.443  1.00 152.96 ? 270  HIS A ND1   1 
ATOM 2058  C CD2   . HIS A 1 263 ? -99.966  -67.991 -70.103  1.00 153.16 ? 270  HIS A CD2   1 
ATOM 2059  C CE1   . HIS A 1 263 ? -97.998  -68.950 -70.216  1.00 153.12 ? 270  HIS A CE1   1 
ATOM 2060  N NE2   . HIS A 1 263 ? -98.700  -67.910 -70.629  1.00 153.18 ? 270  HIS A NE2   1 
ATOM 2061  N N     . LYS A 1 264 ? -103.804 -70.951 -70.026  1.00 154.24 ? 271  LYS A N     1 
ATOM 2062  C CA    . LYS A 1 264 ? -104.698 -72.097 -70.099  1.00 154.75 ? 271  LYS A CA    1 
ATOM 2063  C C     . LYS A 1 264 ? -103.924 -73.338 -69.681  1.00 155.02 ? 271  LYS A C     1 
ATOM 2064  O O     . LYS A 1 264 ? -102.742 -73.441 -69.969  1.00 154.94 ? 271  LYS A O     1 
ATOM 2065  C CB    . LYS A 1 264 ? -105.244 -72.264 -71.520  1.00 154.90 ? 271  LYS A CB    1 
ATOM 2066  C CG    . LYS A 1 264 ? -105.671 -70.983 -72.223  1.00 155.33 ? 271  LYS A CG    1 
ATOM 2067  C CD    . LYS A 1 264 ? -107.118 -70.669 -71.942  1.00 156.32 ? 271  LYS A CD    1 
ATOM 2068  C CE    . LYS A 1 264 ? -107.497 -69.315 -72.513  1.00 156.76 ? 271  LYS A CE    1 
ATOM 2069  N NZ    . LYS A 1 264 ? -108.972 -69.100 -72.421  1.00 157.23 ? 271  LYS A NZ    1 
ATOM 2070  N N     . CYS A 1 265 ? -104.589 -74.281 -69.020  1.00 155.69 ? 272  CYS A N     1 
ATOM 2071  C CA    . CYS A 1 265 ? -103.931 -75.490 -68.531  1.00 156.52 ? 272  CYS A CA    1 
ATOM 2072  C C     . CYS A 1 265 ? -104.909 -76.622 -68.228  1.00 156.97 ? 272  CYS A C     1 
ATOM 2073  O O     . CYS A 1 265 ? -106.097 -76.508 -68.482  1.00 157.04 ? 272  CYS A O     1 
ATOM 2074  C CB    . CYS A 1 265 ? -103.189 -75.164 -67.250  1.00 156.58 ? 272  CYS A CB    1 
ATOM 2075  S SG    . CYS A 1 265 ? -104.320 -75.116 -65.862  1.00 157.45 ? 272  CYS A SG    1 
ATOM 2076  N N     . ALA A 1 266 ? -104.400 -77.705 -67.648  1.00 157.71 ? 273  ALA A N     1 
ATOM 2077  C CA    . ALA A 1 266 ? -105.235 -78.829 -67.235  1.00 158.54 ? 273  ALA A CA    1 
ATOM 2078  C C     . ALA A 1 266 ? -104.595 -79.599 -66.080  1.00 159.23 ? 273  ALA A C     1 
ATOM 2079  O O     . ALA A 1 266 ? -103.366 -79.612 -65.942  1.00 159.21 ? 273  ALA A O     1 
ATOM 2080  C CB    . ALA A 1 266 ? -105.495 -79.746 -68.411  1.00 158.52 ? 273  ALA A CB    1 
ATOM 2081  N N     . PHE A 1 267 ? -105.434 -80.251 -65.272  1.00 160.12 ? 274  PHE A N     1 
ATOM 2082  C CA    . PHE A 1 267 ? -104.998 -80.934 -64.048  1.00 161.11 ? 274  PHE A CA    1 
ATOM 2083  C C     . PHE A 1 267 ? -105.149 -82.459 -64.091  1.00 161.96 ? 274  PHE A C     1 
ATOM 2084  O O     . PHE A 1 267 ? -106.244 -82.983 -63.891  1.00 162.22 ? 274  PHE A O     1 
ATOM 2085  C CB    . PHE A 1 267 ? -105.780 -80.398 -62.848  1.00 160.93 ? 274  PHE A CB    1 
ATOM 2086  C CG    . PHE A 1 267 ? -105.461 -78.980 -62.492  1.00 161.01 ? 274  PHE A CG    1 
ATOM 2087  C CD1   . PHE A 1 267 ? -104.800 -78.689 -61.317  1.00 161.27 ? 274  PHE A CD1   1 
ATOM 2088  C CD2   . PHE A 1 267 ? -105.832 -77.930 -63.317  1.00 161.07 ? 274  PHE A CD2   1 
ATOM 2089  C CE1   . PHE A 1 267 ? -104.508 -77.383 -60.972  1.00 161.23 ? 274  PHE A CE1   1 
ATOM 2090  C CE2   . PHE A 1 267 ? -105.539 -76.626 -62.978  1.00 160.75 ? 274  PHE A CE2   1 
ATOM 2091  C CZ    . PHE A 1 267 ? -104.876 -76.355 -61.808  1.00 160.86 ? 274  PHE A CZ    1 
ATOM 2092  N N     . TYR A 1 268 ? -104.048 -83.167 -64.334  1.00 162.98 ? 275  TYR A N     1 
ATOM 2093  C CA    . TYR A 1 268 ? -104.031 -84.628 -64.283  1.00 163.99 ? 275  TYR A CA    1 
ATOM 2094  C C     . TYR A 1 268 ? -104.125 -85.067 -62.820  1.00 164.73 ? 275  TYR A C     1 
ATOM 2095  O O     . TYR A 1 268 ? -103.247 -84.755 -62.015  1.00 164.93 ? 275  TYR A O     1 
ATOM 2096  C CB    . TYR A 1 268 ? -102.754 -85.170 -64.969  1.00 163.99 ? 275  TYR A CB    1 
ATOM 2097  C CG    . TYR A 1 268 ? -102.497 -86.669 -64.852  1.00 164.11 ? 275  TYR A CG    1 
ATOM 2098  C CD1   . TYR A 1 268 ? -103.093 -87.571 -65.729  1.00 164.57 ? 275  TYR A CD1   1 
ATOM 2099  C CD2   . TYR A 1 268 ? -101.632 -87.178 -63.886  1.00 164.00 ? 275  TYR A CD2   1 
ATOM 2100  C CE1   . TYR A 1 268 ? -102.856 -88.943 -65.631  1.00 164.39 ? 275  TYR A CE1   1 
ATOM 2101  C CE2   . TYR A 1 268 ? -101.389 -88.542 -63.781  1.00 164.15 ? 275  TYR A CE2   1 
ATOM 2102  C CZ    . TYR A 1 268 ? -102.006 -89.417 -64.658  1.00 164.23 ? 275  TYR A CZ    1 
ATOM 2103  O OH    . TYR A 1 268 ? -101.781 -90.768 -64.567  1.00 164.08 ? 275  TYR A OH    1 
ATOM 2104  N N     . LEU A 1 269 ? -105.214 -85.746 -62.467  1.00 165.58 ? 276  LEU A N     1 
ATOM 2105  C CA    . LEU A 1 269 ? -105.300 -86.418 -61.179  1.00 166.47 ? 276  LEU A CA    1 
ATOM 2106  C C     . LEU A 1 269 ? -104.207 -87.479 -61.172  1.00 167.28 ? 276  LEU A C     1 
ATOM 2107  O O     . LEU A 1 269 ? -104.188 -88.341 -62.047  1.00 167.44 ? 276  LEU A O     1 
ATOM 2108  C CB    . LEU A 1 269 ? -106.663 -87.096 -61.011  1.00 166.33 ? 276  LEU A CB    1 
ATOM 2109  C CG    . LEU A 1 269 ? -107.964 -86.390 -60.623  1.00 165.98 ? 276  LEU A CG    1 
ATOM 2110  C CD1   . LEU A 1 269 ? -108.027 -86.160 -59.125  1.00 166.09 ? 276  LEU A CD1   1 
ATOM 2111  C CD2   . LEU A 1 269 ? -108.183 -85.102 -61.396  1.00 165.59 ? 276  LEU A CD2   1 
ATOM 2112  N N     . LYS A 1 270 ? -103.285 -87.397 -60.216  1.00 168.36 ? 277  LYS A N     1 
ATOM 2113  C CA    . LYS A 1 270 ? -102.211 -88.390 -60.087  1.00 169.56 ? 277  LYS A CA    1 
ATOM 2114  C C     . LYS A 1 270 ? -102.781 -89.799 -59.921  1.00 170.17 ? 277  LYS A C     1 
ATOM 2115  O O     . LYS A 1 270 ? -103.761 -89.996 -59.190  1.00 170.35 ? 277  LYS A O     1 
ATOM 2116  C CB    . LYS A 1 270 ? -101.298 -88.082 -58.885  1.00 169.70 ? 277  LYS A CB    1 
ATOM 2117  C CG    . LYS A 1 270 ? -102.010 -88.167 -57.506  1.00 170.58 ? 277  LYS A CG    1 
ATOM 2118  C CD    . LYS A 1 270 ? -101.394 -89.201 -56.540  1.00 171.31 ? 277  LYS A CD    1 
ATOM 2119  C CE    . LYS A 1 270 ? -102.359 -89.516 -55.389  1.00 171.39 ? 277  LYS A CE    1 
ATOM 2120  N NZ    . LYS A 1 270 ? -101.749 -90.313 -54.291  1.00 171.36 ? 277  LYS A NZ    1 
ATOM 2121  N N     . ASP A 1 271 ? -102.168 -90.766 -60.600  1.00 170.84 ? 278  ASP A N     1 
ATOM 2122  C CA    . ASP A 1 271 ? -102.464 -92.185 -60.387  1.00 171.58 ? 278  ASP A CA    1 
ATOM 2123  C C     . ASP A 1 271 ? -103.963 -92.556 -60.508  1.00 172.11 ? 278  ASP A C     1 
ATOM 2124  O O     . ASP A 1 271 ? -104.494 -93.258 -59.638  1.00 172.19 ? 278  ASP A O     1 
ATOM 2125  C CB    . ASP A 1 271 ? -101.893 -92.649 -59.024  1.00 171.57 ? 278  ASP A CB    1 
ATOM 2126  C CG    . ASP A 1 271 ? -100.431 -92.219 -58.796  1.00 171.65 ? 278  ASP A CG    1 
ATOM 2127  O OD1   . ASP A 1 271 ? -99.950  -92.325 -57.644  1.00 170.95 ? 278  ASP A OD1   1 
ATOM 2128  O OD2   . ASP A 1 271 ? -99.761  -91.779 -59.756  1.00 171.94 ? 278  ASP A OD2   1 
ATOM 2129  N N     . THR A 1 272 ? -104.630 -92.091 -61.576  1.00 172.80 ? 279  THR A N     1 
ATOM 2130  C CA    . THR A 1 272 ? -106.066 -92.397 -61.843  1.00 173.45 ? 279  THR A CA    1 
ATOM 2131  C C     . THR A 1 272 ? -106.365 -92.847 -63.287  1.00 173.87 ? 279  THR A C     1 
ATOM 2132  O O     . THR A 1 272 ? -107.480 -92.663 -63.792  1.00 174.04 ? 279  THR A O     1 
ATOM 2133  C CB    . THR A 1 272 ? -107.021 -91.205 -61.508  1.00 173.41 ? 279  THR A CB    1 
ATOM 2134  O OG1   . THR A 1 272 ? -106.520 -89.999 -62.102  1.00 173.38 ? 279  THR A OG1   1 
ATOM 2135  C CG2   . THR A 1 272 ? -107.208 -91.029 -59.996  1.00 173.36 ? 279  THR A CG2   1 
ATOM 2136  N N     . GLU A 1 273 ? -105.374 -93.473 -63.918  1.00 174.31 ? 280  GLU A N     1 
ATOM 2137  C CA    . GLU A 1 273 ? -105.360 -93.776 -65.358  1.00 174.63 ? 280  GLU A CA    1 
ATOM 2138  C C     . GLU A 1 273 ? -104.941 -92.509 -66.117  1.00 174.89 ? 280  GLU A C     1 
ATOM 2139  O O     . GLU A 1 273 ? -103.942 -91.875 -65.757  1.00 174.88 ? 280  GLU A O     1 
ATOM 2140  C CB    . GLU A 1 273 ? -106.693 -94.372 -65.865  1.00 174.61 ? 280  GLU A CB    1 
ATOM 2141  C CG    . GLU A 1 273 ? -107.097 -95.729 -65.242  1.00 174.35 ? 280  GLU A CG    1 
ATOM 2142  C CD    . GLU A 1 273 ? -106.407 -96.954 -65.870  1.00 173.75 ? 280  GLU A CD    1 
ATOM 2143  O OE1   . GLU A 1 273 ? -107.036 -98.033 -65.870  1.00 173.22 ? 280  GLU A OE1   1 
ATOM 2144  O OE2   . GLU A 1 273 ? -105.251 -96.857 -66.349  1.00 173.11 ? 280  GLU A OE2   1 
ATOM 2145  N N     . ARG A 1 274 ? -105.694 -92.130 -67.144  1.00 175.11 ? 281  ARG A N     1 
ATOM 2146  C CA    . ARG A 1 274 ? -105.360 -90.940 -67.908  1.00 175.38 ? 281  ARG A CA    1 
ATOM 2147  C C     . ARG A 1 274 ? -106.368 -89.828 -67.641  1.00 175.48 ? 281  ARG A C     1 
ATOM 2148  O O     . ARG A 1 274 ? -106.431 -88.846 -68.377  1.00 175.57 ? 281  ARG A O     1 
ATOM 2149  C CB    . ARG A 1 274 ? -105.278 -91.284 -69.387  1.00 175.47 ? 281  ARG A CB    1 
ATOM 2150  C CG    . ARG A 1 274 ? -104.122 -90.623 -70.094  1.00 176.01 ? 281  ARG A CG    1 
ATOM 2151  C CD    . ARG A 1 274 ? -103.415 -91.586 -71.044  1.00 177.23 ? 281  ARG A CD    1 
ATOM 2152  N NE    . ARG A 1 274 ? -104.346 -92.459 -71.760  1.00 178.28 ? 281  ARG A NE    1 
ATOM 2153  C CZ    . ARG A 1 274 ? -104.828 -92.224 -72.980  1.00 179.40 ? 281  ARG A CZ    1 
ATOM 2154  N NH1   . ARG A 1 274 ? -104.475 -91.137 -73.659  1.00 179.76 ? 281  ARG A NH1   1 
ATOM 2155  N NH2   . ARG A 1 274 ? -105.674 -93.084 -73.527  1.00 179.86 ? 281  ARG A NH2   1 
ATOM 2156  N N     . MET A 1 275 ? -107.137 -89.997 -66.565  1.00 175.59 ? 282  MET A N     1 
ATOM 2157  C CA    . MET A 1 275 ? -108.160 -89.047 -66.131  1.00 175.68 ? 282  MET A CA    1 
ATOM 2158  C C     . MET A 1 275 ? -107.587 -87.672 -65.747  1.00 175.66 ? 282  MET A C     1 
ATOM 2159  O O     . MET A 1 275 ? -106.474 -87.579 -65.230  1.00 175.73 ? 282  MET A O     1 
ATOM 2160  C CB    . MET A 1 275 ? -108.955 -89.634 -64.957  1.00 175.73 ? 282  MET A CB    1 
ATOM 2161  C CG    . MET A 1 275 ? -109.913 -90.773 -65.312  1.00 176.36 ? 282  MET A CG    1 
ATOM 2162  S SD    . MET A 1 275 ? -111.487 -90.205 -65.999  1.00 178.20 ? 282  MET A SD    1 
ATOM 2163  C CE    . MET A 1 275 ? -112.602 -91.547 -65.567  1.00 177.69 ? 282  MET A CE    1 
ATOM 2164  N N     . TYR A 1 276 ? -108.369 -86.623 -66.017  1.00 175.60 ? 283  TYR A N     1 
ATOM 2165  C CA    . TYR A 1 276 ? -108.049 -85.219 -65.701  1.00 175.37 ? 283  TYR A CA    1 
ATOM 2166  C C     . TYR A 1 276 ? -109.222 -84.599 -64.924  1.00 175.43 ? 283  TYR A C     1 
ATOM 2167  O O     . TYR A 1 276 ? -110.218 -85.274 -64.698  1.00 175.38 ? 283  TYR A O     1 
ATOM 2168  C CB    . TYR A 1 276 ? -107.812 -84.434 -67.000  1.00 175.21 ? 283  TYR A CB    1 
ATOM 2169  C CG    . TYR A 1 276 ? -106.394 -84.463 -67.541  1.00 174.54 ? 283  TYR A CG    1 
ATOM 2170  C CD1   . TYR A 1 276 ? -105.747 -85.663 -67.819  1.00 174.17 ? 283  TYR A CD1   1 
ATOM 2171  C CD2   . TYR A 1 276 ? -105.714 -83.282 -67.803  1.00 174.14 ? 283  TYR A CD2   1 
ATOM 2172  C CE1   . TYR A 1 276 ? -104.452 -85.682 -68.321  1.00 174.02 ? 283  TYR A CE1   1 
ATOM 2173  C CE2   . TYR A 1 276 ? -104.419 -83.291 -68.308  1.00 173.84 ? 283  TYR A CE2   1 
ATOM 2174  C CZ    . TYR A 1 276 ? -103.796 -84.494 -68.563  1.00 173.84 ? 283  TYR A CZ    1 
ATOM 2175  O OH    . TYR A 1 276 ? -102.513 -84.511 -69.057  1.00 173.68 ? 283  TYR A OH    1 
ATOM 2176  N N     . LEU A 1 277 ? -109.118 -83.331 -64.517  1.00 175.55 ? 284  LEU A N     1 
ATOM 2177  C CA    . LEU A 1 277 ? -110.257 -82.645 -63.893  1.00 175.66 ? 284  LEU A CA    1 
ATOM 2178  C C     . LEU A 1 277 ? -110.936 -81.736 -64.906  1.00 175.93 ? 284  LEU A C     1 
ATOM 2179  O O     . LEU A 1 277 ? -110.278 -80.920 -65.558  1.00 175.75 ? 284  LEU A O     1 
ATOM 2180  C CB    . LEU A 1 277 ? -109.853 -81.883 -62.624  1.00 175.52 ? 284  LEU A CB    1 
ATOM 2181  C CG    . LEU A 1 277 ? -109.928 -80.358 -62.497  1.00 175.31 ? 284  LEU A CG    1 
ATOM 2182  C CD1   . LEU A 1 277 ? -111.349 -79.890 -62.293  1.00 175.10 ? 284  LEU A CD1   1 
ATOM 2183  C CD2   . LEU A 1 277 ? -109.091 -79.901 -61.331  1.00 175.45 ? 284  LEU A CD2   1 
ATOM 2184  N N     . CYS A 1 278 ? -112.257 -81.884 -65.017  1.00 176.38 ? 285  CYS A N     1 
ATOM 2185  C CA    . CYS A 1 278 ? -113.028 -81.284 -66.110  1.00 176.80 ? 285  CYS A CA    1 
ATOM 2186  C C     . CYS A 1 278 ? -114.329 -80.621 -65.698  1.00 177.26 ? 285  CYS A C     1 
ATOM 2187  O O     . CYS A 1 278 ? -115.024 -81.081 -64.786  1.00 177.22 ? 285  CYS A O     1 
ATOM 2188  C CB    . CYS A 1 278 ? -113.343 -82.327 -67.177  1.00 176.78 ? 285  CYS A CB    1 
ATOM 2189  S SG    . CYS A 1 278 ? -114.546 -81.782 -68.405  1.00 176.29 ? 285  CYS A SG    1 
ATOM 2190  N N     . LEU A 1 279 ? -114.659 -79.557 -66.428  1.00 177.87 ? 286  LEU A N     1 
ATOM 2191  C CA    . LEU A 1 279 ? -115.850 -78.753 -66.189  1.00 178.51 ? 286  LEU A CA    1 
ATOM 2192  C C     . LEU A 1 279 ? -117.094 -79.535 -66.537  1.00 178.92 ? 286  LEU A C     1 
ATOM 2193  O O     . LEU A 1 279 ? -117.197 -80.133 -67.612  1.00 179.02 ? 286  LEU A O     1 
ATOM 2194  C CB    . LEU A 1 279 ? -115.794 -77.447 -67.001  1.00 178.49 ? 286  LEU A CB    1 
ATOM 2195  C CG    . LEU A 1 279 ? -116.835 -76.316 -66.911  1.00 178.55 ? 286  LEU A CG    1 
ATOM 2196  C CD1   . LEU A 1 279 ? -118.029 -76.505 -67.870  1.00 178.51 ? 286  LEU A CD1   1 
ATOM 2197  C CD2   . LEU A 1 279 ? -117.292 -76.074 -65.486  1.00 178.31 ? 286  LEU A CD2   1 
ATOM 2198  N N     . SER A 1 280 ? -118.038 -79.524 -65.609  1.00 179.45 ? 287  SER A N     1 
ATOM 2199  C CA    . SER A 1 280 ? -119.324 -80.150 -65.830  1.00 180.01 ? 287  SER A CA    1 
ATOM 2200  C C     . SER A 1 280 ? -120.338 -79.084 -66.187  1.00 180.26 ? 287  SER A C     1 
ATOM 2201  O O     . SER A 1 280 ? -120.456 -78.062 -65.497  1.00 180.21 ? 287  SER A O     1 
ATOM 2202  C CB    . SER A 1 280 ? -119.769 -80.874 -64.573  1.00 180.04 ? 287  SER A CB    1 
ATOM 2203  O OG    . SER A 1 280 ? -118.643 -81.377 -63.880  1.00 180.44 ? 287  SER A OG    1 
ATOM 2204  N N     . GLN A 1 281 ? -121.069 -79.326 -67.270  1.00 180.58 ? 288  GLN A N     1 
ATOM 2205  C CA    . GLN A 1 281 ? -122.175 -78.462 -67.644  1.00 180.80 ? 288  GLN A CA    1 
ATOM 2206  C C     . GLN A 1 281 ? -123.196 -78.630 -66.519  1.00 181.01 ? 288  GLN A C     1 
ATOM 2207  O O     . GLN A 1 281 ? -124.409 -78.553 -66.722  1.00 181.05 ? 288  GLN A O     1 
ATOM 2208  C CB    . GLN A 1 281 ? -122.742 -78.851 -69.022  1.00 180.79 ? 288  GLN A CB    1 
ATOM 2209  C CG    . GLN A 1 281 ? -121.783 -79.624 -69.979  1.00 180.64 ? 288  GLN A CG    1 
ATOM 2210  C CD    . GLN A 1 281 ? -120.446 -78.921 -70.283  1.00 180.25 ? 288  GLN A CD    1 
ATOM 2211  O OE1   . GLN A 1 281 ? -119.399 -79.571 -70.353  1.00 179.65 ? 288  GLN A OE1   1 
ATOM 2212  N NE2   . GLN A 1 281 ? -120.484 -77.603 -70.470  1.00 180.25 ? 288  GLN A NE2   1 
ATOM 2213  N N     . GLU A 1 282 ? -122.644 -78.867 -65.327  1.00 181.28 ? 289  GLU A N     1 
ATOM 2214  C CA    . GLU A 1 282 ? -123.362 -79.153 -64.086  1.00 181.56 ? 289  GLU A CA    1 
ATOM 2215  C C     . GLU A 1 282 ? -122.376 -79.093 -62.900  1.00 181.66 ? 289  GLU A C     1 
ATOM 2216  O O     . GLU A 1 282 ? -121.635 -78.114 -62.769  1.00 181.62 ? 289  GLU A O     1 
ATOM 2217  C CB    . GLU A 1 282 ? -124.080 -80.513 -64.157  1.00 181.61 ? 289  GLU A CB    1 
ATOM 2218  C CG    . GLU A 1 282 ? -123.266 -81.649 -64.783  1.00 181.42 ? 289  GLU A CG    1 
ATOM 2219  C CD    . GLU A 1 282 ? -123.773 -83.017 -64.390  1.00 181.12 ? 289  GLU A CD    1 
ATOM 2220  O OE1   . GLU A 1 282 ? -125.005 -83.191 -64.283  1.00 180.84 ? 289  GLU A OE1   1 
ATOM 2221  O OE2   . GLU A 1 282 ? -122.933 -83.919 -64.190  1.00 181.04 ? 289  GLU A OE2   1 
ATOM 2222  N N     . ARG A 1 283 ? -122.374 -80.135 -62.057  1.00 181.78 ? 290  ARG A N     1 
ATOM 2223  C CA    . ARG A 1 283 ? -121.503 -80.236 -60.864  1.00 181.74 ? 290  ARG A CA    1 
ATOM 2224  C C     . ARG A 1 283 ? -120.245 -81.047 -61.190  1.00 181.60 ? 290  ARG A C     1 
ATOM 2225  O O     . ARG A 1 283 ? -120.336 -82.089 -61.839  1.00 181.62 ? 290  ARG A O     1 
ATOM 2226  C CB    . ARG A 1 283 ? -122.261 -80.862 -59.678  1.00 181.74 ? 290  ARG A CB    1 
ATOM 2227  C CG    . ARG A 1 283 ? -123.725 -80.408 -59.523  1.00 181.88 ? 290  ARG A CG    1 
ATOM 2228  C CD    . ARG A 1 283 ? -123.885 -79.055 -58.793  1.00 182.32 ? 290  ARG A CD    1 
ATOM 2229  N NE    . ARG A 1 283 ? -123.252 -77.915 -59.476  1.00 182.59 ? 290  ARG A NE    1 
ATOM 2230  C CZ    . ARG A 1 283 ? -123.806 -77.195 -60.456  1.00 182.49 ? 290  ARG A CZ    1 
ATOM 2231  N NH1   . ARG A 1 283 ? -125.021 -77.483 -60.910  1.00 182.45 ? 290  ARG A NH1   1 
ATOM 2232  N NH2   . ARG A 1 283 ? -123.135 -76.184 -60.994  1.00 182.07 ? 290  ARG A NH2   1 
ATOM 2233  N N     . ILE A 1 284 ? -119.090 -80.584 -60.711  1.00 181.45 ? 291  ILE A N     1 
ATOM 2234  C CA    . ILE A 1 284 ? -117.780 -80.936 -61.306  1.00 181.31 ? 291  ILE A CA    1 
ATOM 2235  C C     . ILE A 1 284 ? -117.252 -82.369 -61.156  1.00 181.21 ? 291  ILE A C     1 
ATOM 2236  O O     . ILE A 1 284 ? -117.274 -82.942 -60.071  1.00 181.13 ? 291  ILE A O     1 
ATOM 2237  C CB    . ILE A 1 284 ? -116.682 -79.913 -60.926  1.00 181.34 ? 291  ILE A CB    1 
ATOM 2238  C CG1   . ILE A 1 284 ? -115.622 -79.860 -62.019  1.00 181.31 ? 291  ILE A CG1   1 
ATOM 2239  C CG2   . ILE A 1 284 ? -116.070 -80.219 -59.561  1.00 181.07 ? 291  ILE A CG2   1 
ATOM 2240  C CD1   . ILE A 1 284 ? -115.224 -78.469 -62.379  1.00 181.54 ? 291  ILE A CD1   1 
ATOM 2241  N N     . ILE A 1 285 ? -116.770 -82.925 -62.268  1.00 181.16 ? 292  ILE A N     1 
ATOM 2242  C CA    . ILE A 1 285 ? -116.244 -84.293 -62.299  1.00 181.19 ? 292  ILE A CA    1 
ATOM 2243  C C     . ILE A 1 285 ? -114.887 -84.407 -63.012  1.00 181.35 ? 292  ILE A C     1 
ATOM 2244  O O     . ILE A 1 285 ? -114.231 -83.396 -63.281  1.00 181.22 ? 292  ILE A O     1 
ATOM 2245  C CB    . ILE A 1 285 ? -117.274 -85.335 -62.899  1.00 181.16 ? 292  ILE A CB    1 
ATOM 2246  C CG1   . ILE A 1 285 ? -117.305 -85.333 -64.452  1.00 180.72 ? 292  ILE A CG1   1 
ATOM 2247  C CG2   . ILE A 1 285 ? -118.659 -85.245 -62.205  1.00 181.15 ? 292  ILE A CG2   1 
ATOM 2248  C CD1   . ILE A 1 285 ? -118.081 -84.230 -65.136  1.00 179.90 ? 292  ILE A CD1   1 
ATOM 2249  N N     . GLN A 1 286 ? -114.484 -85.652 -63.293  1.00 181.58 ? 293  GLN A N     1 
ATOM 2250  C CA    . GLN A 1 286 ? -113.263 -85.983 -64.054  1.00 181.68 ? 293  GLN A CA    1 
ATOM 2251  C C     . GLN A 1 286 ? -113.525 -86.587 -65.456  1.00 181.72 ? 293  GLN A C     1 
ATOM 2252  O O     . GLN A 1 286 ? -114.628 -87.060 -65.741  1.00 181.75 ? 293  GLN A O     1 
ATOM 2253  C CB    . GLN A 1 286 ? -112.329 -86.888 -63.229  1.00 181.67 ? 293  GLN A CB    1 
ATOM 2254  C CG    . GLN A 1 286 ? -113.005 -87.943 -62.347  1.00 181.53 ? 293  GLN A CG    1 
ATOM 2255  C CD    . GLN A 1 286 ? -111.999 -88.890 -61.699  1.00 181.40 ? 293  GLN A CD    1 
ATOM 2256  O OE1   . GLN A 1 286 ? -111.340 -89.675 -62.379  1.00 181.38 ? 293  GLN A OE1   1 
ATOM 2257  N NE2   . GLN A 1 286 ? -111.885 -88.822 -60.379  1.00 181.34 ? 293  GLN A NE2   1 
ATOM 2258  N N     . PHE A 1 287 ? -112.501 -86.574 -66.313  1.00 181.74 ? 294  PHE A N     1 
ATOM 2259  C CA    . PHE A 1 287 ? -112.632 -86.933 -67.737  1.00 181.89 ? 294  PHE A CA    1 
ATOM 2260  C C     . PHE A 1 287 ? -111.413 -87.721 -68.235  1.00 182.05 ? 294  PHE A C     1 
ATOM 2261  O O     . PHE A 1 287 ? -110.299 -87.470 -67.794  1.00 182.14 ? 294  PHE A O     1 
ATOM 2262  C CB    . PHE A 1 287 ? -112.820 -85.652 -68.562  1.00 181.78 ? 294  PHE A CB    1 
ATOM 2263  C CG    . PHE A 1 287 ? -113.101 -85.885 -70.016  1.00 181.62 ? 294  PHE A CG    1 
ATOM 2264  C CD1   . PHE A 1 287 ? -114.335 -86.377 -70.435  1.00 181.57 ? 294  PHE A CD1   1 
ATOM 2265  C CD2   . PHE A 1 287 ? -112.140 -85.581 -70.971  1.00 181.52 ? 294  PHE A CD2   1 
ATOM 2266  C CE1   . PHE A 1 287 ? -114.598 -86.585 -71.781  1.00 181.74 ? 294  PHE A CE1   1 
ATOM 2267  C CE2   . PHE A 1 287 ? -112.389 -85.786 -72.319  1.00 181.86 ? 294  PHE A CE2   1 
ATOM 2268  C CZ    . PHE A 1 287 ? -113.624 -86.289 -72.726  1.00 181.89 ? 294  PHE A CZ    1 
ATOM 2269  N N     . GLN A 1 288 ? -111.623 -88.666 -69.152  1.00 182.26 ? 295  GLN A N     1 
ATOM 2270  C CA    . GLN A 1 288 ? -110.561 -89.588 -69.584  1.00 182.48 ? 295  GLN A CA    1 
ATOM 2271  C C     . GLN A 1 288 ? -109.531 -89.040 -70.567  1.00 182.73 ? 295  GLN A C     1 
ATOM 2272  O O     . GLN A 1 288 ? -108.431 -89.576 -70.660  1.00 182.68 ? 295  GLN A O     1 
ATOM 2273  C CB    . GLN A 1 288 ? -111.157 -90.872 -70.161  1.00 182.45 ? 295  GLN A CB    1 
ATOM 2274  C CG    . GLN A 1 288 ? -111.358 -91.978 -69.142  1.00 182.54 ? 295  GLN A CG    1 
ATOM 2275  C CD    . GLN A 1 288 ? -110.088 -92.759 -68.838  1.00 182.59 ? 295  GLN A CD    1 
ATOM 2276  O OE1   . GLN A 1 288 ? -109.051 -92.189 -68.493  1.00 182.70 ? 295  GLN A OE1   1 
ATOM 2277  N NE2   . GLN A 1 288 ? -110.173 -94.079 -68.948  1.00 182.62 ? 295  GLN A NE2   1 
ATOM 2278  N N     . ALA A 1 289 ? -109.886 -87.990 -71.300  1.00 183.19 ? 296  ALA A N     1 
ATOM 2279  C CA    . ALA A 1 289 ? -109.035 -87.436 -72.359  1.00 183.79 ? 296  ALA A CA    1 
ATOM 2280  C C     . ALA A 1 289 ? -108.929 -88.382 -73.555  1.00 184.31 ? 296  ALA A C     1 
ATOM 2281  O O     . ALA A 1 289 ? -108.676 -89.580 -73.394  1.00 184.36 ? 296  ALA A O     1 
ATOM 2282  C CB    . ALA A 1 289 ? -107.648 -87.077 -71.828  1.00 183.65 ? 296  ALA A CB    1 
ATOM 2283  N N     . THR A 1 290 ? -109.117 -87.820 -74.751  1.00 184.97 ? 297  THR A N     1 
ATOM 2284  C CA    . THR A 1 290 ? -109.147 -88.567 -76.027  1.00 185.46 ? 297  THR A CA    1 
ATOM 2285  C C     . THR A 1 290 ? -107.800 -89.317 -76.309  1.00 185.77 ? 297  THR A C     1 
ATOM 2286  O O     . THR A 1 290 ? -106.851 -89.213 -75.513  1.00 185.57 ? 297  THR A O     1 
ATOM 2287  C CB    . THR A 1 290 ? -109.581 -87.615 -77.235  1.00 185.51 ? 297  THR A CB    1 
ATOM 2288  O OG1   . THR A 1 290 ? -110.141 -86.390 -76.736  1.00 185.55 ? 297  THR A OG1   1 
ATOM 2289  C CG2   . THR A 1 290 ? -110.610 -88.288 -78.167  1.00 185.17 ? 297  THR A CG2   1 
ATOM 2290  N N     . PRO A 1 291 ? -107.731 -90.113 -77.409  1.00 186.13 ? 298  PRO A N     1 
ATOM 2291  C CA    . PRO A 1 291 ? -106.460 -90.670 -77.906  1.00 186.30 ? 298  PRO A CA    1 
ATOM 2292  C C     . PRO A 1 291 ? -105.297 -89.672 -78.097  1.00 186.38 ? 298  PRO A C     1 
ATOM 2293  O O     . PRO A 1 291 ? -105.436 -88.471 -77.863  1.00 186.42 ? 298  PRO A O     1 
ATOM 2294  C CB    . PRO A 1 291 ? -106.853 -91.293 -79.267  1.00 186.34 ? 298  PRO A CB    1 
ATOM 2295  C CG    . PRO A 1 291 ? -108.371 -91.189 -79.372  1.00 186.26 ? 298  PRO A CG    1 
ATOM 2296  C CD    . PRO A 1 291 ? -108.871 -90.839 -78.004  1.00 186.21 ? 298  PRO A CD    1 
ATOM 2297  N N     . CYS A 1 292 ? -104.156 -90.196 -78.532  1.00 186.45 ? 299  CYS A N     1 
ATOM 2298  C CA    . CYS A 1 292 ? -102.929 -89.419 -78.689  1.00 186.43 ? 299  CYS A CA    1 
ATOM 2299  C C     . CYS A 1 292 ? -101.994 -90.109 -79.708  1.00 186.65 ? 299  CYS A C     1 
ATOM 2300  O O     . CYS A 1 292 ? -100.863 -90.478 -79.365  1.00 186.76 ? 299  CYS A O     1 
ATOM 2301  C CB    . CYS A 1 292 ? -102.259 -89.281 -77.319  1.00 186.39 ? 299  CYS A CB    1 
ATOM 2302  S SG    . CYS A 1 292 ? -102.718 -90.619 -76.142  1.00 185.60 ? 299  CYS A SG    1 
ATOM 2303  N N     . PRO A 1 293 ? -102.461 -90.276 -80.971  1.00 186.63 ? 300  PRO A N     1 
ATOM 2304  C CA    . PRO A 1 293 ? -101.818 -91.181 -81.934  1.00 186.46 ? 300  PRO A CA    1 
ATOM 2305  C C     . PRO A 1 293 ? -100.674 -90.568 -82.753  1.00 186.35 ? 300  PRO A C     1 
ATOM 2306  O O     . PRO A 1 293 ? -99.540  -91.044 -82.655  1.00 186.31 ? 300  PRO A O     1 
ATOM 2307  C CB    . PRO A 1 293 ? -102.979 -91.599 -82.847  1.00 186.48 ? 300  PRO A CB    1 
ATOM 2308  C CG    . PRO A 1 293 ? -104.087 -90.566 -82.611  1.00 186.56 ? 300  PRO A CG    1 
ATOM 2309  C CD    . PRO A 1 293 ? -103.600 -89.574 -81.589  1.00 186.62 ? 300  PRO A CD    1 
ATOM 2310  N N     . LYS A 1 294 ? -100.970 -89.540 -83.555  1.00 186.22 ? 301  LYS A N     1 
ATOM 2311  C CA    . LYS A 1 294 ? -99.953  -88.854 -84.375  1.00 186.05 ? 301  LYS A CA    1 
ATOM 2312  C C     . LYS A 1 294 ? -98.937  -88.073 -83.527  1.00 185.91 ? 301  LYS A C     1 
ATOM 2313  O O     . LYS A 1 294 ? -97.730  -88.115 -83.792  1.00 185.88 ? 301  LYS A O     1 
ATOM 2314  C CB    . LYS A 1 294 ? -100.586 -87.964 -85.470  1.00 186.01 ? 301  LYS A CB    1 
ATOM 2315  C CG    . LYS A 1 294 ? -101.759 -87.083 -85.038  1.00 185.83 ? 301  LYS A CG    1 
ATOM 2316  C CD    . LYS A 1 294 ? -102.119 -86.060 -86.115  1.00 185.39 ? 301  LYS A CD    1 
ATOM 2317  C CE    . LYS A 1 294 ? -101.441 -84.709 -85.877  1.00 185.00 ? 301  LYS A CE    1 
ATOM 2318  N NZ    . LYS A 1 294 ? -102.145 -83.876 -84.854  1.00 184.30 ? 301  LYS A NZ    1 
ATOM 2319  N N     . GLU A 1 295 ? -99.442  -87.370 -82.513  1.00 185.67 ? 302  GLU A N     1 
ATOM 2320  C CA    . GLU A 1 295 ? -98.610  -86.689 -81.518  1.00 185.33 ? 302  GLU A CA    1 
ATOM 2321  C C     . GLU A 1 295 ? -98.475  -87.609 -80.286  1.00 184.90 ? 302  GLU A C     1 
ATOM 2322  O O     . GLU A 1 295 ? -99.483  -87.941 -79.643  1.00 184.81 ? 302  GLU A O     1 
ATOM 2323  C CB    . GLU A 1 295 ? -99.212  -85.331 -81.130  1.00 185.42 ? 302  GLU A CB    1 
ATOM 2324  C CG    . GLU A 1 295 ? -100.245 -84.756 -82.113  1.00 185.81 ? 302  GLU A CG    1 
ATOM 2325  C CD    . GLU A 1 295 ? -101.700 -85.038 -81.710  1.00 186.52 ? 302  GLU A CD    1 
ATOM 2326  O OE1   . GLU A 1 295 ? -102.555 -84.157 -81.955  1.00 186.75 ? 302  GLU A OE1   1 
ATOM 2327  O OE2   . GLU A 1 295 ? -101.996 -86.123 -81.151  1.00 186.58 ? 302  GLU A OE2   1 
ATOM 2328  N N     . PRO A 1 296 ? -97.227  -88.012 -79.951  1.00 184.43 ? 303  PRO A N     1 
ATOM 2329  C CA    . PRO A 1 296 ? -96.970  -89.138 -79.022  1.00 183.90 ? 303  PRO A CA    1 
ATOM 2330  C C     . PRO A 1 296 ? -97.311  -88.887 -77.539  1.00 183.27 ? 303  PRO A C     1 
ATOM 2331  O O     . PRO A 1 296 ? -98.151  -89.594 -76.970  1.00 183.12 ? 303  PRO A O     1 
ATOM 2332  C CB    . PRO A 1 296 ? -95.464  -89.421 -79.206  1.00 184.00 ? 303  PRO A CB    1 
ATOM 2333  C CG    . PRO A 1 296 ? -94.965  -88.439 -80.279  1.00 184.21 ? 303  PRO A CG    1 
ATOM 2334  C CD    . PRO A 1 296 ? -95.976  -87.341 -80.361  1.00 184.34 ? 303  PRO A CD    1 
ATOM 2335  N N     . ASN A 1 297 ? -96.652  -87.896 -76.936  1.00 182.53 ? 304  ASN A N     1 
ATOM 2336  C CA    . ASN A 1 297 ? -96.859  -87.512 -75.535  1.00 181.66 ? 304  ASN A CA    1 
ATOM 2337  C C     . ASN A 1 297 ? -97.807  -86.314 -75.395  1.00 181.04 ? 304  ASN A C     1 
ATOM 2338  O O     . ASN A 1 297 ? -97.846  -85.661 -74.351  1.00 181.03 ? 304  ASN A O     1 
ATOM 2339  C CB    . ASN A 1 297 ? -95.513  -87.178 -74.881  1.00 181.62 ? 304  ASN A CB    1 
ATOM 2340  C CG    . ASN A 1 297 ? -94.814  -86.006 -75.554  1.00 181.48 ? 304  ASN A CG    1 
ATOM 2341  O OD1   . ASN A 1 297 ? -95.236  -84.853 -75.436  1.00 181.35 ? 304  ASN A OD1   1 
ATOM 2342  N ND2   . ASN A 1 297 ? -93.743  -86.302 -76.272  1.00 181.47 ? 304  ASN A ND2   1 
ATOM 2343  N N     . LYS A 1 298 ? -98.561  -86.032 -76.454  1.00 180.12 ? 305  LYS A N     1 
ATOM 2344  C CA    . LYS A 1 298 ? -99.450  -84.877 -76.507  1.00 179.10 ? 305  LYS A CA    1 
ATOM 2345  C C     . LYS A 1 298 ? -100.916 -85.337 -76.585  1.00 178.36 ? 305  LYS A C     1 
ATOM 2346  O O     . LYS A 1 298 ? -101.428 -85.652 -77.661  1.00 178.42 ? 305  LYS A O     1 
ATOM 2347  C CB    . LYS A 1 298 ? -99.067  -83.998 -77.706  1.00 179.18 ? 305  LYS A CB    1 
ATOM 2348  C CG    . LYS A 1 298 ? -99.388  -82.517 -77.568  1.00 179.11 ? 305  LYS A CG    1 
ATOM 2349  C CD    . LYS A 1 298 ? -98.979  -81.726 -78.810  1.00 178.64 ? 305  LYS A CD    1 
ATOM 2350  C CE    . LYS A 1 298 ? -100.077 -81.736 -79.863  1.00 178.15 ? 305  LYS A CE    1 
ATOM 2351  N NZ    . LYS A 1 298 ? -99.682  -80.966 -81.070  1.00 177.98 ? 305  LYS A NZ    1 
ATOM 2352  N N     . GLU A 1 299 ? -101.577 -85.387 -75.430  1.00 177.30 ? 306  GLU A N     1 
ATOM 2353  C CA    . GLU A 1 299 ? -102.966 -85.845 -75.333  1.00 176.28 ? 306  GLU A CA    1 
ATOM 2354  C C     . GLU A 1 299 ? -103.967 -84.768 -75.746  1.00 175.68 ? 306  GLU A C     1 
ATOM 2355  O O     . GLU A 1 299 ? -103.826 -83.604 -75.371  1.00 175.68 ? 306  GLU A O     1 
ATOM 2356  C CB    . GLU A 1 299 ? -103.294 -86.298 -73.907  1.00 176.22 ? 306  GLU A CB    1 
ATOM 2357  C CG    . GLU A 1 299 ? -102.408 -87.401 -73.351  1.00 176.04 ? 306  GLU A CG    1 
ATOM 2358  C CD    . GLU A 1 299 ? -102.955 -88.001 -72.068  1.00 176.01 ? 306  GLU A CD    1 
ATOM 2359  O OE1   . GLU A 1 299 ? -104.185 -88.203 -71.972  1.00 176.04 ? 306  GLU A OE1   1 
ATOM 2360  O OE2   . GLU A 1 299 ? -102.155 -88.280 -71.154  1.00 175.98 ? 306  GLU A OE2   1 
ATOM 2361  N N     . MET A 1 300 ? -104.980 -85.166 -76.512  1.00 174.80 ? 307  MET A N     1 
ATOM 2362  C CA    . MET A 1 300 ? -106.098 -84.283 -76.861  1.00 173.72 ? 307  MET A CA    1 
ATOM 2363  C C     . MET A 1 300 ? -107.077 -84.258 -75.686  1.00 172.56 ? 307  MET A C     1 
ATOM 2364  O O     . MET A 1 300 ? -107.234 -85.264 -74.985  1.00 172.34 ? 307  MET A O     1 
ATOM 2365  C CB    . MET A 1 300 ? -106.784 -84.744 -78.157  1.00 174.04 ? 307  MET A CB    1 
ATOM 2366  C CG    . MET A 1 300 ? -105.867 -84.779 -79.404  1.00 174.78 ? 307  MET A CG    1 
ATOM 2367  S SD    . MET A 1 300 ? -106.537 -85.779 -80.758  1.00 176.58 ? 307  MET A SD    1 
ATOM 2368  C CE    . MET A 1 300 ? -105.219 -85.732 -81.969  1.00 175.86 ? 307  MET A CE    1 
ATOM 2369  N N     . ILE A 1 301 ? -107.715 -83.108 -75.463  1.00 171.11 ? 308  ILE A N     1 
ATOM 2370  C CA    . ILE A 1 301 ? -108.520 -82.902 -74.252  1.00 169.56 ? 308  ILE A CA    1 
ATOM 2371  C C     . ILE A 1 301 ? -109.808 -82.086 -74.478  1.00 168.43 ? 308  ILE A C     1 
ATOM 2372  O O     . ILE A 1 301 ? -109.939 -81.368 -75.475  1.00 168.45 ? 308  ILE A O     1 
ATOM 2373  C CB    . ILE A 1 301 ? -107.642 -82.314 -73.087  1.00 169.60 ? 308  ILE A CB    1 
ATOM 2374  C CG1   . ILE A 1 301 ? -107.745 -83.170 -71.815  1.00 169.56 ? 308  ILE A CG1   1 
ATOM 2375  C CG2   . ILE A 1 301 ? -107.886 -80.809 -72.851  1.00 169.39 ? 308  ILE A CG2   1 
ATOM 2376  C CD1   . ILE A 1 301 ? -109.141 -83.648 -71.438  1.00 169.67 ? 308  ILE A CD1   1 
ATOM 2377  N N     . ASN A 1 302 ? -110.740 -82.220 -73.532  1.00 166.72 ? 309  ASN A N     1 
ATOM 2378  C CA    . ASN A 1 302 ? -112.079 -81.610 -73.562  1.00 165.04 ? 309  ASN A CA    1 
ATOM 2379  C C     . ASN A 1 302 ? -112.121 -80.076 -73.470  1.00 163.79 ? 309  ASN A C     1 
ATOM 2380  O O     . ASN A 1 302 ? -111.148 -79.444 -73.068  1.00 163.85 ? 309  ASN A O     1 
ATOM 2381  C CB    . ASN A 1 302 ? -112.911 -82.216 -72.418  1.00 165.03 ? 309  ASN A CB    1 
ATOM 2382  C CG    . ASN A 1 302 ? -114.382 -81.882 -72.516  1.00 164.79 ? 309  ASN A CG    1 
ATOM 2383  O OD1   . ASN A 1 302 ? -114.943 -81.252 -71.624  1.00 164.19 ? 309  ASN A OD1   1 
ATOM 2384  N ND2   . ASN A 1 302 ? -115.014 -82.295 -73.610  1.00 165.05 ? 309  ASN A ND2   1 
ATOM 2385  N N     . ASP A 1 303 ? -113.257 -79.490 -73.846  1.00 162.07 ? 310  ASP A N     1 
ATOM 2386  C CA    . ASP A 1 303 ? -113.552 -78.080 -73.579  1.00 160.27 ? 310  ASP A CA    1 
ATOM 2387  C C     . ASP A 1 303 ? -113.461 -77.750 -72.094  1.00 158.81 ? 310  ASP A C     1 
ATOM 2388  O O     . ASP A 1 303 ? -112.965 -76.691 -71.716  1.00 158.57 ? 310  ASP A O     1 
ATOM 2389  C CB    . ASP A 1 303 ? -114.967 -77.738 -74.056  1.00 160.43 ? 310  ASP A CB    1 
ATOM 2390  C CG    . ASP A 1 303 ? -115.030 -77.432 -75.529  1.00 160.33 ? 310  ASP A CG    1 
ATOM 2391  O OD1   . ASP A 1 303 ? -114.287 -78.073 -76.296  1.00 160.89 ? 310  ASP A OD1   1 
ATOM 2392  O OD2   . ASP A 1 303 ? -115.824 -76.552 -75.920  1.00 159.95 ? 310  ASP A OD2   1 
ATOM 2393  N N     . GLY A 1 304 ? -113.948 -78.674 -71.269  1.00 157.15 ? 311  GLY A N     1 
ATOM 2394  C CA    . GLY A 1 304 ? -114.131 -78.455 -69.837  1.00 154.93 ? 311  GLY A CA    1 
ATOM 2395  C C     . GLY A 1 304 ? -112.954 -78.742 -68.925  1.00 153.34 ? 311  GLY A C     1 
ATOM 2396  O O     . GLY A 1 304 ? -112.980 -78.369 -67.758  1.00 153.29 ? 311  GLY A O     1 
ATOM 2397  N N     . ALA A 1 305 ? -111.927 -79.413 -69.439  1.00 151.57 ? 312  ALA A N     1 
ATOM 2398  C CA    . ALA A 1 305 ? -110.689 -79.606 -68.682  1.00 149.57 ? 312  ALA A CA    1 
ATOM 2399  C C     . ALA A 1 305 ? -109.644 -78.564 -69.063  1.00 148.17 ? 312  ALA A C     1 
ATOM 2400  O O     . ALA A 1 305 ? -108.463 -78.717 -68.739  1.00 148.22 ? 312  ALA A O     1 
ATOM 2401  C CB    . ALA A 1 305 ? -110.142 -81.005 -68.881  1.00 149.66 ? 312  ALA A CB    1 
ATOM 2402  N N     . SER A 1 306 ? -110.091 -77.506 -69.739  1.00 146.09 ? 313  SER A N     1 
ATOM 2403  C CA    . SER A 1 306 ? -109.222 -76.407 -70.130  1.00 144.15 ? 313  SER A CA    1 
ATOM 2404  C C     . SER A 1 306 ? -109.558 -75.135 -69.350  1.00 142.64 ? 313  SER A C     1 
ATOM 2405  O O     . SER A 1 306 ? -110.417 -74.351 -69.760  1.00 142.40 ? 313  SER A O     1 
ATOM 2406  C CB    . SER A 1 306 ? -109.295 -76.172 -71.643  1.00 144.36 ? 313  SER A CB    1 
ATOM 2407  O OG    . SER A 1 306 ? -108.097 -75.597 -72.148  1.00 144.56 ? 313  SER A OG    1 
ATOM 2408  N N     . TRP A 1 307 ? -108.857 -74.946 -68.229  1.00 140.79 ? 314  TRP A N     1 
ATOM 2409  C CA    . TRP A 1 307 ? -109.010 -73.781 -67.334  1.00 138.84 ? 314  TRP A CA    1 
ATOM 2410  C C     . TRP A 1 307 ? -108.045 -72.628 -67.602  1.00 137.35 ? 314  TRP A C     1 
ATOM 2411  O O     . TRP A 1 307 ? -106.904 -72.852 -67.989  1.00 137.40 ? 314  TRP A O     1 
ATOM 2412  C CB    . TRP A 1 307 ? -108.770 -74.210 -65.903  1.00 138.74 ? 314  TRP A CB    1 
ATOM 2413  C CG    . TRP A 1 307 ? -109.626 -75.302 -65.463  1.00 138.42 ? 314  TRP A CG    1 
ATOM 2414  C CD1   . TRP A 1 307 ? -109.410 -76.616 -65.650  1.00 138.52 ? 314  TRP A CD1   1 
ATOM 2415  C CD2   . TRP A 1 307 ? -110.844 -75.190 -64.725  1.00 138.57 ? 314  TRP A CD2   1 
ATOM 2416  N NE1   . TRP A 1 307 ? -110.418 -77.349 -65.080  1.00 138.97 ? 314  TRP A NE1   1 
ATOM 2417  C CE2   . TRP A 1 307 ? -111.315 -76.495 -64.504  1.00 138.46 ? 314  TRP A CE2   1 
ATOM 2418  C CE3   . TRP A 1 307 ? -111.583 -74.111 -64.223  1.00 138.62 ? 314  TRP A CE3   1 
ATOM 2419  C CZ2   . TRP A 1 307 ? -112.494 -76.761 -63.809  1.00 137.99 ? 314  TRP A CZ2   1 
ATOM 2420  C CZ3   . TRP A 1 307 ? -112.760 -74.378 -63.527  1.00 138.46 ? 314  TRP A CZ3   1 
ATOM 2421  C CH2   . TRP A 1 307 ? -113.201 -75.693 -63.331  1.00 137.91 ? 314  TRP A CH2   1 
ATOM 2422  N N     . THR A 1 308 ? -108.495 -71.400 -67.372  1.00 135.24 ? 315  THR A N     1 
ATOM 2423  C CA    . THR A 1 308 ? -107.580 -70.270 -67.323  1.00 133.39 ? 315  THR A CA    1 
ATOM 2424  C C     . THR A 1 308 ? -107.258 -70.035 -65.849  1.00 132.28 ? 315  THR A C     1 
ATOM 2425  O O     . THR A 1 308 ? -108.124 -70.216 -65.001  1.00 132.39 ? 315  THR A O     1 
ATOM 2426  C CB    . THR A 1 308 ? -108.168 -69.019 -67.979  1.00 133.31 ? 315  THR A CB    1 
ATOM 2427  O OG1   . THR A 1 308 ? -108.795 -69.379 -69.212  1.00 133.07 ? 315  THR A OG1   1 
ATOM 2428  C CG2   . THR A 1 308 ? -107.085 -68.007 -68.273  1.00 133.10 ? 315  THR A CG2   1 
ATOM 2429  N N     . ILE A 1 309 ? -106.012 -69.667 -65.543  1.00 130.59 ? 316  ILE A N     1 
ATOM 2430  C CA    . ILE A 1 309 ? -105.534 -69.582 -64.157  1.00 128.54 ? 316  ILE A CA    1 
ATOM 2431  C C     . ILE A 1 309 ? -104.908 -68.228 -63.911  1.00 127.27 ? 316  ILE A C     1 
ATOM 2432  O O     . ILE A 1 309 ? -104.102 -67.757 -64.713  1.00 127.18 ? 316  ILE A O     1 
ATOM 2433  C CB    . ILE A 1 309 ? -104.534 -70.727 -63.828  1.00 128.55 ? 316  ILE A CB    1 
ATOM 2434  C CG1   . ILE A 1 309 ? -104.480 -71.003 -62.321  1.00 128.41 ? 316  ILE A CG1   1 
ATOM 2435  C CG2   . ILE A 1 309 ? -103.156 -70.468 -64.442  1.00 128.09 ? 316  ILE A CG2   1 
ATOM 2436  C CD1   . ILE A 1 309 ? -103.216 -70.548 -61.628  1.00 128.62 ? 316  ILE A CD1   1 
ATOM 2437  N N     . ILE A 1 310 ? -105.306 -67.602 -62.808  1.00 125.56 ? 317  ILE A N     1 
ATOM 2438  C CA    . ILE A 1 310 ? -104.815 -66.276 -62.436  1.00 123.87 ? 317  ILE A CA    1 
ATOM 2439  C C     . ILE A 1 310 ? -104.573 -66.198 -60.928  1.00 122.89 ? 317  ILE A C     1 
ATOM 2440  O O     . ILE A 1 310 ? -105.334 -66.754 -60.132  1.00 122.59 ? 317  ILE A O     1 
ATOM 2441  C CB    . ILE A 1 310 ? -105.749 -65.132 -62.941  1.00 123.77 ? 317  ILE A CB    1 
ATOM 2442  C CG1   . ILE A 1 310 ? -105.341 -63.766 -62.372  1.00 123.53 ? 317  ILE A CG1   1 
ATOM 2443  C CG2   . ILE A 1 310 ? -107.199 -65.423 -62.601  1.00 123.70 ? 317  ILE A CG2   1 
ATOM 2444  C CD1   . ILE A 1 310 ? -104.775 -62.777 -63.361  1.00 122.60 ? 317  ILE A CD1   1 
ATOM 2445  N N     . SER A 1 311 ? -103.478 -65.530 -60.569  1.00 121.66 ? 318  SER A N     1 
ATOM 2446  C CA    . SER A 1 311 ? -103.054 -65.370 -59.196  1.00 120.39 ? 318  SER A CA    1 
ATOM 2447  C C     . SER A 1 311 ? -103.926 -64.275 -58.598  1.00 119.79 ? 318  SER A C     1 
ATOM 2448  O O     . SER A 1 311 ? -104.233 -63.295 -59.258  1.00 119.75 ? 318  SER A O     1 
ATOM 2449  C CB    . SER A 1 311 ? -101.561 -65.008 -59.153  1.00 120.12 ? 318  SER A CB    1 
ATOM 2450  O OG    . SER A 1 311 ? -100.912 -65.590 -58.033  1.00 119.43 ? 318  SER A OG    1 
ATOM 2451  N N     . THR A 1 312 ? -104.338 -64.437 -57.354  1.00 118.95 ? 319  THR A N     1 
ATOM 2452  C CA    . THR A 1 312 ? -105.245 -63.476 -56.794  1.00 118.21 ? 319  THR A CA    1 
ATOM 2453  C C     . THR A 1 312 ? -104.696 -62.701 -55.582  1.00 117.86 ? 319  THR A C     1 
ATOM 2454  O O     . THR A 1 312 ? -103.504 -62.764 -55.286  1.00 117.76 ? 319  THR A O     1 
ATOM 2455  C CB    . THR A 1 312 ? -106.578 -64.150 -56.531  1.00 118.25 ? 319  THR A CB    1 
ATOM 2456  O OG1   . THR A 1 312 ? -107.621 -63.270 -56.948  1.00 118.77 ? 319  THR A OG1   1 
ATOM 2457  C CG2   . THR A 1 312 ? -106.751 -64.569 -55.050  1.00 118.33 ? 319  THR A CG2   1 
ATOM 2458  N N     . ASP A 1 313 ? -105.568 -61.952 -54.906  1.00 117.37 ? 320  ASP A N     1 
ATOM 2459  C CA    . ASP A 1 313 ? -105.210 -61.192 -53.708  1.00 116.59 ? 320  ASP A CA    1 
ATOM 2460  C C     . ASP A 1 313 ? -106.479 -60.813 -52.937  1.00 115.94 ? 320  ASP A C     1 
ATOM 2461  O O     . ASP A 1 313 ? -107.568 -60.805 -53.509  1.00 115.86 ? 320  ASP A O     1 
ATOM 2462  C CB    . ASP A 1 313 ? -104.419 -59.935 -54.096  1.00 116.60 ? 320  ASP A CB    1 
ATOM 2463  C CG    . ASP A 1 313 ? -103.264 -59.654 -53.163  1.00 116.74 ? 320  ASP A CG    1 
ATOM 2464  O OD1   . ASP A 1 313 ? -103.277 -60.181 -52.032  1.00 116.91 ? 320  ASP A OD1   1 
ATOM 2465  O OD2   . ASP A 1 313 ? -102.339 -58.909 -53.566  1.00 116.68 ? 320  ASP A OD2   1 
ATOM 2466  N N     . LYS A 1 314 ? -106.325 -60.523 -51.643  1.00 114.98 ? 321  LYS A N     1 
ATOM 2467  C CA    . LYS A 1 314 ? -107.414 -60.057 -50.782  1.00 113.73 ? 321  LYS A CA    1 
ATOM 2468  C C     . LYS A 1 314 ? -106.996 -58.756 -50.170  1.00 112.85 ? 321  LYS A C     1 
ATOM 2469  O O     . LYS A 1 314 ? -105.820 -58.475 -50.068  1.00 112.70 ? 321  LYS A O     1 
ATOM 2470  C CB    . LYS A 1 314 ? -107.755 -61.070 -49.675  1.00 113.86 ? 321  LYS A CB    1 
ATOM 2471  C CG    . LYS A 1 314 ? -106.950 -60.941 -48.401  1.00 114.05 ? 321  LYS A CG    1 
ATOM 2472  C CD    . LYS A 1 314 ? -107.290 -62.011 -47.368  1.00 115.59 ? 321  LYS A CD    1 
ATOM 2473  C CE    . LYS A 1 314 ? -106.286 -61.925 -46.203  1.00 117.03 ? 321  LYS A CE    1 
ATOM 2474  N NZ    . LYS A 1 314 ? -106.125 -63.159 -45.363  1.00 116.37 ? 321  LYS A NZ    1 
ATOM 2475  N N     . ALA A 1 315 ? -107.970 -57.960 -49.764  1.00 112.13 ? 322  ALA A N     1 
ATOM 2476  C CA    . ALA A 1 315 ? -107.717 -56.659 -49.158  1.00 111.21 ? 322  ALA A CA    1 
ATOM 2477  C C     . ALA A 1 315 ? -108.667 -56.492 -47.997  1.00 110.42 ? 322  ALA A C     1 
ATOM 2478  O O     . ALA A 1 315 ? -109.740 -55.941 -48.148  1.00 110.49 ? 322  ALA A O     1 
ATOM 2479  C CB    . ALA A 1 315 ? -107.910 -55.526 -50.193  1.00 111.15 ? 322  ALA A CB    1 
ATOM 2480  N N     . GLU A 1 316 ? -108.278 -56.984 -46.840  1.00 109.60 ? 323  GLU A N     1 
ATOM 2481  C CA    . GLU A 1 316 ? -109.136 -56.925 -45.671  1.00 109.29 ? 323  GLU A CA    1 
ATOM 2482  C C     . GLU A 1 316 ? -109.073 -55.547 -44.961  1.00 109.04 ? 323  GLU A C     1 
ATOM 2483  O O     . GLU A 1 316 ? -108.156 -54.757 -45.211  1.00 109.17 ? 323  GLU A O     1 
ATOM 2484  C CB    . GLU A 1 316 ? -108.763 -58.064 -44.726  1.00 109.31 ? 323  GLU A CB    1 
ATOM 2485  C CG    . GLU A 1 316 ? -109.907 -58.620 -43.933  1.00 109.43 ? 323  GLU A CG    1 
ATOM 2486  C CD    . GLU A 1 316 ? -109.625 -60.002 -43.409  1.00 110.50 ? 323  GLU A CD    1 
ATOM 2487  O OE1   . GLU A 1 316 ? -108.456 -60.459 -43.486  1.00 110.83 ? 323  GLU A OE1   1 
ATOM 2488  O OE2   . GLU A 1 316 ? -110.587 -60.636 -42.926  1.00 111.02 ? 323  GLU A OE2   1 
ATOM 2489  N N     . TYR A 1 317 ? -110.064 -55.258 -44.112  1.00 108.34 ? 324  TYR A N     1 
ATOM 2490  C CA    . TYR A 1 317 ? -110.156 -53.997 -43.389  1.00 107.81 ? 324  TYR A CA    1 
ATOM 2491  C C     . TYR A 1 317 ? -111.192 -54.119 -42.284  1.00 107.91 ? 324  TYR A C     1 
ATOM 2492  O O     . TYR A 1 317 ? -112.373 -54.053 -42.577  1.00 108.04 ? 324  TYR A O     1 
ATOM 2493  C CB    . TYR A 1 317 ? -110.678 -52.899 -44.303  1.00 107.53 ? 324  TYR A CB    1 
ATOM 2494  C CG    . TYR A 1 317 ? -109.799 -52.435 -45.417  1.00 106.49 ? 324  TYR A CG    1 
ATOM 2495  C CD1   . TYR A 1 317 ? -109.883 -53.008 -46.665  1.00 106.52 ? 324  TYR A CD1   1 
ATOM 2496  C CD2   . TYR A 1 317 ? -108.953 -51.382 -45.245  1.00 105.98 ? 324  TYR A CD2   1 
ATOM 2497  C CE1   . TYR A 1 317 ? -109.108 -52.578 -47.695  1.00 106.79 ? 324  TYR A CE1   1 
ATOM 2498  C CE2   . TYR A 1 317 ? -108.180 -50.937 -46.269  1.00 107.28 ? 324  TYR A CE2   1 
ATOM 2499  C CZ    . TYR A 1 317 ? -108.256 -51.538 -47.497  1.00 107.30 ? 324  TYR A CZ    1 
ATOM 2500  O OH    . TYR A 1 317 ? -107.476 -51.079 -48.532  1.00 108.03 ? 324  TYR A OH    1 
ATOM 2501  N N     . THR A 1 318 ? -110.793 -54.259 -41.024  1.00 108.03 ? 325  THR A N     1 
ATOM 2502  C CA    . THR A 1 318 ? -111.794 -54.283 -39.948  1.00 108.14 ? 325  THR A CA    1 
ATOM 2503  C C     . THR A 1 318 ? -111.875 -52.942 -39.179  1.00 108.57 ? 325  THR A C     1 
ATOM 2504  O O     . THR A 1 318 ? -110.951 -52.133 -39.250  1.00 108.73 ? 325  THR A O     1 
ATOM 2505  C CB    . THR A 1 318 ? -111.645 -55.521 -39.013  1.00 108.04 ? 325  THR A CB    1 
ATOM 2506  O OG1   . THR A 1 318 ? -110.904 -55.178 -37.829  1.00 107.88 ? 325  THR A OG1   1 
ATOM 2507  C CG2   . THR A 1 318 ? -111.006 -56.714 -39.760  1.00 107.74 ? 325  THR A CG2   1 
ATOM 2508  N N     . PHE A 1 319 ? -112.987 -52.718 -38.467  1.00 108.81 ? 326  PHE A N     1 
ATOM 2509  C CA    . PHE A 1 319 ? -113.305 -51.437 -37.825  1.00 108.87 ? 326  PHE A CA    1 
ATOM 2510  C C     . PHE A 1 319 ? -114.662 -51.415 -37.112  1.00 109.62 ? 326  PHE A C     1 
ATOM 2511  O O     . PHE A 1 319 ? -115.694 -51.733 -37.707  1.00 109.65 ? 326  PHE A O     1 
ATOM 2512  C CB    . PHE A 1 319 ? -113.284 -50.315 -38.851  1.00 108.51 ? 326  PHE A CB    1 
ATOM 2513  C CG    . PHE A 1 319 ? -114.436 -50.334 -39.814  1.00 107.22 ? 326  PHE A CG    1 
ATOM 2514  C CD1   . PHE A 1 319 ? -115.284 -49.243 -39.903  1.00 105.32 ? 326  PHE A CD1   1 
ATOM 2515  C CD2   . PHE A 1 319 ? -114.654 -51.422 -40.649  1.00 106.45 ? 326  PHE A CD2   1 
ATOM 2516  C CE1   . PHE A 1 319 ? -116.329 -49.233 -40.795  1.00 104.67 ? 326  PHE A CE1   1 
ATOM 2517  C CE2   . PHE A 1 319 ? -115.704 -51.422 -41.548  1.00 105.41 ? 326  PHE A CE2   1 
ATOM 2518  C CZ    . PHE A 1 319 ? -116.543 -50.318 -41.623  1.00 104.92 ? 326  PHE A CZ    1 
ATOM 2519  N N     . TYR A 1 320 ? -114.640 -50.992 -35.848  1.00 110.38 ? 327  TYR A N     1 
ATOM 2520  C CA    . TYR A 1 320 ? -115.792 -50.988 -34.946  1.00 111.01 ? 327  TYR A CA    1 
ATOM 2521  C C     . TYR A 1 320 ? -116.119 -49.560 -34.545  1.00 110.95 ? 327  TYR A C     1 
ATOM 2522  O O     . TYR A 1 320 ? -115.241 -48.708 -34.540  1.00 111.30 ? 327  TYR A O     1 
ATOM 2523  C CB    . TYR A 1 320 ? -115.432 -51.787 -33.704  1.00 111.21 ? 327  TYR A CB    1 
ATOM 2524  C CG    . TYR A 1 320 ? -116.527 -51.988 -32.680  1.00 113.36 ? 327  TYR A CG    1 
ATOM 2525  C CD1   . TYR A 1 320 ? -117.323 -53.135 -32.709  1.00 116.03 ? 327  TYR A CD1   1 
ATOM 2526  C CD2   . TYR A 1 320 ? -116.729 -51.075 -31.646  1.00 115.37 ? 327  TYR A CD2   1 
ATOM 2527  C CE1   . TYR A 1 320 ? -118.320 -53.364 -31.757  1.00 117.75 ? 327  TYR A CE1   1 
ATOM 2528  C CE2   . TYR A 1 320 ? -117.730 -51.284 -30.684  1.00 117.85 ? 327  TYR A CE2   1 
ATOM 2529  C CZ    . TYR A 1 320 ? -118.523 -52.443 -30.748  1.00 118.85 ? 327  TYR A CZ    1 
ATOM 2530  O OH    . TYR A 1 320 ? -119.511 -52.713 -29.814  1.00 119.35 ? 327  TYR A OH    1 
ATOM 2531  N N     . GLU A 1 321 ? -117.371 -49.305 -34.176  1.00 110.93 ? 328  GLU A N     1 
ATOM 2532  C CA    . GLU A 1 321 ? -117.845 -47.935 -33.912  1.00 110.51 ? 328  GLU A CA    1 
ATOM 2533  C C     . GLU A 1 321 ? -117.738 -47.415 -32.459  1.00 110.10 ? 328  GLU A C     1 
ATOM 2534  O O     . GLU A 1 321 ? -118.160 -46.290 -32.191  1.00 110.08 ? 328  GLU A O     1 
ATOM 2535  C CB    . GLU A 1 321 ? -119.275 -47.749 -34.429  1.00 110.60 ? 328  GLU A CB    1 
ATOM 2536  C CG    . GLU A 1 321 ? -119.426 -47.891 -35.917  1.00 110.67 ? 328  GLU A CG    1 
ATOM 2537  C CD    . GLU A 1 321 ? -120.474 -46.959 -36.485  1.00 111.73 ? 328  GLU A CD    1 
ATOM 2538  O OE1   . GLU A 1 321 ? -120.827 -45.954 -35.833  1.00 111.67 ? 328  GLU A OE1   1 
ATOM 2539  O OE2   . GLU A 1 321 ? -120.937 -47.221 -37.608  1.00 113.06 ? 328  GLU A OE2   1 
ATOM 2540  N N     . GLY A 1 322 ? -117.191 -48.228 -31.550  1.00 109.45 ? 329  GLY A N     1 
ATOM 2541  C CA    . GLY A 1 322 ? -116.882 -47.866 -30.140  1.00 108.75 ? 329  GLY A CA    1 
ATOM 2542  C C     . GLY A 1 322 ? -117.340 -46.579 -29.442  1.00 108.15 ? 329  GLY A C     1 
ATOM 2543  O O     . GLY A 1 322 ? -117.096 -46.409 -28.250  1.00 107.89 ? 329  GLY A O     1 
ATOM 2544  N N     . MET A 1 323 ? -117.963 -45.672 -30.189  1.00 107.62 ? 330  MET A N     1 
ATOM 2545  C CA    . MET A 1 323 ? -118.632 -44.480 -29.661  1.00 107.28 ? 330  MET A CA    1 
ATOM 2546  C C     . MET A 1 323 ? -119.811 -44.086 -30.577  1.00 107.29 ? 330  MET A C     1 
ATOM 2547  O O     . MET A 1 323 ? -120.129 -42.899 -30.717  1.00 107.37 ? 330  MET A O     1 
ATOM 2548  C CB    . MET A 1 323 ? -117.656 -43.301 -29.501  1.00 107.27 ? 330  MET A CB    1 
ATOM 2549  C CG    . MET A 1 323 ? -117.441 -42.787 -28.080  1.00 106.43 ? 330  MET A CG    1 
ATOM 2550  S SD    . MET A 1 323 ? -116.910 -44.047 -26.901  1.00 105.68 ? 330  MET A SD    1 
ATOM 2551  C CE    . MET A 1 323 ? -116.926 -43.105 -25.404  1.00 105.72 ? 330  MET A CE    1 
ATOM 2552  N N     . GLY A 1 324 ? -120.449 -45.080 -31.201  1.00 106.87 ? 331  GLY A N     1 
ATOM 2553  C CA    . GLY A 1 324 ? -121.620 -44.846 -32.035  1.00 106.28 ? 331  GLY A CA    1 
ATOM 2554  C C     . GLY A 1 324 ? -121.299 -44.022 -33.257  1.00 106.09 ? 331  GLY A C     1 
ATOM 2555  O O     . GLY A 1 324 ? -120.143 -43.783 -33.537  1.00 106.08 ? 331  GLY A O     1 
ATOM 2556  N N     . PRO A 1 325 ? -122.328 -43.600 -34.012  1.00 106.24 ? 332  PRO A N     1 
ATOM 2557  C CA    . PRO A 1 325 ? -122.176 -42.809 -35.220  1.00 106.07 ? 332  PRO A CA    1 
ATOM 2558  C C     . PRO A 1 325 ? -121.055 -41.818 -35.148  1.00 105.64 ? 332  PRO A C     1 
ATOM 2559  O O     . PRO A 1 325 ? -120.788 -41.258 -34.086  1.00 105.53 ? 332  PRO A O     1 
ATOM 2560  C CB    . PRO A 1 325 ? -123.524 -42.090 -35.332  1.00 106.08 ? 332  PRO A CB    1 
ATOM 2561  C CG    . PRO A 1 325 ? -124.505 -43.102 -34.819  1.00 106.53 ? 332  PRO A CG    1 
ATOM 2562  C CD    . PRO A 1 325 ? -123.718 -44.078 -33.906  1.00 106.76 ? 332  PRO A CD    1 
ATOM 2563  N N     . VAL A 1 326 ? -120.400 -41.634 -36.289  1.00 105.34 ? 333  VAL A N     1 
ATOM 2564  C CA    . VAL A 1 326 ? -119.335 -40.658 -36.464  1.00 105.04 ? 333  VAL A CA    1 
ATOM 2565  C C     . VAL A 1 326 ? -119.650 -40.024 -37.807  1.00 104.53 ? 333  VAL A C     1 
ATOM 2566  O O     . VAL A 1 326 ? -120.074 -40.728 -38.724  1.00 104.20 ? 333  VAL A O     1 
ATOM 2567  C CB    . VAL A 1 326 ? -117.950 -41.358 -36.460  1.00 105.34 ? 333  VAL A CB    1 
ATOM 2568  C CG1   . VAL A 1 326 ? -117.602 -41.943 -35.055  1.00 105.27 ? 333  VAL A CG1   1 
ATOM 2569  C CG2   . VAL A 1 326 ? -117.912 -42.478 -37.494  1.00 106.07 ? 333  VAL A CG2   1 
ATOM 2570  N N     . LEU A 1 327 ? -119.495 -38.710 -37.931  1.00 104.37 ? 334  LEU A N     1 
ATOM 2571  C CA    . LEU A 1 327 ? -119.992 -38.038 -39.149  1.00 104.61 ? 334  LEU A CA    1 
ATOM 2572  C C     . LEU A 1 327 ? -119.153 -38.339 -40.411  1.00 104.37 ? 334  LEU A C     1 
ATOM 2573  O O     . LEU A 1 327 ? -119.716 -38.549 -41.510  1.00 105.00 ? 334  LEU A O     1 
ATOM 2574  C CB    . LEU A 1 327 ? -120.220 -36.526 -38.949  1.00 104.67 ? 334  LEU A CB    1 
ATOM 2575  C CG    . LEU A 1 327 ? -119.078 -35.501 -38.908  1.00 106.19 ? 334  LEU A CG    1 
ATOM 2576  C CD1   . LEU A 1 327 ? -117.794 -36.050 -38.169  1.00 107.75 ? 334  LEU A CD1   1 
ATOM 2577  C CD2   . LEU A 1 327 ? -118.758 -34.932 -40.313  1.00 106.00 ? 334  LEU A CD2   1 
ATOM 2578  N N     . ALA A 1 328 ? -117.824 -38.377 -40.245  1.00 103.25 ? 335  ALA A N     1 
ATOM 2579  C CA    . ALA A 1 328 ? -116.898 -38.550 -41.365  1.00 101.57 ? 335  ALA A CA    1 
ATOM 2580  C C     . ALA A 1 328 ? -116.587 -40.015 -41.666  1.00 100.42 ? 335  ALA A C     1 
ATOM 2581  O O     . ALA A 1 328 ? -116.770 -40.881 -40.808  1.00 99.93  ? 335  ALA A O     1 
ATOM 2582  C CB    . ALA A 1 328 ? -115.637 -37.764 -41.115  1.00 101.87 ? 335  ALA A CB    1 
ATOM 2583  N N     . PRO A 1 329 ? -116.109 -40.298 -42.890  1.00 99.48  ? 336  PRO A N     1 
ATOM 2584  C CA    . PRO A 1 329 ? -115.936 -41.680 -43.250  1.00 99.09  ? 336  PRO A CA    1 
ATOM 2585  C C     . PRO A 1 329 ? -114.935 -42.335 -42.333  1.00 98.84  ? 336  PRO A C     1 
ATOM 2586  O O     . PRO A 1 329 ? -113.983 -41.694 -41.878  1.00 99.12  ? 336  PRO A O     1 
ATOM 2587  C CB    . PRO A 1 329 ? -115.391 -41.606 -44.678  1.00 98.88  ? 336  PRO A CB    1 
ATOM 2588  C CG    . PRO A 1 329 ? -115.817 -40.283 -45.175  1.00 99.11  ? 336  PRO A CG    1 
ATOM 2589  C CD    . PRO A 1 329 ? -115.660 -39.415 -43.977  1.00 99.57  ? 336  PRO A CD    1 
ATOM 2590  N N     . VAL A 1 330 ? -115.168 -43.610 -42.065  1.00 98.17  ? 337  VAL A N     1 
ATOM 2591  C CA    . VAL A 1 330 ? -114.297 -44.421 -41.229  1.00 97.68  ? 337  VAL A CA    1 
ATOM 2592  C C     . VAL A 1 330 ? -112.947 -44.796 -41.887  1.00 96.90  ? 337  VAL A C     1 
ATOM 2593  O O     . VAL A 1 330 ? -112.226 -45.667 -41.405  1.00 97.01  ? 337  VAL A O     1 
ATOM 2594  C CB    . VAL A 1 330 ? -115.051 -45.686 -40.842  1.00 97.99  ? 337  VAL A CB    1 
ATOM 2595  C CG1   . VAL A 1 330 ? -115.962 -45.400 -39.651  1.00 98.30  ? 337  VAL A CG1   1 
ATOM 2596  C CG2   . VAL A 1 330 ? -115.858 -46.179 -42.028  1.00 98.06  ? 337  VAL A CG2   1 
ATOM 2597  N N     . THR A 1 331 ? -112.608 -44.077 -42.950  1.00 95.91  ? 338  THR A N     1 
ATOM 2598  C CA    . THR A 1 331 ? -111.622 -44.448 -43.945  1.00 94.95  ? 338  THR A CA    1 
ATOM 2599  C C     . THR A 1 331 ? -110.653 -43.276 -44.013  1.00 94.54  ? 338  THR A C     1 
ATOM 2600  O O     . THR A 1 331 ? -111.082 -42.134 -43.868  1.00 95.62  ? 338  THR A O     1 
ATOM 2601  C CB    . THR A 1 331 ? -112.360 -44.610 -45.312  1.00 95.02  ? 338  THR A CB    1 
ATOM 2602  O OG1   . THR A 1 331 ? -112.064 -45.884 -45.902  1.00 95.55  ? 338  THR A OG1   1 
ATOM 2603  C CG2   . THR A 1 331 ? -112.110 -43.438 -46.300  1.00 93.88  ? 338  THR A CG2   1 
ATOM 2604  N N     . PRO A 1 332 ? -109.356 -43.512 -44.261  1.00 93.41  ? 339  PRO A N     1 
ATOM 2605  C CA    . PRO A 1 332 ? -108.558 -44.695 -44.538  1.00 92.72  ? 339  PRO A CA    1 
ATOM 2606  C C     . PRO A 1 332 ? -108.402 -45.616 -43.343  1.00 92.13  ? 339  PRO A C     1 
ATOM 2607  O O     . PRO A 1 332 ? -108.308 -45.139 -42.212  1.00 92.42  ? 339  PRO A O     1 
ATOM 2608  C CB    . PRO A 1 332 ? -107.211 -44.097 -44.892  1.00 92.72  ? 339  PRO A CB    1 
ATOM 2609  C CG    . PRO A 1 332 ? -107.231 -42.757 -44.279  1.00 92.55  ? 339  PRO A CG    1 
ATOM 2610  C CD    . PRO A 1 332 ? -108.571 -42.295 -44.484  1.00 92.96  ? 339  PRO A CD    1 
ATOM 2611  N N     . VAL A 1 333 ? -108.359 -46.919 -43.591  1.00 91.14  ? 340  VAL A N     1 
ATOM 2612  C CA    . VAL A 1 333 ? -108.367 -47.886 -42.503  1.00 90.48  ? 340  VAL A CA    1 
ATOM 2613  C C     . VAL A 1 333 ? -106.980 -48.436 -42.231  1.00 90.00  ? 340  VAL A C     1 
ATOM 2614  O O     . VAL A 1 333 ? -106.341 -49.012 -43.111  1.00 90.41  ? 340  VAL A O     1 
ATOM 2615  C CB    . VAL A 1 333 ? -109.264 -49.037 -42.828  1.00 90.54  ? 340  VAL A CB    1 
ATOM 2616  C CG1   . VAL A 1 333 ? -109.249 -50.054 -41.711  1.00 90.69  ? 340  VAL A CG1   1 
ATOM 2617  C CG2   . VAL A 1 333 ? -110.635 -48.530 -43.075  1.00 91.36  ? 340  VAL A CG2   1 
ATOM 2618  N N     . PRO A 1 334 ? -106.495 -48.240 -41.014  1.00 89.03  ? 341  PRO A N     1 
ATOM 2619  C CA    . PRO A 1 334 ? -105.174 -48.648 -40.612  1.00 88.22  ? 341  PRO A CA    1 
ATOM 2620  C C     . PRO A 1 334 ? -104.989 -50.135 -40.618  1.00 87.60  ? 341  PRO A C     1 
ATOM 2621  O O     . PRO A 1 334 ? -105.762 -50.853 -40.010  1.00 87.46  ? 341  PRO A O     1 
ATOM 2622  C CB    . PRO A 1 334 ? -105.093 -48.100 -39.219  1.00 88.16  ? 341  PRO A CB    1 
ATOM 2623  C CG    . PRO A 1 334 ? -105.815 -46.804 -39.379  1.00 88.96  ? 341  PRO A CG    1 
ATOM 2624  C CD    . PRO A 1 334 ? -107.015 -47.184 -40.145  1.00 89.05  ? 341  PRO A CD    1 
ATOM 2625  N N     . VAL A 1 335 ? -103.957 -50.573 -41.338  1.00 87.25  ? 342  VAL A N     1 
ATOM 2626  C CA    . VAL A 1 335 ? -103.543 -51.984 -41.414  1.00 86.61  ? 342  VAL A CA    1 
ATOM 2627  C C     . VAL A 1 335 ? -102.072 -52.159 -40.985  1.00 86.20  ? 342  VAL A C     1 
ATOM 2628  O O     . VAL A 1 335 ? -101.210 -51.402 -41.389  1.00 85.43  ? 342  VAL A O     1 
ATOM 2629  C CB    . VAL A 1 335 ? -103.938 -52.654 -42.786  1.00 86.40  ? 342  VAL A CB    1 
ATOM 2630  C CG1   . VAL A 1 335 ? -104.332 -51.639 -43.818  1.00 85.71  ? 342  VAL A CG1   1 
ATOM 2631  C CG2   . VAL A 1 335 ? -102.865 -53.563 -43.317  1.00 86.84  ? 342  VAL A CG2   1 
ATOM 2632  N N     . VAL A 1 336 ? -101.816 -53.138 -40.129  1.00 86.41  ? 343  VAL A N     1 
ATOM 2633  C CA    . VAL A 1 336 ? -100.570 -53.173 -39.404  1.00 87.19  ? 343  VAL A CA    1 
ATOM 2634  C C     . VAL A 1 336 ? -99.734  -54.396 -39.697  1.00 88.50  ? 343  VAL A C     1 
ATOM 2635  O O     . VAL A 1 336 ? -99.862  -55.400 -39.001  1.00 88.75  ? 343  VAL A O     1 
ATOM 2636  C CB    . VAL A 1 336 ? -100.801 -53.117 -37.885  1.00 86.95  ? 343  VAL A CB    1 
ATOM 2637  C CG1   . VAL A 1 336 ? -99.637  -53.735 -37.160  1.00 86.02  ? 343  VAL A CG1   1 
ATOM 2638  C CG2   . VAL A 1 336 ? -100.993 -51.685 -37.411  1.00 86.41  ? 343  VAL A CG2   1 
ATOM 2639  N N     . GLU A 1 337 ? -98.847  -54.294 -40.688  1.00 89.85  ? 344  GLU A N     1 
ATOM 2640  C CA    . GLU A 1 337 ? -97.980  -55.406 -41.094  1.00 91.08  ? 344  GLU A CA    1 
ATOM 2641  C C     . GLU A 1 337 ? -97.061  -55.933 -40.004  1.00 91.65  ? 344  GLU A C     1 
ATOM 2642  O O     . GLU A 1 337 ? -97.012  -57.129 -39.772  1.00 91.50  ? 344  GLU A O     1 
ATOM 2643  C CB    . GLU A 1 337 ? -97.157  -54.998 -42.300  1.00 91.06  ? 344  GLU A CB    1 
ATOM 2644  C CG    . GLU A 1 337 ? -97.835  -55.275 -43.605  1.00 93.34  ? 344  GLU A CG    1 
ATOM 2645  C CD    . GLU A 1 337 ? -97.995  -54.023 -44.485  1.00 97.39  ? 344  GLU A CD    1 
ATOM 2646  O OE1   . GLU A 1 337 ? -97.010  -53.256 -44.705  1.00 98.28  ? 344  GLU A OE1   1 
ATOM 2647  O OE2   . GLU A 1 337 ? -99.129  -53.826 -44.982  1.00 98.44  ? 344  GLU A OE2   1 
ATOM 2648  N N     . SER A 1 338 ? -96.324  -55.053 -39.342  1.00 92.90  ? 345  SER A N     1 
ATOM 2649  C CA    . SER A 1 338 ? -95.363  -55.525 -38.352  1.00 94.34  ? 345  SER A CA    1 
ATOM 2650  C C     . SER A 1 338 ? -95.170  -54.660 -37.113  1.00 94.73  ? 345  SER A C     1 
ATOM 2651  O O     . SER A 1 338 ? -95.258  -53.423 -37.155  1.00 94.87  ? 345  SER A O     1 
ATOM 2652  C CB    . SER A 1 338 ? -94.008  -55.788 -38.985  1.00 94.74  ? 345  SER A CB    1 
ATOM 2653  O OG    . SER A 1 338 ? -93.185  -56.496 -38.076  1.00 96.43  ? 345  SER A OG    1 
ATOM 2654  N N     . LEU A 1 339 ? -94.871  -55.350 -36.017  1.00 94.87  ? 346  LEU A N     1 
ATOM 2655  C CA    . LEU A 1 339 ? -94.800  -54.747 -34.716  1.00 94.95  ? 346  LEU A CA    1 
ATOM 2656  C C     . LEU A 1 339 ? -93.443  -55.032 -34.104  1.00 95.21  ? 346  LEU A C     1 
ATOM 2657  O O     . LEU A 1 339 ? -93.142  -56.175 -33.728  1.00 95.13  ? 346  LEU A O     1 
ATOM 2658  C CB    . LEU A 1 339 ? -95.924  -55.313 -33.873  1.00 94.93  ? 346  LEU A CB    1 
ATOM 2659  C CG    . LEU A 1 339 ? -95.999  -54.906 -32.416  1.00 95.00  ? 346  LEU A CG    1 
ATOM 2660  C CD1   . LEU A 1 339 ? -97.429  -54.509 -32.159  1.00 94.12  ? 346  LEU A CD1   1 
ATOM 2661  C CD2   . LEU A 1 339 ? -95.501  -56.059 -31.492  1.00 95.22  ? 346  LEU A CD2   1 
ATOM 2662  N N     . GLN A 1 340 ? -92.635  -53.977 -34.017  1.00 95.54  ? 347  GLN A N     1 
ATOM 2663  C CA    . GLN A 1 340 ? -91.255  -54.074 -33.572  1.00 96.16  ? 347  GLN A CA    1 
ATOM 2664  C C     . GLN A 1 340 ? -91.068  -53.552 -32.182  1.00 96.07  ? 347  GLN A C     1 
ATOM 2665  O O     . GLN A 1 340 ? -91.652  -52.539 -31.807  1.00 95.92  ? 347  GLN A O     1 
ATOM 2666  C CB    . GLN A 1 340 ? -90.326  -53.286 -34.488  1.00 96.55  ? 347  GLN A CB    1 
ATOM 2667  C CG    . GLN A 1 340 ? -89.369  -54.158 -35.279  1.00 99.05  ? 347  GLN A CG    1 
ATOM 2668  C CD    . GLN A 1 340 ? -90.047  -54.880 -36.435  1.00 102.51 ? 347  GLN A CD    1 
ATOM 2669  O OE1   . GLN A 1 340 ? -90.134  -56.116 -36.442  1.00 104.65 ? 347  GLN A OE1   1 
ATOM 2670  N NE2   . GLN A 1 340 ? -90.545  -54.109 -37.417  1.00 102.45 ? 347  GLN A NE2   1 
ATOM 2671  N N     . LEU A 1 341 ? -90.215  -54.240 -31.437  1.00 96.23  ? 348  LEU A N     1 
ATOM 2672  C CA    . LEU A 1 341 ? -89.873  -53.830 -30.105  1.00 96.53  ? 348  LEU A CA    1 
ATOM 2673  C C     . LEU A 1 341 ? -88.527  -53.071 -30.089  1.00 96.51  ? 348  LEU A C     1 
ATOM 2674  O O     . LEU A 1 341 ? -87.456  -53.666 -30.138  1.00 96.55  ? 348  LEU A O     1 
ATOM 2675  C CB    . LEU A 1 341 ? -89.889  -55.066 -29.211  1.00 96.56  ? 348  LEU A CB    1 
ATOM 2676  C CG    . LEU A 1 341 ? -89.687  -55.029 -27.689  1.00 98.26  ? 348  LEU A CG    1 
ATOM 2677  C CD1   . LEU A 1 341 ? -88.265  -55.417 -27.334  1.00 99.44  ? 348  LEU A CD1   1 
ATOM 2678  C CD2   . LEU A 1 341 ? -90.088  -53.718 -26.982  1.00 99.74  ? 348  LEU A CD2   1 
ATOM 2679  N N     . ASN A 1 342 ? -88.606  -51.744 -30.056  1.00 96.75  ? 349  ASN A N     1 
ATOM 2680  C CA    . ASN A 1 342 ? -87.441  -50.887 -29.809  1.00 97.16  ? 349  ASN A CA    1 
ATOM 2681  C C     . ASN A 1 342 ? -87.146  -50.751 -28.329  1.00 97.70  ? 349  ASN A C     1 
ATOM 2682  O O     . ASN A 1 342 ? -88.035  -50.411 -27.544  1.00 98.11  ? 349  ASN A O     1 
ATOM 2683  C CB    . ASN A 1 342 ? -87.689  -49.470 -30.308  1.00 96.81  ? 349  ASN A CB    1 
ATOM 2684  C CG    . ASN A 1 342 ? -88.006  -49.424 -31.748  1.00 96.51  ? 349  ASN A CG    1 
ATOM 2685  O OD1   . ASN A 1 342 ? -88.074  -48.344 -32.330  1.00 96.04  ? 349  ASN A OD1   1 
ATOM 2686  N ND2   . ASN A 1 342 ? -88.212  -50.595 -32.355  1.00 95.95  ? 349  ASN A ND2   1 
ATOM 2687  N N     . GLY A 1 343 ? -85.898  -50.975 -27.944  1.00 97.92  ? 350  GLY A N     1 
ATOM 2688  C CA    . GLY A 1 343 ? -85.507  -50.732 -26.568  1.00 98.18  ? 350  GLY A CA    1 
ATOM 2689  C C     . GLY A 1 343 ? -86.025  -51.785 -25.620  1.00 98.41  ? 350  GLY A C     1 
ATOM 2690  O O     . GLY A 1 343 ? -86.532  -52.826 -26.040  1.00 97.48  ? 350  GLY A O     1 
ATOM 2691  N N     . GLY A 1 344 ? -85.901  -51.482 -24.329  1.00 99.51  ? 351  GLY A N     1 
ATOM 2692  C CA    . GLY A 1 344 ? -86.227  -52.430 -23.248  1.00 100.76 ? 351  GLY A CA    1 
ATOM 2693  C C     . GLY A 1 344 ? -86.724  -51.834 -21.930  1.00 101.44 ? 351  GLY A C     1 
ATOM 2694  O O     . GLY A 1 344 ? -86.382  -50.693 -21.567  1.00 101.68 ? 351  GLY A O     1 
ATOM 2695  N N     . GLY A 1 345 ? -87.553  -52.613 -21.227  1.00 101.75 ? 352  GLY A N     1 
ATOM 2696  C CA    . GLY A 1 345 ? -88.016  -52.273 -19.879  1.00 102.09 ? 352  GLY A CA    1 
ATOM 2697  C C     . GLY A 1 345 ? -88.499  -50.849 -19.693  1.00 102.07 ? 352  GLY A C     1 
ATOM 2698  O O     . GLY A 1 345 ? -89.451  -50.433 -20.347  1.00 102.46 ? 352  GLY A O     1 
ATOM 2699  N N     . ASP A 1 346 ? -87.843  -50.097 -18.813  1.00 101.78 ? 353  ASP A N     1 
ATOM 2700  C CA    . ASP A 1 346 ? -88.353  -48.775 -18.411  1.00 102.09 ? 353  ASP A CA    1 
ATOM 2701  C C     . ASP A 1 346 ? -88.344  -47.724 -19.553  1.00 101.22 ? 353  ASP A C     1 
ATOM 2702  O O     . ASP A 1 346 ? -89.021  -46.681 -19.482  1.00 101.29 ? 353  ASP A O     1 
ATOM 2703  C CB    . ASP A 1 346 ? -87.659  -48.254 -17.125  1.00 102.98 ? 353  ASP A CB    1 
ATOM 2704  C CG    . ASP A 1 346 ? -86.118  -48.436 -17.147  1.00 105.85 ? 353  ASP A CG    1 
ATOM 2705  O OD1   . ASP A 1 346 ? -85.394  -47.398 -17.295  1.00 108.12 ? 353  ASP A OD1   1 
ATOM 2706  O OD2   . ASP A 1 346 ? -85.644  -49.607 -17.017  1.00 107.31 ? 353  ASP A OD2   1 
ATOM 2707  N N     . VAL A 1 347 ? -87.585  -48.020 -20.608  1.00 99.88  ? 354  VAL A N     1 
ATOM 2708  C CA    . VAL A 1 347 ? -87.531  -47.162 -21.791  1.00 97.97  ? 354  VAL A CA    1 
ATOM 2709  C C     . VAL A 1 347 ? -88.338  -47.759 -22.941  1.00 96.83  ? 354  VAL A C     1 
ATOM 2710  O O     . VAL A 1 347 ? -88.757  -47.014 -23.828  1.00 97.32  ? 354  VAL A O     1 
ATOM 2711  C CB    . VAL A 1 347 ? -86.094  -46.947 -22.272  1.00 97.87  ? 354  VAL A CB    1 
ATOM 2712  C CG1   . VAL A 1 347 ? -86.012  -45.663 -23.107  1.00 97.37  ? 354  VAL A CG1   1 
ATOM 2713  C CG2   . VAL A 1 347 ? -85.126  -46.931 -21.085  1.00 97.44  ? 354  VAL A CG2   1 
ATOM 2714  N N     . ALA A 1 348 ? -88.540  -49.082 -22.915  1.00 94.55  ? 355  ALA A N     1 
ATOM 2715  C CA    . ALA A 1 348 ? -89.322  -49.825 -23.919  1.00 92.73  ? 355  ALA A CA    1 
ATOM 2716  C C     . ALA A 1 348 ? -90.405  -49.061 -24.721  1.00 91.53  ? 355  ALA A C     1 
ATOM 2717  O O     . ALA A 1 348 ? -91.370  -48.514 -24.178  1.00 91.52  ? 355  ALA A O     1 
ATOM 2718  C CB    . ALA A 1 348 ? -89.929  -51.090 -23.303  1.00 92.96  ? 355  ALA A CB    1 
ATOM 2719  N N     . MET A 1 349 ? -90.210  -49.037 -26.031  1.00 89.90  ? 356  MET A N     1 
ATOM 2720  C CA    . MET A 1 349 ? -91.201  -48.580 -26.976  1.00 88.15  ? 356  MET A CA    1 
ATOM 2721  C C     . MET A 1 349 ? -91.435  -49.673 -28.030  1.00 87.55  ? 356  MET A C     1 
ATOM 2722  O O     . MET A 1 349 ? -90.971  -50.813 -27.907  1.00 87.33  ? 356  MET A O     1 
ATOM 2723  C CB    . MET A 1 349 ? -90.752  -47.302 -27.641  1.00 87.50  ? 356  MET A CB    1 
ATOM 2724  C CG    . MET A 1 349 ? -90.752  -46.147 -26.739  1.00 87.15  ? 356  MET A CG    1 
ATOM 2725  S SD    . MET A 1 349 ? -90.238  -44.661 -27.614  1.00 89.00  ? 356  MET A SD    1 
ATOM 2726  C CE    . MET A 1 349 ? -91.018  -44.877 -29.196  1.00 88.95  ? 356  MET A CE    1 
ATOM 2727  N N     . LEU A 1 350 ? -92.153  -49.301 -29.075  1.00 86.46  ? 357  LEU A N     1 
ATOM 2728  C CA    . LEU A 1 350 ? -92.740  -50.240 -29.976  1.00 85.46  ? 357  LEU A CA    1 
ATOM 2729  C C     . LEU A 1 350 ? -92.975  -49.478 -31.250  1.00 85.52  ? 357  LEU A C     1 
ATOM 2730  O O     . LEU A 1 350 ? -93.595  -48.400 -31.244  1.00 85.78  ? 357  LEU A O     1 
ATOM 2731  C CB    . LEU A 1 350 ? -94.081  -50.630 -29.415  1.00 85.37  ? 357  LEU A CB    1 
ATOM 2732  C CG    . LEU A 1 350 ? -94.652  -51.981 -29.775  1.00 85.75  ? 357  LEU A CG    1 
ATOM 2733  C CD1   . LEU A 1 350 ? -94.045  -53.085 -28.912  1.00 86.59  ? 357  LEU A CD1   1 
ATOM 2734  C CD2   . LEU A 1 350 ? -96.127  -51.929 -29.584  1.00 84.11  ? 357  LEU A CD2   1 
ATOM 2735  N N     . GLU A 1 351 ? -92.460  -50.007 -32.350  1.00 85.38  ? 358  GLU A N     1 
ATOM 2736  C CA    . GLU A 1 351 ? -92.615  -49.340 -33.636  1.00 85.16  ? 358  GLU A CA    1 
ATOM 2737  C C     . GLU A 1 351 ? -93.570  -50.142 -34.485  1.00 85.10  ? 358  GLU A C     1 
ATOM 2738  O O     . GLU A 1 351 ? -93.494  -51.374 -34.566  1.00 85.25  ? 358  GLU A O     1 
ATOM 2739  C CB    . GLU A 1 351 ? -91.285  -49.154 -34.362  1.00 85.05  ? 358  GLU A CB    1 
ATOM 2740  C CG    . GLU A 1 351 ? -91.350  -48.029 -35.363  1.00 85.46  ? 358  GLU A CG    1 
ATOM 2741  C CD    . GLU A 1 351 ? -90.352  -48.160 -36.508  1.00 86.18  ? 358  GLU A CD    1 
ATOM 2742  O OE1   . GLU A 1 351 ? -90.525  -47.415 -37.519  1.00 86.26  ? 358  GLU A OE1   1 
ATOM 2743  O OE2   . GLU A 1 351 ? -89.412  -48.987 -36.392  1.00 85.02  ? 358  GLU A OE2   1 
ATOM 2744  N N     . LEU A 1 352 ? -94.494  -49.433 -35.098  1.00 84.99  ? 359  LEU A N     1 
ATOM 2745  C CA    . LEU A 1 352 ? -95.524  -50.076 -35.867  1.00 85.04  ? 359  LEU A CA    1 
ATOM 2746  C C     . LEU A 1 352 ? -95.387  -49.648 -37.318  1.00 85.46  ? 359  LEU A C     1 
ATOM 2747  O O     . LEU A 1 352 ? -95.326  -48.443 -37.653  1.00 85.19  ? 359  LEU A O     1 
ATOM 2748  C CB    . LEU A 1 352 ? -96.910  -49.750 -35.297  1.00 84.89  ? 359  LEU A CB    1 
ATOM 2749  C CG    . LEU A 1 352 ? -97.583  -50.682 -34.275  1.00 84.35  ? 359  LEU A CG    1 
ATOM 2750  C CD1   . LEU A 1 352 ? -96.673  -51.123 -33.156  1.00 85.00  ? 359  LEU A CD1   1 
ATOM 2751  C CD2   . LEU A 1 352 ? -98.799  -50.032 -33.675  1.00 83.44  ? 359  LEU A CD2   1 
ATOM 2752  N N     . THR A 1 353 ? -95.296  -50.667 -38.167  1.00 85.69  ? 360  THR A N     1 
ATOM 2753  C CA    . THR A 1 353 ? -95.157  -50.493 -39.601  1.00 85.54  ? 360  THR A CA    1 
ATOM 2754  C C     . THR A 1 353 ? -96.386  -51.133 -40.159  1.00 85.02  ? 360  THR A C     1 
ATOM 2755  O O     . THR A 1 353 ? -96.740  -52.251 -39.791  1.00 85.17  ? 360  THR A O     1 
ATOM 2756  C CB    . THR A 1 353 ? -93.906  -51.224 -40.167  1.00 85.88  ? 360  THR A CB    1 
ATOM 2757  O OG1   . THR A 1 353 ? -93.971  -52.640 -39.863  1.00 86.43  ? 360  THR A OG1   1 
ATOM 2758  C CG2   . THR A 1 353 ? -92.602  -50.594 -39.601  1.00 85.45  ? 360  THR A CG2   1 
ATOM 2759  N N     . GLY A 1 354 ? -97.052  -50.402 -41.023  1.00 84.47  ? 361  GLY A N     1 
ATOM 2760  C CA    . GLY A 1 354 ? -98.234  -50.893 -41.675  1.00 84.50  ? 361  GLY A CA    1 
ATOM 2761  C C     . GLY A 1 354 ? -98.428  -49.914 -42.786  1.00 84.66  ? 361  GLY A C     1 
ATOM 2762  O O     . GLY A 1 354 ? -97.454  -49.449 -43.362  1.00 85.13  ? 361  GLY A O     1 
ATOM 2763  N N     . GLN A 1 355 ? -99.673  -49.583 -43.088  1.00 84.53  ? 362  GLN A N     1 
ATOM 2764  C CA    . GLN A 1 355 ? -99.949  -48.561 -44.076  1.00 84.79  ? 362  GLN A CA    1 
ATOM 2765  C C     . GLN A 1 355 ? -101.229 -47.883 -43.753  1.00 84.82  ? 362  GLN A C     1 
ATOM 2766  O O     . GLN A 1 355 ? -102.001 -48.374 -42.934  1.00 84.96  ? 362  GLN A O     1 
ATOM 2767  C CB    . GLN A 1 355 ? -100.034 -49.153 -45.460  1.00 85.04  ? 362  GLN A CB    1 
ATOM 2768  C CG    . GLN A 1 355 ? -100.140 -50.642 -45.450  1.00 86.46  ? 362  GLN A CG    1 
ATOM 2769  C CD    . GLN A 1 355 ? -100.493 -51.207 -46.790  1.00 88.25  ? 362  GLN A CD    1 
ATOM 2770  O OE1   . GLN A 1 355 ? -101.016 -50.499 -47.660  1.00 89.50  ? 362  GLN A OE1   1 
ATOM 2771  N NE2   . GLN A 1 355 ? -100.231 -52.499 -46.971  1.00 88.20  ? 362  GLN A NE2   1 
ATOM 2772  N N     . ASN A 1 356 ? -101.453 -46.745 -44.398  1.00 84.81  ? 363  ASN A N     1 
ATOM 2773  C CA    . ASN A 1 356 ? -102.590 -45.876 -44.072  1.00 84.92  ? 363  ASN A CA    1 
ATOM 2774  C C     . ASN A 1 356 ? -102.571 -45.330 -42.642  1.00 84.61  ? 363  ASN A C     1 
ATOM 2775  O O     . ASN A 1 356 ? -103.629 -45.191 -42.022  1.00 85.51  ? 363  ASN A O     1 
ATOM 2776  C CB    . ASN A 1 356 ? -103.934 -46.600 -44.262  1.00 84.75  ? 363  ASN A CB    1 
ATOM 2777  C CG    . ASN A 1 356 ? -104.096 -47.169 -45.610  1.00 85.63  ? 363  ASN A CG    1 
ATOM 2778  O OD1   . ASN A 1 356 ? -103.896 -46.499 -46.625  1.00 87.67  ? 363  ASN A OD1   1 
ATOM 2779  N ND2   . ASN A 1 356 ? -104.485 -48.412 -45.652  1.00 86.33  ? 363  ASN A ND2   1 
ATOM 2780  N N     . PHE A 1 357 ? -101.420 -45.041 -42.067  1.00 83.35  ? 364  PHE A N     1 
ATOM 2781  C CA    . PHE A 1 357 ? -101.522 -44.500 -40.738  1.00 82.19  ? 364  PHE A CA    1 
ATOM 2782  C C     . PHE A 1 357 ? -101.857 -43.050 -40.881  1.00 81.88  ? 364  PHE A C     1 
ATOM 2783  O O     . PHE A 1 357 ? -101.832 -42.522 -41.990  1.00 81.56  ? 364  PHE A O     1 
ATOM 2784  C CB    . PHE A 1 357 ? -100.287 -44.750 -39.897  1.00 82.16  ? 364  PHE A CB    1 
ATOM 2785  C CG    . PHE A 1 357 ? -100.059 -46.193 -39.591  1.00 81.31  ? 364  PHE A CG    1 
ATOM 2786  C CD1   . PHE A 1 357 ? -98.944  -46.590 -38.878  1.00 80.52  ? 364  PHE A CD1   1 
ATOM 2787  C CD2   . PHE A 1 357 ? -100.948 -47.159 -40.029  1.00 81.66  ? 364  PHE A CD2   1 
ATOM 2788  C CE1   . PHE A 1 357 ? -98.707  -47.913 -38.588  1.00 79.87  ? 364  PHE A CE1   1 
ATOM 2789  C CE2   . PHE A 1 357 ? -100.713 -48.494 -39.748  1.00 82.98  ? 364  PHE A CE2   1 
ATOM 2790  C CZ    . PHE A 1 357 ? -99.581  -48.863 -39.016  1.00 81.36  ? 364  PHE A CZ    1 
ATOM 2791  N N     . THR A 1 358 ? -102.233 -42.440 -39.763  1.00 81.70  ? 365  THR A N     1 
ATOM 2792  C CA    . THR A 1 358 ? -102.758 -41.066 -39.696  1.00 81.41  ? 365  THR A CA    1 
ATOM 2793  C C     . THR A 1 358 ? -102.459 -40.556 -38.318  1.00 81.29  ? 365  THR A C     1 
ATOM 2794  O O     . THR A 1 358 ? -102.435 -41.357 -37.371  1.00 81.64  ? 365  THR A O     1 
ATOM 2795  C CB    . THR A 1 358 ? -104.285 -40.991 -39.888  1.00 81.20  ? 365  THR A CB    1 
ATOM 2796  O OG1   . THR A 1 358 ? -104.848 -42.311 -39.824  1.00 81.50  ? 365  THR A OG1   1 
ATOM 2797  C CG2   . THR A 1 358 ? -104.615 -40.394 -41.213  1.00 80.86  ? 365  THR A CG2   1 
ATOM 2798  N N     . PRO A 1 359 ? -102.228 -39.234 -38.182  1.00 80.97  ? 366  PRO A N     1 
ATOM 2799  C CA    . PRO A 1 359 ? -101.722 -38.748 -36.918  1.00 81.16  ? 366  PRO A CA    1 
ATOM 2800  C C     . PRO A 1 359 ? -102.738 -38.958 -35.804  1.00 81.69  ? 366  PRO A C     1 
ATOM 2801  O O     . PRO A 1 359 ? -102.353 -39.093 -34.639  1.00 81.82  ? 366  PRO A O     1 
ATOM 2802  C CB    . PRO A 1 359 ? -101.504 -37.262 -37.172  1.00 80.80  ? 366  PRO A CB    1 
ATOM 2803  C CG    . PRO A 1 359 ? -101.606 -37.052 -38.589  1.00 80.42  ? 366  PRO A CG    1 
ATOM 2804  C CD    . PRO A 1 359 ? -102.504 -38.122 -39.096  1.00 80.97  ? 366  PRO A CD    1 
ATOM 2805  N N     . ASN A 1 360 ? -104.013 -39.050 -36.194  1.00 82.14  ? 367  ASN A N     1 
ATOM 2806  C CA    . ASN A 1 360 ? -105.157 -39.110 -35.300  1.00 82.42  ? 367  ASN A CA    1 
ATOM 2807  C C     . ASN A 1 360 ? -105.507 -40.533 -34.858  1.00 82.41  ? 367  ASN A C     1 
ATOM 2808  O O     . ASN A 1 360 ? -106.667 -40.922 -34.815  1.00 82.40  ? 367  ASN A O     1 
ATOM 2809  C CB    . ASN A 1 360 ? -106.344 -38.459 -36.002  1.00 82.79  ? 367  ASN A CB    1 
ATOM 2810  C CG    . ASN A 1 360 ? -106.828 -39.266 -37.215  1.00 84.58  ? 367  ASN A CG    1 
ATOM 2811  O OD1   . ASN A 1 360 ? -106.233 -40.286 -37.556  1.00 86.23  ? 367  ASN A OD1   1 
ATOM 2812  N ND2   . ASN A 1 360 ? -107.916 -38.818 -37.858  1.00 86.91  ? 367  ASN A ND2   1 
ATOM 2813  N N     . LEU A 1 361 ? -104.487 -41.313 -34.539  1.00 82.73  ? 368  LEU A N     1 
ATOM 2814  C CA    . LEU A 1 361 ? -104.660 -42.644 -33.969  1.00 82.97  ? 368  LEU A CA    1 
ATOM 2815  C C     . LEU A 1 361 ? -103.848 -42.669 -32.704  1.00 83.24  ? 368  LEU A C     1 
ATOM 2816  O O     . LEU A 1 361 ? -103.244 -41.667 -32.369  1.00 83.43  ? 368  LEU A O     1 
ATOM 2817  C CB    . LEU A 1 361 ? -104.190 -43.722 -34.944  1.00 82.99  ? 368  LEU A CB    1 
ATOM 2818  C CG    . LEU A 1 361 ? -105.140 -44.022 -36.107  1.00 82.75  ? 368  LEU A CG    1 
ATOM 2819  C CD1   . LEU A 1 361 ? -104.791 -43.244 -37.319  1.00 81.49  ? 368  LEU A CD1   1 
ATOM 2820  C CD2   . LEU A 1 361 ? -105.096 -45.484 -36.421  1.00 82.53  ? 368  LEU A CD2   1 
ATOM 2821  N N     . ARG A 1 362 ? -103.825 -43.803 -32.015  1.00 83.80  ? 369  ARG A N     1 
ATOM 2822  C CA    . ARG A 1 362 ? -103.222 -43.936 -30.670  1.00 84.48  ? 369  ARG A CA    1 
ATOM 2823  C C     . ARG A 1 362 ? -103.311 -45.423 -30.360  1.00 84.58  ? 369  ARG A C     1 
ATOM 2824  O O     . ARG A 1 362 ? -104.390 -45.992 -30.309  1.00 84.41  ? 369  ARG A O     1 
ATOM 2825  C CB    . ARG A 1 362 ? -104.017 -43.130 -29.605  1.00 84.76  ? 369  ARG A CB    1 
ATOM 2826  C CG    . ARG A 1 362 ? -103.337 -41.926 -28.861  1.00 85.51  ? 369  ARG A CG    1 
ATOM 2827  C CD    . ARG A 1 362 ? -102.753 -40.865 -29.775  1.00 88.36  ? 369  ARG A CD    1 
ATOM 2828  N NE    . ARG A 1 362 ? -103.297 -39.530 -29.542  1.00 90.61  ? 369  ARG A NE    1 
ATOM 2829  C CZ    . ARG A 1 362 ? -103.381 -38.573 -30.476  1.00 90.19  ? 369  ARG A CZ    1 
ATOM 2830  N NH1   . ARG A 1 362 ? -102.968 -38.794 -31.716  1.00 88.69  ? 369  ARG A NH1   1 
ATOM 2831  N NH2   . ARG A 1 362 ? -103.895 -37.385 -30.177  1.00 90.25  ? 369  ARG A NH2   1 
ATOM 2832  N N     . VAL A 1 363 ? -102.185 -46.078 -30.205  1.00 85.25  ? 370  VAL A N     1 
ATOM 2833  C CA    . VAL A 1 363 ? -102.232 -47.525 -30.095  1.00 86.17  ? 370  VAL A CA    1 
ATOM 2834  C C     . VAL A 1 363 ? -102.555 -47.857 -28.663  1.00 86.99  ? 370  VAL A C     1 
ATOM 2835  O O     . VAL A 1 363 ? -101.945 -47.286 -27.769  1.00 87.45  ? 370  VAL A O     1 
ATOM 2836  C CB    . VAL A 1 363 ? -100.917 -48.210 -30.629  1.00 86.01  ? 370  VAL A CB    1 
ATOM 2837  C CG1   . VAL A 1 363 ? -99.860  -47.186 -30.960  1.00 85.62  ? 370  VAL A CG1   1 
ATOM 2838  C CG2   . VAL A 1 363 ? -100.376 -49.235 -29.659  1.00 85.75  ? 370  VAL A CG2   1 
ATOM 2839  N N     . TRP A 1 364 ? -103.528 -48.746 -28.452  1.00 88.19  ? 371  TRP A N     1 
ATOM 2840  C CA    . TRP A 1 364 ? -103.964 -49.154 -27.105  1.00 89.54  ? 371  TRP A CA    1 
ATOM 2841  C C     . TRP A 1 364 ? -103.484 -50.530 -26.755  1.00 90.37  ? 371  TRP A C     1 
ATOM 2842  O O     . TRP A 1 364 ? -103.733 -51.491 -27.496  1.00 90.36  ? 371  TRP A O     1 
ATOM 2843  C CB    . TRP A 1 364 ? -105.480 -49.197 -27.006  1.00 89.61  ? 371  TRP A CB    1 
ATOM 2844  C CG    . TRP A 1 364 ? -106.173 -47.877 -26.870  1.00 91.09  ? 371  TRP A CG    1 
ATOM 2845  C CD1   . TRP A 1 364 ? -106.015 -46.758 -27.655  1.00 93.24  ? 371  TRP A CD1   1 
ATOM 2846  C CD2   . TRP A 1 364 ? -107.180 -47.547 -25.917  1.00 91.69  ? 371  TRP A CD2   1 
ATOM 2847  N NE1   . TRP A 1 364 ? -106.855 -45.744 -27.232  1.00 92.80  ? 371  TRP A NE1   1 
ATOM 2848  C CE2   . TRP A 1 364 ? -107.583 -46.210 -26.172  1.00 91.89  ? 371  TRP A CE2   1 
ATOM 2849  C CE3   . TRP A 1 364 ? -107.792 -48.254 -24.874  1.00 90.68  ? 371  TRP A CE3   1 
ATOM 2850  C CZ2   . TRP A 1 364 ? -108.552 -45.578 -25.422  1.00 91.40  ? 371  TRP A CZ2   1 
ATOM 2851  C CZ3   . TRP A 1 364 ? -108.740 -47.629 -24.138  1.00 90.33  ? 371  TRP A CZ3   1 
ATOM 2852  C CH2   . TRP A 1 364 ? -109.115 -46.297 -24.406  1.00 91.58  ? 371  TRP A CH2   1 
ATOM 2853  N N     . PHE A 1 365 ? -102.824 -50.634 -25.611  1.00 91.77  ? 372  PHE A N     1 
ATOM 2854  C CA    . PHE A 1 365 ? -102.410 -51.932 -25.095  1.00 93.48  ? 372  PHE A CA    1 
ATOM 2855  C C     . PHE A 1 365 ? -103.547 -52.466 -24.210  1.00 94.56  ? 372  PHE A C     1 
ATOM 2856  O O     . PHE A 1 365 ? -103.768 -51.967 -23.100  1.00 95.27  ? 372  PHE A O     1 
ATOM 2857  C CB    . PHE A 1 365 ? -101.108 -51.802 -24.303  1.00 93.52  ? 372  PHE A CB    1 
ATOM 2858  C CG    . PHE A 1 365 ? -99.902  -51.446 -25.138  1.00 93.77  ? 372  PHE A CG    1 
ATOM 2859  C CD1   . PHE A 1 365 ? -99.862  -50.240 -25.862  1.00 92.60  ? 372  PHE A CD1   1 
ATOM 2860  C CD2   . PHE A 1 365 ? -98.791  -52.301 -25.161  1.00 93.61  ? 372  PHE A CD2   1 
ATOM 2861  C CE1   . PHE A 1 365 ? -98.766  -49.898 -26.612  1.00 91.92  ? 372  PHE A CE1   1 
ATOM 2862  C CE2   . PHE A 1 365 ? -97.682  -51.973 -25.903  1.00 94.03  ? 372  PHE A CE2   1 
ATOM 2863  C CZ    . PHE A 1 365 ? -97.667  -50.750 -26.638  1.00 93.69  ? 372  PHE A CZ    1 
ATOM 2864  N N     . GLY A 1 366 ? -104.290 -53.460 -24.699  1.00 95.37  ? 373  GLY A N     1 
ATOM 2865  C CA    . GLY A 1 366 ? -105.576 -53.804 -24.082  1.00 95.80  ? 373  GLY A CA    1 
ATOM 2866  C C     . GLY A 1 366 ? -106.479 -52.575 -23.943  1.00 96.25  ? 373  GLY A C     1 
ATOM 2867  O O     . GLY A 1 366 ? -106.904 -51.982 -24.962  1.00 96.15  ? 373  GLY A O     1 
ATOM 2868  N N     . ASP A 1 367 ? -106.739 -52.188 -22.683  1.00 96.52  ? 374  ASP A N     1 
ATOM 2869  C CA    . ASP A 1 367 ? -107.640 -51.060 -22.322  1.00 96.54  ? 374  ASP A CA    1 
ATOM 2870  C C     . ASP A 1 367 ? -106.883 -49.774 -21.935  1.00 96.47  ? 374  ASP A C     1 
ATOM 2871  O O     . ASP A 1 367 ? -107.503 -48.726 -21.732  1.00 96.77  ? 374  ASP A O     1 
ATOM 2872  C CB    . ASP A 1 367 ? -108.638 -51.467 -21.203  1.00 96.32  ? 374  ASP A CB    1 
ATOM 2873  C CG    . ASP A 1 367 ? -107.934 -51.829 -19.874  1.00 96.57  ? 374  ASP A CG    1 
ATOM 2874  O OD1   . ASP A 1 367 ? -107.265 -52.893 -19.787  1.00 97.07  ? 374  ASP A OD1   1 
ATOM 2875  O OD2   . ASP A 1 367 ? -108.051 -51.049 -18.906  1.00 96.38  ? 374  ASP A OD2   1 
ATOM 2876  N N     . VAL A 1 368 ? -105.556 -49.857 -21.835  1.00 96.16  ? 375  VAL A N     1 
ATOM 2877  C CA    . VAL A 1 368 ? -104.727 -48.697 -21.500  1.00 95.79  ? 375  VAL A CA    1 
ATOM 2878  C C     . VAL A 1 368 ? -104.223 -48.015 -22.780  1.00 95.47  ? 375  VAL A C     1 
ATOM 2879  O O     . VAL A 1 368 ? -103.427 -48.599 -23.508  1.00 95.32  ? 375  VAL A O     1 
ATOM 2880  C CB    . VAL A 1 368 ? -103.502 -49.090 -20.614  1.00 95.85  ? 375  VAL A CB    1 
ATOM 2881  C CG1   . VAL A 1 368 ? -103.156 -47.946 -19.675  1.00 96.99  ? 375  VAL A CG1   1 
ATOM 2882  C CG2   . VAL A 1 368 ? -103.758 -50.364 -19.808  1.00 95.27  ? 375  VAL A CG2   1 
ATOM 2883  N N     . GLU A 1 369 ? -104.702 -46.804 -23.068  1.00 95.19  ? 376  GLU A N     1 
ATOM 2884  C CA    . GLU A 1 369 ? -104.191 -46.013 -24.185  1.00 95.11  ? 376  GLU A CA    1 
ATOM 2885  C C     . GLU A 1 369 ? -102.744 -45.590 -23.889  1.00 95.54  ? 376  GLU A C     1 
ATOM 2886  O O     . GLU A 1 369 ? -102.401 -45.202 -22.756  1.00 96.11  ? 376  GLU A O     1 
ATOM 2887  C CB    . GLU A 1 369 ? -105.075 -44.809 -24.419  1.00 94.81  ? 376  GLU A CB    1 
ATOM 2888  C CG    . GLU A 1 369 ? -104.527 -43.774 -25.340  1.00 96.01  ? 376  GLU A CG    1 
ATOM 2889  C CD    . GLU A 1 369 ? -105.624 -42.858 -25.909  1.00 99.38  ? 376  GLU A CD    1 
ATOM 2890  O OE1   . GLU A 1 369 ? -106.474 -43.337 -26.701  1.00 100.45 ? 376  GLU A OE1   1 
ATOM 2891  O OE2   . GLU A 1 369 ? -105.630 -41.647 -25.584  1.00 100.17 ? 376  GLU A OE2   1 
ATOM 2892  N N     . ALA A 1 370 ? -101.890 -45.713 -24.909  1.00 95.47  ? 377  ALA A N     1 
ATOM 2893  C CA    . ALA A 1 370 ? -100.445 -45.457 -24.794  1.00 94.77  ? 377  ALA A CA    1 
ATOM 2894  C C     . ALA A 1 370 ? -100.116 -44.299 -25.689  1.00 94.21  ? 377  ALA A C     1 
ATOM 2895  O O     . ALA A 1 370 ? -100.734 -44.138 -26.726  1.00 93.93  ? 377  ALA A O     1 
ATOM 2896  C CB    . ALA A 1 370 ? -99.639  -46.676 -25.187  1.00 94.64  ? 377  ALA A CB    1 
ATOM 2897  N N     . GLU A 1 371 ? -99.163  -43.479 -25.265  1.00 93.99  ? 378  GLU A N     1 
ATOM 2898  C CA    . GLU A 1 371 ? -98.851  -42.256 -25.984  1.00 93.76  ? 378  GLU A CA    1 
ATOM 2899  C C     . GLU A 1 371 ? -98.266  -42.633 -27.309  1.00 92.96  ? 378  GLU A C     1 
ATOM 2900  O O     . GLU A 1 371 ? -97.432  -43.554 -27.411  1.00 92.75  ? 378  GLU A O     1 
ATOM 2901  C CB    . GLU A 1 371 ? -97.859  -41.394 -25.226  1.00 94.18  ? 378  GLU A CB    1 
ATOM 2902  C CG    . GLU A 1 371 ? -97.466  -40.136 -25.985  1.00 96.02  ? 378  GLU A CG    1 
ATOM 2903  C CD    . GLU A 1 371 ? -96.278  -39.439 -25.346  1.00 98.61  ? 378  GLU A CD    1 
ATOM 2904  O OE1   . GLU A 1 371 ? -95.557  -40.117 -24.551  1.00 98.19  ? 378  GLU A OE1   1 
ATOM 2905  O OE2   . GLU A 1 371 ? -96.082  -38.219 -25.634  1.00 99.38  ? 378  GLU A OE2   1 
ATOM 2906  N N     . THR A 1 372 ? -98.706  -41.920 -28.329  1.00 91.75  ? 379  THR A N     1 
ATOM 2907  C CA    . THR A 1 372 ? -98.437  -42.395 -29.648  1.00 90.79  ? 379  THR A CA    1 
ATOM 2908  C C     . THR A 1 372 ? -97.780  -41.319 -30.475  1.00 90.28  ? 379  THR A C     1 
ATOM 2909  O O     . THR A 1 372 ? -98.364  -40.269 -30.703  1.00 90.36  ? 379  THR A O     1 
ATOM 2910  C CB    . THR A 1 372 ? -99.713  -42.942 -30.286  1.00 90.61  ? 379  THR A CB    1 
ATOM 2911  O OG1   . THR A 1 372 ? -99.992  -44.223 -29.729  1.00 90.81  ? 379  THR A OG1   1 
ATOM 2912  C CG2   . THR A 1 372 ? -99.549  -43.132 -31.747  1.00 91.08  ? 379  THR A CG2   1 
ATOM 2913  N N     . MET A 1 373 ? -96.540  -41.588 -30.886  1.00 89.40  ? 380  MET A N     1 
ATOM 2914  C CA    . MET A 1 373 ? -95.853  -40.774 -31.870  1.00 88.33  ? 380  MET A CA    1 
ATOM 2915  C C     . MET A 1 373 ? -96.047  -41.346 -33.263  1.00 87.14  ? 380  MET A C     1 
ATOM 2916  O O     . MET A 1 373 ? -95.755  -42.541 -33.539  1.00 87.03  ? 380  MET A O     1 
ATOM 2917  C CB    . MET A 1 373 ? -94.371  -40.682 -31.561  1.00 88.89  ? 380  MET A CB    1 
ATOM 2918  C CG    . MET A 1 373 ? -94.042  -39.688 -30.490  1.00 90.79  ? 380  MET A CG    1 
ATOM 2919  S SD    . MET A 1 373 ? -94.312  -40.470 -28.908  1.00 96.69  ? 380  MET A SD    1 
ATOM 2920  C CE    . MET A 1 373 ? -92.950  -41.690 -28.907  1.00 94.61  ? 380  MET A CE    1 
ATOM 2921  N N     . TYR A 1 374 ? -96.547  -40.480 -34.135  1.00 85.32  ? 381  TYR A N     1 
ATOM 2922  C CA    . TYR A 1 374 ? -96.803  -40.828 -35.507  1.00 83.84  ? 381  TYR A CA    1 
ATOM 2923  C C     . TYR A 1 374 ? -95.564  -40.428 -36.254  1.00 83.77  ? 381  TYR A C     1 
ATOM 2924  O O     . TYR A 1 374 ? -95.198  -39.251 -36.213  1.00 84.31  ? 381  TYR A O     1 
ATOM 2925  C CB    . TYR A 1 374 ? -97.992  -40.025 -35.976  1.00 83.09  ? 381  TYR A CB    1 
ATOM 2926  C CG    . TYR A 1 374 ? -98.140  -39.924 -37.439  1.00 82.10  ? 381  TYR A CG    1 
ATOM 2927  C CD1   . TYR A 1 374 ? -98.575  -41.012 -38.196  1.00 82.69  ? 381  TYR A CD1   1 
ATOM 2928  C CD2   . TYR A 1 374 ? -97.876  -38.732 -38.087  1.00 82.40  ? 381  TYR A CD2   1 
ATOM 2929  C CE1   . TYR A 1 374 ? -98.732  -40.918 -39.586  1.00 82.69  ? 381  TYR A CE1   1 
ATOM 2930  C CE2   . TYR A 1 374 ? -98.018  -38.623 -39.484  1.00 83.64  ? 381  TYR A CE2   1 
ATOM 2931  C CZ    . TYR A 1 374 ? -98.445  -39.724 -40.212  1.00 82.88  ? 381  TYR A CZ    1 
ATOM 2932  O OH    . TYR A 1 374 ? -98.583  -39.613 -41.554  1.00 82.51  ? 381  TYR A OH    1 
ATOM 2933  N N     . ARG A 1 375 ? -94.878  -41.384 -36.894  1.00 83.20  ? 382  ARG A N     1 
ATOM 2934  C CA    . ARG A 1 375 ? -93.719  -41.004 -37.704  1.00 82.30  ? 382  ARG A CA    1 
ATOM 2935  C C     . ARG A 1 375 ? -94.142  -40.689 -39.125  1.00 81.77  ? 382  ARG A C     1 
ATOM 2936  O O     . ARG A 1 375 ? -93.900  -39.588 -39.606  1.00 81.32  ? 382  ARG A O     1 
ATOM 2937  C CB    . ARG A 1 375 ? -92.565  -41.996 -37.592  1.00 82.46  ? 382  ARG A CB    1 
ATOM 2938  C CG    . ARG A 1 375 ? -91.803  -41.895 -36.255  1.00 83.24  ? 382  ARG A CG    1 
ATOM 2939  C CD    . ARG A 1 375 ? -91.358  -40.475 -35.952  1.00 84.31  ? 382  ARG A CD    1 
ATOM 2940  N NE    . ARG A 1 375 ? -90.023  -40.200 -36.478  1.00 86.53  ? 382  ARG A NE    1 
ATOM 2941  C CZ    . ARG A 1 375 ? -89.589  -39.018 -36.935  1.00 89.02  ? 382  ARG A CZ    1 
ATOM 2942  N NH1   . ARG A 1 375 ? -90.376  -37.944 -36.985  1.00 89.04  ? 382  ARG A NH1   1 
ATOM 2943  N NH2   . ARG A 1 375 ? -88.339  -38.907 -37.366  1.00 91.11  ? 382  ARG A NH2   1 
ATOM 2944  N N     . CYS A 1 376 ? -94.829  -41.621 -39.773  1.00 81.83  ? 383  CYS A N     1 
ATOM 2945  C CA    . CYS A 1 376 ? -95.425  -41.337 -41.100  1.00 81.96  ? 383  CYS A CA    1 
ATOM 2946  C C     . CYS A 1 376 ? -96.433  -42.403 -41.514  1.00 81.66  ? 383  CYS A C     1 
ATOM 2947  O O     . CYS A 1 376 ? -96.518  -43.457 -40.879  1.00 81.17  ? 383  CYS A O     1 
ATOM 2948  C CB    . CYS A 1 376 ? -94.340  -41.204 -42.186  1.00 82.11  ? 383  CYS A CB    1 
ATOM 2949  S SG    . CYS A 1 376 ? -93.478  -42.747 -42.580  1.00 82.36  ? 383  CYS A SG    1 
ATOM 2950  N N     . GLY A 1 377 ? -97.173  -42.122 -42.581  1.00 81.25  ? 384  GLY A N     1 
ATOM 2951  C CA    . GLY A 1 377 ? -98.016  -43.102 -43.224  1.00 82.08  ? 384  GLY A CA    1 
ATOM 2952  C C     . GLY A 1 377 ? -97.808  -44.583 -42.862  1.00 82.93  ? 384  GLY A C     1 
ATOM 2953  O O     . GLY A 1 377 ? -98.780  -45.297 -42.568  1.00 83.27  ? 384  GLY A O     1 
ATOM 2954  N N     . GLU A 1 378 ? -96.567  -45.073 -42.883  1.00 82.86  ? 385  GLU A N     1 
ATOM 2955  C CA    . GLU A 1 378 ? -96.353  -46.508 -42.827  1.00 83.02  ? 385  GLU A CA    1 
ATOM 2956  C C     . GLU A 1 378 ? -95.498  -46.924 -41.615  1.00 83.86  ? 385  GLU A C     1 
ATOM 2957  O O     . GLU A 1 378 ? -95.060  -48.082 -41.485  1.00 84.03  ? 385  GLU A O     1 
ATOM 2958  C CB    . GLU A 1 378 ? -95.843  -47.010 -44.179  1.00 82.60  ? 385  GLU A CB    1 
ATOM 2959  C CG    . GLU A 1 378 ? -95.104  -45.951 -45.024  1.00 83.30  ? 385  GLU A CG    1 
ATOM 2960  C CD    . GLU A 1 378 ? -96.010  -44.984 -45.814  1.00 83.47  ? 385  GLU A CD    1 
ATOM 2961  O OE1   . GLU A 1 378 ? -97.213  -45.250 -45.987  1.00 84.58  ? 385  GLU A OE1   1 
ATOM 2962  O OE2   . GLU A 1 378 ? -95.510  -43.938 -46.280  1.00 82.08  ? 385  GLU A OE2   1 
ATOM 2963  N N     . SER A 1 379 ? -95.325  -45.976 -40.693  1.00 84.75  ? 386  SER A N     1 
ATOM 2964  C CA    . SER A 1 379 ? -94.586  -46.184 -39.443  1.00 85.52  ? 386  SER A CA    1 
ATOM 2965  C C     . SER A 1 379 ? -95.189  -45.376 -38.279  1.00 86.18  ? 386  SER A C     1 
ATOM 2966  O O     . SER A 1 379 ? -95.467  -44.165 -38.427  1.00 86.21  ? 386  SER A O     1 
ATOM 2967  C CB    . SER A 1 379 ? -93.163  -45.688 -39.632  1.00 85.66  ? 386  SER A CB    1 
ATOM 2968  O OG    . SER A 1 379 ? -93.202  -44.287 -39.887  1.00 84.86  ? 386  SER A OG    1 
ATOM 2969  N N     . MET A 1 380 ? -95.358  -46.023 -37.125  1.00 86.49  ? 387  MET A N     1 
ATOM 2970  C CA    . MET A 1 380 ? -95.735  -45.313 -35.902  1.00 87.33  ? 387  MET A CA    1 
ATOM 2971  C C     . MET A 1 380 ? -94.977  -45.829 -34.714  1.00 88.37  ? 387  MET A C     1 
ATOM 2972  O O     . MET A 1 380 ? -94.332  -46.893 -34.784  1.00 88.76  ? 387  MET A O     1 
ATOM 2973  C CB    . MET A 1 380 ? -97.196  -45.486 -35.601  1.00 87.19  ? 387  MET A CB    1 
ATOM 2974  C CG    . MET A 1 380 ? -98.030  -44.320 -35.986  1.00 87.46  ? 387  MET A CG    1 
ATOM 2975  S SD    . MET A 1 380 ? -99.791  -44.727 -35.973  1.00 88.49  ? 387  MET A SD    1 
ATOM 2976  C CE    . MET A 1 380 ? -99.857  -45.923 -34.623  1.00 86.08  ? 387  MET A CE    1 
ATOM 2977  N N     . LEU A 1 381 ? -95.085  -45.096 -33.605  1.00 89.14  ? 388  LEU A N     1 
ATOM 2978  C CA    . LEU A 1 381 ? -94.276  -45.377 -32.422  1.00 89.61  ? 388  LEU A CA    1 
ATOM 2979  C C     . LEU A 1 381 ? -95.029  -45.057 -31.186  1.00 90.13  ? 388  LEU A C     1 
ATOM 2980  O O     . LEU A 1 381 ? -95.589  -43.974 -31.087  1.00 89.84  ? 388  LEU A O     1 
ATOM 2981  C CB    . LEU A 1 381 ? -93.072  -44.463 -32.407  1.00 89.60  ? 388  LEU A CB    1 
ATOM 2982  C CG    . LEU A 1 381 ? -91.868  -44.774 -33.258  1.00 88.56  ? 388  LEU A CG    1 
ATOM 2983  C CD1   . LEU A 1 381 ? -91.001  -43.536 -33.219  1.00 88.22  ? 388  LEU A CD1   1 
ATOM 2984  C CD2   . LEU A 1 381 ? -91.168  -45.944 -32.645  1.00 87.87  ? 388  LEU A CD2   1 
ATOM 2985  N N     . CYS A 1 382 ? -94.989  -45.955 -30.213  1.00 91.11  ? 389  CYS A N     1 
ATOM 2986  C CA    . CYS A 1 382 ? -95.741  -45.730 -28.983  1.00 92.59  ? 389  CYS A CA    1 
ATOM 2987  C C     . CYS A 1 382 ? -95.005  -46.259 -27.783  1.00 93.23  ? 389  CYS A C     1 
ATOM 2988  O O     . CYS A 1 382 ? -94.168  -47.157 -27.929  1.00 93.36  ? 389  CYS A O     1 
ATOM 2989  C CB    . CYS A 1 382 ? -97.099  -46.407 -29.075  1.00 92.72  ? 389  CYS A CB    1 
ATOM 2990  S SG    . CYS A 1 382 ? -96.979  -48.167 -29.424  1.00 93.75  ? 389  CYS A SG    1 
ATOM 2991  N N     . VAL A 1 383 ? -95.330  -45.723 -26.602  1.00 94.08  ? 390  VAL A N     1 
ATOM 2992  C CA    . VAL A 1 383 ? -94.599  -46.085 -25.385  1.00 95.16  ? 390  VAL A CA    1 
ATOM 2993  C C     . VAL A 1 383 ? -95.222  -47.187 -24.547  1.00 96.59  ? 390  VAL A C     1 
ATOM 2994  O O     . VAL A 1 383 ? -96.180  -46.950 -23.814  1.00 96.60  ? 390  VAL A O     1 
ATOM 2995  C CB    . VAL A 1 383 ? -94.398  -44.904 -24.479  1.00 94.85  ? 390  VAL A CB    1 
ATOM 2996  C CG1   . VAL A 1 383 ? -93.404  -45.301 -23.393  1.00 93.95  ? 390  VAL A CG1   1 
ATOM 2997  C CG2   . VAL A 1 383 ? -93.959  -43.675 -25.293  1.00 94.16  ? 390  VAL A CG2   1 
ATOM 2998  N N     . VAL A 1 384 ? -94.652  -48.383 -24.665  1.00 98.51  ? 391  VAL A N     1 
ATOM 2999  C CA    . VAL A 1 384 ? -95.013  -49.552 -23.854  1.00 100.39 ? 391  VAL A CA    1 
ATOM 3000  C C     . VAL A 1 384 ? -95.352  -49.125 -22.441  1.00 102.02 ? 391  VAL A C     1 
ATOM 3001  O O     . VAL A 1 384 ? -94.442  -48.791 -21.697  1.00 102.26 ? 391  VAL A O     1 
ATOM 3002  C CB    . VAL A 1 384 ? -93.817  -50.530 -23.757  1.00 100.13 ? 391  VAL A CB    1 
ATOM 3003  C CG1   . VAL A 1 384 ? -94.080  -51.640 -22.740  1.00 100.09 ? 391  VAL A CG1   1 
ATOM 3004  C CG2   . VAL A 1 384 ? -93.484  -51.094 -25.116  1.00 99.92  ? 391  VAL A CG2   1 
ATOM 3005  N N     . PRO A 1 385 ? -96.650  -49.147 -22.067  1.00 103.86 ? 392  PRO A N     1 
ATOM 3006  C CA    . PRO A 1 385 ? -97.056  -48.621 -20.759  1.00 105.73 ? 392  PRO A CA    1 
ATOM 3007  C C     . PRO A 1 385 ? -96.613  -49.574 -19.664  1.00 107.58 ? 392  PRO A C     1 
ATOM 3008  O O     . PRO A 1 385 ? -96.496  -50.780 -19.932  1.00 107.31 ? 392  PRO A O     1 
ATOM 3009  C CB    . PRO A 1 385 ? -98.584  -48.579 -20.849  1.00 105.67 ? 392  PRO A CB    1 
ATOM 3010  C CG    . PRO A 1 385 ? -98.920  -49.670 -21.796  1.00 104.69 ? 392  PRO A CG    1 
ATOM 3011  C CD    . PRO A 1 385 ? -97.786  -49.748 -22.786  1.00 103.91 ? 392  PRO A CD    1 
ATOM 3012  N N     . ASP A 1 386 ? -96.355  -49.039 -18.461  1.00 109.89 ? 393  ASP A N     1 
ATOM 3013  C CA    . ASP A 1 386 ? -95.788  -49.848 -17.381  1.00 112.13 ? 393  ASP A CA    1 
ATOM 3014  C C     . ASP A 1 386 ? -96.682  -51.048 -17.067  1.00 113.21 ? 393  ASP A C     1 
ATOM 3015  O O     . ASP A 1 386 ? -97.904  -50.987 -17.294  1.00 113.14 ? 393  ASP A O     1 
ATOM 3016  C CB    . ASP A 1 386 ? -95.544  -49.029 -16.126  1.00 112.31 ? 393  ASP A CB    1 
ATOM 3017  C CG    . ASP A 1 386 ? -94.515  -49.683 -15.229  1.00 114.63 ? 393  ASP A CG    1 
ATOM 3018  O OD1   . ASP A 1 386 ? -93.306  -49.535 -15.538  1.00 117.48 ? 393  ASP A OD1   1 
ATOM 3019  O OD2   . ASP A 1 386 ? -94.903  -50.377 -14.248  1.00 115.80 ? 393  ASP A OD2   1 
ATOM 3020  N N     . ILE A 1 387 ? -96.083  -52.135 -16.571  1.00 114.72 ? 394  ILE A N     1 
ATOM 3021  C CA    . ILE A 1 387 ? -96.850  -53.367 -16.327  1.00 116.50 ? 394  ILE A CA    1 
ATOM 3022  C C     . ILE A 1 387 ? -97.988  -53.142 -15.319  1.00 118.16 ? 394  ILE A C     1 
ATOM 3023  O O     . ILE A 1 387 ? -99.099  -53.683 -15.463  1.00 118.45 ? 394  ILE A O     1 
ATOM 3024  C CB    . ILE A 1 387 ? -95.958  -54.560 -15.940  1.00 116.15 ? 394  ILE A CB    1 
ATOM 3025  C CG1   . ILE A 1 387 ? -96.831  -55.707 -15.415  1.00 115.85 ? 394  ILE A CG1   1 
ATOM 3026  C CG2   . ILE A 1 387 ? -94.883  -54.127 -14.948  1.00 116.24 ? 394  ILE A CG2   1 
ATOM 3027  C CD1   . ILE A 1 387 ? -96.511  -57.061 -15.977  1.00 115.35 ? 394  ILE A CD1   1 
ATOM 3028  N N     . SER A 1 388 ? -97.701  -52.303 -14.329  1.00 120.09 ? 395  SER A N     1 
ATOM 3029  C CA    . SER A 1 388 ? -98.693  -51.831 -13.378  1.00 121.75 ? 395  SER A CA    1 
ATOM 3030  C C     . SER A 1 388 ? -99.743  -50.915 -14.031  1.00 122.89 ? 395  SER A C     1 
ATOM 3031  O O     . SER A 1 388 ? -100.156 -49.906 -13.454  1.00 123.22 ? 395  SER A O     1 
ATOM 3032  C CB    . SER A 1 388 ? -97.985  -51.122 -12.219  1.00 121.83 ? 395  SER A CB    1 
ATOM 3033  O OG    . SER A 1 388 ? -97.058  -50.163 -12.696  1.00 122.02 ? 395  SER A OG    1 
ATOM 3034  N N     . ALA A 1 389 ? -100.152 -51.259 -15.249  1.00 124.26 ? 396  ALA A N     1 
ATOM 3035  C CA    . ALA A 1 389 ? -101.294 -50.620 -15.892  1.00 125.70 ? 396  ALA A CA    1 
ATOM 3036  C C     . ALA A 1 389 ? -102.337 -51.695 -16.011  1.00 126.70 ? 396  ALA A C     1 
ATOM 3037  O O     . ALA A 1 389 ? -103.517 -51.433 -16.213  1.00 126.72 ? 396  ALA A O     1 
ATOM 3038  C CB    . ALA A 1 389 ? -100.924 -50.097 -17.258  1.00 125.52 ? 396  ALA A CB    1 
ATOM 3039  N N     . PHE A 1 390 ? -101.869 -52.921 -15.864  1.00 128.26 ? 397  PHE A N     1 
ATOM 3040  C CA    . PHE A 1 390 ? -102.714 -54.081 -15.987  1.00 130.11 ? 397  PHE A CA    1 
ATOM 3041  C C     . PHE A 1 390 ? -102.804 -54.791 -14.634  1.00 131.84 ? 397  PHE A C     1 
ATOM 3042  O O     . PHE A 1 390 ? -103.887 -54.887 -14.037  1.00 132.33 ? 397  PHE A O     1 
ATOM 3043  C CB    . PHE A 1 390 ? -102.167 -55.010 -17.077  1.00 129.73 ? 397  PHE A CB    1 
ATOM 3044  C CG    . PHE A 1 390 ? -102.015 -54.347 -18.421  1.00 128.69 ? 397  PHE A CG    1 
ATOM 3045  C CD1   . PHE A 1 390 ? -103.126 -54.013 -19.180  1.00 127.95 ? 397  PHE A CD1   1 
ATOM 3046  C CD2   . PHE A 1 390 ? -100.763 -54.061 -18.929  1.00 127.93 ? 397  PHE A CD2   1 
ATOM 3047  C CE1   . PHE A 1 390 ? -102.987 -53.411 -20.410  1.00 127.13 ? 397  PHE A CE1   1 
ATOM 3048  C CE2   . PHE A 1 390 ? -100.621 -53.453 -20.169  1.00 127.32 ? 397  PHE A CE2   1 
ATOM 3049  C CZ    . PHE A 1 390 ? -101.734 -53.131 -20.902  1.00 126.70 ? 397  PHE A CZ    1 
ATOM 3050  N N     . ARG A 1 391 ? -101.664 -55.277 -14.149  1.00 133.62 ? 398  ARG A N     1 
ATOM 3051  C CA    . ARG A 1 391 ? -101.585 -55.855 -12.813  1.00 135.34 ? 398  ARG A CA    1 
ATOM 3052  C C     . ARG A 1 391 ? -101.173 -54.737 -11.876  1.00 137.40 ? 398  ARG A C     1 
ATOM 3053  O O     . ARG A 1 391 ? -99.985  -54.396 -11.821  1.00 137.86 ? 398  ARG A O     1 
ATOM 3054  C CB    . ARG A 1 391 ? -100.561 -56.988 -12.798  1.00 134.76 ? 398  ARG A CB    1 
ATOM 3055  C CG    . ARG A 1 391 ? -100.807 -57.973 -13.909  1.00 132.65 ? 398  ARG A CG    1 
ATOM 3056  C CD    . ARG A 1 391 ? -102.294 -58.248 -14.011  1.00 128.96 ? 398  ARG A CD    1 
ATOM 3057  N NE    . ARG A 1 391 ? -102.651 -58.806 -15.296  1.00 125.33 ? 398  ARG A NE    1 
ATOM 3058  C CZ    . ARG A 1 391 ? -102.287 -60.012 -15.700  1.00 123.92 ? 398  ARG A CZ    1 
ATOM 3059  N NH1   . ARG A 1 391 ? -101.528 -60.784 -14.931  1.00 122.71 ? 398  ARG A NH1   1 
ATOM 3060  N NH2   . ARG A 1 391 ? -102.675 -60.439 -16.886  1.00 123.86 ? 398  ARG A NH2   1 
ATOM 3061  N N     . GLU A 1 392 ? -102.148 -54.157 -11.166  1.00 139.52 ? 399  GLU A N     1 
ATOM 3062  C CA    . GLU A 1 392 ? -101.909 -52.931 -10.375  1.00 141.58 ? 399  GLU A CA    1 
ATOM 3063  C C     . GLU A 1 392 ? -100.805 -53.067 -9.311   1.00 142.47 ? 399  GLU A C     1 
ATOM 3064  O O     . GLU A 1 392 ? -100.092 -52.099 -9.036   1.00 142.49 ? 399  GLU A O     1 
ATOM 3065  C CB    . GLU A 1 392 ? -103.214 -52.308 -9.824   1.00 141.87 ? 399  GLU A CB    1 
ATOM 3066  C CG    . GLU A 1 392 ? -104.452 -53.199 -9.894   1.00 143.89 ? 399  GLU A CG    1 
ATOM 3067  C CD    . GLU A 1 392 ? -104.325 -54.437 -9.022   1.00 146.66 ? 399  GLU A CD    1 
ATOM 3068  O OE1   . GLU A 1 392 ? -104.562 -54.332 -7.798   1.00 147.56 ? 399  GLU A OE1   1 
ATOM 3069  O OE2   . GLU A 1 392 ? -103.979 -55.513 -9.564   1.00 147.86 ? 399  GLU A OE2   1 
ATOM 3070  N N     . GLY A 1 393 ? -100.645 -54.274 -8.759   1.00 143.70 ? 400  GLY A N     1 
ATOM 3071  C CA    . GLY A 1 393 ? -99.476  -54.604 -7.937   1.00 145.43 ? 400  GLY A CA    1 
ATOM 3072  C C     . GLY A 1 393 ? -98.241  -54.700 -8.818   1.00 146.68 ? 400  GLY A C     1 
ATOM 3073  O O     . GLY A 1 393 ? -98.358  -54.613 -10.041  1.00 146.85 ? 400  GLY A O     1 
ATOM 3074  N N     . TRP A 1 394 ? -97.065  -54.896 -8.205   1.00 147.85 ? 401  TRP A N     1 
ATOM 3075  C CA    . TRP A 1 394 ? -95.757  -55.012 -8.919   1.00 148.91 ? 401  TRP A CA    1 
ATOM 3076  C C     . TRP A 1 394 ? -95.224  -53.699 -9.535   1.00 149.23 ? 401  TRP A C     1 
ATOM 3077  O O     . TRP A 1 394 ? -95.946  -52.963 -10.217  1.00 149.20 ? 401  TRP A O     1 
ATOM 3078  C CB    . TRP A 1 394 ? -95.731  -56.095 -10.032  1.00 149.20 ? 401  TRP A CB    1 
ATOM 3079  C CG    . TRP A 1 394 ? -96.733  -57.259 -9.978   1.00 150.34 ? 401  TRP A CG    1 
ATOM 3080  C CD1   . TRP A 1 394 ? -97.389  -57.750 -8.875   1.00 151.16 ? 401  TRP A CD1   1 
ATOM 3081  C CD2   . TRP A 1 394 ? -97.147  -58.087 -11.088  1.00 150.43 ? 401  TRP A CD2   1 
ATOM 3082  N NE1   . TRP A 1 394 ? -98.191  -58.811 -9.238   1.00 151.45 ? 401  TRP A NE1   1 
ATOM 3083  C CE2   . TRP A 1 394 ? -98.059  -59.040 -10.585  1.00 150.55 ? 401  TRP A CE2   1 
ATOM 3084  C CE3   . TRP A 1 394 ? -96.831  -58.116 -12.453  1.00 150.06 ? 401  TRP A CE3   1 
ATOM 3085  C CZ2   . TRP A 1 394 ? -98.659  -60.012 -11.402  1.00 149.99 ? 401  TRP A CZ2   1 
ATOM 3086  C CZ3   . TRP A 1 394 ? -97.432  -59.084 -13.258  1.00 149.70 ? 401  TRP A CZ3   1 
ATOM 3087  C CH2   . TRP A 1 394 ? -98.334  -60.012 -12.730  1.00 149.35 ? 401  TRP A CH2   1 
ATOM 3088  N N     . ARG A 1 395 ? -93.941  -53.435 -9.303   1.00 149.72 ? 402  ARG A N     1 
ATOM 3089  C CA    . ARG A 1 395 ? -93.223  -52.339 -9.963   1.00 150.08 ? 402  ARG A CA    1 
ATOM 3090  C C     . ARG A 1 395 ? -92.475  -52.923 -11.169  1.00 149.48 ? 402  ARG A C     1 
ATOM 3091  O O     . ARG A 1 395 ? -92.067  -52.196 -12.082  1.00 149.40 ? 402  ARG A O     1 
ATOM 3092  C CB    . ARG A 1 395 ? -92.271  -51.640 -8.960   1.00 150.57 ? 402  ARG A CB    1 
ATOM 3093  C CG    . ARG A 1 395 ? -91.318  -50.571 -9.532   1.00 152.48 ? 402  ARG A CG    1 
ATOM 3094  C CD    . ARG A 1 395 ? -92.049  -49.325 -10.057  1.00 155.51 ? 402  ARG A CD    1 
ATOM 3095  N NE    . ARG A 1 395 ? -91.123  -48.221 -10.348  1.00 157.31 ? 402  ARG A NE    1 
ATOM 3096  C CZ    . ARG A 1 395 ? -91.029  -47.095 -9.639   1.00 157.83 ? 402  ARG A CZ    1 
ATOM 3097  N NH1   . ARG A 1 395 ? -91.809  -46.886 -8.583   1.00 158.00 ? 402  ARG A NH1   1 
ATOM 3098  N NH2   . ARG A 1 395 ? -90.156  -46.165 -9.995   1.00 157.67 ? 402  ARG A NH2   1 
ATOM 3099  N N     . TRP A 1 396 ? -92.331  -54.248 -11.159  1.00 148.84 ? 403  TRP A N     1 
ATOM 3100  C CA    . TRP A 1 396 ? -91.665  -55.008 -12.226  1.00 148.35 ? 403  TRP A CA    1 
ATOM 3101  C C     . TRP A 1 396 ? -92.606  -56.041 -12.893  1.00 147.32 ? 403  TRP A C     1 
ATOM 3102  O O     . TRP A 1 396 ? -93.685  -56.358 -12.364  1.00 147.39 ? 403  TRP A O     1 
ATOM 3103  C CB    . TRP A 1 396 ? -90.351  -55.661 -11.713  1.00 148.78 ? 403  TRP A CB    1 
ATOM 3104  C CG    . TRP A 1 396 ? -90.452  -56.399 -10.365  1.00 150.39 ? 403  TRP A CG    1 
ATOM 3105  C CD1   . TRP A 1 396 ? -90.811  -55.862 -9.151   1.00 151.09 ? 403  TRP A CD1   1 
ATOM 3106  C CD2   . TRP A 1 396 ? -90.168  -57.790 -10.114  1.00 151.60 ? 403  TRP A CD2   1 
ATOM 3107  N NE1   . TRP A 1 396 ? -90.787  -56.833 -8.177   1.00 151.29 ? 403  TRP A NE1   1 
ATOM 3108  C CE2   . TRP A 1 396 ? -90.396  -58.023 -8.735   1.00 151.64 ? 403  TRP A CE2   1 
ATOM 3109  C CE3   . TRP A 1 396 ? -89.758  -58.862 -10.920  1.00 152.17 ? 403  TRP A CE3   1 
ATOM 3110  C CZ2   . TRP A 1 396 ? -90.224  -59.285 -8.145   1.00 151.93 ? 403  TRP A CZ2   1 
ATOM 3111  C CZ3   . TRP A 1 396 ? -89.582  -60.118 -10.328  1.00 152.74 ? 403  TRP A CZ3   1 
ATOM 3112  C CH2   . TRP A 1 396 ? -89.818  -60.315 -8.955   1.00 152.54 ? 403  TRP A CH2   1 
ATOM 3113  N N     . VAL A 1 397 ? -92.205  -56.536 -14.064  1.00 145.80 ? 404  VAL A N     1 
ATOM 3114  C CA    . VAL A 1 397 ? -92.951  -57.578 -14.778  1.00 144.14 ? 404  VAL A CA    1 
ATOM 3115  C C     . VAL A 1 397 ? -92.576  -58.950 -14.225  1.00 142.89 ? 404  VAL A C     1 
ATOM 3116  O O     . VAL A 1 397 ? -91.659  -59.613 -14.721  1.00 142.69 ? 404  VAL A O     1 
ATOM 3117  C CB    . VAL A 1 397 ? -92.711  -57.507 -16.313  1.00 144.29 ? 404  VAL A CB    1 
ATOM 3118  C CG1   . VAL A 1 397 ? -91.234  -57.313 -16.632  1.00 143.91 ? 404  VAL A CG1   1 
ATOM 3119  C CG2   . VAL A 1 397 ? -93.270  -58.741 -17.019  1.00 144.40 ? 404  VAL A CG2   1 
ATOM 3120  N N     . ARG A 1 398 ? -93.293  -59.372 -13.192  1.00 141.31 ? 405  ARG A N     1 
ATOM 3121  C CA    . ARG A 1 398 ? -92.878  -60.552 -12.427  1.00 139.83 ? 405  ARG A CA    1 
ATOM 3122  C C     . ARG A 1 398 ? -93.036  -61.875 -13.194  1.00 137.91 ? 405  ARG A C     1 
ATOM 3123  O O     . ARG A 1 398 ? -92.308  -62.843 -12.932  1.00 137.64 ? 405  ARG A O     1 
ATOM 3124  C CB    . ARG A 1 398 ? -93.546  -60.596 -11.033  1.00 140.35 ? 405  ARG A CB    1 
ATOM 3125  C CG    . ARG A 1 398 ? -95.051  -60.852 -11.035  1.00 141.92 ? 405  ARG A CG    1 
ATOM 3126  C CD    . ARG A 1 398 ? -95.523  -61.253 -9.653   1.00 144.28 ? 405  ARG A CD    1 
ATOM 3127  N NE    . ARG A 1 398 ? -95.479  -60.132 -8.719   1.00 145.31 ? 405  ARG A NE    1 
ATOM 3128  C CZ    . ARG A 1 398 ? -95.323  -60.251 -7.403   1.00 146.23 ? 405  ARG A CZ    1 
ATOM 3129  N NH1   . ARG A 1 398 ? -95.167  -61.450 -6.845   1.00 146.35 ? 405  ARG A NH1   1 
ATOM 3130  N NH2   . ARG A 1 398 ? -95.303  -59.161 -6.646   1.00 147.02 ? 405  ARG A NH2   1 
ATOM 3131  N N     . GLN A 1 399 ? -93.981  -61.906 -14.135  1.00 135.49 ? 406  GLN A N     1 
ATOM 3132  C CA    . GLN A 1 399 ? -94.164  -63.061 -15.025  1.00 133.21 ? 406  GLN A CA    1 
ATOM 3133  C C     . GLN A 1 399 ? -95.207  -62.808 -16.137  1.00 130.99 ? 406  GLN A C     1 
ATOM 3134  O O     . GLN A 1 399 ? -96.160  -62.045 -15.922  1.00 131.03 ? 406  GLN A O     1 
ATOM 3135  C CB    . GLN A 1 399 ? -94.492  -64.331 -14.235  1.00 133.35 ? 406  GLN A CB    1 
ATOM 3136  C CG    . GLN A 1 399 ? -95.680  -64.189 -13.332  1.00 134.28 ? 406  GLN A CG    1 
ATOM 3137  C CD    . GLN A 1 399 ? -96.378  -65.496 -13.140  1.00 136.06 ? 406  GLN A CD    1 
ATOM 3138  O OE1   . GLN A 1 399 ? -95.756  -66.507 -12.788  1.00 136.83 ? 406  GLN A OE1   1 
ATOM 3139  N NE2   . GLN A 1 399 ? -97.685  -65.498 -13.382  1.00 136.82 ? 406  GLN A NE2   1 
ATOM 3140  N N     . PRO A 1 400 ? -95.039  -63.491 -17.305  1.00 128.50 ? 407  PRO A N     1 
ATOM 3141  C CA    . PRO A 1 400 ? -95.616  -63.192 -18.629  1.00 126.27 ? 407  PRO A CA    1 
ATOM 3142  C C     . PRO A 1 400 ? -97.070  -62.725 -18.662  1.00 124.07 ? 407  PRO A C     1 
ATOM 3143  O O     . PRO A 1 400 ? -97.969  -63.420 -18.199  1.00 123.97 ? 407  PRO A O     1 
ATOM 3144  C CB    . PRO A 1 400 ? -95.480  -64.521 -19.367  1.00 126.38 ? 407  PRO A CB    1 
ATOM 3145  C CG    . PRO A 1 400 ? -94.290  -65.145 -18.772  1.00 127.22 ? 407  PRO A CG    1 
ATOM 3146  C CD    . PRO A 1 400 ? -94.350  -64.800 -17.322  1.00 128.24 ? 407  PRO A CD    1 
ATOM 3147  N N     . VAL A 1 401 ? -97.284  -61.545 -19.219  1.00 121.46 ? 408  VAL A N     1 
ATOM 3148  C CA    . VAL A 1 401 ? -98.620  -61.009 -19.377  1.00 119.04 ? 408  VAL A CA    1 
ATOM 3149  C C     . VAL A 1 401 ? -98.753  -60.630 -20.836  1.00 117.49 ? 408  VAL A C     1 
ATOM 3150  O O     . VAL A 1 401 ? -97.823  -60.053 -21.401  1.00 117.41 ? 408  VAL A O     1 
ATOM 3151  C CB    . VAL A 1 401 ? -98.843  -59.759 -18.497  1.00 119.01 ? 408  VAL A CB    1 
ATOM 3152  C CG1   . VAL A 1 401 ? -100.223 -59.139 -18.761  1.00 118.61 ? 408  VAL A CG1   1 
ATOM 3153  C CG2   . VAL A 1 401 ? -98.695  -60.103 -17.032  1.00 118.91 ? 408  VAL A CG2   1 
ATOM 3154  N N     . GLN A 1 402 ? -99.904  -60.942 -21.438  1.00 115.25 ? 409  GLN A N     1 
ATOM 3155  C CA    . GLN A 1 402 ? -100.129 -60.662 -22.849  1.00 112.94 ? 409  GLN A CA    1 
ATOM 3156  C C     . GLN A 1 402 ? -101.416 -59.919 -23.131  1.00 111.15 ? 409  GLN A C     1 
ATOM 3157  O O     . GLN A 1 402 ? -102.494 -60.470 -22.978  1.00 110.89 ? 409  GLN A O     1 
ATOM 3158  C CB    . GLN A 1 402 ? -100.140 -61.958 -23.624  1.00 113.14 ? 409  GLN A CB    1 
ATOM 3159  C CG    . GLN A 1 402 ? -100.620 -61.788 -25.038  1.00 114.29 ? 409  GLN A CG    1 
ATOM 3160  C CD    . GLN A 1 402 ? -100.933 -63.109 -25.703  1.00 115.95 ? 409  GLN A CD    1 
ATOM 3161  O OE1   . GLN A 1 402 ? -102.046 -63.327 -26.214  1.00 116.53 ? 409  GLN A OE1   1 
ATOM 3162  N NE2   . GLN A 1 402 ? -99.953  -64.011 -25.692  1.00 115.87 ? 409  GLN A NE2   1 
ATOM 3163  N N     . VAL A 1 403 ? -101.301 -58.674 -23.575  1.00 109.22 ? 410  VAL A N     1 
ATOM 3164  C CA    . VAL A 1 403 ? -102.495 -57.902 -23.930  1.00 107.41 ? 410  VAL A CA    1 
ATOM 3165  C C     . VAL A 1 403 ? -102.566 -57.680 -25.455  1.00 105.74 ? 410  VAL A C     1 
ATOM 3166  O O     . VAL A 1 403 ? -101.548 -57.700 -26.129  1.00 105.50 ? 410  VAL A O     1 
ATOM 3167  C CB    . VAL A 1 403 ? -102.610 -56.568 -23.121  1.00 107.47 ? 410  VAL A CB    1 
ATOM 3168  C CG1   . VAL A 1 403 ? -102.115 -56.763 -21.686  1.00 107.56 ? 410  VAL A CG1   1 
ATOM 3169  C CG2   . VAL A 1 403 ? -101.850 -55.451 -23.793  1.00 107.26 ? 410  VAL A CG2   1 
ATOM 3170  N N     . PRO A 1 404 ? -103.771 -57.492 -26.000  1.00 104.14 ? 411  PRO A N     1 
ATOM 3171  C CA    . PRO A 1 404 ? -103.840 -57.313 -27.420  1.00 102.83 ? 411  PRO A CA    1 
ATOM 3172  C C     . PRO A 1 404 ? -103.660 -55.849 -27.761  1.00 101.76 ? 411  PRO A C     1 
ATOM 3173  O O     . PRO A 1 404 ? -104.224 -54.956 -27.103  1.00 101.93 ? 411  PRO A O     1 
ATOM 3174  C CB    . PRO A 1 404 ? -105.259 -57.743 -27.742  1.00 102.95 ? 411  PRO A CB    1 
ATOM 3175  C CG    . PRO A 1 404 ? -106.035 -57.250 -26.576  1.00 103.73 ? 411  PRO A CG    1 
ATOM 3176  C CD    . PRO A 1 404 ? -105.104 -57.382 -25.378  1.00 104.33 ? 411  PRO A CD    1 
ATOM 3177  N N     . VAL A 1 405 ? -102.882 -55.611 -28.805  1.00 100.24 ? 412  VAL A N     1 
ATOM 3178  C CA    . VAL A 1 405 ? -102.571 -54.268 -29.261  1.00 98.65  ? 412  VAL A CA    1 
ATOM 3179  C C     . VAL A 1 405 ? -103.639 -53.874 -30.245  1.00 97.55  ? 412  VAL A C     1 
ATOM 3180  O O     . VAL A 1 405 ? -104.085 -54.725 -31.012  1.00 98.04  ? 412  VAL A O     1 
ATOM 3181  C CB    . VAL A 1 405 ? -101.222 -54.276 -29.967  1.00 98.68  ? 412  VAL A CB    1 
ATOM 3182  C CG1   . VAL A 1 405 ? -100.914 -52.908 -30.560  1.00 98.48  ? 412  VAL A CG1   1 
ATOM 3183  C CG2   . VAL A 1 405 ? -100.117 -54.756 -29.003  1.00 98.53  ? 412  VAL A CG2   1 
ATOM 3184  N N     . THR A 1 406 ? -104.068 -52.614 -30.234  1.00 95.75  ? 413  THR A N     1 
ATOM 3185  C CA    . THR A 1 406 ? -105.069 -52.178 -31.219  1.00 94.20  ? 413  THR A CA    1 
ATOM 3186  C C     . THR A 1 406 ? -105.056 -50.680 -31.510  1.00 93.03  ? 413  THR A C     1 
ATOM 3187  O O     . THR A 1 406 ? -104.787 -49.883 -30.624  1.00 92.84  ? 413  THR A O     1 
ATOM 3188  C CB    . THR A 1 406 ? -106.506 -52.706 -30.861  1.00 94.18  ? 413  THR A CB    1 
ATOM 3189  O OG1   . THR A 1 406 ? -107.490 -51.947 -31.561  1.00 94.40  ? 413  THR A OG1   1 
ATOM 3190  C CG2   . THR A 1 406 ? -106.784 -52.609 -29.380  1.00 94.01  ? 413  THR A CG2   1 
ATOM 3191  N N     . LEU A 1 407 ? -105.337 -50.301 -32.752  1.00 92.00  ? 414  LEU A N     1 
ATOM 3192  C CA    . LEU A 1 407 ? -105.393 -48.882 -33.115  1.00 91.60  ? 414  LEU A CA    1 
ATOM 3193  C C     . LEU A 1 407 ? -106.790 -48.301 -32.955  1.00 91.66  ? 414  LEU A C     1 
ATOM 3194  O O     . LEU A 1 407 ? -107.783 -48.959 -33.302  1.00 91.44  ? 414  LEU A O     1 
ATOM 3195  C CB    . LEU A 1 407 ? -104.935 -48.634 -34.548  1.00 91.45  ? 414  LEU A CB    1 
ATOM 3196  C CG    . LEU A 1 407 ? -103.658 -49.199 -35.150  1.00 90.42  ? 414  LEU A CG    1 
ATOM 3197  C CD1   . LEU A 1 407 ? -103.561 -48.617 -36.498  1.00 88.67  ? 414  LEU A CD1   1 
ATOM 3198  C CD2   . LEU A 1 407 ? -102.435 -48.850 -34.345  1.00 90.55  ? 414  LEU A CD2   1 
ATOM 3199  N N     . VAL A 1 408 ? -106.834 -47.052 -32.465  1.00 91.68  ? 415  VAL A N     1 
ATOM 3200  C CA    . VAL A 1 408 ? -108.064 -46.366 -32.033  1.00 91.56  ? 415  VAL A CA    1 
ATOM 3201  C C     . VAL A 1 408 ? -108.015 -44.944 -32.542  1.00 91.82  ? 415  VAL A C     1 
ATOM 3202  O O     . VAL A 1 408 ? -107.057 -44.218 -32.278  1.00 91.54  ? 415  VAL A O     1 
ATOM 3203  C CB    . VAL A 1 408 ? -108.175 -46.311 -30.472  1.00 91.57  ? 415  VAL A CB    1 
ATOM 3204  C CG1   . VAL A 1 408 ? -109.243 -45.305 -30.021  1.00 91.34  ? 415  VAL A CG1   1 
ATOM 3205  C CG2   . VAL A 1 408 ? -108.395 -47.715 -29.847  1.00 90.48  ? 415  VAL A CG2   1 
ATOM 3206  N N     . ARG A 1 409 ? -109.051 -44.538 -33.262  1.00 92.45  ? 416  ARG A N     1 
ATOM 3207  C CA    . ARG A 1 409 ? -109.077 -43.206 -33.850  1.00 93.53  ? 416  ARG A CA    1 
ATOM 3208  C C     . ARG A 1 409 ? -109.460 -42.163 -32.802  1.00 94.32  ? 416  ARG A C     1 
ATOM 3209  O O     . ARG A 1 409 ? -109.621 -42.495 -31.624  1.00 94.44  ? 416  ARG A O     1 
ATOM 3210  C CB    . ARG A 1 409 ? -110.031 -43.159 -35.046  1.00 93.33  ? 416  ARG A CB    1 
ATOM 3211  C CG    . ARG A 1 409 ? -109.572 -42.207 -36.117  1.00 94.25  ? 416  ARG A CG    1 
ATOM 3212  C CD    . ARG A 1 409 ? -110.735 -41.545 -36.798  1.00 96.93  ? 416  ARG A CD    1 
ATOM 3213  N NE    . ARG A 1 409 ? -111.160 -42.240 -38.019  1.00 98.52  ? 416  ARG A NE    1 
ATOM 3214  C CZ    . ARG A 1 409 ? -112.052 -41.766 -38.899  1.00 98.88  ? 416  ARG A CZ    1 
ATOM 3215  N NH1   . ARG A 1 409 ? -112.640 -40.583 -38.720  1.00 98.42  ? 416  ARG A NH1   1 
ATOM 3216  N NH2   . ARG A 1 409 ? -112.358 -42.478 -39.971  1.00 98.47  ? 416  ARG A NH2   1 
ATOM 3217  N N     . ASN A 1 410 ? -109.589 -40.903 -33.226  1.00 95.40  ? 417  ASN A N     1 
ATOM 3218  C CA    . ASN A 1 410 ? -110.165 -39.847 -32.372  1.00 96.35  ? 417  ASN A CA    1 
ATOM 3219  C C     . ASN A 1 410 ? -111.649 -40.020 -32.086  1.00 96.92  ? 417  ASN A C     1 
ATOM 3220  O O     . ASN A 1 410 ? -111.976 -40.634 -31.091  1.00 97.63  ? 417  ASN A O     1 
ATOM 3221  C CB    . ASN A 1 410 ? -109.814 -38.457 -32.863  1.00 96.17  ? 417  ASN A CB    1 
ATOM 3222  C CG    . ASN A 1 410 ? -108.420 -38.079 -32.464  1.00 96.61  ? 417  ASN A CG    1 
ATOM 3223  O OD1   . ASN A 1 410 ? -107.858 -38.651 -31.516  1.00 94.87  ? 417  ASN A OD1   1 
ATOM 3224  N ND2   . ASN A 1 410 ? -107.836 -37.126 -33.182  1.00 97.41  ? 417  ASN A ND2   1 
ATOM 3225  N N     . ASP A 1 411 ? -112.559 -39.549 -32.929  1.00 97.28  ? 418  ASP A N     1 
ATOM 3226  C CA    . ASP A 1 411 ? -113.922 -40.051 -32.758  1.00 97.45  ? 418  ASP A CA    1 
ATOM 3227  C C     . ASP A 1 411 ? -113.856 -41.569 -32.738  1.00 97.07  ? 418  ASP A C     1 
ATOM 3228  O O     . ASP A 1 411 ? -113.506 -42.183 -33.734  1.00 97.30  ? 418  ASP A O     1 
ATOM 3229  C CB    . ASP A 1 411 ? -114.913 -39.525 -33.806  1.00 97.95  ? 418  ASP A CB    1 
ATOM 3230  C CG    . ASP A 1 411 ? -114.376 -39.529 -35.217  1.00 98.89  ? 418  ASP A CG    1 
ATOM 3231  O OD1   . ASP A 1 411 ? -113.481 -40.338 -35.562  1.00 98.33  ? 418  ASP A OD1   1 
ATOM 3232  O OD2   . ASP A 1 411 ? -114.909 -38.696 -35.989  1.00 102.13 ? 418  ASP A OD2   1 
ATOM 3233  N N     . GLY A 1 412 ? -114.164 -42.155 -31.591  1.00 96.64  ? 419  GLY A N     1 
ATOM 3234  C CA    . GLY A 1 412 ? -113.731 -43.510 -31.261  1.00 96.84  ? 419  GLY A CA    1 
ATOM 3235  C C     . GLY A 1 412 ? -114.045 -44.691 -32.176  1.00 97.14  ? 419  GLY A C     1 
ATOM 3236  O O     . GLY A 1 412 ? -114.631 -45.686 -31.721  1.00 97.37  ? 419  GLY A O     1 
ATOM 3237  N N     . ILE A 1 413 ? -113.649 -44.602 -33.453  1.00 96.87  ? 420  ILE A N     1 
ATOM 3238  C CA    . ILE A 1 413 ? -113.682 -45.746 -34.367  1.00 96.17  ? 420  ILE A CA    1 
ATOM 3239  C C     . ILE A 1 413 ? -112.481 -46.566 -33.993  1.00 96.12  ? 420  ILE A C     1 
ATOM 3240  O O     . ILE A 1 413 ? -111.416 -46.003 -33.739  1.00 96.47  ? 420  ILE A O     1 
ATOM 3241  C CB    . ILE A 1 413 ? -113.532 -45.322 -35.814  1.00 95.90  ? 420  ILE A CB    1 
ATOM 3242  C CG1   . ILE A 1 413 ? -114.673 -44.407 -36.238  1.00 96.45  ? 420  ILE A CG1   1 
ATOM 3243  C CG2   . ILE A 1 413 ? -113.510 -46.516 -36.712  1.00 96.01  ? 420  ILE A CG2   1 
ATOM 3244  C CD1   . ILE A 1 413 ? -114.218 -42.995 -36.560  1.00 97.91  ? 420  ILE A CD1   1 
ATOM 3245  N N     . ILE A 1 414 ? -112.632 -47.882 -33.908  1.00 96.05  ? 421  ILE A N     1 
ATOM 3246  C CA    . ILE A 1 414 ? -111.497 -48.696 -33.469  1.00 96.31  ? 421  ILE A CA    1 
ATOM 3247  C C     . ILE A 1 414 ? -111.149 -49.810 -34.453  1.00 97.00  ? 421  ILE A C     1 
ATOM 3248  O O     . ILE A 1 414 ? -111.960 -50.707 -34.720  1.00 97.45  ? 421  ILE A O     1 
ATOM 3249  C CB    . ILE A 1 414 ? -111.614 -49.196 -31.992  1.00 96.00  ? 421  ILE A CB    1 
ATOM 3250  C CG1   . ILE A 1 414 ? -112.044 -50.662 -31.902  1.00 95.61  ? 421  ILE A CG1   1 
ATOM 3251  C CG2   . ILE A 1 414 ? -112.523 -48.285 -31.174  1.00 95.73  ? 421  ILE A CG2   1 
ATOM 3252  C CD1   . ILE A 1 414 ? -112.434 -51.083 -30.489  1.00 95.64  ? 421  ILE A CD1   1 
ATOM 3253  N N     . TYR A 1 415 ? -109.933 -49.716 -34.999  1.00 97.49  ? 422  TYR A N     1 
ATOM 3254  C CA    . TYR A 1 415 ? -109.423 -50.649 -35.992  1.00 97.35  ? 422  TYR A CA    1 
ATOM 3255  C C     . TYR A 1 415 ? -108.612 -51.748 -35.288  1.00 98.45  ? 422  TYR A C     1 
ATOM 3256  O O     . TYR A 1 415 ? -107.583 -51.474 -34.685  1.00 98.19  ? 422  TYR A O     1 
ATOM 3257  C CB    . TYR A 1 415 ? -108.574 -49.894 -36.995  1.00 96.45  ? 422  TYR A CB    1 
ATOM 3258  C CG    . TYR A 1 415 ? -109.138 -48.566 -37.458  1.00 93.72  ? 422  TYR A CG    1 
ATOM 3259  C CD1   . TYR A 1 415 ? -108.744 -47.375 -36.873  1.00 91.82  ? 422  TYR A CD1   1 
ATOM 3260  C CD2   . TYR A 1 415 ? -110.028 -48.506 -38.515  1.00 92.32  ? 422  TYR A CD2   1 
ATOM 3261  C CE1   . TYR A 1 415 ? -109.242 -46.176 -37.318  1.00 90.99  ? 422  TYR A CE1   1 
ATOM 3262  C CE2   . TYR A 1 415 ? -110.532 -47.315 -38.969  1.00 90.04  ? 422  TYR A CE2   1 
ATOM 3263  C CZ    . TYR A 1 415 ? -110.144 -46.160 -38.369  1.00 90.35  ? 422  TYR A CZ    1 
ATOM 3264  O OH    . TYR A 1 415 ? -110.659 -44.975 -38.831  1.00 91.21  ? 422  TYR A OH    1 
ATOM 3265  N N     . SER A 1 416 ? -109.114 -52.979 -35.342  1.00 99.80  ? 423  SER A N     1 
ATOM 3266  C CA    . SER A 1 416 ? -108.524 -54.104 -34.644  1.00 101.25 ? 423  SER A CA    1 
ATOM 3267  C C     . SER A 1 416 ? -107.277 -54.562 -35.352  1.00 102.48 ? 423  SER A C     1 
ATOM 3268  O O     . SER A 1 416 ? -107.047 -54.164 -36.490  1.00 102.81 ? 423  SER A O     1 
ATOM 3269  C CB    . SER A 1 416 ? -109.498 -55.261 -34.611  1.00 101.19 ? 423  SER A CB    1 
ATOM 3270  O OG    . SER A 1 416 ? -108.858 -56.407 -34.088  1.00 101.94 ? 423  SER A OG    1 
ATOM 3271  N N     . THR A 1 417 ? -106.476 -55.404 -34.689  1.00 103.91 ? 424  THR A N     1 
ATOM 3272  C CA    . THR A 1 417 ? -105.213 -55.855 -35.271  1.00 105.09 ? 424  THR A CA    1 
ATOM 3273  C C     . THR A 1 417 ? -104.865 -57.331 -35.092  1.00 106.19 ? 424  THR A C     1 
ATOM 3274  O O     . THR A 1 417 ? -104.083 -57.864 -35.885  1.00 106.63 ? 424  THR A O     1 
ATOM 3275  C CB    . THR A 1 417 ? -103.987 -55.030 -34.789  1.00 104.86 ? 424  THR A CB    1 
ATOM 3276  O OG1   . THR A 1 417 ? -103.539 -55.526 -33.525  1.00 105.11 ? 424  THR A OG1   1 
ATOM 3277  C CG2   . THR A 1 417 ? -104.288 -53.552 -34.691  1.00 104.52 ? 424  THR A CG2   1 
ATOM 3278  N N     . SER A 1 418 ? -105.375 -57.988 -34.053  1.00 107.38 ? 425  SER A N     1 
ATOM 3279  C CA    . SER A 1 418 ? -105.005 -59.401 -33.808  1.00 108.77 ? 425  SER A CA    1 
ATOM 3280  C C     . SER A 1 418 ? -103.487 -59.600 -33.573  1.00 109.60 ? 425  SER A C     1 
ATOM 3281  O O     . SER A 1 418 ? -102.922 -60.690 -33.793  1.00 109.41 ? 425  SER A O     1 
ATOM 3282  C CB    . SER A 1 418 ? -105.436 -60.288 -34.983  1.00 108.63 ? 425  SER A CB    1 
ATOM 3283  O OG    . SER A 1 418 ? -104.360 -60.393 -35.903  1.00 108.27 ? 425  SER A OG    1 
ATOM 3284  N N     . LEU A 1 419 ? -102.828 -58.527 -33.163  1.00 110.61 ? 426  LEU A N     1 
ATOM 3285  C CA    . LEU A 1 419 ? -101.440 -58.611 -32.784  1.00 111.68 ? 426  LEU A CA    1 
ATOM 3286  C C     . LEU A 1 419 ? -101.396 -58.352 -31.311  1.00 112.37 ? 426  LEU A C     1 
ATOM 3287  O O     . LEU A 1 419 ? -102.212 -57.583 -30.792  1.00 112.52 ? 426  LEU A O     1 
ATOM 3288  C CB    . LEU A 1 419 ? -100.600 -57.593 -33.551  1.00 111.62 ? 426  LEU A CB    1 
ATOM 3289  C CG    . LEU A 1 419 ? -100.278 -58.062 -34.972  1.00 111.81 ? 426  LEU A CG    1 
ATOM 3290  C CD1   . LEU A 1 419 ? -99.946  -56.877 -35.837  1.00 111.28 ? 426  LEU A CD1   1 
ATOM 3291  C CD2   . LEU A 1 419 ? -99.158  -59.140 -35.003  1.00 111.42 ? 426  LEU A CD2   1 
ATOM 3292  N N     . THR A 1 420 ? -100.454 -59.000 -30.635  1.00 113.24 ? 427  THR A N     1 
ATOM 3293  C CA    . THR A 1 420 ? -100.434 -58.972 -29.187  1.00 114.07 ? 427  THR A CA    1 
ATOM 3294  C C     . THR A 1 420 ? -99.038  -58.706 -28.597  1.00 114.94 ? 427  THR A C     1 
ATOM 3295  O O     . THR A 1 420 ? -98.110  -59.489 -28.819  1.00 115.29 ? 427  THR A O     1 
ATOM 3296  C CB    . THR A 1 420 ? -101.025 -60.295 -28.619  1.00 113.86 ? 427  THR A CB    1 
ATOM 3297  O OG1   . THR A 1 420 ? -99.978  -61.242 -28.405  1.00 113.72 ? 427  THR A OG1   1 
ATOM 3298  C CG2   . THR A 1 420 ? -102.054 -60.901 -29.561  1.00 113.31 ? 427  THR A CG2   1 
ATOM 3299  N N     . PHE A 1 421 ? -98.888  -57.613 -27.847  1.00 115.87 ? 428  PHE A N     1 
ATOM 3300  C CA    . PHE A 1 421 ? -97.689  -57.444 -27.022  1.00 117.09 ? 428  PHE A CA    1 
ATOM 3301  C C     . PHE A 1 421 ? -97.701  -58.366 -25.798  1.00 117.66 ? 428  PHE A C     1 
ATOM 3302  O O     . PHE A 1 421 ? -98.702  -58.444 -25.068  1.00 117.65 ? 428  PHE A O     1 
ATOM 3303  C CB    . PHE A 1 421 ? -97.503  -56.006 -26.546  1.00 117.19 ? 428  PHE A CB    1 
ATOM 3304  C CG    . PHE A 1 421 ? -96.228  -55.799 -25.788  1.00 118.19 ? 428  PHE A CG    1 
ATOM 3305  C CD1   . PHE A 1 421 ? -95.935  -56.554 -24.655  1.00 118.77 ? 428  PHE A CD1   1 
ATOM 3306  C CD2   . PHE A 1 421 ? -95.305  -54.871 -26.210  1.00 119.55 ? 428  PHE A CD2   1 
ATOM 3307  C CE1   . PHE A 1 421 ? -94.742  -56.391 -23.954  1.00 119.06 ? 428  PHE A CE1   1 
ATOM 3308  C CE2   . PHE A 1 421 ? -94.098  -54.692 -25.507  1.00 120.43 ? 428  PHE A CE2   1 
ATOM 3309  C CZ    . PHE A 1 421 ? -93.822  -55.458 -24.374  1.00 119.87 ? 428  PHE A CZ    1 
ATOM 3310  N N     . THR A 1 422 ? -96.563  -59.014 -25.559  1.00 118.47 ? 429  THR A N     1 
ATOM 3311  C CA    . THR A 1 422 ? -96.403  -59.957 -24.454  1.00 119.50 ? 429  THR A CA    1 
ATOM 3312  C C     . THR A 1 422 ? -95.312  -59.497 -23.480  1.00 120.40 ? 429  THR A C     1 
ATOM 3313  O O     . THR A 1 422 ? -94.125  -59.617 -23.766  1.00 120.80 ? 429  THR A O     1 
ATOM 3314  C CB    . THR A 1 422 ? -96.064  -61.368 -25.005  1.00 119.44 ? 429  THR A CB    1 
ATOM 3315  O OG1   . THR A 1 422 ? -96.999  -61.713 -26.040  1.00 119.51 ? 429  THR A OG1   1 
ATOM 3316  C CG2   . THR A 1 422 ? -96.069  -62.434 -23.897  1.00 118.93 ? 429  THR A CG2   1 
ATOM 3317  N N     . TYR A 1 423 ? -95.705  -58.962 -22.330  1.00 121.53 ? 430  TYR A N     1 
ATOM 3318  C CA    . TYR A 1 423 ? -94.721  -58.617 -21.309  1.00 122.71 ? 430  TYR A CA    1 
ATOM 3319  C C     . TYR A 1 423 ? -93.934  -59.860 -20.926  1.00 124.76 ? 430  TYR A C     1 
ATOM 3320  O O     . TYR A 1 423 ? -94.476  -60.970 -20.919  1.00 125.08 ? 430  TYR A O     1 
ATOM 3321  C CB    . TYR A 1 423 ? -95.390  -58.014 -20.076  1.00 121.74 ? 430  TYR A CB    1 
ATOM 3322  C CG    . TYR A 1 423 ? -95.896  -56.612 -20.284  1.00 118.37 ? 430  TYR A CG    1 
ATOM 3323  C CD1   . TYR A 1 423 ? -97.154  -56.390 -20.812  1.00 115.43 ? 430  TYR A CD1   1 
ATOM 3324  C CD2   . TYR A 1 423 ? -95.124  -55.508 -19.944  1.00 115.01 ? 430  TYR A CD2   1 
ATOM 3325  C CE1   . TYR A 1 423 ? -97.635  -55.110 -21.002  1.00 113.11 ? 430  TYR A CE1   1 
ATOM 3326  C CE2   . TYR A 1 423 ? -95.600  -54.221 -20.136  1.00 112.80 ? 430  TYR A CE2   1 
ATOM 3327  C CZ    . TYR A 1 423 ? -96.862  -54.032 -20.668  1.00 111.96 ? 430  TYR A CZ    1 
ATOM 3328  O OH    . TYR A 1 423 ? -97.376  -52.768 -20.873  1.00 111.61 ? 430  TYR A OH    1 
ATOM 3329  N N     . THR A 1 424 ? -92.656  -59.675 -20.622  1.00 127.16 ? 431  THR A N     1 
ATOM 3330  C CA    . THR A 1 424 ? -91.801  -60.787 -20.237  1.00 129.83 ? 431  THR A CA    1 
ATOM 3331  C C     . THR A 1 424 ? -90.820  -60.351 -19.154  1.00 131.76 ? 431  THR A C     1 
ATOM 3332  O O     . THR A 1 424 ? -90.291  -59.238 -19.232  1.00 131.87 ? 431  THR A O     1 
ATOM 3333  C CB    . THR A 1 424 ? -90.985  -61.263 -21.427  1.00 129.75 ? 431  THR A CB    1 
ATOM 3334  O OG1   . THR A 1 424 ? -90.597  -60.117 -22.181  1.00 130.58 ? 431  THR A OG1   1 
ATOM 3335  C CG2   . THR A 1 424 ? -91.800  -62.186 -22.327  1.00 130.12 ? 431  THR A CG2   1 
ATOM 3336  N N     . PRO A 1 425 ? -90.575  -61.222 -18.141  1.00 133.82 ? 432  PRO A N     1 
ATOM 3337  C CA    . PRO A 1 425 ? -89.553  -60.946 -17.118  1.00 135.41 ? 432  PRO A CA    1 
ATOM 3338  C C     . PRO A 1 425 ? -88.178  -60.783 -17.773  1.00 137.10 ? 432  PRO A C     1 
ATOM 3339  O O     . PRO A 1 425 ? -87.877  -61.514 -18.725  1.00 137.19 ? 432  PRO A O     1 
ATOM 3340  C CB    . PRO A 1 425 ? -89.586  -62.202 -16.227  1.00 135.30 ? 432  PRO A CB    1 
ATOM 3341  C CG    . PRO A 1 425 ? -90.259  -63.268 -17.051  1.00 134.61 ? 432  PRO A CG    1 
ATOM 3342  C CD    . PRO A 1 425 ? -91.239  -62.524 -17.912  1.00 134.00 ? 432  PRO A CD    1 
ATOM 3343  N N     . GLU A 1 426 ? -87.377  -59.831 -17.276  1.00 139.11 ? 433  GLU A N     1 
ATOM 3344  C CA    . GLU A 1 426 ? -86.071  -59.452 -17.879  1.00 141.11 ? 433  GLU A CA    1 
ATOM 3345  C C     . GLU A 1 426 ? -84.990  -60.548 -17.791  1.00 142.11 ? 433  GLU A C     1 
ATOM 3346  O O     . GLU A 1 426 ? -84.858  -61.221 -16.745  1.00 142.40 ? 433  GLU A O     1 
ATOM 3347  C CB    . GLU A 1 426 ? -85.538  -58.137 -17.287  1.00 141.24 ? 433  GLU A CB    1 
ATOM 3348  C CG    . GLU A 1 426 ? -86.228  -56.869 -17.815  1.00 142.87 ? 433  GLU A CG    1 
ATOM 3349  C CD    . GLU A 1 426 ? -87.594  -56.555 -17.160  1.00 145.02 ? 433  GLU A CD    1 
ATOM 3350  O OE1   . GLU A 1 426 ? -88.199  -55.513 -17.535  1.00 145.60 ? 433  GLU A OE1   1 
ATOM 3351  O OE2   . GLU A 1 426 ? -88.058  -57.331 -16.277  1.00 145.11 ? 433  GLU A OE2   1 
ATOM 3352  N N     . PRO A 1 427 ? -84.220  -60.739 -18.894  1.00 142.92 ? 434  PRO A N     1 
ATOM 3353  C CA    . PRO A 1 427 ? -83.300  -61.892 -18.968  1.00 143.43 ? 434  PRO A CA    1 
ATOM 3354  C C     . PRO A 1 427 ? -81.891  -61.612 -18.407  1.00 143.80 ? 434  PRO A C     1 
ATOM 3355  O O     . PRO A 1 427 ? -81.057  -60.954 -19.036  1.00 144.07 ? 434  PRO A O     1 
ATOM 3356  C CB    . PRO A 1 427 ? -83.270  -62.231 -20.480  1.00 143.46 ? 434  PRO A CB    1 
ATOM 3357  C CG    . PRO A 1 427 ? -84.160  -61.162 -21.175  1.00 143.08 ? 434  PRO A CG    1 
ATOM 3358  C CD    . PRO A 1 427 ? -84.303  -60.036 -20.188  1.00 142.78 ? 434  PRO A CD    1 
ATOM 3359  N N     . GLN B 2 53  ? -80.259  -68.353 -28.740  1.00 156.75 ? 1924 GLN B N     1 
ATOM 3360  C CA    . GLN B 2 53  ? -81.701  -68.070 -29.010  1.00 156.79 ? 1924 GLN B CA    1 
ATOM 3361  C C     . GLN B 2 53  ? -82.612  -68.403 -27.808  1.00 156.61 ? 1924 GLN B C     1 
ATOM 3362  O O     . GLN B 2 53  ? -82.863  -69.585 -27.528  1.00 156.54 ? 1924 GLN B O     1 
ATOM 3363  C CB    . GLN B 2 53  ? -82.162  -68.840 -30.261  1.00 156.93 ? 1924 GLN B CB    1 
ATOM 3364  C CG    . GLN B 2 53  ? -83.559  -68.451 -30.752  1.00 157.29 ? 1924 GLN B CG    1 
ATOM 3365  C CD    . GLN B 2 53  ? -84.252  -69.514 -31.600  1.00 157.07 ? 1924 GLN B CD    1 
ATOM 3366  O OE1   . GLN B 2 53  ? -84.003  -70.713 -31.466  1.00 156.83 ? 1924 GLN B OE1   1 
ATOM 3367  N NE2   . GLN B 2 53  ? -85.151  -69.065 -32.466  1.00 156.76 ? 1924 GLN B NE2   1 
ATOM 3368  N N     . THR B 2 54  ? -83.110  -67.366 -27.115  1.00 156.38 ? 1925 THR B N     1 
ATOM 3369  C CA    . THR B 2 54  ? -84.083  -67.532 -26.001  1.00 156.14 ? 1925 THR B CA    1 
ATOM 3370  C C     . THR B 2 54  ? -85.421  -68.126 -26.533  1.00 155.83 ? 1925 THR B C     1 
ATOM 3371  O O     . THR B 2 54  ? -86.371  -68.370 -25.759  1.00 155.96 ? 1925 THR B O     1 
ATOM 3372  C CB    . THR B 2 54  ? -84.310  -66.194 -25.167  1.00 156.22 ? 1925 THR B CB    1 
ATOM 3373  O OG1   . THR B 2 54  ? -83.076  -65.478 -25.021  1.00 155.97 ? 1925 THR B OG1   1 
ATOM 3374  C CG2   . THR B 2 54  ? -84.882  -66.480 -23.757  1.00 156.12 ? 1925 THR B CG2   1 
ATOM 3375  N N     . ASP B 2 55  ? -85.432  -68.384 -27.854  1.00 154.98 ? 1926 ASP B N     1 
ATOM 3376  C CA    . ASP B 2 55  ? -86.588  -68.830 -28.697  1.00 153.87 ? 1926 ASP B CA    1 
ATOM 3377  C C     . ASP B 2 55  ? -87.972  -68.136 -28.519  1.00 152.66 ? 1926 ASP B C     1 
ATOM 3378  O O     . ASP B 2 55  ? -88.901  -68.391 -29.298  1.00 152.61 ? 1926 ASP B O     1 
ATOM 3379  C CB    . ASP B 2 55  ? -86.645  -70.382 -28.921  1.00 154.11 ? 1926 ASP B CB    1 
ATOM 3380  C CG    . ASP B 2 55  ? -87.216  -71.174 -27.728  1.00 154.43 ? 1926 ASP B CG    1 
ATOM 3381  O OD1   . ASP B 2 55  ? -88.174  -70.711 -27.068  1.00 154.66 ? 1926 ASP B OD1   1 
ATOM 3382  O OD2   . ASP B 2 55  ? -86.718  -72.301 -27.484  1.00 154.35 ? 1926 ASP B OD2   1 
ATOM 3383  N N     . ARG B 2 56  ? -88.083  -67.262 -27.518  1.00 151.04 ? 1927 ARG B N     1 
ATOM 3384  C CA    . ARG B 2 56  ? -89.243  -66.393 -27.373  1.00 149.52 ? 1927 ARG B CA    1 
ATOM 3385  C C     . ARG B 2 56  ? -89.313  -65.442 -28.589  1.00 148.18 ? 1927 ARG B C     1 
ATOM 3386  O O     . ARG B 2 56  ? -90.350  -65.360 -29.273  1.00 148.19 ? 1927 ARG B O     1 
ATOM 3387  C CB    . ARG B 2 56  ? -89.183  -65.627 -26.032  1.00 149.70 ? 1927 ARG B CB    1 
ATOM 3388  C CG    . ARG B 2 56  ? -90.314  -64.607 -25.792  1.00 150.27 ? 1927 ARG B CG    1 
ATOM 3389  C CD    . ARG B 2 56  ? -91.710  -65.209 -26.004  1.00 151.22 ? 1927 ARG B CD    1 
ATOM 3390  N NE    . ARG B 2 56  ? -92.561  -64.325 -26.805  1.00 152.07 ? 1927 ARG B NE    1 
ATOM 3391  C CZ    . ARG B 2 56  ? -93.595  -64.730 -27.539  1.00 152.31 ? 1927 ARG B CZ    1 
ATOM 3392  N NH1   . ARG B 2 56  ? -93.934  -66.016 -27.591  1.00 152.70 ? 1927 ARG B NH1   1 
ATOM 3393  N NH2   . ARG B 2 56  ? -94.293  -63.840 -28.228  1.00 151.76 ? 1927 ARG B NH2   1 
ATOM 3394  N N     . THR B 2 57  ? -88.195  -64.763 -28.867  1.00 146.07 ? 1928 THR B N     1 
ATOM 3395  C CA    . THR B 2 57  ? -88.115  -63.752 -29.927  1.00 143.74 ? 1928 THR B CA    1 
ATOM 3396  C C     . THR B 2 57  ? -87.024  -64.108 -30.931  1.00 142.02 ? 1928 THR B C     1 
ATOM 3397  O O     . THR B 2 57  ? -86.869  -63.441 -31.957  1.00 141.60 ? 1928 THR B O     1 
ATOM 3398  C CB    . THR B 2 57  ? -87.819  -62.347 -29.343  1.00 143.90 ? 1928 THR B CB    1 
ATOM 3399  O OG1   . THR B 2 57  ? -86.603  -62.395 -28.586  1.00 143.97 ? 1928 THR B OG1   1 
ATOM 3400  C CG2   . THR B 2 57  ? -88.968  -61.849 -28.441  1.00 143.52 ? 1928 THR B CG2   1 
ATOM 3401  N N     . GLY B 2 58  ? -86.277  -65.168 -30.623  1.00 140.13 ? 1929 GLY B N     1 
ATOM 3402  C CA    . GLY B 2 58  ? -85.166  -65.621 -31.461  1.00 137.88 ? 1929 GLY B CA    1 
ATOM 3403  C C     . GLY B 2 58  ? -83.872  -64.859 -31.224  1.00 136.22 ? 1929 GLY B C     1 
ATOM 3404  O O     . GLY B 2 58  ? -82.891  -65.025 -31.956  1.00 135.83 ? 1929 GLY B O     1 
ATOM 3405  N N     . GLU B 2 59  ? -83.876  -64.046 -30.170  1.00 134.61 ? 1930 GLU B N     1 
ATOM 3406  C CA    . GLU B 2 59  ? -82.840  -63.054 -29.915  1.00 132.96 ? 1930 GLU B CA    1 
ATOM 3407  C C     . GLU B 2 59  ? -81.611  -63.658 -29.247  1.00 131.74 ? 1930 GLU B C     1 
ATOM 3408  O O     . GLU B 2 59  ? -81.740  -64.520 -28.374  1.00 131.58 ? 1930 GLU B O     1 
ATOM 3409  C CB    . GLU B 2 59  ? -83.422  -61.955 -29.034  1.00 132.95 ? 1930 GLU B CB    1 
ATOM 3410  C CG    . GLU B 2 59  ? -83.315  -60.570 -29.636  1.00 133.73 ? 1930 GLU B CG    1 
ATOM 3411  C CD    . GLU B 2 59  ? -84.127  -59.528 -28.882  1.00 134.75 ? 1930 GLU B CD    1 
ATOM 3412  O OE1   . GLU B 2 59  ? -84.738  -59.899 -27.857  1.00 134.75 ? 1930 GLU B OE1   1 
ATOM 3413  O OE2   . GLU B 2 59  ? -84.161  -58.343 -29.310  1.00 134.91 ? 1930 GLU B OE2   1 
ATOM 3414  N N     . THR B 2 60  ? -80.424  -63.201 -29.651  1.00 130.28 ? 1931 THR B N     1 
ATOM 3415  C CA    . THR B 2 60  ? -79.165  -63.699 -29.068  1.00 128.85 ? 1931 THR B CA    1 
ATOM 3416  C C     . THR B 2 60  ? -78.694  -62.895 -27.867  1.00 127.82 ? 1931 THR B C     1 
ATOM 3417  O O     . THR B 2 60  ? -79.259  -61.858 -27.539  1.00 127.67 ? 1931 THR B O     1 
ATOM 3418  C CB    . THR B 2 60  ? -77.996  -63.806 -30.095  1.00 128.74 ? 1931 THR B CB    1 
ATOM 3419  O OG1   . THR B 2 60  ? -76.837  -64.323 -29.432  1.00 128.75 ? 1931 THR B OG1   1 
ATOM 3420  C CG2   . THR B 2 60  ? -77.629  -62.467 -30.649  1.00 128.51 ? 1931 THR B CG2   1 
ATOM 3421  N N     . ALA B 2 61  ? -77.647  -63.394 -27.224  1.00 126.57 ? 1932 ALA B N     1 
ATOM 3422  C CA    . ALA B 2 61  ? -77.042  -62.716 -26.105  1.00 125.53 ? 1932 ALA B CA    1 
ATOM 3423  C C     . ALA B 2 61  ? -76.580  -61.325 -26.532  1.00 124.86 ? 1932 ALA B C     1 
ATOM 3424  O O     . ALA B 2 61  ? -76.698  -60.355 -25.764  1.00 124.66 ? 1932 ALA B O     1 
ATOM 3425  C CB    . ALA B 2 61  ? -75.893  -63.536 -25.574  1.00 125.54 ? 1932 ALA B CB    1 
ATOM 3426  N N     . LEU B 2 62  ? -76.086  -61.224 -27.767  1.00 124.02 ? 1933 LEU B N     1 
ATOM 3427  C CA    . LEU B 2 62  ? -75.644  -59.938 -28.310  1.00 123.24 ? 1933 LEU B CA    1 
ATOM 3428  C C     . LEU B 2 62  ? -76.842  -58.991 -28.504  1.00 122.88 ? 1933 LEU B C     1 
ATOM 3429  O O     . LEU B 2 62  ? -76.903  -57.924 -27.873  1.00 122.89 ? 1933 LEU B O     1 
ATOM 3430  C CB    . LEU B 2 62  ? -74.831  -60.129 -29.599  1.00 122.99 ? 1933 LEU B CB    1 
ATOM 3431  C CG    . LEU B 2 62  ? -73.594  -59.240 -29.778  1.00 122.33 ? 1933 LEU B CG    1 
ATOM 3432  C CD1   . LEU B 2 62  ? -73.918  -57.946 -30.445  1.00 122.22 ? 1933 LEU B CD1   1 
ATOM 3433  C CD2   . LEU B 2 62  ? -72.909  -58.954 -28.453  1.00 122.03 ? 1933 LEU B CD2   1 
ATOM 3434  N N     . HIS B 2 63  ? -77.797  -59.410 -29.342  1.00 122.19 ? 1934 HIS B N     1 
ATOM 3435  C CA    . HIS B 2 63  ? -79.086  -58.732 -29.530  1.00 121.36 ? 1934 HIS B CA    1 
ATOM 3436  C C     . HIS B 2 63  ? -79.573  -58.036 -28.260  1.00 121.13 ? 1934 HIS B C     1 
ATOM 3437  O O     . HIS B 2 63  ? -79.932  -56.860 -28.280  1.00 120.98 ? 1934 HIS B O     1 
ATOM 3438  C CB    . HIS B 2 63  ? -80.154  -59.743 -29.946  1.00 121.13 ? 1934 HIS B CB    1 
ATOM 3439  C CG    . HIS B 2 63  ? -80.166  -60.080 -31.405  1.00 120.51 ? 1934 HIS B CG    1 
ATOM 3440  N ND1   . HIS B 2 63  ? -79.998  -61.365 -31.868  1.00 119.69 ? 1934 HIS B ND1   1 
ATOM 3441  C CD2   . HIS B 2 63  ? -80.386  -59.315 -32.501  1.00 120.24 ? 1934 HIS B CD2   1 
ATOM 3442  C CE1   . HIS B 2 63  ? -80.081  -61.375 -33.185  1.00 119.39 ? 1934 HIS B CE1   1 
ATOM 3443  N NE2   . HIS B 2 63  ? -80.312  -60.142 -33.595  1.00 119.36 ? 1934 HIS B NE2   1 
ATOM 3444  N N     . LEU B 2 64  ? -79.584  -58.782 -27.158  1.00 120.93 ? 1935 LEU B N     1 
ATOM 3445  C CA    . LEU B 2 64  ? -80.050  -58.282 -25.873  1.00 120.70 ? 1935 LEU B CA    1 
ATOM 3446  C C     . LEU B 2 64  ? -79.222  -57.103 -25.407  1.00 120.63 ? 1935 LEU B C     1 
ATOM 3447  O O     . LEU B 2 64  ? -79.741  -56.003 -25.250  1.00 120.78 ? 1935 LEU B O     1 
ATOM 3448  C CB    . LEU B 2 64  ? -80.029  -59.388 -24.815  1.00 120.63 ? 1935 LEU B CB    1 
ATOM 3449  C CG    . LEU B 2 64  ? -81.068  -60.513 -24.905  1.00 120.31 ? 1935 LEU B CG    1 
ATOM 3450  C CD1   . LEU B 2 64  ? -80.955  -61.446 -23.685  1.00 119.93 ? 1935 LEU B CD1   1 
ATOM 3451  C CD2   . LEU B 2 64  ? -82.488  -59.959 -25.052  1.00 119.46 ? 1935 LEU B CD2   1 
ATOM 3452  N N     . ALA B 2 65  ? -77.930  -57.328 -25.208  1.00 120.51 ? 1936 ALA B N     1 
ATOM 3453  C CA    . ALA B 2 65  ? -77.039  -56.262 -24.770  1.00 120.43 ? 1936 ALA B CA    1 
ATOM 3454  C C     . ALA B 2 65  ? -77.148  -55.036 -25.664  1.00 120.22 ? 1936 ALA B C     1 
ATOM 3455  O O     . ALA B 2 65  ? -76.943  -53.917 -25.210  1.00 120.18 ? 1936 ALA B O     1 
ATOM 3456  C CB    . ALA B 2 65  ? -75.603  -56.753 -24.710  1.00 120.57 ? 1936 ALA B CB    1 
ATOM 3457  N N     . ALA B 2 66  ? -77.479  -55.254 -26.930  1.00 120.16 ? 1937 ALA B N     1 
ATOM 3458  C CA    . ALA B 2 66  ? -77.706  -54.157 -27.854  1.00 120.34 ? 1937 ALA B CA    1 
ATOM 3459  C C     . ALA B 2 66  ? -78.917  -53.354 -27.428  1.00 120.47 ? 1937 ALA B C     1 
ATOM 3460  O O     . ALA B 2 66  ? -78.823  -52.155 -27.200  1.00 120.41 ? 1937 ALA B O     1 
ATOM 3461  C CB    . ALA B 2 66  ? -77.898  -54.677 -29.254  1.00 120.43 ? 1937 ALA B CB    1 
ATOM 3462  N N     . ARG B 2 67  ? -80.048  -54.035 -27.305  1.00 120.73 ? 1938 ARG B N     1 
ATOM 3463  C CA    . ARG B 2 67  ? -81.298  -53.403 -26.923  1.00 121.11 ? 1938 ARG B CA    1 
ATOM 3464  C C     . ARG B 2 67  ? -81.277  -52.806 -25.537  1.00 121.42 ? 1938 ARG B C     1 
ATOM 3465  O O     . ARG B 2 67  ? -81.890  -51.779 -25.290  1.00 121.28 ? 1938 ARG B O     1 
ATOM 3466  C CB    . ARG B 2 67  ? -82.422  -54.413 -26.975  1.00 121.10 ? 1938 ARG B CB    1 
ATOM 3467  C CG    . ARG B 2 67  ? -83.738  -53.767 -27.310  1.00 121.78 ? 1938 ARG B CG    1 
ATOM 3468  C CD    . ARG B 2 67  ? -84.820  -54.789 -27.481  1.00 121.57 ? 1938 ARG B CD    1 
ATOM 3469  N NE    . ARG B 2 67  ? -85.125  -55.390 -26.194  1.00 121.00 ? 1938 ARG B NE    1 
ATOM 3470  C CZ    . ARG B 2 67  ? -85.342  -56.685 -26.011  1.00 120.38 ? 1938 ARG B CZ    1 
ATOM 3471  N NH1   . ARG B 2 67  ? -85.312  -57.503 -27.054  1.00 119.83 ? 1938 ARG B NH1   1 
ATOM 3472  N NH2   . ARG B 2 67  ? -85.608  -57.152 -24.792  1.00 119.78 ? 1938 ARG B NH2   1 
ATOM 3473  N N     . TYR B 2 68  ? -80.579  -53.471 -24.629  1.00 122.28 ? 1939 TYR B N     1 
ATOM 3474  C CA    . TYR B 2 68  ? -80.509  -53.048 -23.232  1.00 123.04 ? 1939 TYR B CA    1 
ATOM 3475  C C     . TYR B 2 68  ? -79.416  -52.015 -22.983  1.00 122.96 ? 1939 TYR B C     1 
ATOM 3476  O O     . TYR B 2 68  ? -79.250  -51.537 -21.870  1.00 122.96 ? 1939 TYR B O     1 
ATOM 3477  C CB    . TYR B 2 68  ? -80.387  -54.274 -22.304  1.00 123.31 ? 1939 TYR B CB    1 
ATOM 3478  C CG    . TYR B 2 68  ? -81.741  -54.789 -21.873  1.00 125.38 ? 1939 TYR B CG    1 
ATOM 3479  C CD1   . TYR B 2 68  ? -82.795  -54.841 -22.780  1.00 127.24 ? 1939 TYR B CD1   1 
ATOM 3480  C CD2   . TYR B 2 68  ? -81.979  -55.203 -20.562  1.00 127.48 ? 1939 TYR B CD2   1 
ATOM 3481  C CE1   . TYR B 2 68  ? -84.045  -55.285 -22.413  1.00 128.64 ? 1939 TYR B CE1   1 
ATOM 3482  C CE2   . TYR B 2 68  ? -83.246  -55.656 -20.178  1.00 129.30 ? 1939 TYR B CE2   1 
ATOM 3483  C CZ    . TYR B 2 68  ? -84.272  -55.689 -21.123  1.00 129.85 ? 1939 TYR B CZ    1 
ATOM 3484  O OH    . TYR B 2 68  ? -85.535  -56.126 -20.804  1.00 131.47 ? 1939 TYR B OH    1 
ATOM 3485  N N     . SER B 2 69  ? -78.693  -51.668 -24.041  1.00 123.12 ? 1940 SER B N     1 
ATOM 3486  C CA    . SER B 2 69  ? -77.656  -50.647 -24.005  1.00 123.38 ? 1940 SER B CA    1 
ATOM 3487  C C     . SER B 2 69  ? -76.509  -50.948 -23.031  1.00 123.85 ? 1940 SER B C     1 
ATOM 3488  O O     . SER B 2 69  ? -75.893  -50.035 -22.496  1.00 123.81 ? 1940 SER B O     1 
ATOM 3489  C CB    . SER B 2 69  ? -78.275  -49.273 -23.739  1.00 123.10 ? 1940 SER B CB    1 
ATOM 3490  O OG    . SER B 2 69  ? -77.513  -48.249 -24.344  1.00 122.76 ? 1940 SER B OG    1 
ATOM 3491  N N     . ARG B 2 70  ? -76.223  -52.229 -22.817  1.00 124.68 ? 1941 ARG B N     1 
ATOM 3492  C CA    . ARG B 2 70  ? -75.071  -52.653 -22.015  1.00 125.84 ? 1941 ARG B CA    1 
ATOM 3493  C C     . ARG B 2 70  ? -73.810  -52.605 -22.886  1.00 126.26 ? 1941 ARG B C     1 
ATOM 3494  O O     . ARG B 2 70  ? -73.434  -53.597 -23.524  1.00 126.16 ? 1941 ARG B O     1 
ATOM 3495  C CB    . ARG B 2 70  ? -75.270  -54.073 -21.470  1.00 126.17 ? 1941 ARG B CB    1 
ATOM 3496  C CG    . ARG B 2 70  ? -76.623  -54.376 -20.856  1.00 127.27 ? 1941 ARG B CG    1 
ATOM 3497  C CD    . ARG B 2 70  ? -76.556  -54.541 -19.345  1.00 129.23 ? 1941 ARG B CD    1 
ATOM 3498  N NE    . ARG B 2 70  ? -77.878  -54.296 -18.782  1.00 131.08 ? 1941 ARG B NE    1 
ATOM 3499  C CZ    . ARG B 2 70  ? -78.336  -53.090 -18.461  1.00 131.96 ? 1941 ARG B CZ    1 
ATOM 3500  N NH1   . ARG B 2 70  ? -77.557  -52.023 -18.623  1.00 131.96 ? 1941 ARG B NH1   1 
ATOM 3501  N NH2   . ARG B 2 70  ? -79.567  -52.953 -17.968  1.00 132.22 ? 1941 ARG B NH2   1 
ATOM 3502  N N     . SER B 2 71  ? -73.154  -51.447 -22.898  1.00 127.00 ? 1942 SER B N     1 
ATOM 3503  C CA    . SER B 2 71  ? -72.153  -51.149 -23.926  1.00 127.62 ? 1942 SER B CA    1 
ATOM 3504  C C     . SER B 2 71  ? -70.886  -52.005 -23.841  1.00 127.99 ? 1942 SER B C     1 
ATOM 3505  O O     . SER B 2 71  ? -70.232  -52.254 -24.866  1.00 128.06 ? 1942 SER B O     1 
ATOM 3506  C CB    . SER B 2 71  ? -71.843  -49.635 -24.016  1.00 127.59 ? 1942 SER B CB    1 
ATOM 3507  O OG    . SER B 2 71  ? -71.330  -49.104 -22.807  1.00 127.71 ? 1942 SER B OG    1 
ATOM 3508  N N     . ASP B 2 72  ? -70.540  -52.460 -22.639  1.00 128.41 ? 1943 ASP B N     1 
ATOM 3509  C CA    . ASP B 2 72  ? -69.341  -53.287 -22.497  1.00 128.85 ? 1943 ASP B CA    1 
ATOM 3510  C C     . ASP B 2 72  ? -69.725  -54.729 -22.289  1.00 128.40 ? 1943 ASP B C     1 
ATOM 3511  O O     . ASP B 2 72  ? -68.913  -55.624 -22.496  1.00 128.37 ? 1943 ASP B O     1 
ATOM 3512  C CB    . ASP B 2 72  ? -68.381  -52.772 -21.402  1.00 129.32 ? 1943 ASP B CB    1 
ATOM 3513  C CG    . ASP B 2 72  ? -68.972  -52.861 -20.004  1.00 130.68 ? 1943 ASP B CG    1 
ATOM 3514  O OD1   . ASP B 2 72  ? -70.217  -52.767 -19.877  1.00 132.95 ? 1943 ASP B OD1   1 
ATOM 3515  O OD2   . ASP B 2 72  ? -68.184  -53.015 -19.038  1.00 131.21 ? 1943 ASP B OD2   1 
ATOM 3516  N N     . ALA B 2 73  ? -70.973  -54.949 -21.898  1.00 128.16 ? 1944 ALA B N     1 
ATOM 3517  C CA    . ALA B 2 73  ? -71.508  -56.296 -21.893  1.00 128.24 ? 1944 ALA B CA    1 
ATOM 3518  C C     . ALA B 2 73  ? -71.343  -56.858 -23.293  1.00 128.08 ? 1944 ALA B C     1 
ATOM 3519  O O     . ALA B 2 73  ? -70.956  -58.014 -23.479  1.00 127.70 ? 1944 ALA B O     1 
ATOM 3520  C CB    . ALA B 2 73  ? -72.958  -56.292 -21.492  1.00 128.35 ? 1944 ALA B CB    1 
ATOM 3521  N N     . ALA B 2 74  ? -71.614  -55.999 -24.269  1.00 128.27 ? 1945 ALA B N     1 
ATOM 3522  C CA    . ALA B 2 74  ? -71.445  -56.331 -25.672  1.00 128.57 ? 1945 ALA B CA    1 
ATOM 3523  C C     . ALA B 2 74  ? -69.986  -56.586 -26.010  1.00 128.86 ? 1945 ALA B C     1 
ATOM 3524  O O     . ALA B 2 74  ? -69.688  -57.497 -26.789  1.00 129.06 ? 1945 ALA B O     1 
ATOM 3525  C CB    . ALA B 2 74  ? -72.001  -55.232 -26.544  1.00 128.45 ? 1945 ALA B CB    1 
ATOM 3526  N N     . LYS B 2 75  ? -69.087  -55.796 -25.418  1.00 129.09 ? 1946 LYS B N     1 
ATOM 3527  C CA    . LYS B 2 75  ? -67.655  -55.910 -25.702  1.00 129.37 ? 1946 LYS B CA    1 
ATOM 3528  C C     . LYS B 2 75  ? -67.080  -57.309 -25.470  1.00 129.53 ? 1946 LYS B C     1 
ATOM 3529  O O     . LYS B 2 75  ? -66.472  -57.872 -26.381  1.00 129.47 ? 1946 LYS B O     1 
ATOM 3530  C CB    . LYS B 2 75  ? -66.851  -54.858 -24.949  1.00 129.44 ? 1946 LYS B CB    1 
ATOM 3531  C CG    . LYS B 2 75  ? -65.955  -54.044 -25.858  1.00 130.16 ? 1946 LYS B CG    1 
ATOM 3532  C CD    . LYS B 2 75  ? -65.418  -52.801 -25.168  1.00 132.48 ? 1946 LYS B CD    1 
ATOM 3533  C CE    . LYS B 2 75  ? -64.082  -53.076 -24.484  1.00 133.64 ? 1946 LYS B CE    1 
ATOM 3534  N NZ    . LYS B 2 75  ? -63.241  -51.838 -24.404  1.00 134.45 ? 1946 LYS B NZ    1 
ATOM 3535  N N     . ARG B 2 76  ? -67.278  -57.876 -24.277  1.00 129.79 ? 1947 ARG B N     1 
ATOM 3536  C CA    . ARG B 2 76  ? -66.795  -59.249 -24.000  1.00 130.19 ? 1947 ARG B CA    1 
ATOM 3537  C C     . ARG B 2 76  ? -67.400  -60.333 -24.923  1.00 129.82 ? 1947 ARG B C     1 
ATOM 3538  O O     . ARG B 2 76  ? -66.728  -61.318 -25.287  1.00 129.72 ? 1947 ARG B O     1 
ATOM 3539  C CB    . ARG B 2 76  ? -66.925  -59.647 -22.517  1.00 130.49 ? 1947 ARG B CB    1 
ATOM 3540  C CG    . ARG B 2 76  ? -67.973  -58.913 -21.709  1.00 132.07 ? 1947 ARG B CG    1 
ATOM 3541  C CD    . ARG B 2 76  ? -67.315  -57.932 -20.742  1.00 135.24 ? 1947 ARG B CD    1 
ATOM 3542  N NE    . ARG B 2 76  ? -68.242  -57.546 -19.675  1.00 138.09 ? 1947 ARG B NE    1 
ATOM 3543  C CZ    . ARG B 2 76  ? -68.097  -56.485 -18.882  1.00 139.03 ? 1947 ARG B CZ    1 
ATOM 3544  N NH1   . ARG B 2 76  ? -67.048  -55.680 -19.014  1.00 139.79 ? 1947 ARG B NH1   1 
ATOM 3545  N NH2   . ARG B 2 76  ? -69.009  -56.226 -17.950  1.00 138.76 ? 1947 ARG B NH2   1 
ATOM 3546  N N     . LEU B 2 77  ? -68.665  -60.126 -25.299  1.00 129.23 ? 1948 LEU B N     1 
ATOM 3547  C CA    . LEU B 2 77  ? -69.388  -61.011 -26.204  1.00 128.34 ? 1948 LEU B CA    1 
ATOM 3548  C C     . LEU B 2 77  ? -68.768  -60.926 -27.588  1.00 128.05 ? 1948 LEU B C     1 
ATOM 3549  O O     . LEU B 2 77  ? -69.004  -61.788 -28.438  1.00 128.15 ? 1948 LEU B O     1 
ATOM 3550  C CB    . LEU B 2 77  ? -70.862  -60.613 -26.252  1.00 128.05 ? 1948 LEU B CB    1 
ATOM 3551  C CG    . LEU B 2 77  ? -71.835  -60.989 -25.127  1.00 127.65 ? 1948 LEU B CG    1 
ATOM 3552  C CD1   . LEU B 2 77  ? -72.915  -61.881 -25.651  1.00 127.34 ? 1948 LEU B CD1   1 
ATOM 3553  C CD2   . LEU B 2 77  ? -71.176  -61.620 -23.904  1.00 127.96 ? 1948 LEU B CD2   1 
ATOM 3554  N N     . LEU B 2 78  ? -67.974  -59.878 -27.805  1.00 127.48 ? 1949 LEU B N     1 
ATOM 3555  C CA    . LEU B 2 78  ? -67.204  -59.741 -29.034  1.00 127.01 ? 1949 LEU B CA    1 
ATOM 3556  C C     . LEU B 2 78  ? -65.777  -60.229 -28.853  1.00 127.05 ? 1949 LEU B C     1 
ATOM 3557  O O     . LEU B 2 78  ? -65.165  -60.696 -29.813  1.00 126.91 ? 1949 LEU B O     1 
ATOM 3558  C CB    . LEU B 2 78  ? -67.241  -58.305 -29.571  1.00 126.73 ? 1949 LEU B CB    1 
ATOM 3559  C CG    . LEU B 2 78  ? -68.199  -57.992 -30.726  1.00 125.38 ? 1949 LEU B CG    1 
ATOM 3560  C CD1   . LEU B 2 78  ? -67.769  -58.673 -32.018  1.00 124.80 ? 1949 LEU B CD1   1 
ATOM 3561  C CD2   . LEU B 2 78  ? -69.621  -58.365 -30.388  1.00 124.36 ? 1949 LEU B CD2   1 
ATOM 3562  N N     . GLU B 2 79  ? -65.253  -60.129 -27.630  1.00 127.20 ? 1950 GLU B N     1 
ATOM 3563  C CA    . GLU B 2 79  ? -63.967  -60.769 -27.312  1.00 127.41 ? 1950 GLU B CA    1 
ATOM 3564  C C     . GLU B 2 79  ? -64.135  -62.242 -27.657  1.00 127.36 ? 1950 GLU B C     1 
ATOM 3565  O O     . GLU B 2 79  ? -63.323  -62.809 -28.401  1.00 127.42 ? 1950 GLU B O     1 
ATOM 3566  C CB    . GLU B 2 79  ? -63.534  -60.621 -25.834  1.00 127.46 ? 1950 GLU B CB    1 
ATOM 3567  C CG    . GLU B 2 79  ? -63.863  -59.301 -25.100  1.00 127.14 ? 1950 GLU B CG    1 
ATOM 3568  C CD    . GLU B 2 79  ? -63.182  -58.054 -25.659  1.00 126.34 ? 1950 GLU B CD    1 
ATOM 3569  O OE1   . GLU B 2 79  ? -62.665  -57.246 -24.853  1.00 125.61 ? 1950 GLU B OE1   1 
ATOM 3570  O OE2   . GLU B 2 79  ? -63.189  -57.866 -26.893  1.00 125.79 ? 1950 GLU B OE2   1 
ATOM 3571  N N     . ALA B 2 80  ? -65.201  -62.842 -27.119  1.00 127.05 ? 1951 ALA B N     1 
ATOM 3572  C CA    . ALA B 2 80  ? -65.709  -64.099 -27.650  1.00 126.96 ? 1951 ALA B CA    1 
ATOM 3573  C C     . ALA B 2 80  ? -65.982  -63.895 -29.140  1.00 126.81 ? 1951 ALA B C     1 
ATOM 3574  O O     . ALA B 2 80  ? -66.691  -62.954 -29.534  1.00 126.83 ? 1951 ALA B O     1 
ATOM 3575  C CB    . ALA B 2 80  ? -66.980  -64.527 -26.930  1.00 127.09 ? 1951 ALA B CB    1 
ATOM 3576  N N     . SER B 2 81  ? -65.396  -64.763 -29.963  1.00 126.36 ? 1952 SER B N     1 
ATOM 3577  C CA    . SER B 2 81  ? -65.530  -64.679 -31.414  1.00 125.75 ? 1952 SER B CA    1 
ATOM 3578  C C     . SER B 2 81  ? -66.976  -64.925 -31.844  1.00 125.34 ? 1952 SER B C     1 
ATOM 3579  O O     . SER B 2 81  ? -67.238  -65.513 -32.912  1.00 125.36 ? 1952 SER B O     1 
ATOM 3580  C CB    . SER B 2 81  ? -64.567  -65.648 -32.087  1.00 125.87 ? 1952 SER B CB    1 
ATOM 3581  O OG    . SER B 2 81  ? -63.232  -65.283 -31.790  1.00 126.06 ? 1952 SER B OG    1 
ATOM 3582  N N     . ALA B 2 82  ? -67.893  -64.452 -30.989  1.00 124.52 ? 1953 ALA B N     1 
ATOM 3583  C CA    . ALA B 2 82  ? -69.341  -64.541 -31.167  1.00 123.50 ? 1953 ALA B CA    1 
ATOM 3584  C C     . ALA B 2 82  ? -69.800  -63.769 -32.400  1.00 122.63 ? 1953 ALA B C     1 
ATOM 3585  O O     . ALA B 2 82  ? -69.465  -62.596 -32.561  1.00 122.57 ? 1953 ALA B O     1 
ATOM 3586  C CB    . ALA B 2 82  ? -70.056  -64.027 -29.912  1.00 123.45 ? 1953 ALA B CB    1 
ATOM 3587  N N     . ASP B 2 83  ? -70.554  -64.443 -33.265  1.00 121.54 ? 1954 ASP B N     1 
ATOM 3588  C CA    . ASP B 2 83  ? -71.020  -63.849 -34.508  1.00 120.60 ? 1954 ASP B CA    1 
ATOM 3589  C C     . ASP B 2 83  ? -71.998  -62.724 -34.197  1.00 119.89 ? 1954 ASP B C     1 
ATOM 3590  O O     . ASP B 2 83  ? -72.959  -62.895 -33.441  1.00 119.59 ? 1954 ASP B O     1 
ATOM 3591  C CB    . ASP B 2 83  ? -71.655  -64.913 -35.427  1.00 120.74 ? 1954 ASP B CB    1 
ATOM 3592  C CG    . ASP B 2 83  ? -71.837  -64.430 -36.869  1.00 120.28 ? 1954 ASP B CG    1 
ATOM 3593  O OD1   . ASP B 2 83  ? -72.646  -65.039 -37.605  1.00 119.15 ? 1954 ASP B OD1   1 
ATOM 3594  O OD2   . ASP B 2 83  ? -71.176  -63.446 -37.266  1.00 120.30 ? 1954 ASP B OD2   1 
ATOM 3595  N N     . ALA B 2 84  ? -71.719  -61.565 -34.780  1.00 119.23 ? 1955 ALA B N     1 
ATOM 3596  C CA    . ALA B 2 84  ? -72.526  -60.369 -34.566  1.00 118.61 ? 1955 ALA B CA    1 
ATOM 3597  C C     . ALA B 2 84  ? -73.492  -60.095 -35.725  1.00 118.09 ? 1955 ALA B C     1 
ATOM 3598  O O     . ALA B 2 84  ? -74.016  -58.979 -35.854  1.00 118.09 ? 1955 ALA B O     1 
ATOM 3599  C CB    . ALA B 2 84  ? -71.626  -59.158 -34.313  1.00 118.58 ? 1955 ALA B CB    1 
ATOM 3600  N N     . ASN B 2 85  ? -73.722  -61.107 -36.562  1.00 117.28 ? 1956 ASN B N     1 
ATOM 3601  C CA    . ASN B 2 85  ? -74.726  -61.009 -37.608  1.00 116.78 ? 1956 ASN B CA    1 
ATOM 3602  C C     . ASN B 2 85  ? -75.791  -62.118 -37.564  1.00 116.80 ? 1956 ASN B C     1 
ATOM 3603  O O     . ASN B 2 85  ? -76.326  -62.534 -38.602  1.00 116.67 ? 1956 ASN B O     1 
ATOM 3604  C CB    . ASN B 2 85  ? -74.066  -60.879 -38.980  1.00 116.69 ? 1956 ASN B CB    1 
ATOM 3605  C CG    . ASN B 2 85  ? -73.320  -59.567 -39.141  1.00 116.25 ? 1956 ASN B CG    1 
ATOM 3606  O OD1   . ASN B 2 85  ? -73.833  -58.593 -39.688  1.00 115.59 ? 1956 ASN B OD1   1 
ATOM 3607  N ND2   . ASN B 2 85  ? -72.108  -59.532 -38.637  1.00 116.13 ? 1956 ASN B ND2   1 
ATOM 3608  N N     . ILE B 2 86  ? -76.097  -62.573 -36.346  1.00 116.74 ? 1957 ILE B N     1 
ATOM 3609  C CA    . ILE B 2 86  ? -77.180  -63.524 -36.077  1.00 116.77 ? 1957 ILE B CA    1 
ATOM 3610  C C     . ILE B 2 86  ? -78.534  -62.846 -36.219  1.00 117.06 ? 1957 ILE B C     1 
ATOM 3611  O O     . ILE B 2 86  ? -78.693  -61.673 -35.856  1.00 117.22 ? 1957 ILE B O     1 
ATOM 3612  C CB    . ILE B 2 86  ? -77.091  -64.068 -34.645  1.00 116.69 ? 1957 ILE B CB    1 
ATOM 3613  C CG1   . ILE B 2 86  ? -75.699  -64.647 -34.362  1.00 117.23 ? 1957 ILE B CG1   1 
ATOM 3614  C CG2   . ILE B 2 86  ? -78.208  -65.062 -34.372  1.00 116.35 ? 1957 ILE B CG2   1 
ATOM 3615  C CD1   . ILE B 2 86  ? -75.270  -65.772 -35.301  1.00 118.58 ? 1957 ILE B CD1   1 
ATOM 3616  N N     . GLN B 2 87  ? -79.514  -63.582 -36.738  1.00 117.29 ? 1958 GLN B N     1 
ATOM 3617  C CA    . GLN B 2 87  ? -80.859  -63.023 -36.950  1.00 117.43 ? 1958 GLN B CA    1 
ATOM 3618  C C     . GLN B 2 87  ? -81.859  -63.533 -35.904  1.00 117.20 ? 1958 GLN B C     1 
ATOM 3619  O O     . GLN B 2 87  ? -81.942  -64.743 -35.653  1.00 117.26 ? 1958 GLN B O     1 
ATOM 3620  C CB    . GLN B 2 87  ? -81.387  -63.331 -38.365  1.00 117.52 ? 1958 GLN B CB    1 
ATOM 3621  C CG    . GLN B 2 87  ? -80.433  -63.034 -39.512  1.00 117.82 ? 1958 GLN B CG    1 
ATOM 3622  C CD    . GLN B 2 87  ? -81.151  -62.417 -40.693  1.00 119.30 ? 1958 GLN B CD    1 
ATOM 3623  O OE1   . GLN B 2 87  ? -81.574  -63.114 -41.617  1.00 120.08 ? 1958 GLN B OE1   1 
ATOM 3624  N NE2   . GLN B 2 87  ? -81.314  -61.101 -40.658  1.00 119.45 ? 1958 GLN B NE2   1 
ATOM 3625  N N     . ASP B 2 88  ? -82.606  -62.611 -35.298  1.00 116.73 ? 1959 ASP B N     1 
ATOM 3626  C CA    . ASP B 2 88  ? -83.745  -62.980 -34.460  1.00 116.12 ? 1959 ASP B CA    1 
ATOM 3627  C C     . ASP B 2 88  ? -84.955  -63.202 -35.363  1.00 115.52 ? 1959 ASP B C     1 
ATOM 3628  O O     . ASP B 2 88  ? -84.855  -63.011 -36.572  1.00 115.40 ? 1959 ASP B O     1 
ATOM 3629  C CB    . ASP B 2 88  ? -84.015  -61.914 -33.387  1.00 116.34 ? 1959 ASP B CB    1 
ATOM 3630  C CG    . ASP B 2 88  ? -84.273  -60.517 -33.967  1.00 116.70 ? 1959 ASP B CG    1 
ATOM 3631  O OD1   . ASP B 2 88  ? -84.368  -60.367 -35.211  1.00 117.46 ? 1959 ASP B OD1   1 
ATOM 3632  O OD2   . ASP B 2 88  ? -84.389  -59.561 -33.164  1.00 116.06 ? 1959 ASP B OD2   1 
ATOM 3633  N N     . ASN B 2 89  ? -86.089  -63.596 -34.793  1.00 114.78 ? 1960 ASN B N     1 
ATOM 3634  C CA    . ASN B 2 89  ? -87.262  -63.951 -35.603  1.00 114.42 ? 1960 ASN B CA    1 
ATOM 3635  C C     . ASN B 2 89  ? -87.831  -62.822 -36.467  1.00 113.23 ? 1960 ASN B C     1 
ATOM 3636  O O     . ASN B 2 89  ? -88.575  -63.068 -37.405  1.00 112.88 ? 1960 ASN B O     1 
ATOM 3637  C CB    . ASN B 2 89  ? -88.350  -64.559 -34.719  1.00 115.22 ? 1960 ASN B CB    1 
ATOM 3638  C CG    . ASN B 2 89  ? -87.836  -65.730 -33.899  1.00 117.83 ? 1960 ASN B CG    1 
ATOM 3639  O OD1   . ASN B 2 89  ? -86.840  -66.366 -34.266  1.00 120.45 ? 1960 ASN B OD1   1 
ATOM 3640  N ND2   . ASN B 2 89  ? -88.502  -66.018 -32.773  1.00 120.35 ? 1960 ASN B ND2   1 
ATOM 3641  N N     . MET B 2 90  ? -87.475  -61.588 -36.125  1.00 112.02 ? 1961 MET B N     1 
ATOM 3642  C CA    . MET B 2 90  ? -87.780  -60.410 -36.929  1.00 110.65 ? 1961 MET B CA    1 
ATOM 3643  C C     . MET B 2 90  ? -86.812  -60.318 -38.091  1.00 109.63 ? 1961 MET B C     1 
ATOM 3644  O O     . MET B 2 90  ? -87.037  -59.606 -39.073  1.00 109.24 ? 1961 MET B O     1 
ATOM 3645  C CB    . MET B 2 90  ? -87.636  -59.142 -36.079  1.00 110.77 ? 1961 MET B CB    1 
ATOM 3646  C CG    . MET B 2 90  ? -88.731  -58.904 -35.053  1.00 110.21 ? 1961 MET B CG    1 
ATOM 3647  S SD    . MET B 2 90  ? -90.372  -59.375 -35.600  1.00 108.07 ? 1961 MET B SD    1 
ATOM 3648  C CE    . MET B 2 90  ? -90.584  -58.624 -37.240  1.00 107.69 ? 1961 MET B CE    1 
ATOM 3649  N N     . GLY B 2 91  ? -85.717  -61.048 -37.949  1.00 108.64 ? 1962 GLY B N     1 
ATOM 3650  C CA    . GLY B 2 91  ? -84.657  -61.037 -38.925  1.00 107.46 ? 1962 GLY B CA    1 
ATOM 3651  C C     . GLY B 2 91  ? -83.808  -59.803 -38.754  1.00 106.40 ? 1962 GLY B C     1 
ATOM 3652  O O     . GLY B 2 91  ? -83.541  -59.098 -39.733  1.00 106.55 ? 1962 GLY B O     1 
ATOM 3653  N N     . ARG B 2 92  ? -83.396  -59.527 -37.517  1.00 104.82 ? 1963 ARG B N     1 
ATOM 3654  C CA    . ARG B 2 92  ? -82.510  -58.397 -37.275  1.00 103.47 ? 1963 ARG B CA    1 
ATOM 3655  C C     . ARG B 2 92  ? -81.253  -58.785 -36.528  1.00 102.38 ? 1963 ARG B C     1 
ATOM 3656  O O     . ARG B 2 92  ? -81.290  -59.589 -35.597  1.00 102.40 ? 1963 ARG B O     1 
ATOM 3657  C CB    . ARG B 2 92  ? -83.217  -57.197 -36.623  1.00 103.50 ? 1963 ARG B CB    1 
ATOM 3658  C CG    . ARG B 2 92  ? -84.281  -57.501 -35.594  1.00 104.62 ? 1963 ARG B CG    1 
ATOM 3659  C CD    . ARG B 2 92  ? -85.285  -56.333 -35.469  1.00 107.34 ? 1963 ARG B CD    1 
ATOM 3660  N NE    . ARG B 2 92  ? -85.109  -55.505 -34.268  1.00 108.97 ? 1963 ARG B NE    1 
ATOM 3661  C CZ    . ARG B 2 92  ? -85.553  -54.251 -34.097  1.00 109.74 ? 1963 ARG B CZ    1 
ATOM 3662  N NH1   . ARG B 2 92  ? -86.207  -53.585 -35.053  1.00 109.61 ? 1963 ARG B NH1   1 
ATOM 3663  N NH2   . ARG B 2 92  ? -85.311  -53.643 -32.943  1.00 110.47 ? 1963 ARG B NH2   1 
ATOM 3664  N N     . THR B 2 93  ? -80.139  -58.229 -36.998  1.00 100.87 ? 1964 THR B N     1 
ATOM 3665  C CA    . THR B 2 93  ? -78.825  -58.373 -36.378  1.00 99.07  ? 1964 THR B CA    1 
ATOM 3666  C C     . THR B 2 93  ? -78.770  -57.451 -35.167  1.00 97.65  ? 1964 THR B C     1 
ATOM 3667  O O     . THR B 2 93  ? -79.432  -56.410 -35.156  1.00 96.98  ? 1964 THR B O     1 
ATOM 3668  C CB    . THR B 2 93  ? -77.656  -58.071 -37.399  1.00 99.18  ? 1964 THR B CB    1 
ATOM 3669  O OG1   . THR B 2 93  ? -76.578  -57.346 -36.769  1.00 99.29  ? 1964 THR B OG1   1 
ATOM 3670  C CG2   . THR B 2 93  ? -78.156  -57.252 -38.540  1.00 99.23  ? 1964 THR B CG2   1 
ATOM 3671  N N     . PRO B 2 94  ? -77.993  -57.840 -34.135  1.00 96.44  ? 1965 PRO B N     1 
ATOM 3672  C CA    . PRO B 2 94  ? -77.826  -56.966 -32.975  1.00 95.55  ? 1965 PRO B CA    1 
ATOM 3673  C C     . PRO B 2 94  ? -77.625  -55.473 -33.300  1.00 94.54  ? 1965 PRO B C     1 
ATOM 3674  O O     . PRO B 2 94  ? -78.165  -54.622 -32.579  1.00 94.42  ? 1965 PRO B O     1 
ATOM 3675  C CB    . PRO B 2 94  ? -76.616  -57.574 -32.272  1.00 95.53  ? 1965 PRO B CB    1 
ATOM 3676  C CG    . PRO B 2 94  ? -76.759  -59.045 -32.553  1.00 95.38  ? 1965 PRO B CG    1 
ATOM 3677  C CD    . PRO B 2 94  ? -77.299  -59.135 -33.944  1.00 96.04  ? 1965 PRO B CD    1 
ATOM 3678  N N     . LEU B 2 95  ? -76.888  -55.152 -34.366  1.00 93.36  ? 1966 LEU B N     1 
ATOM 3679  C CA    . LEU B 2 95  ? -76.798  -53.761 -34.822  1.00 92.27  ? 1966 LEU B CA    1 
ATOM 3680  C C     . LEU B 2 95  ? -78.179  -53.101 -34.999  1.00 91.92  ? 1966 LEU B C     1 
ATOM 3681  O O     . LEU B 2 95  ? -78.410  -52.007 -34.491  1.00 91.76  ? 1966 LEU B O     1 
ATOM 3682  C CB    . LEU B 2 95  ? -75.993  -53.645 -36.100  1.00 91.96  ? 1966 LEU B CB    1 
ATOM 3683  C CG    . LEU B 2 95  ? -76.064  -52.265 -36.728  1.00 90.72  ? 1966 LEU B CG    1 
ATOM 3684  C CD1   . LEU B 2 95  ? -75.243  -51.298 -35.922  1.00 89.48  ? 1966 LEU B CD1   1 
ATOM 3685  C CD2   . LEU B 2 95  ? -75.539  -52.359 -38.134  1.00 90.19  ? 1966 LEU B CD2   1 
ATOM 3686  N N     . HIS B 2 96  ? -79.094  -53.772 -35.696  1.00 91.46  ? 1967 HIS B N     1 
ATOM 3687  C CA    . HIS B 2 96  ? -80.474  -53.285 -35.827  1.00 90.97  ? 1967 HIS B CA    1 
ATOM 3688  C C     . HIS B 2 96  ? -81.055  -52.928 -34.457  1.00 90.69  ? 1967 HIS B C     1 
ATOM 3689  O O     . HIS B 2 96  ? -81.626  -51.856 -34.255  1.00 90.10  ? 1967 HIS B O     1 
ATOM 3690  C CB    . HIS B 2 96  ? -81.362  -54.353 -36.472  1.00 90.97  ? 1967 HIS B CB    1 
ATOM 3691  C CG    . HIS B 2 96  ? -81.257  -54.434 -37.963  1.00 90.18  ? 1967 HIS B CG    1 
ATOM 3692  N ND1   . HIS B 2 96  ? -80.866  -55.582 -38.615  1.00 88.34  ? 1967 HIS B ND1   1 
ATOM 3693  C CD2   . HIS B 2 96  ? -81.540  -53.528 -38.928  1.00 89.28  ? 1967 HIS B CD2   1 
ATOM 3694  C CE1   . HIS B 2 96  ? -80.894  -55.372 -39.917  1.00 88.77  ? 1967 HIS B CE1   1 
ATOM 3695  N NE2   . HIS B 2 96  ? -81.302  -54.135 -40.133  1.00 88.55  ? 1967 HIS B NE2   1 
ATOM 3696  N N     . ALA B 2 97  ? -80.893  -53.860 -33.522  1.00 90.93  ? 1968 ALA B N     1 
ATOM 3697  C CA    . ALA B 2 97  ? -81.372  -53.707 -32.151  1.00 91.03  ? 1968 ALA B CA    1 
ATOM 3698  C C     . ALA B 2 97  ? -80.740  -52.476 -31.564  1.00 90.92  ? 1968 ALA B C     1 
ATOM 3699  O O     . ALA B 2 97  ? -81.460  -51.606 -31.046  1.00 91.57  ? 1968 ALA B O     1 
ATOM 3700  C CB    . ALA B 2 97  ? -81.021  -54.929 -31.298  1.00 91.02  ? 1968 ALA B CB    1 
ATOM 3701  N N     . ALA B 2 98  ? -79.410  -52.405 -31.664  1.00 89.95  ? 1969 ALA B N     1 
ATOM 3702  C CA    . ALA B 2 98  ? -78.671  -51.258 -31.193  1.00 89.46  ? 1969 ALA B CA    1 
ATOM 3703  C C     . ALA B 2 98  ? -79.219  -49.924 -31.738  1.00 89.29  ? 1969 ALA B C     1 
ATOM 3704  O O     . ALA B 2 98  ? -79.456  -48.977 -30.966  1.00 89.35  ? 1969 ALA B O     1 
ATOM 3705  C CB    . ALA B 2 98  ? -77.225  -51.419 -31.515  1.00 89.32  ? 1969 ALA B CB    1 
ATOM 3706  N N     . VAL B 2 99  ? -79.453  -49.854 -33.047  1.00 88.93  ? 1970 VAL B N     1 
ATOM 3707  C CA    . VAL B 2 99  ? -80.001  -48.627 -33.632  1.00 88.68  ? 1970 VAL B CA    1 
ATOM 3708  C C     . VAL B 2 99  ? -81.378  -48.345 -33.062  1.00 88.80  ? 1970 VAL B C     1 
ATOM 3709  O O     . VAL B 2 99  ? -81.650  -47.216 -32.623  1.00 88.70  ? 1970 VAL B O     1 
ATOM 3710  C CB    . VAL B 2 99  ? -80.095  -48.678 -35.169  1.00 88.34  ? 1970 VAL B CB    1 
ATOM 3711  C CG1   . VAL B 2 99  ? -80.645  -47.368 -35.715  1.00 87.81  ? 1970 VAL B CG1   1 
ATOM 3712  C CG2   . VAL B 2 99  ? -78.743  -48.927 -35.753  1.00 88.53  ? 1970 VAL B CG2   1 
ATOM 3713  N N     . SER B 2 100 ? -82.226  -49.380 -33.068  1.00 88.92  ? 1971 SER B N     1 
ATOM 3714  C CA    . SER B 2 100 ? -83.625  -49.262 -32.642  1.00 89.20  ? 1971 SER B CA    1 
ATOM 3715  C C     . SER B 2 100 ? -83.729  -48.715 -31.233  1.00 89.50  ? 1971 SER B C     1 
ATOM 3716  O O     . SER B 2 100 ? -84.669  -47.959 -30.910  1.00 89.31  ? 1971 SER B O     1 
ATOM 3717  C CB    . SER B 2 100 ? -84.343  -50.608 -32.721  1.00 89.15  ? 1971 SER B CB    1 
ATOM 3718  O OG    . SER B 2 100 ? -85.163  -50.683 -33.882  1.00 89.67  ? 1971 SER B OG    1 
ATOM 3719  N N     . ALA B 2 101 ? -82.733  -49.087 -30.420  1.00 89.77  ? 1972 ALA B N     1 
ATOM 3720  C CA    . ALA B 2 101 ? -82.682  -48.783 -28.994  1.00 89.90  ? 1972 ALA B CA    1 
ATOM 3721  C C     . ALA B 2 101 ? -81.891  -47.529 -28.644  1.00 89.95  ? 1972 ALA B C     1 
ATOM 3722  O O     . ALA B 2 101 ? -81.587  -47.310 -27.474  1.00 90.17  ? 1972 ALA B O     1 
ATOM 3723  C CB    . ALA B 2 101 ? -82.116  -49.970 -28.251  1.00 89.85  ? 1972 ALA B CB    1 
ATOM 3724  N N     . ASP B 2 102 ? -81.586  -46.709 -29.653  1.00 90.05  ? 1973 ASP B N     1 
ATOM 3725  C CA    . ASP B 2 102 ? -80.714  -45.530 -29.526  1.00 90.06  ? 1973 ASP B CA    1 
ATOM 3726  C C     . ASP B 2 102 ? -79.609  -45.759 -28.526  1.00 90.40  ? 1973 ASP B C     1 
ATOM 3727  O O     . ASP B 2 102 ? -79.436  -44.962 -27.606  1.00 90.35  ? 1973 ASP B O     1 
ATOM 3728  C CB    . ASP B 2 102 ? -81.491  -44.273 -29.134  1.00 89.90  ? 1973 ASP B CB    1 
ATOM 3729  C CG    . ASP B 2 102 ? -80.725  -42.985 -29.443  1.00 90.41  ? 1973 ASP B CG    1 
ATOM 3730  O OD1   . ASP B 2 102 ? -79.510  -43.054 -29.686  1.00 89.80  ? 1973 ASP B OD1   1 
ATOM 3731  O OD2   . ASP B 2 102 ? -81.336  -41.893 -29.456  1.00 91.24  ? 1973 ASP B OD2   1 
ATOM 3732  N N     . ALA B 2 103 ? -78.875  -46.857 -28.709  1.00 91.04  ? 1974 ALA B N     1 
ATOM 3733  C CA    . ALA B 2 103 ? -77.849  -47.296 -27.764  1.00 91.72  ? 1974 ALA B CA    1 
ATOM 3734  C C     . ALA B 2 103 ? -76.442  -46.933 -28.245  1.00 92.39  ? 1974 ALA B C     1 
ATOM 3735  O O     . ALA B 2 103 ? -75.672  -47.837 -28.587  1.00 92.53  ? 1974 ALA B O     1 
ATOM 3736  C CB    . ALA B 2 103 ? -77.962  -48.794 -27.555  1.00 91.26  ? 1974 ALA B CB    1 
ATOM 3737  N N     . GLN B 2 104 ? -76.100  -45.631 -28.247  1.00 93.19  ? 1975 GLN B N     1 
ATOM 3738  C CA    . GLN B 2 104 ? -74.873  -45.160 -28.922  1.00 94.10  ? 1975 GLN B CA    1 
ATOM 3739  C C     . GLN B 2 104 ? -73.693  -46.032 -28.493  1.00 94.28  ? 1975 GLN B C     1 
ATOM 3740  O O     . GLN B 2 104 ? -72.868  -46.434 -29.334  1.00 94.28  ? 1975 GLN B O     1 
ATOM 3741  C CB    . GLN B 2 104 ? -74.599  -43.635 -28.763  1.00 94.20  ? 1975 GLN B CB    1 
ATOM 3742  C CG    . GLN B 2 104 ? -73.330  -43.083 -29.608  1.00 96.95  ? 1975 GLN B CG    1 
ATOM 3743  C CD    . GLN B 2 104 ? -73.594  -42.491 -31.074  1.00 99.12  ? 1975 GLN B CD    1 
ATOM 3744  O OE1   . GLN B 2 104 ? -74.172  -41.405 -31.251  1.00 101.12 ? 1975 GLN B OE1   1 
ATOM 3745  N NE2   . GLN B 2 104 ? -73.088  -43.181 -32.086  1.00 97.55  ? 1975 GLN B NE2   1 
ATOM 3746  N N     . GLY B 2 105 ? -73.669  -46.369 -27.198  1.00 94.48  ? 1976 GLY B N     1 
ATOM 3747  C CA    . GLY B 2 105 ? -72.632  -47.225 -26.612  1.00 94.35  ? 1976 GLY B CA    1 
ATOM 3748  C C     . GLY B 2 105 ? -72.358  -48.452 -27.451  1.00 94.15  ? 1976 GLY B C     1 
ATOM 3749  O O     . GLY B 2 105 ? -71.341  -48.540 -28.140  1.00 93.68  ? 1976 GLY B O     1 
ATOM 3750  N N     . VAL B 2 106 ? -73.299  -49.382 -27.404  1.00 94.47  ? 1977 VAL B N     1 
ATOM 3751  C CA    . VAL B 2 106 ? -73.201  -50.645 -28.141  1.00 95.01  ? 1977 VAL B CA    1 
ATOM 3752  C C     . VAL B 2 106 ? -73.038  -50.436 -29.645  1.00 95.10  ? 1977 VAL B C     1 
ATOM 3753  O O     . VAL B 2 106 ? -72.151  -51.015 -30.259  1.00 94.88  ? 1977 VAL B O     1 
ATOM 3754  C CB    . VAL B 2 106 ? -74.435  -51.554 -27.866  1.00 95.08  ? 1977 VAL B CB    1 
ATOM 3755  C CG1   . VAL B 2 106 ? -74.228  -52.963 -28.423  1.00 94.45  ? 1977 VAL B CG1   1 
ATOM 3756  C CG2   . VAL B 2 106 ? -74.723  -51.606 -26.375  1.00 95.47  ? 1977 VAL B CG2   1 
ATOM 3757  N N     . PHE B 2 107 ? -73.912  -49.622 -30.221  1.00 95.58  ? 1978 PHE B N     1 
ATOM 3758  C CA    . PHE B 2 107 ? -73.804  -49.198 -31.613  1.00 96.44  ? 1978 PHE B CA    1 
ATOM 3759  C C     . PHE B 2 107 ? -72.353  -49.057 -32.036  1.00 97.53  ? 1978 PHE B C     1 
ATOM 3760  O O     . PHE B 2 107 ? -71.842  -49.897 -32.801  1.00 97.80  ? 1978 PHE B O     1 
ATOM 3761  C CB    . PHE B 2 107 ? -74.509  -47.854 -31.781  1.00 96.11  ? 1978 PHE B CB    1 
ATOM 3762  C CG    . PHE B 2 107 ? -74.459  -47.287 -33.176  1.00 94.89  ? 1978 PHE B CG    1 
ATOM 3763  C CD1   . PHE B 2 107 ? -74.914  -48.012 -34.265  1.00 93.93  ? 1978 PHE B CD1   1 
ATOM 3764  C CD2   . PHE B 2 107 ? -74.017  -45.995 -33.382  1.00 94.76  ? 1978 PHE B CD2   1 
ATOM 3765  C CE1   . PHE B 2 107 ? -74.897  -47.460 -35.549  1.00 94.35  ? 1978 PHE B CE1   1 
ATOM 3766  C CE2   . PHE B 2 107 ? -73.999  -45.432 -34.665  1.00 94.31  ? 1978 PHE B CE2   1 
ATOM 3767  C CZ    . PHE B 2 107 ? -74.439  -46.159 -35.748  1.00 93.53  ? 1978 PHE B CZ    1 
ATOM 3768  N N     . GLN B 2 108 ? -71.708  -48.004 -31.503  1.00 98.31  ? 1979 GLN B N     1 
ATOM 3769  C CA    . GLN B 2 108 ? -70.286  -47.696 -31.718  1.00 98.70  ? 1979 GLN B CA    1 
ATOM 3770  C C     . GLN B 2 108 ? -69.379  -48.900 -31.722  1.00 98.30  ? 1979 GLN B C     1 
ATOM 3771  O O     . GLN B 2 108 ? -68.499  -48.998 -32.559  1.00 98.32  ? 1979 GLN B O     1 
ATOM 3772  C CB    . GLN B 2 108 ? -69.786  -46.688 -30.692  1.00 99.03  ? 1979 GLN B CB    1 
ATOM 3773  C CG    . GLN B 2 108 ? -70.022  -45.266 -31.136  1.00 101.89 ? 1979 GLN B CG    1 
ATOM 3774  C CD    . GLN B 2 108 ? -69.490  -45.014 -32.550  1.00 105.82 ? 1979 GLN B CD    1 
ATOM 3775  O OE1   . GLN B 2 108 ? -70.252  -44.704 -33.486  1.00 106.85 ? 1979 GLN B OE1   1 
ATOM 3776  N NE2   . GLN B 2 108 ? -68.173  -45.166 -32.715  1.00 107.26 ? 1979 GLN B NE2   1 
ATOM 3777  N N     . ILE B 2 109 ? -69.603  -49.818 -30.793  1.00 98.07  ? 1980 ILE B N     1 
ATOM 3778  C CA    . ILE B 2 109 ? -68.824  -51.028 -30.759  1.00 97.99  ? 1980 ILE B CA    1 
ATOM 3779  C C     . ILE B 2 109 ? -69.010  -51.728 -32.094  1.00 98.24  ? 1980 ILE B C     1 
ATOM 3780  O O     . ILE B 2 109 ? -68.049  -51.866 -32.851  1.00 98.70  ? 1980 ILE B O     1 
ATOM 3781  C CB    . ILE B 2 109 ? -69.216  -51.949 -29.583  1.00 97.84  ? 1980 ILE B CB    1 
ATOM 3782  C CG1   . ILE B 2 109 ? -68.654  -51.441 -28.248  1.00 98.43  ? 1980 ILE B CG1   1 
ATOM 3783  C CG2   . ILE B 2 109 ? -68.677  -53.352 -29.800  1.00 96.93  ? 1980 ILE B CG2   1 
ATOM 3784  C CD1   . ILE B 2 109 ? -68.308  -49.937 -28.156  1.00 100.68 ? 1980 ILE B CD1   1 
ATOM 3785  N N     . LEU B 2 110 ? -70.245  -52.117 -32.409  1.00 98.25  ? 1981 LEU B N     1 
ATOM 3786  C CA    . LEU B 2 110 ? -70.497  -53.013 -33.547  1.00 98.23  ? 1981 LEU B CA    1 
ATOM 3787  C C     . LEU B 2 110 ? -69.994  -52.444 -34.858  1.00 98.06  ? 1981 LEU B C     1 
ATOM 3788  O O     . LEU B 2 110 ? -69.415  -53.157 -35.661  1.00 98.06  ? 1981 LEU B O     1 
ATOM 3789  C CB    . LEU B 2 110 ? -71.976  -53.378 -33.681  1.00 98.35  ? 1981 LEU B CB    1 
ATOM 3790  C CG    . LEU B 2 110 ? -72.714  -53.783 -32.406  1.00 98.80  ? 1981 LEU B CG    1 
ATOM 3791  C CD1   . LEU B 2 110 ? -73.713  -52.695 -32.040  1.00 98.62  ? 1981 LEU B CD1   1 
ATOM 3792  C CD2   . LEU B 2 110 ? -73.424  -55.125 -32.597  1.00 98.96  ? 1981 LEU B CD2   1 
ATOM 3793  N N     . ILE B 2 111 ? -70.204  -51.151 -35.061  1.00 97.97  ? 1982 ILE B N     1 
ATOM 3794  C CA    . ILE B 2 111 ? -69.811  -50.498 -36.306  1.00 97.83  ? 1982 ILE B CA    1 
ATOM 3795  C C     . ILE B 2 111 ? -68.274  -50.331 -36.386  1.00 98.51  ? 1982 ILE B C     1 
ATOM 3796  O O     . ILE B 2 111 ? -67.689  -50.444 -37.475  1.00 98.61  ? 1982 ILE B O     1 
ATOM 3797  C CB    . ILE B 2 111 ? -70.643  -49.210 -36.544  1.00 97.13  ? 1982 ILE B CB    1 
ATOM 3798  C CG1   . ILE B 2 111 ? -69.865  -48.178 -37.337  1.00 96.99  ? 1982 ILE B CG1   1 
ATOM 3799  C CG2   . ILE B 2 111 ? -71.046  -48.605 -35.236  1.00 96.96  ? 1982 ILE B CG2   1 
ATOM 3800  C CD1   . ILE B 2 111 ? -70.513  -46.810 -37.363  1.00 96.60  ? 1982 ILE B CD1   1 
ATOM 3801  N N     . ARG B 2 112 ? -67.623  -50.099 -35.239  1.00 99.10  ? 1983 ARG B N     1 
ATOM 3802  C CA    . ARG B 2 112 ? -66.150  -50.048 -35.183  1.00 99.63  ? 1983 ARG B CA    1 
ATOM 3803  C C     . ARG B 2 112 ? -65.527  -51.411 -35.468  1.00 99.46  ? 1983 ARG B C     1 
ATOM 3804  O O     . ARG B 2 112 ? -64.382  -51.486 -35.921  1.00 99.66  ? 1983 ARG B O     1 
ATOM 3805  C CB    . ARG B 2 112 ? -65.637  -49.469 -33.860  1.00 99.86  ? 1983 ARG B CB    1 
ATOM 3806  C CG    . ARG B 2 112 ? -65.686  -47.930 -33.820  1.00 102.44 ? 1983 ARG B CG    1 
ATOM 3807  C CD    . ARG B 2 112 ? -64.605  -47.305 -32.921  1.00 107.50 ? 1983 ARG B CD    1 
ATOM 3808  N NE    . ARG B 2 112 ? -64.737  -47.672 -31.499  1.00 112.31 ? 1983 ARG B NE    1 
ATOM 3809  C CZ    . ARG B 2 112 ? -65.281  -46.896 -30.548  1.00 114.71 ? 1983 ARG B CZ    1 
ATOM 3810  N NH1   . ARG B 2 112 ? -65.756  -45.685 -30.841  1.00 115.33 ? 1983 ARG B NH1   1 
ATOM 3811  N NH2   . ARG B 2 112 ? -65.355  -47.325 -29.286  1.00 115.14 ? 1983 ARG B NH2   1 
ATOM 3812  N N     . ASN B 2 113 ? -66.305  -52.470 -35.222  1.00 99.25  ? 1984 ASN B N     1 
ATOM 3813  C CA    . ASN B 2 113 ? -65.948  -53.869 -35.537  1.00 98.92  ? 1984 ASN B CA    1 
ATOM 3814  C C     . ASN B 2 113 ? -66.132  -54.205 -37.033  1.00 98.44  ? 1984 ASN B C     1 
ATOM 3815  O O     . ASN B 2 113 ? -67.184  -53.950 -37.615  1.00 98.44  ? 1984 ASN B O     1 
ATOM 3816  C CB    . ASN B 2 113 ? -66.755  -54.820 -34.614  1.00 98.95  ? 1984 ASN B CB    1 
ATOM 3817  C CG    . ASN B 2 113 ? -66.747  -56.277 -35.078  1.00 99.04  ? 1984 ASN B CG    1 
ATOM 3818  O OD1   . ASN B 2 113 ? -66.122  -57.133 -34.456  1.00 99.39  ? 1984 ASN B OD1   1 
ATOM 3819  N ND2   . ASN B 2 113 ? -67.470  -56.564 -36.151  1.00 99.08  ? 1984 ASN B ND2   1 
ATOM 3820  N N     . ARG B 2 114 ? -65.107  -54.783 -37.643  1.00 97.81  ? 1985 ARG B N     1 
ATOM 3821  C CA    . ARG B 2 114 ? -65.122  -55.050 -39.082  1.00 97.34  ? 1985 ARG B CA    1 
ATOM 3822  C C     . ARG B 2 114 ? -66.047  -56.191 -39.515  1.00 97.30  ? 1985 ARG B C     1 
ATOM 3823  O O     . ARG B 2 114 ? -66.632  -56.141 -40.599  1.00 97.39  ? 1985 ARG B O     1 
ATOM 3824  C CB    . ARG B 2 114 ? -63.696  -55.281 -39.584  1.00 97.19  ? 1985 ARG B CB    1 
ATOM 3825  C CG    . ARG B 2 114 ? -63.547  -56.112 -40.846  1.00 95.85  ? 1985 ARG B CG    1 
ATOM 3826  C CD    . ARG B 2 114 ? -62.103  -56.485 -41.015  1.00 94.25  ? 1985 ARG B CD    1 
ATOM 3827  N NE    . ARG B 2 114 ? -61.241  -55.314 -40.849  1.00 92.47  ? 1985 ARG B NE    1 
ATOM 3828  C CZ    . ARG B 2 114 ? -60.745  -54.586 -41.847  1.00 91.35  ? 1985 ARG B CZ    1 
ATOM 3829  N NH1   . ARG B 2 114 ? -61.008  -54.905 -43.108  1.00 90.74  ? 1985 ARG B NH1   1 
ATOM 3830  N NH2   . ARG B 2 114 ? -59.970  -53.542 -41.584  1.00 90.78  ? 1985 ARG B NH2   1 
ATOM 3831  N N     . ALA B 2 115 ? -66.170  -57.220 -38.684  1.00 97.19  ? 1986 ALA B N     1 
ATOM 3832  C CA    . ALA B 2 115 ? -66.971  -58.395 -39.053  1.00 97.13  ? 1986 ALA B CA    1 
ATOM 3833  C C     . ALA B 2 115 ? -68.419  -58.023 -39.432  1.00 96.89  ? 1986 ALA B C     1 
ATOM 3834  O O     . ALA B 2 115 ? -68.971  -58.549 -40.411  1.00 97.13  ? 1986 ALA B O     1 
ATOM 3835  C CB    . ALA B 2 115 ? -66.934  -59.480 -37.931  1.00 97.12  ? 1986 ALA B CB    1 
ATOM 3836  N N     . THR B 2 116 ? -68.977  -57.067 -38.689  1.00 96.23  ? 1987 THR B N     1 
ATOM 3837  C CA    . THR B 2 116 ? -70.401  -56.739 -38.675  1.00 95.70  ? 1987 THR B CA    1 
ATOM 3838  C C     . THR B 2 116 ? -71.002  -56.230 -39.977  1.00 95.12  ? 1987 THR B C     1 
ATOM 3839  O O     . THR B 2 116 ? -70.615  -55.161 -40.460  1.00 95.24  ? 1987 THR B O     1 
ATOM 3840  C CB    . THR B 2 116 ? -70.609  -55.666 -37.638  1.00 95.85  ? 1987 THR B CB    1 
ATOM 3841  O OG1   . THR B 2 116 ? -69.954  -56.081 -36.438  1.00 96.56  ? 1987 THR B OG1   1 
ATOM 3842  C CG2   . THR B 2 116 ? -72.090  -55.417 -37.376  1.00 96.34  ? 1987 THR B CG2   1 
ATOM 3843  N N     . ASP B 2 117 ? -71.973  -56.965 -40.518  1.00 94.22  ? 1988 ASP B N     1 
ATOM 3844  C CA    . ASP B 2 117 ? -72.651  -56.517 -41.729  1.00 93.70  ? 1988 ASP B CA    1 
ATOM 3845  C C     . ASP B 2 117 ? -73.405  -55.231 -41.451  1.00 93.31  ? 1988 ASP B C     1 
ATOM 3846  O O     . ASP B 2 117 ? -74.398  -55.245 -40.711  1.00 93.63  ? 1988 ASP B O     1 
ATOM 3847  C CB    . ASP B 2 117 ? -73.636  -57.569 -42.244  1.00 93.80  ? 1988 ASP B CB    1 
ATOM 3848  C CG    . ASP B 2 117 ? -74.230  -57.208 -43.618  1.00 94.19  ? 1988 ASP B CG    1 
ATOM 3849  O OD1   . ASP B 2 117 ? -73.908  -56.133 -44.170  1.00 95.32  ? 1988 ASP B OD1   1 
ATOM 3850  O OD2   . ASP B 2 117 ? -75.020  -58.014 -44.163  1.00 94.24  ? 1988 ASP B OD2   1 
ATOM 3851  N N     . LEU B 2 118 ? -72.932  -54.130 -42.040  1.00 92.37  ? 1989 LEU B N     1 
ATOM 3852  C CA    . LEU B 2 118 ? -73.592  -52.833 -41.898  1.00 91.53  ? 1989 LEU B CA    1 
ATOM 3853  C C     . LEU B 2 118 ? -74.822  -52.692 -42.778  1.00 90.98  ? 1989 LEU B C     1 
ATOM 3854  O O     . LEU B 2 118 ? -75.630  -51.800 -42.587  1.00 90.97  ? 1989 LEU B O     1 
ATOM 3855  C CB    . LEU B 2 118 ? -72.636  -51.686 -42.227  1.00 91.50  ? 1989 LEU B CB    1 
ATOM 3856  C CG    . LEU B 2 118 ? -71.363  -51.459 -41.412  1.00 91.57  ? 1989 LEU B CG    1 
ATOM 3857  C CD1   . LEU B 2 118 ? -70.787  -50.072 -41.737  1.00 90.25  ? 1989 LEU B CD1   1 
ATOM 3858  C CD2   . LEU B 2 118 ? -71.608  -51.641 -39.907  1.00 91.61  ? 1989 LEU B CD2   1 
ATOM 3859  N N     . ASP B 2 119 ? -74.973  -53.558 -43.751  1.00 90.62  ? 1990 ASP B N     1 
ATOM 3860  C CA    . ASP B 2 119 ? -76.069  -53.378 -44.654  1.00 90.92  ? 1990 ASP B CA    1 
ATOM 3861  C C     . ASP B 2 119 ? -77.091  -54.485 -44.562  1.00 91.03  ? 1990 ASP B C     1 
ATOM 3862  O O     . ASP B 2 119 ? -77.926  -54.650 -45.480  1.00 91.00  ? 1990 ASP B O     1 
ATOM 3863  C CB    . ASP B 2 119 ? -75.549  -53.188 -46.055  1.00 91.20  ? 1990 ASP B CB    1 
ATOM 3864  C CG    . ASP B 2 119 ? -75.043  -51.789 -46.276  1.00 92.93  ? 1990 ASP B CG    1 
ATOM 3865  O OD1   . ASP B 2 119 ? -75.809  -50.831 -46.005  1.00 94.48  ? 1990 ASP B OD1   1 
ATOM 3866  O OD2   . ASP B 2 119 ? -73.883  -51.648 -46.724  1.00 94.61  ? 1990 ASP B OD2   1 
ATOM 3867  N N     . ALA B 2 120 ? -77.044  -55.195 -43.421  1.00 90.87  ? 1991 ALA B N     1 
ATOM 3868  C CA    . ALA B 2 120 ? -77.910  -56.346 -43.138  1.00 90.83  ? 1991 ALA B CA    1 
ATOM 3869  C C     . ALA B 2 120 ? -79.351  -55.952 -43.195  1.00 91.10  ? 1991 ALA B C     1 
ATOM 3870  O O     . ALA B 2 120 ? -79.716  -54.855 -42.776  1.00 91.13  ? 1991 ALA B O     1 
ATOM 3871  C CB    . ALA B 2 120 ? -77.607  -56.908 -41.809  1.00 90.59  ? 1991 ALA B CB    1 
ATOM 3872  N N     . ARG B 2 121 ? -80.169  -56.841 -43.734  1.00 91.73  ? 1992 ARG B N     1 
ATOM 3873  C CA    . ARG B 2 121 ? -81.587  -56.556 -43.865  1.00 92.61  ? 1992 ARG B CA    1 
ATOM 3874  C C     . ARG B 2 121 ? -82.460  -57.365 -42.892  1.00 93.11  ? 1992 ARG B C     1 
ATOM 3875  O O     . ARG B 2 121 ? -81.995  -58.338 -42.282  1.00 93.23  ? 1992 ARG B O     1 
ATOM 3876  C CB    . ARG B 2 121 ? -82.040  -56.696 -45.319  1.00 92.54  ? 1992 ARG B CB    1 
ATOM 3877  C CG    . ARG B 2 121 ? -82.035  -58.094 -45.931  1.00 93.10  ? 1992 ARG B CG    1 
ATOM 3878  C CD    . ARG B 2 121 ? -82.377  -57.978 -47.405  1.00 93.29  ? 1992 ARG B CD    1 
ATOM 3879  N NE    . ARG B 2 121 ? -81.834  -56.713 -47.893  1.00 92.49  ? 1992 ARG B NE    1 
ATOM 3880  C CZ    . ARG B 2 121 ? -82.552  -55.722 -48.403  1.00 92.91  ? 1992 ARG B CZ    1 
ATOM 3881  N NH1   . ARG B 2 121 ? -81.948  -54.608 -48.783  1.00 93.33  ? 1992 ARG B NH1   1 
ATOM 3882  N NH2   . ARG B 2 121 ? -83.861  -55.849 -48.549  1.00 93.38  ? 1992 ARG B NH2   1 
ATOM 3883  N N     . MET B 2 122 ? -83.707  -56.933 -42.718  1.00 93.73  ? 1993 MET B N     1 
ATOM 3884  C CA    . MET B 2 122 ? -84.655  -57.652 -41.867  1.00 94.22  ? 1993 MET B CA    1 
ATOM 3885  C C     . MET B 2 122 ? -85.635  -58.421 -42.732  1.00 94.32  ? 1993 MET B C     1 
ATOM 3886  O O     . MET B 2 122 ? -85.528  -58.409 -43.956  1.00 94.54  ? 1993 MET B O     1 
ATOM 3887  C CB    . MET B 2 122 ? -85.427  -56.690 -40.969  1.00 94.45  ? 1993 MET B CB    1 
ATOM 3888  C CG    . MET B 2 122 ? -84.610  -55.799 -40.040  1.00 94.52  ? 1993 MET B CG    1 
ATOM 3889  S SD    . MET B 2 122 ? -85.794  -54.969 -38.947  1.00 94.84  ? 1993 MET B SD    1 
ATOM 3890  C CE    . MET B 2 122 ? -84.762  -53.737 -38.162  1.00 95.96  ? 1993 MET B CE    1 
ATOM 3891  N N     . HIS B 2 123 ? -86.605  -59.074 -42.109  1.00 94.38  ? 1994 HIS B N     1 
ATOM 3892  C CA    . HIS B 2 123 ? -87.601  -59.816 -42.882  1.00 94.66  ? 1994 HIS B CA    1 
ATOM 3893  C C     . HIS B 2 123 ? -88.348  -58.928 -43.857  1.00 93.92  ? 1994 HIS B C     1 
ATOM 3894  O O     . HIS B 2 123 ? -88.829  -59.400 -44.874  1.00 94.30  ? 1994 HIS B O     1 
ATOM 3895  C CB    . HIS B 2 123 ? -88.557  -60.596 -41.972  1.00 95.24  ? 1994 HIS B CB    1 
ATOM 3896  C CG    . HIS B 2 123 ? -87.883  -61.697 -41.202  1.00 97.95  ? 1994 HIS B CG    1 
ATOM 3897  N ND1   . HIS B 2 123 ? -86.701  -62.286 -41.612  1.00 99.83  ? 1994 HIS B ND1   1 
ATOM 3898  C CD2   . HIS B 2 123 ? -88.233  -62.328 -40.055  1.00 99.97  ? 1994 HIS B CD2   1 
ATOM 3899  C CE1   . HIS B 2 123 ? -86.351  -63.225 -40.749  1.00 99.98  ? 1994 HIS B CE1   1 
ATOM 3900  N NE2   . HIS B 2 123 ? -87.264  -63.270 -39.793  1.00 100.70 ? 1994 HIS B NE2   1 
ATOM 3901  N N     . ASP B 2 124 ? -88.413  -57.639 -43.552  1.00 93.12  ? 1995 ASP B N     1 
ATOM 3902  C CA    . ASP B 2 124 ? -89.032  -56.663 -44.443  1.00 92.71  ? 1995 ASP B CA    1 
ATOM 3903  C C     . ASP B 2 124 ? -87.953  -55.911 -45.164  1.00 92.24  ? 1995 ASP B C     1 
ATOM 3904  O O     . ASP B 2 124 ? -88.221  -54.923 -45.878  1.00 92.21  ? 1995 ASP B O     1 
ATOM 3905  C CB    . ASP B 2 124 ? -89.869  -55.661 -43.661  1.00 93.20  ? 1995 ASP B CB    1 
ATOM 3906  C CG    . ASP B 2 124 ? -89.221  -55.249 -42.353  1.00 93.47  ? 1995 ASP B CG    1 
ATOM 3907  O OD1   . ASP B 2 124 ? -89.273  -54.046 -42.014  1.00 94.14  ? 1995 ASP B OD1   1 
ATOM 3908  O OD2   . ASP B 2 124 ? -88.673  -56.128 -41.664  1.00 94.26  ? 1995 ASP B OD2   1 
ATOM 3909  N N     . GLY B 2 125 ? -86.730  -56.387 -44.944  1.00 91.42  ? 1996 GLY B N     1 
ATOM 3910  C CA    . GLY B 2 125 ? -85.546  -55.878 -45.600  1.00 90.24  ? 1996 GLY B CA    1 
ATOM 3911  C C     . GLY B 2 125 ? -85.131  -54.505 -45.142  1.00 89.23  ? 1996 GLY B C     1 
ATOM 3912  O O     . GLY B 2 125 ? -84.606  -53.730 -45.920  1.00 89.25  ? 1996 GLY B O     1 
ATOM 3913  N N     . THR B 2 126 ? -85.352  -54.188 -43.881  1.00 88.28  ? 1997 THR B N     1 
ATOM 3914  C CA    . THR B 2 126 ? -84.897  -52.900 -43.410  1.00 87.47  ? 1997 THR B CA    1 
ATOM 3915  C C     . THR B 2 126 ? -83.408  -52.938 -42.992  1.00 87.10  ? 1997 THR B C     1 
ATOM 3916  O O     . THR B 2 126 ? -82.955  -53.841 -42.270  1.00 86.92  ? 1997 THR B O     1 
ATOM 3917  C CB    . THR B 2 126 ? -85.865  -52.256 -42.358  1.00 87.34  ? 1997 THR B CB    1 
ATOM 3918  O OG1   . THR B 2 126 ? -86.384  -53.260 -41.492  1.00 86.56  ? 1997 THR B OG1   1 
ATOM 3919  C CG2   . THR B 2 126 ? -87.049  -51.611 -43.050  1.00 87.04  ? 1997 THR B CG2   1 
ATOM 3920  N N     . THR B 2 127 ? -82.660  -51.970 -43.515  1.00 86.22  ? 1998 THR B N     1 
ATOM 3921  C CA    . THR B 2 127 ? -81.261  -51.741 -43.164  1.00 85.45  ? 1998 THR B CA    1 
ATOM 3922  C C     . THR B 2 127 ? -81.178  -50.879 -41.900  1.00 84.71  ? 1998 THR B C     1 
ATOM 3923  O O     . THR B 2 127 ? -82.121  -50.132 -41.617  1.00 85.16  ? 1998 THR B O     1 
ATOM 3924  C CB    . THR B 2 127 ? -80.568  -50.981 -44.295  1.00 85.72  ? 1998 THR B CB    1 
ATOM 3925  O OG1   . THR B 2 127 ? -81.130  -49.663 -44.435  1.00 84.89  ? 1998 THR B OG1   1 
ATOM 3926  C CG2   . THR B 2 127 ? -80.756  -51.737 -45.590  1.00 86.67  ? 1998 THR B CG2   1 
ATOM 3927  N N     . PRO B 2 128 ? -80.062  -50.963 -41.131  1.00 83.49  ? 1999 PRO B N     1 
ATOM 3928  C CA    . PRO B 2 128 ? -79.921  -50.039 -39.984  1.00 82.03  ? 1999 PRO B CA    1 
ATOM 3929  C C     . PRO B 2 128 ? -79.898  -48.607 -40.443  1.00 80.65  ? 1999 PRO B C     1 
ATOM 3930  O O     . PRO B 2 128 ? -80.433  -47.744 -39.784  1.00 79.72  ? 1999 PRO B O     1 
ATOM 3931  C CB    . PRO B 2 128 ? -78.583  -50.437 -39.382  1.00 82.00  ? 1999 PRO B CB    1 
ATOM 3932  C CG    . PRO B 2 128 ? -78.507  -51.902 -39.674  1.00 82.59  ? 1999 PRO B CG    1 
ATOM 3933  C CD    . PRO B 2 128 ? -79.024  -52.009 -41.096  1.00 83.39  ? 1999 PRO B CD    1 
ATOM 3934  N N     . LEU B 2 129 ? -79.311  -48.385 -41.610  1.00 80.31  ? 2000 LEU B N     1 
ATOM 3935  C CA    . LEU B 2 129 ? -79.372  -47.086 -42.263  1.00 79.67  ? 2000 LEU B CA    1 
ATOM 3936  C C     . LEU B 2 129 ? -80.822  -46.607 -42.443  1.00 79.53  ? 2000 LEU B C     1 
ATOM 3937  O O     . LEU B 2 129 ? -81.072  -45.409 -42.427  1.00 79.79  ? 2000 LEU B O     1 
ATOM 3938  C CB    . LEU B 2 129 ? -78.586  -47.092 -43.595  1.00 79.29  ? 2000 LEU B CB    1 
ATOM 3939  C CG    . LEU B 2 129 ? -77.799  -45.808 -43.881  1.00 77.58  ? 2000 LEU B CG    1 
ATOM 3940  C CD1   . LEU B 2 129 ? -78.355  -44.847 -44.947  1.00 74.32  ? 2000 LEU B CD1   1 
ATOM 3941  C CD2   . LEU B 2 129 ? -77.597  -45.089 -42.554  1.00 77.44  ? 2000 LEU B CD2   1 
ATOM 3942  N N     . ILE B 2 130 ? -81.768  -47.531 -42.592  1.00 79.34  ? 2001 ILE B N     1 
ATOM 3943  C CA    . ILE B 2 130 ? -83.198  -47.157 -42.677  1.00 79.04  ? 2001 ILE B CA    1 
ATOM 3944  C C     . ILE B 2 130 ? -83.775  -46.723 -41.313  1.00 78.33  ? 2001 ILE B C     1 
ATOM 3945  O O     . ILE B 2 130 ? -84.237  -45.587 -41.178  1.00 77.69  ? 2001 ILE B O     1 
ATOM 3946  C CB    . ILE B 2 130 ? -84.081  -48.265 -43.327  1.00 79.04  ? 2001 ILE B CB    1 
ATOM 3947  C CG1   . ILE B 2 130 ? -83.579  -48.605 -44.732  1.00 79.22  ? 2001 ILE B CG1   1 
ATOM 3948  C CG2   . ILE B 2 130 ? -85.518  -47.820 -43.371  1.00 78.80  ? 2001 ILE B CG2   1 
ATOM 3949  C CD1   . ILE B 2 130 ? -83.828  -47.532 -45.758  1.00 79.17  ? 2001 ILE B CD1   1 
ATOM 3950  N N     . LEU B 2 131 ? -83.738  -47.619 -40.323  1.00 77.65  ? 2002 LEU B N     1 
ATOM 3951  C CA    . LEU B 2 131 ? -84.154  -47.279 -38.976  1.00 77.52  ? 2002 LEU B CA    1 
ATOM 3952  C C     . LEU B 2 131 ? -83.514  -45.959 -38.614  1.00 77.91  ? 2002 LEU B C     1 
ATOM 3953  O O     . LEU B 2 131 ? -84.205  -44.973 -38.331  1.00 78.68  ? 2002 LEU B O     1 
ATOM 3954  C CB    . LEU B 2 131 ? -83.705  -48.311 -37.960  1.00 77.12  ? 2002 LEU B CB    1 
ATOM 3955  C CG    . LEU B 2 131 ? -83.851  -49.778 -38.276  1.00 77.83  ? 2002 LEU B CG    1 
ATOM 3956  C CD1   . LEU B 2 131 ? -83.308  -50.615 -37.144  1.00 77.30  ? 2002 LEU B CD1   1 
ATOM 3957  C CD2   . LEU B 2 131 ? -85.305  -50.095 -38.530  1.00 80.11  ? 2002 LEU B CD2   1 
ATOM 3958  N N     . ALA B 2 132 ? -82.188  -45.933 -38.630  1.00 77.68  ? 2003 ALA B N     1 
ATOM 3959  C CA    . ALA B 2 132 ? -81.463  -44.728 -38.333  1.00 77.37  ? 2003 ALA B CA    1 
ATOM 3960  C C     . ALA B 2 132 ? -82.210  -43.513 -38.884  1.00 77.64  ? 2003 ALA B C     1 
ATOM 3961  O O     . ALA B 2 132 ? -82.453  -42.564 -38.140  1.00 77.80  ? 2003 ALA B O     1 
ATOM 3962  C CB    . ALA B 2 132 ? -80.106  -44.809 -38.919  1.00 77.70  ? 2003 ALA B CB    1 
ATOM 3963  N N     . ALA B 2 133 ? -82.604  -43.559 -40.160  1.00 77.53  ? 2004 ALA B N     1 
ATOM 3964  C CA    . ALA B 2 133 ? -83.285  -42.438 -40.796  1.00 77.82  ? 2004 ALA B CA    1 
ATOM 3965  C C     . ALA B 2 133 ? -84.673  -42.137 -40.233  1.00 78.32  ? 2004 ALA B C     1 
ATOM 3966  O O     . ALA B 2 133 ? -85.012  -40.959 -40.023  1.00 78.07  ? 2004 ALA B O     1 
ATOM 3967  C CB    . ALA B 2 133 ? -83.371  -42.649 -42.283  1.00 77.88  ? 2004 ALA B CB    1 
ATOM 3968  N N     . ARG B 2 134 ? -85.484  -43.180 -40.002  1.00 79.04  ? 2005 ARG B N     1 
ATOM 3969  C CA    . ARG B 2 134 ? -86.887  -42.963 -39.551  1.00 79.66  ? 2005 ARG B CA    1 
ATOM 3970  C C     . ARG B 2 134 ? -87.004  -42.736 -38.048  1.00 80.21  ? 2005 ARG B C     1 
ATOM 3971  O O     . ARG B 2 134 ? -87.527  -41.692 -37.642  1.00 80.93  ? 2005 ARG B O     1 
ATOM 3972  C CB    . ARG B 2 134 ? -87.887  -44.012 -40.069  1.00 79.08  ? 2005 ARG B CB    1 
ATOM 3973  C CG    . ARG B 2 134 ? -87.872  -45.317 -39.338  1.00 78.88  ? 2005 ARG B CG    1 
ATOM 3974  C CD    . ARG B 2 134 ? -88.381  -46.461 -40.213  1.00 77.66  ? 2005 ARG B CD    1 
ATOM 3975  N NE    . ARG B 2 134 ? -88.379  -47.742 -39.506  1.00 75.66  ? 2005 ARG B NE    1 
ATOM 3976  C CZ    . ARG B 2 134 ? -88.621  -48.905 -40.087  1.00 75.44  ? 2005 ARG B CZ    1 
ATOM 3977  N NH1   . ARG B 2 134 ? -88.874  -48.945 -41.388  1.00 76.91  ? 2005 ARG B NH1   1 
ATOM 3978  N NH2   . ARG B 2 134 ? -88.616  -50.021 -39.378  1.00 73.99  ? 2005 ARG B NH2   1 
ATOM 3979  N N     . LEU B 2 135 ? -86.477  -43.668 -37.246  1.00 80.17  ? 2006 LEU B N     1 
ATOM 3980  C CA    . LEU B 2 135 ? -86.485  -43.575 -35.775  1.00 80.48  ? 2006 LEU B CA    1 
ATOM 3981  C C     . LEU B 2 135 ? -85.881  -42.291 -35.159  1.00 81.23  ? 2006 LEU B C     1 
ATOM 3982  O O     . LEU B 2 135 ? -85.740  -42.185 -33.923  1.00 81.40  ? 2006 LEU B O     1 
ATOM 3983  C CB    . LEU B 2 135 ? -85.770  -44.774 -35.177  1.00 80.08  ? 2006 LEU B CB    1 
ATOM 3984  C CG    . LEU B 2 135 ? -86.415  -46.123 -35.397  1.00 79.84  ? 2006 LEU B CG    1 
ATOM 3985  C CD1   . LEU B 2 135 ? -85.826  -47.186 -34.480  1.00 79.38  ? 2006 LEU B CD1   1 
ATOM 3986  C CD2   . LEU B 2 135 ? -87.844  -45.948 -35.121  1.00 79.93  ? 2006 LEU B CD2   1 
ATOM 3987  N N     . ALA B 2 136 ? -85.551  -41.328 -36.023  1.00 81.55  ? 2007 ALA B N     1 
ATOM 3988  C CA    . ALA B 2 136 ? -84.923  -40.072 -35.643  1.00 81.95  ? 2007 ALA B CA    1 
ATOM 3989  C C     . ALA B 2 136 ? -83.996  -40.204 -34.438  1.00 82.45  ? 2007 ALA B C     1 
ATOM 3990  O O     . ALA B 2 136 ? -84.358  -39.827 -33.342  1.00 82.62  ? 2007 ALA B O     1 
ATOM 3991  C CB    . ALA B 2 136 ? -85.960  -39.017 -35.421  1.00 81.38  ? 2007 ALA B CB    1 
ATOM 3992  N N     . VAL B 2 137 ? -82.816  -40.780 -34.643  1.00 83.11  ? 2008 VAL B N     1 
ATOM 3993  C CA    . VAL B 2 137 ? -81.776  -40.788 -33.619  1.00 84.02  ? 2008 VAL B CA    1 
ATOM 3994  C C     . VAL B 2 137 ? -80.673  -39.814 -34.047  1.00 85.13  ? 2008 VAL B C     1 
ATOM 3995  O O     . VAL B 2 137 ? -80.608  -39.445 -35.228  1.00 85.57  ? 2008 VAL B O     1 
ATOM 3996  C CB    . VAL B 2 137 ? -81.194  -42.159 -33.456  1.00 83.62  ? 2008 VAL B CB    1 
ATOM 3997  C CG1   . VAL B 2 137 ? -82.215  -43.065 -32.869  1.00 83.65  ? 2008 VAL B CG1   1 
ATOM 3998  C CG2   . VAL B 2 137 ? -80.792  -42.685 -34.798  1.00 84.28  ? 2008 VAL B CG2   1 
ATOM 3999  N N     . GLU B 2 138 ? -79.835  -39.385 -33.099  1.00 85.97  ? 2009 GLU B N     1 
ATOM 4000  C CA    . GLU B 2 138 ? -78.773  -38.423 -33.389  1.00 86.91  ? 2009 GLU B CA    1 
ATOM 4001  C C     . GLU B 2 138 ? -77.539  -39.159 -33.867  1.00 86.62  ? 2009 GLU B C     1 
ATOM 4002  O O     . GLU B 2 138 ? -77.303  -40.283 -33.447  1.00 86.93  ? 2009 GLU B O     1 
ATOM 4003  C CB    . GLU B 2 138 ? -78.455  -37.572 -32.153  1.00 87.26  ? 2009 GLU B CB    1 
ATOM 4004  C CG    . GLU B 2 138 ? -79.630  -36.673 -31.718  1.00 91.75  ? 2009 GLU B CG    1 
ATOM 4005  C CD    . GLU B 2 138 ? -79.222  -35.531 -30.755  1.00 98.37  ? 2009 GLU B CD    1 
ATOM 4006  O OE1   . GLU B 2 138 ? -78.369  -35.778 -29.855  1.00 101.48 ? 2009 GLU B OE1   1 
ATOM 4007  O OE2   . GLU B 2 138 ? -79.765  -34.389 -30.883  1.00 99.94  ? 2009 GLU B OE2   1 
ATOM 4008  N N     . GLY B 2 139 ? -76.765  -38.547 -34.757  1.00 86.40  ? 2010 GLY B N     1 
ATOM 4009  C CA    . GLY B 2 139 ? -75.495  -39.134 -35.176  1.00 86.18  ? 2010 GLY B CA    1 
ATOM 4010  C C     . GLY B 2 139 ? -75.545  -40.407 -36.021  1.00 85.85  ? 2010 GLY B C     1 
ATOM 4011  O O     . GLY B 2 139 ? -75.127  -40.388 -37.181  1.00 85.99  ? 2010 GLY B O     1 
ATOM 4012  N N     . MET B 2 140 ? -76.057  -41.503 -35.446  1.00 85.29  ? 2011 MET B N     1 
ATOM 4013  C CA    . MET B 2 140 ? -76.074  -42.847 -36.074  1.00 84.69  ? 2011 MET B CA    1 
ATOM 4014  C C     . MET B 2 140 ? -76.090  -42.891 -37.585  1.00 84.13  ? 2011 MET B C     1 
ATOM 4015  O O     . MET B 2 140 ? -75.269  -43.586 -38.174  1.00 83.93  ? 2011 MET B O     1 
ATOM 4016  C CB    . MET B 2 140 ? -77.228  -43.688 -35.562  1.00 84.55  ? 2011 MET B CB    1 
ATOM 4017  C CG    . MET B 2 140 ? -77.305  -43.740 -34.073  1.00 85.79  ? 2011 MET B CG    1 
ATOM 4018  S SD    . MET B 2 140 ? -77.849  -45.358 -33.538  1.00 88.67  ? 2011 MET B SD    1 
ATOM 4019  C CE    . MET B 2 140 ? -78.414  -45.005 -31.888  1.00 88.96  ? 2011 MET B CE    1 
ATOM 4020  N N     . LEU B 2 141 ? -77.018  -42.161 -38.201  1.00 83.82  ? 2012 LEU B N     1 
ATOM 4021  C CA    . LEU B 2 141 ? -77.110  -42.110 -39.654  1.00 83.76  ? 2012 LEU B CA    1 
ATOM 4022  C C     . LEU B 2 141 ? -75.761  -41.828 -40.251  1.00 84.80  ? 2012 LEU B C     1 
ATOM 4023  O O     . LEU B 2 141 ? -75.265  -42.595 -41.091  1.00 84.81  ? 2012 LEU B O     1 
ATOM 4024  C CB    . LEU B 2 141 ? -78.029  -40.989 -40.110  1.00 83.13  ? 2012 LEU B CB    1 
ATOM 4025  C CG    . LEU B 2 141 ? -78.228  -41.066 -41.626  1.00 80.63  ? 2012 LEU B CG    1 
ATOM 4026  C CD1   . LEU B 2 141 ? -79.378  -41.995 -41.908  1.00 79.16  ? 2012 LEU B CD1   1 
ATOM 4027  C CD2   . LEU B 2 141 ? -78.490  -39.720 -42.214  1.00 77.95  ? 2012 LEU B CD2   1 
ATOM 4028  N N     . GLU B 2 142 ? -75.200  -40.694 -39.815  1.00 85.86  ? 2013 GLU B N     1 
ATOM 4029  C CA    . GLU B 2 142 ? -73.860  -40.240 -40.201  1.00 86.64  ? 2013 GLU B CA    1 
ATOM 4030  C C     . GLU B 2 142 ? -72.771  -41.301 -39.968  1.00 86.19  ? 2013 GLU B C     1 
ATOM 4031  O O     . GLU B 2 142 ? -72.049  -41.655 -40.892  1.00 86.26  ? 2013 GLU B O     1 
ATOM 4032  C CB    . GLU B 2 142 ? -73.509  -38.962 -39.446  1.00 87.11  ? 2013 GLU B CB    1 
ATOM 4033  C CG    . GLU B 2 142 ? -73.911  -37.700 -40.131  1.00 90.22  ? 2013 GLU B CG    1 
ATOM 4034  C CD    . GLU B 2 142 ? -72.750  -36.708 -40.192  1.00 95.28  ? 2013 GLU B CD    1 
ATOM 4035  O OE1   . GLU B 2 142 ? -71.644  -37.110 -40.644  1.00 96.71  ? 2013 GLU B OE1   1 
ATOM 4036  O OE2   . GLU B 2 142 ? -72.940  -35.528 -39.799  1.00 96.81  ? 2013 GLU B OE2   1 
ATOM 4037  N N     . ASP B 2 143 ? -72.667  -41.809 -38.745  1.00 85.71  ? 2014 ASP B N     1 
ATOM 4038  C CA    . ASP B 2 143 ? -71.646  -42.782 -38.429  1.00 85.82  ? 2014 ASP B CA    1 
ATOM 4039  C C     . ASP B 2 143 ? -71.727  -43.982 -39.363  1.00 85.49  ? 2014 ASP B C     1 
ATOM 4040  O O     . ASP B 2 143 ? -70.691  -44.446 -39.853  1.00 85.92  ? 2014 ASP B O     1 
ATOM 4041  C CB    . ASP B 2 143 ? -71.720  -43.218 -36.961  1.00 86.33  ? 2014 ASP B CB    1 
ATOM 4042  C CG    . ASP B 2 143 ? -71.521  -42.046 -35.978  1.00 88.53  ? 2014 ASP B CG    1 
ATOM 4043  O OD1   . ASP B 2 143 ? -71.405  -40.873 -36.431  1.00 90.17  ? 2014 ASP B OD1   1 
ATOM 4044  O OD2   . ASP B 2 143 ? -71.494  -42.299 -34.744  1.00 90.39  ? 2014 ASP B OD2   1 
ATOM 4045  N N     . LEU B 2 144 ? -72.935  -44.472 -39.639  1.00 84.85  ? 2015 LEU B N     1 
ATOM 4046  C CA    . LEU B 2 144 ? -73.092  -45.569 -40.600  1.00 84.07  ? 2015 LEU B CA    1 
ATOM 4047  C C     . LEU B 2 144 ? -72.688  -45.159 -41.977  1.00 83.89  ? 2015 LEU B C     1 
ATOM 4048  O O     . LEU B 2 144 ? -72.123  -45.956 -42.700  1.00 84.02  ? 2015 LEU B O     1 
ATOM 4049  C CB    . LEU B 2 144 ? -74.509  -46.083 -40.682  1.00 83.82  ? 2015 LEU B CB    1 
ATOM 4050  C CG    . LEU B 2 144 ? -75.071  -46.897 -39.536  1.00 83.63  ? 2015 LEU B CG    1 
ATOM 4051  C CD1   . LEU B 2 144 ? -76.535  -47.140 -39.833  1.00 83.91  ? 2015 LEU B CD1   1 
ATOM 4052  C CD2   . LEU B 2 144 ? -74.323  -48.208 -39.347  1.00 82.45  ? 2015 LEU B CD2   1 
ATOM 4053  N N     . ILE B 2 145 ? -72.987  -43.924 -42.354  1.00 83.83  ? 2016 ILE B N     1 
ATOM 4054  C CA    . ILE B 2 145 ? -72.567  -43.450 -43.669  1.00 84.07  ? 2016 ILE B CA    1 
ATOM 4055  C C     . ILE B 2 145 ? -71.046  -43.451 -43.771  1.00 84.10  ? 2016 ILE B C     1 
ATOM 4056  O O     . ILE B 2 145 ? -70.493  -44.120 -44.629  1.00 83.72  ? 2016 ILE B O     1 
ATOM 4057  C CB    . ILE B 2 145 ? -73.222  -42.106 -44.067  1.00 84.27  ? 2016 ILE B CB    1 
ATOM 4058  C CG1   . ILE B 2 145 ? -74.723  -42.347 -44.299  1.00 84.84  ? 2016 ILE B CG1   1 
ATOM 4059  C CG2   . ILE B 2 145 ? -72.531  -41.489 -45.312  1.00 83.08  ? 2016 ILE B CG2   1 
ATOM 4060  C CD1   . ILE B 2 145 ? -75.540  -41.088 -44.574  1.00 87.26  ? 2016 ILE B CD1   1 
ATOM 4061  N N     . ASN B 2 146 ? -70.385  -42.736 -42.867  1.00 84.62  ? 2017 ASN B N     1 
ATOM 4062  C CA    . ASN B 2 146 ? -68.917  -42.704 -42.805  1.00 85.20  ? 2017 ASN B CA    1 
ATOM 4063  C C     . ASN B 2 146 ? -68.273  -44.079 -42.763  1.00 85.63  ? 2017 ASN B C     1 
ATOM 4064  O O     . ASN B 2 146 ? -67.258  -44.292 -43.419  1.00 86.21  ? 2017 ASN B O     1 
ATOM 4065  C CB    . ASN B 2 146 ? -68.425  -41.858 -41.635  1.00 84.87  ? 2017 ASN B CB    1 
ATOM 4066  C CG    . ASN B 2 146 ? -68.845  -40.403 -41.769  1.00 85.63  ? 2017 ASN B CG    1 
ATOM 4067  O OD1   . ASN B 2 146 ? -69.104  -39.910 -42.877  1.00 85.33  ? 2017 ASN B OD1   1 
ATOM 4068  N ND2   . ASN B 2 146 ? -68.924  -39.704 -40.637  1.00 86.79  ? 2017 ASN B ND2   1 
ATOM 4069  N N     . SER B 2 147 ? -68.858  -45.022 -42.033  1.00 85.54  ? 2018 SER B N     1 
ATOM 4070  C CA    . SER B 2 147 ? -68.329  -46.368 -42.075  1.00 85.86  ? 2018 SER B CA    1 
ATOM 4071  C C     . SER B 2 147 ? -68.646  -47.120 -43.401  1.00 86.58  ? 2018 SER B C     1 
ATOM 4072  O O     . SER B 2 147 ? -68.324  -48.325 -43.569  1.00 87.00  ? 2018 SER B O     1 
ATOM 4073  C CB    . SER B 2 147 ? -68.751  -47.125 -40.832  1.00 85.55  ? 2018 SER B CB    1 
ATOM 4074  O OG    . SER B 2 147 ? -68.162  -46.519 -39.703  1.00 85.74  ? 2018 SER B OG    1 
ATOM 4075  N N     . HIS B 2 148 ? -69.250  -46.399 -44.350  1.00 86.96  ? 2019 HIS B N     1 
ATOM 4076  C CA    . HIS B 2 148 ? -69.457  -46.897 -45.731  1.00 87.47  ? 2019 HIS B CA    1 
ATOM 4077  C C     . HIS B 2 148 ? -70.554  -47.936 -45.850  1.00 87.06  ? 2019 HIS B C     1 
ATOM 4078  O O     . HIS B 2 148 ? -70.379  -49.027 -46.388  1.00 86.74  ? 2019 HIS B O     1 
ATOM 4079  C CB    . HIS B 2 148 ? -68.131  -47.347 -46.384  1.00 88.19  ? 2019 HIS B CB    1 
ATOM 4080  C CG    . HIS B 2 148 ? -67.098  -46.268 -46.415  1.00 89.70  ? 2019 HIS B CG    1 
ATOM 4081  N ND1   . HIS B 2 148 ? -66.074  -46.197 -45.497  1.00 91.12  ? 2019 HIS B ND1   1 
ATOM 4082  C CD2   . HIS B 2 148 ? -66.974  -45.179 -47.211  1.00 91.16  ? 2019 HIS B CD2   1 
ATOM 4083  C CE1   . HIS B 2 148 ? -65.346  -45.123 -45.741  1.00 92.75  ? 2019 HIS B CE1   1 
ATOM 4084  N NE2   . HIS B 2 148 ? -65.878  -44.483 -46.769  1.00 93.41  ? 2019 HIS B NE2   1 
ATOM 4085  N N     . ALA B 2 149 ? -71.701  -47.568 -45.311  1.00 87.09  ? 2020 ALA B N     1 
ATOM 4086  C CA    . ALA B 2 149 ? -72.908  -48.323 -45.511  1.00 86.82  ? 2020 ALA B CA    1 
ATOM 4087  C C     . ALA B 2 149 ? -73.481  -47.952 -46.892  1.00 86.89  ? 2020 ALA B C     1 
ATOM 4088  O O     . ALA B 2 149 ? -73.297  -46.813 -47.396  1.00 86.87  ? 2020 ALA B O     1 
ATOM 4089  C CB    . ALA B 2 149 ? -73.875  -48.009 -44.423  1.00 86.68  ? 2020 ALA B CB    1 
ATOM 4090  N N     . ASP B 2 150 ? -74.133  -48.932 -47.518  1.00 86.44  ? 2021 ASP B N     1 
ATOM 4091  C CA    . ASP B 2 150 ? -74.706  -48.730 -48.823  1.00 86.02  ? 2021 ASP B CA    1 
ATOM 4092  C C     . ASP B 2 150 ? -75.782  -47.721 -48.583  1.00 84.89  ? 2021 ASP B C     1 
ATOM 4093  O O     . ASP B 2 150 ? -76.767  -48.001 -47.917  1.00 85.18  ? 2021 ASP B O     1 
ATOM 4094  C CB    . ASP B 2 150 ? -75.267  -50.037 -49.389  1.00 86.67  ? 2021 ASP B CB    1 
ATOM 4095  C CG    . ASP B 2 150 ? -75.716  -49.911 -50.856  1.00 89.67  ? 2021 ASP B CG    1 
ATOM 4096  O OD1   . ASP B 2 150 ? -75.965  -48.780 -51.353  1.00 92.02  ? 2021 ASP B OD1   1 
ATOM 4097  O OD2   . ASP B 2 150 ? -75.842  -50.967 -51.520  1.00 94.01  ? 2021 ASP B OD2   1 
ATOM 4098  N N     . VAL B 2 151 ? -75.567  -46.521 -49.083  1.00 83.70  ? 2022 VAL B N     1 
ATOM 4099  C CA    . VAL B 2 151 ? -76.524  -45.454 -48.854  1.00 82.88  ? 2022 VAL B CA    1 
ATOM 4100  C C     . VAL B 2 151 ? -77.767  -45.608 -49.732  1.00 82.30  ? 2022 VAL B C     1 
ATOM 4101  O O     . VAL B 2 151 ? -78.848  -45.100 -49.383  1.00 82.49  ? 2022 VAL B O     1 
ATOM 4102  C CB    . VAL B 2 151 ? -75.865  -44.048 -48.953  1.00 82.89  ? 2022 VAL B CB    1 
ATOM 4103  C CG1   . VAL B 2 151 ? -74.360  -44.218 -49.052  1.00 84.33  ? 2022 VAL B CG1   1 
ATOM 4104  C CG2   . VAL B 2 151 ? -76.409  -43.200 -50.110  1.00 81.15  ? 2022 VAL B CG2   1 
ATOM 4105  N N     . ASN B 2 152 ? -77.637  -46.337 -50.838  1.00 81.10  ? 2023 ASN B N     1 
ATOM 4106  C CA    . ASN B 2 152 ? -78.782  -46.535 -51.702  1.00 80.24  ? 2023 ASN B CA    1 
ATOM 4107  C C     . ASN B 2 152 ? -79.482  -47.855 -51.588  1.00 79.76  ? 2023 ASN B C     1 
ATOM 4108  O O     . ASN B 2 152 ? -80.442  -48.087 -52.312  1.00 79.80  ? 2023 ASN B O     1 
ATOM 4109  C CB    . ASN B 2 152 ? -78.455  -46.221 -53.135  1.00 80.28  ? 2023 ASN B CB    1 
ATOM 4110  C CG    . ASN B 2 152 ? -78.099  -44.785 -53.321  1.00 81.54  ? 2023 ASN B CG    1 
ATOM 4111  O OD1   . ASN B 2 152 ? -77.412  -44.195 -52.481  1.00 82.61  ? 2023 ASN B OD1   1 
ATOM 4112  N ND2   . ASN B 2 152 ? -78.567  -44.194 -54.415  1.00 82.86  ? 2023 ASN B ND2   1 
ATOM 4113  N N     . ALA B 2 153 ? -79.027  -48.684 -50.655  1.00 79.28  ? 2024 ALA B N     1 
ATOM 4114  C CA    . ALA B 2 153 ? -79.699  -49.930 -50.259  1.00 79.54  ? 2024 ALA B CA    1 
ATOM 4115  C C     . ALA B 2 153 ? -81.178  -49.750 -50.024  1.00 79.72  ? 2024 ALA B C     1 
ATOM 4116  O O     . ALA B 2 153 ? -81.568  -48.741 -49.468  1.00 80.08  ? 2024 ALA B O     1 
ATOM 4117  C CB    . ALA B 2 153 ? -79.085  -50.431 -48.985  1.00 79.67  ? 2024 ALA B CB    1 
ATOM 4118  N N     . VAL B 2 154 ? -82.005  -50.717 -50.409  1.00 79.97  ? 2025 VAL B N     1 
ATOM 4119  C CA    . VAL B 2 154 ? -83.449  -50.568 -50.168  1.00 80.51  ? 2025 VAL B CA    1 
ATOM 4120  C C     . VAL B 2 154 ? -84.119  -51.714 -49.371  1.00 81.31  ? 2025 VAL B C     1 
ATOM 4121  O O     . VAL B 2 154 ? -83.619  -52.848 -49.370  1.00 81.26  ? 2025 VAL B O     1 
ATOM 4122  C CB    . VAL B 2 154 ? -84.263  -50.223 -51.478  1.00 80.12  ? 2025 VAL B CB    1 
ATOM 4123  C CG1   . VAL B 2 154 ? -83.678  -49.020 -52.204  1.00 79.21  ? 2025 VAL B CG1   1 
ATOM 4124  C CG2   . VAL B 2 154 ? -84.361  -51.388 -52.390  1.00 80.07  ? 2025 VAL B CG2   1 
ATOM 4125  N N     . ASP B 2 155 ? -85.235  -51.404 -48.686  1.00 82.08  ? 2026 ASP B N     1 
ATOM 4126  C CA    . ASP B 2 155 ? -86.144  -52.453 -48.113  1.00 82.81  ? 2026 ASP B CA    1 
ATOM 4127  C C     . ASP B 2 155 ? -87.069  -53.131 -49.150  1.00 82.48  ? 2026 ASP B C     1 
ATOM 4128  O O     . ASP B 2 155 ? -87.139  -52.690 -50.302  1.00 82.96  ? 2026 ASP B O     1 
ATOM 4129  C CB    . ASP B 2 155 ? -86.977  -51.919 -46.933  1.00 83.19  ? 2026 ASP B CB    1 
ATOM 4130  C CG    . ASP B 2 155 ? -87.876  -50.730 -47.308  1.00 85.26  ? 2026 ASP B CG    1 
ATOM 4131  O OD1   . ASP B 2 155 ? -87.964  -50.410 -48.522  1.00 85.48  ? 2026 ASP B OD1   1 
ATOM 4132  O OD2   . ASP B 2 155 ? -88.488  -50.117 -46.371  1.00 86.90  ? 2026 ASP B OD2   1 
ATOM 4133  N N     . ASP B 2 156 ? -87.788  -54.178 -48.752  1.00 81.34  ? 2027 ASP B N     1 
ATOM 4134  C CA    . ASP B 2 156 ? -88.623  -54.892 -49.709  1.00 80.54  ? 2027 ASP B CA    1 
ATOM 4135  C C     . ASP B 2 156 ? -89.583  -53.983 -50.482  1.00 79.71  ? 2027 ASP B C     1 
ATOM 4136  O O     . ASP B 2 156 ? -89.982  -54.314 -51.580  1.00 80.35  ? 2027 ASP B O     1 
ATOM 4137  C CB    . ASP B 2 156 ? -89.380  -56.029 -49.044  1.00 80.91  ? 2027 ASP B CB    1 
ATOM 4138  C CG    . ASP B 2 156 ? -88.462  -56.967 -48.271  1.00 83.29  ? 2027 ASP B CG    1 
ATOM 4139  O OD1   . ASP B 2 156 ? -87.237  -56.733 -48.321  1.00 86.22  ? 2027 ASP B OD1   1 
ATOM 4140  O OD2   . ASP B 2 156 ? -88.948  -57.928 -47.605  1.00 84.84  ? 2027 ASP B OD2   1 
ATOM 4141  N N     . LEU B 2 157 ? -89.942  -52.825 -49.956  1.00 78.11  ? 2028 LEU B N     1 
ATOM 4142  C CA    . LEU B 2 157 ? -90.868  -51.998 -50.701  1.00 76.59  ? 2028 LEU B CA    1 
ATOM 4143  C C     . LEU B 2 157 ? -90.062  -51.073 -51.562  1.00 76.34  ? 2028 LEU B C     1 
ATOM 4144  O O     . LEU B 2 157 ? -90.587  -50.149 -52.234  1.00 75.99  ? 2028 LEU B O     1 
ATOM 4145  C CB    . LEU B 2 157 ? -91.806  -51.256 -49.768  1.00 76.47  ? 2028 LEU B CB    1 
ATOM 4146  C CG    . LEU B 2 157 ? -92.996  -52.109 -49.309  1.00 75.86  ? 2028 LEU B CG    1 
ATOM 4147  C CD1   . LEU B 2 157 ? -92.684  -53.115 -48.120  1.00 75.26  ? 2028 LEU B CD1   1 
ATOM 4148  C CD2   . LEU B 2 157 ? -94.215  -51.207 -49.040  1.00 74.57  ? 2028 LEU B CD2   1 
ATOM 4149  N N     . GLY B 2 158 ? -88.764  -51.351 -51.530  1.00 75.99  ? 2029 GLY B N     1 
ATOM 4150  C CA    . GLY B 2 158 ? -87.772  -50.667 -52.335  1.00 76.32  ? 2029 GLY B CA    1 
ATOM 4151  C C     . GLY B 2 158 ? -87.658  -49.190 -52.062  1.00 76.24  ? 2029 GLY B C     1 
ATOM 4152  O O     . GLY B 2 158 ? -87.553  -48.411 -52.990  1.00 76.53  ? 2029 GLY B O     1 
ATOM 4153  N N     . LYS B 2 159 ? -87.689  -48.816 -50.791  1.00 75.99  ? 2030 LYS B N     1 
ATOM 4154  C CA    . LYS B 2 159 ? -87.551  -47.440 -50.371  1.00 75.68  ? 2030 LYS B CA    1 
ATOM 4155  C C     . LYS B 2 159 ? -86.189  -47.314 -49.711  1.00 75.86  ? 2030 LYS B C     1 
ATOM 4156  O O     . LYS B 2 159 ? -85.766  -48.176 -48.895  1.00 75.34  ? 2030 LYS B O     1 
ATOM 4157  C CB    . LYS B 2 159 ? -88.637  -47.075 -49.362  1.00 75.99  ? 2030 LYS B CB    1 
ATOM 4158  C CG    . LYS B 2 159 ? -90.055  -46.858 -49.912  1.00 76.79  ? 2030 LYS B CG    1 
ATOM 4159  C CD    . LYS B 2 159 ? -91.123  -46.770 -48.780  1.00 77.87  ? 2030 LYS B CD    1 
ATOM 4160  C CE    . LYS B 2 159 ? -91.095  -47.977 -47.815  1.00 78.48  ? 2030 LYS B CE    1 
ATOM 4161  N NZ    . LYS B 2 159 ? -92.375  -48.173 -47.056  1.00 79.61  ? 2030 LYS B NZ    1 
ATOM 4162  N N     . SER B 2 160 ? -85.486  -46.246 -50.067  1.00 75.76  ? 2031 SER B N     1 
ATOM 4163  C CA    . SER B 2 160 ? -84.152  -46.023 -49.528  1.00 75.98  ? 2031 SER B CA    1 
ATOM 4164  C C     . SER B 2 160 ? -84.255  -45.154 -48.287  1.00 75.89  ? 2031 SER B C     1 
ATOM 4165  O O     . SER B 2 160 ? -85.275  -44.478 -48.079  1.00 76.11  ? 2031 SER B O     1 
ATOM 4166  C CB    . SER B 2 160 ? -83.312  -45.303 -50.558  1.00 76.30  ? 2031 SER B CB    1 
ATOM 4167  O OG    . SER B 2 160 ? -83.834  -44.002 -50.790  1.00 77.53  ? 2031 SER B OG    1 
ATOM 4168  N N     . ALA B 2 161 ? -83.211  -45.124 -47.465  1.00 75.32  ? 2032 ALA B N     1 
ATOM 4169  C CA    . ALA B 2 161 ? -83.266  -44.249 -46.299  1.00 74.70  ? 2032 ALA B CA    1 
ATOM 4170  C C     . ALA B 2 161 ? -83.597  -42.821 -46.684  1.00 74.40  ? 2032 ALA B C     1 
ATOM 4171  O O     . ALA B 2 161 ? -84.202  -42.132 -45.892  1.00 74.55  ? 2032 ALA B O     1 
ATOM 4172  C CB    . ALA B 2 161 ? -82.017  -44.309 -45.476  1.00 74.60  ? 2032 ALA B CB    1 
ATOM 4173  N N     . LEU B 2 162 ? -83.234  -42.383 -47.892  1.00 74.27  ? 2033 LEU B N     1 
ATOM 4174  C CA    . LEU B 2 162 ? -83.576  -41.044 -48.345  1.00 74.13  ? 2033 LEU B CA    1 
ATOM 4175  C C     . LEU B 2 162 ? -85.061  -40.944 -48.429  1.00 74.87  ? 2033 LEU B C     1 
ATOM 4176  O O     . LEU B 2 162 ? -85.656  -39.988 -47.955  1.00 74.66  ? 2033 LEU B O     1 
ATOM 4177  C CB    . LEU B 2 162 ? -83.006  -40.740 -49.713  1.00 73.82  ? 2033 LEU B CB    1 
ATOM 4178  C CG    . LEU B 2 162 ? -83.382  -39.297 -50.046  1.00 73.09  ? 2033 LEU B CG    1 
ATOM 4179  C CD1   . LEU B 2 162 ? -82.728  -38.378 -49.060  1.00 73.05  ? 2033 LEU B CD1   1 
ATOM 4180  C CD2   . LEU B 2 162 ? -82.985  -38.898 -51.429  1.00 73.47  ? 2033 LEU B CD2   1 
ATOM 4181  N N     . HIS B 2 163 ? -85.650  -41.955 -49.054  1.00 76.26  ? 2034 HIS B N     1 
ATOM 4182  C CA    . HIS B 2 163 ? -87.094  -42.106 -49.149  1.00 77.15  ? 2034 HIS B CA    1 
ATOM 4183  C C     . HIS B 2 163 ? -87.692  -41.898 -47.773  1.00 77.02  ? 2034 HIS B C     1 
ATOM 4184  O O     . HIS B 2 163 ? -88.314  -40.861 -47.531  1.00 77.09  ? 2034 HIS B O     1 
ATOM 4185  C CB    . HIS B 2 163 ? -87.462  -43.479 -49.718  1.00 77.52  ? 2034 HIS B CB    1 
ATOM 4186  C CG    . HIS B 2 163 ? -87.636  -43.495 -51.206  1.00 79.00  ? 2034 HIS B CG    1 
ATOM 4187  N ND1   . HIS B 2 163 ? -87.253  -44.562 -51.988  1.00 78.96  ? 2034 HIS B ND1   1 
ATOM 4188  C CD2   . HIS B 2 163 ? -88.184  -42.586 -52.051  1.00 79.05  ? 2034 HIS B CD2   1 
ATOM 4189  C CE1   . HIS B 2 163 ? -87.568  -44.312 -53.250  1.00 79.33  ? 2034 HIS B CE1   1 
ATOM 4190  N NE2   . HIS B 2 163 ? -88.130  -43.118 -53.315  1.00 78.35  ? 2034 HIS B NE2   1 
ATOM 4191  N N     . TRP B 2 164 ? -87.456  -42.848 -46.866  1.00 76.75  ? 2035 TRP B N     1 
ATOM 4192  C CA    . TRP B 2 164 ? -87.975  -42.759 -45.496  1.00 76.74  ? 2035 TRP B CA    1 
ATOM 4193  C C     . TRP B 2 164 ? -87.767  -41.414 -44.810  1.00 75.80  ? 2035 TRP B C     1 
ATOM 4194  O O     . TRP B 2 164 ? -88.712  -40.807 -44.339  1.00 75.98  ? 2035 TRP B O     1 
ATOM 4195  C CB    . TRP B 2 164 ? -87.327  -43.802 -44.656  1.00 77.13  ? 2035 TRP B CB    1 
ATOM 4196  C CG    . TRP B 2 164 ? -87.840  -45.127 -44.841  1.00 79.54  ? 2035 TRP B CG    1 
ATOM 4197  C CD1   . TRP B 2 164 ? -87.329  -46.084 -45.637  1.00 80.76  ? 2035 TRP B CD1   1 
ATOM 4198  C CD2   . TRP B 2 164 ? -88.952  -45.707 -44.162  1.00 83.28  ? 2035 TRP B CD2   1 
ATOM 4199  N NE1   . TRP B 2 164 ? -88.059  -47.246 -45.518  1.00 82.77  ? 2035 TRP B NE1   1 
ATOM 4200  C CE2   . TRP B 2 164 ? -89.056  -47.040 -44.605  1.00 84.30  ? 2035 TRP B CE2   1 
ATOM 4201  C CE3   . TRP B 2 164 ? -89.871  -45.232 -43.218  1.00 83.82  ? 2035 TRP B CE3   1 
ATOM 4202  C CZ2   . TRP B 2 164 ? -90.038  -47.898 -44.142  1.00 85.22  ? 2035 TRP B CZ2   1 
ATOM 4203  C CZ3   . TRP B 2 164 ? -90.842  -46.081 -42.763  1.00 83.44  ? 2035 TRP B CZ3   1 
ATOM 4204  C CH2   . TRP B 2 164 ? -90.929  -47.393 -43.225  1.00 84.14  ? 2035 TRP B CH2   1 
ATOM 4205  N N     . ALA B 2 165 ? -86.528  -40.954 -44.754  1.00 74.74  ? 2036 ALA B N     1 
ATOM 4206  C CA    . ALA B 2 165 ? -86.242  -39.605 -44.286  1.00 74.01  ? 2036 ALA B CA    1 
ATOM 4207  C C     . ALA B 2 165 ? -87.146  -38.524 -44.893  1.00 73.15  ? 2036 ALA B C     1 
ATOM 4208  O O     . ALA B 2 165 ? -87.432  -37.525 -44.253  1.00 73.07  ? 2036 ALA B O     1 
ATOM 4209  C CB    . ALA B 2 165 ? -84.768  -39.252 -44.510  1.00 74.40  ? 2036 ALA B CB    1 
ATOM 4210  N N     . ALA B 2 166 ? -87.594  -38.701 -46.122  1.00 72.28  ? 2037 ALA B N     1 
ATOM 4211  C CA    . ALA B 2 166 ? -88.529  -37.716 -46.674  1.00 71.83  ? 2037 ALA B CA    1 
ATOM 4212  C C     . ALA B 2 166 ? -89.965  -38.010 -46.234  1.00 71.16  ? 2037 ALA B C     1 
ATOM 4213  O O     . ALA B 2 166 ? -90.826  -37.130 -46.208  1.00 70.45  ? 2037 ALA B O     1 
ATOM 4214  C CB    . ALA B 2 166 ? -88.419  -37.641 -48.208  1.00 72.13  ? 2037 ALA B CB    1 
ATOM 4215  N N     . ALA B 2 167 ? -90.210  -39.266 -45.902  1.00 70.41  ? 2038 ALA B N     1 
ATOM 4216  C CA    . ALA B 2 167 ? -91.473  -39.654 -45.384  1.00 70.05  ? 2038 ALA B CA    1 
ATOM 4217  C C     . ALA B 2 167 ? -91.625  -39.054 -43.996  1.00 70.03  ? 2038 ALA B C     1 
ATOM 4218  O O     . ALA B 2 167 ? -92.647  -38.459 -43.688  1.00 70.88  ? 2038 ALA B O     1 
ATOM 4219  C CB    . ALA B 2 167 ? -91.553  -41.126 -45.336  1.00 70.05  ? 2038 ALA B CB    1 
ATOM 4220  N N     . VAL B 2 168 ? -90.605  -39.157 -43.164  1.00 69.46  ? 2039 VAL B N     1 
ATOM 4221  C CA    . VAL B 2 168 ? -90.728  -38.656 -41.808  1.00 69.09  ? 2039 VAL B CA    1 
ATOM 4222  C C     . VAL B 2 168 ? -90.227  -37.224 -41.661  1.00 69.14  ? 2039 VAL B C     1 
ATOM 4223  O O     . VAL B 2 168 ? -89.822  -36.813 -40.576  1.00 69.25  ? 2039 VAL B O     1 
ATOM 4224  C CB    . VAL B 2 168 ? -90.026  -39.579 -40.808  1.00 68.99  ? 2039 VAL B CB    1 
ATOM 4225  C CG1   . VAL B 2 168 ? -90.549  -40.958 -40.930  1.00 68.95  ? 2039 VAL B CG1   1 
ATOM 4226  C CG2   . VAL B 2 168 ? -88.532  -39.600 -41.051  1.00 70.17  ? 2039 VAL B CG2   1 
ATOM 4227  N N     . ASN B 2 169 ? -90.288  -36.457 -42.749  1.00 69.41  ? 2040 ASN B N     1 
ATOM 4228  C CA    . ASN B 2 169 ? -89.677  -35.111 -42.840  1.00 69.32  ? 2040 ASN B CA    1 
ATOM 4229  C C     . ASN B 2 169 ? -88.436  -34.921 -42.004  1.00 69.66  ? 2040 ASN B C     1 
ATOM 4230  O O     . ASN B 2 169 ? -88.411  -34.030 -41.173  1.00 69.57  ? 2040 ASN B O     1 
ATOM 4231  C CB    . ASN B 2 169 ? -90.649  -34.032 -42.418  1.00 68.91  ? 2040 ASN B CB    1 
ATOM 4232  C CG    . ASN B 2 169 ? -90.165  -32.634 -42.780  1.00 68.68  ? 2040 ASN B CG    1 
ATOM 4233  O OD1   . ASN B 2 169 ? -89.496  -32.418 -43.791  1.00 67.18  ? 2040 ASN B OD1   1 
ATOM 4234  N ND2   . ASN B 2 169 ? -90.538  -31.671 -41.961  1.00 70.10  ? 2040 ASN B ND2   1 
ATOM 4235  N N     . ASN B 2 170 ? -87.429  -35.760 -42.226  1.00 70.15  ? 2041 ASN B N     1 
ATOM 4236  C CA    . ASN B 2 170 ? -86.211  -35.763 -41.439  1.00 70.39  ? 2041 ASN B CA    1 
ATOM 4237  C C     . ASN B 2 170 ? -85.116  -34.975 -42.140  1.00 70.32  ? 2041 ASN B C     1 
ATOM 4238  O O     . ASN B 2 170 ? -84.116  -35.548 -42.576  1.00 70.21  ? 2041 ASN B O     1 
ATOM 4239  C CB    . ASN B 2 170 ? -85.774  -37.204 -41.193  1.00 70.51  ? 2041 ASN B CB    1 
ATOM 4240  C CG    . ASN B 2 170 ? -84.513  -37.299 -40.385  1.00 72.02  ? 2041 ASN B CG    1 
ATOM 4241  O OD1   . ASN B 2 170 ? -83.689  -36.383 -40.367  1.00 73.55  ? 2041 ASN B OD1   1 
ATOM 4242  N ND2   . ASN B 2 170 ? -84.342  -38.422 -39.718  1.00 74.94  ? 2041 ASN B ND2   1 
ATOM 4243  N N     . VAL B 2 171 ? -85.298  -33.663 -42.227  1.00 70.45  ? 2042 VAL B N     1 
ATOM 4244  C CA    . VAL B 2 171 ? -84.422  -32.835 -43.038  1.00 71.68  ? 2042 VAL B CA    1 
ATOM 4245  C C     . VAL B 2 171 ? -82.916  -33.152 -42.884  1.00 72.88  ? 2042 VAL B C     1 
ATOM 4246  O O     . VAL B 2 171 ? -82.179  -33.349 -43.885  1.00 72.51  ? 2042 VAL B O     1 
ATOM 4247  C CB    . VAL B 2 171 ? -84.699  -31.353 -42.838  1.00 71.18  ? 2042 VAL B CB    1 
ATOM 4248  C CG1   . VAL B 2 171 ? -83.769  -30.549 -43.668  1.00 71.80  ? 2042 VAL B CG1   1 
ATOM 4249  C CG2   . VAL B 2 171 ? -86.014  -31.066 -43.345  1.00 71.24  ? 2042 VAL B CG2   1 
ATOM 4250  N N     . ASP B 2 172 ? -82.462  -33.208 -41.634  1.00 74.28  ? 2043 ASP B N     1 
ATOM 4251  C CA    . ASP B 2 172 ? -81.039  -33.459 -41.380  1.00 75.50  ? 2043 ASP B CA    1 
ATOM 4252  C C     . ASP B 2 172 ? -80.569  -34.691 -42.137  1.00 74.90  ? 2043 ASP B C     1 
ATOM 4253  O O     . ASP B 2 172 ? -79.733  -34.608 -43.023  1.00 74.78  ? 2043 ASP B O     1 
ATOM 4254  C CB    . ASP B 2 172 ? -80.764  -33.564 -39.871  1.00 76.36  ? 2043 ASP B CB    1 
ATOM 4255  C CG    . ASP B 2 172 ? -80.650  -32.184 -39.193  1.00 78.96  ? 2043 ASP B CG    1 
ATOM 4256  O OD1   . ASP B 2 172 ? -81.102  -31.143 -39.764  1.00 79.96  ? 2043 ASP B OD1   1 
ATOM 4257  O OD2   . ASP B 2 172 ? -80.084  -32.156 -38.071  1.00 82.47  ? 2043 ASP B OD2   1 
ATOM 4258  N N     . ALA B 2 173 ? -81.163  -35.821 -41.804  1.00 74.70  ? 2044 ALA B N     1 
ATOM 4259  C CA    . ALA B 2 173 ? -80.905  -37.051 -42.511  1.00 74.69  ? 2044 ALA B CA    1 
ATOM 4260  C C     . ALA B 2 173 ? -80.775  -36.834 -44.021  1.00 74.40  ? 2044 ALA B C     1 
ATOM 4261  O O     . ALA B 2 173 ? -79.794  -37.253 -44.640  1.00 74.13  ? 2044 ALA B O     1 
ATOM 4262  C CB    . ALA B 2 173 ? -82.016  -38.061 -42.213  1.00 74.86  ? 2044 ALA B CB    1 
ATOM 4263  N N     . ALA B 2 174 ? -81.771  -36.171 -44.597  1.00 73.96  ? 2045 ALA B N     1 
ATOM 4264  C CA    . ALA B 2 174 ? -81.857  -36.046 -46.039  1.00 73.51  ? 2045 ALA B CA    1 
ATOM 4265  C C     . ALA B 2 174 ? -80.640  -35.307 -46.603  1.00 73.08  ? 2045 ALA B C     1 
ATOM 4266  O O     . ALA B 2 174 ? -80.096  -35.675 -47.642  1.00 72.61  ? 2045 ALA B O     1 
ATOM 4267  C CB    . ALA B 2 174 ? -83.165  -35.365 -46.430  1.00 73.42  ? 2045 ALA B CB    1 
ATOM 4268  N N     . VAL B 2 175 ? -80.191  -34.286 -45.889  1.00 72.87  ? 2046 VAL B N     1 
ATOM 4269  C CA    . VAL B 2 175 ? -79.035  -33.529 -46.339  1.00 72.61  ? 2046 VAL B CA    1 
ATOM 4270  C C     . VAL B 2 175 ? -77.771  -34.353 -46.288  1.00 72.55  ? 2046 VAL B C     1 
ATOM 4271  O O     . VAL B 2 175 ? -77.175  -34.581 -47.325  1.00 73.19  ? 2046 VAL B O     1 
ATOM 4272  C CB    . VAL B 2 175 ? -78.844  -32.277 -45.562  1.00 72.44  ? 2046 VAL B CB    1 
ATOM 4273  C CG1   . VAL B 2 175 ? -77.691  -31.563 -46.126  1.00 72.56  ? 2046 VAL B CG1   1 
ATOM 4274  C CG2   . VAL B 2 175 ? -80.089  -31.434 -45.676  1.00 72.77  ? 2046 VAL B CG2   1 
ATOM 4275  N N     . VAL B 2 176 ? -77.372  -34.818 -45.112  1.00 72.02  ? 2047 VAL B N     1 
ATOM 4276  C CA    . VAL B 2 176 ? -76.309  -35.787 -45.031  1.00 72.00  ? 2047 VAL B CA    1 
ATOM 4277  C C     . VAL B 2 176 ? -76.415  -36.840 -46.134  1.00 73.20  ? 2047 VAL B C     1 
ATOM 4278  O O     . VAL B 2 176 ? -75.480  -37.046 -46.889  1.00 73.95  ? 2047 VAL B O     1 
ATOM 4279  C CB    . VAL B 2 176 ? -76.350  -36.505 -43.739  1.00 71.37  ? 2047 VAL B CB    1 
ATOM 4280  C CG1   . VAL B 2 176 ? -75.449  -37.732 -43.800  1.00 70.82  ? 2047 VAL B CG1   1 
ATOM 4281  C CG2   . VAL B 2 176 ? -75.931  -35.586 -42.644  1.00 71.46  ? 2047 VAL B CG2   1 
ATOM 4282  N N     . LEU B 2 177 ? -77.554  -37.504 -46.246  1.00 74.14  ? 2048 LEU B N     1 
ATOM 4283  C CA    . LEU B 2 177 ? -77.731  -38.511 -47.296  1.00 74.75  ? 2048 LEU B CA    1 
ATOM 4284  C C     . LEU B 2 177 ? -77.519  -37.967 -48.697  1.00 75.36  ? 2048 LEU B C     1 
ATOM 4285  O O     . LEU B 2 177 ? -77.072  -38.685 -49.571  1.00 75.32  ? 2048 LEU B O     1 
ATOM 4286  C CB    . LEU B 2 177 ? -79.115  -39.182 -47.228  1.00 74.57  ? 2048 LEU B CB    1 
ATOM 4287  C CG    . LEU B 2 177 ? -79.161  -40.471 -46.430  1.00 73.76  ? 2048 LEU B CG    1 
ATOM 4288  C CD1   . LEU B 2 177 ? -79.944  -40.223 -45.204  1.00 74.66  ? 2048 LEU B CD1   1 
ATOM 4289  C CD2   . LEU B 2 177 ? -79.853  -41.478 -47.218  1.00 73.49  ? 2048 LEU B CD2   1 
ATOM 4290  N N     . LEU B 2 178 ? -77.864  -36.716 -48.941  1.00 76.31  ? 2049 LEU B N     1 
ATOM 4291  C CA    . LEU B 2 178 ? -77.723  -36.250 -50.302  1.00 77.68  ? 2049 LEU B CA    1 
ATOM 4292  C C     . LEU B 2 178 ? -76.258  -36.087 -50.610  1.00 78.78  ? 2049 LEU B C     1 
ATOM 4293  O O     . LEU B 2 178 ? -75.781  -36.583 -51.648  1.00 79.19  ? 2049 LEU B O     1 
ATOM 4294  C CB    . LEU B 2 178 ? -78.515  -34.983 -50.561  1.00 77.55  ? 2049 LEU B CB    1 
ATOM 4295  C CG    . LEU B 2 178 ? -79.960  -35.384 -50.812  1.00 76.92  ? 2049 LEU B CG    1 
ATOM 4296  C CD1   . LEU B 2 178 ? -80.870  -34.270 -50.362  1.00 78.42  ? 2049 LEU B CD1   1 
ATOM 4297  C CD2   . LEU B 2 178 ? -80.173  -35.737 -52.249  1.00 74.57  ? 2049 LEU B CD2   1 
ATOM 4298  N N     . LYS B 2 179 ? -75.549  -35.440 -49.677  1.00 79.71  ? 2050 LYS B N     1 
ATOM 4299  C CA    . LYS B 2 179 ? -74.101  -35.221 -49.780  1.00 80.43  ? 2050 LYS B CA    1 
ATOM 4300  C C     . LYS B 2 179 ? -73.317  -36.511 -49.605  1.00 80.32  ? 2050 LYS B C     1 
ATOM 4301  O O     . LYS B 2 179 ? -72.151  -36.465 -49.273  1.00 80.80  ? 2050 LYS B O     1 
ATOM 4302  C CB    . LYS B 2 179 ? -73.596  -34.229 -48.726  1.00 80.45  ? 2050 LYS B CB    1 
ATOM 4303  C CG    . LYS B 2 179 ? -74.518  -33.065 -48.352  1.00 83.21  ? 2050 LYS B CG    1 
ATOM 4304  C CD    . LYS B 2 179 ? -74.576  -31.948 -49.414  1.00 87.47  ? 2050 LYS B CD    1 
ATOM 4305  C CE    . LYS B 2 179 ? -74.254  -30.545 -48.830  1.00 88.19  ? 2050 LYS B CE    1 
ATOM 4306  N NZ    . LYS B 2 179 ? -74.522  -30.412 -47.371  1.00 87.62  ? 2050 LYS B NZ    1 
ATOM 4307  N N     . ASN B 2 180 ? -73.937  -37.663 -49.794  1.00 80.12  ? 2051 ASN B N     1 
ATOM 4308  C CA    . ASN B 2 180 ? -73.169  -38.882 -49.798  1.00 80.18  ? 2051 ASN B CA    1 
ATOM 4309  C C     . ASN B 2 180 ? -73.688  -39.842 -50.837  1.00 80.31  ? 2051 ASN B C     1 
ATOM 4310  O O     . ASN B 2 180 ? -73.978  -41.007 -50.568  1.00 79.52  ? 2051 ASN B O     1 
ATOM 4311  C CB    . ASN B 2 180 ? -73.050  -39.480 -48.397  1.00 80.42  ? 2051 ASN B CB    1 
ATOM 4312  C CG    . ASN B 2 180 ? -72.089  -38.689 -47.521  1.00 80.99  ? 2051 ASN B CG    1 
ATOM 4313  O OD1   . ASN B 2 180 ? -72.493  -37.759 -46.835  1.00 81.87  ? 2051 ASN B OD1   1 
ATOM 4314  N ND2   . ASN B 2 180 ? -70.802  -39.013 -47.591  1.00 81.92  ? 2051 ASN B ND2   1 
ATOM 4315  N N     . GLY B 2 181 ? -73.778  -39.322 -52.055  1.00 81.04  ? 2052 GLY B N     1 
ATOM 4316  C CA    . GLY B 2 181 ? -74.280  -40.107 -53.172  1.00 82.27  ? 2052 GLY B CA    1 
ATOM 4317  C C     . GLY B 2 181 ? -75.784  -40.017 -53.145  1.00 82.86  ? 2052 GLY B C     1 
ATOM 4318  O O     . GLY B 2 181 ? -76.345  -38.926 -53.423  1.00 83.56  ? 2052 GLY B O     1 
ATOM 4319  N N     . ALA B 2 182 ? -76.430  -41.132 -52.773  1.00 82.47  ? 2053 ALA B N     1 
ATOM 4320  C CA    . ALA B 2 182 ? -77.884  -41.163 -52.571  1.00 82.22  ? 2053 ALA B CA    1 
ATOM 4321  C C     . ALA B 2 182 ? -78.620  -40.768 -53.821  1.00 81.96  ? 2053 ALA B C     1 
ATOM 4322  O O     . ALA B 2 182 ? -78.654  -39.601 -54.228  1.00 81.82  ? 2053 ALA B O     1 
ATOM 4323  C CB    . ALA B 2 182 ? -78.317  -40.265 -51.394  1.00 81.99  ? 2053 ALA B CB    1 
ATOM 4324  N N     . ASN B 2 183 ? -79.215  -41.745 -54.451  1.00 81.96  ? 2054 ASN B N     1 
ATOM 4325  C CA    . ASN B 2 183 ? -79.975  -41.414 -55.599  1.00 82.66  ? 2054 ASN B CA    1 
ATOM 4326  C C     . ASN B 2 183 ? -81.151  -40.560 -55.136  1.00 82.55  ? 2054 ASN B C     1 
ATOM 4327  O O     . ASN B 2 183 ? -82.015  -41.035 -54.380  1.00 82.72  ? 2054 ASN B O     1 
ATOM 4328  C CB    . ASN B 2 183 ? -80.426  -42.687 -56.268  1.00 83.16  ? 2054 ASN B CB    1 
ATOM 4329  C CG    . ASN B 2 183 ? -81.164  -42.432 -57.528  1.00 84.68  ? 2054 ASN B CG    1 
ATOM 4330  O OD1   . ASN B 2 183 ? -81.542  -41.286 -57.835  1.00 84.95  ? 2054 ASN B OD1   1 
ATOM 4331  N ND2   . ASN B 2 183 ? -81.394  -43.508 -58.286  1.00 86.60  ? 2054 ASN B ND2   1 
ATOM 4332  N N     . LYS B 2 184 ? -81.159  -39.289 -55.543  1.00 81.96  ? 2055 LYS B N     1 
ATOM 4333  C CA    . LYS B 2 184 ? -82.220  -38.383 -55.113  1.00 80.97  ? 2055 LYS B CA    1 
ATOM 4334  C C     . LYS B 2 184 ? -83.486  -38.631 -55.896  1.00 80.90  ? 2055 LYS B C     1 
ATOM 4335  O O     . LYS B 2 184 ? -84.551  -38.108 -55.547  1.00 81.38  ? 2055 LYS B O     1 
ATOM 4336  C CB    . LYS B 2 184 ? -81.814  -36.927 -55.254  1.00 80.61  ? 2055 LYS B CB    1 
ATOM 4337  C CG    . LYS B 2 184 ? -81.843  -36.402 -56.649  1.00 80.64  ? 2055 LYS B CG    1 
ATOM 4338  C CD    . LYS B 2 184 ? -81.409  -34.941 -56.674  1.00 82.39  ? 2055 LYS B CD    1 
ATOM 4339  C CE    . LYS B 2 184 ? -80.755  -34.539 -58.008  1.00 82.90  ? 2055 LYS B CE    1 
ATOM 4340  N NZ    . LYS B 2 184 ? -79.509  -35.298 -58.286  1.00 84.37  ? 2055 LYS B NZ    1 
ATOM 4341  N N     . ASP B 2 185 ? -83.386  -39.416 -56.965  1.00 80.34  ? 2056 ASP B N     1 
ATOM 4342  C CA    . ASP B 2 185 ? -84.558  -39.643 -57.793  1.00 79.86  ? 2056 ASP B CA    1 
ATOM 4343  C C     . ASP B 2 185 ? -84.911  -41.077 -57.916  1.00 79.53  ? 2056 ASP B C     1 
ATOM 4344  O O     . ASP B 2 185 ? -85.692  -41.453 -58.792  1.00 80.00  ? 2056 ASP B O     1 
ATOM 4345  C CB    . ASP B 2 185 ? -84.432  -39.005 -59.151  1.00 79.48  ? 2056 ASP B CB    1 
ATOM 4346  C CG    . ASP B 2 185 ? -84.557  -37.526 -59.078  1.00 80.84  ? 2056 ASP B CG    1 
ATOM 4347  O OD1   . ASP B 2 185 ? -85.531  -37.013 -58.448  1.00 80.19  ? 2056 ASP B OD1   1 
ATOM 4348  O OD2   . ASP B 2 185 ? -83.648  -36.872 -59.642  1.00 82.84  ? 2056 ASP B OD2   1 
ATOM 4349  N N     . MET B 2 186 ? -84.361  -41.865 -57.001  1.00 78.71  ? 2057 MET B N     1 
ATOM 4350  C CA    . MET B 2 186 ? -84.674  -43.268 -56.908  1.00 78.30  ? 2057 MET B CA    1 
ATOM 4351  C C     . MET B 2 186 ? -86.159  -43.480 -56.887  1.00 78.99  ? 2057 MET B C     1 
ATOM 4352  O O     . MET B 2 186 ? -86.904  -42.593 -56.474  1.00 79.32  ? 2057 MET B O     1 
ATOM 4353  C CB    . MET B 2 186 ? -84.078  -43.803 -55.642  1.00 77.40  ? 2057 MET B CB    1 
ATOM 4354  C CG    . MET B 2 186 ? -84.635  -45.090 -55.242  1.00 76.30  ? 2057 MET B CG    1 
ATOM 4355  S SD    . MET B 2 186 ? -83.420  -46.029 -54.337  1.00 77.99  ? 2057 MET B SD    1 
ATOM 4356  C CE    . MET B 2 186 ? -82.107  -44.850 -54.026  1.00 77.08  ? 2057 MET B CE    1 
ATOM 4357  N N     . GLN B 2 187 ? -86.606  -44.636 -57.355  1.00 79.75  ? 2058 GLN B N     1 
ATOM 4358  C CA    . GLN B 2 187 ? -88.017  -45.010 -57.171  1.00 80.95  ? 2058 GLN B CA    1 
ATOM 4359  C C     . GLN B 2 187 ? -88.176  -46.264 -56.312  1.00 81.16  ? 2058 GLN B C     1 
ATOM 4360  O O     . GLN B 2 187 ? -87.203  -46.948 -56.011  1.00 81.05  ? 2058 GLN B O     1 
ATOM 4361  C CB    . GLN B 2 187 ? -88.766  -45.095 -58.505  1.00 80.83  ? 2058 GLN B CB    1 
ATOM 4362  C CG    . GLN B 2 187 ? -88.660  -43.795 -59.289  1.00 82.74  ? 2058 GLN B CG    1 
ATOM 4363  C CD    . GLN B 2 187 ? -89.329  -43.837 -60.651  1.00 85.93  ? 2058 GLN B CD    1 
ATOM 4364  O OE1   . GLN B 2 187 ? -88.661  -43.857 -61.697  1.00 87.67  ? 2058 GLN B OE1   1 
ATOM 4365  N NE2   . GLN B 2 187 ? -90.649  -43.825 -60.651  1.00 86.73  ? 2058 GLN B NE2   1 
ATOM 4366  N N     . ASN B 2 188 ? -89.390  -46.531 -55.872  1.00 81.91  ? 2059 ASN B N     1 
ATOM 4367  C CA    . ASN B 2 188 ? -89.649  -47.723 -55.070  1.00 83.11  ? 2059 ASN B CA    1 
ATOM 4368  C C     . ASN B 2 188 ? -90.666  -48.515 -55.803  1.00 83.44  ? 2059 ASN B C     1 
ATOM 4369  O O     . ASN B 2 188 ? -91.238  -47.989 -56.764  1.00 83.53  ? 2059 ASN B O     1 
ATOM 4370  C CB    . ASN B 2 188 ? -90.200  -47.361 -53.683  1.00 83.63  ? 2059 ASN B CB    1 
ATOM 4371  C CG    . ASN B 2 188 ? -91.364  -46.348 -53.727  1.00 84.28  ? 2059 ASN B CG    1 
ATOM 4372  O OD1   . ASN B 2 188 ? -91.396  -45.417 -54.544  1.00 82.19  ? 2059 ASN B OD1   1 
ATOM 4373  N ND2   . ASN B 2 188 ? -92.312  -46.535 -52.824  1.00 84.30  ? 2059 ASN B ND2   1 
ATOM 4374  N N     . ASN B 2 189 ? -90.942  -49.741 -55.374  1.00 83.50  ? 2060 ASN B N     1 
ATOM 4375  C CA    . ASN B 2 189 ? -91.921  -50.482 -56.132  1.00 84.36  ? 2060 ASN B CA    1 
ATOM 4376  C C     . ASN B 2 189 ? -93.303  -49.916 -55.983  1.00 84.89  ? 2060 ASN B C     1 
ATOM 4377  O O     . ASN B 2 189 ? -94.237  -50.637 -55.695  1.00 85.52  ? 2060 ASN B O     1 
ATOM 4378  C CB    . ASN B 2 189 ? -91.876  -52.000 -55.954  1.00 84.47  ? 2060 ASN B CB    1 
ATOM 4379  C CG    . ASN B 2 189 ? -91.223  -52.423 -54.679  1.00 86.61  ? 2060 ASN B CG    1 
ATOM 4380  O OD1   . ASN B 2 189 ? -90.067  -52.082 -54.430  1.00 90.74  ? 2060 ASN B OD1   1 
ATOM 4381  N ND2   . ASN B 2 189 ? -91.940  -53.205 -53.864  1.00 86.47  ? 2060 ASN B ND2   1 
ATOM 4382  N N     . ARG B 2 190 ? -93.408  -48.606 -56.161  1.00 85.76  ? 2061 ARG B N     1 
ATOM 4383  C CA    . ARG B 2 190 ? -94.641  -47.943 -56.537  1.00 87.09  ? 2061 ARG B CA    1 
ATOM 4384  C C     . ARG B 2 190 ? -94.240  -46.746 -57.360  1.00 87.73  ? 2061 ARG B C     1 
ATOM 4385  O O     . ARG B 2 190 ? -95.052  -45.860 -57.599  1.00 88.12  ? 2061 ARG B O     1 
ATOM 4386  C CB    . ARG B 2 190 ? -95.496  -47.524 -55.342  1.00 87.31  ? 2061 ARG B CB    1 
ATOM 4387  C CG    . ARG B 2 190 ? -96.236  -48.689 -54.646  1.00 90.67  ? 2061 ARG B CG    1 
ATOM 4388  C CD    . ARG B 2 190 ? -97.183  -48.254 -53.505  1.00 94.90  ? 2061 ARG B CD    1 
ATOM 4389  N NE    . ARG B 2 190 ? -97.393  -49.312 -52.493  1.00 97.26  ? 2061 ARG B NE    1 
ATOM 4390  C CZ    . ARG B 2 190 ? -98.562  -49.557 -51.884  1.00 97.60  ? 2061 ARG B CZ    1 
ATOM 4391  N NH1   . ARG B 2 190 ? -98.670  -50.515 -50.972  1.00 95.99  ? 2061 ARG B NH1   1 
ATOM 4392  N NH2   . ARG B 2 190 ? -99.641  -48.846 -52.196  1.00 98.75  ? 2061 ARG B NH2   1 
ATOM 4393  N N     . GLU B 2 191 ? -92.989  -46.742 -57.827  1.00 88.62  ? 2062 GLU B N     1 
ATOM 4394  C CA    . GLU B 2 191 ? -92.442  -45.665 -58.675  1.00 89.33  ? 2062 GLU B CA    1 
ATOM 4395  C C     . GLU B 2 191 ? -92.502  -44.319 -57.952  1.00 88.87  ? 2062 GLU B C     1 
ATOM 4396  O O     . GLU B 2 191 ? -92.805  -43.277 -58.537  1.00 89.11  ? 2062 GLU B O     1 
ATOM 4397  C CB    . GLU B 2 191 ? -93.154  -45.601 -60.039  1.00 89.62  ? 2062 GLU B CB    1 
ATOM 4398  C CG    . GLU B 2 191 ? -92.375  -46.211 -61.206  1.00 93.17  ? 2062 GLU B CG    1 
ATOM 4399  C CD    . GLU B 2 191 ? -93.279  -46.821 -62.273  1.00 97.79  ? 2062 GLU B CD    1 
ATOM 4400  O OE1   . GLU B 2 191 ? -93.466  -46.198 -63.366  1.00 97.70  ? 2062 GLU B OE1   1 
ATOM 4401  O OE2   . GLU B 2 191 ? -93.804  -47.934 -61.994  1.00 100.56 ? 2062 GLU B OE2   1 
ATOM 4402  N N     . GLU B 2 192 ? -92.218  -44.343 -56.658  1.00 88.06  ? 2063 GLU B N     1 
ATOM 4403  C CA    . GLU B 2 192 ? -92.310  -43.133 -55.862  1.00 86.74  ? 2063 GLU B CA    1 
ATOM 4404  C C     . GLU B 2 192 ? -90.915  -42.512 -55.603  1.00 85.97  ? 2063 GLU B C     1 
ATOM 4405  O O     . GLU B 2 192 ? -90.073  -43.074 -54.866  1.00 85.49  ? 2063 GLU B O     1 
ATOM 4406  C CB    . GLU B 2 192 ? -93.019  -43.447 -54.546  1.00 86.66  ? 2063 GLU B CB    1 
ATOM 4407  C CG    . GLU B 2 192 ? -94.491  -43.770 -54.619  1.00 86.29  ? 2063 GLU B CG    1 
ATOM 4408  C CD    . GLU B 2 192 ? -94.961  -44.508 -53.370  1.00 86.39  ? 2063 GLU B CD    1 
ATOM 4409  O OE1   . GLU B 2 192 ? -94.136  -45.261 -52.839  1.00 84.64  ? 2063 GLU B OE1   1 
ATOM 4410  O OE2   . GLU B 2 192 ? -96.135  -44.356 -52.923  1.00 87.16  ? 2063 GLU B OE2   1 
ATOM 4411  N N     . THR B 2 193 ? -90.681  -41.365 -56.238  1.00 84.65  ? 2064 THR B N     1 
ATOM 4412  C CA    . THR B 2 193 ? -89.538  -40.519 -55.933  1.00 83.56  ? 2064 THR B CA    1 
ATOM 4413  C C     . THR B 2 193 ? -89.594  -40.118 -54.428  1.00 82.84  ? 2064 THR B C     1 
ATOM 4414  O O     . THR B 2 193 ? -90.666  -39.999 -53.849  1.00 81.87  ? 2064 THR B O     1 
ATOM 4415  C CB    . THR B 2 193 ? -89.479  -39.290 -56.918  1.00 83.54  ? 2064 THR B CB    1 
ATOM 4416  O OG1   . THR B 2 193 ? -88.471  -38.369 -56.520  1.00 85.48  ? 2064 THR B OG1   1 
ATOM 4417  C CG2   . THR B 2 193 ? -90.768  -38.518 -56.981  1.00 82.97  ? 2064 THR B CG2   1 
ATOM 4418  N N     . PRO B 2 194 ? -88.434  -39.937 -53.762  1.00 82.39  ? 2065 PRO B N     1 
ATOM 4419  C CA    . PRO B 2 194 ? -88.636  -39.554 -52.378  1.00 81.45  ? 2065 PRO B CA    1 
ATOM 4420  C C     . PRO B 2 194 ? -89.263  -38.171 -52.302  1.00 80.52  ? 2065 PRO B C     1 
ATOM 4421  O O     . PRO B 2 194 ? -90.030  -37.923 -51.396  1.00 80.90  ? 2065 PRO B O     1 
ATOM 4422  C CB    . PRO B 2 194 ? -87.217  -39.547 -51.795  1.00 81.41  ? 2065 PRO B CB    1 
ATOM 4423  C CG    . PRO B 2 194 ? -86.372  -40.157 -52.805  1.00 81.47  ? 2065 PRO B CG    1 
ATOM 4424  C CD    . PRO B 2 194 ? -87.008  -39.872 -54.115  1.00 82.23  ? 2065 PRO B CD    1 
ATOM 4425  N N     . LEU B 2 195 ? -88.970  -37.282 -53.247  1.00 79.15  ? 2066 LEU B N     1 
ATOM 4426  C CA    . LEU B 2 195 ? -89.741  -36.051 -53.345  1.00 77.88  ? 2066 LEU B CA    1 
ATOM 4427  C C     . LEU B 2 195 ? -91.231  -36.349 -53.229  1.00 77.95  ? 2066 LEU B C     1 
ATOM 4428  O O     . LEU B 2 195 ? -91.974  -35.584 -52.641  1.00 77.78  ? 2066 LEU B O     1 
ATOM 4429  C CB    . LEU B 2 195 ? -89.484  -35.317 -54.655  1.00 77.49  ? 2066 LEU B CB    1 
ATOM 4430  C CG    . LEU B 2 195 ? -90.244  -34.002 -54.695  1.00 75.82  ? 2066 LEU B CG    1 
ATOM 4431  C CD1   . LEU B 2 195 ? -89.690  -33.205 -53.568  1.00 77.59  ? 2066 LEU B CD1   1 
ATOM 4432  C CD2   . LEU B 2 195 ? -90.117  -33.242 -55.970  1.00 73.01  ? 2066 LEU B CD2   1 
ATOM 4433  N N     . PHE B 2 196 ? -91.672  -37.470 -53.780  1.00 78.28  ? 2067 PHE B N     1 
ATOM 4434  C CA    . PHE B 2 196 ? -93.099  -37.845 -53.717  1.00 78.43  ? 2067 PHE B CA    1 
ATOM 4435  C C     . PHE B 2 196 ? -93.564  -38.053 -52.281  1.00 78.14  ? 2067 PHE B C     1 
ATOM 4436  O O     . PHE B 2 196 ? -94.312  -37.233 -51.787  1.00 77.70  ? 2067 PHE B O     1 
ATOM 4437  C CB    . PHE B 2 196 ? -93.342  -39.120 -54.518  1.00 78.99  ? 2067 PHE B CB    1 
ATOM 4438  C CG    . PHE B 2 196 ? -94.773  -39.432 -54.766  1.00 78.26  ? 2067 PHE B CG    1 
ATOM 4439  C CD1   . PHE B 2 196 ? -95.503  -38.689 -55.704  1.00 77.89  ? 2067 PHE B CD1   1 
ATOM 4440  C CD2   . PHE B 2 196 ? -95.375  -40.509 -54.121  1.00 76.26  ? 2067 PHE B CD2   1 
ATOM 4441  C CE1   . PHE B 2 196 ? -96.837  -39.004 -55.968  1.00 78.19  ? 2067 PHE B CE1   1 
ATOM 4442  C CE2   . PHE B 2 196 ? -96.689  -40.837 -54.371  1.00 76.17  ? 2067 PHE B CE2   1 
ATOM 4443  C CZ    . PHE B 2 196 ? -97.431  -40.083 -55.283  1.00 78.07  ? 2067 PHE B CZ    1 
ATOM 4444  N N     . LEU B 2 197 ? -93.114  -39.135 -51.625  1.00 77.80  ? 2068 LEU B N     1 
ATOM 4445  C CA    . LEU B 2 197 ? -93.420  -39.390 -50.220  1.00 77.48  ? 2068 LEU B CA    1 
ATOM 4446  C C     . LEU B 2 197 ? -93.418  -38.117 -49.406  1.00 77.54  ? 2068 LEU B C     1 
ATOM 4447  O O     . LEU B 2 197 ? -94.346  -37.897 -48.654  1.00 78.01  ? 2068 LEU B O     1 
ATOM 4448  C CB    . LEU B 2 197 ? -92.472  -40.414 -49.584  1.00 77.43  ? 2068 LEU B CB    1 
ATOM 4449  C CG    . LEU B 2 197 ? -92.701  -41.864 -49.963  1.00 76.32  ? 2068 LEU B CG    1 
ATOM 4450  C CD1   . LEU B 2 197 ? -92.221  -41.896 -51.329  1.00 77.95  ? 2068 LEU B CD1   1 
ATOM 4451  C CD2   . LEU B 2 197 ? -91.923  -42.859 -49.130  1.00 73.72  ? 2068 LEU B CD2   1 
ATOM 4452  N N     . ALA B 2 198 ? -92.405  -37.276 -49.546  1.00 77.22  ? 2069 ALA B N     1 
ATOM 4453  C CA    . ALA B 2 198 ? -92.477  -35.975 -48.931  1.00 77.74  ? 2069 ALA B CA    1 
ATOM 4454  C C     . ALA B 2 198 ? -93.828  -35.345 -49.262  1.00 78.58  ? 2069 ALA B C     1 
ATOM 4455  O O     . ALA B 2 198 ? -94.712  -35.285 -48.408  1.00 78.48  ? 2069 ALA B O     1 
ATOM 4456  C CB    . ALA B 2 198 ? -91.379  -35.114 -49.410  1.00 77.61  ? 2069 ALA B CB    1 
ATOM 4457  N N     . ALA B 2 199 ? -94.014  -34.914 -50.510  1.00 79.60  ? 2070 ALA B N     1 
ATOM 4458  C CA    . ALA B 2 199 ? -95.299  -34.327 -50.973  1.00 80.33  ? 2070 ALA B CA    1 
ATOM 4459  C C     . ALA B 2 199 ? -96.601  -35.049 -50.558  1.00 80.68  ? 2070 ALA B C     1 
ATOM 4460  O O     . ALA B 2 199 ? -97.631  -34.415 -50.449  1.00 80.87  ? 2070 ALA B O     1 
ATOM 4461  C CB    . ALA B 2 199 ? -95.271  -34.133 -52.485  1.00 80.37  ? 2070 ALA B CB    1 
ATOM 4462  N N     . ARG B 2 200 ? -96.566  -36.363 -50.368  1.00 81.12  ? 2071 ARG B N     1 
ATOM 4463  C CA    . ARG B 2 200 ? -97.723  -37.071 -49.858  1.00 81.62  ? 2071 ARG B CA    1 
ATOM 4464  C C     . ARG B 2 200 ? -97.893  -36.632 -48.417  1.00 81.75  ? 2071 ARG B C     1 
ATOM 4465  O O     . ARG B 2 200 ? -98.829  -35.886 -48.106  1.00 81.96  ? 2071 ARG B O     1 
ATOM 4466  C CB    . ARG B 2 200 ? -97.577  -38.602 -49.954  1.00 81.83  ? 2071 ARG B CB    1 
ATOM 4467  C CG    . ARG B 2 200 ? -98.689  -39.366 -49.217  1.00 83.59  ? 2071 ARG B CG    1 
ATOM 4468  C CD    . ARG B 2 200 ? -98.974  -40.778 -49.775  1.00 87.93  ? 2071 ARG B CD    1 
ATOM 4469  N NE    . ARG B 2 200 ? -97.946  -41.764 -49.432  1.00 91.37  ? 2071 ARG B NE    1 
ATOM 4470  C CZ    . ARG B 2 200 ? -97.561  -42.056 -48.183  1.00 94.46  ? 2071 ARG B CZ    1 
ATOM 4471  N NH1   . ARG B 2 200 ? -98.111  -41.440 -47.129  1.00 96.50  ? 2071 ARG B NH1   1 
ATOM 4472  N NH2   . ARG B 2 200 ? -96.617  -42.965 -47.978  1.00 94.67  ? 2071 ARG B NH2   1 
ATOM 4473  N N     . GLU B 2 201 ? -96.970  -37.094 -47.557  1.00 81.46  ? 2072 GLU B N     1 
ATOM 4474  C CA    . GLU B 2 201 ? -96.935  -36.811 -46.106  1.00 80.45  ? 2072 GLU B CA    1 
ATOM 4475  C C     . GLU B 2 201 ? -96.986  -35.303 -45.887  1.00 79.93  ? 2072 GLU B C     1 
ATOM 4476  O O     . GLU B 2 201 ? -97.293  -34.810 -44.784  1.00 80.20  ? 2072 GLU B O     1 
ATOM 4477  C CB    . GLU B 2 201 ? -95.647  -37.352 -45.501  1.00 80.02  ? 2072 GLU B CB    1 
ATOM 4478  C CG    . GLU B 2 201 ? -95.562  -38.824 -45.514  1.00 81.87  ? 2072 GLU B CG    1 
ATOM 4479  C CD    . GLU B 2 201 ? -96.367  -39.382 -44.394  1.00 85.58  ? 2072 GLU B CD    1 
ATOM 4480  O OE1   . GLU B 2 201 ? -96.518  -40.642 -44.280  1.00 86.78  ? 2072 GLU B OE1   1 
ATOM 4481  O OE2   . GLU B 2 201 ? -96.848  -38.519 -43.619  1.00 86.15  ? 2072 GLU B OE2   1 
ATOM 4482  N N     . GLY B 2 202 ? -96.667  -34.573 -46.953  1.00 78.75  ? 2073 GLY B N     1 
ATOM 4483  C CA    . GLY B 2 202 ? -96.638  -33.131 -46.906  1.00 77.17  ? 2073 GLY B CA    1 
ATOM 4484  C C     . GLY B 2 202 ? -95.523  -32.548 -46.075  1.00 75.72  ? 2073 GLY B C     1 
ATOM 4485  O O     . GLY B 2 202 ? -95.567  -31.373 -45.730  1.00 76.38  ? 2073 GLY B O     1 
ATOM 4486  N N     . SER B 2 203 ? -94.524  -33.360 -45.769  1.00 73.87  ? 2074 SER B N     1 
ATOM 4487  C CA    . SER B 2 203 ? -93.371  -32.904 -45.061  1.00 72.49  ? 2074 SER B CA    1 
ATOM 4488  C C     . SER B 2 203 ? -92.551  -31.957 -45.953  1.00 71.95  ? 2074 SER B C     1 
ATOM 4489  O O     . SER B 2 203 ? -91.779  -32.385 -46.798  1.00 71.33  ? 2074 SER B O     1 
ATOM 4490  C CB    . SER B 2 203 ? -92.590  -34.112 -44.610  1.00 72.35  ? 2074 SER B CB    1 
ATOM 4491  O OG    . SER B 2 203 ? -92.024  -34.770 -45.710  1.00 72.65  ? 2074 SER B OG    1 
ATOM 4492  N N     . TYR B 2 204 ? -92.743  -30.659 -45.717  1.00 71.77  ? 2075 TYR B N     1 
ATOM 4493  C CA    . TYR B 2 204 ? -92.390  -29.562 -46.619  1.00 71.50  ? 2075 TYR B CA    1 
ATOM 4494  C C     . TYR B 2 204 ? -90.939  -29.232 -46.606  1.00 72.50  ? 2075 TYR B C     1 
ATOM 4495  O O     . TYR B 2 204 ? -90.400  -28.825 -47.638  1.00 72.74  ? 2075 TYR B O     1 
ATOM 4496  C CB    . TYR B 2 204 ? -93.132  -28.310 -46.172  1.00 70.95  ? 2075 TYR B CB    1 
ATOM 4497  C CG    . TYR B 2 204 ? -92.746  -26.992 -46.821  1.00 69.16  ? 2075 TYR B CG    1 
ATOM 4498  C CD1   . TYR B 2 204 ? -93.541  -26.412 -47.806  1.00 69.00  ? 2075 TYR B CD1   1 
ATOM 4499  C CD2   . TYR B 2 204 ? -91.648  -26.288 -46.406  1.00 67.94  ? 2075 TYR B CD2   1 
ATOM 4500  C CE1   . TYR B 2 204 ? -93.212  -25.177 -48.390  1.00 66.66  ? 2075 TYR B CE1   1 
ATOM 4501  C CE2   . TYR B 2 204 ? -91.322  -25.061 -46.984  1.00 67.52  ? 2075 TYR B CE2   1 
ATOM 4502  C CZ    . TYR B 2 204 ? -92.103  -24.518 -47.967  1.00 65.84  ? 2075 TYR B CZ    1 
ATOM 4503  O OH    . TYR B 2 204 ? -91.767  -23.313 -48.507  1.00 64.97  ? 2075 TYR B OH    1 
ATOM 4504  N N     . GLU B 2 205 ? -90.320  -29.355 -45.428  1.00 73.41  ? 2076 GLU B N     1 
ATOM 4505  C CA    . GLU B 2 205 ? -88.941  -28.902 -45.229  1.00 74.13  ? 2076 GLU B CA    1 
ATOM 4506  C C     . GLU B 2 205 ? -87.980  -29.821 -45.950  1.00 74.16  ? 2076 GLU B C     1 
ATOM 4507  O O     . GLU B 2 205 ? -87.139  -29.346 -46.724  1.00 74.91  ? 2076 GLU B O     1 
ATOM 4508  C CB    . GLU B 2 205 ? -88.584  -28.805 -43.755  1.00 74.13  ? 2076 GLU B CB    1 
ATOM 4509  C CG    . GLU B 2 205 ? -89.204  -27.621 -43.045  1.00 77.11  ? 2076 GLU B CG    1 
ATOM 4510  C CD    . GLU B 2 205 ? -90.673  -27.874 -42.668  1.00 80.97  ? 2076 GLU B CD    1 
ATOM 4511  O OE1   . GLU B 2 205 ? -91.433  -26.903 -42.341  1.00 80.19  ? 2076 GLU B OE1   1 
ATOM 4512  O OE2   . GLU B 2 205 ? -91.067  -29.072 -42.725  1.00 82.41  ? 2076 GLU B OE2   1 
ATOM 4513  N N     . THR B 2 206 ? -88.115  -31.128 -45.724  1.00 73.41  ? 2077 THR B N     1 
ATOM 4514  C CA    . THR B 2 206 ? -87.324  -32.095 -46.462  1.00 72.69  ? 2077 THR B CA    1 
ATOM 4515  C C     . THR B 2 206 ? -87.586  -31.886 -47.930  1.00 72.02  ? 2077 THR B C     1 
ATOM 4516  O O     . THR B 2 206 ? -86.687  -31.988 -48.714  1.00 71.58  ? 2077 THR B O     1 
ATOM 4517  C CB    . THR B 2 206 ? -87.653  -33.555 -46.072  1.00 73.15  ? 2077 THR B CB    1 
ATOM 4518  O OG1   . THR B 2 206 ? -87.176  -33.838 -44.741  1.00 72.96  ? 2077 THR B OG1   1 
ATOM 4519  C CG2   . THR B 2 206 ? -87.037  -34.537 -47.077  1.00 72.93  ? 2077 THR B CG2   1 
ATOM 4520  N N     . ALA B 2 207 ? -88.816  -31.552 -48.284  1.00 71.89  ? 2078 ALA B N     1 
ATOM 4521  C CA    . ALA B 2 207 ? -89.171  -31.330 -49.667  1.00 72.46  ? 2078 ALA B CA    1 
ATOM 4522  C C     . ALA B 2 207 ? -88.375  -30.209 -50.318  1.00 72.89  ? 2078 ALA B C     1 
ATOM 4523  O O     . ALA B 2 207 ? -87.796  -30.389 -51.391  1.00 73.35  ? 2078 ALA B O     1 
ATOM 4524  C CB    . ALA B 2 207 ? -90.618  -31.070 -49.795  1.00 72.47  ? 2078 ALA B CB    1 
ATOM 4525  N N     . LYS B 2 208 ? -88.340  -29.052 -49.674  1.00 73.17  ? 2079 LYS B N     1 
ATOM 4526  C CA    . LYS B 2 208 ? -87.518  -27.926 -50.140  1.00 73.67  ? 2079 LYS B CA    1 
ATOM 4527  C C     . LYS B 2 208 ? -86.079  -28.371 -50.388  1.00 73.59  ? 2079 LYS B C     1 
ATOM 4528  O O     . LYS B 2 208 ? -85.419  -27.886 -51.286  1.00 73.27  ? 2079 LYS B O     1 
ATOM 4529  C CB    . LYS B 2 208 ? -87.541  -26.789 -49.100  1.00 74.06  ? 2079 LYS B CB    1 
ATOM 4530  C CG    . LYS B 2 208 ? -87.057  -25.425 -49.566  1.00 74.45  ? 2079 LYS B CG    1 
ATOM 4531  C CD    . LYS B 2 208 ? -86.563  -24.686 -48.357  1.00 78.87  ? 2079 LYS B CD    1 
ATOM 4532  C CE    . LYS B 2 208 ? -87.068  -23.248 -48.283  1.00 83.07  ? 2079 LYS B CE    1 
ATOM 4533  N NZ    . LYS B 2 208 ? -86.091  -22.205 -48.801  1.00 85.43  ? 2079 LYS B NZ    1 
ATOM 4534  N N     . VAL B 2 209 ? -85.601  -29.297 -49.575  1.00 73.84  ? 2080 VAL B N     1 
ATOM 4535  C CA    . VAL B 2 209 ? -84.237  -29.744 -49.679  1.00 74.32  ? 2080 VAL B CA    1 
ATOM 4536  C C     . VAL B 2 209 ? -83.985  -30.576 -50.938  1.00 74.80  ? 2080 VAL B C     1 
ATOM 4537  O O     . VAL B 2 209 ? -82.928  -30.411 -51.566  1.00 75.46  ? 2080 VAL B O     1 
ATOM 4538  C CB    . VAL B 2 209 ? -83.796  -30.494 -48.415  1.00 74.43  ? 2080 VAL B CB    1 
ATOM 4539  C CG1   . VAL B 2 209 ? -82.740  -31.579 -48.730  1.00 74.42  ? 2080 VAL B CG1   1 
ATOM 4540  C CG2   . VAL B 2 209 ? -83.288  -29.515 -47.403  1.00 73.96  ? 2080 VAL B CG2   1 
ATOM 4541  N N     . LEU B 2 210 ? -84.910  -31.455 -51.331  1.00 74.51  ? 2081 LEU B N     1 
ATOM 4542  C CA    . LEU B 2 210 ? -84.674  -32.172 -52.567  1.00 74.39  ? 2081 LEU B CA    1 
ATOM 4543  C C     . LEU B 2 210 ? -84.927  -31.229 -53.727  1.00 75.06  ? 2081 LEU B C     1 
ATOM 4544  O O     . LEU B 2 210 ? -84.117  -31.134 -54.629  1.00 75.42  ? 2081 LEU B O     1 
ATOM 4545  C CB    . LEU B 2 210 ? -85.439  -33.468 -52.673  1.00 73.66  ? 2081 LEU B CB    1 
ATOM 4546  C CG    . LEU B 2 210 ? -85.467  -34.260 -51.379  1.00 74.15  ? 2081 LEU B CG    1 
ATOM 4547  C CD1   . LEU B 2 210 ? -86.815  -33.941 -50.810  1.00 76.53  ? 2081 LEU B CD1   1 
ATOM 4548  C CD2   . LEU B 2 210 ? -85.309  -35.797 -51.476  1.00 71.88  ? 2081 LEU B CD2   1 
ATOM 4549  N N     . LEU B 2 211 ? -85.997  -30.464 -53.698  1.00 75.82  ? 2082 LEU B N     1 
ATOM 4550  C CA    . LEU B 2 211 ? -86.117  -29.421 -54.707  1.00 76.99  ? 2082 LEU B CA    1 
ATOM 4551  C C     . LEU B 2 211 ? -84.817  -28.620 -54.785  1.00 78.00  ? 2082 LEU B C     1 
ATOM 4552  O O     . LEU B 2 211 ? -84.521  -27.959 -55.780  1.00 77.54  ? 2082 LEU B O     1 
ATOM 4553  C CB    . LEU B 2 211 ? -87.283  -28.483 -54.376  1.00 77.00  ? 2082 LEU B CB    1 
ATOM 4554  C CG    . LEU B 2 211 ? -88.646  -28.716 -55.022  1.00 76.41  ? 2082 LEU B CG    1 
ATOM 4555  C CD1   . LEU B 2 211 ? -88.510  -28.672 -56.500  1.00 76.81  ? 2082 LEU B CD1   1 
ATOM 4556  C CD2   . LEU B 2 211 ? -89.205  -30.036 -54.607  1.00 75.55  ? 2082 LEU B CD2   1 
ATOM 4557  N N     . ASP B 2 212 ? -84.047  -28.705 -53.710  1.00 79.89  ? 2083 ASP B N     1 
ATOM 4558  C CA    . ASP B 2 212 ? -82.845  -27.921 -53.556  1.00 81.87  ? 2083 ASP B CA    1 
ATOM 4559  C C     . ASP B 2 212 ? -81.671  -28.515 -54.247  1.00 82.59  ? 2083 ASP B C     1 
ATOM 4560  O O     . ASP B 2 212 ? -80.852  -27.780 -54.791  1.00 83.18  ? 2083 ASP B O     1 
ATOM 4561  C CB    . ASP B 2 212 ? -82.494  -27.749 -52.098  1.00 82.17  ? 2083 ASP B CB    1 
ATOM 4562  C CG    . ASP B 2 212 ? -82.881  -26.423 -51.593  1.00 84.21  ? 2083 ASP B CG    1 
ATOM 4563  O OD1   . ASP B 2 212 ? -83.141  -25.523 -52.455  1.00 85.45  ? 2083 ASP B OD1   1 
ATOM 4564  O OD2   . ASP B 2 212 ? -82.920  -26.298 -50.347  1.00 86.51  ? 2083 ASP B OD2   1 
ATOM 4565  N N     . HIS B 2 213 ? -81.567  -29.834 -54.205  1.00 83.21  ? 2084 HIS B N     1 
ATOM 4566  C CA    . HIS B 2 213 ? -80.574  -30.519 -55.014  1.00 84.33  ? 2084 HIS B CA    1 
ATOM 4567  C C     . HIS B 2 213 ? -81.123  -30.898 -56.387  1.00 84.68  ? 2084 HIS B C     1 
ATOM 4568  O O     . HIS B 2 213 ? -80.631  -31.796 -57.061  1.00 84.53  ? 2084 HIS B O     1 
ATOM 4569  C CB    . HIS B 2 213 ? -80.037  -31.678 -54.217  1.00 84.40  ? 2084 HIS B CB    1 
ATOM 4570  C CG    . HIS B 2 213 ? -79.396  -31.226 -52.958  1.00 85.54  ? 2084 HIS B CG    1 
ATOM 4571  N ND1   . HIS B 2 213 ? -79.267  -32.028 -51.849  1.00 87.34  ? 2084 HIS B ND1   1 
ATOM 4572  C CD2   . HIS B 2 213 ? -78.861  -30.027 -52.627  1.00 86.01  ? 2084 HIS B CD2   1 
ATOM 4573  C CE1   . HIS B 2 213 ? -78.655  -31.351 -50.892  1.00 87.42  ? 2084 HIS B CE1   1 
ATOM 4574  N NE2   . HIS B 2 213 ? -78.404  -30.133 -51.339  1.00 87.24  ? 2084 HIS B NE2   1 
ATOM 4575  N N     . PHE B 2 214 ? -82.125  -30.128 -56.791  1.00 85.39  ? 2085 PHE B N     1 
ATOM 4576  C CA    . PHE B 2 214 ? -82.994  -30.424 -57.902  1.00 86.23  ? 2085 PHE B CA    1 
ATOM 4577  C C     . PHE B 2 214 ? -83.289  -31.913 -58.005  1.00 86.60  ? 2085 PHE B C     1 
ATOM 4578  O O     . PHE B 2 214 ? -82.657  -32.627 -58.791  1.00 87.15  ? 2085 PHE B O     1 
ATOM 4579  C CB    . PHE B 2 214 ? -82.409  -29.918 -59.214  1.00 86.17  ? 2085 PHE B CB    1 
ATOM 4580  C CG    . PHE B 2 214 ? -81.371  -28.875 -59.047  1.00 86.94  ? 2085 PHE B CG    1 
ATOM 4581  C CD1   . PHE B 2 214 ? -81.668  -27.544 -59.350  1.00 88.72  ? 2085 PHE B CD1   1 
ATOM 4582  C CD2   . PHE B 2 214 ? -80.090  -29.220 -58.608  1.00 86.72  ? 2085 PHE B CD2   1 
ATOM 4583  C CE1   . PHE B 2 214 ? -80.713  -26.564 -59.223  1.00 89.34  ? 2085 PHE B CE1   1 
ATOM 4584  C CE2   . PHE B 2 214 ? -79.116  -28.271 -58.465  1.00 89.00  ? 2085 PHE B CE2   1 
ATOM 4585  C CZ    . PHE B 2 214 ? -79.419  -26.927 -58.778  1.00 91.29  ? 2085 PHE B CZ    1 
ATOM 4586  N N     . ALA B 2 215 ? -84.237  -32.394 -57.209  1.00 86.66  ? 2086 ALA B N     1 
ATOM 4587  C CA    . ALA B 2 215 ? -84.808  -33.679 -57.519  1.00 86.68  ? 2086 ALA B CA    1 
ATOM 4588  C C     . ALA B 2 215 ? -85.731  -33.393 -58.663  1.00 86.68  ? 2086 ALA B C     1 
ATOM 4589  O O     . ALA B 2 215 ? -86.187  -32.258 -58.852  1.00 86.18  ? 2086 ALA B O     1 
ATOM 4590  C CB    . ALA B 2 215 ? -85.548  -34.277 -56.361  1.00 86.78  ? 2086 ALA B CB    1 
ATOM 4591  N N     . ASN B 2 216 ? -85.967  -34.422 -59.453  1.00 87.11  ? 2087 ASN B N     1 
ATOM 4592  C CA    . ASN B 2 216 ? -86.824  -34.292 -60.581  1.00 87.69  ? 2087 ASN B CA    1 
ATOM 4593  C C     . ASN B 2 216 ? -88.215  -34.319 -60.055  1.00 87.60  ? 2087 ASN B C     1 
ATOM 4594  O O     . ASN B 2 216 ? -88.658  -35.306 -59.452  1.00 87.13  ? 2087 ASN B O     1 
ATOM 4595  C CB    . ASN B 2 216 ? -86.598  -35.424 -61.564  1.00 88.17  ? 2087 ASN B CB    1 
ATOM 4596  C CG    . ASN B 2 216 ? -87.531  -35.356 -62.737  1.00 89.86  ? 2087 ASN B CG    1 
ATOM 4597  O OD1   . ASN B 2 216 ? -88.007  -34.274 -63.127  1.00 91.04  ? 2087 ASN B OD1   1 
ATOM 4598  N ND2   . ASN B 2 216 ? -87.806  -36.509 -63.318  1.00 90.95  ? 2087 ASN B ND2   1 
ATOM 4599  N N     . ARG B 2 217 ? -88.903  -33.209 -60.256  1.00 88.10  ? 2088 ARG B N     1 
ATOM 4600  C CA    . ARG B 2 217 ? -90.229  -33.103 -59.707  1.00 89.19  ? 2088 ARG B CA    1 
ATOM 4601  C C     . ARG B 2 217 ? -91.281  -33.758 -60.611  1.00 90.40  ? 2088 ARG B C     1 
ATOM 4602  O O     . ARG B 2 217 ? -92.400  -34.037 -60.171  1.00 90.93  ? 2088 ARG B O     1 
ATOM 4603  C CB    . ARG B 2 217 ? -90.553  -31.652 -59.342  1.00 88.81  ? 2088 ARG B CB    1 
ATOM 4604  C CG    . ARG B 2 217 ? -91.060  -30.783 -60.444  1.00 87.93  ? 2088 ARG B CG    1 
ATOM 4605  C CD    . ARG B 2 217 ? -91.210  -29.383 -59.925  1.00 86.79  ? 2088 ARG B CD    1 
ATOM 4606  N NE    . ARG B 2 217 ? -89.895  -28.797 -59.804  1.00 87.19  ? 2088 ARG B NE    1 
ATOM 4607  C CZ    . ARG B 2 217 ? -89.634  -27.624 -59.252  1.00 88.32  ? 2088 ARG B CZ    1 
ATOM 4608  N NH1   . ARG B 2 217 ? -90.612  -26.879 -58.754  1.00 88.64  ? 2088 ARG B NH1   1 
ATOM 4609  N NH2   . ARG B 2 217 ? -88.374  -27.201 -59.192  1.00 89.45  ? 2088 ARG B NH2   1 
ATOM 4610  N N     . ASP B 2 218 ? -90.888  -34.042 -61.855  1.00 91.42  ? 2089 ASP B N     1 
ATOM 4611  C CA    . ASP B 2 218 ? -91.760  -34.627 -62.867  1.00 91.61  ? 2089 ASP B CA    1 
ATOM 4612  C C     . ASP B 2 218 ? -91.845  -36.148 -62.849  1.00 91.56  ? 2089 ASP B C     1 
ATOM 4613  O O     . ASP B 2 218 ? -92.817  -36.685 -63.339  1.00 92.21  ? 2089 ASP B O     1 
ATOM 4614  C CB    . ASP B 2 218 ? -91.372  -34.115 -64.248  1.00 91.87  ? 2089 ASP B CB    1 
ATOM 4615  C CG    . ASP B 2 218 ? -91.482  -32.597 -64.355  1.00 93.96  ? 2089 ASP B CG    1 
ATOM 4616  O OD1   . ASP B 2 218 ? -92.475  -32.028 -63.836  1.00 94.50  ? 2089 ASP B OD1   1 
ATOM 4617  O OD2   . ASP B 2 218 ? -90.573  -31.970 -64.959  1.00 96.13  ? 2089 ASP B OD2   1 
ATOM 4618  N N     . ILE B 2 219 ? -90.863  -36.854 -62.296  1.00 91.58  ? 2090 ILE B N     1 
ATOM 4619  C CA    . ILE B 2 219 ? -91.026  -38.300 -62.122  1.00 91.87  ? 2090 ILE B CA    1 
ATOM 4620  C C     . ILE B 2 219 ? -92.277  -38.505 -61.289  1.00 92.69  ? 2090 ILE B C     1 
ATOM 4621  O O     . ILE B 2 219 ? -92.428  -37.909 -60.220  1.00 92.66  ? 2090 ILE B O     1 
ATOM 4622  C CB    . ILE B 2 219 ? -89.858  -38.986 -61.399  1.00 91.66  ? 2090 ILE B CB    1 
ATOM 4623  C CG1   . ILE B 2 219 ? -88.522  -38.555 -61.997  1.00 91.93  ? 2090 ILE B CG1   1 
ATOM 4624  C CG2   . ILE B 2 219 ? -90.030  -40.506 -61.426  1.00 90.25  ? 2090 ILE B CG2   1 
ATOM 4625  C CD1   . ILE B 2 219 ? -87.286  -38.929 -61.163  1.00 93.67  ? 2090 ILE B CD1   1 
ATOM 4626  N N     . THR B 2 220 ? -93.167  -39.347 -61.797  1.00 93.66  ? 2091 THR B N     1 
ATOM 4627  C CA    . THR B 2 220 ? -94.453  -39.604 -61.182  1.00 94.53  ? 2091 THR B CA    1 
ATOM 4628  C C     . THR B 2 220 ? -94.397  -40.825 -60.249  1.00 95.34  ? 2091 THR B C     1 
ATOM 4629  O O     . THR B 2 220 ? -93.308  -41.211 -59.828  1.00 95.60  ? 2091 THR B O     1 
ATOM 4630  C CB    . THR B 2 220 ? -95.484  -39.849 -62.242  1.00 94.34  ? 2091 THR B CB    1 
ATOM 4631  O OG1   . THR B 2 220 ? -96.368  -40.846 -61.748  1.00 94.51  ? 2091 THR B OG1   1 
ATOM 4632  C CG2   . THR B 2 220 ? -94.842  -40.415 -63.495  1.00 95.25  ? 2091 THR B CG2   1 
ATOM 4633  N N     . ASP B 2 221 ? -95.569  -41.384 -59.896  1.00 96.13  ? 2092 ASP B N     1 
ATOM 4634  C CA    . ASP B 2 221 ? -95.704  -42.668 -59.149  1.00 96.93  ? 2092 ASP B CA    1 
ATOM 4635  C C     . ASP B 2 221 ? -96.070  -43.707 -60.148  1.00 97.24  ? 2092 ASP B C     1 
ATOM 4636  O O     . ASP B 2 221 ? -96.077  -43.412 -61.335  1.00 97.76  ? 2092 ASP B O     1 
ATOM 4637  C CB    . ASP B 2 221 ? -96.805  -42.633 -58.079  1.00 97.00  ? 2092 ASP B CB    1 
ATOM 4638  C CG    . ASP B 2 221 ? -98.070  -41.936 -58.560  1.00 97.96  ? 2092 ASP B CG    1 
ATOM 4639  O OD1   . ASP B 2 221 ? -98.974  -41.687 -57.731  1.00 98.29  ? 2092 ASP B OD1   1 
ATOM 4640  O OD2   . ASP B 2 221 ? -98.164  -41.621 -59.763  1.00 98.79  ? 2092 ASP B OD2   1 
ATOM 4641  N N     . HIS B 2 222 ? -96.402  -44.908 -59.688  1.00 97.63  ? 2093 HIS B N     1 
ATOM 4642  C CA    . HIS B 2 222 ? -96.810  -45.964 -60.614  1.00 98.17  ? 2093 HIS B CA    1 
ATOM 4643  C C     . HIS B 2 222 ? -98.277  -45.864 -60.976  1.00 98.32  ? 2093 HIS B C     1 
ATOM 4644  O O     . HIS B 2 222 ? -98.908  -46.876 -61.239  1.00 98.49  ? 2093 HIS B O     1 
ATOM 4645  C CB    . HIS B 2 222 ? -96.514  -47.356 -60.058  1.00 98.27  ? 2093 HIS B CB    1 
ATOM 4646  C CG    . HIS B 2 222 ? -97.435  -47.789 -58.951  1.00 99.08  ? 2093 HIS B CG    1 
ATOM 4647  N ND1   . HIS B 2 222 ? -97.637  -49.116 -58.628  1.00 99.60  ? 2093 HIS B ND1   1 
ATOM 4648  C CD2   . HIS B 2 222 ? -98.209  -47.074 -58.099  1.00 99.73  ? 2093 HIS B CD2   1 
ATOM 4649  C CE1   . HIS B 2 222 ? -98.488  -49.197 -57.621  1.00 100.20 ? 2093 HIS B CE1   1 
ATOM 4650  N NE2   . HIS B 2 222 ? -98.854  -47.973 -57.284  1.00 100.32 ? 2093 HIS B NE2   1 
ATOM 4651  N N     . MET B 2 223 ? -98.830  -44.658 -60.969  1.00 98.46  ? 2094 MET B N     1 
ATOM 4652  C CA    . MET B 2 223 ? -100.205 -44.475 -61.380  1.00 98.77  ? 2094 MET B CA    1 
ATOM 4653  C C     . MET B 2 223 ? -100.304 -43.134 -62.042  1.00 99.03  ? 2094 MET B C     1 
ATOM 4654  O O     . MET B 2 223 ? -101.378 -42.577 -62.191  1.00 99.43  ? 2094 MET B O     1 
ATOM 4655  C CB    . MET B 2 223 ? -101.156 -44.617 -60.193  1.00 98.76  ? 2094 MET B CB    1 
ATOM 4656  C CG    . MET B 2 223 ? -101.108 -46.019 -59.593  1.00 99.31  ? 2094 MET B CG    1 
ATOM 4657  S SD    . MET B 2 223 ? -102.223 -46.368 -58.240  1.00 101.41 ? 2094 MET B SD    1 
ATOM 4658  C CE    . MET B 2 223 ? -103.702 -45.492 -58.831  1.00 102.58 ? 2094 MET B CE    1 
ATOM 4659  N N     . ASP B 2 224 ? -99.149  -42.625 -62.439  1.00 99.43  ? 2095 ASP B N     1 
ATOM 4660  C CA    . ASP B 2 224 ? -99.027  -41.410 -63.263  1.00 100.22 ? 2095 ASP B CA    1 
ATOM 4661  C C     . ASP B 2 224 ? -99.511  -40.090 -62.635  1.00 99.68  ? 2095 ASP B C     1 
ATOM 4662  O O     . ASP B 2 224 ? -99.682  -39.077 -63.332  1.00 99.40  ? 2095 ASP B O     1 
ATOM 4663  C CB    . ASP B 2 224 ? -99.551  -41.659 -64.679  1.00 100.91 ? 2095 ASP B CB    1 
ATOM 4664  C CG    . ASP B 2 224 ? -98.900  -42.895 -65.314  1.00 104.13 ? 2095 ASP B CG    1 
ATOM 4665  O OD1   . ASP B 2 224 ? -98.704  -43.913 -64.585  1.00 106.17 ? 2095 ASP B OD1   1 
ATOM 4666  O OD2   . ASP B 2 224 ? -98.568  -42.849 -66.529  1.00 107.86 ? 2095 ASP B OD2   1 
ATOM 4667  N N     . ARG B 2 225 ? -99.666  -40.128 -61.307  1.00 99.24  ? 2096 ARG B N     1 
ATOM 4668  C CA    . ARG B 2 225 ? -99.787  -38.953 -60.449  1.00 98.94  ? 2096 ARG B CA    1 
ATOM 4669  C C     . ARG B 2 225 ? -98.424  -38.307 -60.103  1.00 98.49  ? 2096 ARG B C     1 
ATOM 4670  O O     . ARG B 2 225 ? -97.578  -38.943 -59.445  1.00 97.94  ? 2096 ARG B O     1 
ATOM 4671  C CB    . ARG B 2 225 ? -100.444 -39.376 -59.141  1.00 99.18  ? 2096 ARG B CB    1 
ATOM 4672  C CG    . ARG B 2 225 ? -101.971 -39.350 -59.102  1.00 100.47 ? 2096 ARG B CG    1 
ATOM 4673  C CD    . ARG B 2 225 ? -102.475 -39.909 -57.767  1.00 100.57 ? 2096 ARG B CD    1 
ATOM 4674  N NE    . ARG B 2 225 ? -101.723 -41.106 -57.383  1.00 100.14 ? 2096 ARG B NE    1 
ATOM 4675  C CZ    . ARG B 2 225 ? -101.702 -41.616 -56.156  1.00 100.75 ? 2096 ARG B CZ    1 
ATOM 4676  N NH1   . ARG B 2 225 ? -102.388 -41.039 -55.175  1.00 100.78 ? 2096 ARG B NH1   1 
ATOM 4677  N NH2   . ARG B 2 225 ? -100.998 -42.707 -55.905  1.00 100.79 ? 2096 ARG B NH2   1 
ATOM 4678  N N     . LEU B 2 226 ? -98.236  -37.044 -60.517  1.00 97.86  ? 2097 LEU B N     1 
ATOM 4679  C CA    . LEU B 2 226 ? -97.061  -36.244 -60.155  1.00 97.38  ? 2097 LEU B CA    1 
ATOM 4680  C C     . LEU B 2 226 ? -96.984  -36.173 -58.623  1.00 97.70  ? 2097 LEU B C     1 
ATOM 4681  O O     . LEU B 2 226 ? -97.985  -36.434 -57.958  1.00 98.16  ? 2097 LEU B O     1 
ATOM 4682  C CB    . LEU B 2 226 ? -97.163  -34.834 -60.756  1.00 96.92  ? 2097 LEU B CB    1 
ATOM 4683  C CG    . LEU B 2 226 ? -96.794  -34.620 -62.239  1.00 96.78  ? 2097 LEU B CG    1 
ATOM 4684  C CD1   . LEU B 2 226 ? -97.342  -33.323 -62.884  1.00 95.76  ? 2097 LEU B CD1   1 
ATOM 4685  C CD2   . LEU B 2 226 ? -95.310  -34.702 -62.451  1.00 96.33  ? 2097 LEU B CD2   1 
ATOM 4686  N N     . PRO B 2 227 ? -95.802  -35.846 -58.038  1.00 97.52  ? 2098 PRO B N     1 
ATOM 4687  C CA    . PRO B 2 227 ? -95.855  -35.560 -56.613  1.00 96.87  ? 2098 PRO B CA    1 
ATOM 4688  C C     . PRO B 2 227 ? -96.745  -34.331 -56.386  1.00 96.04  ? 2098 PRO B C     1 
ATOM 4689  O O     . PRO B 2 227 ? -97.637  -34.350 -55.538  1.00 95.42  ? 2098 PRO B O     1 
ATOM 4690  C CB    . PRO B 2 227 ? -94.392  -35.282 -56.273  1.00 96.88  ? 2098 PRO B CB    1 
ATOM 4691  C CG    . PRO B 2 227 ? -93.812  -34.791 -57.524  1.00 96.85  ? 2098 PRO B CG    1 
ATOM 4692  C CD    . PRO B 2 227 ? -94.436  -35.653 -58.553  1.00 97.53  ? 2098 PRO B CD    1 
ATOM 4693  N N     . ARG B 2 228 ? -96.525  -33.310 -57.203  1.00 95.27  ? 2099 ARG B N     1 
ATOM 4694  C CA    . ARG B 2 228 ? -97.419  -32.185 -57.311  1.00 95.19  ? 2099 ARG B CA    1 
ATOM 4695  C C     . ARG B 2 228 ? -98.901  -32.514 -57.098  1.00 95.01  ? 2099 ARG B C     1 
ATOM 4696  O O     . ARG B 2 228 ? -99.670  -31.640 -56.711  1.00 94.96  ? 2099 ARG B O     1 
ATOM 4697  C CB    . ARG B 2 228 ? -97.231  -31.546 -58.679  1.00 95.42  ? 2099 ARG B CB    1 
ATOM 4698  C CG    . ARG B 2 228 ? -97.568  -30.063 -58.742  1.00 96.10  ? 2099 ARG B CG    1 
ATOM 4699  C CD    . ARG B 2 228 ? -99.046  -29.822 -58.980  1.00 96.82  ? 2099 ARG B CD    1 
ATOM 4700  N NE    . ARG B 2 228 ? -99.309  -28.420 -59.278  1.00 98.08  ? 2099 ARG B NE    1 
ATOM 4701  C CZ    . ARG B 2 228 ? -100.496 -27.838 -59.151  1.00 98.72  ? 2099 ARG B CZ    1 
ATOM 4702  N NH1   . ARG B 2 228 ? -101.536 -28.538 -58.727  1.00 98.87  ? 2099 ARG B NH1   1 
ATOM 4703  N NH2   . ARG B 2 228 ? -100.643 -26.553 -59.444  1.00 98.61  ? 2099 ARG B NH2   1 
ATOM 4704  N N     . ASP B 2 229 ? -99.307  -33.758 -57.347  1.00 94.88  ? 2100 ASP B N     1 
ATOM 4705  C CA    . ASP B 2 229 ? -100.733 -34.110 -57.321  1.00 94.54  ? 2100 ASP B CA    1 
ATOM 4706  C C     . ASP B 2 229 ? -101.123 -34.654 -55.991  1.00 93.35  ? 2100 ASP B C     1 
ATOM 4707  O O     . ASP B 2 229 ? -102.076 -34.180 -55.402  1.00 93.77  ? 2100 ASP B O     1 
ATOM 4708  C CB    . ASP B 2 229 ? -101.123 -35.111 -58.418  1.00 95.17  ? 2100 ASP B CB    1 
ATOM 4709  C CG    . ASP B 2 229 ? -101.057 -34.505 -59.824  1.00 97.89  ? 2100 ASP B CG    1 
ATOM 4710  O OD1   . ASP B 2 229 ? -101.533 -33.340 -60.027  1.00 98.93  ? 2100 ASP B OD1   1 
ATOM 4711  O OD2   . ASP B 2 229 ? -100.521 -35.213 -60.718  1.00 99.79  ? 2100 ASP B OD2   1 
ATOM 4712  N N     . ILE B 2 230 ? -100.396 -35.647 -55.505  1.00 91.87  ? 2101 ILE B N     1 
ATOM 4713  C CA    . ILE B 2 230 ? -100.717 -36.222 -54.210  1.00 90.73  ? 2101 ILE B CA    1 
ATOM 4714  C C     . ILE B 2 230 ? -100.676 -35.133 -53.120  1.00 90.31  ? 2101 ILE B C     1 
ATOM 4715  O O     . ILE B 2 230 ? -101.180 -35.332 -52.023  1.00 90.24  ? 2101 ILE B O     1 
ATOM 4716  C CB    . ILE B 2 230 ? -99.806  -37.424 -53.904  1.00 90.51  ? 2101 ILE B CB    1 
ATOM 4717  C CG1   . ILE B 2 230 ? -100.284 -38.194 -52.693  1.00 90.28  ? 2101 ILE B CG1   1 
ATOM 4718  C CG2   . ILE B 2 230 ? -98.403  -36.983 -53.677  1.00 90.95  ? 2101 ILE B CG2   1 
ATOM 4719  C CD1   . ILE B 2 230 ? -101.679 -38.674 -52.802  1.00 90.25  ? 2101 ILE B CD1   1 
ATOM 4720  N N     . ALA B 2 231 ? -100.089 -33.979 -53.448  1.00 89.51  ? 2102 ALA B N     1 
ATOM 4721  C CA    . ALA B 2 231 ? -100.160 -32.795 -52.613  1.00 88.64  ? 2102 ALA B CA    1 
ATOM 4722  C C     . ALA B 2 231 ? -101.559 -32.270 -52.696  1.00 88.66  ? 2102 ALA B C     1 
ATOM 4723  O O     . ALA B 2 231 ? -102.370 -32.568 -51.844  1.00 88.73  ? 2102 ALA B O     1 
ATOM 4724  C CB    . ALA B 2 231 ? -99.227  -31.779 -53.086  1.00 88.52  ? 2102 ALA B CB    1 
ATOM 4725  N N     . GLN B 2 232 ? -101.848 -31.493 -53.729  1.00 88.97  ? 2103 GLN B N     1 
ATOM 4726  C CA    . GLN B 2 232 ? -103.230 -31.101 -54.088  1.00 89.63  ? 2103 GLN B CA    1 
ATOM 4727  C C     . GLN B 2 232 ? -104.343 -31.891 -53.413  1.00 89.44  ? 2103 GLN B C     1 
ATOM 4728  O O     . GLN B 2 232 ? -105.245 -31.335 -52.793  1.00 89.01  ? 2103 GLN B O     1 
ATOM 4729  C CB    . GLN B 2 232 ? -103.428 -31.267 -55.600  1.00 89.98  ? 2103 GLN B CB    1 
ATOM 4730  C CG    . GLN B 2 232 ? -103.373 -30.006 -56.388  1.00 91.50  ? 2103 GLN B CG    1 
ATOM 4731  C CD    . GLN B 2 232 ? -104.252 -28.972 -55.790  1.00 94.23  ? 2103 GLN B CD    1 
ATOM 4732  O OE1   . GLN B 2 232 ? -103.763 -27.960 -55.275  1.00 96.24  ? 2103 GLN B OE1   1 
ATOM 4733  N NE2   . GLN B 2 232 ? -105.565 -29.222 -55.806  1.00 95.08  ? 2103 GLN B NE2   1 
ATOM 4734  N N     . GLU B 2 233 ? -104.264 -33.201 -53.604  1.00 89.85  ? 2104 GLU B N     1 
ATOM 4735  C CA    . GLU B 2 233 ? -105.192 -34.159 -53.057  1.00 90.58  ? 2104 GLU B CA    1 
ATOM 4736  C C     . GLU B 2 233 ? -105.230 -34.100 -51.518  1.00 90.15  ? 2104 GLU B C     1 
ATOM 4737  O O     . GLU B 2 233 ? -106.272 -33.752 -50.968  1.00 90.63  ? 2104 GLU B O     1 
ATOM 4738  C CB    . GLU B 2 233 ? -104.882 -35.575 -53.594  1.00 90.87  ? 2104 GLU B CB    1 
ATOM 4739  C CG    . GLU B 2 233 ? -105.609 -36.693 -52.839  1.00 94.47  ? 2104 GLU B CG    1 
ATOM 4740  C CD    . GLU B 2 233 ? -105.501 -38.070 -53.499  1.00 99.88  ? 2104 GLU B CD    1 
ATOM 4741  O OE1   . GLU B 2 233 ? -105.690 -39.074 -52.749  1.00 101.04 ? 2104 GLU B OE1   1 
ATOM 4742  O OE2   . GLU B 2 233 ? -105.242 -38.152 -54.742  1.00 102.06 ? 2104 GLU B OE2   1 
ATOM 4743  N N     . ARG B 2 234 ? -104.106 -34.408 -50.847  1.00 89.37  ? 2105 ARG B N     1 
ATOM 4744  C CA    . ARG B 2 234 ? -104.001 -34.451 -49.375  1.00 88.19  ? 2105 ARG B CA    1 
ATOM 4745  C C     . ARG B 2 234 ? -104.103 -33.065 -48.744  1.00 87.36  ? 2105 ARG B C     1 
ATOM 4746  O O     . ARG B 2 234 ? -104.070 -32.915 -47.518  1.00 86.80  ? 2105 ARG B O     1 
ATOM 4747  C CB    . ARG B 2 234 ? -102.694 -35.110 -48.949  1.00 88.39  ? 2105 ARG B CB    1 
ATOM 4748  C CG    . ARG B 2 234 ? -102.690 -36.595 -48.946  1.00 89.59  ? 2105 ARG B CG    1 
ATOM 4749  C CD    . ARG B 2 234 ? -103.329 -37.198 -47.705  1.00 93.70  ? 2105 ARG B CD    1 
ATOM 4750  N NE    . ARG B 2 234 ? -102.811 -38.553 -47.443  1.00 98.40  ? 2105 ARG B NE    1 
ATOM 4751  C CZ    . ARG B 2 234 ? -102.793 -39.586 -48.315  1.00 99.47  ? 2105 ARG B CZ    1 
ATOM 4752  N NH1   . ARG B 2 234 ? -103.271 -39.466 -49.562  1.00 98.30  ? 2105 ARG B NH1   1 
ATOM 4753  N NH2   . ARG B 2 234 ? -102.275 -40.761 -47.939  1.00 99.06  ? 2105 ARG B NH2   1 
ATOM 4754  N N     . MET B 2 235 ? -104.224 -32.066 -49.606  1.00 86.74  ? 2106 MET B N     1 
ATOM 4755  C CA    . MET B 2 235 ? -104.580 -30.722 -49.225  1.00 86.61  ? 2106 MET B CA    1 
ATOM 4756  C C     . MET B 2 235 ? -103.414 -29.951 -48.637  1.00 86.06  ? 2106 MET B C     1 
ATOM 4757  O O     . MET B 2 235 ? -103.626 -28.959 -47.940  1.00 86.53  ? 2106 MET B O     1 
ATOM 4758  C CB    . MET B 2 235 ? -105.761 -30.722 -48.261  1.00 87.11  ? 2106 MET B CB    1 
ATOM 4759  C CG    . MET B 2 235 ? -107.074 -31.151 -48.852  1.00 89.20  ? 2106 MET B CG    1 
ATOM 4760  S SD    . MET B 2 235 ? -107.581 -29.948 -50.049  1.00 94.67  ? 2106 MET B SD    1 
ATOM 4761  C CE    . MET B 2 235 ? -108.724 -30.925 -51.040  1.00 96.32  ? 2106 MET B CE    1 
ATOM 4762  N N     . HIS B 2 236 ? -102.188 -30.386 -48.928  1.00 84.90  ? 2107 HIS B N     1 
ATOM 4763  C CA    . HIS B 2 236 ? -100.992 -29.603 -48.607  1.00 83.61  ? 2107 HIS B CA    1 
ATOM 4764  C C     . HIS B 2 236 ? -100.741 -28.539 -49.667  1.00 83.59  ? 2107 HIS B C     1 
ATOM 4765  O O     . HIS B 2 236 ? -100.139 -28.801 -50.696  1.00 83.65  ? 2107 HIS B O     1 
ATOM 4766  C CB    . HIS B 2 236 ? -99.799  -30.513 -48.512  1.00 82.72  ? 2107 HIS B CB    1 
ATOM 4767  C CG    . HIS B 2 236 ? -100.046 -31.724 -47.700  1.00 81.06  ? 2107 HIS B CG    1 
ATOM 4768  N ND1   . HIS B 2 236 ? -99.537  -32.956 -48.033  1.00 80.04  ? 2107 HIS B ND1   1 
ATOM 4769  C CD2   . HIS B 2 236 ? -100.748 -31.899 -46.558  1.00 82.26  ? 2107 HIS B CD2   1 
ATOM 4770  C CE1   . HIS B 2 236 ? -99.905  -33.841 -47.125  1.00 81.38  ? 2107 HIS B CE1   1 
ATOM 4771  N NE2   . HIS B 2 236 ? -100.641 -33.226 -46.216  1.00 83.36  ? 2107 HIS B NE2   1 
ATOM 4772  N N     . HIS B 2 237 ? -101.221 -27.332 -49.439  1.00 83.63  ? 2108 HIS B N     1 
ATOM 4773  C CA    . HIS B 2 237 ? -101.156 -26.326 -50.487  1.00 84.03  ? 2108 HIS B CA    1 
ATOM 4774  C C     . HIS B 2 237 ? -99.813  -25.682 -50.435  1.00 83.88  ? 2108 HIS B C     1 
ATOM 4775  O O     . HIS B 2 237 ? -99.429  -24.939 -51.341  1.00 83.94  ? 2108 HIS B O     1 
ATOM 4776  C CB    . HIS B 2 237 ? -102.220 -25.267 -50.296  1.00 84.36  ? 2108 HIS B CB    1 
ATOM 4777  C CG    . HIS B 2 237 ? -103.556 -25.830 -49.975  1.00 86.12  ? 2108 HIS B CG    1 
ATOM 4778  N ND1   . HIS B 2 237 ? -104.718 -25.108 -50.107  1.00 88.37  ? 2108 HIS B ND1   1 
ATOM 4779  C CD2   . HIS B 2 237 ? -103.919 -27.058 -49.545  1.00 86.90  ? 2108 HIS B CD2   1 
ATOM 4780  C CE1   . HIS B 2 237 ? -105.740 -25.867 -49.759  1.00 89.63  ? 2108 HIS B CE1   1 
ATOM 4781  N NE2   . HIS B 2 237 ? -105.280 -27.058 -49.416  1.00 88.80  ? 2108 HIS B NE2   1 
ATOM 4782  N N     . ASP B 2 238 ? -99.088  -25.944 -49.358  1.00 83.77  ? 2109 ASP B N     1 
ATOM 4783  C CA    . ASP B 2 238 ? -97.781  -25.358 -49.269  1.00 83.41  ? 2109 ASP B CA    1 
ATOM 4784  C C     . ASP B 2 238 ? -96.886  -26.141 -50.182  1.00 83.16  ? 2109 ASP B C     1 
ATOM 4785  O O     . ASP B 2 238 ? -96.439  -25.613 -51.211  1.00 83.32  ? 2109 ASP B O     1 
ATOM 4786  C CB    . ASP B 2 238 ? -97.307  -25.264 -47.836  1.00 83.30  ? 2109 ASP B CB    1 
ATOM 4787  C CG    . ASP B 2 238 ? -97.753  -23.960 -47.204  1.00 83.58  ? 2109 ASP B CG    1 
ATOM 4788  O OD1   . ASP B 2 238 ? -98.046  -23.021 -47.974  1.00 80.41  ? 2109 ASP B OD1   1 
ATOM 4789  O OD2   . ASP B 2 238 ? -97.834  -23.868 -45.962  1.00 85.46  ? 2109 ASP B OD2   1 
ATOM 4790  N N     . ILE B 2 239 ? -96.712  -27.421 -49.862  1.00 82.39  ? 2110 ILE B N     1 
ATOM 4791  C CA    . ILE B 2 239 ? -95.970  -28.312 -50.724  1.00 81.12  ? 2110 ILE B CA    1 
ATOM 4792  C C     . ILE B 2 239 ? -96.352  -28.108 -52.157  1.00 80.78  ? 2110 ILE B C     1 
ATOM 4793  O O     . ILE B 2 239 ? -95.478  -28.119 -52.979  1.00 81.06  ? 2110 ILE B O     1 
ATOM 4794  C CB    . ILE B 2 239 ? -96.125  -29.734 -50.300  1.00 81.07  ? 2110 ILE B CB    1 
ATOM 4795  C CG1   . ILE B 2 239 ? -94.986  -30.053 -49.347  1.00 80.88  ? 2110 ILE B CG1   1 
ATOM 4796  C CG2   . ILE B 2 239 ? -96.155  -30.652 -51.487  1.00 80.68  ? 2110 ILE B CG2   1 
ATOM 4797  C CD1   . ILE B 2 239 ? -94.859  -31.488 -49.030  1.00 81.84  ? 2110 ILE B CD1   1 
ATOM 4798  N N     . VAL B 2 240 ? -97.627  -27.872 -52.456  1.00 80.48  ? 2111 VAL B N     1 
ATOM 4799  C CA    . VAL B 2 240 ? -98.009  -27.498 -53.816  1.00 80.59  ? 2111 VAL B CA    1 
ATOM 4800  C C     . VAL B 2 240 ? -97.274  -26.235 -54.234  1.00 81.12  ? 2111 VAL B C     1 
ATOM 4801  O O     . VAL B 2 240 ? -96.524  -26.233 -55.194  1.00 81.18  ? 2111 VAL B O     1 
ATOM 4802  C CB    . VAL B 2 240 ? -99.531  -27.306 -54.004  1.00 80.41  ? 2111 VAL B CB    1 
ATOM 4803  C CG1   . VAL B 2 240 ? -99.853  -26.758 -55.395  1.00 79.30  ? 2111 VAL B CG1   1 
ATOM 4804  C CG2   . VAL B 2 240 ? -100.270 -28.604 -53.764  1.00 80.27  ? 2111 VAL B CG2   1 
ATOM 4805  N N     . ARG B 2 241 ? -97.447  -25.159 -53.495  1.00 81.99  ? 2112 ARG B N     1 
ATOM 4806  C CA    . ARG B 2 241 ? -96.929  -23.872 -53.958  1.00 82.96  ? 2112 ARG B CA    1 
ATOM 4807  C C     . ARG B 2 241 ? -95.443  -23.982 -54.259  1.00 83.66  ? 2112 ARG B C     1 
ATOM 4808  O O     . ARG B 2 241 ? -94.901  -23.302 -55.135  1.00 83.66  ? 2112 ARG B O     1 
ATOM 4809  C CB    . ARG B 2 241 ? -97.173  -22.784 -52.908  1.00 82.69  ? 2112 ARG B CB    1 
ATOM 4810  C CG    . ARG B 2 241 ? -96.982  -21.363 -53.435  1.00 82.10  ? 2112 ARG B CG    1 
ATOM 4811  C CD    . ARG B 2 241 ? -96.306  -20.490 -52.432  1.00 81.76  ? 2112 ARG B CD    1 
ATOM 4812  N NE    . ARG B 2 241 ? -97.080  -20.341 -51.204  1.00 81.85  ? 2112 ARG B NE    1 
ATOM 4813  C CZ    . ARG B 2 241 ? -96.983  -21.111 -50.126  1.00 81.99  ? 2112 ARG B CZ    1 
ATOM 4814  N NH1   . ARG B 2 241 ? -96.166  -22.148 -50.079  1.00 82.48  ? 2112 ARG B NH1   1 
ATOM 4815  N NH2   . ARG B 2 241 ? -97.733  -20.846 -49.083  1.00 83.45  ? 2112 ARG B NH2   1 
ATOM 4816  N N     . LEU B 2 242 ? -94.798  -24.856 -53.505  1.00 84.68  ? 2113 LEU B N     1 
ATOM 4817  C CA    . LEU B 2 242 ? -93.383  -25.051 -53.602  1.00 85.70  ? 2113 LEU B CA    1 
ATOM 4818  C C     . LEU B 2 242 ? -93.088  -25.829 -54.870  1.00 87.07  ? 2113 LEU B C     1 
ATOM 4819  O O     . LEU B 2 242 ? -92.181  -25.476 -55.612  1.00 87.71  ? 2113 LEU B O     1 
ATOM 4820  C CB    . LEU B 2 242 ? -92.880  -25.794 -52.378  1.00 85.15  ? 2113 LEU B CB    1 
ATOM 4821  C CG    . LEU B 2 242 ? -91.378  -25.936 -52.301  1.00 83.97  ? 2113 LEU B CG    1 
ATOM 4822  C CD1   . LEU B 2 242 ? -90.782  -24.602 -52.011  1.00 83.18  ? 2113 LEU B CD1   1 
ATOM 4823  C CD2   . LEU B 2 242 ? -91.024  -26.939 -51.239  1.00 83.36  ? 2113 LEU B CD2   1 
ATOM 4824  N N     . LEU B 2 243 ? -93.858  -26.872 -55.137  1.00 88.41  ? 2114 LEU B N     1 
ATOM 4825  C CA    . LEU B 2 243 ? -93.680  -27.620 -56.364  1.00 90.29  ? 2114 LEU B CA    1 
ATOM 4826  C C     . LEU B 2 243 ? -94.058  -26.795 -57.600  1.00 92.35  ? 2114 LEU B C     1 
ATOM 4827  O O     . LEU B 2 243 ? -93.485  -26.977 -58.670  1.00 93.51  ? 2114 LEU B O     1 
ATOM 4828  C CB    . LEU B 2 243 ? -94.481  -28.907 -56.333  1.00 89.75  ? 2114 LEU B CB    1 
ATOM 4829  C CG    . LEU B 2 243 ? -94.030  -29.873 -55.253  1.00 89.51  ? 2114 LEU B CG    1 
ATOM 4830  C CD1   . LEU B 2 243 ? -95.055  -30.937 -54.947  1.00 87.89  ? 2114 LEU B CD1   1 
ATOM 4831  C CD2   . LEU B 2 243 ? -92.745  -30.503 -55.687  1.00 90.84  ? 2114 LEU B CD2   1 
ATOM 4832  N N     . ASP B 2 244 ? -95.008  -25.884 -57.474  1.00 94.02  ? 2115 ASP B N     1 
ATOM 4833  C CA    . ASP B 2 244 ? -95.398  -25.104 -58.618  1.00 95.67  ? 2115 ASP B CA    1 
ATOM 4834  C C     . ASP B 2 244 ? -94.350  -24.091 -58.939  1.00 96.80  ? 2115 ASP B C     1 
ATOM 4835  O O     . ASP B 2 244 ? -94.197  -23.745 -60.088  1.00 96.95  ? 2115 ASP B O     1 
ATOM 4836  C CB    . ASP B 2 244 ? -96.690  -24.351 -58.337  1.00 96.31  ? 2115 ASP B CB    1 
ATOM 4837  C CG    . ASP B 2 244 ? -97.936  -25.195 -58.570  1.00 97.63  ? 2115 ASP B CG    1 
ATOM 4838  O OD1   . ASP B 2 244 ? -97.896  -26.093 -59.439  1.00 97.98  ? 2115 ASP B OD1   1 
ATOM 4839  O OD2   . ASP B 2 244 ? -98.960  -24.945 -57.881  1.00 98.75  ? 2115 ASP B OD2   1 
ATOM 4840  N N     . GLU B 2 245 ? -93.640  -23.605 -57.922  1.00 98.79  ? 2116 GLU B N     1 
ATOM 4841  C CA    . GLU B 2 245 ? -92.871  -22.348 -58.038  1.00 100.75 ? 2116 GLU B CA    1 
ATOM 4842  C C     . GLU B 2 245 ? -91.478  -22.230 -57.372  1.00 101.39 ? 2116 GLU B C     1 
ATOM 4843  O O     . GLU B 2 245 ? -91.032  -21.112 -57.102  1.00 102.05 ? 2116 GLU B O     1 
ATOM 4844  C CB    . GLU B 2 245 ? -93.725  -21.175 -57.532  1.00 100.77 ? 2116 GLU B CB    1 
ATOM 4845  C CG    . GLU B 2 245 ? -94.750  -20.643 -58.503  1.00 102.86 ? 2116 GLU B CG    1 
ATOM 4846  C CD    . GLU B 2 245 ? -95.656  -19.602 -57.859  1.00 106.75 ? 2116 GLU B CD    1 
ATOM 4847  O OE1   . GLU B 2 245 ? -96.127  -18.692 -58.583  1.00 109.08 ? 2116 GLU B OE1   1 
ATOM 4848  O OE2   . GLU B 2 245 ? -95.901  -19.686 -56.627  1.00 108.61 ? 2116 GLU B OE2   1 
ATOM 4849  N N     . TYR B 2 246 ? -90.771  -23.322 -57.116  1.00 101.88 ? 2117 TYR B N     1 
ATOM 4850  C CA    . TYR B 2 246 ? -89.499  -23.167 -56.414  1.00 102.47 ? 2117 TYR B CA    1 
ATOM 4851  C C     . TYR B 2 246 ? -88.375  -23.924 -57.113  1.00 102.71 ? 2117 TYR B C     1 
ATOM 4852  O O     . TYR B 2 246 ? -88.323  -25.148 -57.041  1.00 102.82 ? 2117 TYR B O     1 
ATOM 4853  C CB    . TYR B 2 246 ? -89.662  -23.547 -54.932  1.00 102.64 ? 2117 TYR B CB    1 
ATOM 4854  C CG    . TYR B 2 246 ? -88.393  -23.510 -54.126  1.00 103.41 ? 2117 TYR B CG    1 
ATOM 4855  C CD1   . TYR B 2 246 ? -87.975  -22.346 -53.499  1.00 103.96 ? 2117 TYR B CD1   1 
ATOM 4856  C CD2   . TYR B 2 246 ? -87.605  -24.653 -53.984  1.00 104.70 ? 2117 TYR B CD2   1 
ATOM 4857  C CE1   . TYR B 2 246 ? -86.787  -22.311 -52.761  1.00 104.60 ? 2117 TYR B CE1   1 
ATOM 4858  C CE2   . TYR B 2 246 ? -86.419  -24.631 -53.248  1.00 105.06 ? 2117 TYR B CE2   1 
ATOM 4859  C CZ    . TYR B 2 246 ? -86.020  -23.456 -52.645  1.00 104.83 ? 2117 TYR B CZ    1 
ATOM 4860  O OH    . TYR B 2 246 ? -84.854  -23.439 -51.934  1.00 104.95 ? 2117 TYR B OH    1 
ATOM 4861  N N     . ASN B 2 247 ? -87.484  -23.168 -57.766  1.00 103.04 ? 2118 ASN B N     1 
ATOM 4862  C CA    . ASN B 2 247 ? -86.428  -23.670 -58.694  1.00 103.63 ? 2118 ASN B CA    1 
ATOM 4863  C C     . ASN B 2 247 ? -86.736  -23.633 -60.228  1.00 104.73 ? 2118 ASN B C     1 
ATOM 4864  O O     . ASN B 2 247 ? -86.698  -22.555 -60.854  1.00 104.98 ? 2118 ASN B O     1 
ATOM 4865  C CB    . ASN B 2 247 ? -85.794  -24.995 -58.250  1.00 102.97 ? 2118 ASN B CB    1 
ATOM 4866  C CG    . ASN B 2 247 ? -84.453  -24.793 -57.599  1.00 101.69 ? 2118 ASN B CG    1 
ATOM 4867  O OD1   . ASN B 2 247 ? -84.048  -23.668 -57.349  1.00 99.85  ? 2118 ASN B OD1   1 
ATOM 4868  N ND2   . ASN B 2 247 ? -83.754  -25.879 -57.323  1.00 100.13 ? 2118 ASN B ND2   1 
ATOM 4869  N N     . LEU B 2 248 ? -87.014  -24.795 -60.828  1.00 105.64 ? 2119 LEU B N     1 
ATOM 4870  C CA    . LEU B 2 248 ? -87.332  -24.899 -62.271  1.00 106.85 ? 2119 LEU B CA    1 
ATOM 4871  C C     . LEU B 2 248 ? -86.149  -24.610 -63.236  1.00 107.62 ? 2119 LEU B C     1 
ATOM 4872  O O     . LEU B 2 248 ? -85.721  -25.464 -64.049  1.00 107.80 ? 2119 LEU B O     1 
ATOM 4873  C CB    . LEU B 2 248 ? -88.527  -24.006 -62.637  1.00 106.84 ? 2119 LEU B CB    1 
ATOM 4874  C CG    . LEU B 2 248 ? -89.902  -24.156 -61.972  1.00 107.36 ? 2119 LEU B CG    1 
ATOM 4875  C CD1   . LEU B 2 248 ? -90.235  -25.640 -61.705  1.00 107.33 ? 2119 LEU B CD1   1 
ATOM 4876  C CD2   . LEU B 2 248 ? -90.074  -23.265 -60.716  1.00 106.42 ? 2119 LEU B CD2   1 
ATOM 4877  N N     . HIS C 3 5   ? -76.853  -41.323 -16.459  1.00 134.00 ? 16   HIS C N     1 
ATOM 4878  C CA    . HIS C 3 5   ? -77.913  -40.309 -16.807  1.00 134.03 ? 16   HIS C CA    1 
ATOM 4879  C C     . HIS C 3 5   ? -77.358  -38.941 -17.286  1.00 133.16 ? 16   HIS C C     1 
ATOM 4880  O O     . HIS C 3 5   ? -76.148  -38.791 -17.522  1.00 133.00 ? 16   HIS C O     1 
ATOM 4881  C CB    . HIS C 3 5   ? -78.923  -40.131 -15.648  1.00 134.46 ? 16   HIS C CB    1 
ATOM 4882  C CG    . HIS C 3 5   ? -79.898  -41.262 -15.511  1.00 136.21 ? 16   HIS C CG    1 
ATOM 4883  N ND1   . HIS C 3 5   ? -80.854  -41.545 -16.466  1.00 137.32 ? 16   HIS C ND1   1 
ATOM 4884  C CD2   . HIS C 3 5   ? -80.069  -42.177 -14.526  1.00 137.62 ? 16   HIS C CD2   1 
ATOM 4885  C CE1   . HIS C 3 5   ? -81.570  -42.585 -16.075  1.00 137.81 ? 16   HIS C CE1   1 
ATOM 4886  N NE2   . HIS C 3 5   ? -81.114  -42.989 -14.902  1.00 138.19 ? 16   HIS C NE2   1 
ATOM 4887  N N     . SER C 3 6   ? -78.264  -37.963 -17.394  1.00 132.12 ? 17   SER C N     1 
ATOM 4888  C CA    . SER C 3 6   ? -78.053  -36.657 -18.058  1.00 131.02 ? 17   SER C CA    1 
ATOM 4889  C C     . SER C 3 6   ? -77.118  -36.670 -19.289  1.00 129.93 ? 17   SER C C     1 
ATOM 4890  O O     . SER C 3 6   ? -77.286  -35.853 -20.203  1.00 130.20 ? 17   SER C O     1 
ATOM 4891  C CB    . SER C 3 6   ? -77.757  -35.513 -17.056  1.00 131.10 ? 17   SER C CB    1 
ATOM 4892  O OG    . SER C 3 6   ? -76.463  -35.601 -16.494  1.00 131.32 ? 17   SER C OG    1 
ATOM 4893  N N     . ALA C 3 7   ? -76.155  -37.590 -19.318  1.00 128.19 ? 18   ALA C N     1 
ATOM 4894  C CA    . ALA C 3 7   ? -75.422  -37.869 -20.541  1.00 126.53 ? 18   ALA C CA    1 
ATOM 4895  C C     . ALA C 3 7   ? -76.464  -38.376 -21.525  1.00 125.30 ? 18   ALA C C     1 
ATOM 4896  O O     . ALA C 3 7   ? -76.786  -37.680 -22.501  1.00 124.81 ? 18   ALA C O     1 
ATOM 4897  C CB    . ALA C 3 7   ? -74.315  -38.918 -20.300  1.00 126.66 ? 18   ALA C CB    1 
ATOM 4898  N N     . VAL C 3 8   ? -77.026  -39.554 -21.218  1.00 123.84 ? 19   VAL C N     1 
ATOM 4899  C CA    . VAL C 3 8   ? -78.044  -40.209 -22.055  1.00 122.35 ? 19   VAL C CA    1 
ATOM 4900  C C     . VAL C 3 8   ? -79.399  -39.581 -21.885  1.00 121.60 ? 19   VAL C C     1 
ATOM 4901  O O     . VAL C 3 8   ? -80.181  -39.518 -22.826  1.00 121.28 ? 19   VAL C O     1 
ATOM 4902  C CB    . VAL C 3 8   ? -78.203  -41.729 -21.773  1.00 121.98 ? 19   VAL C CB    1 
ATOM 4903  C CG1   . VAL C 3 8   ? -77.141  -42.517 -22.474  1.00 121.48 ? 19   VAL C CG1   1 
ATOM 4904  C CG2   . VAL C 3 8   ? -78.183  -42.019 -20.291  1.00 122.19 ? 19   VAL C CG2   1 
ATOM 4905  N N     . MET C 3 9   ? -79.684  -39.125 -20.674  1.00 120.99 ? 20   MET C N     1 
ATOM 4906  C CA    . MET C 3 9   ? -81.026  -38.660 -20.377  1.00 120.46 ? 20   MET C CA    1 
ATOM 4907  C C     . MET C 3 9   ? -81.316  -37.411 -21.167  1.00 119.52 ? 20   MET C C     1 
ATOM 4908  O O     . MET C 3 9   ? -82.386  -37.299 -21.765  1.00 119.65 ? 20   MET C O     1 
ATOM 4909  C CB    . MET C 3 9   ? -81.241  -38.411 -18.891  1.00 120.89 ? 20   MET C CB    1 
ATOM 4910  C CG    . MET C 3 9   ? -82.651  -38.728 -18.447  1.00 122.41 ? 20   MET C CG    1 
ATOM 4911  S SD    . MET C 3 9   ? -82.873  -40.522 -18.415  1.00 126.08 ? 20   MET C SD    1 
ATOM 4912  C CE    . MET C 3 9   ? -84.383  -40.678 -17.436  1.00 126.33 ? 20   MET C CE    1 
ATOM 4913  N N     . GLU C 3 10  ? -80.360  -36.487 -21.193  1.00 118.07 ? 21   GLU C N     1 
ATOM 4914  C CA    . GLU C 3 10  ? -80.525  -35.307 -22.012  1.00 116.70 ? 21   GLU C CA    1 
ATOM 4915  C C     . GLU C 3 10  ? -80.643  -35.657 -23.495  1.00 115.61 ? 21   GLU C C     1 
ATOM 4916  O O     . GLU C 3 10  ? -81.334  -34.958 -24.250  1.00 115.46 ? 21   GLU C O     1 
ATOM 4917  C CB    . GLU C 3 10  ? -79.427  -34.287 -21.751  1.00 116.75 ? 21   GLU C CB    1 
ATOM 4918  C CG    . GLU C 3 10  ? -79.945  -33.081 -21.025  1.00 117.56 ? 21   GLU C CG    1 
ATOM 4919  C CD    . GLU C 3 10  ? -81.176  -32.484 -21.705  1.00 119.39 ? 21   GLU C CD    1 
ATOM 4920  O OE1   . GLU C 3 10  ? -81.066  -31.983 -22.857  1.00 119.80 ? 21   GLU C OE1   1 
ATOM 4921  O OE2   . GLU C 3 10  ? -82.260  -32.514 -21.075  1.00 120.25 ? 21   GLU C OE2   1 
ATOM 4922  N N     . ARG C 3 11  ? -80.000  -36.754 -23.898  1.00 114.17 ? 22   ARG C N     1 
ATOM 4923  C CA    . ARG C 3 11  ? -80.085  -37.221 -25.288  1.00 112.65 ? 22   ARG C CA    1 
ATOM 4924  C C     . ARG C 3 11  ? -81.454  -37.847 -25.591  1.00 111.30 ? 22   ARG C C     1 
ATOM 4925  O O     . ARG C 3 11  ? -82.049  -37.574 -26.645  1.00 111.17 ? 22   ARG C O     1 
ATOM 4926  C CB    . ARG C 3 11  ? -78.939  -38.185 -25.628  1.00 112.77 ? 22   ARG C CB    1 
ATOM 4927  C CG    . ARG C 3 11  ? -78.791  -38.485 -27.105  1.00 112.22 ? 22   ARG C CG    1 
ATOM 4928  C CD    . ARG C 3 11  ? -77.409  -39.040 -27.411  1.00 112.03 ? 22   ARG C CD    1 
ATOM 4929  N NE    . ARG C 3 11  ? -77.355  -39.642 -28.744  1.00 111.63 ? 22   ARG C NE    1 
ATOM 4930  C CZ    . ARG C 3 11  ? -77.828  -40.849 -29.040  1.00 110.50 ? 22   ARG C CZ    1 
ATOM 4931  N NH1   . ARG C 3 11  ? -78.391  -41.583 -28.092  1.00 110.20 ? 22   ARG C NH1   1 
ATOM 4932  N NH2   . ARG C 3 11  ? -77.750  -41.315 -30.279  1.00 108.80 ? 22   ARG C NH2   1 
ATOM 4933  N N     . LEU C 3 12  ? -81.942  -38.674 -24.665  1.00 109.41 ? 23   LEU C N     1 
ATOM 4934  C CA    . LEU C 3 12  ? -83.244  -39.322 -24.819  1.00 107.62 ? 23   LEU C CA    1 
ATOM 4935  C C     . LEU C 3 12  ? -84.406  -38.317 -24.733  1.00 106.97 ? 23   LEU C C     1 
ATOM 4936  O O     . LEU C 3 12  ? -85.353  -38.382 -25.524  1.00 106.83 ? 23   LEU C O     1 
ATOM 4937  C CB    . LEU C 3 12  ? -83.412  -40.466 -23.819  1.00 106.98 ? 23   LEU C CB    1 
ATOM 4938  C CG    . LEU C 3 12  ? -84.840  -40.883 -23.460  1.00 105.23 ? 23   LEU C CG    1 
ATOM 4939  C CD1   . LEU C 3 12  ? -85.537  -41.547 -24.610  1.00 103.03 ? 23   LEU C CD1   1 
ATOM 4940  C CD2   . LEU C 3 12  ? -84.819  -41.810 -22.270  1.00 104.50 ? 23   LEU C CD2   1 
ATOM 4941  N N     . ARG C 3 13  ? -84.332  -37.388 -23.782  1.00 105.97 ? 24   ARG C N     1 
ATOM 4942  C CA    . ARG C 3 13  ? -85.313  -36.304 -23.722  1.00 105.19 ? 24   ARG C CA    1 
ATOM 4943  C C     . ARG C 3 13  ? -85.376  -35.604 -25.095  1.00 104.09 ? 24   ARG C C     1 
ATOM 4944  O O     . ARG C 3 13  ? -86.457  -35.229 -25.572  1.00 104.19 ? 24   ARG C O     1 
ATOM 4945  C CB    . ARG C 3 13  ? -84.964  -35.269 -22.628  1.00 105.58 ? 24   ARG C CB    1 
ATOM 4946  C CG    . ARG C 3 13  ? -85.172  -35.695 -21.173  1.00 107.16 ? 24   ARG C CG    1 
ATOM 4947  C CD    . ARG C 3 13  ? -84.830  -34.565 -20.192  1.00 110.11 ? 24   ARG C CD    1 
ATOM 4948  N NE    . ARG C 3 13  ? -84.468  -35.088 -18.869  1.00 113.95 ? 24   ARG C NE    1 
ATOM 4949  C CZ    . ARG C 3 13  ? -83.314  -34.856 -18.237  1.00 116.08 ? 24   ARG C CZ    1 
ATOM 4950  N NH1   . ARG C 3 13  ? -82.377  -34.084 -18.787  1.00 117.21 ? 24   ARG C NH1   1 
ATOM 4951  N NH2   . ARG C 3 13  ? -83.096  -35.396 -17.038  1.00 116.40 ? 24   ARG C NH2   1 
ATOM 4952  N N     . ARG C 3 14  ? -84.210  -35.436 -25.722  1.00 102.31 ? 25   ARG C N     1 
ATOM 4953  C CA    . ARG C 3 14  ? -84.114  -34.679 -26.959  1.00 100.49 ? 25   ARG C CA    1 
ATOM 4954  C C     . ARG C 3 14  ? -84.697  -35.462 -28.127  1.00 98.37  ? 25   ARG C C     1 
ATOM 4955  O O     . ARG C 3 14  ? -85.347  -34.879 -28.997  1.00 98.19  ? 25   ARG C O     1 
ATOM 4956  C CB    . ARG C 3 14  ? -82.666  -34.266 -27.220  1.00 101.10 ? 25   ARG C CB    1 
ATOM 4957  C CG    . ARG C 3 14  ? -82.418  -33.514 -28.543  1.00 103.59 ? 25   ARG C CG    1 
ATOM 4958  C CD    . ARG C 3 14  ? -81.071  -32.717 -28.539  1.00 107.50 ? 25   ARG C CD    1 
ATOM 4959  N NE    . ARG C 3 14  ? -80.098  -33.171 -27.534  1.00 108.93 ? 25   ARG C NE    1 
ATOM 4960  C CZ    . ARG C 3 14  ? -79.785  -32.498 -26.421  1.00 109.98 ? 25   ARG C CZ    1 
ATOM 4961  N NH1   . ARG C 3 14  ? -80.342  -31.309 -26.135  1.00 107.87 ? 25   ARG C NH1   1 
ATOM 4962  N NH2   . ARG C 3 14  ? -78.893  -33.028 -25.591  1.00 110.98 ? 25   ARG C NH2   1 
ATOM 4963  N N     . ARG C 3 15  ? -84.475  -36.777 -28.134  1.00 95.82  ? 26   ARG C N     1 
ATOM 4964  C CA    . ARG C 3 15  ? -85.009  -37.631 -29.202  1.00 93.35  ? 26   ARG C CA    1 
ATOM 4965  C C     . ARG C 3 15  ? -86.527  -37.629 -29.154  1.00 92.08  ? 26   ARG C C     1 
ATOM 4966  O O     . ARG C 3 15  ? -87.191  -37.201 -30.108  1.00 91.73  ? 26   ARG C O     1 
ATOM 4967  C CB    . ARG C 3 15  ? -84.498  -39.080 -29.114  1.00 93.02  ? 26   ARG C CB    1 
ATOM 4968  C CG    . ARG C 3 15  ? -85.227  -40.017 -30.067  1.00 91.01  ? 26   ARG C CG    1 
ATOM 4969  C CD    . ARG C 3 15  ? -84.490  -41.311 -30.299  1.00 89.43  ? 26   ARG C CD    1 
ATOM 4970  N NE    . ARG C 3 15  ? -85.164  -42.438 -29.659  1.00 88.59  ? 26   ARG C NE    1 
ATOM 4971  C CZ    . ARG C 3 15  ? -84.751  -43.025 -28.538  1.00 88.08  ? 26   ARG C CZ    1 
ATOM 4972  N NH1   . ARG C 3 15  ? -83.649  -42.591 -27.932  1.00 87.05  ? 26   ARG C NH1   1 
ATOM 4973  N NH2   . ARG C 3 15  ? -85.444  -44.042 -28.015  1.00 87.98  ? 26   ARG C NH2   1 
ATOM 4974  N N     . ILE C 3 16  ? -87.055  -38.113 -28.024  1.00 90.37  ? 27   ILE C N     1 
ATOM 4975  C CA    . ILE C 3 16  ? -88.495  -38.176 -27.760  1.00 88.00  ? 27   ILE C CA    1 
ATOM 4976  C C     . ILE C 3 16  ? -89.166  -36.844 -28.134  1.00 87.13  ? 27   ILE C C     1 
ATOM 4977  O O     . ILE C 3 16  ? -90.189  -36.844 -28.831  1.00 87.20  ? 27   ILE C O     1 
ATOM 4978  C CB    . ILE C 3 16  ? -88.768  -38.637 -26.328  1.00 87.17  ? 27   ILE C CB    1 
ATOM 4979  C CG1   . ILE C 3 16  ? -88.917  -40.140 -26.328  1.00 86.53  ? 27   ILE C CG1   1 
ATOM 4980  C CG2   . ILE C 3 16  ? -90.023  -38.080 -25.825  1.00 86.62  ? 27   ILE C CG2   1 
ATOM 4981  C CD1   . ILE C 3 16  ? -89.054  -40.753 -24.933  1.00 88.62  ? 27   ILE C CD1   1 
ATOM 4982  N N     . GLU C 3 17  ? -88.551  -35.726 -27.745  1.00 85.48  ? 28   GLU C N     1 
ATOM 4983  C CA    . GLU C 3 17  ? -89.065  -34.440 -28.130  1.00 84.11  ? 28   GLU C CA    1 
ATOM 4984  C C     . GLU C 3 17  ? -89.214  -34.332 -29.625  1.00 83.81  ? 28   GLU C C     1 
ATOM 4985  O O     . GLU C 3 17  ? -90.159  -33.708 -30.103  1.00 84.17  ? 28   GLU C O     1 
ATOM 4986  C CB    . GLU C 3 17  ? -88.192  -33.303 -27.642  1.00 84.00  ? 28   GLU C CB    1 
ATOM 4987  C CG    . GLU C 3 17  ? -88.604  -31.924 -28.232  1.00 82.76  ? 28   GLU C CG    1 
ATOM 4988  C CD    . GLU C 3 17  ? -89.992  -31.447 -27.777  1.00 80.81  ? 28   GLU C CD    1 
ATOM 4989  O OE1   . GLU C 3 17  ? -90.596  -32.114 -26.907  1.00 80.65  ? 28   GLU C OE1   1 
ATOM 4990  O OE2   . GLU C 3 17  ? -90.478  -30.410 -28.289  1.00 78.66  ? 28   GLU C OE2   1 
ATOM 4991  N N     . LEU C 3 18  ? -88.307  -34.939 -30.382  1.00 83.22  ? 29   LEU C N     1 
ATOM 4992  C CA    . LEU C 3 18  ? -88.389  -34.809 -31.855  1.00 82.41  ? 29   LEU C CA    1 
ATOM 4993  C C     . LEU C 3 18  ? -89.658  -35.440 -32.399  1.00 81.77  ? 29   LEU C C     1 
ATOM 4994  O O     . LEU C 3 18  ? -90.446  -34.778 -33.077  1.00 80.85  ? 29   LEU C O     1 
ATOM 4995  C CB    . LEU C 3 18  ? -87.145  -35.351 -32.588  1.00 82.08  ? 29   LEU C CB    1 
ATOM 4996  C CG    . LEU C 3 18  ? -86.474  -34.380 -33.576  1.00 80.69  ? 29   LEU C CG    1 
ATOM 4997  C CD1   . LEU C 3 18  ? -86.028  -35.150 -34.751  1.00 78.90  ? 29   LEU C CD1   1 
ATOM 4998  C CD2   . LEU C 3 18  ? -87.368  -33.208 -34.042  1.00 81.36  ? 29   LEU C CD2   1 
ATOM 4999  N N     . CYS C 3 19  ? -89.839  -36.711 -32.059  1.00 81.49  ? 30   CYS C N     1 
ATOM 5000  C CA    . CYS C 3 19  ? -91.054  -37.450 -32.385  1.00 81.99  ? 30   CYS C CA    1 
ATOM 5001  C C     . CYS C 3 19  ? -92.288  -36.707 -31.930  1.00 81.87  ? 30   CYS C C     1 
ATOM 5002  O O     . CYS C 3 19  ? -93.213  -36.474 -32.736  1.00 81.94  ? 30   CYS C O     1 
ATOM 5003  C CB    . CYS C 3 19  ? -91.064  -38.796 -31.681  1.00 82.11  ? 30   CYS C CB    1 
ATOM 5004  S SG    . CYS C 3 19  ? -89.472  -39.534 -31.503  1.00 82.85  ? 30   CYS C SG    1 
ATOM 5005  N N     . ARG C 3 20  ? -92.287  -36.373 -30.633  1.00 81.28  ? 31   ARG C N     1 
ATOM 5006  C CA    . ARG C 3 20  ? -93.329  -35.581 -30.003  1.00 80.84  ? 31   ARG C CA    1 
ATOM 5007  C C     . ARG C 3 20  ? -93.646  -34.346 -30.849  1.00 80.21  ? 31   ARG C C     1 
ATOM 5008  O O     . ARG C 3 20  ? -94.759  -34.199 -31.369  1.00 80.53  ? 31   ARG C O     1 
ATOM 5009  C CB    . ARG C 3 20  ? -92.914  -35.166 -28.586  1.00 81.05  ? 31   ARG C CB    1 
ATOM 5010  C CG    . ARG C 3 20  ? -93.987  -35.427 -27.521  1.00 82.12  ? 31   ARG C CG    1 
ATOM 5011  C CD    . ARG C 3 20  ? -93.617  -36.549 -26.558  1.00 81.68  ? 31   ARG C CD    1 
ATOM 5012  N NE    . ARG C 3 20  ? -93.116  -36.002 -25.305  1.00 83.46  ? 31   ARG C NE    1 
ATOM 5013  C CZ    . ARG C 3 20  ? -93.018  -36.691 -24.168  1.00 86.95  ? 31   ARG C CZ    1 
ATOM 5014  N NH1   . ARG C 3 20  ? -93.382  -37.977 -24.100  1.00 85.60  ? 31   ARG C NH1   1 
ATOM 5015  N NH2   . ARG C 3 20  ? -92.539  -36.086 -23.078  1.00 89.95  ? 31   ARG C NH2   1 
ATOM 5016  N N     . ARG C 3 21  ? -92.662  -33.478 -31.021  1.00 79.34  ? 32   ARG C N     1 
ATOM 5017  C CA    . ARG C 3 21  ? -92.882  -32.256 -31.776  1.00 78.72  ? 32   ARG C CA    1 
ATOM 5018  C C     . ARG C 3 21  ? -93.421  -32.545 -33.154  1.00 78.73  ? 32   ARG C C     1 
ATOM 5019  O O     . ARG C 3 21  ? -94.294  -31.825 -33.641  1.00 78.41  ? 32   ARG C O     1 
ATOM 5020  C CB    . ARG C 3 21  ? -91.582  -31.473 -31.942  1.00 78.59  ? 32   ARG C CB    1 
ATOM 5021  C CG    . ARG C 3 21  ? -91.758  -30.005 -32.321  1.00 76.98  ? 32   ARG C CG    1 
ATOM 5022  C CD    . ARG C 3 21  ? -92.269  -29.757 -33.713  1.00 74.59  ? 32   ARG C CD    1 
ATOM 5023  N NE    . ARG C 3 21  ? -92.250  -28.323 -34.002  1.00 75.58  ? 32   ARG C NE    1 
ATOM 5024  C CZ    . ARG C 3 21  ? -93.291  -27.489 -33.888  1.00 74.60  ? 32   ARG C CZ    1 
ATOM 5025  N NH1   . ARG C 3 21  ? -94.487  -27.915 -33.488  1.00 74.34  ? 32   ARG C NH1   1 
ATOM 5026  N NH2   . ARG C 3 21  ? -93.143  -26.207 -34.182  1.00 73.51  ? 32   ARG C NH2   1 
ATOM 5027  N N     . HIS C 3 22  ? -92.849  -33.569 -33.796  1.00 78.80  ? 33   HIS C N     1 
ATOM 5028  C CA    . HIS C 3 22  ? -93.199  -33.923 -35.167  1.00 78.47  ? 33   HIS C CA    1 
ATOM 5029  C C     . HIS C 3 22  ? -94.646  -34.298 -35.129  1.00 78.61  ? 33   HIS C C     1 
ATOM 5030  O O     . HIS C 3 22  ? -95.491  -33.583 -35.699  1.00 78.77  ? 33   HIS C O     1 
ATOM 5031  C CB    . HIS C 3 22  ? -92.362  -35.102 -35.674  1.00 78.38  ? 33   HIS C CB    1 
ATOM 5032  C CG    . HIS C 3 22  ? -92.722  -35.562 -37.052  1.00 76.62  ? 33   HIS C CG    1 
ATOM 5033  N ND1   . HIS C 3 22  ? -92.646  -34.739 -38.154  1.00 75.97  ? 33   HIS C ND1   1 
ATOM 5034  C CD2   . HIS C 3 22  ? -93.149  -36.763 -37.503  1.00 74.23  ? 33   HIS C CD2   1 
ATOM 5035  C CE1   . HIS C 3 22  ? -93.025  -35.413 -39.225  1.00 75.21  ? 33   HIS C CE1   1 
ATOM 5036  N NE2   . HIS C 3 22  ? -93.333  -36.643 -38.856  1.00 74.41  ? 33   HIS C NE2   1 
ATOM 5037  N N     . HIS C 3 23  ? -94.925  -35.382 -34.403  1.00 78.36  ? 34   HIS C N     1 
ATOM 5038  C CA    . HIS C 3 23  ? -96.273  -35.920 -34.313  1.00 78.50  ? 34   HIS C CA    1 
ATOM 5039  C C     . HIS C 3 23  ? -97.301  -34.810 -34.177  1.00 79.10  ? 34   HIS C C     1 
ATOM 5040  O O     . HIS C 3 23  ? -98.261  -34.738 -34.932  1.00 78.73  ? 34   HIS C O     1 
ATOM 5041  C CB    . HIS C 3 23  ? -96.399  -36.877 -33.140  1.00 78.04  ? 34   HIS C CB    1 
ATOM 5042  C CG    . HIS C 3 23  ? -97.778  -37.402 -32.960  1.00 76.39  ? 34   HIS C CG    1 
ATOM 5043  N ND1   . HIS C 3 23  ? -98.897  -36.643 -33.226  1.00 75.03  ? 34   HIS C ND1   1 
ATOM 5044  C CD2   . HIS C 3 23  ? -98.225  -38.612 -32.563  1.00 75.64  ? 34   HIS C CD2   1 
ATOM 5045  C CE1   . HIS C 3 23  ? -99.979  -37.359 -32.991  1.00 75.94  ? 34   HIS C CE1   1 
ATOM 5046  N NE2   . HIS C 3 23  ? -99.598  -38.558 -32.582  1.00 77.14  ? 34   HIS C NE2   1 
ATOM 5047  N N     . SER C 3 24  ? -97.084  -33.953 -33.193  1.00 80.24  ? 35   SER C N     1 
ATOM 5048  C CA    . SER C 3 24  ? -97.828  -32.719 -33.084  1.00 81.58  ? 35   SER C CA    1 
ATOM 5049  C C     . SER C 3 24  ? -98.095  -32.059 -34.470  1.00 82.20  ? 35   SER C C     1 
ATOM 5050  O O     . SER C 3 24  ? -99.238  -32.056 -34.914  1.00 82.24  ? 35   SER C O     1 
ATOM 5051  C CB    . SER C 3 24  ? -97.111  -31.789 -32.098  1.00 81.57  ? 35   SER C CB    1 
ATOM 5052  O OG    . SER C 3 24  ? -97.748  -30.524 -32.001  1.00 83.41  ? 35   SER C OG    1 
ATOM 5053  N N     . THR C 3 25  ? -97.060  -31.561 -35.158  1.00 83.40  ? 36   THR C N     1 
ATOM 5054  C CA    . THR C 3 25  ? -97.222  -30.780 -36.403  1.00 84.75  ? 36   THR C CA    1 
ATOM 5055  C C     . THR C 3 25  ? -98.028  -31.534 -37.437  1.00 86.80  ? 36   THR C C     1 
ATOM 5056  O O     . THR C 3 25  ? -98.728  -30.938 -38.265  1.00 87.46  ? 36   THR C O     1 
ATOM 5057  C CB    . THR C 3 25  ? -95.898  -30.507 -37.093  1.00 84.20  ? 36   THR C CB    1 
ATOM 5058  O OG1   . THR C 3 25  ? -94.828  -30.668 -36.152  1.00 84.19  ? 36   THR C OG1   1 
ATOM 5059  C CG2   . THR C 3 25  ? -95.890  -29.107 -37.754  1.00 82.46  ? 36   THR C CG2   1 
ATOM 5060  N N     . CYS C 3 26  ? -97.911  -32.855 -37.407  1.00 88.54  ? 37   CYS C N     1 
ATOM 5061  C CA    . CYS C 3 26  ? -98.669  -33.703 -38.322  1.00 89.90  ? 37   CYS C CA    1 
ATOM 5062  C C     . CYS C 3 26  ? -100.131 -33.702 -37.936  1.00 90.76  ? 37   CYS C C     1 
ATOM 5063  O O     . CYS C 3 26  ? -100.951 -33.214 -38.682  1.00 90.73  ? 37   CYS C O     1 
ATOM 5064  C CB    . CYS C 3 26  ? -98.101  -35.131 -38.340  1.00 89.86  ? 37   CYS C CB    1 
ATOM 5065  S SG    . CYS C 3 26  ? -96.425  -35.248 -39.039  1.00 89.78  ? 37   CYS C SG    1 
ATOM 5066  N N     . GLU C 3 27  ? -100.428 -34.204 -36.739  1.00 92.46  ? 38   GLU C N     1 
ATOM 5067  C CA    . GLU C 3 27  ? -101.811 -34.402 -36.264  1.00 94.03  ? 38   GLU C CA    1 
ATOM 5068  C C     . GLU C 3 27  ? -102.548 -33.094 -36.177  1.00 94.57  ? 38   GLU C C     1 
ATOM 5069  O O     . GLU C 3 27  ? -103.649 -33.051 -35.656  1.00 95.08  ? 38   GLU C O     1 
ATOM 5070  C CB    . GLU C 3 27  ? -101.862 -35.124 -34.890  1.00 93.97  ? 38   GLU C CB    1 
ATOM 5071  C CG    . GLU C 3 27  ? -103.259 -35.635 -34.486  1.00 95.12  ? 38   GLU C CG    1 
ATOM 5072  C CD    . GLU C 3 27  ? -103.459 -35.757 -32.975  1.00 97.78  ? 38   GLU C CD    1 
ATOM 5073  O OE1   . GLU C 3 27  ? -102.642 -35.208 -32.197  1.00 98.80  ? 38   GLU C OE1   1 
ATOM 5074  O OE2   . GLU C 3 27  ? -104.453 -36.408 -32.565  1.00 97.97  ? 38   GLU C OE2   1 
ATOM 5075  N N     . ALA C 3 28  ? -101.943 -32.040 -36.697  1.00 95.21  ? 39   ALA C N     1 
ATOM 5076  C CA    . ALA C 3 28  ? -102.487 -30.730 -36.539  1.00 96.27  ? 39   ALA C CA    1 
ATOM 5077  C C     . ALA C 3 28  ? -102.785 -30.144 -37.884  1.00 97.41  ? 39   ALA C C     1 
ATOM 5078  O O     . ALA C 3 28  ? -103.635 -29.262 -37.996  1.00 97.53  ? 39   ALA C O     1 
ATOM 5079  C CB    . ALA C 3 28  ? -101.522 -29.884 -35.808  1.00 96.18  ? 39   ALA C CB    1 
ATOM 5080  N N     . ARG C 3 29  ? -102.056 -30.615 -38.897  1.00 99.01  ? 40   ARG C N     1 
ATOM 5081  C CA    . ARG C 3 29  ? -102.328 -30.255 -40.285  1.00 100.55 ? 40   ARG C CA    1 
ATOM 5082  C C     . ARG C 3 29  ? -103.516 -31.102 -40.703  1.00 100.77 ? 40   ARG C C     1 
ATOM 5083  O O     . ARG C 3 29  ? -104.477 -30.592 -41.241  1.00 100.97 ? 40   ARG C O     1 
ATOM 5084  C CB    . ARG C 3 29  ? -101.115 -30.509 -41.207  1.00 100.96 ? 40   ARG C CB    1 
ATOM 5085  C CG    . ARG C 3 29  ? -101.051 -31.970 -41.763  1.00 104.24 ? 40   ARG C CG    1 
ATOM 5086  C CD    . ARG C 3 29  ? -100.260 -32.179 -43.070  1.00 107.50 ? 40   ARG C CD    1 
ATOM 5087  N NE    . ARG C 3 29  ? -98.905  -32.658 -42.807  1.00 108.43 ? 40   ARG C NE    1 
ATOM 5088  C CZ    . ARG C 3 29  ? -97.811  -31.906 -42.890  1.00 109.18 ? 40   ARG C CZ    1 
ATOM 5089  N NH1   . ARG C 3 29  ? -97.882  -30.619 -43.256  1.00 108.81 ? 40   ARG C NH1   1 
ATOM 5090  N NH2   . ARG C 3 29  ? -96.635  -32.450 -42.614  1.00 109.85 ? 40   ARG C NH2   1 
ATOM 5091  N N     . TYR C 3 30  ? -103.450 -32.394 -40.412  1.00 101.56 ? 41   TYR C N     1 
ATOM 5092  C CA    . TYR C 3 30  ? -104.455 -33.358 -40.828  1.00 102.29 ? 41   TYR C CA    1 
ATOM 5093  C C     . TYR C 3 30  ? -105.846 -32.939 -40.380  1.00 102.80 ? 41   TYR C C     1 
ATOM 5094  O O     . TYR C 3 30  ? -106.798 -32.967 -41.179  1.00 102.72 ? 41   TYR C O     1 
ATOM 5095  C CB    . TYR C 3 30  ? -104.107 -34.729 -40.255  1.00 102.36 ? 41   TYR C CB    1 
ATOM 5096  C CG    . TYR C 3 30  ? -104.974 -35.876 -40.741  1.00 102.61 ? 41   TYR C CG    1 
ATOM 5097  C CD1   . TYR C 3 30  ? -105.052 -36.197 -42.091  1.00 102.54 ? 41   TYR C CD1   1 
ATOM 5098  C CD2   . TYR C 3 30  ? -105.693 -36.654 -39.841  1.00 103.46 ? 41   TYR C CD2   1 
ATOM 5099  C CE1   . TYR C 3 30  ? -105.824 -37.248 -42.531  1.00 102.56 ? 41   TYR C CE1   1 
ATOM 5100  C CE2   . TYR C 3 30  ? -106.462 -37.709 -40.275  1.00 104.16 ? 41   TYR C CE2   1 
ATOM 5101  C CZ    . TYR C 3 30  ? -106.523 -38.003 -41.621  1.00 103.63 ? 41   TYR C CZ    1 
ATOM 5102  O OH    . TYR C 3 30  ? -107.290 -39.063 -42.043  1.00 104.05 ? 41   TYR C OH    1 
ATOM 5103  N N     . GLU C 3 31  ? -105.933 -32.542 -39.102  1.00 103.37 ? 42   GLU C N     1 
ATOM 5104  C CA    . GLU C 3 31  ? -107.151 -31.995 -38.480  1.00 103.85 ? 42   GLU C CA    1 
ATOM 5105  C C     . GLU C 3 31  ? -107.610 -30.696 -39.154  1.00 103.94 ? 42   GLU C C     1 
ATOM 5106  O O     . GLU C 3 31  ? -108.796 -30.469 -39.335  1.00 103.61 ? 42   GLU C O     1 
ATOM 5107  C CB    . GLU C 3 31  ? -106.902 -31.732 -36.991  1.00 103.82 ? 42   GLU C CB    1 
ATOM 5108  C CG    . GLU C 3 31  ? -107.945 -32.301 -36.059  1.00 105.60 ? 42   GLU C CG    1 
ATOM 5109  C CD    . GLU C 3 31  ? -107.752 -33.804 -35.808  1.00 109.35 ? 42   GLU C CD    1 
ATOM 5110  O OE1   . GLU C 3 31  ? -107.180 -34.164 -34.745  1.00 110.40 ? 42   GLU C OE1   1 
ATOM 5111  O OE2   . GLU C 3 31  ? -108.162 -34.628 -36.673  1.00 110.53 ? 42   GLU C OE2   1 
ATOM 5112  N N     . ALA C 3 32  ? -106.657 -29.851 -39.523  1.00 104.59 ? 43   ALA C N     1 
ATOM 5113  C CA    . ALA C 3 32  ? -106.965 -28.555 -40.056  1.00 105.54 ? 43   ALA C CA    1 
ATOM 5114  C C     . ALA C 3 32  ? -107.477 -28.657 -41.465  1.00 106.65 ? 43   ALA C C     1 
ATOM 5115  O O     . ALA C 3 32  ? -108.409 -27.974 -41.827  1.00 107.03 ? 43   ALA C O     1 
ATOM 5116  C CB    . ALA C 3 32  ? -105.774 -27.688 -40.005  1.00 105.45 ? 43   ALA C CB    1 
ATOM 5117  N N     . VAL C 3 33  ? -106.880 -29.516 -42.273  1.00 108.31 ? 44   VAL C N     1 
ATOM 5118  C CA    . VAL C 3 33  ? -107.304 -29.626 -43.669  1.00 109.51 ? 44   VAL C CA    1 
ATOM 5119  C C     . VAL C 3 33  ? -108.601 -30.426 -43.831  1.00 110.93 ? 44   VAL C C     1 
ATOM 5120  O O     . VAL C 3 33  ? -109.321 -30.226 -44.810  1.00 111.20 ? 44   VAL C O     1 
ATOM 5121  C CB    . VAL C 3 33  ? -106.201 -30.201 -44.583  1.00 109.09 ? 44   VAL C CB    1 
ATOM 5122  C CG1   . VAL C 3 33  ? -105.120 -29.173 -44.836  1.00 108.08 ? 44   VAL C CG1   1 
ATOM 5123  C CG2   . VAL C 3 33  ? -105.628 -31.482 -44.000  1.00 109.29 ? 44   VAL C CG2   1 
ATOM 5124  N N     . SER C 3 34  ? -108.910 -31.296 -42.861  1.00 112.53 ? 45   SER C N     1 
ATOM 5125  C CA    . SER C 3 34  ? -109.952 -32.330 -43.026  1.00 114.19 ? 45   SER C CA    1 
ATOM 5126  C C     . SER C 3 34  ? -111.377 -31.867 -43.386  1.00 115.56 ? 45   SER C C     1 
ATOM 5127  O O     . SER C 3 34  ? -112.007 -32.502 -44.219  1.00 115.61 ? 45   SER C O     1 
ATOM 5128  C CB    . SER C 3 34  ? -109.941 -33.339 -41.871  1.00 114.09 ? 45   SER C CB    1 
ATOM 5129  O OG    . SER C 3 34  ? -110.868 -33.002 -40.861  1.00 114.64 ? 45   SER C OG    1 
ATOM 5130  N N     . PRO C 3 35  ? -111.892 -30.791 -42.755  1.00 117.17 ? 46   PRO C N     1 
ATOM 5131  C CA    . PRO C 3 35  ? -113.003 -30.062 -43.352  1.00 118.63 ? 46   PRO C CA    1 
ATOM 5132  C C     . PRO C 3 35  ? -112.931 -29.932 -44.885  1.00 120.09 ? 46   PRO C C     1 
ATOM 5133  O O     . PRO C 3 35  ? -113.591 -30.689 -45.604  1.00 120.07 ? 46   PRO C O     1 
ATOM 5134  C CB    . PRO C 3 35  ? -112.875 -28.693 -42.686  1.00 118.45 ? 46   PRO C CB    1 
ATOM 5135  C CG    . PRO C 3 35  ? -112.486 -29.056 -41.287  1.00 118.15 ? 46   PRO C CG    1 
ATOM 5136  C CD    . PRO C 3 35  ? -111.730 -30.375 -41.351  1.00 117.32 ? 46   PRO C CD    1 
ATOM 5137  N N     . GLU C 3 36  ? -112.135 -28.990 -45.379  1.00 121.82 ? 47   GLU C N     1 
ATOM 5138  C CA    . GLU C 3 36  ? -111.948 -28.848 -46.815  1.00 123.57 ? 47   GLU C CA    1 
ATOM 5139  C C     . GLU C 3 36  ? -111.719 -30.190 -47.535  1.00 124.60 ? 47   GLU C C     1 
ATOM 5140  O O     . GLU C 3 36  ? -112.040 -30.329 -48.717  1.00 124.92 ? 47   GLU C O     1 
ATOM 5141  C CB    . GLU C 3 36  ? -110.785 -27.901 -47.098  1.00 123.71 ? 47   GLU C CB    1 
ATOM 5142  C CG    . GLU C 3 36  ? -110.427 -27.811 -48.570  1.00 124.39 ? 47   GLU C CG    1 
ATOM 5143  C CD    . GLU C 3 36  ? -109.022 -27.337 -48.808  1.00 125.11 ? 47   GLU C CD    1 
ATOM 5144  O OE1   . GLU C 3 36  ? -108.242 -27.196 -47.837  1.00 125.63 ? 47   GLU C OE1   1 
ATOM 5145  O OE2   . GLU C 3 36  ? -108.702 -27.107 -49.990  1.00 125.31 ? 47   GLU C OE2   1 
ATOM 5146  N N     . ARG C 3 37  ? -111.166 -31.171 -46.831  1.00 125.97 ? 48   ARG C N     1 
ATOM 5147  C CA    . ARG C 3 37  ? -110.789 -32.422 -47.476  1.00 127.47 ? 48   ARG C CA    1 
ATOM 5148  C C     . ARG C 3 37  ? -111.967 -33.388 -47.561  1.00 128.39 ? 48   ARG C C     1 
ATOM 5149  O O     . ARG C 3 37  ? -112.156 -34.061 -48.574  1.00 128.59 ? 48   ARG C O     1 
ATOM 5150  C CB    . ARG C 3 37  ? -109.588 -33.058 -46.777  1.00 127.38 ? 48   ARG C CB    1 
ATOM 5151  C CG    . ARG C 3 37  ? -108.799 -33.986 -47.671  1.00 127.70 ? 48   ARG C CG    1 
ATOM 5152  C CD    . ARG C 3 37  ? -107.955 -34.963 -46.875  1.00 128.62 ? 48   ARG C CD    1 
ATOM 5153  N NE    . ARG C 3 37  ? -108.732 -35.697 -45.872  1.00 128.67 ? 48   ARG C NE    1 
ATOM 5154  C CZ    . ARG C 3 37  ? -108.439 -35.730 -44.576  1.00 128.46 ? 48   ARG C CZ    1 
ATOM 5155  N NH1   . ARG C 3 37  ? -107.371 -35.079 -44.112  1.00 128.45 ? 48   ARG C NH1   1 
ATOM 5156  N NH2   . ARG C 3 37  ? -109.207 -36.425 -43.749  1.00 127.05 ? 48   ARG C NH2   1 
ATOM 5157  N N     . LEU C 3 38  ? -112.760 -33.445 -46.500  1.00 129.65 ? 49   LEU C N     1 
ATOM 5158  C CA    . LEU C 3 38  ? -114.011 -34.200 -46.496  1.00 131.03 ? 49   LEU C CA    1 
ATOM 5159  C C     . LEU C 3 38  ? -114.991 -33.683 -47.569  1.00 131.92 ? 49   LEU C C     1 
ATOM 5160  O O     . LEU C 3 38  ? -116.021 -34.304 -47.836  1.00 132.03 ? 49   LEU C O     1 
ATOM 5161  C CB    . LEU C 3 38  ? -114.617 -34.154 -45.079  1.00 131.02 ? 49   LEU C CB    1 
ATOM 5162  C CG    . LEU C 3 38  ? -116.102 -34.180 -44.681  1.00 131.10 ? 49   LEU C CG    1 
ATOM 5163  C CD1   . LEU C 3 38  ? -116.190 -34.468 -43.181  1.00 131.25 ? 49   LEU C CD1   1 
ATOM 5164  C CD2   . LEU C 3 38  ? -116.864 -32.886 -45.027  1.00 130.21 ? 49   LEU C CD2   1 
ATOM 5165  N N     . GLU C 3 39  ? -114.638 -32.569 -48.209  1.00 133.14 ? 50   GLU C N     1 
ATOM 5166  C CA    . GLU C 3 39  ? -115.581 -31.823 -49.050  1.00 134.27 ? 50   GLU C CA    1 
ATOM 5167  C C     . GLU C 3 39  ? -115.699 -32.272 -50.509  1.00 134.93 ? 50   GLU C C     1 
ATOM 5168  O O     . GLU C 3 39  ? -116.750 -32.097 -51.121  1.00 135.18 ? 50   GLU C O     1 
ATOM 5169  C CB    . GLU C 3 39  ? -115.323 -30.312 -48.948  1.00 134.39 ? 50   GLU C CB    1 
ATOM 5170  C CG    . GLU C 3 39  ? -116.559 -29.437 -49.138  1.00 134.00 ? 50   GLU C CG    1 
ATOM 5171  C CD    . GLU C 3 39  ? -117.731 -29.834 -48.250  1.00 133.61 ? 50   GLU C CD    1 
ATOM 5172  O OE1   . GLU C 3 39  ? -118.776 -29.171 -48.369  1.00 134.21 ? 50   GLU C OE1   1 
ATOM 5173  O OE2   . GLU C 3 39  ? -117.629 -30.791 -47.447  1.00 132.70 ? 50   GLU C OE2   1 
ATOM 5174  N N     . LEU C 3 40  ? -114.638 -32.833 -51.069  1.00 135.75 ? 51   LEU C N     1 
ATOM 5175  C CA    . LEU C 3 40  ? -114.776 -33.524 -52.340  1.00 136.76 ? 51   LEU C CA    1 
ATOM 5176  C C     . LEU C 3 40  ? -115.224 -34.973 -52.066  1.00 137.65 ? 51   LEU C C     1 
ATOM 5177  O O     . LEU C 3 40  ? -115.301 -35.791 -52.984  1.00 137.93 ? 51   LEU C O     1 
ATOM 5178  C CB    . LEU C 3 40  ? -113.472 -33.442 -53.157  1.00 136.67 ? 51   LEU C CB    1 
ATOM 5179  C CG    . LEU C 3 40  ? -113.499 -33.543 -54.694  1.00 136.36 ? 51   LEU C CG    1 
ATOM 5180  C CD1   . LEU C 3 40  ? -112.596 -32.479 -55.328  1.00 135.35 ? 51   LEU C CD1   1 
ATOM 5181  C CD2   . LEU C 3 40  ? -113.154 -34.956 -55.215  1.00 135.66 ? 51   LEU C CD2   1 
ATOM 5182  N N     . GLU C 3 41  ? -115.532 -35.272 -50.800  1.00 138.67 ? 52   GLU C N     1 
ATOM 5183  C CA    . GLU C 3 41  ? -116.013 -36.597 -50.385  1.00 139.89 ? 52   GLU C CA    1 
ATOM 5184  C C     . GLU C 3 41  ? -117.505 -36.576 -50.066  1.00 140.46 ? 52   GLU C C     1 
ATOM 5185  O O     . GLU C 3 41  ? -118.196 -37.574 -50.243  1.00 140.33 ? 52   GLU C O     1 
ATOM 5186  C CB    . GLU C 3 41  ? -115.201 -37.135 -49.190  1.00 140.23 ? 52   GLU C CB    1 
ATOM 5187  C CG    . GLU C 3 41  ? -115.649 -38.523 -48.607  1.00 141.11 ? 52   GLU C CG    1 
ATOM 5188  C CD    . GLU C 3 41  ? -115.016 -39.765 -49.297  1.00 141.60 ? 52   GLU C CD    1 
ATOM 5189  O OE1   . GLU C 3 41  ? -114.895 -40.815 -48.620  1.00 141.32 ? 52   GLU C OE1   1 
ATOM 5190  O OE2   . GLU C 3 41  ? -114.653 -39.706 -50.501  1.00 141.50 ? 52   GLU C OE2   1 
ATOM 5191  N N     . ARG C 3 42  ? -117.991 -35.438 -49.582  1.00 141.61 ? 53   ARG C N     1 
ATOM 5192  C CA    . ARG C 3 42  ? -119.434 -35.208 -49.455  1.00 142.74 ? 53   ARG C CA    1 
ATOM 5193  C C     . ARG C 3 42  ? -120.032 -34.977 -50.827  1.00 142.88 ? 53   ARG C C     1 
ATOM 5194  O O     . ARG C 3 42  ? -120.763 -35.821 -51.335  1.00 143.06 ? 53   ARG C O     1 
ATOM 5195  C CB    . ARG C 3 42  ? -119.744 -33.999 -48.569  1.00 143.06 ? 53   ARG C CB    1 
ATOM 5196  C CG    . ARG C 3 42  ? -119.487 -34.218 -47.099  1.00 145.10 ? 53   ARG C CG    1 
ATOM 5197  C CD    . ARG C 3 42  ? -120.201 -35.456 -46.572  1.00 148.33 ? 53   ARG C CD    1 
ATOM 5198  N NE    . ARG C 3 42  ? -119.901 -35.667 -45.156  1.00 150.89 ? 53   ARG C NE    1 
ATOM 5199  C CZ    . ARG C 3 42  ? -118.871 -36.370 -44.695  1.00 151.47 ? 53   ARG C CZ    1 
ATOM 5200  N NH1   . ARG C 3 42  ? -118.693 -36.493 -43.389  1.00 151.74 ? 53   ARG C NH1   1 
ATOM 5201  N NH2   . ARG C 3 42  ? -118.020 -36.947 -45.534  1.00 152.11 ? 53   ARG C NH2   1 
ATOM 5202  N N     . GLN C 3 43  ? -119.702 -33.842 -51.436  1.00 142.98 ? 54   GLN C N     1 
ATOM 5203  C CA    . GLN C 3 43  ? -120.202 -33.519 -52.763  1.00 143.19 ? 54   GLN C CA    1 
ATOM 5204  C C     . GLN C 3 43  ? -120.187 -34.713 -53.711  1.00 142.97 ? 54   GLN C C     1 
ATOM 5205  O O     . GLN C 3 43  ? -120.999 -34.772 -54.628  1.00 143.00 ? 54   GLN C O     1 
ATOM 5206  C CB    . GLN C 3 43  ? -119.426 -32.355 -53.369  1.00 143.49 ? 54   GLN C CB    1 
ATOM 5207  C CG    . GLN C 3 43  ? -120.132 -31.698 -54.555  1.00 144.31 ? 54   GLN C CG    1 
ATOM 5208  C CD    . GLN C 3 43  ? -119.792 -30.228 -54.692  1.00 145.22 ? 54   GLN C CD    1 
ATOM 5209  O OE1   . GLN C 3 43  ? -118.793 -29.749 -54.144  1.00 145.04 ? 54   GLN C OE1   1 
ATOM 5210  N NE2   . GLN C 3 43  ? -120.630 -29.497 -55.425  1.00 145.81 ? 54   GLN C NE2   1 
ATOM 5211  N N     . HIS C 3 44  ? -119.278 -35.657 -53.483  1.00 142.84 ? 55   HIS C N     1 
ATOM 5212  C CA    . HIS C 3 44  ? -119.241 -36.883 -54.273  1.00 142.98 ? 55   HIS C CA    1 
ATOM 5213  C C     . HIS C 3 44  ? -120.249 -37.932 -53.803  1.00 142.95 ? 55   HIS C C     1 
ATOM 5214  O O     . HIS C 3 44  ? -120.940 -38.506 -54.627  1.00 142.96 ? 55   HIS C O     1 
ATOM 5215  C CB    . HIS C 3 44  ? -117.828 -37.465 -54.341  1.00 143.14 ? 55   HIS C CB    1 
ATOM 5216  C CG    . HIS C 3 44  ? -117.661 -38.539 -55.375  1.00 143.56 ? 55   HIS C CG    1 
ATOM 5217  N ND1   . HIS C 3 44  ? -117.692 -39.885 -55.068  1.00 144.09 ? 55   HIS C ND1   1 
ATOM 5218  C CD2   . HIS C 3 44  ? -117.457 -38.464 -56.711  1.00 143.62 ? 55   HIS C CD2   1 
ATOM 5219  C CE1   . HIS C 3 44  ? -117.514 -40.591 -56.170  1.00 143.83 ? 55   HIS C CE1   1 
ATOM 5220  N NE2   . HIS C 3 44  ? -117.373 -39.753 -57.182  1.00 143.80 ? 55   HIS C NE2   1 
ATOM 5221  N N     . THR C 3 45  ? -120.340 -38.178 -52.495  1.00 143.14 ? 56   THR C N     1 
ATOM 5222  C CA    . THR C 3 45  ? -121.330 -39.122 -51.920  1.00 143.27 ? 56   THR C CA    1 
ATOM 5223  C C     . THR C 3 45  ? -122.773 -38.669 -52.145  1.00 143.73 ? 56   THR C C     1 
ATOM 5224  O O     . THR C 3 45  ? -123.721 -39.362 -51.774  1.00 143.46 ? 56   THR C O     1 
ATOM 5225  C CB    . THR C 3 45  ? -121.113 -39.315 -50.400  1.00 143.12 ? 56   THR C CB    1 
ATOM 5226  O OG1   . THR C 3 45  ? -119.773 -39.758 -50.155  1.00 142.90 ? 56   THR C OG1   1 
ATOM 5227  C CG2   . THR C 3 45  ? -122.087 -40.327 -49.827  1.00 142.48 ? 56   THR C CG2   1 
ATOM 5228  N N     . PHE C 3 46  ? -122.920 -37.497 -52.754  1.00 144.55 ? 57   PHE C N     1 
ATOM 5229  C CA    . PHE C 3 46  ? -124.217 -36.888 -52.976  1.00 145.44 ? 57   PHE C CA    1 
ATOM 5230  C C     . PHE C 3 46  ? -124.753 -37.290 -54.335  1.00 146.05 ? 57   PHE C C     1 
ATOM 5231  O O     . PHE C 3 46  ? -125.542 -38.227 -54.408  1.00 146.12 ? 57   PHE C O     1 
ATOM 5232  C CB    . PHE C 3 46  ? -124.143 -35.363 -52.835  1.00 145.52 ? 57   PHE C CB    1 
ATOM 5233  C CG    . PHE C 3 46  ? -125.491 -34.680 -52.846  1.00 145.57 ? 57   PHE C CG    1 
ATOM 5234  C CD1   . PHE C 3 46  ? -126.387 -34.854 -51.783  1.00 145.00 ? 57   PHE C CD1   1 
ATOM 5235  C CD2   . PHE C 3 46  ? -125.857 -33.849 -53.916  1.00 145.16 ? 57   PHE C CD2   1 
ATOM 5236  C CE1   . PHE C 3 46  ? -127.628 -34.219 -51.790  1.00 144.79 ? 57   PHE C CE1   1 
ATOM 5237  C CE2   . PHE C 3 46  ? -127.095 -33.208 -53.931  1.00 144.68 ? 57   PHE C CE2   1 
ATOM 5238  C CZ    . PHE C 3 46  ? -127.982 -33.392 -52.866  1.00 144.77 ? 57   PHE C CZ    1 
ATOM 5239  N N     . ALA C 3 47  ? -124.324 -36.601 -55.400  1.00 146.84 ? 58   ALA C N     1 
ATOM 5240  C CA    . ALA C 3 47  ? -124.808 -36.885 -56.764  1.00 147.67 ? 58   ALA C CA    1 
ATOM 5241  C C     . ALA C 3 47  ? -124.483 -38.325 -57.224  1.00 148.23 ? 58   ALA C C     1 
ATOM 5242  O O     . ALA C 3 47  ? -124.616 -38.672 -58.400  1.00 148.34 ? 58   ALA C O     1 
ATOM 5243  C CB    . ALA C 3 47  ? -124.293 -35.834 -57.758  1.00 147.47 ? 58   ALA C CB    1 
ATOM 5244  N N     . LEU C 3 48  ? -124.070 -39.147 -56.261  1.00 148.91 ? 59   LEU C N     1 
ATOM 5245  C CA    . LEU C 3 48  ? -123.868 -40.575 -56.441  1.00 149.54 ? 59   LEU C CA    1 
ATOM 5246  C C     . LEU C 3 48  ? -124.918 -41.356 -55.664  1.00 150.14 ? 59   LEU C C     1 
ATOM 5247  O O     . LEU C 3 48  ? -125.240 -42.481 -56.030  1.00 150.41 ? 59   LEU C O     1 
ATOM 5248  C CB    . LEU C 3 48  ? -122.490 -40.975 -55.936  1.00 149.55 ? 59   LEU C CB    1 
ATOM 5249  C CG    . LEU C 3 48  ? -121.942 -42.325 -56.382  1.00 149.48 ? 59   LEU C CG    1 
ATOM 5250  C CD1   . LEU C 3 48  ? -121.146 -42.157 -57.678  1.00 149.70 ? 59   LEU C CD1   1 
ATOM 5251  C CD2   . LEU C 3 48  ? -121.090 -42.924 -55.277  1.00 148.95 ? 59   LEU C CD2   1 
ATOM 5252  N N     . HIS C 3 49  ? -125.424 -40.766 -54.579  1.00 150.82 ? 60   HIS C N     1 
ATOM 5253  C CA    . HIS C 3 49  ? -126.559 -41.311 -53.813  1.00 151.36 ? 60   HIS C CA    1 
ATOM 5254  C C     . HIS C 3 49  ? -127.883 -41.228 -54.603  1.00 151.56 ? 60   HIS C C     1 
ATOM 5255  O O     . HIS C 3 49  ? -128.730 -42.129 -54.507  1.00 151.46 ? 60   HIS C O     1 
ATOM 5256  C CB    . HIS C 3 49  ? -126.653 -40.598 -52.460  1.00 151.50 ? 60   HIS C CB    1 
ATOM 5257  C CG    . HIS C 3 49  ? -127.954 -40.795 -51.748  1.00 151.83 ? 60   HIS C CG    1 
ATOM 5258  N ND1   . HIS C 3 49  ? -128.868 -39.775 -51.574  1.00 151.85 ? 60   HIS C ND1   1 
ATOM 5259  C CD2   . HIS C 3 49  ? -128.489 -41.888 -51.154  1.00 151.97 ? 60   HIS C CD2   1 
ATOM 5260  C CE1   . HIS C 3 49  ? -129.911 -40.234 -50.907  1.00 152.24 ? 60   HIS C CE1   1 
ATOM 5261  N NE2   . HIS C 3 49  ? -129.707 -41.514 -50.642  1.00 152.43 ? 60   HIS C NE2   1 
ATOM 5262  N N     . GLN C 3 50  ? -128.041 -40.154 -55.382  1.00 151.82 ? 61   GLN C N     1 
ATOM 5263  C CA    . GLN C 3 50  ? -129.118 -40.043 -56.378  1.00 152.17 ? 61   GLN C CA    1 
ATOM 5264  C C     . GLN C 3 50  ? -128.871 -40.968 -57.577  1.00 152.17 ? 61   GLN C C     1 
ATOM 5265  O O     . GLN C 3 50  ? -128.840 -40.521 -58.728  1.00 152.41 ? 61   GLN C O     1 
ATOM 5266  C CB    . GLN C 3 50  ? -129.296 -38.594 -56.861  1.00 152.31 ? 61   GLN C CB    1 
ATOM 5267  C CG    . GLN C 3 50  ? -130.405 -37.811 -56.164  1.00 152.72 ? 61   GLN C CG    1 
ATOM 5268  C CD    . GLN C 3 50  ? -129.901 -37.051 -54.954  1.00 153.21 ? 61   GLN C CD    1 
ATOM 5269  O OE1   . GLN C 3 50  ? -129.764 -37.607 -53.860  1.00 153.62 ? 61   GLN C OE1   1 
ATOM 5270  N NE2   . GLN C 3 50  ? -129.620 -35.766 -55.146  1.00 153.07 ? 61   GLN C NE2   1 
ATOM 5271  N N     . ARG C 3 51  ? -128.720 -42.257 -57.278  1.00 151.99 ? 62   ARG C N     1 
ATOM 5272  C CA    . ARG C 3 51  ? -128.419 -43.321 -58.230  1.00 151.83 ? 62   ARG C CA    1 
ATOM 5273  C C     . ARG C 3 51  ? -128.473 -44.602 -57.422  1.00 152.32 ? 62   ARG C C     1 
ATOM 5274  O O     . ARG C 3 51  ? -128.831 -45.660 -57.921  1.00 152.32 ? 62   ARG C O     1 
ATOM 5275  C CB    . ARG C 3 51  ? -127.019 -43.165 -58.814  1.00 151.49 ? 62   ARG C CB    1 
ATOM 5276  C CG    . ARG C 3 51  ? -126.950 -42.518 -60.182  1.00 150.01 ? 62   ARG C CG    1 
ATOM 5277  C CD    . ARG C 3 51  ? -125.521 -42.497 -60.666  1.00 147.67 ? 62   ARG C CD    1 
ATOM 5278  N NE    . ARG C 3 51  ? -124.947 -43.841 -60.661  1.00 145.28 ? 62   ARG C NE    1 
ATOM 5279  C CZ    . ARG C 3 51  ? -123.684 -44.123 -60.954  1.00 143.43 ? 62   ARG C CZ    1 
ATOM 5280  N NH1   . ARG C 3 51  ? -122.837 -43.157 -61.282  1.00 142.76 ? 62   ARG C NH1   1 
ATOM 5281  N NH2   . ARG C 3 51  ? -123.273 -45.380 -60.924  1.00 142.42 ? 62   ARG C NH2   1 
ATOM 5282  N N     . CYS C 3 52  ? -128.090 -44.486 -56.158  1.00 153.01 ? 63   CYS C N     1 
ATOM 5283  C CA    . CYS C 3 52  ? -128.258 -45.547 -55.193  1.00 153.77 ? 63   CYS C CA    1 
ATOM 5284  C C     . CYS C 3 52  ? -129.739 -45.679 -54.925  1.00 154.85 ? 63   CYS C C     1 
ATOM 5285  O O     . CYS C 3 52  ? -130.227 -46.770 -54.651  1.00 154.88 ? 63   CYS C O     1 
ATOM 5286  C CB    . CYS C 3 52  ? -127.506 -45.200 -53.908  1.00 153.44 ? 63   CYS C CB    1 
ATOM 5287  S SG    . CYS C 3 52  ? -127.901 -46.192 -52.435  1.00 152.36 ? 63   CYS C SG    1 
ATOM 5288  N N     . ILE C 3 53  ? -130.456 -44.562 -55.042  1.00 156.30 ? 64   ILE C N     1 
ATOM 5289  C CA    . ILE C 3 53  ? -131.868 -44.509 -54.668  1.00 157.66 ? 64   ILE C CA    1 
ATOM 5290  C C     . ILE C 3 53  ? -132.881 -44.764 -55.809  1.00 158.77 ? 64   ILE C C     1 
ATOM 5291  O O     . ILE C 3 53  ? -133.996 -45.216 -55.532  1.00 159.01 ? 64   ILE C O     1 
ATOM 5292  C CB    . ILE C 3 53  ? -132.190 -43.228 -53.812  1.00 157.53 ? 64   ILE C CB    1 
ATOM 5293  C CG1   . ILE C 3 53  ? -133.199 -43.552 -52.699  1.00 157.52 ? 64   ILE C CG1   1 
ATOM 5294  C CG2   . ILE C 3 53  ? -132.611 -42.042 -54.680  1.00 157.22 ? 64   ILE C CG2   1 
ATOM 5295  C CD1   . ILE C 3 53  ? -132.663 -44.496 -51.609  1.00 157.22 ? 64   ILE C CD1   1 
ATOM 5296  N N     . GLN C 3 54  ? -132.497 -44.510 -57.068  1.00 160.07 ? 65   GLN C N     1 
ATOM 5297  C CA    . GLN C 3 54  ? -133.376 -44.809 -58.228  1.00 161.40 ? 65   GLN C CA    1 
ATOM 5298  C C     . GLN C 3 54  ? -133.099 -46.163 -58.908  1.00 162.11 ? 65   GLN C C     1 
ATOM 5299  O O     . GLN C 3 54  ? -133.750 -46.507 -59.904  1.00 162.36 ? 65   GLN C O     1 
ATOM 5300  C CB    . GLN C 3 54  ? -133.376 -43.688 -59.280  1.00 161.43 ? 65   GLN C CB    1 
ATOM 5301  C CG    . GLN C 3 54  ? -133.673 -42.297 -58.748  1.00 162.24 ? 65   GLN C CG    1 
ATOM 5302  C CD    . GLN C 3 54  ? -132.417 -41.597 -58.275  1.00 163.42 ? 65   GLN C CD    1 
ATOM 5303  O OE1   . GLN C 3 54  ? -131.328 -42.168 -58.333  1.00 163.49 ? 65   GLN C OE1   1 
ATOM 5304  N NE2   . GLN C 3 54  ? -132.558 -40.357 -57.803  1.00 163.83 ? 65   GLN C NE2   1 
ATOM 5305  N N     . ALA C 3 55  ? -132.125 -46.907 -58.384  1.00 162.94 ? 66   ALA C N     1 
ATOM 5306  C CA    . ALA C 3 55  ? -131.939 -48.313 -58.737  1.00 163.74 ? 66   ALA C CA    1 
ATOM 5307  C C     . ALA C 3 55  ? -132.507 -49.170 -57.609  1.00 164.44 ? 66   ALA C C     1 
ATOM 5308  O O     . ALA C 3 55  ? -132.578 -50.396 -57.720  1.00 164.50 ? 66   ALA C O     1 
ATOM 5309  C CB    . ALA C 3 55  ? -130.482 -48.628 -58.976  1.00 163.69 ? 66   ALA C CB    1 
ATOM 5310  N N     . LYS C 3 56  ? -132.895 -48.505 -56.520  1.00 165.36 ? 67   LYS C N     1 
ATOM 5311  C CA    . LYS C 3 56  ? -133.759 -49.097 -55.504  1.00 166.40 ? 67   LYS C CA    1 
ATOM 5312  C C     . LYS C 3 56  ? -135.212 -48.941 -55.966  1.00 167.01 ? 67   LYS C C     1 
ATOM 5313  O O     . LYS C 3 56  ? -136.073 -49.741 -55.608  1.00 166.98 ? 67   LYS C O     1 
ATOM 5314  C CB    . LYS C 3 56  ? -133.561 -48.412 -54.146  1.00 166.43 ? 67   LYS C CB    1 
ATOM 5315  C CG    . LYS C 3 56  ? -133.345 -49.362 -52.953  1.00 167.06 ? 67   LYS C CG    1 
ATOM 5316  C CD    . LYS C 3 56  ? -134.276 -50.581 -52.951  1.00 167.82 ? 67   LYS C CD    1 
ATOM 5317  C CE    . LYS C 3 56  ? -135.690 -50.226 -52.528  1.00 168.30 ? 67   LYS C CE    1 
ATOM 5318  N NZ    . LYS C 3 56  ? -136.623 -51.348 -52.805  1.00 168.69 ? 67   LYS C NZ    1 
ATOM 5319  N N     . ALA C 3 57  ? -135.458 -47.901 -56.770  1.00 167.84 ? 68   ALA C N     1 
ATOM 5320  C CA    . ALA C 3 57  ? -136.758 -47.630 -57.410  1.00 168.54 ? 68   ALA C CA    1 
ATOM 5321  C C     . ALA C 3 57  ? -137.010 -48.465 -58.685  1.00 169.05 ? 68   ALA C C     1 
ATOM 5322  O O     . ALA C 3 57  ? -138.000 -48.242 -59.398  1.00 169.28 ? 68   ALA C O     1 
ATOM 5323  C CB    . ALA C 3 57  ? -136.904 -46.127 -57.712  1.00 168.34 ? 68   ALA C CB    1 
ATOM 5324  N N     . LYS C 3 58  ? -136.105 -49.405 -58.970  1.00 169.55 ? 69   LYS C N     1 
ATOM 5325  C CA    . LYS C 3 58  ? -136.274 -50.405 -60.039  1.00 169.82 ? 69   LYS C CA    1 
ATOM 5326  C C     . LYS C 3 58  ? -136.360 -51.822 -59.448  1.00 170.17 ? 69   LYS C C     1 
ATOM 5327  O O     . LYS C 3 58  ? -136.792 -52.756 -60.132  1.00 170.21 ? 69   LYS C O     1 
ATOM 5328  C CB    . LYS C 3 58  ? -135.150 -50.306 -61.091  1.00 169.66 ? 69   LYS C CB    1 
ATOM 5329  C CG    . LYS C 3 58  ? -135.504 -49.523 -62.366  1.00 169.19 ? 69   LYS C CG    1 
ATOM 5330  C CD    . LYS C 3 58  ? -135.961 -48.097 -62.074  1.00 168.31 ? 69   LYS C CD    1 
ATOM 5331  C CE    . LYS C 3 58  ? -136.094 -47.279 -63.336  1.00 167.90 ? 69   LYS C CE    1 
ATOM 5332  N NZ    . LYS C 3 58  ? -134.770 -46.778 -63.781  1.00 167.64 ? 69   LYS C NZ    1 
ATOM 5333  N N     . ARG C 3 59  ? -135.950 -51.952 -58.178  1.00 170.55 ? 70   ARG C N     1 
ATOM 5334  C CA    . ARG C 3 59  ? -136.026 -53.195 -57.375  1.00 170.96 ? 70   ARG C CA    1 
ATOM 5335  C C     . ARG C 3 59  ? -135.642 -54.479 -58.118  1.00 171.01 ? 70   ARG C C     1 
ATOM 5336  O O     . ARG C 3 59  ? -136.112 -55.571 -57.775  1.00 171.01 ? 70   ARG C O     1 
ATOM 5337  C CB    . ARG C 3 59  ? -137.411 -53.370 -56.729  1.00 171.12 ? 70   ARG C CB    1 
ATOM 5338  C CG    . ARG C 3 59  ? -137.785 -52.371 -55.625  1.00 171.59 ? 70   ARG C CG    1 
ATOM 5339  C CD    . ARG C 3 59  ? -138.554 -51.127 -56.139  1.00 172.26 ? 70   ARG C CD    1 
ATOM 5340  N NE    . ARG C 3 59  ? -139.249 -51.343 -57.412  1.00 172.62 ? 70   ARG C NE    1 
ATOM 5341  C CZ    . ARG C 3 59  ? -140.441 -51.918 -57.544  1.00 172.30 ? 70   ARG C CZ    1 
ATOM 5342  N NH1   . ARG C 3 59  ? -140.967 -52.065 -58.755  1.00 171.94 ? 70   ARG C NH1   1 
ATOM 5343  N NH2   . ARG C 3 59  ? -141.100 -52.350 -56.474  1.00 172.08 ? 70   ARG C NH2   1 
ATOM 5344  N N     . PRO D 1 5   ? -4.463   -72.713 -47.733  1.00 148.03 ? 12   PRO D N     1 
ATOM 5345  C CA    . PRO D 1 5   ? -4.776   -72.324 -46.346  1.00 148.05 ? 12   PRO D CA    1 
ATOM 5346  C C     . PRO D 1 5   ? -6.307   -72.232 -46.066  1.00 147.89 ? 12   PRO D C     1 
ATOM 5347  O O     . PRO D 1 5   ? -6.995   -71.433 -46.723  1.00 148.04 ? 12   PRO D O     1 
ATOM 5348  C CB    . PRO D 1 5   ? -4.093   -70.949 -46.197  1.00 148.07 ? 12   PRO D CB    1 
ATOM 5349  C CG    . PRO D 1 5   ? -3.090   -70.872 -47.329  1.00 148.07 ? 12   PRO D CG    1 
ATOM 5350  C CD    . PRO D 1 5   ? -3.659   -71.698 -48.441  1.00 148.09 ? 12   PRO D CD    1 
ATOM 5351  N N     . PRO D 1 6   ? -6.840   -73.049 -45.109  1.00 147.45 ? 13   PRO D N     1 
ATOM 5352  C CA    . PRO D 1 6   ? -8.295   -73.085 -44.773  1.00 146.78 ? 13   PRO D CA    1 
ATOM 5353  C C     . PRO D 1 6   ? -8.907   -71.722 -44.337  1.00 145.81 ? 13   PRO D C     1 
ATOM 5354  O O     . PRO D 1 6   ? -8.214   -70.917 -43.692  1.00 145.95 ? 13   PRO D O     1 
ATOM 5355  C CB    . PRO D 1 6   ? -8.373   -74.124 -43.637  1.00 146.84 ? 13   PRO D CB    1 
ATOM 5356  C CG    . PRO D 1 6   ? -7.184   -75.017 -43.868  1.00 147.21 ? 13   PRO D CG    1 
ATOM 5357  C CD    . PRO D 1 6   ? -6.093   -74.080 -44.353  1.00 147.52 ? 13   PRO D CD    1 
ATOM 5358  N N     . PRO D 1 7   ? -10.200  -71.475 -44.682  1.00 144.52 ? 14   PRO D N     1 
ATOM 5359  C CA    . PRO D 1 7   ? -10.832  -70.144 -44.578  1.00 143.36 ? 14   PRO D CA    1 
ATOM 5360  C C     . PRO D 1 7   ? -10.996  -69.638 -43.147  1.00 142.18 ? 14   PRO D C     1 
ATOM 5361  O O     . PRO D 1 7   ? -11.451  -70.376 -42.290  1.00 142.01 ? 14   PRO D O     1 
ATOM 5362  C CB    . PRO D 1 7   ? -12.208  -70.358 -45.229  1.00 143.45 ? 14   PRO D CB    1 
ATOM 5363  C CG    . PRO D 1 7   ? -12.115  -71.667 -45.967  1.00 143.74 ? 14   PRO D CG    1 
ATOM 5364  C CD    . PRO D 1 7   ? -11.157  -72.484 -45.175  1.00 144.33 ? 14   PRO D CD    1 
ATOM 5365  N N     . LYS D 1 8   ? -10.635  -68.385 -42.898  1.00 141.08 ? 15   LYS D N     1 
ATOM 5366  C CA    . LYS D 1 8   ? -10.659  -67.848 -41.535  1.00 140.29 ? 15   LYS D CA    1 
ATOM 5367  C C     . LYS D 1 8   ? -11.789  -66.844 -41.324  1.00 139.33 ? 15   LYS D C     1 
ATOM 5368  O O     . LYS D 1 8   ? -11.696  -65.698 -41.787  1.00 139.24 ? 15   LYS D O     1 
ATOM 5369  C CB    . LYS D 1 8   ? -9.335   -67.149 -41.167  1.00 140.73 ? 15   LYS D CB    1 
ATOM 5370  C CG    . LYS D 1 8   ? -8.082   -67.553 -41.953  1.00 141.48 ? 15   LYS D CG    1 
ATOM 5371  C CD    . LYS D 1 8   ? -7.182   -68.528 -41.204  1.00 141.58 ? 15   LYS D CD    1 
ATOM 5372  C CE    . LYS D 1 8   ? -5.979   -68.883 -42.054  1.00 142.03 ? 15   LYS D CE    1 
ATOM 5373  N NZ    . LYS D 1 8   ? -5.892   -70.358 -42.220  1.00 142.85 ? 15   LYS D NZ    1 
ATOM 5374  N N     . ARG D 1 9   ? -12.834  -67.264 -40.608  1.00 137.95 ? 16   ARG D N     1 
ATOM 5375  C CA    . ARG D 1 9   ? -13.912  -66.364 -40.192  1.00 136.60 ? 16   ARG D CA    1 
ATOM 5376  C C     . ARG D 1 9   ? -13.331  -65.114 -39.543  1.00 135.61 ? 16   ARG D C     1 
ATOM 5377  O O     . ARG D 1 9   ? -12.432  -65.204 -38.714  1.00 135.44 ? 16   ARG D O     1 
ATOM 5378  C CB    . ARG D 1 9   ? -14.849  -67.059 -39.210  1.00 136.73 ? 16   ARG D CB    1 
ATOM 5379  C CG    . ARG D 1 9   ? -15.969  -67.920 -39.818  1.00 137.47 ? 16   ARG D CG    1 
ATOM 5380  C CD    . ARG D 1 9   ? -17.059  -68.141 -38.762  1.00 138.30 ? 16   ARG D CD    1 
ATOM 5381  N NE    . ARG D 1 9   ? -16.951  -67.089 -37.747  1.00 139.85 ? 16   ARG D NE    1 
ATOM 5382  C CZ    . ARG D 1 9   ? -17.920  -66.684 -36.932  1.00 140.77 ? 16   ARG D CZ    1 
ATOM 5383  N NH1   . ARG D 1 9   ? -19.129  -67.234 -36.984  1.00 142.14 ? 16   ARG D NH1   1 
ATOM 5384  N NH2   . ARG D 1 9   ? -17.676  -65.710 -36.059  1.00 140.48 ? 16   ARG D NH2   1 
ATOM 5385  N N     . LEU D 1 10  ? -13.833  -63.949 -39.937  1.00 134.63 ? 17   LEU D N     1 
ATOM 5386  C CA    . LEU D 1 10  ? -13.342  -62.681 -39.414  1.00 133.74 ? 17   LEU D CA    1 
ATOM 5387  C C     . LEU D 1 10  ? -13.445  -62.677 -37.905  1.00 133.32 ? 17   LEU D C     1 
ATOM 5388  O O     . LEU D 1 10  ? -14.251  -63.397 -37.343  1.00 133.42 ? 17   LEU D O     1 
ATOM 5389  C CB    . LEU D 1 10  ? -14.122  -61.516 -40.008  1.00 133.61 ? 17   LEU D CB    1 
ATOM 5390  C CG    . LEU D 1 10  ? -13.659  -60.103 -39.650  1.00 133.50 ? 17   LEU D CG    1 
ATOM 5391  C CD1   . LEU D 1 10  ? -13.594  -59.241 -40.870  1.00 133.61 ? 17   LEU D CD1   1 
ATOM 5392  C CD2   . LEU D 1 10  ? -14.547  -59.449 -38.629  1.00 133.22 ? 17   LEU D CD2   1 
ATOM 5393  N N     . THR D 1 11  ? -12.622  -61.873 -37.252  1.00 132.97 ? 18   THR D N     1 
ATOM 5394  C CA    . THR D 1 11  ? -12.544  -61.891 -35.804  1.00 132.77 ? 18   THR D CA    1 
ATOM 5395  C C     . THR D 1 11  ? -12.881  -60.554 -35.173  1.00 132.50 ? 18   THR D C     1 
ATOM 5396  O O     . THR D 1 11  ? -12.736  -59.510 -35.793  1.00 132.34 ? 18   THR D O     1 
ATOM 5397  C CB    . THR D 1 11  ? -11.153  -62.303 -35.337  1.00 132.87 ? 18   THR D CB    1 
ATOM 5398  O OG1   . THR D 1 11  ? -10.186  -61.398 -35.885  1.00 133.34 ? 18   THR D OG1   1 
ATOM 5399  C CG2   . THR D 1 11  ? -10.845  -63.736 -35.774  1.00 132.78 ? 18   THR D CG2   1 
ATOM 5400  N N     . ARG D 1 12  ? -13.327  -60.609 -33.926  1.00 132.47 ? 19   ARG D N     1 
ATOM 5401  C CA    . ARG D 1 12  ? -13.579  -59.437 -33.106  1.00 132.62 ? 19   ARG D CA    1 
ATOM 5402  C C     . ARG D 1 12  ? -12.464  -58.394 -33.283  1.00 133.31 ? 19   ARG D C     1 
ATOM 5403  O O     . ARG D 1 12  ? -12.673  -57.186 -33.120  1.00 133.13 ? 19   ARG D O     1 
ATOM 5404  C CB    . ARG D 1 12  ? -13.658  -59.897 -31.647  1.00 132.48 ? 19   ARG D CB    1 
ATOM 5405  C CG    . ARG D 1 12  ? -14.280  -58.924 -30.671  1.00 130.78 ? 19   ARG D CG    1 
ATOM 5406  C CD    . ARG D 1 12  ? -15.773  -58.917 -30.781  1.00 127.56 ? 19   ARG D CD    1 
ATOM 5407  N NE    . ARG D 1 12  ? -16.327  -57.865 -29.956  1.00 125.66 ? 19   ARG D NE    1 
ATOM 5408  C CZ    . ARG D 1 12  ? -16.615  -58.018 -28.671  1.00 125.01 ? 19   ARG D CZ    1 
ATOM 5409  N NH1   . ARG D 1 12  ? -17.124  -57.005 -27.970  1.00 124.06 ? 19   ARG D NH1   1 
ATOM 5410  N NH2   . ARG D 1 12  ? -16.397  -59.191 -28.087  1.00 124.92 ? 19   ARG D NH2   1 
ATOM 5411  N N     . GLU D 1 13  ? -11.279  -58.891 -33.631  1.00 134.23 ? 20   GLU D N     1 
ATOM 5412  C CA    . GLU D 1 13  ? -10.072  -58.084 -33.785  1.00 134.92 ? 20   GLU D CA    1 
ATOM 5413  C C     . GLU D 1 13  ? -10.007  -57.456 -35.177  1.00 134.75 ? 20   GLU D C     1 
ATOM 5414  O O     . GLU D 1 13  ? -10.131  -56.238 -35.308  1.00 134.72 ? 20   GLU D O     1 
ATOM 5415  C CB    . GLU D 1 13  ? -8.823   -58.941 -33.490  1.00 135.24 ? 20   GLU D CB    1 
ATOM 5416  C CG    . GLU D 1 13  ? -7.534   -58.153 -33.154  1.00 137.44 ? 20   GLU D CG    1 
ATOM 5417  C CD    . GLU D 1 13  ? -7.718   -57.075 -32.070  1.00 140.22 ? 20   GLU D CD    1 
ATOM 5418  O OE1   . GLU D 1 13  ? -8.632   -57.196 -31.216  1.00 141.37 ? 20   GLU D OE1   1 
ATOM 5419  O OE2   . GLU D 1 13  ? -6.936   -56.097 -32.073  1.00 140.72 ? 20   GLU D OE2   1 
ATOM 5420  N N     . ALA D 1 14  ? -9.839   -58.295 -36.203  1.00 134.64 ? 21   ALA D N     1 
ATOM 5421  C CA    . ALA D 1 14  ? -9.794   -57.863 -37.604  1.00 134.51 ? 21   ALA D CA    1 
ATOM 5422  C C     . ALA D 1 14  ? -10.738  -56.702 -37.869  1.00 134.47 ? 21   ALA D C     1 
ATOM 5423  O O     . ALA D 1 14  ? -10.383  -55.735 -38.547  1.00 134.38 ? 21   ALA D O     1 
ATOM 5424  C CB    . ALA D 1 14  ? -10.113  -59.027 -38.527  1.00 134.16 ? 21   ALA D CB    1 
ATOM 5425  N N     . MET D 1 15  ? -11.934  -56.808 -37.303  1.00 134.66 ? 22   MET D N     1 
ATOM 5426  C CA    . MET D 1 15  ? -12.959  -55.786 -37.419  1.00 135.01 ? 22   MET D CA    1 
ATOM 5427  C C     . MET D 1 15  ? -12.523  -54.432 -36.836  1.00 135.20 ? 22   MET D C     1 
ATOM 5428  O O     . MET D 1 15  ? -12.373  -53.487 -37.604  1.00 135.44 ? 22   MET D O     1 
ATOM 5429  C CB    . MET D 1 15  ? -14.281  -56.280 -36.812  1.00 135.11 ? 22   MET D CB    1 
ATOM 5430  C CG    . MET D 1 15  ? -15.435  -55.262 -36.755  1.00 135.12 ? 22   MET D CG    1 
ATOM 5431  S SD    . MET D 1 15  ? -16.154  -54.778 -38.332  1.00 134.71 ? 22   MET D SD    1 
ATOM 5432  C CE    . MET D 1 15  ? -16.411  -56.370 -39.121  1.00 135.13 ? 22   MET D CE    1 
ATOM 5433  N N     . ARG D 1 16  ? -12.308  -54.331 -35.516  1.00 135.20 ? 23   ARG D N     1 
ATOM 5434  C CA    . ARG D 1 16  ? -12.007  -53.034 -34.881  1.00 135.26 ? 23   ARG D CA    1 
ATOM 5435  C C     . ARG D 1 16  ? -10.882  -52.277 -35.613  1.00 135.23 ? 23   ARG D C     1 
ATOM 5436  O O     . ARG D 1 16  ? -10.826  -51.039 -35.574  1.00 135.00 ? 23   ARG D O     1 
ATOM 5437  C CB    . ARG D 1 16  ? -11.710  -53.205 -33.389  1.00 135.34 ? 23   ARG D CB    1 
ATOM 5438  C CG    . ARG D 1 16  ? -10.419  -53.956 -33.089  1.00 136.95 ? 23   ARG D CG    1 
ATOM 5439  C CD    . ARG D 1 16  ? -10.356  -54.540 -31.682  1.00 138.67 ? 23   ARG D CD    1 
ATOM 5440  N NE    . ARG D 1 16  ? -11.361  -55.575 -31.457  1.00 139.93 ? 23   ARG D NE    1 
ATOM 5441  C CZ    . ARG D 1 16  ? -12.333  -55.487 -30.551  1.00 141.15 ? 23   ARG D CZ    1 
ATOM 5442  N NH1   . ARG D 1 16  ? -13.200  -56.475 -30.420  1.00 141.63 ? 23   ARG D NH1   1 
ATOM 5443  N NH2   . ARG D 1 16  ? -12.443  -54.416 -29.768  1.00 141.30 ? 23   ARG D NH2   1 
ATOM 5444  N N     . ASN D 1 17  ? -10.022  -53.053 -36.293  1.00 135.32 ? 24   ASN D N     1 
ATOM 5445  C CA    . ASN D 1 17  ? -8.960   -52.573 -37.213  1.00 134.98 ? 24   ASN D CA    1 
ATOM 5446  C C     . ASN D 1 17  ? -9.423   -52.595 -38.676  1.00 134.30 ? 24   ASN D C     1 
ATOM 5447  O O     . ASN D 1 17  ? -8.710   -53.046 -39.573  1.00 134.20 ? 24   ASN D O     1 
ATOM 5448  C CB    . ASN D 1 17  ? -7.660   -53.396 -37.050  1.00 135.17 ? 24   ASN D CB    1 
ATOM 5449  C CG    . ASN D 1 17  ? -7.046   -53.288 -35.639  1.00 135.68 ? 24   ASN D CG    1 
ATOM 5450  O OD1   . ASN D 1 17  ? -6.554   -54.284 -35.096  1.00 135.76 ? 24   ASN D OD1   1 
ATOM 5451  N ND2   . ASN D 1 17  ? -7.076   -52.084 -35.049  1.00 135.72 ? 24   ASN D ND2   1 
ATOM 5452  N N     . TYR D 1 18  ? -10.654  -52.141 -38.872  1.00 133.65 ? 25   TYR D N     1 
ATOM 5453  C CA    . TYR D 1 18  ? -11.222  -51.820 -40.169  1.00 132.96 ? 25   TYR D CA    1 
ATOM 5454  C C     . TYR D 1 18  ? -12.083  -50.594 -39.914  1.00 132.52 ? 25   TYR D C     1 
ATOM 5455  O O     . TYR D 1 18  ? -12.196  -49.709 -40.759  1.00 132.37 ? 25   TYR D O     1 
ATOM 5456  C CB    . TYR D 1 18  ? -12.071  -52.966 -40.743  1.00 132.87 ? 25   TYR D CB    1 
ATOM 5457  C CG    . TYR D 1 18  ? -13.043  -52.484 -41.800  1.00 132.69 ? 25   TYR D CG    1 
ATOM 5458  C CD1   . TYR D 1 18  ? -12.687  -52.456 -43.147  1.00 132.32 ? 25   TYR D CD1   1 
ATOM 5459  C CD2   . TYR D 1 18  ? -14.315  -52.004 -41.446  1.00 133.13 ? 25   TYR D CD2   1 
ATOM 5460  C CE1   . TYR D 1 18  ? -13.590  -51.979 -44.130  1.00 132.09 ? 25   TYR D CE1   1 
ATOM 5461  C CE2   . TYR D 1 18  ? -15.218  -51.518 -42.415  1.00 132.10 ? 25   TYR D CE2   1 
ATOM 5462  C CZ    . TYR D 1 18  ? -14.848  -51.510 -43.747  1.00 131.57 ? 25   TYR D CZ    1 
ATOM 5463  O OH    . TYR D 1 18  ? -15.746  -51.041 -44.675  1.00 130.64 ? 25   TYR D OH    1 
ATOM 5464  N N     . LEU D 1 19  ? -12.692  -50.542 -38.736  1.00 132.09 ? 26   LEU D N     1 
ATOM 5465  C CA    . LEU D 1 19  ? -13.420  -49.354 -38.345  1.00 131.95 ? 26   LEU D CA    1 
ATOM 5466  C C     . LEU D 1 19  ? -12.458  -48.216 -38.079  1.00 131.88 ? 26   LEU D C     1 
ATOM 5467  O O     . LEU D 1 19  ? -12.883  -47.072 -37.938  1.00 131.84 ? 26   LEU D O     1 
ATOM 5468  C CB    . LEU D 1 19  ? -14.315  -49.605 -37.128  1.00 132.13 ? 26   LEU D CB    1 
ATOM 5469  C CG    . LEU D 1 19  ? -15.660  -50.322 -37.328  1.00 132.02 ? 26   LEU D CG    1 
ATOM 5470  C CD1   . LEU D 1 19  ? -16.200  -50.150 -38.762  1.00 131.98 ? 26   LEU D CD1   1 
ATOM 5471  C CD2   . LEU D 1 19  ? -15.550  -51.792 -36.965  1.00 131.19 ? 26   LEU D CD2   1 
ATOM 5472  N N     . LYS D 1 20  ? -11.163  -48.535 -38.010  1.00 131.78 ? 27   LYS D N     1 
ATOM 5473  C CA    . LYS D 1 20  ? -10.113  -47.502 -38.035  1.00 131.53 ? 27   LYS D CA    1 
ATOM 5474  C C     . LYS D 1 20  ? -9.576   -47.276 -39.468  1.00 130.57 ? 27   LYS D C     1 
ATOM 5475  O O     . LYS D 1 20  ? -9.606   -46.152 -39.979  1.00 130.28 ? 27   LYS D O     1 
ATOM 5476  C CB    . LYS D 1 20  ? -8.971   -47.805 -37.047  1.00 131.95 ? 27   LYS D CB    1 
ATOM 5477  C CG    . LYS D 1 20  ? -9.396   -48.167 -35.599  1.00 134.10 ? 27   LYS D CG    1 
ATOM 5478  C CD    . LYS D 1 20  ? -10.139  -47.040 -34.817  1.00 136.84 ? 27   LYS D CD    1 
ATOM 5479  C CE    . LYS D 1 20  ? -10.650  -47.530 -33.418  1.00 138.01 ? 27   LYS D CE    1 
ATOM 5480  N NZ    . LYS D 1 20  ? -11.675  -48.638 -33.471  1.00 138.49 ? 27   LYS D NZ    1 
ATOM 5481  N N     . GLU D 1 21  ? -9.113   -48.344 -40.115  1.00 129.53 ? 28   GLU D N     1 
ATOM 5482  C CA    . GLU D 1 21  ? -8.641   -48.254 -41.501  1.00 128.70 ? 28   GLU D CA    1 
ATOM 5483  C C     . GLU D 1 21  ? -9.752   -47.760 -42.447  1.00 127.70 ? 28   GLU D C     1 
ATOM 5484  O O     . GLU D 1 21  ? -9.721   -46.625 -42.915  1.00 127.80 ? 28   GLU D O     1 
ATOM 5485  C CB    . GLU D 1 21  ? -8.063   -49.598 -41.991  1.00 128.93 ? 28   GLU D CB    1 
ATOM 5486  C CG    . GLU D 1 21  ? -7.301   -50.436 -40.929  1.00 130.11 ? 28   GLU D CG    1 
ATOM 5487  C CD    . GLU D 1 21  ? -5.836   -50.017 -40.677  1.00 130.86 ? 28   GLU D CD    1 
ATOM 5488  O OE1   . GLU D 1 21  ? -5.467   -48.837 -40.902  1.00 131.55 ? 28   GLU D OE1   1 
ATOM 5489  O OE2   . GLU D 1 21  ? -5.055   -50.886 -40.224  1.00 129.70 ? 28   GLU D OE2   1 
ATOM 5490  N N     . ARG D 1 22  ? -10.750  -48.603 -42.692  1.00 126.29 ? 29   ARG D N     1 
ATOM 5491  C CA    . ARG D 1 22  ? -11.779  -48.342 -43.707  1.00 124.78 ? 29   ARG D CA    1 
ATOM 5492  C C     . ARG D 1 22  ? -11.141  -48.352 -45.095  1.00 122.94 ? 29   ARG D C     1 
ATOM 5493  O O     . ARG D 1 22  ? -11.534  -47.594 -45.981  1.00 122.55 ? 29   ARG D O     1 
ATOM 5494  C CB    . ARG D 1 22  ? -12.571  -47.044 -43.423  1.00 125.19 ? 29   ARG D CB    1 
ATOM 5495  C CG    . ARG D 1 22  ? -13.859  -46.845 -44.268  1.00 126.81 ? 29   ARG D CG    1 
ATOM 5496  C CD    . ARG D 1 22  ? -14.888  -48.013 -44.141  1.00 129.28 ? 29   ARG D CD    1 
ATOM 5497  N NE    . ARG D 1 22  ? -15.509  -48.102 -42.809  1.00 131.21 ? 29   ARG D NE    1 
ATOM 5498  C CZ    . ARG D 1 22  ? -16.789  -47.831 -42.529  1.00 131.74 ? 29   ARG D CZ    1 
ATOM 5499  N NH1   . ARG D 1 22  ? -17.629  -47.458 -43.493  1.00 132.03 ? 29   ARG D NH1   1 
ATOM 5500  N NH2   . ARG D 1 22  ? -17.238  -47.940 -41.277  1.00 131.26 ? 29   ARG D NH2   1 
ATOM 5501  N N     . GLY D 1 23  ? -10.168  -49.246 -45.259  1.00 120.99 ? 30   GLY D N     1 
ATOM 5502  C CA    . GLY D 1 23  ? -9.426   -49.372 -46.499  1.00 119.01 ? 30   GLY D CA    1 
ATOM 5503  C C     . GLY D 1 23  ? -10.143  -50.145 -47.589  1.00 117.45 ? 30   GLY D C     1 
ATOM 5504  O O     . GLY D 1 23  ? -9.622   -51.155 -48.073  1.00 117.44 ? 30   GLY D O     1 
ATOM 5505  N N     . ASP D 1 24  ? -11.314  -49.646 -47.993  1.00 115.95 ? 31   ASP D N     1 
ATOM 5506  C CA    . ASP D 1 24  ? -12.224  -50.337 -48.936  1.00 114.55 ? 31   ASP D CA    1 
ATOM 5507  C C     . ASP D 1 24  ? -11.730  -50.433 -50.372  1.00 113.05 ? 31   ASP D C     1 
ATOM 5508  O O     . ASP D 1 24  ? -11.434  -49.426 -50.990  1.00 113.01 ? 31   ASP D O     1 
ATOM 5509  C CB    . ASP D 1 24  ? -13.611  -49.643 -48.978  1.00 114.85 ? 31   ASP D CB    1 
ATOM 5510  C CG    . ASP D 1 24  ? -14.616  -50.220 -47.966  1.00 115.09 ? 31   ASP D CG    1 
ATOM 5511  O OD1   . ASP D 1 24  ? -14.731  -51.485 -47.868  1.00 114.65 ? 31   ASP D OD1   1 
ATOM 5512  O OD2   . ASP D 1 24  ? -15.295  -49.380 -47.298  1.00 114.41 ? 31   ASP D OD2   1 
ATOM 5513  N N     . GLN D 1 25  ? -11.657  -51.648 -50.899  1.00 111.33 ? 32   GLN D N     1 
ATOM 5514  C CA    . GLN D 1 25  ? -11.839  -51.840 -52.333  1.00 109.91 ? 32   GLN D CA    1 
ATOM 5515  C C     . GLN D 1 25  ? -13.308  -51.467 -52.649  1.00 108.92 ? 32   GLN D C     1 
ATOM 5516  O O     . GLN D 1 25  ? -14.145  -51.471 -51.733  1.00 109.11 ? 32   GLN D O     1 
ATOM 5517  C CB    . GLN D 1 25  ? -11.544  -53.291 -52.736  1.00 109.73 ? 32   GLN D CB    1 
ATOM 5518  C CG    . GLN D 1 25  ? -10.099  -53.540 -53.131  1.00 109.62 ? 32   GLN D CG    1 
ATOM 5519  C CD    . GLN D 1 25  ? -9.679   -55.018 -53.053  1.00 110.52 ? 32   GLN D CD    1 
ATOM 5520  O OE1   . GLN D 1 25  ? -9.640   -55.730 -54.074  1.00 109.61 ? 32   GLN D OE1   1 
ATOM 5521  N NE2   . GLN D 1 25  ? -9.350   -55.480 -51.835  1.00 111.12 ? 32   GLN D NE2   1 
ATOM 5522  N N     . THR D 1 26  ? -13.600  -51.092 -53.908  1.00 107.22 ? 33   THR D N     1 
ATOM 5523  C CA    . THR D 1 26  ? -14.980  -50.842 -54.424  1.00 105.19 ? 33   THR D CA    1 
ATOM 5524  C C     . THR D 1 26  ? -15.056  -50.724 -55.967  1.00 104.43 ? 33   THR D C     1 
ATOM 5525  O O     . THR D 1 26  ? -14.463  -49.832 -56.542  1.00 104.66 ? 33   THR D O     1 
ATOM 5526  C CB    . THR D 1 26  ? -15.764  -49.639 -53.700  1.00 104.93 ? 33   THR D CB    1 
ATOM 5527  O OG1   . THR D 1 26  ? -16.564  -48.920 -54.645  1.00 103.62 ? 33   THR D OG1   1 
ATOM 5528  C CG2   . THR D 1 26  ? -14.848  -48.656 -52.949  1.00 103.76 ? 33   THR D CG2   1 
ATOM 5529  N N     . VAL D 1 27  ? -15.768  -51.630 -56.634  1.00 103.33 ? 34   VAL D N     1 
ATOM 5530  C CA    . VAL D 1 27  ? -16.144  -51.442 -58.040  1.00 102.35 ? 34   VAL D CA    1 
ATOM 5531  C C     . VAL D 1 27  ? -17.207  -50.344 -58.086  1.00 102.31 ? 34   VAL D C     1 
ATOM 5532  O O     . VAL D 1 27  ? -17.524  -49.741 -57.052  1.00 102.23 ? 34   VAL D O     1 
ATOM 5533  C CB    . VAL D 1 27  ? -16.688  -52.751 -58.696  1.00 102.19 ? 34   VAL D CB    1 
ATOM 5534  C CG1   . VAL D 1 27  ? -17.293  -52.498 -60.091  1.00 101.58 ? 34   VAL D CG1   1 
ATOM 5535  C CG2   . VAL D 1 27  ? -15.595  -53.763 -58.827  1.00 101.88 ? 34   VAL D CG2   1 
ATOM 5536  N N     . LEU D 1 28  ? -17.746  -50.079 -59.280  1.00 102.07 ? 35   LEU D N     1 
ATOM 5537  C CA    . LEU D 1 28  ? -18.701  -48.986 -59.508  1.00 101.57 ? 35   LEU D CA    1 
ATOM 5538  C C     . LEU D 1 28  ? -19.046  -48.835 -60.993  1.00 101.35 ? 35   LEU D C     1 
ATOM 5539  O O     . LEU D 1 28  ? -18.555  -47.928 -61.649  1.00 101.49 ? 35   LEU D O     1 
ATOM 5540  C CB    . LEU D 1 28  ? -18.120  -47.663 -59.001  1.00 101.28 ? 35   LEU D CB    1 
ATOM 5541  C CG    . LEU D 1 28  ? -19.051  -46.669 -58.321  1.00 101.47 ? 35   LEU D CG    1 
ATOM 5542  C CD1   . LEU D 1 28  ? -18.243  -45.523 -57.726  1.00 102.02 ? 35   LEU D CD1   1 
ATOM 5543  C CD2   . LEU D 1 28  ? -20.095  -46.138 -59.282  1.00 102.46 ? 35   LEU D CD2   1 
ATOM 5544  N N     . ILE D 1 29  ? -19.895  -49.712 -61.518  1.00 101.13 ? 36   ILE D N     1 
ATOM 5545  C CA    . ILE D 1 29  ? -20.350  -49.609 -62.909  1.00 100.82 ? 36   ILE D CA    1 
ATOM 5546  C C     . ILE D 1 29  ? -21.387  -48.476 -63.158  1.00 101.10 ? 36   ILE D C     1 
ATOM 5547  O O     . ILE D 1 29  ? -22.434  -48.419 -62.507  1.00 100.99 ? 36   ILE D O     1 
ATOM 5548  C CB    . ILE D 1 29  ? -20.925  -50.942 -63.382  1.00 100.57 ? 36   ILE D CB    1 
ATOM 5549  C CG1   . ILE D 1 29  ? -19.966  -52.076 -63.005  1.00 100.13 ? 36   ILE D CG1   1 
ATOM 5550  C CG2   . ILE D 1 29  ? -21.205  -50.894 -64.881  1.00 100.00 ? 36   ILE D CG2   1 
ATOM 5551  C CD1   . ILE D 1 29  ? -20.604  -53.440 -63.027  1.00 99.31  ? 36   ILE D CD1   1 
ATOM 5552  N N     . LEU D 1 30  ? -21.064  -47.575 -64.096  1.00 101.27 ? 37   LEU D N     1 
ATOM 5553  C CA    . LEU D 1 30  ? -22.012  -46.590 -64.663  1.00 101.04 ? 37   LEU D CA    1 
ATOM 5554  C C     . LEU D 1 30  ? -22.524  -47.111 -66.003  1.00 101.17 ? 37   LEU D C     1 
ATOM 5555  O O     . LEU D 1 30  ? -21.833  -47.907 -66.669  1.00 100.99 ? 37   LEU D O     1 
ATOM 5556  C CB    . LEU D 1 30  ? -21.341  -45.227 -64.872  1.00 100.64 ? 37   LEU D CB    1 
ATOM 5557  C CG    . LEU D 1 30  ? -21.263  -44.214 -63.714  1.00 100.87 ? 37   LEU D CG    1 
ATOM 5558  C CD1   . LEU D 1 30  ? -22.632  -43.899 -63.000  1.00 100.03 ? 37   LEU D CD1   1 
ATOM 5559  C CD2   . LEU D 1 30  ? -20.151  -44.596 -62.713  1.00 100.61 ? 37   LEU D CD2   1 
ATOM 5560  N N     . HIS D 1 31  ? -23.719  -46.671 -66.406  1.00 101.59 ? 38   HIS D N     1 
ATOM 5561  C CA    . HIS D 1 31  ? -24.343  -47.202 -67.632  1.00 102.37 ? 38   HIS D CA    1 
ATOM 5562  C C     . HIS D 1 31  ? -25.741  -46.652 -67.918  1.00 102.72 ? 38   HIS D C     1 
ATOM 5563  O O     . HIS D 1 31  ? -26.489  -46.252 -67.005  1.00 102.63 ? 38   HIS D O     1 
ATOM 5564  C CB    . HIS D 1 31  ? -24.463  -48.720 -67.535  1.00 102.49 ? 38   HIS D CB    1 
ATOM 5565  C CG    . HIS D 1 31  ? -25.477  -49.153 -66.524  1.00 103.35 ? 38   HIS D CG    1 
ATOM 5566  N ND1   . HIS D 1 31  ? -25.436  -48.741 -65.204  1.00 103.51 ? 38   HIS D ND1   1 
ATOM 5567  C CD2   . HIS D 1 31  ? -26.589  -49.914 -66.648  1.00 103.39 ? 38   HIS D CD2   1 
ATOM 5568  C CE1   . HIS D 1 31  ? -26.472  -49.243 -64.558  1.00 103.56 ? 38   HIS D CE1   1 
ATOM 5569  N NE2   . HIS D 1 31  ? -27.184  -49.962 -65.409  1.00 103.87 ? 38   HIS D NE2   1 
ATOM 5570  N N     . ALA D 1 32  ? -26.092  -46.688 -69.203  1.00 103.31 ? 39   ALA D N     1 
ATOM 5571  C CA    . ALA D 1 32  ? -27.374  -46.181 -69.699  1.00 103.68 ? 39   ALA D CA    1 
ATOM 5572  C C     . ALA D 1 32  ? -28.519  -47.152 -69.368  1.00 103.73 ? 39   ALA D C     1 
ATOM 5573  O O     . ALA D 1 32  ? -28.281  -48.374 -69.313  1.00 103.83 ? 39   ALA D O     1 
ATOM 5574  C CB    . ALA D 1 32  ? -27.281  -45.961 -71.208  1.00 103.65 ? 39   ALA D CB    1 
ATOM 5575  N N     . LYS D 1 33  ? -29.735  -46.614 -69.157  1.00 103.40 ? 40   LYS D N     1 
ATOM 5576  C CA    . LYS D 1 33  ? -30.918  -47.428 -68.800  1.00 103.17 ? 40   LYS D CA    1 
ATOM 5577  C C     . LYS D 1 33  ? -31.488  -48.194 -69.975  1.00 103.44 ? 40   LYS D C     1 
ATOM 5578  O O     . LYS D 1 33  ? -32.190  -49.199 -69.793  1.00 103.35 ? 40   LYS D O     1 
ATOM 5579  C CB    . LYS D 1 33  ? -32.021  -46.598 -68.130  1.00 102.84 ? 40   LYS D CB    1 
ATOM 5580  C CG    . LYS D 1 33  ? -32.276  -46.954 -66.667  1.00 102.83 ? 40   LYS D CG    1 
ATOM 5581  C CD    . LYS D 1 33  ? -33.022  -45.833 -65.935  1.00 103.16 ? 40   LYS D CD    1 
ATOM 5582  C CE    . LYS D 1 33  ? -32.793  -45.878 -64.408  1.00 102.60 ? 40   LYS D CE    1 
ATOM 5583  N NZ    . LYS D 1 33  ? -32.749  -44.498 -63.798  1.00 101.23 ? 40   LYS D NZ    1 
ATOM 5584  N N     . VAL D 1 34  ? -31.192  -47.723 -71.181  1.00 104.05 ? 41   VAL D N     1 
ATOM 5585  C CA    . VAL D 1 34  ? -31.701  -48.377 -72.392  1.00 104.99 ? 41   VAL D CA    1 
ATOM 5586  C C     . VAL D 1 34  ? -30.544  -48.711 -73.335  1.00 105.45 ? 41   VAL D C     1 
ATOM 5587  O O     . VAL D 1 34  ? -29.430  -48.187 -73.180  1.00 105.62 ? 41   VAL D O     1 
ATOM 5588  C CB    . VAL D 1 34  ? -32.774  -47.524 -73.161  1.00 105.01 ? 41   VAL D CB    1 
ATOM 5589  C CG1   . VAL D 1 34  ? -33.715  -48.429 -73.895  1.00 104.95 ? 41   VAL D CG1   1 
ATOM 5590  C CG2   . VAL D 1 34  ? -33.576  -46.619 -72.224  1.00 105.32 ? 41   VAL D CG2   1 
ATOM 5591  N N     . ALA D 1 35  ? -30.810  -49.598 -74.292  1.00 105.79 ? 42   ALA D N     1 
ATOM 5592  C CA    . ALA D 1 35  ? -29.855  -49.919 -75.331  1.00 106.53 ? 42   ALA D CA    1 
ATOM 5593  C C     . ALA D 1 35  ? -30.619  -50.300 -76.584  1.00 107.43 ? 42   ALA D C     1 
ATOM 5594  O O     . ALA D 1 35  ? -31.445  -51.214 -76.537  1.00 107.63 ? 42   ALA D O     1 
ATOM 5595  C CB    . ALA D 1 35  ? -28.981  -51.047 -74.899  1.00 106.18 ? 42   ALA D CB    1 
ATOM 5596  N N     . GLN D 1 36  ? -30.344  -49.597 -77.692  1.00 108.47 ? 43   GLN D N     1 
ATOM 5597  C CA    . GLN D 1 36  ? -30.996  -49.837 -79.003  1.00 109.10 ? 43   GLN D CA    1 
ATOM 5598  C C     . GLN D 1 36  ? -30.639  -51.165 -79.652  1.00 109.68 ? 43   GLN D C     1 
ATOM 5599  O O     . GLN D 1 36  ? -29.464  -51.527 -79.764  1.00 109.33 ? 43   GLN D O     1 
ATOM 5600  C CB    . GLN D 1 36  ? -30.664  -48.717 -79.992  1.00 109.24 ? 43   GLN D CB    1 
ATOM 5601  C CG    . GLN D 1 36  ? -31.791  -47.706 -80.226  1.00 109.06 ? 43   GLN D CG    1 
ATOM 5602  C CD    . GLN D 1 36  ? -31.949  -47.306 -81.711  1.00 107.52 ? 43   GLN D CD    1 
ATOM 5603  O OE1   . GLN D 1 36  ? -32.026  -48.175 -82.617  1.00 105.29 ? 43   GLN D OE1   1 
ATOM 5604  N NE2   . GLN D 1 36  ? -32.009  -45.986 -81.960  1.00 105.52 ? 43   GLN D NE2   1 
ATOM 5605  N N     . LYS D 1 37  ? -31.674  -51.858 -80.104  1.00 110.91 ? 44   LYS D N     1 
ATOM 5606  C CA    . LYS D 1 37  ? -31.541  -53.163 -80.752  1.00 112.77 ? 44   LYS D CA    1 
ATOM 5607  C C     . LYS D 1 37  ? -30.621  -53.028 -81.965  1.00 113.45 ? 44   LYS D C     1 
ATOM 5608  O O     . LYS D 1 37  ? -30.430  -51.919 -82.455  1.00 113.81 ? 44   LYS D O     1 
ATOM 5609  C CB    . LYS D 1 37  ? -32.940  -53.679 -81.160  1.00 112.99 ? 44   LYS D CB    1 
ATOM 5610  C CG    . LYS D 1 37  ? -32.977  -54.979 -82.008  1.00 114.76 ? 44   LYS D CG    1 
ATOM 5611  C CD    . LYS D 1 37  ? -33.531  -56.179 -81.242  1.00 117.97 ? 44   LYS D CD    1 
ATOM 5612  C CE    . LYS D 1 37  ? -33.738  -57.374 -82.166  1.00 119.39 ? 44   LYS D CE    1 
ATOM 5613  N NZ    . LYS D 1 37  ? -33.697  -58.663 -81.404  1.00 120.70 ? 44   LYS D NZ    1 
ATOM 5614  N N     . SER D 1 38  ? -30.053  -54.136 -82.444  1.00 114.45 ? 45   SER D N     1 
ATOM 5615  C CA    . SER D 1 38  ? -29.189  -54.108 -83.644  1.00 115.51 ? 45   SER D CA    1 
ATOM 5616  C C     . SER D 1 38  ? -29.522  -55.182 -84.713  1.00 116.41 ? 45   SER D C     1 
ATOM 5617  O O     . SER D 1 38  ? -28.837  -56.221 -84.814  1.00 116.26 ? 45   SER D O     1 
ATOM 5618  C CB    . SER D 1 38  ? -27.700  -54.146 -83.250  1.00 115.36 ? 45   SER D CB    1 
ATOM 5619  O OG    . SER D 1 38  ? -27.411  -53.169 -82.260  1.00 114.89 ? 45   SER D OG    1 
ATOM 5620  N N     . TYR D 1 39  ? -30.557  -54.888 -85.515  1.00 117.49 ? 46   TYR D N     1 
ATOM 5621  C CA    . TYR D 1 39  ? -31.133  -55.804 -86.537  1.00 118.57 ? 46   TYR D CA    1 
ATOM 5622  C C     . TYR D 1 39  ? -30.148  -56.356 -87.566  1.00 119.02 ? 46   TYR D C     1 
ATOM 5623  O O     . TYR D 1 39  ? -29.474  -55.591 -88.262  1.00 119.15 ? 46   TYR D O     1 
ATOM 5624  C CB    . TYR D 1 39  ? -32.317  -55.146 -87.271  1.00 118.57 ? 46   TYR D CB    1 
ATOM 5625  C CG    . TYR D 1 39  ? -33.408  -54.699 -86.337  1.00 119.65 ? 46   TYR D CG    1 
ATOM 5626  C CD1   . TYR D 1 39  ? -33.348  -53.442 -85.719  1.00 120.77 ? 46   TYR D CD1   1 
ATOM 5627  C CD2   . TYR D 1 39  ? -34.488  -55.537 -86.045  1.00 120.52 ? 46   TYR D CD2   1 
ATOM 5628  C CE1   . TYR D 1 39  ? -34.351  -53.010 -84.827  1.00 121.92 ? 46   TYR D CE1   1 
ATOM 5629  C CE2   . TYR D 1 39  ? -35.501  -55.128 -85.154  1.00 121.88 ? 46   TYR D CE2   1 
ATOM 5630  C CZ    . TYR D 1 39  ? -35.429  -53.856 -84.543  1.00 122.77 ? 46   TYR D CZ    1 
ATOM 5631  O OH    . TYR D 1 39  ? -36.414  -53.426 -83.654  1.00 122.77 ? 46   TYR D OH    1 
ATOM 5632  N N     . GLY D 1 40  ? -30.089  -57.684 -87.667  1.00 119.58 ? 47   GLY D N     1 
ATOM 5633  C CA    . GLY D 1 40  ? -29.235  -58.371 -88.644  1.00 120.41 ? 47   GLY D CA    1 
ATOM 5634  C C     . GLY D 1 40  ? -27.763  -58.021 -88.545  1.00 121.00 ? 47   GLY D C     1 
ATOM 5635  O O     . GLY D 1 40  ? -27.237  -57.829 -87.441  1.00 121.43 ? 47   GLY D O     1 
ATOM 5636  N N     . ASN D 1 41  ? -27.111  -57.903 -89.703  1.00 121.32 ? 48   ASN D N     1 
ATOM 5637  C CA    . ASN D 1 41  ? -25.646  -57.701 -89.790  1.00 121.47 ? 48   ASN D CA    1 
ATOM 5638  C C     . ASN D 1 41  ? -25.046  -56.454 -89.119  1.00 120.86 ? 48   ASN D C     1 
ATOM 5639  O O     . ASN D 1 41  ? -23.850  -56.426 -88.870  1.00 120.72 ? 48   ASN D O     1 
ATOM 5640  C CB    . ASN D 1 41  ? -25.161  -57.816 -91.252  1.00 121.83 ? 48   ASN D CB    1 
ATOM 5641  C CG    . ASN D 1 41  ? -25.123  -59.273 -91.762  1.00 122.79 ? 48   ASN D CG    1 
ATOM 5642  O OD1   . ASN D 1 41  ? -25.634  -60.208 -91.118  1.00 123.25 ? 48   ASN D OD1   1 
ATOM 5643  N ND2   . ASN D 1 41  ? -24.513  -59.462 -92.930  1.00 123.35 ? 48   ASN D ND2   1 
ATOM 5644  N N     . GLU D 1 42  ? -25.876  -55.458 -88.807  1.00 120.40 ? 49   GLU D N     1 
ATOM 5645  C CA    . GLU D 1 42  ? -25.403  -54.169 -88.260  1.00 119.96 ? 49   GLU D CA    1 
ATOM 5646  C C     . GLU D 1 42  ? -24.815  -54.224 -86.848  1.00 119.55 ? 49   GLU D C     1 
ATOM 5647  O O     . GLU D 1 42  ? -24.598  -55.302 -86.325  1.00 119.38 ? 49   GLU D O     1 
ATOM 5648  C CB    . GLU D 1 42  ? -26.485  -53.068 -88.369  1.00 120.08 ? 49   GLU D CB    1 
ATOM 5649  C CG    . GLU D 1 42  ? -27.863  -53.400 -87.808  1.00 119.13 ? 49   GLU D CG    1 
ATOM 5650  C CD    . GLU D 1 42  ? -28.717  -52.169 -87.568  1.00 117.82 ? 49   GLU D CD    1 
ATOM 5651  O OE1   . GLU D 1 42  ? -29.827  -52.105 -88.125  1.00 116.98 ? 49   GLU D OE1   1 
ATOM 5652  O OE2   . GLU D 1 42  ? -28.280  -51.271 -86.821  1.00 117.04 ? 49   GLU D OE2   1 
ATOM 5653  N N     . LYS D 1 43  ? -24.571  -53.063 -86.242  1.00 119.23 ? 50   LYS D N     1 
ATOM 5654  C CA    . LYS D 1 43  ? -23.890  -53.004 -84.951  1.00 119.33 ? 50   LYS D CA    1 
ATOM 5655  C C     . LYS D 1 43  ? -24.077  -51.706 -84.123  1.00 119.56 ? 50   LYS D C     1 
ATOM 5656  O O     . LYS D 1 43  ? -23.111  -50.994 -83.871  1.00 119.54 ? 50   LYS D O     1 
ATOM 5657  C CB    . LYS D 1 43  ? -22.387  -53.211 -85.186  1.00 119.20 ? 50   LYS D CB    1 
ATOM 5658  C CG    . LYS D 1 43  ? -21.774  -54.521 -84.717  1.00 118.55 ? 50   LYS D CG    1 
ATOM 5659  C CD    . LYS D 1 43  ? -20.278  -54.312 -84.448  1.00 117.43 ? 50   LYS D CD    1 
ATOM 5660  C CE    . LYS D 1 43  ? -19.512  -55.612 -84.244  1.00 116.95 ? 50   LYS D CE    1 
ATOM 5661  N NZ    . LYS D 1 43  ? -19.759  -56.589 -85.333  1.00 116.06 ? 50   LYS D NZ    1 
ATOM 5662  N N     . ARG D 1 44  ? -25.276  -51.391 -83.659  1.00 119.93 ? 51   ARG D N     1 
ATOM 5663  C CA    . ARG D 1 44  ? -25.407  -50.144 -82.890  1.00 120.61 ? 51   ARG D CA    1 
ATOM 5664  C C     . ARG D 1 44  ? -24.733  -50.202 -81.520  1.00 120.92 ? 51   ARG D C     1 
ATOM 5665  O O     . ARG D 1 44  ? -25.132  -50.980 -80.656  1.00 121.50 ? 51   ARG D O     1 
ATOM 5666  C CB    . ARG D 1 44  ? -26.867  -49.697 -82.756  1.00 120.60 ? 51   ARG D CB    1 
ATOM 5667  C CG    . ARG D 1 44  ? -27.337  -48.856 -83.926  1.00 121.18 ? 51   ARG D CG    1 
ATOM 5668  C CD    . ARG D 1 44  ? -28.846  -48.879 -84.045  1.00 121.72 ? 51   ARG D CD    1 
ATOM 5669  N NE    . ARG D 1 44  ? -29.248  -49.362 -85.366  1.00 121.61 ? 51   ARG D NE    1 
ATOM 5670  C CZ    . ARG D 1 44  ? -29.447  -48.586 -86.424  1.00 121.36 ? 51   ARG D CZ    1 
ATOM 5671  N NH1   . ARG D 1 44  ? -29.287  -47.269 -86.330  1.00 121.32 ? 51   ARG D NH1   1 
ATOM 5672  N NH2   . ARG D 1 44  ? -29.809  -49.138 -87.575  1.00 121.03 ? 51   ARG D NH2   1 
ATOM 5673  N N     . PHE D 1 45  ? -23.717  -49.373 -81.319  1.00 121.13 ? 52   PHE D N     1 
ATOM 5674  C CA    . PHE D 1 45  ? -23.006  -49.340 -80.037  1.00 121.33 ? 52   PHE D CA    1 
ATOM 5675  C C     . PHE D 1 45  ? -23.771  -48.578 -78.939  1.00 120.95 ? 52   PHE D C     1 
ATOM 5676  O O     . PHE D 1 45  ? -24.552  -47.670 -79.232  1.00 120.66 ? 52   PHE D O     1 
ATOM 5677  C CB    . PHE D 1 45  ? -21.593  -48.741 -80.198  1.00 121.82 ? 52   PHE D CB    1 
ATOM 5678  C CG    . PHE D 1 45  ? -20.672  -49.525 -81.117  1.00 122.57 ? 52   PHE D CG    1 
ATOM 5679  C CD1   . PHE D 1 45  ? -20.891  -50.878 -81.397  1.00 123.69 ? 52   PHE D CD1   1 
ATOM 5680  C CD2   . PHE D 1 45  ? -19.553  -48.903 -81.678  1.00 123.58 ? 52   PHE D CD2   1 
ATOM 5681  C CE1   . PHE D 1 45  ? -20.018  -51.596 -82.240  1.00 123.95 ? 52   PHE D CE1   1 
ATOM 5682  C CE2   . PHE D 1 45  ? -18.678  -49.612 -82.520  1.00 124.40 ? 52   PHE D CE2   1 
ATOM 5683  C CZ    . PHE D 1 45  ? -18.915  -50.963 -82.798  1.00 124.17 ? 52   PHE D CZ    1 
ATOM 5684  N N     . PHE D 1 46  ? -23.510  -48.946 -77.684  1.00 120.68 ? 53   PHE D N     1 
ATOM 5685  C CA    . PHE D 1 46  ? -24.121  -48.297 -76.524  1.00 120.69 ? 53   PHE D CA    1 
ATOM 5686  C C     . PHE D 1 46  ? -23.584  -46.893 -76.382  1.00 120.42 ? 53   PHE D C     1 
ATOM 5687  O O     . PHE D 1 46  ? -22.426  -46.695 -75.985  1.00 120.17 ? 53   PHE D O     1 
ATOM 5688  C CB    . PHE D 1 46  ? -23.841  -49.084 -75.245  1.00 121.04 ? 53   PHE D CB    1 
ATOM 5689  C CG    . PHE D 1 46  ? -24.530  -50.425 -75.176  1.00 121.24 ? 53   PHE D CG    1 
ATOM 5690  C CD1   . PHE D 1 46  ? -25.010  -51.055 -76.336  1.00 121.63 ? 53   PHE D CD1   1 
ATOM 5691  C CD2   . PHE D 1 46  ? -24.661  -51.072 -73.956  1.00 120.70 ? 53   PHE D CD2   1 
ATOM 5692  C CE1   . PHE D 1 46  ? -25.617  -52.294 -76.281  1.00 121.39 ? 53   PHE D CE1   1 
ATOM 5693  C CE2   . PHE D 1 46  ? -25.261  -52.307 -73.894  1.00 121.56 ? 53   PHE D CE2   1 
ATOM 5694  C CZ    . PHE D 1 46  ? -25.742  -52.925 -75.065  1.00 121.53 ? 53   PHE D CZ    1 
ATOM 5695  N N     . CYS D 1 47  ? -24.458  -45.934 -76.677  1.00 120.33 ? 54   CYS D N     1 
ATOM 5696  C CA    . CYS D 1 47  ? -24.030  -44.607 -77.132  1.00 120.33 ? 54   CYS D CA    1 
ATOM 5697  C C     . CYS D 1 47  ? -23.578  -43.611 -76.054  1.00 119.98 ? 54   CYS D C     1 
ATOM 5698  O O     . CYS D 1 47  ? -22.947  -42.583 -76.394  1.00 120.07 ? 54   CYS D O     1 
ATOM 5699  C CB    . CYS D 1 47  ? -25.034  -43.996 -78.125  1.00 120.50 ? 54   CYS D CB    1 
ATOM 5700  S SG    . CYS D 1 47  ? -24.799  -44.604 -79.819  0.50 120.36 ? 54   CYS D SG    1 
ATOM 5701  N N     . PRO D 1 48  ? -23.939  -43.869 -74.778  1.00 119.23 ? 55   PRO D N     1 
ATOM 5702  C CA    . PRO D 1 48  ? -22.927  -43.558 -73.784  1.00 118.73 ? 55   PRO D CA    1 
ATOM 5703  C C     . PRO D 1 48  ? -22.359  -44.931 -73.510  1.00 118.33 ? 55   PRO D C     1 
ATOM 5704  O O     . PRO D 1 48  ? -23.124  -45.884 -73.480  1.00 118.18 ? 55   PRO D O     1 
ATOM 5705  C CB    . PRO D 1 48  ? -23.728  -42.996 -72.599  1.00 118.68 ? 55   PRO D CB    1 
ATOM 5706  C CG    . PRO D 1 48  ? -25.177  -42.994 -73.044  1.00 119.06 ? 55   PRO D CG    1 
ATOM 5707  C CD    . PRO D 1 48  ? -25.276  -43.979 -74.177  1.00 119.14 ? 55   PRO D CD    1 
ATOM 5708  N N     . PRO D 1 49  ? -21.028  -45.062 -73.412  1.00 118.27 ? 56   PRO D N     1 
ATOM 5709  C CA    . PRO D 1 49  ? -20.493  -46.414 -73.231  1.00 118.29 ? 56   PRO D CA    1 
ATOM 5710  C C     . PRO D 1 49  ? -20.382  -46.782 -71.746  1.00 118.33 ? 56   PRO D C     1 
ATOM 5711  O O     . PRO D 1 49  ? -20.016  -45.933 -70.909  1.00 118.47 ? 56   PRO D O     1 
ATOM 5712  C CB    . PRO D 1 49  ? -19.115  -46.357 -73.905  1.00 118.15 ? 56   PRO D CB    1 
ATOM 5713  C CG    . PRO D 1 49  ? -18.893  -44.880 -74.260  1.00 118.13 ? 56   PRO D CG    1 
ATOM 5714  C CD    . PRO D 1 49  ? -19.952  -44.074 -73.567  1.00 118.20 ? 56   PRO D CD    1 
ATOM 5715  N N     . PRO D 1 50  ? -20.738  -48.034 -71.413  1.00 118.21 ? 57   PRO D N     1 
ATOM 5716  C CA    . PRO D 1 50  ? -20.764  -48.497 -70.030  1.00 118.29 ? 57   PRO D CA    1 
ATOM 5717  C C     . PRO D 1 50  ? -19.382  -48.365 -69.416  1.00 118.56 ? 57   PRO D C     1 
ATOM 5718  O O     . PRO D 1 50  ? -18.397  -48.881 -69.962  1.00 118.45 ? 57   PRO D O     1 
ATOM 5719  C CB    . PRO D 1 50  ? -21.181  -49.960 -70.154  1.00 118.34 ? 57   PRO D CB    1 
ATOM 5720  C CG    . PRO D 1 50  ? -21.007  -50.312 -71.610  1.00 118.12 ? 57   PRO D CG    1 
ATOM 5721  C CD    . PRO D 1 50  ? -21.202  -49.064 -72.359  1.00 118.09 ? 57   PRO D CD    1 
ATOM 5722  N N     . CYS D 1 51  ? -19.325  -47.671 -68.286  1.00 119.03 ? 58   CYS D N     1 
ATOM 5723  C CA    . CYS D 1 51  ? -18.076  -47.108 -67.798  1.00 119.86 ? 58   CYS D CA    1 
ATOM 5724  C C     . CYS D 1 51  ? -17.673  -47.604 -66.395  1.00 119.83 ? 58   CYS D C     1 
ATOM 5725  O O     . CYS D 1 51  ? -18.107  -47.048 -65.373  1.00 120.23 ? 58   CYS D O     1 
ATOM 5726  C CB    . CYS D 1 51  ? -18.183  -45.577 -67.838  1.00 119.99 ? 58   CYS D CB    1 
ATOM 5727  S SG    . CYS D 1 51  ? -16.581  -44.719 -67.871  1.00 122.82 ? 58   CYS D SG    1 
ATOM 5728  N N     . VAL D 1 52  ? -16.821  -48.629 -66.369  1.00 119.54 ? 59   VAL D N     1 
ATOM 5729  C CA    . VAL D 1 52  ? -16.435  -49.339 -65.149  1.00 119.24 ? 59   VAL D CA    1 
ATOM 5730  C C     . VAL D 1 52  ? -15.411  -48.605 -64.262  1.00 119.29 ? 59   VAL D C     1 
ATOM 5731  O O     . VAL D 1 52  ? -14.234  -48.929 -64.317  1.00 119.28 ? 59   VAL D O     1 
ATOM 5732  C CB    . VAL D 1 52  ? -15.811  -50.704 -65.531  1.00 119.12 ? 59   VAL D CB    1 
ATOM 5733  C CG1   . VAL D 1 52  ? -15.448  -51.496 -64.295  1.00 119.30 ? 59   VAL D CG1   1 
ATOM 5734  C CG2   . VAL D 1 52  ? -16.746  -51.505 -66.421  1.00 118.97 ? 59   VAL D CG2   1 
ATOM 5735  N N     . TYR D 1 53  ? -15.839  -47.657 -63.425  1.00 119.43 ? 60   TYR D N     1 
ATOM 5736  C CA    . TYR D 1 53  ? -14.922  -47.015 -62.459  1.00 119.71 ? 60   TYR D CA    1 
ATOM 5737  C C     . TYR D 1 53  ? -14.435  -48.001 -61.397  1.00 119.54 ? 60   TYR D C     1 
ATOM 5738  O O     . TYR D 1 53  ? -14.693  -49.206 -61.489  1.00 119.36 ? 60   TYR D O     1 
ATOM 5739  C CB    . TYR D 1 53  ? -15.561  -45.803 -61.788  1.00 120.01 ? 60   TYR D CB    1 
ATOM 5740  C CG    . TYR D 1 53  ? -15.735  -44.610 -62.702  1.00 122.36 ? 60   TYR D CG    1 
ATOM 5741  C CD1   . TYR D 1 53  ? -16.135  -44.776 -64.040  1.00 123.49 ? 60   TYR D CD1   1 
ATOM 5742  C CD2   . TYR D 1 53  ? -15.525  -43.298 -62.228  1.00 124.28 ? 60   TYR D CD2   1 
ATOM 5743  C CE1   . TYR D 1 53  ? -16.303  -43.687 -64.882  1.00 124.60 ? 60   TYR D CE1   1 
ATOM 5744  C CE2   . TYR D 1 53  ? -15.697  -42.186 -63.078  1.00 125.11 ? 60   TYR D CE2   1 
ATOM 5745  C CZ    . TYR D 1 53  ? -16.087  -42.400 -64.409  1.00 125.53 ? 60   TYR D CZ    1 
ATOM 5746  O OH    . TYR D 1 53  ? -16.269  -41.345 -65.280  1.00 126.67 ? 60   TYR D OH    1 
ATOM 5747  N N     . LEU D 1 54  ? -13.736  -47.495 -60.383  1.00 119.45 ? 61   LEU D N     1 
ATOM 5748  C CA    . LEU D 1 54  ? -12.997  -48.373 -59.487  1.00 119.17 ? 61   LEU D CA    1 
ATOM 5749  C C     . LEU D 1 54  ? -12.432  -47.592 -58.309  1.00 119.48 ? 61   LEU D C     1 
ATOM 5750  O O     . LEU D 1 54  ? -11.238  -47.624 -58.048  1.00 119.28 ? 61   LEU D O     1 
ATOM 5751  C CB    . LEU D 1 54  ? -11.890  -49.051 -60.290  1.00 118.72 ? 61   LEU D CB    1 
ATOM 5752  C CG    . LEU D 1 54  ? -11.528  -50.491 -60.014  1.00 118.12 ? 61   LEU D CG    1 
ATOM 5753  C CD1   . LEU D 1 54  ? -11.535  -51.282 -61.302  1.00 117.30 ? 61   LEU D CD1   1 
ATOM 5754  C CD2   . LEU D 1 54  ? -10.173  -50.504 -59.400  1.00 118.36 ? 61   LEU D CD2   1 
ATOM 5755  N N     . MET D 1 55  ? -13.318  -46.907 -57.595  1.00 120.07 ? 62   MET D N     1 
ATOM 5756  C CA    . MET D 1 55  ? -12.947  -46.035 -56.484  1.00 121.06 ? 62   MET D CA    1 
ATOM 5757  C C     . MET D 1 55  ? -12.449  -46.780 -55.247  1.00 121.05 ? 62   MET D C     1 
ATOM 5758  O O     . MET D 1 55  ? -12.329  -48.007 -55.255  1.00 120.96 ? 62   MET D O     1 
ATOM 5759  C CB    . MET D 1 55  ? -14.134  -45.152 -56.106  1.00 121.63 ? 62   MET D CB    1 
ATOM 5760  C CG    . MET D 1 55  ? -14.756  -44.360 -57.275  1.00 124.36 ? 62   MET D CG    1 
ATOM 5761  S SD    . MET D 1 55  ? -13.610  -43.501 -58.408  1.00 130.45 ? 62   MET D SD    1 
ATOM 5762  C CE    . MET D 1 55  ? -12.729  -42.344 -57.320  1.00 128.41 ? 62   MET D CE    1 
ATOM 5763  N N     . GLY D 1 56  ? -12.136  -46.031 -54.191  1.00 121.14 ? 63   GLY D N     1 
ATOM 5764  C CA    . GLY D 1 56  ? -11.754  -46.641 -52.923  1.00 121.57 ? 63   GLY D CA    1 
ATOM 5765  C C     . GLY D 1 56  ? -10.275  -46.793 -52.623  1.00 121.83 ? 63   GLY D C     1 
ATOM 5766  O O     . GLY D 1 56  ? -9.536   -47.525 -53.307  1.00 121.49 ? 63   GLY D O     1 
ATOM 5767  N N     . SER D 1 57  ? -9.870   -46.119 -51.549  1.00 122.32 ? 64   SER D N     1 
ATOM 5768  C CA    . SER D 1 57  ? -8.476   -46.048 -51.116  1.00 122.57 ? 64   SER D CA    1 
ATOM 5769  C C     . SER D 1 57  ? -8.017   -47.359 -50.518  1.00 122.64 ? 64   SER D C     1 
ATOM 5770  O O     . SER D 1 57  ? -7.768   -47.450 -49.318  1.00 122.48 ? 64   SER D O     1 
ATOM 5771  C CB    . SER D 1 57  ? -8.287   -44.908 -50.101  1.00 122.72 ? 64   SER D CB    1 
ATOM 5772  O OG    . SER D 1 57  ? -8.827   -45.237 -48.832  1.00 121.98 ? 64   SER D OG    1 
ATOM 5773  N N     . GLY D 1 58  ? -7.892   -48.370 -51.364  1.00 122.86 ? 65   GLY D N     1 
ATOM 5774  C CA    . GLY D 1 58  ? -7.583   -49.705 -50.881  1.00 123.63 ? 65   GLY D CA    1 
ATOM 5775  C C     . GLY D 1 58  ? -7.327   -50.680 -52.004  1.00 124.13 ? 65   GLY D C     1 
ATOM 5776  O O     . GLY D 1 58  ? -6.990   -51.851 -51.769  1.00 124.06 ? 65   GLY D O     1 
ATOM 5777  N N     . TRP D 1 59  ? -7.509   -50.198 -53.229  1.00 124.66 ? 66   TRP D N     1 
ATOM 5778  C CA    . TRP D 1 59  ? -7.064   -50.923 -54.402  1.00 125.14 ? 66   TRP D CA    1 
ATOM 5779  C C     . TRP D 1 59  ? -5.552   -50.865 -54.397  1.00 126.15 ? 66   TRP D C     1 
ATOM 5780  O O     . TRP D 1 59  ? -4.863   -51.843 -54.745  1.00 125.98 ? 66   TRP D O     1 
ATOM 5781  C CB    . TRP D 1 59  ? -7.614   -50.245 -55.633  1.00 124.74 ? 66   TRP D CB    1 
ATOM 5782  C CG    . TRP D 1 59  ? -9.005   -50.634 -55.917  1.00 123.34 ? 66   TRP D CG    1 
ATOM 5783  C CD1   . TRP D 1 59  ? -10.132  -49.908 -55.675  1.00 122.06 ? 66   TRP D CD1   1 
ATOM 5784  C CD2   . TRP D 1 59  ? -9.430   -51.863 -56.507  1.00 121.98 ? 66   TRP D CD2   1 
ATOM 5785  N NE1   . TRP D 1 59  ? -11.237  -50.611 -56.088  1.00 121.40 ? 66   TRP D NE1   1 
ATOM 5786  C CE2   . TRP D 1 59  ? -10.833  -51.818 -56.598  1.00 121.50 ? 66   TRP D CE2   1 
ATOM 5787  C CE3   . TRP D 1 59  ? -8.757   -52.997 -56.975  1.00 122.05 ? 66   TRP D CE3   1 
ATOM 5788  C CZ2   . TRP D 1 59  ? -11.579  -52.865 -57.140  1.00 121.60 ? 66   TRP D CZ2   1 
ATOM 5789  C CZ3   . TRP D 1 59  ? -9.499   -54.039 -57.510  1.00 121.81 ? 66   TRP D CZ3   1 
ATOM 5790  C CH2   . TRP D 1 59  ? -10.894  -53.963 -57.591  1.00 121.59 ? 66   TRP D CH2   1 
ATOM 5791  N N     . LYS D 1 60  ? -5.065   -49.697 -53.962  1.00 127.35 ? 67   LYS D N     1 
ATOM 5792  C CA    . LYS D 1 60  ? -3.651   -49.443 -53.718  1.00 128.41 ? 67   LYS D CA    1 
ATOM 5793  C C     . LYS D 1 60  ? -3.069   -50.426 -52.687  1.00 128.45 ? 67   LYS D C     1 
ATOM 5794  O O     . LYS D 1 60  ? -2.129   -51.164 -53.005  1.00 128.46 ? 67   LYS D O     1 
ATOM 5795  C CB    . LYS D 1 60  ? -3.422   -47.979 -53.307  1.00 128.64 ? 67   LYS D CB    1 
ATOM 5796  C CG    . LYS D 1 60  ? -2.240   -47.324 -54.057  1.00 130.68 ? 67   LYS D CG    1 
ATOM 5797  C CD    . LYS D 1 60  ? -1.866   -45.948 -53.508  1.00 132.19 ? 67   LYS D CD    1 
ATOM 5798  C CE    . LYS D 1 60  ? -0.448   -45.579 -53.891  1.00 132.44 ? 67   LYS D CE    1 
ATOM 5799  N NZ    . LYS D 1 60  ? 0.079    -44.548 -52.959  1.00 132.79 ? 67   LYS D NZ    1 
ATOM 5800  N N     . LYS D 1 61  ? -3.642   -50.457 -51.478  1.00 128.65 ? 68   LYS D N     1 
ATOM 5801  C CA    . LYS D 1 61  ? -3.280   -51.472 -50.460  1.00 128.80 ? 68   LYS D CA    1 
ATOM 5802  C C     . LYS D 1 61  ? -3.207   -52.898 -51.026  1.00 128.63 ? 68   LYS D C     1 
ATOM 5803  O O     . LYS D 1 61  ? -2.417   -53.722 -50.551  1.00 128.76 ? 68   LYS D O     1 
ATOM 5804  C CB    . LYS D 1 61  ? -4.251   -51.463 -49.266  1.00 128.90 ? 68   LYS D CB    1 
ATOM 5805  C CG    . LYS D 1 61  ? -4.063   -50.319 -48.297  1.00 129.72 ? 68   LYS D CG    1 
ATOM 5806  C CD    . LYS D 1 61  ? -4.920   -49.138 -48.702  1.00 131.07 ? 68   LYS D CD    1 
ATOM 5807  C CE    . LYS D 1 61  ? -4.105   -47.871 -48.749  1.00 131.75 ? 68   LYS D CE    1 
ATOM 5808  N NZ    . LYS D 1 61  ? -4.409   -47.145 -50.000  1.00 132.51 ? 68   LYS D NZ    1 
ATOM 5809  N N     . LYS D 1 62  ? -4.032   -53.193 -52.028  1.00 128.36 ? 69   LYS D N     1 
ATOM 5810  C CA    . LYS D 1 62  ? -4.022   -54.521 -52.610  1.00 128.24 ? 69   LYS D CA    1 
ATOM 5811  C C     . LYS D 1 62  ? -2.896   -54.697 -53.640  1.00 127.90 ? 69   LYS D C     1 
ATOM 5812  O O     . LYS D 1 62  ? -2.394   -55.810 -53.795  1.00 127.90 ? 69   LYS D O     1 
ATOM 5813  C CB    . LYS D 1 62  ? -5.396   -54.897 -53.176  1.00 128.49 ? 69   LYS D CB    1 
ATOM 5814  C CG    . LYS D 1 62  ? -5.672   -56.404 -53.177  1.00 128.61 ? 69   LYS D CG    1 
ATOM 5815  C CD    . LYS D 1 62  ? -5.819   -56.972 -51.768  1.00 128.68 ? 69   LYS D CD    1 
ATOM 5816  C CE    . LYS D 1 62  ? -5.277   -58.406 -51.701  1.00 129.42 ? 69   LYS D CE    1 
ATOM 5817  N NZ    . LYS D 1 62  ? -5.698   -59.298 -52.846  1.00 128.42 ? 69   LYS D NZ    1 
ATOM 5818  N N     . LYS D 1 63  ? -2.500   -53.614 -54.324  1.00 127.23 ? 70   LYS D N     1 
ATOM 5819  C CA    . LYS D 1 63  ? -1.227   -53.604 -55.099  1.00 126.60 ? 70   LYS D CA    1 
ATOM 5820  C C     . LYS D 1 63  ? 0.007    -53.761 -54.184  1.00 125.48 ? 70   LYS D C     1 
ATOM 5821  O O     . LYS D 1 63  ? 0.878    -54.610 -54.448  1.00 125.20 ? 70   LYS D O     1 
ATOM 5822  C CB    . LYS D 1 63  ? -1.089   -52.339 -55.975  1.00 126.96 ? 70   LYS D CB    1 
ATOM 5823  C CG    . LYS D 1 63  ? -1.483   -52.509 -57.470  1.00 127.82 ? 70   LYS D CG    1 
ATOM 5824  C CD    . LYS D 1 63  ? -0.299   -52.335 -58.457  1.00 128.43 ? 70   LYS D CD    1 
ATOM 5825  C CE    . LYS D 1 63  ? -0.806   -52.057 -59.884  1.00 128.71 ? 70   LYS D CE    1 
ATOM 5826  N NZ    . LYS D 1 63  ? 0.248    -51.984 -60.929  1.00 128.35 ? 70   LYS D NZ    1 
ATOM 5827  N N     . GLU D 1 64  ? 0.049    -52.949 -53.117  1.00 124.12 ? 71   GLU D N     1 
ATOM 5828  C CA    . GLU D 1 64  ? 1.100    -53.000 -52.083  1.00 122.97 ? 71   GLU D CA    1 
ATOM 5829  C C     . GLU D 1 64  ? 1.302    -54.399 -51.464  1.00 122.50 ? 71   GLU D C     1 
ATOM 5830  O O     . GLU D 1 64  ? 2.340    -55.053 -51.711  1.00 122.24 ? 71   GLU D O     1 
ATOM 5831  C CB    . GLU D 1 64  ? 0.876    -51.909 -51.021  1.00 122.44 ? 71   GLU D CB    1 
ATOM 5832  C CG    . GLU D 1 64  ? 1.291    -50.511 -51.538  1.00 122.33 ? 71   GLU D CG    1 
ATOM 5833  C CD    . GLU D 1 64  ? 0.641    -49.302 -50.806  1.00 122.36 ? 71   GLU D CD    1 
ATOM 5834  O OE1   . GLU D 1 64  ? 0.258    -49.417 -49.611  1.00 122.14 ? 71   GLU D OE1   1 
ATOM 5835  O OE2   . GLU D 1 64  ? 0.535    -48.213 -51.437  1.00 121.36 ? 71   GLU D OE2   1 
ATOM 5836  N N     . GLN D 1 65  ? 0.307    -54.865 -50.700  1.00 121.91 ? 72   GLN D N     1 
ATOM 5837  C CA    . GLN D 1 65  ? 0.325    -56.215 -50.087  1.00 121.31 ? 72   GLN D CA    1 
ATOM 5838  C C     . GLN D 1 65  ? 0.778    -57.339 -51.066  1.00 120.70 ? 72   GLN D C     1 
ATOM 5839  O O     . GLN D 1 65  ? 1.570    -58.219 -50.689  1.00 120.30 ? 72   GLN D O     1 
ATOM 5840  C CB    . GLN D 1 65  ? -1.040   -56.536 -49.428  1.00 121.20 ? 72   GLN D CB    1 
ATOM 5841  C CG    . GLN D 1 65  ? -1.031   -57.695 -48.378  1.00 122.23 ? 72   GLN D CG    1 
ATOM 5842  C CD    . GLN D 1 65  ? -1.564   -59.080 -48.904  1.00 123.51 ? 72   GLN D CD    1 
ATOM 5843  O OE1   . GLN D 1 65  ? -2.171   -59.177 -49.990  1.00 123.33 ? 72   GLN D OE1   1 
ATOM 5844  N NE2   . GLN D 1 65  ? -1.337   -60.146 -48.110  1.00 122.92 ? 72   GLN D NE2   1 
ATOM 5845  N N     . MET D 1 66  ? 0.291    -57.282 -52.313  1.00 120.04 ? 73   MET D N     1 
ATOM 5846  C CA    . MET D 1 66  ? 0.535    -58.339 -53.299  1.00 119.38 ? 73   MET D CA    1 
ATOM 5847  C C     . MET D 1 66  ? 2.008    -58.440 -53.668  1.00 119.36 ? 73   MET D C     1 
ATOM 5848  O O     . MET D 1 66  ? 2.640    -59.497 -53.475  1.00 118.88 ? 73   MET D O     1 
ATOM 5849  C CB    . MET D 1 66  ? -0.305   -58.131 -54.567  1.00 119.20 ? 73   MET D CB    1 
ATOM 5850  C CG    . MET D 1 66  ? -1.744   -58.594 -54.445  1.00 117.95 ? 73   MET D CG    1 
ATOM 5851  S SD    . MET D 1 66  ? -2.433   -59.086 -56.042  1.00 117.21 ? 73   MET D SD    1 
ATOM 5852  C CE    . MET D 1 66  ? -2.208   -60.863 -55.955  1.00 114.24 ? 73   MET D CE    1 
ATOM 5853  N N     . GLU D 1 67  ? 2.542    -57.334 -54.196  1.00 119.48 ? 74   GLU D N     1 
ATOM 5854  C CA    . GLU D 1 67  ? 3.939    -57.270 -54.645  1.00 119.59 ? 74   GLU D CA    1 
ATOM 5855  C C     . GLU D 1 67  ? 4.915    -57.619 -53.519  1.00 119.91 ? 74   GLU D C     1 
ATOM 5856  O O     . GLU D 1 67  ? 5.854    -58.402 -53.747  1.00 119.68 ? 74   GLU D O     1 
ATOM 5857  C CB    . GLU D 1 67  ? 4.252    -55.910 -55.257  1.00 119.30 ? 74   GLU D CB    1 
ATOM 5858  C CG    . GLU D 1 67  ? 3.424    -55.638 -56.490  1.00 119.15 ? 74   GLU D CG    1 
ATOM 5859  C CD    . GLU D 1 67  ? 3.965    -54.494 -57.300  1.00 119.54 ? 74   GLU D CD    1 
ATOM 5860  O OE1   . GLU D 1 67  ? 4.176    -53.396 -56.705  1.00 119.35 ? 74   GLU D OE1   1 
ATOM 5861  O OE2   . GLU D 1 67  ? 4.173    -54.706 -58.526  1.00 118.99 ? 74   GLU D OE2   1 
ATOM 5862  N N     . ARG D 1 68  ? 4.659    -57.062 -52.318  1.00 120.32 ? 75   ARG D N     1 
ATOM 5863  C CA    . ARG D 1 68  ? 5.373    -57.401 -51.059  1.00 120.64 ? 75   ARG D CA    1 
ATOM 5864  C C     . ARG D 1 68  ? 5.223    -58.874 -50.640  1.00 120.77 ? 75   ARG D C     1 
ATOM 5865  O O     . ARG D 1 68  ? 5.268    -59.192 -49.447  1.00 120.61 ? 75   ARG D O     1 
ATOM 5866  C CB    . ARG D 1 68  ? 4.895    -56.509 -49.907  1.00 120.49 ? 75   ARG D CB    1 
ATOM 5867  C CG    . ARG D 1 68  ? 5.373    -55.066 -49.955  1.00 121.94 ? 75   ARG D CG    1 
ATOM 5868  C CD    . ARG D 1 68  ? 4.949    -54.310 -48.684  1.00 124.76 ? 75   ARG D CD    1 
ATOM 5869  N NE    . ARG D 1 68  ? 3.490    -54.108 -48.590  1.00 127.41 ? 75   ARG D NE    1 
ATOM 5870  C CZ    . ARG D 1 68  ? 2.657    -54.815 -47.815  1.00 128.03 ? 75   ARG D CZ    1 
ATOM 5871  N NH1   . ARG D 1 68  ? 3.121    -55.796 -47.044  1.00 128.50 ? 75   ARG D NH1   1 
ATOM 5872  N NH2   . ARG D 1 68  ? 1.352    -54.544 -47.810  1.00 127.58 ? 75   ARG D NH2   1 
ATOM 5873  N N     . ASP D 1 69  ? 5.038    -59.749 -51.628  1.00 121.36 ? 76   ASP D N     1 
ATOM 5874  C CA    . ASP D 1 69  ? 4.877    -61.187 -51.439  1.00 122.40 ? 76   ASP D CA    1 
ATOM 5875  C C     . ASP D 1 69  ? 5.627    -61.904 -52.538  1.00 123.45 ? 76   ASP D C     1 
ATOM 5876  O O     . ASP D 1 69  ? 5.774    -63.139 -52.508  1.00 123.58 ? 76   ASP D O     1 
ATOM 5877  C CB    . ASP D 1 69  ? 3.399    -61.583 -51.528  1.00 122.17 ? 76   ASP D CB    1 
ATOM 5878  C CG    . ASP D 1 69  ? 2.700    -61.532 -50.184  1.00 122.17 ? 76   ASP D CG    1 
ATOM 5879  O OD1   . ASP D 1 69  ? 3.110    -62.307 -49.288  1.00 122.33 ? 76   ASP D OD1   1 
ATOM 5880  O OD2   . ASP D 1 69  ? 1.743    -60.729 -50.029  1.00 121.71 ? 76   ASP D OD2   1 
ATOM 5881  N N     . GLY D 1 70  ? 6.087    -61.110 -53.510  1.00 124.65 ? 77   GLY D N     1 
ATOM 5882  C CA    . GLY D 1 70  ? 6.648    -61.608 -54.770  1.00 125.91 ? 77   GLY D CA    1 
ATOM 5883  C C     . GLY D 1 70  ? 5.628    -61.539 -55.900  1.00 126.79 ? 77   GLY D C     1 
ATOM 5884  O O     . GLY D 1 70  ? 5.156    -62.590 -56.375  1.00 126.41 ? 77   GLY D O     1 
ATOM 5885  N N     . CYS D 1 71  ? 5.286    -60.309 -56.318  1.00 127.97 ? 78   CYS D N     1 
ATOM 5886  C CA    . CYS D 1 71  ? 4.306    -60.088 -57.403  1.00 129.45 ? 78   CYS D CA    1 
ATOM 5887  C C     . CYS D 1 71  ? 4.665    -58.990 -58.415  1.00 130.08 ? 78   CYS D C     1 
ATOM 5888  O O     . CYS D 1 71  ? 5.041    -57.871 -58.040  1.00 129.51 ? 78   CYS D O     1 
ATOM 5889  C CB    . CYS D 1 71  ? 2.884    -59.869 -56.846  1.00 129.53 ? 78   CYS D CB    1 
ATOM 5890  S SG    . CYS D 1 71  ? 2.164    -61.315 -55.941  1.00 130.97 ? 78   CYS D SG    1 
ATOM 5891  N N     . SER D 1 72  ? 4.512    -59.340 -59.696  1.00 131.56 ? 79   SER D N     1 
ATOM 5892  C CA    . SER D 1 72  ? 4.803    -58.453 -60.835  1.00 133.44 ? 79   SER D CA    1 
ATOM 5893  C C     . SER D 1 72  ? 3.996    -57.158 -60.787  1.00 134.95 ? 79   SER D C     1 
ATOM 5894  O O     . SER D 1 72  ? 2.983    -57.077 -60.099  1.00 135.20 ? 79   SER D O     1 
ATOM 5895  C CB    . SER D 1 72  ? 4.527    -59.149 -62.193  1.00 133.08 ? 79   SER D CB    1 
ATOM 5896  O OG    . SER D 1 72  ? 5.023    -60.478 -62.281  1.00 132.87 ? 79   SER D OG    1 
ATOM 5897  N N     . GLU D 1 73  ? 4.462    -56.150 -61.525  1.00 137.11 ? 80   GLU D N     1 
ATOM 5898  C CA    . GLU D 1 73  ? 3.648    -54.986 -61.872  1.00 139.37 ? 80   GLU D CA    1 
ATOM 5899  C C     . GLU D 1 73  ? 2.570    -55.461 -62.847  1.00 140.71 ? 80   GLU D C     1 
ATOM 5900  O O     . GLU D 1 73  ? 1.520    -54.818 -63.044  1.00 140.71 ? 80   GLU D O     1 
ATOM 5901  C CB    . GLU D 1 73  ? 4.516    -53.915 -62.539  1.00 139.52 ? 80   GLU D CB    1 
ATOM 5902  C CG    . GLU D 1 73  ? 4.098    -52.488 -62.200  1.00 140.55 ? 80   GLU D CG    1 
ATOM 5903  C CD    . GLU D 1 73  ? 4.263    -52.182 -60.722  1.00 141.42 ? 80   GLU D CD    1 
ATOM 5904  O OE1   . GLU D 1 73  ? 3.248    -52.225 -59.995  1.00 141.74 ? 80   GLU D OE1   1 
ATOM 5905  O OE2   . GLU D 1 73  ? 5.410    -51.926 -60.292  1.00 141.74 ? 80   GLU D OE2   1 
ATOM 5906  N N     . GLN D 1 74  ? 2.880    -56.603 -63.458  1.00 142.53 ? 81   GLN D N     1 
ATOM 5907  C CA    . GLN D 1 74  ? 1.997    -57.324 -64.361  1.00 144.25 ? 81   GLN D CA    1 
ATOM 5908  C C     . GLN D 1 74  ? 0.995    -58.166 -63.562  1.00 144.96 ? 81   GLN D C     1 
ATOM 5909  O O     . GLN D 1 74  ? -0.132   -58.394 -64.016  1.00 145.20 ? 81   GLN D O     1 
ATOM 5910  C CB    . GLN D 1 74  ? 2.827    -58.214 -65.319  1.00 144.40 ? 81   GLN D CB    1 
ATOM 5911  C CG    . GLN D 1 74  ? 3.269    -57.550 -66.660  1.00 145.35 ? 81   GLN D CG    1 
ATOM 5912  C CD    . GLN D 1 74  ? 4.553    -56.695 -66.589  1.00 146.25 ? 81   GLN D CD    1 
ATOM 5913  O OE1   . GLN D 1 74  ? 5.072    -56.384 -65.510  1.00 146.59 ? 81   GLN D OE1   1 
ATOM 5914  N NE2   . GLN D 1 74  ? 5.058    -56.309 -67.761  1.00 146.13 ? 81   GLN D NE2   1 
ATOM 5915  N N     . GLU D 1 75  ? 1.408    -58.609 -62.373  1.00 145.89 ? 82   GLU D N     1 
ATOM 5916  C CA    . GLU D 1 75  ? 0.592    -59.507 -61.546  1.00 146.82 ? 82   GLU D CA    1 
ATOM 5917  C C     . GLU D 1 75  ? -0.498   -58.773 -60.779  1.00 146.86 ? 82   GLU D C     1 
ATOM 5918  O O     . GLU D 1 75  ? -1.653   -59.187 -60.816  1.00 146.88 ? 82   GLU D O     1 
ATOM 5919  C CB    . GLU D 1 75  ? 1.448    -60.328 -60.570  1.00 147.14 ? 82   GLU D CB    1 
ATOM 5920  C CG    . GLU D 1 75  ? 2.041    -61.625 -61.134  1.00 148.56 ? 82   GLU D CG    1 
ATOM 5921  C CD    . GLU D 1 75  ? 2.877    -62.374 -60.094  1.00 150.73 ? 82   GLU D CD    1 
ATOM 5922  O OE1   . GLU D 1 75  ? 4.117    -62.199 -60.085  1.00 151.39 ? 82   GLU D OE1   1 
ATOM 5923  O OE2   . GLU D 1 75  ? 2.293    -63.120 -59.271  1.00 151.39 ? 82   GLU D OE2   1 
ATOM 5924  N N     . SER D 1 76  ? -0.132   -57.698 -60.080  1.00 147.07 ? 83   SER D N     1 
ATOM 5925  C CA    . SER D 1 76  ? -1.111   -56.899 -59.333  1.00 147.29 ? 83   SER D CA    1 
ATOM 5926  C C     . SER D 1 76  ? -1.854   -55.938 -60.271  1.00 147.46 ? 83   SER D C     1 
ATOM 5927  O O     . SER D 1 76  ? -2.241   -54.829 -59.886  1.00 147.54 ? 83   SER D O     1 
ATOM 5928  C CB    . SER D 1 76  ? -0.478   -56.184 -58.120  1.00 147.28 ? 83   SER D CB    1 
ATOM 5929  O OG    . SER D 1 76  ? 0.444    -55.182 -58.499  1.00 147.18 ? 83   SER D OG    1 
ATOM 5930  N N     . GLN D 1 77  ? -2.047   -56.399 -61.507  1.00 147.60 ? 84   GLN D N     1 
ATOM 5931  C CA    . GLN D 1 77  ? -2.841   -55.708 -62.523  1.00 147.79 ? 84   GLN D CA    1 
ATOM 5932  C C     . GLN D 1 77  ? -4.309   -56.219 -62.541  1.00 147.20 ? 84   GLN D C     1 
ATOM 5933  O O     . GLN D 1 77  ? -4.607   -57.286 -63.108  1.00 147.36 ? 84   GLN D O     1 
ATOM 5934  C CB    . GLN D 1 77  ? -2.161   -55.856 -63.907  1.00 148.14 ? 84   GLN D CB    1 
ATOM 5935  C CG    . GLN D 1 77  ? -2.907   -55.222 -65.105  1.00 149.63 ? 84   GLN D CG    1 
ATOM 5936  C CD    . GLN D 1 77  ? -2.562   -53.752 -65.334  1.00 151.35 ? 84   GLN D CD    1 
ATOM 5937  O OE1   . GLN D 1 77  ? -1.548   -53.435 -65.963  1.00 151.88 ? 84   GLN D OE1   1 
ATOM 5938  N NE2   . GLN D 1 77  ? -3.420   -52.849 -64.843  1.00 151.68 ? 84   GLN D NE2   1 
ATOM 5939  N N     . PRO D 1 78  ? -5.231   -55.464 -61.913  1.00 146.41 ? 85   PRO D N     1 
ATOM 5940  C CA    . PRO D 1 78  ? -6.635   -55.823 -62.049  1.00 145.81 ? 85   PRO D CA    1 
ATOM 5941  C C     . PRO D 1 78  ? -6.967   -56.020 -63.524  1.00 145.33 ? 85   PRO D C     1 
ATOM 5942  O O     . PRO D 1 78  ? -6.616   -55.177 -64.345  1.00 145.35 ? 85   PRO D O     1 
ATOM 5943  C CB    . PRO D 1 78  ? -7.349   -54.589 -61.499  1.00 145.81 ? 85   PRO D CB    1 
ATOM 5944  C CG    . PRO D 1 78  ? -6.399   -54.035 -60.490  1.00 145.91 ? 85   PRO D CG    1 
ATOM 5945  C CD    . PRO D 1 78  ? -5.044   -54.263 -61.075  1.00 146.29 ? 85   PRO D CD    1 
ATOM 5946  N N     . CYS D 1 79  ? -7.611   -57.129 -63.865  1.00 144.83 ? 86   CYS D N     1 
ATOM 5947  C CA    . CYS D 1 79  ? -7.824   -57.467 -65.276  1.00 144.68 ? 86   CYS D CA    1 
ATOM 5948  C C     . CYS D 1 79  ? -9.287   -57.774 -65.669  1.00 143.68 ? 86   CYS D C     1 
ATOM 5949  O O     . CYS D 1 79  ? -9.701   -58.940 -65.665  1.00 143.69 ? 86   CYS D O     1 
ATOM 5950  C CB    . CYS D 1 79  ? -6.897   -58.615 -65.679  1.00 145.16 ? 86   CYS D CB    1 
ATOM 5951  S SG    . CYS D 1 79  ? -6.543   -58.673 -67.444  1.00 148.08 ? 86   CYS D SG    1 
ATOM 5952  N N     . ALA D 1 80  ? -10.029  -56.727 -66.055  1.00 142.53 ? 87   ALA D N     1 
ATOM 5953  C CA    . ALA D 1 80  ? -11.485  -56.766 -66.308  1.00 141.24 ? 87   ALA D CA    1 
ATOM 5954  C C     . ALA D 1 80  ? -11.937  -57.108 -67.732  1.00 140.47 ? 87   ALA D C     1 
ATOM 5955  O O     . ALA D 1 80  ? -11.269  -56.799 -68.705  1.00 140.36 ? 87   ALA D O     1 
ATOM 5956  C CB    . ALA D 1 80  ? -12.110  -55.453 -65.887  1.00 141.15 ? 87   ALA D CB    1 
ATOM 5957  N N     . PHE D 1 81  ? -13.099  -57.737 -67.824  1.00 139.95 ? 88   PHE D N     1 
ATOM 5958  C CA    . PHE D 1 81  ? -13.760  -58.057 -69.086  1.00 139.78 ? 88   PHE D CA    1 
ATOM 5959  C C     . PHE D 1 81  ? -15.245  -57.750 -68.911  1.00 140.10 ? 88   PHE D C     1 
ATOM 5960  O O     . PHE D 1 81  ? -15.833  -58.089 -67.879  1.00 140.16 ? 88   PHE D O     1 
ATOM 5961  C CB    . PHE D 1 81  ? -13.628  -59.550 -69.410  1.00 139.44 ? 88   PHE D CB    1 
ATOM 5962  C CG    . PHE D 1 81  ? -12.256  -59.980 -69.830  1.00 138.43 ? 88   PHE D CG    1 
ATOM 5963  C CD1   . PHE D 1 81  ? -11.175  -59.895 -68.960  1.00 138.01 ? 88   PHE D CD1   1 
ATOM 5964  C CD2   . PHE D 1 81  ? -12.057  -60.525 -71.087  1.00 137.74 ? 88   PHE D CD2   1 
ATOM 5965  C CE1   . PHE D 1 81  ? -9.904   -60.304 -69.356  1.00 137.66 ? 88   PHE D CE1   1 
ATOM 5966  C CE2   . PHE D 1 81  ? -10.794  -60.943 -71.494  1.00 137.36 ? 88   PHE D CE2   1 
ATOM 5967  C CZ    . PHE D 1 81  ? -9.715   -60.832 -70.627  1.00 137.21 ? 88   PHE D CZ    1 
ATOM 5968  N N     . ILE D 1 82  ? -15.859  -57.110 -69.902  1.00 140.42 ? 89   ILE D N     1 
ATOM 5969  C CA    . ILE D 1 82  ? -17.298  -56.856 -69.847  1.00 140.62 ? 89   ILE D CA    1 
ATOM 5970  C C     . ILE D 1 82  ? -18.016  -57.764 -70.834  1.00 141.30 ? 89   ILE D C     1 
ATOM 5971  O O     . ILE D 1 82  ? -17.382  -58.460 -71.620  1.00 141.20 ? 89   ILE D O     1 
ATOM 5972  C CB    . ILE D 1 82  ? -17.647  -55.376 -70.093  1.00 140.26 ? 89   ILE D CB    1 
ATOM 5973  C CG1   . ILE D 1 82  ? -19.048  -55.066 -69.557  1.00 139.58 ? 89   ILE D CG1   1 
ATOM 5974  C CG2   . ILE D 1 82  ? -17.521  -55.048 -71.571  1.00 140.14 ? 89   ILE D CG2   1 
ATOM 5975  C CD1   . ILE D 1 82  ? -19.242  -53.643 -69.105  1.00 138.03 ? 89   ILE D CD1   1 
ATOM 5976  N N     . GLY D 1 83  ? -19.341  -57.762 -70.765  1.00 142.35 ? 90   GLY D N     1 
ATOM 5977  C CA    . GLY D 1 83  ? -20.159  -58.600 -71.615  1.00 143.80 ? 90   GLY D CA    1 
ATOM 5978  C C     . GLY D 1 83  ? -21.622  -58.476 -71.269  1.00 144.89 ? 90   GLY D C     1 
ATOM 5979  O O     . GLY D 1 83  ? -21.999  -58.301 -70.103  1.00 144.89 ? 90   GLY D O     1 
ATOM 5980  N N     . ILE D 1 84  ? -22.448  -58.562 -72.301  1.00 146.02 ? 91   ILE D N     1 
ATOM 5981  C CA    . ILE D 1 84  ? -23.886  -58.586 -72.119  1.00 147.26 ? 91   ILE D CA    1 
ATOM 5982  C C     . ILE D 1 84  ? -24.342  -59.931 -71.536  1.00 148.29 ? 91   ILE D C     1 
ATOM 5983  O O     . ILE D 1 84  ? -25.497  -60.068 -71.101  1.00 148.13 ? 91   ILE D O     1 
ATOM 5984  C CB    . ILE D 1 84  ? -24.634  -58.246 -73.437  1.00 147.11 ? 91   ILE D CB    1 
ATOM 5985  C CG1   . ILE D 1 84  ? -23.895  -58.803 -74.654  1.00 147.35 ? 91   ILE D CG1   1 
ATOM 5986  C CG2   . ILE D 1 84  ? -24.763  -56.745 -73.599  1.00 146.67 ? 91   ILE D CG2   1 
ATOM 5987  C CD1   . ILE D 1 84  ? -24.446  -60.099 -75.186  1.00 148.20 ? 91   ILE D CD1   1 
ATOM 5988  N N     . GLY D 1 85  ? -23.422  -60.903 -71.510  1.00 149.65 ? 92   GLY D N     1 
ATOM 5989  C CA    . GLY D 1 85  ? -23.729  -62.268 -71.092  1.00 151.70 ? 92   GLY D CA    1 
ATOM 5990  C C     . GLY D 1 85  ? -24.715  -62.905 -72.057  1.00 153.27 ? 92   GLY D C     1 
ATOM 5991  O O     . GLY D 1 85  ? -25.396  -62.199 -72.795  1.00 153.27 ? 92   GLY D O     1 
ATOM 5992  N N     . ASN D 1 86  ? -24.805  -64.236 -72.040  1.00 155.03 ? 93   ASN D N     1 
ATOM 5993  C CA    . ASN D 1 86  ? -25.634  -65.020 -72.997  1.00 156.77 ? 93   ASN D CA    1 
ATOM 5994  C C     . ASN D 1 86  ? -25.377  -64.714 -74.482  1.00 157.87 ? 93   ASN D C     1 
ATOM 5995  O O     . ASN D 1 86  ? -26.229  -64.137 -75.183  1.00 157.99 ? 93   ASN D O     1 
ATOM 5996  C CB    . ASN D 1 86  ? -27.142  -64.949 -72.674  1.00 156.80 ? 93   ASN D CB    1 
ATOM 5997  C CG    . ASN D 1 86  ? -28.000  -65.768 -73.652  1.00 156.89 ? 93   ASN D CG    1 
ATOM 5998  O OD1   . ASN D 1 86  ? -28.046  -66.998 -73.583  1.00 156.48 ? 93   ASN D OD1   1 
ATOM 5999  N ND2   . ASN D 1 86  ? -28.684  -65.075 -74.565  1.00 156.87 ? 93   ASN D ND2   1 
ATOM 6000  N N     . SER D 1 87  ? -24.197  -65.112 -74.948  1.00 159.18 ? 94   SER D N     1 
ATOM 6001  C CA    . SER D 1 87  ? -23.791  -64.874 -76.333  1.00 160.40 ? 94   SER D CA    1 
ATOM 6002  C C     . SER D 1 87  ? -22.689  -65.837 -76.769  1.00 161.10 ? 94   SER D C     1 
ATOM 6003  O O     . SER D 1 87  ? -22.050  -66.493 -75.927  1.00 161.38 ? 94   SER D O     1 
ATOM 6004  C CB    . SER D 1 87  ? -23.344  -63.409 -76.534  1.00 160.41 ? 94   SER D CB    1 
ATOM 6005  O OG    . SER D 1 87  ? -22.551  -62.933 -75.452  1.00 160.38 ? 94   SER D OG    1 
ATOM 6006  N N     . ASP D 1 88  ? -22.494  -65.931 -78.086  1.00 161.70 ? 95   ASP D N     1 
ATOM 6007  C CA    . ASP D 1 88  ? -21.337  -66.624 -78.656  1.00 162.16 ? 95   ASP D CA    1 
ATOM 6008  C C     . ASP D 1 88  ? -20.256  -65.609 -79.033  1.00 162.27 ? 95   ASP D C     1 
ATOM 6009  O O     . ASP D 1 88  ? -19.152  -65.993 -79.435  1.00 162.27 ? 95   ASP D O     1 
ATOM 6010  C CB    . ASP D 1 88  ? -21.738  -67.493 -79.863  1.00 162.28 ? 95   ASP D CB    1 
ATOM 6011  C CG    . ASP D 1 88  ? -22.241  -68.886 -79.456  1.00 162.62 ? 95   ASP D CG    1 
ATOM 6012  O OD1   . ASP D 1 88  ? -21.638  -69.520 -78.552  1.00 162.73 ? 95   ASP D OD1   1 
ATOM 6013  O OD2   . ASP D 1 88  ? -23.237  -69.352 -80.055  1.00 162.64 ? 95   ASP D OD2   1 
ATOM 6014  N N     . GLN D 1 89  ? -20.581  -64.318 -78.878  1.00 162.41 ? 96   GLN D N     1 
ATOM 6015  C CA    . GLN D 1 89  ? -19.657  -63.210 -79.173  1.00 162.43 ? 96   GLN D CA    1 
ATOM 6016  C C     . GLN D 1 89  ? -18.438  -63.241 -78.252  1.00 162.38 ? 96   GLN D C     1 
ATOM 6017  O O     . GLN D 1 89  ? -17.432  -62.577 -78.525  1.00 162.56 ? 96   GLN D O     1 
ATOM 6018  C CB    . GLN D 1 89  ? -20.356  -61.834 -79.075  1.00 162.47 ? 96   GLN D CB    1 
ATOM 6019  C CG    . GLN D 1 89  ? -20.692  -61.373 -77.642  1.00 162.59 ? 96   GLN D CG    1 
ATOM 6020  C CD    . GLN D 1 89  ? -20.841  -59.854 -77.477  1.00 162.73 ? 96   GLN D CD    1 
ATOM 6021  O OE1   . GLN D 1 89  ? -21.453  -59.176 -78.303  1.00 162.81 ? 96   GLN D OE1   1 
ATOM 6022  N NE2   . GLN D 1 89  ? -20.296  -59.325 -76.385  1.00 162.11 ? 96   GLN D NE2   1 
ATOM 6023  N N     . GLU D 1 90  ? -18.530  -64.033 -77.180  1.00 162.04 ? 97   GLU D N     1 
ATOM 6024  C CA    . GLU D 1 90  ? -17.566  -64.006 -76.077  1.00 161.66 ? 97   GLU D CA    1 
ATOM 6025  C C     . GLU D 1 90  ? -17.524  -62.620 -75.442  1.00 161.15 ? 97   GLU D C     1 
ATOM 6026  O O     . GLU D 1 90  ? -18.421  -61.798 -75.660  1.00 161.20 ? 97   GLU D O     1 
ATOM 6027  C CB    . GLU D 1 90  ? -16.167  -64.485 -76.504  1.00 161.71 ? 97   GLU D CB    1 
ATOM 6028  C CG    . GLU D 1 90  ? -15.960  -65.995 -76.358  1.00 162.58 ? 97   GLU D CG    1 
ATOM 6029  C CD    . GLU D 1 90  ? -15.814  -66.476 -74.902  1.00 163.77 ? 97   GLU D CD    1 
ATOM 6030  O OE1   . GLU D 1 90  ? -16.328  -65.825 -73.961  1.00 163.97 ? 97   GLU D OE1   1 
ATOM 6031  O OE2   . GLU D 1 90  ? -15.181  -67.533 -74.698  1.00 164.04 ? 97   GLU D OE2   1 
ATOM 6032  N N     . MET D 1 91  ? -16.495  -62.354 -74.651  1.00 160.40 ? 98   MET D N     1 
ATOM 6033  C CA    . MET D 1 91  ? -16.450  -61.104 -73.920  1.00 159.71 ? 98   MET D CA    1 
ATOM 6034  C C     . MET D 1 91  ? -15.423  -60.179 -74.531  1.00 159.42 ? 98   MET D C     1 
ATOM 6035  O O     . MET D 1 91  ? -14.704  -60.556 -75.446  1.00 159.28 ? 98   MET D O     1 
ATOM 6036  C CB    . MET D 1 91  ? -16.191  -61.364 -72.434  1.00 159.65 ? 98   MET D CB    1 
ATOM 6037  C CG    . MET D 1 91  ? -17.166  -62.375 -71.824  1.00 159.02 ? 98   MET D CG    1 
ATOM 6038  S SD    . MET D 1 91  ? -17.103  -62.469 -70.025  1.00 158.02 ? 98   MET D SD    1 
ATOM 6039  C CE    . MET D 1 91  ? -18.028  -61.009 -69.552  1.00 157.73 ? 98   MET D CE    1 
ATOM 6040  N N     . GLN D 1 92  ? -15.380  -58.954 -74.036  1.00 159.35 ? 99   GLN D N     1 
ATOM 6041  C CA    . GLN D 1 92  ? -14.450  -57.963 -74.544  1.00 159.45 ? 99   GLN D CA    1 
ATOM 6042  C C     . GLN D 1 92  ? -13.661  -57.346 -73.399  1.00 159.56 ? 99   GLN D C     1 
ATOM 6043  O O     . GLN D 1 92  ? -14.224  -56.899 -72.396  1.00 159.42 ? 99   GLN D O     1 
ATOM 6044  C CB    . GLN D 1 92  ? -15.189  -56.892 -75.345  1.00 159.45 ? 99   GLN D CB    1 
ATOM 6045  C CG    . GLN D 1 92  ? -15.730  -57.381 -76.688  1.00 159.16 ? 99   GLN D CG    1 
ATOM 6046  C CD    . GLN D 1 92  ? -16.868  -56.520 -77.226  1.00 158.66 ? 99   GLN D CD    1 
ATOM 6047  O OE1   . GLN D 1 92  ? -16.940  -55.315 -76.970  1.00 158.14 ? 99   GLN D OE1   1 
ATOM 6048  N NE2   . GLN D 1 92  ? -17.764  -57.143 -77.979  1.00 158.76 ? 99   GLN D NE2   1 
ATOM 6049  N N     . GLN D 1 93  ? -12.346  -57.334 -73.561  1.00 159.82 ? 100  GLN D N     1 
ATOM 6050  C CA    . GLN D 1 93  ? -11.454  -56.913 -72.505  1.00 160.17 ? 100  GLN D CA    1 
ATOM 6051  C C     . GLN D 1 93  ? -11.603  -55.431 -72.264  1.00 160.45 ? 100  GLN D C     1 
ATOM 6052  O O     . GLN D 1 93  ? -12.066  -54.699 -73.128  1.00 160.42 ? 100  GLN D O     1 
ATOM 6053  C CB    . GLN D 1 93  ? -10.015  -57.247 -72.883  1.00 160.12 ? 100  GLN D CB    1 
ATOM 6054  C CG    . GLN D 1 93  ? -9.077   -57.344 -71.695  1.00 160.48 ? 100  GLN D CG    1 
ATOM 6055  C CD    . GLN D 1 93  ? -7.733   -57.969 -72.040  1.00 160.87 ? 100  GLN D CD    1 
ATOM 6056  O OE1   . GLN D 1 93  ? -7.565   -58.580 -73.104  1.00 160.56 ? 100  GLN D OE1   1 
ATOM 6057  N NE2   . GLN D 1 93  ? -6.763   -57.819 -71.132  1.00 160.86 ? 100  GLN D NE2   1 
ATOM 6058  N N     . LEU D 1 94  ? -11.238  -54.997 -71.070  1.00 161.14 ? 101  LEU D N     1 
ATOM 6059  C CA    . LEU D 1 94  ? -11.106  -53.580 -70.802  1.00 162.07 ? 101  LEU D CA    1 
ATOM 6060  C C     . LEU D 1 94  ? -9.673   -53.248 -70.448  1.00 162.65 ? 101  LEU D C     1 
ATOM 6061  O O     . LEU D 1 94  ? -9.016   -53.999 -69.717  1.00 162.61 ? 101  LEU D O     1 
ATOM 6062  C CB    . LEU D 1 94  ? -12.034  -53.131 -69.673  1.00 162.17 ? 101  LEU D CB    1 
ATOM 6063  C CG    . LEU D 1 94  ? -13.479  -52.743 -70.000  1.00 162.35 ? 101  LEU D CG    1 
ATOM 6064  C CD1   . LEU D 1 94  ? -13.585  -51.951 -71.319  1.00 162.68 ? 101  LEU D CD1   1 
ATOM 6065  C CD2   . LEU D 1 94  ? -14.356  -53.978 -70.027  1.00 162.42 ? 101  LEU D CD2   1 
ATOM 6066  N N     . ASN D 1 95  ? -9.191   -52.124 -70.974  1.00 163.47 ? 102  ASN D N     1 
ATOM 6067  C CA    . ASN D 1 95  ? -7.854   -51.660 -70.636  1.00 164.23 ? 102  ASN D CA    1 
ATOM 6068  C C     . ASN D 1 95  ? -7.850   -50.791 -69.380  1.00 164.53 ? 102  ASN D C     1 
ATOM 6069  O O     . ASN D 1 95  ? -7.955   -49.553 -69.447  1.00 164.55 ? 102  ASN D O     1 
ATOM 6070  C CB    . ASN D 1 95  ? -7.166   -50.951 -71.805  1.00 164.38 ? 102  ASN D CB    1 
ATOM 6071  C CG    . ASN D 1 95  ? -5.713   -50.623 -71.499  1.00 164.80 ? 102  ASN D CG    1 
ATOM 6072  O OD1   . ASN D 1 95  ? -5.366   -49.464 -71.269  1.00 165.28 ? 102  ASN D OD1   1 
ATOM 6073  N ND2   . ASN D 1 95  ? -4.866   -51.649 -71.455  1.00 164.90 ? 102  ASN D ND2   1 
ATOM 6074  N N     . LEU D 1 96  ? -7.725   -51.474 -68.241  1.00 164.83 ? 103  LEU D N     1 
ATOM 6075  C CA    . LEU D 1 96  ? -7.642   -50.846 -66.926  1.00 165.04 ? 103  LEU D CA    1 
ATOM 6076  C C     . LEU D 1 96  ? -6.222   -50.395 -66.595  1.00 165.09 ? 103  LEU D C     1 
ATOM 6077  O O     . LEU D 1 96  ? -5.937   -49.988 -65.465  1.00 165.22 ? 103  LEU D O     1 
ATOM 6078  C CB    . LEU D 1 96  ? -8.158   -51.805 -65.846  1.00 165.16 ? 103  LEU D CB    1 
ATOM 6079  C CG    . LEU D 1 96  ? -9.673   -51.984 -65.672  1.00 165.24 ? 103  LEU D CG    1 
ATOM 6080  C CD1   . LEU D 1 96  ? -9.974   -52.873 -64.474  1.00 165.01 ? 103  LEU D CD1   1 
ATOM 6081  C CD2   . LEU D 1 96  ? -10.366  -50.636 -65.511  1.00 165.52 ? 103  LEU D CD2   1 
ATOM 6082  N N     . GLU D 1 97  ? -5.343   -50.472 -67.593  1.00 165.04 ? 104  GLU D N     1 
ATOM 6083  C CA    . GLU D 1 97  ? -3.959   -50.036 -67.461  1.00 164.90 ? 104  GLU D CA    1 
ATOM 6084  C C     . GLU D 1 97  ? -3.907   -48.508 -67.335  1.00 164.40 ? 104  GLU D C     1 
ATOM 6085  O O     . GLU D 1 97  ? -4.827   -47.806 -67.782  1.00 164.37 ? 104  GLU D O     1 
ATOM 6086  C CB    . GLU D 1 97  ? -3.137   -50.532 -68.661  1.00 165.11 ? 104  GLU D CB    1 
ATOM 6087  C CG    . GLU D 1 97  ? -1.677   -50.866 -68.342  1.00 166.15 ? 104  GLU D CG    1 
ATOM 6088  C CD    . GLU D 1 97  ? -1.053   -51.859 -69.328  1.00 167.51 ? 104  GLU D CD    1 
ATOM 6089  O OE1   . GLU D 1 97  ? -1.228   -51.698 -70.562  1.00 167.71 ? 104  GLU D OE1   1 
ATOM 6090  O OE2   . GLU D 1 97  ? -0.374   -52.801 -68.859  1.00 168.06 ? 104  GLU D OE2   1 
ATOM 6091  N N     . GLY D 1 98  ? -2.843   -48.012 -66.705  1.00 163.77 ? 105  GLY D N     1 
ATOM 6092  C CA    . GLY D 1 98  ? -2.636   -46.576 -66.514  1.00 162.87 ? 105  GLY D CA    1 
ATOM 6093  C C     . GLY D 1 98  ? -3.677   -45.969 -65.595  1.00 162.22 ? 105  GLY D C     1 
ATOM 6094  O O     . GLY D 1 98  ? -3.534   -46.018 -64.371  1.00 162.25 ? 105  GLY D O     1 
ATOM 6095  N N     . LYS D 1 99  ? -4.721   -45.395 -66.194  1.00 161.51 ? 106  LYS D N     1 
ATOM 6096  C CA    . LYS D 1 99  ? -5.873   -44.856 -65.451  1.00 160.56 ? 106  LYS D CA    1 
ATOM 6097  C C     . LYS D 1 99  ? -6.757   -45.982 -64.865  1.00 159.67 ? 106  LYS D C     1 
ATOM 6098  O O     . LYS D 1 99  ? -6.765   -47.116 -65.377  1.00 159.48 ? 106  LYS D O     1 
ATOM 6099  C CB    . LYS D 1 99  ? -6.686   -43.826 -66.290  1.00 160.66 ? 106  LYS D CB    1 
ATOM 6100  C CG    . LYS D 1 99  ? -6.497   -43.852 -67.839  1.00 160.82 ? 106  LYS D CG    1 
ATOM 6101  C CD    . LYS D 1 99  ? -7.246   -45.015 -68.524  1.00 160.56 ? 106  LYS D CD    1 
ATOM 6102  C CE    . LYS D 1 99  ? -6.830   -45.207 -69.987  1.00 159.74 ? 106  LYS D CE    1 
ATOM 6103  N NZ    . LYS D 1 99  ? -7.311   -46.527 -70.504  1.00 159.00 ? 106  LYS D NZ    1 
ATOM 6104  N N     . ASN D 1 100 ? -7.474   -45.660 -63.784  1.00 158.46 ? 107  ASN D N     1 
ATOM 6105  C CA    . ASN D 1 100 ? -8.298   -46.632 -63.039  1.00 157.12 ? 107  ASN D CA    1 
ATOM 6106  C C     . ASN D 1 100 ? -9.695   -46.935 -63.622  1.00 156.29 ? 107  ASN D C     1 
ATOM 6107  O O     . ASN D 1 100 ? -10.210  -48.040 -63.438  1.00 156.11 ? 107  ASN D O     1 
ATOM 6108  C CB    . ASN D 1 100 ? -8.397   -46.234 -61.557  1.00 157.07 ? 107  ASN D CB    1 
ATOM 6109  C CG    . ASN D 1 100 ? -8.962   -44.830 -61.355  1.00 156.76 ? 107  ASN D CG    1 
ATOM 6110  O OD1   . ASN D 1 100 ? -10.181  -44.618 -61.356  1.00 156.17 ? 107  ASN D OD1   1 
ATOM 6111  N ND2   . ASN D 1 100 ? -8.069   -43.866 -61.160  1.00 156.60 ? 107  ASN D ND2   1 
ATOM 6112  N N     . TYR D 1 101 ? -10.295  -45.959 -64.310  1.00 155.22 ? 108  TYR D N     1 
ATOM 6113  C CA    . TYR D 1 101 ? -11.570  -46.144 -65.031  1.00 154.19 ? 108  TYR D CA    1 
ATOM 6114  C C     . TYR D 1 101 ? -11.363  -46.849 -66.394  1.00 153.01 ? 108  TYR D C     1 
ATOM 6115  O O     . TYR D 1 101 ? -10.243  -47.243 -66.737  1.00 152.88 ? 108  TYR D O     1 
ATOM 6116  C CB    . TYR D 1 101 ? -12.294  -44.791 -65.212  1.00 154.49 ? 108  TYR D CB    1 
ATOM 6117  C CG    . TYR D 1 101 ? -11.614  -43.868 -66.201  1.00 155.80 ? 108  TYR D CG    1 
ATOM 6118  C CD1   . TYR D 1 101 ? -10.526  -43.071 -65.813  1.00 156.87 ? 108  TYR D CD1   1 
ATOM 6119  C CD2   . TYR D 1 101 ? -12.040  -43.805 -67.534  1.00 157.36 ? 108  TYR D CD2   1 
ATOM 6120  C CE1   . TYR D 1 101 ? -9.878   -42.230 -66.731  1.00 158.07 ? 108  TYR D CE1   1 
ATOM 6121  C CE2   . TYR D 1 101 ? -11.400  -42.964 -68.463  1.00 158.42 ? 108  TYR D CE2   1 
ATOM 6122  C CZ    . TYR D 1 101 ? -10.320  -42.182 -68.051  1.00 158.57 ? 108  TYR D CZ    1 
ATOM 6123  O OH    . TYR D 1 101 ? -9.685   -41.358 -68.950  1.00 158.77 ? 108  TYR D OH    1 
ATOM 6124  N N     . CYS D 1 102 ? -12.447  -47.016 -67.152  1.00 151.58 ? 109  CYS D N     1 
ATOM 6125  C CA    . CYS D 1 102 ? -12.399  -47.579 -68.506  1.00 150.32 ? 109  CYS D CA    1 
ATOM 6126  C C     . CYS D 1 102 ? -13.796  -47.603 -69.114  1.00 149.17 ? 109  CYS D C     1 
ATOM 6127  O O     . CYS D 1 102 ? -14.791  -47.546 -68.389  1.00 149.15 ? 109  CYS D O     1 
ATOM 6128  C CB    . CYS D 1 102 ? -11.797  -48.992 -68.525  1.00 150.41 ? 109  CYS D CB    1 
ATOM 6129  S SG    . CYS D 1 102 ? -11.091  -49.484 -70.139  1.00 151.33 ? 109  CYS D SG    1 
ATOM 6130  N N     . THR D 1 103 ? -13.860  -47.686 -70.445  1.00 147.63 ? 110  THR D N     1 
ATOM 6131  C CA    . THR D 1 103 ? -15.128  -47.652 -71.193  1.00 146.08 ? 110  THR D CA    1 
ATOM 6132  C C     . THR D 1 103 ? -15.127  -48.691 -72.314  1.00 145.01 ? 110  THR D C     1 
ATOM 6133  O O     . THR D 1 103 ? -14.086  -48.944 -72.930  1.00 144.98 ? 110  THR D O     1 
ATOM 6134  C CB    . THR D 1 103 ? -15.409  -46.254 -71.819  1.00 146.05 ? 110  THR D CB    1 
ATOM 6135  O OG1   . THR D 1 103 ? -14.227  -45.776 -72.465  1.00 146.53 ? 110  THR D OG1   1 
ATOM 6136  C CG2   . THR D 1 103 ? -15.832  -45.233 -70.773  1.00 145.46 ? 110  THR D CG2   1 
ATOM 6137  N N     . ALA D 1 104 ? -16.295  -49.286 -72.573  1.00 143.61 ? 111  ALA D N     1 
ATOM 6138  C CA    . ALA D 1 104 ? -16.453  -50.301 -73.628  1.00 142.16 ? 111  ALA D CA    1 
ATOM 6139  C C     . ALA D 1 104 ? -17.368  -49.795 -74.755  1.00 141.12 ? 111  ALA D C     1 
ATOM 6140  O O     . ALA D 1 104 ? -18.582  -50.034 -74.768  1.00 141.04 ? 111  ALA D O     1 
ATOM 6141  C CB    . ALA D 1 104 ? -16.966  -51.601 -73.044  1.00 142.02 ? 111  ALA D CB    1 
ATOM 6142  N N     . LYS D 1 105 ? -16.764  -49.094 -75.707  1.00 139.76 ? 112  LYS D N     1 
ATOM 6143  C CA    . LYS D 1 105 ? -17.521  -48.321 -76.684  1.00 138.45 ? 112  LYS D CA    1 
ATOM 6144  C C     . LYS D 1 105 ? -17.864  -49.088 -77.957  1.00 137.54 ? 112  LYS D C     1 
ATOM 6145  O O     . LYS D 1 105 ? -18.384  -48.486 -78.901  1.00 137.41 ? 112  LYS D O     1 
ATOM 6146  C CB    . LYS D 1 105 ? -16.811  -46.996 -76.997  1.00 138.47 ? 112  LYS D CB    1 
ATOM 6147  C CG    . LYS D 1 105 ? -15.301  -46.999 -76.700  1.00 138.76 ? 112  LYS D CG    1 
ATOM 6148  C CD    . LYS D 1 105 ? -14.816  -45.612 -76.265  1.00 139.08 ? 112  LYS D CD    1 
ATOM 6149  C CE    . LYS D 1 105 ? -13.505  -45.672 -75.475  1.00 139.16 ? 112  LYS D CE    1 
ATOM 6150  N NZ    . LYS D 1 105 ? -13.281  -44.433 -74.655  1.00 138.48 ? 112  LYS D NZ    1 
ATOM 6151  N N     . THR D 1 106 ? -17.582  -50.399 -77.980  1.00 136.32 ? 113  THR D N     1 
ATOM 6152  C CA    . THR D 1 106 ? -18.069  -51.292 -79.062  1.00 135.19 ? 113  THR D CA    1 
ATOM 6153  C C     . THR D 1 106 ? -18.932  -52.478 -78.568  1.00 134.38 ? 113  THR D C     1 
ATOM 6154  O O     . THR D 1 106 ? -18.712  -53.639 -78.965  1.00 134.09 ? 113  THR D O     1 
ATOM 6155  C CB    . THR D 1 106 ? -16.946  -51.834 -79.968  1.00 135.11 ? 113  THR D CB    1 
ATOM 6156  O OG1   . THR D 1 106 ? -16.202  -52.827 -79.260  1.00 135.29 ? 113  THR D OG1   1 
ATOM 6157  C CG2   . THR D 1 106 ? -16.029  -50.725 -80.424  1.00 135.31 ? 113  THR D CG2   1 
ATOM 6158  N N     . LEU D 1 107 ? -19.918  -52.163 -77.719  1.00 133.25 ? 114  LEU D N     1 
ATOM 6159  C CA    . LEU D 1 107 ? -20.904  -53.131 -77.219  1.00 131.91 ? 114  LEU D CA    1 
ATOM 6160  C C     . LEU D 1 107 ? -22.262  -52.958 -77.876  1.00 131.33 ? 114  LEU D C     1 
ATOM 6161  O O     . LEU D 1 107 ? -22.774  -51.840 -77.981  1.00 131.20 ? 114  LEU D O     1 
ATOM 6162  C CB    . LEU D 1 107 ? -21.071  -52.976 -75.716  1.00 131.65 ? 114  LEU D CB    1 
ATOM 6163  C CG    . LEU D 1 107 ? -19.958  -53.599 -74.891  1.00 130.95 ? 114  LEU D CG    1 
ATOM 6164  C CD1   . LEU D 1 107 ? -20.186  -53.278 -73.430  1.00 130.05 ? 114  LEU D CD1   1 
ATOM 6165  C CD2   . LEU D 1 107 ? -19.918  -55.105 -75.139  1.00 130.79 ? 114  LEU D CD2   1 
ATOM 6166  N N     . TYR D 1 108 ? -22.851  -54.065 -78.305  1.00 130.59 ? 115  TYR D N     1 
ATOM 6167  C CA    . TYR D 1 108 ? -24.115  -54.005 -79.024  1.00 130.08 ? 115  TYR D CA    1 
ATOM 6168  C C     . TYR D 1 108 ? -25.028  -55.154 -78.620  1.00 130.08 ? 115  TYR D C     1 
ATOM 6169  O O     . TYR D 1 108 ? -24.750  -55.852 -77.646  1.00 130.21 ? 115  TYR D O     1 
ATOM 6170  C CB    . TYR D 1 108 ? -23.863  -53.978 -80.538  1.00 129.88 ? 115  TYR D CB    1 
ATOM 6171  C CG    . TYR D 1 108 ? -23.287  -55.252 -81.137  1.00 129.11 ? 115  TYR D CG    1 
ATOM 6172  C CD1   . TYR D 1 108 ? -24.042  -56.027 -82.037  1.00 128.16 ? 115  TYR D CD1   1 
ATOM 6173  C CD2   . TYR D 1 108 ? -21.992  -55.678 -80.823  1.00 128.14 ? 115  TYR D CD2   1 
ATOM 6174  C CE1   . TYR D 1 108 ? -23.525  -57.197 -82.599  1.00 127.03 ? 115  TYR D CE1   1 
ATOM 6175  C CE2   . TYR D 1 108 ? -21.471  -56.850 -81.380  1.00 127.76 ? 115  TYR D CE2   1 
ATOM 6176  C CZ    . TYR D 1 108 ? -22.238  -57.598 -82.268  1.00 127.11 ? 115  TYR D CZ    1 
ATOM 6177  O OH    . TYR D 1 108 ? -21.708  -58.744 -82.805  1.00 126.68 ? 115  TYR D OH    1 
ATOM 6178  N N     . ILE D 1 109 ? -26.109  -55.351 -79.368  1.00 130.00 ? 116  ILE D N     1 
ATOM 6179  C CA    . ILE D 1 109 ? -27.095  -56.381 -79.050  1.00 130.15 ? 116  ILE D CA    1 
ATOM 6180  C C     . ILE D 1 109 ? -27.774  -56.879 -80.328  1.00 130.26 ? 116  ILE D C     1 
ATOM 6181  O O     . ILE D 1 109 ? -28.569  -56.160 -80.936  1.00 130.30 ? 116  ILE D O     1 
ATOM 6182  C CB    . ILE D 1 109 ? -28.121  -55.875 -77.949  1.00 130.28 ? 116  ILE D CB    1 
ATOM 6183  C CG1   . ILE D 1 109 ? -29.226  -56.901 -77.648  1.00 130.21 ? 116  ILE D CG1   1 
ATOM 6184  C CG2   . ILE D 1 109 ? -28.695  -54.483 -78.275  1.00 130.58 ? 116  ILE D CG2   1 
ATOM 6185  C CD1   . ILE D 1 109 ? -29.025  -57.622 -76.325  1.00 129.84 ? 116  ILE D CD1   1 
ATOM 6186  N N     . SER D 1 110 ? -27.447  -58.111 -80.721  1.00 130.50 ? 117  SER D N     1 
ATOM 6187  C CA    . SER D 1 110 ? -27.911  -58.730 -81.977  1.00 130.91 ? 117  SER D CA    1 
ATOM 6188  C C     . SER D 1 110 ? -29.421  -58.714 -82.200  1.00 131.11 ? 117  SER D C     1 
ATOM 6189  O O     . SER D 1 110 ? -30.195  -58.432 -81.290  1.00 131.34 ? 117  SER D O     1 
ATOM 6190  C CB    . SER D 1 110 ? -27.432  -60.178 -82.034  1.00 130.90 ? 117  SER D CB    1 
ATOM 6191  O OG    . SER D 1 110 ? -26.147  -60.309 -81.438  1.00 131.69 ? 117  SER D OG    1 
ATOM 6192  N N     . ASP D 1 111 ? -29.841  -59.022 -83.422  1.00 131.54 ? 118  ASP D N     1 
ATOM 6193  C CA    . ASP D 1 111 ? -31.263  -59.305 -83.689  1.00 131.98 ? 118  ASP D CA    1 
ATOM 6194  C C     . ASP D 1 111 ? -31.631  -60.689 -83.136  1.00 131.72 ? 118  ASP D C     1 
ATOM 6195  O O     . ASP D 1 111 ? -32.814  -60.986 -82.866  1.00 131.63 ? 118  ASP D O     1 
ATOM 6196  C CB    . ASP D 1 111 ? -31.580  -59.231 -85.194  1.00 132.43 ? 118  ASP D CB    1 
ATOM 6197  C CG    . ASP D 1 111 ? -30.844  -60.300 -86.019  1.00 133.48 ? 118  ASP D CG    1 
ATOM 6198  O OD1   . ASP D 1 111 ? -29.649  -60.585 -85.740  1.00 134.69 ? 118  ASP D OD1   1 
ATOM 6199  O OD2   . ASP D 1 111 ? -31.469  -60.844 -86.958  1.00 134.08 ? 118  ASP D OD2   1 
ATOM 6200  N N     . SER D 1 112 ? -30.587  -61.517 -82.995  1.00 131.28 ? 119  SER D N     1 
ATOM 6201  C CA    . SER D 1 112 ? -30.665  -62.868 -82.437  1.00 130.74 ? 119  SER D CA    1 
ATOM 6202  C C     . SER D 1 112 ? -30.429  -62.871 -80.921  1.00 130.19 ? 119  SER D C     1 
ATOM 6203  O O     . SER D 1 112 ? -29.664  -63.674 -80.390  1.00 130.43 ? 119  SER D O     1 
ATOM 6204  C CB    . SER D 1 112 ? -29.667  -63.792 -83.141  1.00 130.76 ? 119  SER D CB    1 
ATOM 6205  O OG    . SER D 1 112 ? -30.267  -64.403 -84.265  1.00 131.16 ? 119  SER D OG    1 
ATOM 6206  N N     . ASP D 1 113 ? -31.088  -61.943 -80.242  1.00 129.32 ? 120  ASP D N     1 
ATOM 6207  C CA    . ASP D 1 113 ? -31.130  -61.902 -78.797  1.00 128.31 ? 120  ASP D CA    1 
ATOM 6208  C C     . ASP D 1 113 ? -32.567  -61.500 -78.442  1.00 127.71 ? 120  ASP D C     1 
ATOM 6209  O O     . ASP D 1 113 ? -32.887  -60.304 -78.311  1.00 127.71 ? 120  ASP D O     1 
ATOM 6210  C CB    . ASP D 1 113 ? -30.098  -60.902 -78.263  1.00 128.20 ? 120  ASP D CB    1 
ATOM 6211  C CG    . ASP D 1 113 ? -29.345  -61.422 -77.049  1.00 128.19 ? 120  ASP D CG    1 
ATOM 6212  O OD1   . ASP D 1 113 ? -29.718  -62.503 -76.515  1.00 128.33 ? 120  ASP D OD1   1 
ATOM 6213  O OD2   . ASP D 1 113 ? -28.372  -60.746 -76.634  1.00 127.17 ? 120  ASP D OD2   1 
ATOM 6214  N N     . LYS D 1 114 ? -33.434  -62.508 -78.330  1.00 126.57 ? 121  LYS D N     1 
ATOM 6215  C CA    . LYS D 1 114 ? -34.868  -62.297 -78.145  1.00 125.65 ? 121  LYS D CA    1 
ATOM 6216  C C     . LYS D 1 114 ? -35.235  -61.511 -76.863  1.00 124.51 ? 121  LYS D C     1 
ATOM 6217  O O     . LYS D 1 114 ? -36.261  -60.816 -76.803  1.00 124.67 ? 121  LYS D O     1 
ATOM 6218  C CB    . LYS D 1 114 ? -35.604  -63.639 -78.195  1.00 125.98 ? 121  LYS D CB    1 
ATOM 6219  C CG    . LYS D 1 114 ? -36.427  -63.882 -79.471  1.00 127.84 ? 121  LYS D CG    1 
ATOM 6220  C CD    . LYS D 1 114 ? -35.773  -64.876 -80.449  1.00 130.49 ? 121  LYS D CD    1 
ATOM 6221  C CE    . LYS D 1 114 ? -35.029  -64.179 -81.606  1.00 131.59 ? 121  LYS D CE    1 
ATOM 6222  N NZ    . LYS D 1 114 ? -33.691  -63.658 -81.198  1.00 132.17 ? 121  LYS D NZ    1 
ATOM 6223  N N     . ARG D 1 115 ? -34.379  -61.605 -75.854  1.00 122.84 ? 122  ARG D N     1 
ATOM 6224  C CA    . ARG D 1 115 ? -34.644  -61.028 -74.528  1.00 121.15 ? 122  ARG D CA    1 
ATOM 6225  C C     . ARG D 1 115 ? -34.966  -59.540 -74.500  1.00 119.39 ? 122  ARG D C     1 
ATOM 6226  O O     . ARG D 1 115 ? -34.112  -58.707 -74.772  1.00 119.04 ? 122  ARG D O     1 
ATOM 6227  C CB    . ARG D 1 115 ? -33.474  -61.327 -73.584  1.00 121.53 ? 122  ARG D CB    1 
ATOM 6228  C CG    . ARG D 1 115 ? -32.154  -61.521 -74.306  1.00 122.22 ? 122  ARG D CG    1 
ATOM 6229  C CD    . ARG D 1 115 ? -31.076  -61.978 -73.366  1.00 123.21 ? 122  ARG D CD    1 
ATOM 6230  N NE    . ARG D 1 115 ? -30.392  -60.854 -72.725  1.00 123.98 ? 122  ARG D NE    1 
ATOM 6231  C CZ    . ARG D 1 115 ? -29.099  -60.875 -72.395  1.00 124.97 ? 122  ARG D CZ    1 
ATOM 6232  N NH1   . ARG D 1 115 ? -28.364  -61.955 -72.661  1.00 125.28 ? 122  ARG D NH1   1 
ATOM 6233  N NH2   . ARG D 1 115 ? -28.529  -59.823 -71.811  1.00 124.80 ? 122  ARG D NH2   1 
ATOM 6234  N N     . LYS D 1 116 ? -36.202  -59.224 -74.134  1.00 117.36 ? 123  LYS D N     1 
ATOM 6235  C CA    . LYS D 1 116 ? -36.660  -57.844 -74.031  1.00 115.57 ? 123  LYS D CA    1 
ATOM 6236  C C     . LYS D 1 116 ? -36.054  -57.049 -72.848  1.00 113.98 ? 123  LYS D C     1 
ATOM 6237  O O     . LYS D 1 116 ? -36.456  -55.916 -72.595  1.00 113.72 ? 123  LYS D O     1 
ATOM 6238  C CB    . LYS D 1 116 ? -38.201  -57.785 -74.057  1.00 115.82 ? 123  LYS D CB    1 
ATOM 6239  C CG    . LYS D 1 116 ? -38.811  -58.121 -75.437  1.00 117.00 ? 123  LYS D CG    1 
ATOM 6240  C CD    . LYS D 1 116 ? -39.065  -56.844 -76.281  1.00 119.84 ? 123  LYS D CD    1 
ATOM 6241  C CE    . LYS D 1 116 ? -38.621  -56.961 -77.775  1.00 119.88 ? 123  LYS D CE    1 
ATOM 6242  N NZ    . LYS D 1 116 ? -38.093  -55.648 -78.335  1.00 117.58 ? 123  LYS D NZ    1 
ATOM 6243  N N     . HIS D 1 117 ? -35.082  -57.636 -72.150  1.00 112.15 ? 124  HIS D N     1 
ATOM 6244  C CA    . HIS D 1 117 ? -34.249  -56.926 -71.163  1.00 110.78 ? 124  HIS D CA    1 
ATOM 6245  C C     . HIS D 1 117 ? -32.905  -57.654 -71.054  1.00 109.79 ? 124  HIS D C     1 
ATOM 6246  O O     . HIS D 1 117 ? -32.759  -58.776 -71.569  1.00 109.42 ? 124  HIS D O     1 
ATOM 6247  C CB    . HIS D 1 117 ? -34.886  -56.918 -69.776  1.00 111.09 ? 124  HIS D CB    1 
ATOM 6248  C CG    . HIS D 1 117 ? -35.990  -55.925 -69.583  1.00 111.31 ? 124  HIS D CG    1 
ATOM 6249  N ND1   . HIS D 1 117 ? -35.774  -54.675 -69.041  1.00 111.42 ? 124  HIS D ND1   1 
ATOM 6250  C CD2   . HIS D 1 117 ? -37.330  -56.030 -69.768  1.00 111.43 ? 124  HIS D CD2   1 
ATOM 6251  C CE1   . HIS D 1 117 ? -36.925  -54.033 -68.949  1.00 111.65 ? 124  HIS D CE1   1 
ATOM 6252  N NE2   . HIS D 1 117 ? -37.885  -54.833 -69.383  1.00 112.15 ? 124  HIS D NE2   1 
ATOM 6253  N N     . PHE D 1 118 ? -31.931  -57.038 -70.378  1.00 108.60 ? 125  PHE D N     1 
ATOM 6254  C CA    . PHE D 1 118 ? -30.580  -57.621 -70.287  1.00 107.97 ? 125  PHE D CA    1 
ATOM 6255  C C     . PHE D 1 118 ? -29.696  -56.952 -69.244  1.00 107.94 ? 125  PHE D C     1 
ATOM 6256  O O     . PHE D 1 118 ? -30.028  -55.868 -68.740  1.00 107.63 ? 125  PHE D O     1 
ATOM 6257  C CB    . PHE D 1 118 ? -29.861  -57.602 -71.655  1.00 107.85 ? 125  PHE D CB    1 
ATOM 6258  C CG    . PHE D 1 118 ? -29.218  -56.266 -71.998  1.00 107.11 ? 125  PHE D CG    1 
ATOM 6259  C CD1   . PHE D 1 118 ? -27.855  -56.041 -71.764  1.00 105.77 ? 125  PHE D CD1   1 
ATOM 6260  C CD2   . PHE D 1 118 ? -29.970  -55.230 -72.536  1.00 105.62 ? 125  PHE D CD2   1 
ATOM 6261  C CE1   . PHE D 1 118 ? -27.264  -54.811 -72.049  1.00 103.06 ? 125  PHE D CE1   1 
ATOM 6262  C CE2   . PHE D 1 118 ? -29.378  -54.019 -72.821  1.00 103.99 ? 125  PHE D CE2   1 
ATOM 6263  C CZ    . PHE D 1 118 ? -28.023  -53.813 -72.570  1.00 102.86 ? 125  PHE D CZ    1 
ATOM 6264  N N     . MET D 1 119 ? -28.559  -57.603 -68.960  1.00 108.07 ? 126  MET D N     1 
ATOM 6265  C CA    . MET D 1 119 ? -27.593  -57.135 -67.944  1.00 108.45 ? 126  MET D CA    1 
ATOM 6266  C C     . MET D 1 119 ? -26.097  -57.229 -68.319  1.00 107.74 ? 126  MET D C     1 
ATOM 6267  O O     . MET D 1 119 ? -25.638  -58.218 -68.902  1.00 107.62 ? 126  MET D O     1 
ATOM 6268  C CB    . MET D 1 119 ? -27.849  -57.841 -66.603  1.00 108.97 ? 126  MET D CB    1 
ATOM 6269  C CG    . MET D 1 119 ? -28.836  -57.078 -65.729  1.00 111.68 ? 126  MET D CG    1 
ATOM 6270  S SD    . MET D 1 119 ? -29.733  -58.097 -64.527  1.00 116.81 ? 126  MET D SD    1 
ATOM 6271  C CE    . MET D 1 119 ? -28.632  -57.885 -63.075  1.00 115.83 ? 126  MET D CE    1 
ATOM 6272  N N     . LEU D 1 120 ? -25.346  -56.194 -67.954  1.00 106.95 ? 127  LEU D N     1 
ATOM 6273  C CA    . LEU D 1 120 ? -23.913  -56.168 -68.198  1.00 106.66 ? 127  LEU D CA    1 
ATOM 6274  C C     . LEU D 1 120 ? -23.189  -56.851 -67.064  1.00 106.60 ? 127  LEU D C     1 
ATOM 6275  O O     . LEU D 1 120 ? -23.353  -56.445 -65.899  1.00 106.75 ? 127  LEU D O     1 
ATOM 6276  C CB    . LEU D 1 120 ? -23.398  -54.727 -68.240  1.00 106.75 ? 127  LEU D CB    1 
ATOM 6277  C CG    . LEU D 1 120 ? -23.864  -53.712 -69.277  1.00 106.54 ? 127  LEU D CG    1 
ATOM 6278  C CD1   . LEU D 1 120 ? -23.374  -52.339 -68.868  1.00 105.49 ? 127  LEU D CD1   1 
ATOM 6279  C CD2   . LEU D 1 120 ? -23.362  -54.111 -70.655  1.00 106.76 ? 127  LEU D CD2   1 
ATOM 6280  N N     . SER D 1 121 ? -22.362  -57.846 -67.400  1.00 106.33 ? 128  SER D N     1 
ATOM 6281  C CA    . SER D 1 121 ? -21.537  -58.541 -66.394  1.00 106.11 ? 128  SER D CA    1 
ATOM 6282  C C     . SER D 1 121 ? -20.035  -58.268 -66.520  1.00 105.52 ? 128  SER D C     1 
ATOM 6283  O O     . SER D 1 121 ? -19.422  -58.608 -67.512  1.00 105.38 ? 128  SER D O     1 
ATOM 6284  C CB    . SER D 1 121 ? -21.815  -60.050 -66.405  1.00 106.31 ? 128  SER D CB    1 
ATOM 6285  O OG    . SER D 1 121 ? -21.557  -60.613 -67.682  1.00 107.39 ? 128  SER D OG    1 
ATOM 6286  N N     . VAL D 1 122 ? -19.461  -57.671 -65.482  1.00 105.38 ? 129  VAL D N     1 
ATOM 6287  C CA    . VAL D 1 122 ? -18.066  -57.234 -65.466  1.00 105.66 ? 129  VAL D CA    1 
ATOM 6288  C C     . VAL D 1 122 ? -17.120  -58.216 -64.712  1.00 106.33 ? 129  VAL D C     1 
ATOM 6289  O O     . VAL D 1 122 ? -16.701  -57.958 -63.563  1.00 106.11 ? 129  VAL D O     1 
ATOM 6290  C CB    . VAL D 1 122 ? -17.953  -55.803 -64.858  1.00 105.44 ? 129  VAL D CB    1 
ATOM 6291  C CG1   . VAL D 1 122 ? -16.622  -55.174 -65.200  1.00 105.67 ? 129  VAL D CG1   1 
ATOM 6292  C CG2   . VAL D 1 122 ? -19.066  -54.919 -65.347  1.00 105.26 ? 129  VAL D CG2   1 
ATOM 6293  N N     . LYS D 1 123 ? -16.790  -59.332 -65.375  1.00 107.23 ? 130  LYS D N     1 
ATOM 6294  C CA    . LYS D 1 123 ? -15.835  -60.343 -64.883  1.00 108.11 ? 130  LYS D CA    1 
ATOM 6295  C C     . LYS D 1 123 ? -14.503  -59.696 -64.464  1.00 108.90 ? 130  LYS D C     1 
ATOM 6296  O O     . LYS D 1 123 ? -14.170  -58.631 -64.949  1.00 109.37 ? 130  LYS D O     1 
ATOM 6297  C CB    . LYS D 1 123 ? -15.631  -61.386 -65.987  1.00 107.77 ? 130  LYS D CB    1 
ATOM 6298  C CG    . LYS D 1 123 ? -14.689  -62.517 -65.658  1.00 108.45 ? 130  LYS D CG    1 
ATOM 6299  C CD    . LYS D 1 123 ? -15.039  -63.165 -64.325  1.00 109.58 ? 130  LYS D CD    1 
ATOM 6300  C CE    . LYS D 1 123 ? -13.780  -63.657 -63.600  1.00 109.63 ? 130  LYS D CE    1 
ATOM 6301  N NZ    . LYS D 1 123 ? -14.032  -63.958 -62.164  1.00 109.27 ? 130  LYS D NZ    1 
ATOM 6302  N N     . MET D 1 124 ? -13.759  -60.292 -63.541  1.00 110.03 ? 131  MET D N     1 
ATOM 6303  C CA    . MET D 1 124 ? -12.493  -59.686 -63.073  1.00 111.35 ? 131  MET D CA    1 
ATOM 6304  C C     . MET D 1 124 ? -11.625  -60.654 -62.275  1.00 112.63 ? 131  MET D C     1 
ATOM 6305  O O     . MET D 1 124 ? -12.131  -61.540 -61.569  1.00 113.11 ? 131  MET D O     1 
ATOM 6306  C CB    . MET D 1 124 ? -12.717  -58.452 -62.188  1.00 110.96 ? 131  MET D CB    1 
ATOM 6307  C CG    . MET D 1 124 ? -13.346  -57.251 -62.820  1.00 110.69 ? 131  MET D CG    1 
ATOM 6308  S SD    . MET D 1 124 ? -12.940  -55.752 -61.895  1.00 112.74 ? 131  MET D SD    1 
ATOM 6309  C CE    . MET D 1 124 ? -12.784  -56.318 -60.213  1.00 112.37 ? 131  MET D CE    1 
ATOM 6310  N N     . PHE D 1 125 ? -10.314  -60.442 -62.365  1.00 113.81 ? 132  PHE D N     1 
ATOM 6311  C CA    . PHE D 1 125 ? -9.315   -61.194 -61.610  1.00 114.93 ? 132  PHE D CA    1 
ATOM 6312  C C     . PHE D 1 125 ? -7.978   -60.441 -61.604  1.00 115.85 ? 132  PHE D C     1 
ATOM 6313  O O     . PHE D 1 125 ? -7.724   -59.588 -62.465  1.00 116.46 ? 132  PHE D O     1 
ATOM 6314  C CB    . PHE D 1 125 ? -9.134   -62.601 -62.200  1.00 114.82 ? 132  PHE D CB    1 
ATOM 6315  C CG    . PHE D 1 125 ? -8.904   -62.612 -63.670  1.00 114.76 ? 132  PHE D CG    1 
ATOM 6316  C CD1   . PHE D 1 125 ? -7.621   -62.534 -64.181  1.00 115.68 ? 132  PHE D CD1   1 
ATOM 6317  C CD2   . PHE D 1 125 ? -9.971   -62.699 -64.544  1.00 115.22 ? 132  PHE D CD2   1 
ATOM 6318  C CE1   . PHE D 1 125 ? -7.406   -62.536 -65.547  1.00 117.33 ? 132  PHE D CE1   1 
ATOM 6319  C CE2   . PHE D 1 125 ? -9.773   -62.712 -65.916  1.00 116.48 ? 132  PHE D CE2   1 
ATOM 6320  C CZ    . PHE D 1 125 ? -8.489   -62.631 -66.423  1.00 117.44 ? 132  PHE D CZ    1 
ATOM 6321  N N     . TYR D 1 126 ? -7.112   -60.746 -60.647  1.00 116.59 ? 133  TYR D N     1 
ATOM 6322  C CA    . TYR D 1 126 ? -5.733   -60.286 -60.754  1.00 117.35 ? 133  TYR D CA    1 
ATOM 6323  C C     . TYR D 1 126 ? -4.940   -61.199 -61.706  1.00 118.03 ? 133  TYR D C     1 
ATOM 6324  O O     . TYR D 1 126 ? -5.196   -62.418 -61.754  1.00 118.20 ? 133  TYR D O     1 
ATOM 6325  C CB    . TYR D 1 126 ? -5.074   -60.243 -59.383  1.00 117.38 ? 133  TYR D CB    1 
ATOM 6326  C CG    . TYR D 1 126 ? -5.849   -59.435 -58.383  1.00 117.14 ? 133  TYR D CG    1 
ATOM 6327  C CD1   . TYR D 1 126 ? -6.506   -60.058 -57.321  1.00 117.05 ? 133  TYR D CD1   1 
ATOM 6328  C CD2   . TYR D 1 126 ? -5.937   -58.050 -58.502  1.00 116.46 ? 133  TYR D CD2   1 
ATOM 6329  C CE1   . TYR D 1 126 ? -7.216   -59.320 -56.397  1.00 117.23 ? 133  TYR D CE1   1 
ATOM 6330  C CE2   . TYR D 1 126 ? -6.649   -57.300 -57.589  1.00 116.76 ? 133  TYR D CE2   1 
ATOM 6331  C CZ    . TYR D 1 126 ? -7.291   -57.937 -56.537  1.00 117.40 ? 133  TYR D CZ    1 
ATOM 6332  O OH    . TYR D 1 126 ? -8.010   -57.192 -55.619  1.00 118.80 ? 133  TYR D OH    1 
ATOM 6333  N N     . GLY D 1 127 ? -3.991   -60.601 -62.447  1.00 118.54 ? 134  GLY D N     1 
ATOM 6334  C CA    . GLY D 1 127 ? -3.132   -61.290 -63.436  1.00 118.94 ? 134  GLY D CA    1 
ATOM 6335  C C     . GLY D 1 127 ? -2.700   -62.706 -63.068  1.00 119.38 ? 134  GLY D C     1 
ATOM 6336  O O     . GLY D 1 127 ? -2.633   -63.594 -63.932  1.00 119.32 ? 134  GLY D O     1 
ATOM 6337  N N     . ASN D 1 128 ? -2.438   -62.917 -61.776  1.00 119.71 ? 135  ASN D N     1 
ATOM 6338  C CA    . ASN D 1 128 ? -1.994   -64.213 -61.240  1.00 120.12 ? 135  ASN D CA    1 
ATOM 6339  C C     . ASN D 1 128 ? -3.013   -65.363 -61.277  1.00 120.16 ? 135  ASN D C     1 
ATOM 6340  O O     . ASN D 1 128 ? -2.776   -66.416 -60.674  1.00 120.45 ? 135  ASN D O     1 
ATOM 6341  C CB    . ASN D 1 128 ? -1.399   -64.058 -59.817  1.00 120.37 ? 135  ASN D CB    1 
ATOM 6342  C CG    . ASN D 1 128 ? -2.071   -62.949 -58.983  1.00 120.91 ? 135  ASN D CG    1 
ATOM 6343  O OD1   . ASN D 1 128 ? -2.046   -61.759 -59.336  1.00 121.13 ? 135  ASN D OD1   1 
ATOM 6344  N ND2   . ASN D 1 128 ? -2.622   -63.339 -57.843  1.00 120.95 ? 135  ASN D ND2   1 
ATOM 6345  N N     . SER D 1 129 ? -4.107   -65.166 -62.020  1.00 120.23 ? 136  SER D N     1 
ATOM 6346  C CA    . SER D 1 129 ? -5.321   -66.038 -62.007  1.00 120.17 ? 136  SER D CA    1 
ATOM 6347  C C     . SER D 1 129 ? -6.165   -65.911 -60.716  1.00 119.95 ? 136  SER D C     1 
ATOM 6348  O O     . SER D 1 129 ? -7.286   -66.439 -60.656  1.00 119.72 ? 136  SER D O     1 
ATOM 6349  C CB    . SER D 1 129 ? -5.013   -67.525 -62.321  1.00 120.11 ? 136  SER D CB    1 
ATOM 6350  O OG    . SER D 1 129 ? -4.401   -67.697 -63.590  1.00 119.95 ? 136  SER D OG    1 
ATOM 6351  N N     . ASP D 1 130 ? -5.611   -65.219 -59.707  1.00 119.77 ? 137  ASP D N     1 
ATOM 6352  C CA    . ASP D 1 130 ? -6.300   -64.915 -58.442  1.00 119.62 ? 137  ASP D CA    1 
ATOM 6353  C C     . ASP D 1 130 ? -7.596   -64.181 -58.721  1.00 118.98 ? 137  ASP D C     1 
ATOM 6354  O O     . ASP D 1 130 ? -7.562   -63.027 -59.182  1.00 119.16 ? 137  ASP D O     1 
ATOM 6355  C CB    . ASP D 1 130 ? -5.435   -64.039 -57.522  1.00 120.01 ? 137  ASP D CB    1 
ATOM 6356  C CG    . ASP D 1 130 ? -4.636   -64.849 -56.500  1.00 121.48 ? 137  ASP D CG    1 
ATOM 6357  O OD1   . ASP D 1 130 ? -4.217   -64.254 -55.474  1.00 122.69 ? 137  ASP D OD1   1 
ATOM 6358  O OD2   . ASP D 1 130 ? -4.416   -66.064 -56.722  1.00 123.01 ? 137  ASP D OD2   1 
ATOM 6359  N N     . ASP D 1 131 ? -8.718   -64.844 -58.411  1.00 117.86 ? 138  ASP D N     1 
ATOM 6360  C CA    . ASP D 1 131 ? -10.054  -64.408 -58.826  1.00 116.28 ? 138  ASP D CA    1 
ATOM 6361  C C     . ASP D 1 131 ? -10.663  -63.275 -57.984  1.00 115.04 ? 138  ASP D C     1 
ATOM 6362  O O     . ASP D 1 131 ? -10.299  -63.102 -56.816  1.00 114.76 ? 138  ASP D O     1 
ATOM 6363  C CB    . ASP D 1 131 ? -10.982  -65.612 -58.867  1.00 116.43 ? 138  ASP D CB    1 
ATOM 6364  C CG    . ASP D 1 131 ? -12.035  -65.467 -59.924  1.00 117.48 ? 138  ASP D CG    1 
ATOM 6365  O OD1   . ASP D 1 131 ? -12.409  -66.491 -60.562  1.00 118.85 ? 138  ASP D OD1   1 
ATOM 6366  O OD2   . ASP D 1 131 ? -12.468  -64.307 -60.131  1.00 118.02 ? 138  ASP D OD2   1 
ATOM 6367  N N     . ILE D 1 132 ? -11.556  -62.486 -58.589  1.00 113.72 ? 139  ILE D N     1 
ATOM 6368  C CA    . ILE D 1 132 ? -12.317  -61.445 -57.850  1.00 112.82 ? 139  ILE D CA    1 
ATOM 6369  C C     . ILE D 1 132 ? -13.810  -61.357 -58.188  1.00 112.17 ? 139  ILE D C     1 
ATOM 6370  O O     . ILE D 1 132 ? -14.546  -60.604 -57.541  1.00 111.94 ? 139  ILE D O     1 
ATOM 6371  C CB    . ILE D 1 132 ? -11.691  -60.012 -57.924  1.00 112.90 ? 139  ILE D CB    1 
ATOM 6372  C CG1   . ILE D 1 132 ? -11.297  -59.649 -59.365  1.00 112.06 ? 139  ILE D CG1   1 
ATOM 6373  C CG2   . ILE D 1 132 ? -10.554  -59.873 -56.907  1.00 112.73 ? 139  ILE D CG2   1 
ATOM 6374  C CD1   . ILE D 1 132 ? -10.443  -58.421 -59.526  1.00 111.39 ? 139  ILE D CD1   1 
ATOM 6375  N N     . GLY D 1 133 ? -14.231  -62.102 -59.215  1.00 111.34 ? 140  GLY D N     1 
ATOM 6376  C CA    . GLY D 1 133 ? -15.648  -62.404 -59.461  1.00 110.14 ? 140  GLY D CA    1 
ATOM 6377  C C     . GLY D 1 133 ? -16.392  -61.461 -60.379  1.00 109.30 ? 140  GLY D C     1 
ATOM 6378  O O     . GLY D 1 133 ? -15.889  -60.399 -60.715  1.00 109.24 ? 140  GLY D O     1 
ATOM 6379  N N     . VAL D 1 134 ? -17.611  -61.856 -60.756  1.00 108.63 ? 141  VAL D N     1 
ATOM 6380  C CA    . VAL D 1 134 ? -18.478  -61.110 -61.694  1.00 107.38 ? 141  VAL D CA    1 
ATOM 6381  C C     . VAL D 1 134 ? -19.255  -59.980 -60.995  1.00 107.13 ? 141  VAL D C     1 
ATOM 6382  O O     . VAL D 1 134 ? -19.781  -60.166 -59.902  1.00 106.89 ? 141  VAL D O     1 
ATOM 6383  C CB    . VAL D 1 134 ? -19.458  -62.084 -62.391  1.00 106.89 ? 141  VAL D CB    1 
ATOM 6384  C CG1   . VAL D 1 134 ? -20.362  -61.369 -63.321  1.00 106.38 ? 141  VAL D CG1   1 
ATOM 6385  C CG2   . VAL D 1 134 ? -18.691  -63.131 -63.149  1.00 106.35 ? 141  VAL D CG2   1 
ATOM 6386  N N     . PHE D 1 135 ? -19.311  -58.810 -61.624  1.00 106.97 ? 142  PHE D N     1 
ATOM 6387  C CA    . PHE D 1 135 ? -20.158  -57.699 -61.148  1.00 107.28 ? 142  PHE D CA    1 
ATOM 6388  C C     . PHE D 1 135 ? -21.307  -57.387 -62.100  1.00 107.26 ? 142  PHE D C     1 
ATOM 6389  O O     . PHE D 1 135 ? -21.159  -57.523 -63.312  1.00 107.71 ? 142  PHE D O     1 
ATOM 6390  C CB    . PHE D 1 135 ? -19.321  -56.466 -60.893  1.00 107.18 ? 142  PHE D CB    1 
ATOM 6391  C CG    . PHE D 1 135 ? -18.339  -56.664 -59.817  1.00 108.61 ? 142  PHE D CG    1 
ATOM 6392  C CD1   . PHE D 1 135 ? -17.237  -57.478 -60.016  1.00 109.99 ? 142  PHE D CD1   1 
ATOM 6393  C CD2   . PHE D 1 135 ? -18.540  -56.082 -58.574  1.00 110.68 ? 142  PHE D CD2   1 
ATOM 6394  C CE1   . PHE D 1 135 ? -16.327  -57.697 -58.990  1.00 112.36 ? 142  PHE D CE1   1 
ATOM 6395  C CE2   . PHE D 1 135 ? -17.631  -56.280 -57.528  1.00 112.20 ? 142  PHE D CE2   1 
ATOM 6396  C CZ    . PHE D 1 135 ? -16.517  -57.089 -57.732  1.00 112.65 ? 142  PHE D CZ    1 
ATOM 6397  N N     . LEU D 1 136 ? -22.457  -56.987 -61.569  1.00 107.03 ? 143  LEU D N     1 
ATOM 6398  C CA    . LEU D 1 136 ? -23.621  -56.858 -62.427  1.00 106.63 ? 143  LEU D CA    1 
ATOM 6399  C C     . LEU D 1 136 ? -24.167  -55.447 -62.454  1.00 106.92 ? 143  LEU D C     1 
ATOM 6400  O O     . LEU D 1 136 ? -24.109  -54.724 -61.456  1.00 106.70 ? 143  LEU D O     1 
ATOM 6401  C CB    . LEU D 1 136 ? -24.684  -57.896 -62.077  1.00 106.44 ? 143  LEU D CB    1 
ATOM 6402  C CG    . LEU D 1 136 ? -24.353  -59.328 -62.526  1.00 105.58 ? 143  LEU D CG    1 
ATOM 6403  C CD1   . LEU D 1 136 ? -25.172  -60.364 -61.769  1.00 104.85 ? 143  LEU D CD1   1 
ATOM 6404  C CD2   . LEU D 1 136 ? -24.572  -59.494 -64.009  1.00 105.12 ? 143  LEU D CD2   1 
ATOM 6405  N N     . SER D 1 137 ? -24.633  -55.061 -63.642  1.00 107.49 ? 144  SER D N     1 
ATOM 6406  C CA    . SER D 1 137 ? -25.195  -53.737 -63.906  1.00 108.05 ? 144  SER D CA    1 
ATOM 6407  C C     . SER D 1 137 ? -26.651  -53.731 -63.503  1.00 108.50 ? 144  SER D C     1 
ATOM 6408  O O     . SER D 1 137 ? -27.293  -54.794 -63.442  1.00 108.73 ? 144  SER D O     1 
ATOM 6409  C CB    . SER D 1 137 ? -25.092  -53.400 -65.398  1.00 107.94 ? 144  SER D CB    1 
ATOM 6410  O OG    . SER D 1 137 ? -25.870  -54.294 -66.185  1.00 107.75 ? 144  SER D OG    1 
ATOM 6411  N N     . LYS D 1 138 ? -27.179  -52.544 -63.257  1.00 108.74 ? 145  LYS D N     1 
ATOM 6412  C CA    . LYS D 1 138 ? -28.528  -52.440 -62.773  1.00 109.58 ? 145  LYS D CA    1 
ATOM 6413  C C     . LYS D 1 138 ? -29.551  -52.506 -63.911  1.00 110.45 ? 145  LYS D C     1 
ATOM 6414  O O     . LYS D 1 138 ? -30.086  -51.471 -64.285  1.00 110.88 ? 145  LYS D O     1 
ATOM 6415  C CB    . LYS D 1 138 ? -28.674  -51.149 -61.968  1.00 109.32 ? 145  LYS D CB    1 
ATOM 6416  C CG    . LYS D 1 138 ? -29.833  -51.128 -60.996  1.00 109.74 ? 145  LYS D CG    1 
ATOM 6417  C CD    . LYS D 1 138 ? -29.743  -49.943 -60.052  1.00 110.30 ? 145  LYS D CD    1 
ATOM 6418  C CE    . LYS D 1 138 ? -28.693  -50.174 -58.956  1.00 110.87 ? 145  LYS D CE    1 
ATOM 6419  N NZ    . LYS D 1 138 ? -28.690  -49.046 -57.979  1.00 111.21 ? 145  LYS D NZ    1 
ATOM 6420  N N     . ARG D 1 139 ? -29.807  -53.710 -64.457  1.00 111.41 ? 146  ARG D N     1 
ATOM 6421  C CA    . ARG D 1 139 ? -30.926  -53.991 -65.412  1.00 112.22 ? 146  ARG D CA    1 
ATOM 6422  C C     . ARG D 1 139 ? -31.034  -53.011 -66.587  1.00 112.28 ? 146  ARG D C     1 
ATOM 6423  O O     . ARG D 1 139 ? -31.287  -51.813 -66.401  1.00 112.18 ? 146  ARG D O     1 
ATOM 6424  C CB    . ARG D 1 139 ? -32.284  -54.087 -64.664  1.00 112.69 ? 146  ARG D CB    1 
ATOM 6425  C CG    . ARG D 1 139 ? -33.553  -54.205 -65.555  1.00 114.94 ? 146  ARG D CG    1 
ATOM 6426  C CD    . ARG D 1 139 ? -34.853  -54.392 -64.706  1.00 119.28 ? 146  ARG D CD    1 
ATOM 6427  N NE    . ARG D 1 139 ? -36.104  -54.401 -65.492  1.00 121.31 ? 146  ARG D NE    1 
ATOM 6428  C CZ    . ARG D 1 139 ? -37.114  -53.533 -65.341  1.00 123.22 ? 146  ARG D CZ    1 
ATOM 6429  N NH1   . ARG D 1 139 ? -37.066  -52.566 -64.421  1.00 123.35 ? 146  ARG D NH1   1 
ATOM 6430  N NH2   . ARG D 1 139 ? -38.195  -53.634 -66.108  1.00 123.80 ? 146  ARG D NH2   1 
ATOM 6431  N N     . ILE D 1 140 ? -30.859  -53.500 -67.806  1.00 112.57 ? 147  ILE D N     1 
ATOM 6432  C CA    . ILE D 1 140 ? -31.026  -52.600 -68.958  1.00 112.89 ? 147  ILE D CA    1 
ATOM 6433  C C     . ILE D 1 140 ? -32.113  -53.079 -69.935  1.00 113.45 ? 147  ILE D C     1 
ATOM 6434  O O     . ILE D 1 140 ? -32.264  -54.300 -70.159  1.00 113.75 ? 147  ILE D O     1 
ATOM 6435  C CB    . ILE D 1 140 ? -29.711  -52.356 -69.695  1.00 112.58 ? 147  ILE D CB    1 
ATOM 6436  C CG1   . ILE D 1 140 ? -28.606  -51.955 -68.724  1.00 112.13 ? 147  ILE D CG1   1 
ATOM 6437  C CG2   . ILE D 1 140 ? -29.890  -51.249 -70.679  1.00 113.15 ? 147  ILE D CG2   1 
ATOM 6438  C CD1   . ILE D 1 140 ? -27.247  -51.750 -69.383  1.00 111.11 ? 147  ILE D CD1   1 
ATOM 6439  N N     . LYS D 1 141 ? -32.856  -52.120 -70.507  1.00 113.78 ? 148  LYS D N     1 
ATOM 6440  C CA    . LYS D 1 141 ? -34.028  -52.413 -71.355  1.00 114.46 ? 148  LYS D CA    1 
ATOM 6441  C C     . LYS D 1 141 ? -33.770  -52.265 -72.869  1.00 114.74 ? 148  LYS D C     1 
ATOM 6442  O O     . LYS D 1 141 ? -33.477  -51.152 -73.329  1.00 114.98 ? 148  LYS D O     1 
ATOM 6443  C CB    . LYS D 1 141 ? -35.204  -51.515 -70.925  1.00 114.46 ? 148  LYS D CB    1 
ATOM 6444  C CG    . LYS D 1 141 ? -36.523  -51.715 -71.710  1.00 114.99 ? 148  LYS D CG    1 
ATOM 6445  C CD    . LYS D 1 141 ? -37.610  -50.745 -71.188  1.00 116.29 ? 148  LYS D CD    1 
ATOM 6446  C CE    . LYS D 1 141 ? -38.809  -50.605 -72.136  1.00 116.92 ? 148  LYS D CE    1 
ATOM 6447  N NZ    . LYS D 1 141 ? -39.634  -51.855 -72.255  1.00 117.19 ? 148  LYS D NZ    1 
ATOM 6448  N N     . VAL D 1 142 ? -33.876  -53.359 -73.634  1.00 114.82 ? 149  VAL D N     1 
ATOM 6449  C CA    . VAL D 1 142 ? -33.858  -53.260 -75.108  1.00 115.36 ? 149  VAL D CA    1 
ATOM 6450  C C     . VAL D 1 142 ? -34.965  -52.328 -75.581  1.00 116.25 ? 149  VAL D C     1 
ATOM 6451  O O     . VAL D 1 142 ? -36.083  -52.402 -75.070  1.00 116.64 ? 149  VAL D O     1 
ATOM 6452  C CB    . VAL D 1 142 ? -34.051  -54.648 -75.804  1.00 115.16 ? 149  VAL D CB    1 
ATOM 6453  C CG1   . VAL D 1 142 ? -34.752  -54.537 -77.199  1.00 114.17 ? 149  VAL D CG1   1 
ATOM 6454  C CG2   . VAL D 1 142 ? -32.733  -55.380 -75.905  1.00 114.98 ? 149  VAL D CG2   1 
ATOM 6455  N N     . ILE D 1 143 ? -34.645  -51.420 -76.503  1.00 117.26 ? 150  ILE D N     1 
ATOM 6456  C CA    . ILE D 1 143 ? -35.678  -50.802 -77.346  1.00 118.26 ? 150  ILE D CA    1 
ATOM 6457  C C     . ILE D 1 143 ? -35.365  -50.981 -78.836  1.00 119.74 ? 150  ILE D C     1 
ATOM 6458  O O     . ILE D 1 143 ? -34.257  -51.372 -79.207  1.00 119.91 ? 150  ILE D O     1 
ATOM 6459  C CB    . ILE D 1 143 ? -36.005  -49.318 -77.013  1.00 117.73 ? 150  ILE D CB    1 
ATOM 6460  C CG1   . ILE D 1 143 ? -34.810  -48.409 -77.281  1.00 116.37 ? 150  ILE D CG1   1 
ATOM 6461  C CG2   . ILE D 1 143 ? -36.616  -49.174 -75.596  1.00 117.35 ? 150  ILE D CG2   1 
ATOM 6462  C CD1   . ILE D 1 143 ? -35.167  -46.939 -77.115  1.00 115.33 ? 150  ILE D CD1   1 
ATOM 6463  N N     . SER D 1 144 ? -36.356  -50.701 -79.678  1.00 121.45 ? 151  SER D N     1 
ATOM 6464  C CA    . SER D 1 144 ? -36.237  -50.919 -81.111  1.00 123.36 ? 151  SER D CA    1 
ATOM 6465  C C     . SER D 1 144 ? -35.868  -49.630 -81.862  1.00 124.81 ? 151  SER D C     1 
ATOM 6466  O O     . SER D 1 144 ? -35.372  -49.691 -83.001  1.00 124.90 ? 151  SER D O     1 
ATOM 6467  C CB    . SER D 1 144 ? -37.552  -51.457 -81.639  1.00 123.16 ? 151  SER D CB    1 
ATOM 6468  O OG    . SER D 1 144 ? -38.591  -50.565 -81.281  1.00 123.68 ? 151  SER D OG    1 
ATOM 6469  N N     . LYS D 1 145 ? -36.103  -48.483 -81.210  1.00 126.56 ? 152  LYS D N     1 
ATOM 6470  C CA    . LYS D 1 145 ? -35.929  -47.150 -81.800  1.00 128.47 ? 152  LYS D CA    1 
ATOM 6471  C C     . LYS D 1 145 ? -36.431  -46.062 -80.837  1.00 129.95 ? 152  LYS D C     1 
ATOM 6472  O O     . LYS D 1 145 ? -37.518  -46.205 -80.274  1.00 130.19 ? 152  LYS D O     1 
ATOM 6473  C CB    . LYS D 1 145 ? -36.720  -47.071 -83.106  1.00 128.58 ? 152  LYS D CB    1 
ATOM 6474  C CG    . LYS D 1 145 ? -36.898  -45.667 -83.669  1.00 129.42 ? 152  LYS D CG    1 
ATOM 6475  C CD    . LYS D 1 145 ? -37.585  -45.691 -85.032  1.00 130.34 ? 152  LYS D CD    1 
ATOM 6476  C CE    . LYS D 1 145 ? -36.730  -46.384 -86.097  1.00 130.31 ? 152  LYS D CE    1 
ATOM 6477  N NZ    . LYS D 1 145 ? -37.014  -45.820 -87.446  1.00 131.03 ? 152  LYS D NZ    1 
ATOM 6478  N N     . PRO D 1 146 ? -35.659  -44.973 -80.643  1.00 131.48 ? 153  PRO D N     1 
ATOM 6479  C CA    . PRO D 1 146 ? -36.134  -43.918 -79.756  1.00 133.15 ? 153  PRO D CA    1 
ATOM 6480  C C     . PRO D 1 146 ? -37.589  -43.570 -80.050  1.00 135.09 ? 153  PRO D C     1 
ATOM 6481  O O     . PRO D 1 146 ? -37.928  -43.229 -81.188  1.00 135.22 ? 153  PRO D O     1 
ATOM 6482  C CB    . PRO D 1 146 ? -35.205  -42.755 -80.082  1.00 132.85 ? 153  PRO D CB    1 
ATOM 6483  C CG    . PRO D 1 146 ? -33.922  -43.420 -80.386  1.00 132.24 ? 153  PRO D CG    1 
ATOM 6484  C CD    . PRO D 1 146 ? -34.288  -44.702 -81.102  1.00 131.56 ? 153  PRO D CD    1 
ATOM 6485  N N     . SER D 1 147 ? -38.432  -43.691 -79.023  1.00 137.37 ? 154  SER D N     1 
ATOM 6486  C CA    . SER D 1 147 ? -39.880  -43.602 -79.178  1.00 139.53 ? 154  SER D CA    1 
ATOM 6487  C C     . SER D 1 147 ? -40.416  -42.194 -78.971  1.00 141.13 ? 154  SER D C     1 
ATOM 6488  O O     . SER D 1 147 ? -40.599  -41.769 -77.827  1.00 141.42 ? 154  SER D O     1 
ATOM 6489  C CB    . SER D 1 147 ? -40.584  -44.576 -78.225  1.00 139.32 ? 154  SER D CB    1 
ATOM 6490  O OG    . SER D 1 147 ? -40.599  -45.885 -78.765  1.00 139.54 ? 154  SER D OG    1 
ATOM 6491  N N     . LYS D 1 148 ? -40.679  -41.496 -80.083  1.00 143.21 ? 155  LYS D N     1 
ATOM 6492  C CA    . LYS D 1 148 ? -41.318  -40.159 -80.094  1.00 145.28 ? 155  LYS D CA    1 
ATOM 6493  C C     . LYS D 1 148 ? -42.832  -40.237 -79.779  1.00 146.51 ? 155  LYS D C     1 
ATOM 6494  O O     . LYS D 1 148 ? -43.651  -40.399 -80.694  1.00 146.60 ? 155  LYS D O     1 
ATOM 6495  C CB    . LYS D 1 148 ? -41.086  -39.465 -81.456  1.00 145.29 ? 155  LYS D CB    1 
ATOM 6496  C CG    . LYS D 1 148 ? -39.618  -39.146 -81.782  1.00 145.80 ? 155  LYS D CG    1 
ATOM 6497  C CD    . LYS D 1 148 ? -39.243  -39.570 -83.215  1.00 145.62 ? 155  LYS D CD    1 
ATOM 6498  C CE    . LYS D 1 148 ? -37.726  -39.588 -83.419  1.00 144.52 ? 155  LYS D CE    1 
ATOM 6499  N NZ    . LYS D 1 148 ? -37.307  -40.682 -84.332  1.00 143.31 ? 155  LYS D NZ    1 
ATOM 6500  N N     . LYS D 1 149 ? -43.192  -40.126 -78.494  1.00 148.08 ? 156  LYS D N     1 
ATOM 6501  C CA    . LYS D 1 149 ? -44.575  -40.362 -78.041  1.00 149.59 ? 156  LYS D CA    1 
ATOM 6502  C C     . LYS D 1 149 ? -45.150  -39.168 -77.307  1.00 150.37 ? 156  LYS D C     1 
ATOM 6503  O O     . LYS D 1 149 ? -44.533  -38.650 -76.370  1.00 150.42 ? 156  LYS D O     1 
ATOM 6504  C CB    . LYS D 1 149 ? -44.680  -41.612 -77.138  1.00 149.78 ? 156  LYS D CB    1 
ATOM 6505  C CG    . LYS D 1 149 ? -44.006  -42.883 -77.679  1.00 150.86 ? 156  LYS D CG    1 
ATOM 6506  C CD    . LYS D 1 149 ? -44.496  -43.239 -79.087  1.00 152.34 ? 156  LYS D CD    1 
ATOM 6507  C CE    . LYS D 1 149 ? -43.333  -43.704 -79.971  1.00 153.12 ? 156  LYS D CE    1 
ATOM 6508  N NZ    . LYS D 1 149 ? -43.689  -44.210 -81.332  1.00 154.24 ? 156  LYS D NZ    1 
ATOM 6509  N N     . LYS D 1 150 ? -46.340  -38.756 -77.739  1.00 151.53 ? 157  LYS D N     1 
ATOM 6510  C CA    . LYS D 1 150 ? -47.105  -37.681 -77.091  1.00 152.64 ? 157  LYS D CA    1 
ATOM 6511  C C     . LYS D 1 150 ? -47.784  -38.182 -75.789  1.00 153.39 ? 157  LYS D C     1 
ATOM 6512  O O     . LYS D 1 150 ? -47.805  -39.394 -75.523  1.00 153.59 ? 157  LYS D O     1 
ATOM 6513  C CB    . LYS D 1 150 ? -48.120  -37.077 -78.077  1.00 152.57 ? 157  LYS D CB    1 
ATOM 6514  C CG    . LYS D 1 150 ? -48.348  -35.558 -77.960  1.00 152.22 ? 157  LYS D CG    1 
ATOM 6515  C CD    . LYS D 1 150 ? -47.433  -34.745 -78.874  1.00 150.87 ? 157  LYS D CD    1 
ATOM 6516  C CE    . LYS D 1 150 ? -48.172  -33.556 -79.487  1.00 150.06 ? 157  LYS D CE    1 
ATOM 6517  N NZ    . LYS D 1 150 ? -48.732  -32.604 -78.493  1.00 149.08 ? 157  LYS D NZ    1 
ATOM 6518  N N     . GLN D 1 151 ? -48.380  -37.248 -75.036  1.00 154.21 ? 158  GLN D N     1 
ATOM 6519  C CA    . GLN D 1 151 ? -48.573  -37.304 -73.551  1.00 154.99 ? 158  GLN D CA    1 
ATOM 6520  C C     . GLN D 1 151 ? -49.085  -38.550 -72.784  1.00 155.38 ? 158  GLN D C     1 
ATOM 6521  O O     . GLN D 1 151 ? -49.184  -38.521 -71.543  1.00 155.48 ? 158  GLN D O     1 
ATOM 6522  C CB    . GLN D 1 151 ? -49.351  -36.058 -73.087  1.00 155.02 ? 158  GLN D CB    1 
ATOM 6523  C CG    . GLN D 1 151 ? -48.960  -35.565 -71.692  1.00 155.15 ? 158  GLN D CG    1 
ATOM 6524  C CD    . GLN D 1 151 ? -48.649  -34.086 -71.674  1.00 155.64 ? 158  GLN D CD    1 
ATOM 6525  O OE1   . GLN D 1 151 ? -48.138  -33.536 -72.655  1.00 156.03 ? 158  GLN D OE1   1 
ATOM 6526  N NE2   . GLN D 1 151 ? -48.948  -33.431 -70.557  1.00 155.38 ? 158  GLN D NE2   1 
ATOM 6527  N N     . SER D 1 152 ? -49.383  -39.640 -73.492  1.00 155.70 ? 159  SER D N     1 
ATOM 6528  C CA    . SER D 1 152 ? -49.733  -40.905 -72.831  1.00 155.81 ? 159  SER D CA    1 
ATOM 6529  C C     . SER D 1 152 ? -48.501  -41.528 -72.125  1.00 155.68 ? 159  SER D C     1 
ATOM 6530  O O     . SER D 1 152 ? -47.602  -42.090 -72.770  1.00 155.75 ? 159  SER D O     1 
ATOM 6531  C CB    . SER D 1 152 ? -50.383  -41.874 -73.835  1.00 155.92 ? 159  SER D CB    1 
ATOM 6532  O OG    . SER D 1 152 ? -51.403  -42.649 -73.224  1.00 156.18 ? 159  SER D OG    1 
ATOM 6533  N N     . LEU D 1 153 ? -48.468  -41.399 -70.798  1.00 155.48 ? 160  LEU D N     1 
ATOM 6534  C CA    . LEU D 1 153 ? -47.396  -41.964 -69.954  1.00 155.24 ? 160  LEU D CA    1 
ATOM 6535  C C     . LEU D 1 153 ? -47.574  -43.488 -69.717  1.00 154.95 ? 160  LEU D C     1 
ATOM 6536  O O     . LEU D 1 153 ? -47.437  -43.975 -68.581  1.00 154.84 ? 160  LEU D O     1 
ATOM 6537  C CB    . LEU D 1 153 ? -47.332  -41.204 -68.608  1.00 155.30 ? 160  LEU D CB    1 
ATOM 6538  C CG    . LEU D 1 153 ? -46.636  -39.842 -68.413  1.00 154.94 ? 160  LEU D CG    1 
ATOM 6539  C CD1   . LEU D 1 153 ? -46.527  -39.023 -69.698  1.00 154.79 ? 160  LEU D CD1   1 
ATOM 6540  C CD2   . LEU D 1 153 ? -47.324  -39.026 -67.312  1.00 154.15 ? 160  LEU D CD2   1 
ATOM 6541  N N     . LYS D 1 154 ? -47.867  -44.227 -70.797  1.00 154.43 ? 161  LYS D N     1 
ATOM 6542  C CA    . LYS D 1 154 ? -48.235  -45.656 -70.719  1.00 153.71 ? 161  LYS D CA    1 
ATOM 6543  C C     . LYS D 1 154 ? -47.061  -46.560 -70.356  1.00 153.18 ? 161  LYS D C     1 
ATOM 6544  O O     . LYS D 1 154 ? -47.188  -47.409 -69.469  1.00 153.05 ? 161  LYS D O     1 
ATOM 6545  C CB    . LYS D 1 154 ? -48.945  -46.149 -72.002  1.00 153.78 ? 161  LYS D CB    1 
ATOM 6546  C CG    . LYS D 1 154 ? -48.110  -46.137 -73.289  1.00 153.55 ? 161  LYS D CG    1 
ATOM 6547  C CD    . LYS D 1 154 ? -48.957  -46.513 -74.505  1.00 153.21 ? 161  LYS D CD    1 
ATOM 6548  C CE    . LYS D 1 154 ? -49.827  -45.343 -74.972  1.00 152.76 ? 161  LYS D CE    1 
ATOM 6549  N NZ    . LYS D 1 154 ? -50.663  -45.678 -76.151  1.00 152.39 ? 161  LYS D NZ    1 
ATOM 6550  N N     . ASN D 1 155 ? -45.928  -46.373 -71.035  1.00 152.50 ? 162  ASN D N     1 
ATOM 6551  C CA    . ASN D 1 155 ? -44.729  -47.161 -70.750  1.00 151.67 ? 162  ASN D CA    1 
ATOM 6552  C C     . ASN D 1 155 ? -43.977  -46.668 -69.513  1.00 150.91 ? 162  ASN D C     1 
ATOM 6553  O O     . ASN D 1 155 ? -43.392  -47.475 -68.785  1.00 150.87 ? 162  ASN D O     1 
ATOM 6554  C CB    . ASN D 1 155 ? -43.802  -47.237 -71.963  1.00 151.72 ? 162  ASN D CB    1 
ATOM 6555  C CG    . ASN D 1 155 ? -42.867  -48.427 -71.897  1.00 151.99 ? 162  ASN D CG    1 
ATOM 6556  O OD1   . ASN D 1 155 ? -42.016  -48.525 -71.003  1.00 151.74 ? 162  ASN D OD1   1 
ATOM 6557  N ND2   . ASN D 1 155 ? -43.021  -49.347 -72.844  1.00 152.41 ? 162  ASN D ND2   1 
ATOM 6558  N N     . ALA D 1 156 ? -44.001  -45.349 -69.293  1.00 149.93 ? 163  ALA D N     1 
ATOM 6559  C CA    . ALA D 1 156 ? -43.465  -44.697 -68.077  1.00 148.83 ? 163  ALA D CA    1 
ATOM 6560  C C     . ALA D 1 156 ? -41.966  -44.925 -67.840  1.00 147.94 ? 163  ALA D C     1 
ATOM 6561  O O     . ALA D 1 156 ? -41.242  -44.000 -67.463  1.00 147.70 ? 163  ALA D O     1 
ATOM 6562  C CB    . ALA D 1 156 ? -44.291  -45.093 -66.826  1.00 148.86 ? 163  ALA D CB    1 
ATOM 6563  N N     . ASP D 1 157 ? -41.528  -46.165 -68.063  1.00 146.98 ? 164  ASP D N     1 
ATOM 6564  C CA    . ASP D 1 157 ? -40.128  -46.593 -67.947  1.00 146.01 ? 164  ASP D CA    1 
ATOM 6565  C C     . ASP D 1 157 ? -39.224  -45.788 -68.888  1.00 145.00 ? 164  ASP D C     1 
ATOM 6566  O O     . ASP D 1 157 ? -38.076  -45.481 -68.539  1.00 144.59 ? 164  ASP D O     1 
ATOM 6567  C CB    . ASP D 1 157 ? -40.022  -48.100 -68.270  1.00 146.31 ? 164  ASP D CB    1 
ATOM 6568  C CG    . ASP D 1 157 ? -39.025  -48.851 -67.365  1.00 146.66 ? 164  ASP D CG    1 
ATOM 6569  O OD1   . ASP D 1 157 ? -38.501  -48.253 -66.390  1.00 146.61 ? 164  ASP D OD1   1 
ATOM 6570  O OD2   . ASP D 1 157 ? -38.777  -50.057 -67.638  1.00 146.75 ? 164  ASP D OD2   1 
ATOM 6571  N N     . LEU D 1 158 ? -39.772  -45.457 -70.067  1.00 143.89 ? 165  LEU D N     1 
ATOM 6572  C CA    . LEU D 1 158 ? -39.105  -44.678 -71.125  1.00 142.55 ? 165  LEU D CA    1 
ATOM 6573  C C     . LEU D 1 158 ? -39.065  -43.169 -70.851  1.00 141.95 ? 165  LEU D C     1 
ATOM 6574  O O     . LEU D 1 158 ? -38.093  -42.504 -71.201  1.00 141.84 ? 165  LEU D O     1 
ATOM 6575  C CB    . LEU D 1 158 ? -39.761  -44.943 -72.485  1.00 142.26 ? 165  LEU D CB    1 
ATOM 6576  C CG    . LEU D 1 158 ? -39.560  -46.342 -73.073  1.00 142.11 ? 165  LEU D CG    1 
ATOM 6577  C CD1   . LEU D 1 158 ? -40.586  -46.669 -74.171  1.00 141.82 ? 165  LEU D CD1   1 
ATOM 6578  C CD2   . LEU D 1 158 ? -38.131  -46.520 -73.578  1.00 141.59 ? 165  LEU D CD2   1 
ATOM 6579  N N     . CYS D 1 159 ? -40.110  -42.633 -70.225  1.00 141.22 ? 166  CYS D N     1 
ATOM 6580  C CA    . CYS D 1 159 ? -40.179  -41.203 -69.920  1.00 140.58 ? 166  CYS D CA    1 
ATOM 6581  C C     . CYS D 1 159 ? -39.170  -40.817 -68.845  1.00 139.86 ? 166  CYS D C     1 
ATOM 6582  O O     . CYS D 1 159 ? -39.168  -41.391 -67.759  1.00 139.76 ? 166  CYS D O     1 
ATOM 6583  C CB    . CYS D 1 159 ? -41.598  -40.820 -69.479  1.00 140.77 ? 166  CYS D CB    1 
ATOM 6584  S SG    . CYS D 1 159 ? -42.957  -41.568 -70.477  1.00 141.64 ? 166  CYS D SG    1 
ATOM 6585  N N     . ILE D 1 160 ? -38.300  -39.860 -69.158  1.00 139.31 ? 167  ILE D N     1 
ATOM 6586  C CA    . ILE D 1 160 ? -37.339  -39.356 -68.172  1.00 138.93 ? 167  ILE D CA    1 
ATOM 6587  C C     . ILE D 1 160 ? -38.108  -38.595 -67.105  1.00 138.77 ? 167  ILE D C     1 
ATOM 6588  O O     . ILE D 1 160 ? -38.732  -37.568 -67.398  1.00 138.73 ? 167  ILE D O     1 
ATOM 6589  C CB    . ILE D 1 160 ? -36.222  -38.443 -68.789  1.00 138.86 ? 167  ILE D CB    1 
ATOM 6590  C CG1   . ILE D 1 160 ? -35.176  -39.273 -69.539  1.00 138.88 ? 167  ILE D CG1   1 
ATOM 6591  C CG2   . ILE D 1 160 ? -35.504  -37.617 -67.709  1.00 138.21 ? 167  ILE D CG2   1 
ATOM 6592  C CD1   . ILE D 1 160 ? -35.375  -39.300 -71.042  1.00 139.37 ? 167  ILE D CD1   1 
ATOM 6593  N N     . ALA D 1 161 ? -38.071  -39.124 -65.881  1.00 138.57 ? 168  ALA D N     1 
ATOM 6594  C CA    . ALA D 1 161 ? -38.742  -38.515 -64.736  1.00 138.29 ? 168  ALA D CA    1 
ATOM 6595  C C     . ALA D 1 161 ? -37.827  -37.507 -64.065  1.00 138.07 ? 168  ALA D C     1 
ATOM 6596  O O     . ALA D 1 161 ? -36.617  -37.496 -64.326  1.00 138.00 ? 168  ALA D O     1 
ATOM 6597  C CB    . ALA D 1 161 ? -39.167  -39.581 -63.750  1.00 138.34 ? 168  ALA D CB    1 
ATOM 6598  N N     . SER D 1 162 ? -38.407  -36.660 -63.209  1.00 137.83 ? 169  SER D N     1 
ATOM 6599  C CA    . SER D 1 162 ? -37.627  -35.700 -62.412  1.00 137.59 ? 169  SER D CA    1 
ATOM 6600  C C     . SER D 1 162 ? -36.581  -36.432 -61.555  1.00 137.40 ? 169  SER D C     1 
ATOM 6601  O O     . SER D 1 162 ? -36.585  -37.661 -61.487  1.00 137.41 ? 169  SER D O     1 
ATOM 6602  C CB    . SER D 1 162 ? -38.543  -34.834 -61.537  1.00 137.40 ? 169  SER D CB    1 
ATOM 6603  O OG    . SER D 1 162 ? -37.776  -34.005 -60.682  1.00 137.27 ? 169  SER D OG    1 
ATOM 6604  N N     . GLY D 1 163 ? -35.671  -35.690 -60.931  1.00 137.18 ? 170  GLY D N     1 
ATOM 6605  C CA    . GLY D 1 163 ? -34.692  -36.296 -60.032  1.00 137.02 ? 170  GLY D CA    1 
ATOM 6606  C C     . GLY D 1 163 ? -33.688  -37.293 -60.609  1.00 136.87 ? 170  GLY D C     1 
ATOM 6607  O O     . GLY D 1 163 ? -32.583  -37.403 -60.079  1.00 136.90 ? 170  GLY D O     1 
ATOM 6608  N N     . THR D 1 164 ? -34.048  -38.022 -61.672  1.00 136.69 ? 171  THR D N     1 
ATOM 6609  C CA    . THR D 1 164 ? -33.151  -39.064 -62.223  1.00 136.62 ? 171  THR D CA    1 
ATOM 6610  C C     . THR D 1 164 ? -31.853  -38.480 -62.791  1.00 136.79 ? 171  THR D C     1 
ATOM 6611  O O     . THR D 1 164 ? -31.857  -37.402 -63.393  1.00 136.76 ? 171  THR D O     1 
ATOM 6612  C CB    . THR D 1 164 ? -33.817  -40.011 -63.297  1.00 136.49 ? 171  THR D CB    1 
ATOM 6613  O OG1   . THR D 1 164 ? -33.333  -39.714 -64.616  1.00 136.02 ? 171  THR D OG1   1 
ATOM 6614  C CG2   . THR D 1 164 ? -35.326  -39.938 -63.264  1.00 136.13 ? 171  THR D CG2   1 
ATOM 6615  N N     . LYS D 1 165 ? -30.743  -39.188 -62.580  1.00 136.94 ? 172  LYS D N     1 
ATOM 6616  C CA    . LYS D 1 165 ? -29.488  -38.812 -63.226  1.00 136.85 ? 172  LYS D CA    1 
ATOM 6617  C C     . LYS D 1 165 ? -29.524  -39.217 -64.706  1.00 136.77 ? 172  LYS D C     1 
ATOM 6618  O O     . LYS D 1 165 ? -29.961  -40.318 -65.062  1.00 136.42 ? 172  LYS D O     1 
ATOM 6619  C CB    . LYS D 1 165 ? -28.232  -39.319 -62.473  1.00 136.80 ? 172  LYS D CB    1 
ATOM 6620  C CG    . LYS D 1 165 ? -28.077  -40.837 -62.320  1.00 137.10 ? 172  LYS D CG    1 
ATOM 6621  C CD    . LYS D 1 165 ? -28.343  -41.346 -60.894  1.00 137.00 ? 172  LYS D CD    1 
ATOM 6622  C CE    . LYS D 1 165 ? -27.981  -42.838 -60.788  1.00 136.41 ? 172  LYS D CE    1 
ATOM 6623  N NZ    . LYS D 1 165 ? -28.208  -43.426 -59.439  1.00 135.34 ? 172  LYS D NZ    1 
ATOM 6624  N N     . VAL D 1 166 ? -29.119  -38.276 -65.556  1.00 136.96 ? 173  VAL D N     1 
ATOM 6625  C CA    . VAL D 1 166 ? -29.085  -38.461 -67.005  1.00 137.00 ? 173  VAL D CA    1 
ATOM 6626  C C     . VAL D 1 166 ? -27.743  -37.992 -67.582  1.00 137.32 ? 173  VAL D C     1 
ATOM 6627  O O     . VAL D 1 166 ? -27.143  -37.015 -67.104  1.00 137.15 ? 173  VAL D O     1 
ATOM 6628  C CB    . VAL D 1 166 ? -30.259  -37.731 -67.710  1.00 136.80 ? 173  VAL D CB    1 
ATOM 6629  C CG1   . VAL D 1 166 ? -31.601  -38.223 -67.185  1.00 136.69 ? 173  VAL D CG1   1 
ATOM 6630  C CG2   . VAL D 1 166 ? -30.159  -36.231 -67.523  1.00 136.61 ? 173  VAL D CG2   1 
ATOM 6631  N N     . ALA D 1 167 ? -27.263  -38.722 -68.584  1.00 137.76 ? 174  ALA D N     1 
ATOM 6632  C CA    . ALA D 1 167 ? -26.073  -38.332 -69.332  1.00 138.40 ? 174  ALA D CA    1 
ATOM 6633  C C     . ALA D 1 167 ? -26.530  -38.010 -70.738  1.00 139.08 ? 174  ALA D C     1 
ATOM 6634  O O     . ALA D 1 167 ? -27.354  -38.738 -71.307  1.00 139.22 ? 174  ALA D O     1 
ATOM 6635  C CB    . ALA D 1 167 ? -25.065  -39.453 -69.368  1.00 138.30 ? 174  ALA D CB    1 
ATOM 6636  N N     . LEU D 1 168 ? -26.006  -36.912 -71.288  1.00 139.84 ? 175  LEU D N     1 
ATOM 6637  C CA    . LEU D 1 168 ? -26.339  -36.461 -72.652  1.00 140.25 ? 175  LEU D CA    1 
ATOM 6638  C C     . LEU D 1 168 ? -25.086  -36.309 -73.508  1.00 140.98 ? 175  LEU D C     1 
ATOM 6639  O O     . LEU D 1 168 ? -24.066  -35.756 -73.064  1.00 140.88 ? 175  LEU D O     1 
ATOM 6640  C CB    . LEU D 1 168 ? -27.170  -35.167 -72.637  1.00 139.83 ? 175  LEU D CB    1 
ATOM 6641  C CG    . LEU D 1 168 ? -27.071  -34.248 -71.412  1.00 139.23 ? 175  LEU D CG    1 
ATOM 6642  C CD1   . LEU D 1 168 ? -25.804  -33.419 -71.437  1.00 138.48 ? 175  LEU D CD1   1 
ATOM 6643  C CD2   . LEU D 1 168 ? -28.296  -33.359 -71.291  1.00 138.73 ? 175  LEU D CD2   1 
ATOM 6644  N N     . PHE D 1 169 ? -25.171  -36.816 -74.735  1.00 142.02 ? 176  PHE D N     1 
ATOM 6645  C CA    . PHE D 1 169 ? -24.030  -36.804 -75.642  1.00 143.18 ? 176  PHE D CA    1 
ATOM 6646  C C     . PHE D 1 169 ? -24.295  -36.084 -76.954  1.00 144.47 ? 176  PHE D C     1 
ATOM 6647  O O     . PHE D 1 169 ? -25.445  -35.973 -77.398  1.00 144.58 ? 176  PHE D O     1 
ATOM 6648  C CB    . PHE D 1 169 ? -23.564  -38.223 -75.934  1.00 142.74 ? 176  PHE D CB    1 
ATOM 6649  C CG    . PHE D 1 169 ? -24.542  -39.038 -76.715  1.00 141.66 ? 176  PHE D CG    1 
ATOM 6650  C CD1   . PHE D 1 169 ? -24.657  -38.884 -78.088  1.00 140.91 ? 176  PHE D CD1   1 
ATOM 6651  C CD2   . PHE D 1 169 ? -25.332  -39.981 -76.085  1.00 140.75 ? 176  PHE D CD2   1 
ATOM 6652  C CE1   . PHE D 1 169 ? -25.557  -39.647 -78.817  1.00 140.76 ? 176  PHE D CE1   1 
ATOM 6653  C CE2   . PHE D 1 169 ? -26.231  -40.754 -76.811  1.00 140.56 ? 176  PHE D CE2   1 
ATOM 6654  C CZ    . PHE D 1 169 ? -26.344  -40.586 -78.178  1.00 140.44 ? 176  PHE D CZ    1 
ATOM 6655  N N     . ASN D 1 170 ? -23.213  -35.620 -77.575  1.00 146.08 ? 177  ASN D N     1 
ATOM 6656  C CA    . ASN D 1 170 ? -23.289  -34.988 -78.886  1.00 147.66 ? 177  ASN D CA    1 
ATOM 6657  C C     . ASN D 1 170 ? -22.449  -35.692 -79.941  1.00 148.58 ? 177  ASN D C     1 
ATOM 6658  O O     . ASN D 1 170 ? -21.226  -35.822 -79.806  1.00 148.76 ? 177  ASN D O     1 
ATOM 6659  C CB    . ASN D 1 170 ? -22.900  -33.510 -78.826  1.00 147.67 ? 177  ASN D CB    1 
ATOM 6660  C CG    . ASN D 1 170 ? -22.963  -32.849 -80.189  1.00 148.25 ? 177  ASN D CG    1 
ATOM 6661  O OD1   . ASN D 1 170 ? -21.937  -32.657 -80.848  1.00 148.69 ? 177  ASN D OD1   1 
ATOM 6662  N ND2   . ASN D 1 170 ? -24.178  -32.535 -80.639  1.00 149.02 ? 177  ASN D ND2   1 
ATOM 6663  N N     . ARG D 1 171 ? -23.130  -36.136 -80.989  1.00 149.77 ? 178  ARG D N     1 
ATOM 6664  C CA    . ARG D 1 171 ? -22.484  -36.700 -82.160  1.00 151.24 ? 178  ARG D CA    1 
ATOM 6665  C C     . ARG D 1 171 ? -22.970  -35.852 -83.323  1.00 151.86 ? 178  ARG D C     1 
ATOM 6666  O O     . ARG D 1 171 ? -24.049  -35.257 -83.228  1.00 152.04 ? 178  ARG D O     1 
ATOM 6667  C CB    . ARG D 1 171 ? -22.882  -38.165 -82.344  1.00 151.45 ? 178  ARG D CB    1 
ATOM 6668  C CG    . ARG D 1 171 ? -22.794  -39.050 -81.059  1.00 153.34 ? 178  ARG D CG    1 
ATOM 6669  C CD    . ARG D 1 171 ? -23.172  -40.554 -81.278  1.00 155.81 ? 178  ARG D CD    1 
ATOM 6670  N NE    . ARG D 1 171 ? -23.962  -40.717 -82.495  1.00 158.56 ? 178  ARG D NE    1 
ATOM 6671  C CZ    . ARG D 1 171 ? -23.435  -40.852 -83.711  1.00 160.30 ? 178  ARG D CZ    1 
ATOM 6672  N NH1   . ARG D 1 171 ? -24.219  -40.949 -84.765  1.00 161.09 ? 178  ARG D NH1   1 
ATOM 6673  N NH2   . ARG D 1 171 ? -22.118  -40.878 -83.878  1.00 161.42 ? 178  ARG D NH2   1 
ATOM 6674  N N     . LEU D 1 172 ? -22.186  -35.775 -84.403  1.00 152.75 ? 179  LEU D N     1 
ATOM 6675  C CA    . LEU D 1 172 ? -22.431  -34.776 -85.467  1.00 153.24 ? 179  LEU D CA    1 
ATOM 6676  C C     . LEU D 1 172 ? -22.533  -35.335 -86.887  1.00 153.54 ? 179  LEU D C     1 
ATOM 6677  O O     . LEU D 1 172 ? -21.781  -36.238 -87.285  1.00 153.26 ? 179  LEU D O     1 
ATOM 6678  C CB    . LEU D 1 172 ? -21.391  -33.634 -85.424  1.00 153.27 ? 179  LEU D CB    1 
ATOM 6679  C CG    . LEU D 1 172 ? -21.207  -32.837 -84.119  1.00 153.80 ? 179  LEU D CG    1 
ATOM 6680  C CD1   . LEU D 1 172 ? -20.058  -33.415 -83.269  1.00 154.22 ? 179  LEU D CD1   1 
ATOM 6681  C CD2   . LEU D 1 172 ? -20.977  -31.352 -84.384  1.00 154.17 ? 179  LEU D CD2   1 
ATOM 6682  N N     . ARG D 1 173 ? -23.492  -34.774 -87.627  1.00 154.21 ? 180  ARG D N     1 
ATOM 6683  C CA    . ARG D 1 173 ? -23.683  -34.989 -89.080  1.00 154.98 ? 180  ARG D CA    1 
ATOM 6684  C C     . ARG D 1 173 ? -23.931  -36.448 -89.482  1.00 155.08 ? 180  ARG D C     1 
ATOM 6685  O O     . ARG D 1 173 ? -24.221  -36.741 -90.650  1.00 155.11 ? 180  ARG D O     1 
ATOM 6686  C CB    . ARG D 1 173 ? -22.532  -34.358 -89.904  1.00 155.27 ? 180  ARG D CB    1 
ATOM 6687  C CG    . ARG D 1 173 ? -22.951  -33.729 -91.268  1.00 156.07 ? 180  ARG D CG    1 
ATOM 6688  C CD    . ARG D 1 173 ? -21.932  -32.703 -91.805  1.00 157.14 ? 180  ARG D CD    1 
ATOM 6689  N NE    . ARG D 1 173 ? -20.556  -33.213 -91.778  1.00 158.45 ? 180  ARG D NE    1 
ATOM 6690  C CZ    . ARG D 1 173 ? -19.559  -32.687 -91.061  1.00 159.14 ? 180  ARG D CZ    1 
ATOM 6691  N NH1   . ARG D 1 173 ? -19.763  -31.606 -90.308  1.00 159.62 ? 180  ARG D NH1   1 
ATOM 6692  N NH2   . ARG D 1 173 ? -18.345  -33.235 -91.102  1.00 158.97 ? 180  ARG D NH2   1 
ATOM 6693  N N     . SER D 1 174 ? -23.824  -37.342 -88.500  1.00 155.25 ? 181  SER D N     1 
ATOM 6694  C CA    . SER D 1 174 ? -24.122  -38.773 -88.645  1.00 155.31 ? 181  SER D CA    1 
ATOM 6695  C C     . SER D 1 174 ? -22.857  -39.638 -88.754  1.00 155.42 ? 181  SER D C     1 
ATOM 6696  O O     . SER D 1 174 ? -22.877  -40.701 -89.396  1.00 155.41 ? 181  SER D O     1 
ATOM 6697  C CB    . SER D 1 174 ? -25.093  -39.037 -89.810  1.00 155.24 ? 181  SER D CB    1 
ATOM 6698  O OG    . SER D 1 174 ? -25.558  -40.373 -89.806  1.00 155.03 ? 181  SER D OG    1 
ATOM 6699  N N     . GLN D 1 175 ? -21.770  -39.196 -88.109  1.00 155.47 ? 182  GLN D N     1 
ATOM 6700  C CA    . GLN D 1 175 ? -20.523  -39.978 -88.117  1.00 155.42 ? 182  GLN D CA    1 
ATOM 6701  C C     . GLN D 1 175 ? -19.965  -40.485 -86.771  1.00 155.37 ? 182  GLN D C     1 
ATOM 6702  O O     . GLN D 1 175 ? -19.595  -39.699 -85.874  1.00 155.31 ? 182  GLN D O     1 
ATOM 6703  C CB    . GLN D 1 175 ? -19.436  -39.292 -88.940  1.00 155.39 ? 182  GLN D CB    1 
ATOM 6704  C CG    . GLN D 1 175 ? -18.589  -40.296 -89.727  1.00 155.31 ? 182  GLN D CG    1 
ATOM 6705  C CD    . GLN D 1 175 ? -19.429  -41.297 -90.536  1.00 155.22 ? 182  GLN D CD    1 
ATOM 6706  O OE1   . GLN D 1 175 ? -20.355  -40.922 -91.254  1.00 154.58 ? 182  GLN D OE1   1 
ATOM 6707  N NE2   . GLN D 1 175 ? -19.095  -42.573 -90.419  1.00 155.52 ? 182  GLN D NE2   1 
ATOM 6708  N N     . THR D 1 176 ? -19.891  -41.822 -86.702  1.00 155.15 ? 183  THR D N     1 
ATOM 6709  C CA    . THR D 1 176 ? -19.477  -42.642 -85.534  1.00 154.90 ? 183  THR D CA    1 
ATOM 6710  C C     . THR D 1 176 ? -18.401  -42.076 -84.580  1.00 154.59 ? 183  THR D C     1 
ATOM 6711  O O     . THR D 1 176 ? -18.500  -42.214 -83.347  1.00 154.48 ? 183  THR D O     1 
ATOM 6712  C CB    . THR D 1 176 ? -19.070  -44.103 -85.994  1.00 154.93 ? 183  THR D CB    1 
ATOM 6713  O OG1   . THR D 1 176 ? -18.325  -44.770 -84.962  1.00 155.16 ? 183  THR D OG1   1 
ATOM 6714  C CG2   . THR D 1 176 ? -18.238  -44.082 -87.281  1.00 154.83 ? 183  THR D CG2   1 
ATOM 6715  N N     . VAL D 1 177 ? -17.398  -41.426 -85.162  1.00 154.17 ? 184  VAL D N     1 
ATOM 6716  C CA    . VAL D 1 177 ? -16.163  -41.096 -84.455  1.00 153.51 ? 184  VAL D CA    1 
ATOM 6717  C C     . VAL D 1 177 ? -16.220  -39.800 -83.630  1.00 153.24 ? 184  VAL D C     1 
ATOM 6718  O O     . VAL D 1 177 ? -15.522  -39.677 -82.616  1.00 153.10 ? 184  VAL D O     1 
ATOM 6719  C CB    . VAL D 1 177 ? -14.963  -41.097 -85.433  1.00 153.40 ? 184  VAL D CB    1 
ATOM 6720  C CG1   . VAL D 1 177 ? -14.498  -42.522 -85.682  1.00 152.76 ? 184  VAL D CG1   1 
ATOM 6721  C CG2   . VAL D 1 177 ? -15.349  -40.425 -86.750  1.00 153.08 ? 184  VAL D CG2   1 
ATOM 6722  N N     . SER D 1 178 ? -17.069  -38.860 -84.053  1.00 152.85 ? 185  SER D N     1 
ATOM 6723  C CA    . SER D 1 178 ? -17.118  -37.502 -83.475  1.00 152.48 ? 185  SER D CA    1 
ATOM 6724  C C     . SER D 1 178 ? -17.550  -37.444 -82.011  1.00 152.24 ? 185  SER D C     1 
ATOM 6725  O O     . SER D 1 178 ? -17.093  -36.578 -81.258  1.00 152.13 ? 185  SER D O     1 
ATOM 6726  C CB    . SER D 1 178 ? -18.053  -36.616 -84.295  1.00 152.43 ? 185  SER D CB    1 
ATOM 6727  O OG    . SER D 1 178 ? -19.373  -37.119 -84.237  1.00 151.96 ? 185  SER D OG    1 
ATOM 6728  N N     . THR D 1 179 ? -18.439  -38.373 -81.651  1.00 151.95 ? 186  THR D N     1 
ATOM 6729  C CA    . THR D 1 179 ? -19.082  -38.492 -80.331  1.00 151.38 ? 186  THR D CA    1 
ATOM 6730  C C     . THR D 1 179 ? -18.336  -37.825 -79.173  1.00 151.21 ? 186  THR D C     1 
ATOM 6731  O O     . THR D 1 179 ? -17.197  -38.186 -78.865  1.00 151.18 ? 186  THR D O     1 
ATOM 6732  C CB    . THR D 1 179 ? -19.332  -39.977 -79.992  1.00 151.26 ? 186  THR D CB    1 
ATOM 6733  O OG1   . THR D 1 179 ? -19.763  -40.676 -81.165  1.00 150.93 ? 186  THR D OG1   1 
ATOM 6734  C CG2   . THR D 1 179 ? -20.391  -40.108 -78.932  1.00 151.35 ? 186  THR D CG2   1 
ATOM 6735  N N     . ARG D 1 180 ? -18.989  -36.844 -78.551  1.00 151.04 ? 187  ARG D N     1 
ATOM 6736  C CA    . ARG D 1 180 ? -18.425  -36.099 -77.424  1.00 151.13 ? 187  ARG D CA    1 
ATOM 6737  C C     . ARG D 1 180 ? -19.530  -35.863 -76.388  1.00 150.97 ? 187  ARG D C     1 
ATOM 6738  O O     . ARG D 1 180 ? -20.619  -35.407 -76.746  1.00 150.89 ? 187  ARG D O     1 
ATOM 6739  C CB    . ARG D 1 180 ? -17.790  -34.775 -77.896  1.00 151.24 ? 187  ARG D CB    1 
ATOM 6740  C CG    . ARG D 1 180 ? -16.601  -34.955 -78.857  1.00 152.23 ? 187  ARG D CG    1 
ATOM 6741  C CD    . ARG D 1 180 ? -16.007  -33.643 -79.367  1.00 154.17 ? 187  ARG D CD    1 
ATOM 6742  N NE    . ARG D 1 180 ? -14.974  -33.114 -78.467  1.00 155.85 ? 187  ARG D NE    1 
ATOM 6743  C CZ    . ARG D 1 180 ? -14.304  -31.971 -78.645  1.00 156.19 ? 187  ARG D CZ    1 
ATOM 6744  N NH1   . ARG D 1 180 ? -14.539  -31.204 -79.703  1.00 156.24 ? 187  ARG D NH1   1 
ATOM 6745  N NH2   . ARG D 1 180 ? -13.396  -31.588 -77.755  1.00 155.75 ? 187  ARG D NH2   1 
ATOM 6746  N N     . TYR D 1 181 ? -19.254  -36.193 -75.121  1.00 150.83 ? 188  TYR D N     1 
ATOM 6747  C CA    . TYR D 1 181 ? -20.264  -36.161 -74.047  1.00 150.59 ? 188  TYR D CA    1 
ATOM 6748  C C     . TYR D 1 181 ? -19.984  -35.053 -73.059  1.00 151.18 ? 188  TYR D C     1 
ATOM 6749  O O     . TYR D 1 181 ? -18.832  -34.848 -72.675  1.00 151.06 ? 188  TYR D O     1 
ATOM 6750  C CB    . TYR D 1 181 ? -20.283  -37.474 -73.263  1.00 150.03 ? 188  TYR D CB    1 
ATOM 6751  C CG    . TYR D 1 181 ? -20.000  -38.713 -74.074  1.00 148.42 ? 188  TYR D CG    1 
ATOM 6752  C CD1   . TYR D 1 181 ? -18.758  -39.334 -74.021  1.00 147.48 ? 188  TYR D CD1   1 
ATOM 6753  C CD2   . TYR D 1 181 ? -20.975  -39.273 -74.891  1.00 146.80 ? 188  TYR D CD2   1 
ATOM 6754  C CE1   . TYR D 1 181 ? -18.495  -40.485 -74.769  1.00 146.66 ? 188  TYR D CE1   1 
ATOM 6755  C CE2   . TYR D 1 181 ? -20.731  -40.415 -75.638  1.00 145.79 ? 188  TYR D CE2   1 
ATOM 6756  C CZ    . TYR D 1 181 ? -19.490  -41.019 -75.577  1.00 145.94 ? 188  TYR D CZ    1 
ATOM 6757  O OH    . TYR D 1 181 ? -19.245  -42.149 -76.325  1.00 145.15 ? 188  TYR D OH    1 
ATOM 6758  N N     . LEU D 1 182 ? -21.035  -34.360 -72.624  1.00 152.09 ? 189  LEU D N     1 
ATOM 6759  C CA    . LEU D 1 182 ? -20.887  -33.320 -71.605  1.00 153.15 ? 189  LEU D CA    1 
ATOM 6760  C C     . LEU D 1 182 ? -20.268  -33.926 -70.349  1.00 154.13 ? 189  LEU D C     1 
ATOM 6761  O O     . LEU D 1 182 ? -20.931  -34.645 -69.602  1.00 154.18 ? 189  LEU D O     1 
ATOM 6762  C CB    . LEU D 1 182 ? -22.228  -32.662 -71.255  1.00 152.92 ? 189  LEU D CB    1 
ATOM 6763  C CG    . LEU D 1 182 ? -22.275  -31.221 -70.700  1.00 152.55 ? 189  LEU D CG    1 
ATOM 6764  C CD1   . LEU D 1 182 ? -23.544  -31.008 -69.893  1.00 152.03 ? 189  LEU D CD1   1 
ATOM 6765  C CD2   . LEU D 1 182 ? -21.069  -30.796 -69.848  1.00 152.51 ? 189  LEU D CD2   1 
ATOM 6766  N N     . HIS D 1 183 ? -18.989  -33.643 -70.140  1.00 155.41 ? 190  HIS D N     1 
ATOM 6767  C CA    . HIS D 1 183 ? -18.301  -34.062 -68.934  1.00 156.74 ? 190  HIS D CA    1 
ATOM 6768  C C     . HIS D 1 183 ? -17.667  -32.863 -68.244  1.00 157.77 ? 190  HIS D C     1 
ATOM 6769  O O     . HIS D 1 183 ? -17.479  -31.811 -68.850  1.00 157.77 ? 190  HIS D O     1 
ATOM 6770  C CB    . HIS D 1 183 ? -17.246  -35.123 -69.255  1.00 156.72 ? 190  HIS D CB    1 
ATOM 6771  C CG    . HIS D 1 183 ? -16.489  -35.603 -68.056  1.00 156.79 ? 190  HIS D CG    1 
ATOM 6772  N ND1   . HIS D 1 183 ? -15.122  -35.466 -67.935  1.00 156.37 ? 190  HIS D ND1   1 
ATOM 6773  C CD2   . HIS D 1 183 ? -16.912  -36.194 -66.912  1.00 156.71 ? 190  HIS D CD2   1 
ATOM 6774  C CE1   . HIS D 1 183 ? -14.733  -35.967 -66.777  1.00 156.53 ? 190  HIS D CE1   1 
ATOM 6775  N NE2   . HIS D 1 183 ? -15.800  -36.412 -66.136  1.00 156.91 ? 190  HIS D NE2   1 
ATOM 6776  N N     . VAL D 1 184 ? -17.343  -33.040 -66.969  1.00 159.28 ? 191  VAL D N     1 
ATOM 6777  C CA    . VAL D 1 184 ? -16.681  -32.016 -66.169  1.00 160.74 ? 191  VAL D CA    1 
ATOM 6778  C C     . VAL D 1 184 ? -15.203  -32.371 -65.896  1.00 161.77 ? 191  VAL D C     1 
ATOM 6779  O O     . VAL D 1 184 ? -14.912  -33.384 -65.238  1.00 161.97 ? 191  VAL D O     1 
ATOM 6780  C CB    . VAL D 1 184 ? -17.439  -31.771 -64.833  1.00 160.69 ? 191  VAL D CB    1 
ATOM 6781  C CG1   . VAL D 1 184 ? -18.612  -30.821 -65.043  1.00 160.60 ? 191  VAL D CG1   1 
ATOM 6782  C CG2   . VAL D 1 184 ? -17.905  -33.097 -64.219  1.00 160.71 ? 191  VAL D CG2   1 
ATOM 6783  N N     . GLU D 1 185 ? -14.283  -31.545 -66.415  1.00 162.95 ? 192  GLU D N     1 
ATOM 6784  C CA    . GLU D 1 185 ? -12.835  -31.668 -66.126  1.00 163.86 ? 192  GLU D CA    1 
ATOM 6785  C C     . GLU D 1 185 ? -12.359  -30.719 -65.012  1.00 164.52 ? 192  GLU D C     1 
ATOM 6786  O O     . GLU D 1 185 ? -11.957  -29.574 -65.274  1.00 164.48 ? 192  GLU D O     1 
ATOM 6787  C CB    . GLU D 1 185 ? -11.979  -31.510 -67.395  1.00 163.72 ? 192  GLU D CB    1 
ATOM 6788  C CG    . GLU D 1 185 ? -11.808  -32.814 -68.168  1.00 163.80 ? 192  GLU D CG    1 
ATOM 6789  C CD    . GLU D 1 185 ? -10.453  -32.956 -68.842  1.00 163.88 ? 192  GLU D CD    1 
ATOM 6790  O OE1   . GLU D 1 185 ? -10.269  -33.922 -69.615  1.00 163.50 ? 192  GLU D OE1   1 
ATOM 6791  O OE2   . GLU D 1 185 ? -9.566   -32.113 -68.601  1.00 164.25 ? 192  GLU D OE2   1 
ATOM 6792  N N     . GLY D 1 186 ? -12.426  -31.212 -63.772  1.00 165.34 ? 193  GLY D N     1 
ATOM 6793  C CA    . GLY D 1 186 ? -11.985  -30.468 -62.590  1.00 166.46 ? 193  GLY D CA    1 
ATOM 6794  C C     . GLY D 1 186 ? -12.966  -29.429 -62.064  1.00 167.22 ? 193  GLY D C     1 
ATOM 6795  O O     . GLY D 1 186 ? -12.978  -29.133 -60.865  1.00 167.35 ? 193  GLY D O     1 
ATOM 6796  N N     . GLY D 1 187 ? -13.785  -28.880 -62.961  1.00 167.79 ? 194  GLY D N     1 
ATOM 6797  C CA    . GLY D 1 187 ? -14.713  -27.791 -62.637  1.00 168.43 ? 194  GLY D CA    1 
ATOM 6798  C C     . GLY D 1 187 ? -15.092  -26.998 -63.877  1.00 168.75 ? 194  GLY D C     1 
ATOM 6799  O O     . GLY D 1 187 ? -15.954  -26.115 -63.831  1.00 168.77 ? 194  GLY D O     1 
ATOM 6800  N N     . ASN D 1 188 ? -14.434  -27.318 -64.988  1.00 169.05 ? 195  ASN D N     1 
ATOM 6801  C CA    . ASN D 1 188 ? -14.737  -26.705 -66.275  1.00 169.38 ? 195  ASN D CA    1 
ATOM 6802  C C     . ASN D 1 188 ? -15.325  -27.654 -67.329  1.00 169.70 ? 195  ASN D C     1 
ATOM 6803  O O     . ASN D 1 188 ? -14.604  -28.449 -67.958  1.00 169.69 ? 195  ASN D O     1 
ATOM 6804  C CB    . ASN D 1 188 ? -13.521  -25.956 -66.819  1.00 169.25 ? 195  ASN D CB    1 
ATOM 6805  C CG    . ASN D 1 188 ? -13.620  -24.466 -66.598  1.00 169.06 ? 195  ASN D CG    1 
ATOM 6806  O OD1   . ASN D 1 188 ? -14.495  -23.987 -65.875  1.00 168.62 ? 195  ASN D OD1   1 
ATOM 6807  N ND2   . ASN D 1 188 ? -12.729  -23.718 -67.232  1.00 168.97 ? 195  ASN D ND2   1 
ATOM 6808  N N     . PHE D 1 189 ? -16.644  -27.540 -67.501  1.00 169.99 ? 196  PHE D N     1 
ATOM 6809  C CA    . PHE D 1 189 ? -17.441  -28.330 -68.449  1.00 170.33 ? 196  PHE D CA    1 
ATOM 6810  C C     . PHE D 1 189 ? -16.777  -28.395 -69.826  1.00 170.20 ? 196  PHE D C     1 
ATOM 6811  O O     . PHE D 1 189 ? -16.378  -27.365 -70.368  1.00 170.39 ? 196  PHE D O     1 
ATOM 6812  C CB    . PHE D 1 189 ? -18.857  -27.733 -68.588  1.00 170.49 ? 196  PHE D CB    1 
ATOM 6813  C CG    . PHE D 1 189 ? -19.498  -27.350 -67.273  1.00 171.70 ? 196  PHE D CG    1 
ATOM 6814  C CD1   . PHE D 1 189 ? -19.192  -26.126 -66.656  1.00 172.63 ? 196  PHE D CD1   1 
ATOM 6815  C CD2   . PHE D 1 189 ? -20.414  -28.203 -66.652  1.00 172.65 ? 196  PHE D CD2   1 
ATOM 6816  C CE1   . PHE D 1 189 ? -19.776  -25.760 -65.433  1.00 172.96 ? 196  PHE D CE1   1 
ATOM 6817  C CE2   . PHE D 1 189 ? -21.007  -27.850 -65.427  1.00 173.18 ? 196  PHE D CE2   1 
ATOM 6818  C CZ    . PHE D 1 189 ? -20.687  -26.622 -64.819  1.00 173.20 ? 196  PHE D CZ    1 
ATOM 6819  N N     . HIS D 1 190 ? -16.647  -29.604 -70.375  1.00 169.95 ? 197  HIS D N     1 
ATOM 6820  C CA    . HIS D 1 190 ? -16.097  -29.791 -71.722  1.00 169.59 ? 197  HIS D CA    1 
ATOM 6821  C C     . HIS D 1 190 ? -16.883  -30.853 -72.489  1.00 169.02 ? 197  HIS D C     1 
ATOM 6822  O O     . HIS D 1 190 ? -18.028  -31.140 -72.141  1.00 168.84 ? 197  HIS D O     1 
ATOM 6823  C CB    . HIS D 1 190 ? -14.574  -30.070 -71.671  1.00 169.91 ? 197  HIS D CB    1 
ATOM 6824  C CG    . HIS D 1 190 ? -14.202  -31.501 -71.399  1.00 170.73 ? 197  HIS D CG    1 
ATOM 6825  N ND1   . HIS D 1 190 ? -13.186  -32.141 -72.079  1.00 171.15 ? 197  HIS D ND1   1 
ATOM 6826  C CD2   . HIS D 1 190 ? -14.701  -32.411 -70.528  1.00 171.48 ? 197  HIS D CD2   1 
ATOM 6827  C CE1   . HIS D 1 190 ? -13.074  -33.380 -71.637  1.00 171.36 ? 197  HIS D CE1   1 
ATOM 6828  N NE2   . HIS D 1 190 ? -13.987  -33.573 -70.702  1.00 171.58 ? 197  HIS D NE2   1 
ATOM 6829  N N     . ALA D 1 191 ? -16.280  -31.415 -73.535  1.00 168.52 ? 198  ALA D N     1 
ATOM 6830  C CA    . ALA D 1 191 ? -16.891  -32.506 -74.293  1.00 168.09 ? 198  ALA D CA    1 
ATOM 6831  C C     . ALA D 1 191 ? -15.877  -33.592 -74.667  1.00 167.82 ? 198  ALA D C     1 
ATOM 6832  O O     . ALA D 1 191 ? -15.355  -33.603 -75.783  1.00 167.83 ? 198  ALA D O     1 
ATOM 6833  C CB    . ALA D 1 191 ? -17.580  -31.964 -75.532  1.00 168.00 ? 198  ALA D CB    1 
ATOM 6834  N N     . SER D 1 192 ? -15.604  -34.500 -73.729  1.00 167.42 ? 199  SER D N     1 
ATOM 6835  C CA    . SER D 1 192 ? -14.652  -35.591 -73.951  1.00 167.08 ? 199  SER D CA    1 
ATOM 6836  C C     . SER D 1 192 ? -15.223  -36.649 -74.893  1.00 166.78 ? 199  SER D C     1 
ATOM 6837  O O     . SER D 1 192 ? -16.435  -36.787 -75.017  1.00 166.60 ? 199  SER D O     1 
ATOM 6838  C CB    . SER D 1 192 ? -14.269  -36.234 -72.613  1.00 167.12 ? 199  SER D CB    1 
ATOM 6839  O OG    . SER D 1 192 ? -13.212  -37.168 -72.762  1.00 167.38 ? 199  SER D OG    1 
ATOM 6840  N N     . SER D 1 193 ? -14.342  -37.377 -75.572  1.00 166.65 ? 200  SER D N     1 
ATOM 6841  C CA    . SER D 1 193 ? -14.739  -38.576 -76.313  1.00 166.62 ? 200  SER D CA    1 
ATOM 6842  C C     . SER D 1 193 ? -14.216  -39.810 -75.575  1.00 166.69 ? 200  SER D C     1 
ATOM 6843  O O     . SER D 1 193 ? -14.056  -40.888 -76.159  1.00 166.52 ? 200  SER D O     1 
ATOM 6844  C CB    . SER D 1 193 ? -14.261  -38.529 -77.772  1.00 166.58 ? 200  SER D CB    1 
ATOM 6845  O OG    . SER D 1 193 ? -12.935  -38.049 -77.885  1.00 166.50 ? 200  SER D OG    1 
ATOM 6846  N N     . GLN D 1 194 ? -13.964  -39.614 -74.278  1.00 166.88 ? 201  GLN D N     1 
ATOM 6847  C CA    . GLN D 1 194 ? -13.478  -40.638 -73.346  1.00 167.07 ? 201  GLN D CA    1 
ATOM 6848  C C     . GLN D 1 194 ? -14.327  -40.670 -72.074  1.00 166.94 ? 201  GLN D C     1 
ATOM 6849  O O     . GLN D 1 194 ? -14.669  -41.740 -71.559  1.00 166.95 ? 201  GLN D O     1 
ATOM 6850  C CB    . GLN D 1 194 ? -12.011  -40.367 -72.967  1.00 167.14 ? 201  GLN D CB    1 
ATOM 6851  C CG    . GLN D 1 194 ? -11.018  -41.459 -73.383  1.00 167.68 ? 201  GLN D CG    1 
ATOM 6852  C CD    . GLN D 1 194 ? -10.979  -41.706 -74.884  1.00 168.14 ? 201  GLN D CD    1 
ATOM 6853  O OE1   . GLN D 1 194 ? -11.138  -42.841 -75.343  1.00 168.36 ? 201  GLN D OE1   1 
ATOM 6854  N NE2   . GLN D 1 194 ? -10.770  -40.644 -75.654  1.00 168.17 ? 201  GLN D NE2   1 
ATOM 6855  N N     . GLN D 1 195 ? -14.658  -39.481 -71.580  1.00 166.81 ? 202  GLN D N     1 
ATOM 6856  C CA    . GLN D 1 195 ? -15.315  -39.322 -70.294  1.00 166.81 ? 202  GLN D CA    1 
ATOM 6857  C C     . GLN D 1 195 ? -16.728  -38.776 -70.420  1.00 166.56 ? 202  GLN D C     1 
ATOM 6858  O O     . GLN D 1 195 ? -16.965  -37.834 -71.170  1.00 166.78 ? 202  GLN D O     1 
ATOM 6859  C CB    . GLN D 1 195 ? -14.485  -38.390 -69.404  1.00 166.94 ? 202  GLN D CB    1 
ATOM 6860  C CG    . GLN D 1 195 ? -13.413  -39.091 -68.566  1.00 167.71 ? 202  GLN D CG    1 
ATOM 6861  C CD    . GLN D 1 195 ? -13.998  -39.920 -67.421  1.00 168.50 ? 202  GLN D CD    1 
ATOM 6862  O OE1   . GLN D 1 195 ? -14.496  -41.031 -67.631  1.00 168.90 ? 202  GLN D OE1   1 
ATOM 6863  N NE2   . GLN D 1 195 ? -13.931  -39.382 -66.204  1.00 168.47 ? 202  GLN D NE2   1 
ATOM 6864  N N     . TRP D 1 196 ? -17.664  -39.368 -69.681  1.00 166.25 ? 203  TRP D N     1 
ATOM 6865  C CA    . TRP D 1 196 ? -19.021  -38.821 -69.575  1.00 165.85 ? 203  TRP D CA    1 
ATOM 6866  C C     . TRP D 1 196 ? -19.498  -38.768 -68.129  1.00 165.94 ? 203  TRP D C     1 
ATOM 6867  O O     . TRP D 1 196 ? -19.396  -39.755 -67.394  1.00 165.98 ? 203  TRP D O     1 
ATOM 6868  C CB    . TRP D 1 196 ? -20.024  -39.574 -70.465  1.00 165.61 ? 203  TRP D CB    1 
ATOM 6869  C CG    . TRP D 1 196 ? -20.154  -41.056 -70.207  1.00 164.73 ? 203  TRP D CG    1 
ATOM 6870  C CD1   . TRP D 1 196 ? -19.450  -42.066 -70.808  1.00 164.20 ? 203  TRP D CD1   1 
ATOM 6871  C CD2   . TRP D 1 196 ? -21.060  -41.687 -69.304  1.00 163.77 ? 203  TRP D CD2   1 
ATOM 6872  N NE1   . TRP D 1 196 ? -19.855  -43.283 -70.324  1.00 163.20 ? 203  TRP D NE1   1 
ATOM 6873  C CE2   . TRP D 1 196 ? -20.842  -43.081 -69.399  1.00 163.31 ? 203  TRP D CE2   1 
ATOM 6874  C CE3   . TRP D 1 196 ? -22.030  -41.211 -68.416  1.00 163.77 ? 203  TRP D CE3   1 
ATOM 6875  C CZ2   . TRP D 1 196 ? -21.558  -44.001 -68.640  1.00 163.29 ? 203  TRP D CZ2   1 
ATOM 6876  C CZ3   . TRP D 1 196 ? -22.745  -42.127 -67.660  1.00 163.18 ? 203  TRP D CZ3   1 
ATOM 6877  C CH2   . TRP D 1 196 ? -22.505  -43.507 -67.779  1.00 163.19 ? 203  TRP D CH2   1 
ATOM 6878  N N     . GLY D 1 197 ? -19.993  -37.598 -67.731  1.00 166.00 ? 204  GLY D N     1 
ATOM 6879  C CA    . GLY D 1 197 ? -20.545  -37.385 -66.397  1.00 166.12 ? 204  GLY D CA    1 
ATOM 6880  C C     . GLY D 1 197 ? -22.047  -37.600 -66.374  1.00 166.18 ? 204  GLY D C     1 
ATOM 6881  O O     . GLY D 1 197 ? -22.713  -37.547 -67.411  1.00 166.03 ? 204  GLY D O     1 
ATOM 6882  N N     . ALA D 1 198 ? -22.579  -37.855 -65.185  1.00 166.41 ? 205  ALA D N     1 
ATOM 6883  C CA    . ALA D 1 198 ? -24.010  -38.044 -65.008  1.00 166.63 ? 205  ALA D CA    1 
ATOM 6884  C C     . ALA D 1 198 ? -24.572  -36.930 -64.138  1.00 166.91 ? 205  ALA D C     1 
ATOM 6885  O O     . ALA D 1 198 ? -24.092  -36.674 -63.028  1.00 166.77 ? 205  ALA D O     1 
ATOM 6886  C CB    . ALA D 1 198 ? -24.304  -39.405 -64.407  1.00 166.61 ? 205  ALA D CB    1 
ATOM 6887  N N     . PHE D 1 199 ? -25.591  -36.266 -64.671  1.00 167.35 ? 206  PHE D N     1 
ATOM 6888  C CA    . PHE D 1 199 ? -26.184  -35.099 -64.036  1.00 167.82 ? 206  PHE D CA    1 
ATOM 6889  C C     . PHE D 1 199 ? -27.612  -35.396 -63.630  1.00 168.19 ? 206  PHE D C     1 
ATOM 6890  O O     . PHE D 1 199 ? -28.340  -36.075 -64.356  1.00 168.20 ? 206  PHE D O     1 
ATOM 6891  C CB    . PHE D 1 199 ? -26.200  -33.910 -64.998  1.00 167.78 ? 206  PHE D CB    1 
ATOM 6892  C CG    . PHE D 1 199 ? -24.898  -33.675 -65.709  1.00 167.63 ? 206  PHE D CG    1 
ATOM 6893  C CD1   . PHE D 1 199 ? -24.671  -34.212 -66.978  1.00 167.68 ? 206  PHE D CD1   1 
ATOM 6894  C CD2   . PHE D 1 199 ? -23.903  -32.900 -65.124  1.00 167.44 ? 206  PHE D CD2   1 
ATOM 6895  C CE1   . PHE D 1 199 ? -23.465  -33.988 -67.648  1.00 167.59 ? 206  PHE D CE1   1 
ATOM 6896  C CE2   . PHE D 1 199 ? -22.694  -32.669 -65.785  1.00 167.63 ? 206  PHE D CE2   1 
ATOM 6897  C CZ    . PHE D 1 199 ? -22.474  -33.215 -67.049  1.00 167.57 ? 206  PHE D CZ    1 
ATOM 6898  N N     . PHE D 1 200 ? -28.015  -34.865 -62.479  1.00 168.64 ? 207  PHE D N     1 
ATOM 6899  C CA    . PHE D 1 200 ? -29.393  -34.996 -62.023  1.00 169.09 ? 207  PHE D CA    1 
ATOM 6900  C C     . PHE D 1 200 ? -30.260  -33.978 -62.749  1.00 169.42 ? 207  PHE D C     1 
ATOM 6901  O O     . PHE D 1 200 ? -29.876  -32.816 -62.885  1.00 169.28 ? 207  PHE D O     1 
ATOM 6902  C CB    . PHE D 1 200 ? -29.488  -34.835 -60.500  1.00 169.09 ? 207  PHE D CB    1 
ATOM 6903  C CG    . PHE D 1 200 ? -28.700  -35.865 -59.736  1.00 169.11 ? 207  PHE D CG    1 
ATOM 6904  C CD1   . PHE D 1 200 ? -29.171  -37.174 -59.613  1.00 169.09 ? 207  PHE D CD1   1 
ATOM 6905  C CD2   . PHE D 1 200 ? -27.480  -35.531 -59.150  1.00 169.41 ? 207  PHE D CD2   1 
ATOM 6906  C CE1   . PHE D 1 200 ? -28.439  -38.138 -58.917  1.00 169.33 ? 207  PHE D CE1   1 
ATOM 6907  C CE2   . PHE D 1 200 ? -26.738  -36.482 -58.449  1.00 169.64 ? 207  PHE D CE2   1 
ATOM 6908  C CZ    . PHE D 1 200 ? -27.219  -37.791 -58.331  1.00 169.76 ? 207  PHE D CZ    1 
ATOM 6909  N N     . ILE D 1 201 ? -31.416  -34.435 -63.229  1.00 169.93 ? 208  ILE D N     1 
ATOM 6910  C CA    . ILE D 1 201 ? -32.324  -33.607 -64.027  1.00 170.45 ? 208  ILE D CA    1 
ATOM 6911  C C     . ILE D 1 201 ? -33.529  -33.125 -63.183  1.00 171.08 ? 208  ILE D C     1 
ATOM 6912  O O     . ILE D 1 201 ? -34.669  -33.555 -63.372  1.00 171.13 ? 208  ILE D O     1 
ATOM 6913  C CB    . ILE D 1 201 ? -32.711  -34.318 -65.392  1.00 170.25 ? 208  ILE D CB    1 
ATOM 6914  C CG1   . ILE D 1 201 ? -33.309  -33.332 -66.396  1.00 169.64 ? 208  ILE D CG1   1 
ATOM 6915  C CG2   . ILE D 1 201 ? -33.616  -35.527 -65.189  1.00 170.14 ? 208  ILE D CG2   1 
ATOM 6916  C CD1   . ILE D 1 201 ? -32.307  -32.766 -67.348  1.00 168.71 ? 208  ILE D CD1   1 
ATOM 6917  N N     . HIS D 1 202 ? -33.243  -32.228 -62.242  1.00 171.80 ? 209  HIS D N     1 
ATOM 6918  C CA    . HIS D 1 202 ? -34.255  -31.681 -61.338  1.00 172.62 ? 209  HIS D CA    1 
ATOM 6919  C C     . HIS D 1 202 ? -35.211  -30.746 -62.083  1.00 173.22 ? 209  HIS D C     1 
ATOM 6920  O O     . HIS D 1 202 ? -34.785  -30.035 -62.985  1.00 173.27 ? 209  HIS D O     1 
ATOM 6921  C CB    . HIS D 1 202 ? -33.583  -30.915 -60.186  1.00 172.66 ? 209  HIS D CB    1 
ATOM 6922  C CG    . HIS D 1 202 ? -32.609  -31.727 -59.378  1.00 172.50 ? 209  HIS D CG    1 
ATOM 6923  N ND1   . HIS D 1 202 ? -32.957  -32.900 -58.741  1.00 172.51 ? 209  HIS D ND1   1 
ATOM 6924  C CD2   . HIS D 1 202 ? -31.308  -31.505 -59.067  1.00 172.04 ? 209  HIS D CD2   1 
ATOM 6925  C CE1   . HIS D 1 202 ? -31.906  -33.379 -58.097  1.00 172.50 ? 209  HIS D CE1   1 
ATOM 6926  N NE2   . HIS D 1 202 ? -30.894  -32.550 -58.277  1.00 172.10 ? 209  HIS D NE2   1 
ATOM 6927  N N     . LEU D 1 203 ? -36.490  -30.744 -61.700  1.00 174.16 ? 210  LEU D N     1 
ATOM 6928  C CA    . LEU D 1 203 ? -37.512  -29.882 -62.329  1.00 175.22 ? 210  LEU D CA    1 
ATOM 6929  C C     . LEU D 1 203 ? -37.722  -28.565 -61.565  1.00 176.19 ? 210  LEU D C     1 
ATOM 6930  O O     . LEU D 1 203 ? -37.434  -28.496 -60.372  1.00 176.41 ? 210  LEU D O     1 
ATOM 6931  C CB    . LEU D 1 203 ? -38.844  -30.630 -62.444  1.00 175.03 ? 210  LEU D CB    1 
ATOM 6932  C CG    . LEU D 1 203 ? -39.849  -30.133 -63.485  1.00 174.74 ? 210  LEU D CG    1 
ATOM 6933  C CD1   . LEU D 1 203 ? -39.458  -30.636 -64.856  1.00 174.82 ? 210  LEU D CD1   1 
ATOM 6934  C CD2   . LEU D 1 203 ? -41.242  -30.599 -63.133  1.00 174.63 ? 210  LEU D CD2   1 
ATOM 6935  N N     . LEU D 1 204 ? -38.230  -27.531 -62.247  1.00 177.41 ? 211  LEU D N     1 
ATOM 6936  C CA    . LEU D 1 204 ? -38.424  -26.198 -61.635  1.00 178.59 ? 211  LEU D CA    1 
ATOM 6937  C C     . LEU D 1 204 ? -39.741  -25.497 -62.036  1.00 179.47 ? 211  LEU D C     1 
ATOM 6938  O O     . LEU D 1 204 ? -40.538  -26.035 -62.813  1.00 179.56 ? 211  LEU D O     1 
ATOM 6939  C CB    . LEU D 1 204 ? -37.221  -25.274 -61.930  1.00 178.52 ? 211  LEU D CB    1 
ATOM 6940  C CG    . LEU D 1 204 ? -35.789  -25.624 -61.486  1.00 178.68 ? 211  LEU D CG    1 
ATOM 6941  C CD1   . LEU D 1 204 ? -34.783  -24.740 -62.205  1.00 178.96 ? 211  LEU D CD1   1 
ATOM 6942  C CD2   . LEU D 1 204 ? -35.588  -25.524 -59.975  1.00 178.72 ? 211  LEU D CD2   1 
ATOM 6943  N N     . ASP D 1 205 ? -39.942  -24.290 -61.498  1.00 180.68 ? 212  ASP D N     1 
ATOM 6944  C CA    . ASP D 1 205 ? -41.131  -23.452 -61.755  1.00 181.84 ? 212  ASP D CA    1 
ATOM 6945  C C     . ASP D 1 205 ? -41.023  -22.610 -63.053  1.00 182.70 ? 212  ASP D C     1 
ATOM 6946  O O     . ASP D 1 205 ? -39.959  -22.042 -63.342  1.00 182.83 ? 212  ASP D O     1 
ATOM 6947  C CB    . ASP D 1 205 ? -41.388  -22.509 -60.559  1.00 181.72 ? 212  ASP D CB    1 
ATOM 6948  C CG    . ASP D 1 205 ? -41.698  -23.252 -59.264  1.00 181.50 ? 212  ASP D CG    1 
ATOM 6949  O OD1   . ASP D 1 205 ? -40.868  -23.203 -58.330  1.00 181.12 ? 212  ASP D OD1   1 
ATOM 6950  O OD2   . ASP D 1 205 ? -42.775  -23.874 -59.174  1.00 181.14 ? 212  ASP D OD2   1 
ATOM 6951  N N     . ASP D 1 206 ? -42.127  -22.524 -63.811  1.00 183.70 ? 213  ASP D N     1 
ATOM 6952  C CA    . ASP D 1 206 ? -42.212  -21.681 -65.028  1.00 184.61 ? 213  ASP D CA    1 
ATOM 6953  C C     . ASP D 1 206 ? -41.908  -20.196 -64.739  1.00 185.53 ? 213  ASP D C     1 
ATOM 6954  O O     . ASP D 1 206 ? -41.126  -19.568 -65.469  1.00 185.72 ? 213  ASP D O     1 
ATOM 6955  C CB    . ASP D 1 206 ? -43.572  -21.843 -65.740  1.00 184.31 ? 213  ASP D CB    1 
ATOM 6956  C CG    . ASP D 1 206 ? -43.629  -23.071 -66.668  1.00 183.89 ? 213  ASP D CG    1 
ATOM 6957  O OD1   . ASP D 1 206 ? -42.737  -23.947 -66.610  1.00 183.44 ? 213  ASP D OD1   1 
ATOM 6958  O OD2   . ASP D 1 206 ? -44.586  -23.164 -67.465  1.00 183.04 ? 213  ASP D OD2   1 
ATOM 6959  N N     . ASP D 1 207 ? -42.522  -19.650 -63.681  1.00 186.60 ? 214  ASP D N     1 
ATOM 6960  C CA    . ASP D 1 207 ? -42.201  -18.304 -63.166  1.00 187.55 ? 214  ASP D CA    1 
ATOM 6961  C C     . ASP D 1 207 ? -41.076  -18.385 -62.135  1.00 188.20 ? 214  ASP D C     1 
ATOM 6962  O O     . ASP D 1 207 ? -41.102  -19.251 -61.255  1.00 188.31 ? 214  ASP D O     1 
ATOM 6963  C CB    . ASP D 1 207 ? -43.437  -17.624 -62.562  1.00 187.53 ? 214  ASP D CB    1 
ATOM 6964  C CG    . ASP D 1 207 ? -44.220  -16.814 -63.585  1.00 187.67 ? 214  ASP D CG    1 
ATOM 6965  O OD1   . ASP D 1 207 ? -44.439  -17.314 -64.712  1.00 187.52 ? 214  ASP D OD1   1 
ATOM 6966  O OD2   . ASP D 1 207 ? -44.619  -15.675 -63.258  1.00 187.85 ? 214  ASP D OD2   1 
ATOM 6967  N N     . GLU D 1 208 ? -40.111  -17.467 -62.235  1.00 189.11 ? 215  GLU D N     1 
ATOM 6968  C CA    . GLU D 1 208 ? -38.802  -17.616 -61.568  1.00 189.92 ? 215  GLU D CA    1 
ATOM 6969  C C     . GLU D 1 208 ? -38.393  -16.514 -60.569  1.00 190.36 ? 215  GLU D C     1 
ATOM 6970  O O     . GLU D 1 208 ? -38.692  -15.329 -60.773  1.00 190.37 ? 215  GLU D O     1 
ATOM 6971  C CB    . GLU D 1 208 ? -37.695  -17.768 -62.629  1.00 190.00 ? 215  GLU D CB    1 
ATOM 6972  C CG    . GLU D 1 208 ? -37.667  -19.112 -63.376  1.00 190.24 ? 215  GLU D CG    1 
ATOM 6973  C CD    . GLU D 1 208 ? -37.009  -20.237 -62.581  1.00 190.59 ? 215  GLU D CD    1 
ATOM 6974  O OE1   . GLU D 1 208 ? -36.810  -21.324 -63.160  1.00 190.70 ? 215  GLU D OE1   1 
ATOM 6975  O OE2   . GLU D 1 208 ? -36.691  -20.043 -61.386  1.00 190.75 ? 215  GLU D OE2   1 
ATOM 6976  N N     . SER D 1 209 ? -37.709  -16.931 -59.495  1.00 190.97 ? 216  SER D N     1 
ATOM 6977  C CA    . SER D 1 209 ? -36.964  -16.020 -58.599  1.00 191.48 ? 216  SER D CA    1 
ATOM 6978  C C     . SER D 1 209 ? -35.468  -16.060 -58.967  1.00 191.79 ? 216  SER D C     1 
ATOM 6979  O O     . SER D 1 209 ? -35.131  -16.326 -60.126  1.00 191.94 ? 216  SER D O     1 
ATOM 6980  C CB    . SER D 1 209 ? -37.206  -16.348 -57.112  1.00 191.43 ? 216  SER D CB    1 
ATOM 6981  O OG    . SER D 1 209 ? -36.462  -17.474 -56.680  1.00 191.38 ? 216  SER D OG    1 
ATOM 6982  N N     . GLU D 1 210 ? -34.576  -15.808 -58.007  1.00 192.11 ? 217  GLU D N     1 
ATOM 6983  C CA    . GLU D 1 210 ? -33.128  -15.766 -58.303  1.00 192.46 ? 217  GLU D CA    1 
ATOM 6984  C C     . GLU D 1 210 ? -32.526  -17.117 -58.774  1.00 192.52 ? 217  GLU D C     1 
ATOM 6985  O O     . GLU D 1 210 ? -33.204  -18.154 -58.742  1.00 192.49 ? 217  GLU D O     1 
ATOM 6986  C CB    . GLU D 1 210 ? -32.318  -15.128 -57.150  1.00 192.51 ? 217  GLU D CB    1 
ATOM 6987  C CG    . GLU D 1 210 ? -32.334  -15.877 -55.813  1.00 193.05 ? 217  GLU D CG    1 
ATOM 6988  C CD    . GLU D 1 210 ? -33.555  -15.558 -54.953  1.00 193.88 ? 217  GLU D CD    1 
ATOM 6989  O OE1   . GLU D 1 210 ? -34.000  -14.384 -54.934  1.00 194.25 ? 217  GLU D OE1   1 
ATOM 6990  O OE2   . GLU D 1 210 ? -34.066  -16.488 -54.287  1.00 193.89 ? 217  GLU D OE2   1 
ATOM 6991  N N     . GLY D 1 211 ? -31.265  -17.081 -59.222  1.00 192.56 ? 218  GLY D N     1 
ATOM 6992  C CA    . GLY D 1 211 ? -30.570  -18.250 -59.792  1.00 192.55 ? 218  GLY D CA    1 
ATOM 6993  C C     . GLY D 1 211 ? -29.980  -19.251 -58.801  1.00 192.59 ? 218  GLY D C     1 
ATOM 6994  O O     . GLY D 1 211 ? -29.194  -20.124 -59.193  1.00 192.70 ? 218  GLY D O     1 
ATOM 6995  N N     . GLU D 1 212 ? -30.358  -19.119 -57.524  1.00 192.48 ? 219  GLU D N     1 
ATOM 6996  C CA    . GLU D 1 212 ? -30.007  -20.075 -56.452  1.00 192.16 ? 219  GLU D CA    1 
ATOM 6997  C C     . GLU D 1 212 ? -31.271  -20.597 -55.717  1.00 191.93 ? 219  GLU D C     1 
ATOM 6998  O O     . GLU D 1 212 ? -32.349  -20.671 -56.319  1.00 191.95 ? 219  GLU D O     1 
ATOM 6999  C CB    . GLU D 1 212 ? -29.004  -19.446 -55.465  1.00 192.16 ? 219  GLU D CB    1 
ATOM 7000  C CG    . GLU D 1 212 ? -27.570  -19.339 -55.983  1.00 191.71 ? 219  GLU D CG    1 
ATOM 7001  C CD    . GLU D 1 212 ? -26.779  -20.629 -55.836  1.00 191.21 ? 219  GLU D CD    1 
ATOM 7002  O OE1   . GLU D 1 212 ? -27.264  -21.702 -56.257  1.00 191.02 ? 219  GLU D OE1   1 
ATOM 7003  O OE2   . GLU D 1 212 ? -25.654  -20.560 -55.306  1.00 190.86 ? 219  GLU D OE2   1 
ATOM 7004  N N     . GLU D 1 213 ? -31.126  -20.959 -54.434  1.00 191.49 ? 220  GLU D N     1 
ATOM 7005  C CA    . GLU D 1 213 ? -32.231  -21.440 -53.555  1.00 190.92 ? 220  GLU D CA    1 
ATOM 7006  C C     . GLU D 1 213 ? -33.116  -22.523 -54.197  1.00 190.39 ? 220  GLU D C     1 
ATOM 7007  O O     . GLU D 1 213 ? -34.291  -22.688 -53.829  1.00 190.37 ? 220  GLU D O     1 
ATOM 7008  C CB    . GLU D 1 213 ? -33.100  -20.277 -53.022  1.00 190.99 ? 220  GLU D CB    1 
ATOM 7009  C CG    . GLU D 1 213 ? -32.398  -18.918 -52.831  1.00 191.33 ? 220  GLU D CG    1 
ATOM 7010  C CD    . GLU D 1 213 ? -31.117  -18.981 -52.003  1.00 191.90 ? 220  GLU D CD    1 
ATOM 7011  O OE1   . GLU D 1 213 ? -31.078  -19.698 -50.978  1.00 192.23 ? 220  GLU D OE1   1 
ATOM 7012  O OE2   . GLU D 1 213 ? -30.143  -18.295 -52.382  1.00 192.05 ? 220  GLU D OE2   1 
ATOM 7013  N N     . PHE D 1 214 ? -32.509  -23.254 -55.137  1.00 189.60 ? 221  PHE D N     1 
ATOM 7014  C CA    . PHE D 1 214 ? -33.135  -24.281 -55.988  1.00 188.82 ? 221  PHE D CA    1 
ATOM 7015  C C     . PHE D 1 214 ? -34.146  -25.218 -55.288  1.00 188.07 ? 221  PHE D C     1 
ATOM 7016  O O     . PHE D 1 214 ? -33.751  -26.190 -54.635  1.00 188.13 ? 221  PHE D O     1 
ATOM 7017  C CB    . PHE D 1 214 ? -32.036  -25.080 -56.745  1.00 188.95 ? 221  PHE D CB    1 
ATOM 7018  C CG    . PHE D 1 214 ? -30.727  -25.237 -55.970  1.00 189.42 ? 221  PHE D CG    1 
ATOM 7019  C CD1   . PHE D 1 214 ? -29.763  -24.219 -55.968  1.00 189.58 ? 221  PHE D CD1   1 
ATOM 7020  C CD2   . PHE D 1 214 ? -30.456  -26.409 -55.253  1.00 189.70 ? 221  PHE D CD2   1 
ATOM 7021  C CE1   . PHE D 1 214 ? -28.561  -24.361 -55.249  1.00 189.53 ? 221  PHE D CE1   1 
ATOM 7022  C CE2   . PHE D 1 214 ? -29.254  -26.559 -54.534  1.00 189.65 ? 221  PHE D CE2   1 
ATOM 7023  C CZ    . PHE D 1 214 ? -28.307  -25.531 -54.536  1.00 189.53 ? 221  PHE D CZ    1 
ATOM 7024  N N     . THR D 1 215 ? -35.442  -24.916 -55.426  1.00 187.02 ? 222  THR D N     1 
ATOM 7025  C CA    . THR D 1 215 ? -36.522  -25.770 -54.877  1.00 185.88 ? 222  THR D CA    1 
ATOM 7026  C C     . THR D 1 215 ? -37.171  -26.656 -55.970  1.00 184.90 ? 222  THR D C     1 
ATOM 7027  O O     . THR D 1 215 ? -37.675  -26.144 -56.980  1.00 184.87 ? 222  THR D O     1 
ATOM 7028  C CB    . THR D 1 215 ? -37.602  -24.951 -54.073  1.00 185.99 ? 222  THR D CB    1 
ATOM 7029  O OG1   . THR D 1 215 ? -38.176  -23.935 -54.908  1.00 186.30 ? 222  THR D OG1   1 
ATOM 7030  C CG2   . THR D 1 215 ? -37.002  -24.300 -52.811  1.00 185.71 ? 222  THR D CG2   1 
ATOM 7031  N N     . VAL D 1 216 ? -37.151  -27.976 -55.745  1.00 183.54 ? 223  VAL D N     1 
ATOM 7032  C CA    . VAL D 1 216 ? -37.509  -29.005 -56.756  1.00 182.13 ? 223  VAL D CA    1 
ATOM 7033  C C     . VAL D 1 216 ? -39.017  -29.343 -56.848  1.00 181.14 ? 223  VAL D C     1 
ATOM 7034  O O     . VAL D 1 216 ? -39.800  -28.958 -55.971  1.00 181.14 ? 223  VAL D O     1 
ATOM 7035  C CB    . VAL D 1 216 ? -36.675  -30.320 -56.560  1.00 182.18 ? 223  VAL D CB    1 
ATOM 7036  C CG1   . VAL D 1 216 ? -35.189  -30.083 -56.860  1.00 181.88 ? 223  VAL D CG1   1 
ATOM 7037  C CG2   . VAL D 1 216 ? -36.864  -30.893 -55.148  1.00 182.06 ? 223  VAL D CG2   1 
ATOM 7038  N N     . ARG D 1 217 ? -39.409  -30.053 -57.914  1.00 179.69 ? 224  ARG D N     1 
ATOM 7039  C CA    . ARG D 1 217 ? -40.798  -30.513 -58.103  1.00 178.20 ? 224  ARG D CA    1 
ATOM 7040  C C     . ARG D 1 217 ? -40.912  -32.000 -58.422  1.00 177.03 ? 224  ARG D C     1 
ATOM 7041  O O     . ARG D 1 217 ? -39.907  -32.685 -58.613  1.00 176.91 ? 224  ARG D O     1 
ATOM 7042  C CB    . ARG D 1 217 ? -41.511  -29.721 -59.200  1.00 178.31 ? 224  ARG D CB    1 
ATOM 7043  C CG    . ARG D 1 217 ? -42.467  -28.655 -58.701  1.00 178.46 ? 224  ARG D CG    1 
ATOM 7044  C CD    . ARG D 1 217 ? -41.959  -27.280 -59.081  1.00 179.10 ? 224  ARG D CD    1 
ATOM 7045  N NE    . ARG D 1 217 ? -42.959  -26.519 -59.832  1.00 179.43 ? 224  ARG D NE    1 
ATOM 7046  C CZ    . ARG D 1 217 ? -43.212  -26.674 -61.133  1.00 179.36 ? 224  ARG D CZ    1 
ATOM 7047  N NH1   . ARG D 1 217 ? -44.138  -25.931 -61.721  1.00 179.53 ? 224  ARG D NH1   1 
ATOM 7048  N NH2   . ARG D 1 217 ? -42.550  -27.572 -61.852  1.00 179.15 ? 224  ARG D NH2   1 
ATOM 7049  N N     . ASP D 1 218 ? -42.155  -32.476 -58.494  1.00 175.62 ? 225  ASP D N     1 
ATOM 7050  C CA    . ASP D 1 218 ? -42.462  -33.889 -58.740  1.00 174.28 ? 225  ASP D CA    1 
ATOM 7051  C C     . ASP D 1 218 ? -42.735  -34.172 -60.229  1.00 173.07 ? 225  ASP D C     1 
ATOM 7052  O O     . ASP D 1 218 ? -42.437  -33.341 -61.089  1.00 173.05 ? 225  ASP D O     1 
ATOM 7053  C CB    . ASP D 1 218 ? -43.661  -34.334 -57.875  1.00 174.40 ? 225  ASP D CB    1 
ATOM 7054  C CG    . ASP D 1 218 ? -43.329  -34.408 -56.379  1.00 174.43 ? 225  ASP D CG    1 
ATOM 7055  O OD1   . ASP D 1 218 ? -42.386  -35.142 -55.992  1.00 174.13 ? 225  ASP D OD1   1 
ATOM 7056  O OD2   . ASP D 1 218 ? -44.034  -33.739 -55.588  1.00 174.49 ? 225  ASP D OD2   1 
ATOM 7057  N N     . GLY D 1 219 ? -43.281  -35.355 -60.517  1.00 171.52 ? 226  GLY D N     1 
ATOM 7058  C CA    . GLY D 1 219 ? -43.735  -35.714 -61.857  1.00 169.55 ? 226  GLY D CA    1 
ATOM 7059  C C     . GLY D 1 219 ? -42.653  -35.918 -62.902  1.00 168.25 ? 226  GLY D C     1 
ATOM 7060  O O     . GLY D 1 219 ? -41.454  -35.749 -62.634  1.00 168.14 ? 226  GLY D O     1 
ATOM 7061  N N     . TYR D 1 220 ? -43.094  -36.286 -64.102  1.00 166.79 ? 227  TYR D N     1 
ATOM 7062  C CA    . TYR D 1 220 ? -42.203  -36.470 -65.242  1.00 165.39 ? 227  TYR D CA    1 
ATOM 7063  C C     . TYR D 1 220 ? -41.753  -35.129 -65.816  1.00 164.22 ? 227  TYR D C     1 
ATOM 7064  O O     . TYR D 1 220 ? -42.302  -34.078 -65.466  1.00 164.16 ? 227  TYR D O     1 
ATOM 7065  C CB    . TYR D 1 220 ? -42.886  -37.307 -66.331  1.00 165.61 ? 227  TYR D CB    1 
ATOM 7066  C CG    . TYR D 1 220 ? -43.055  -38.766 -65.969  1.00 166.07 ? 227  TYR D CG    1 
ATOM 7067  C CD1   . TYR D 1 220 ? -44.303  -39.264 -65.584  1.00 166.52 ? 227  TYR D CD1   1 
ATOM 7068  C CD2   . TYR D 1 220 ? -41.966  -39.650 -66.005  1.00 166.18 ? 227  TYR D CD2   1 
ATOM 7069  C CE1   . TYR D 1 220 ? -44.469  -40.606 -65.248  1.00 166.78 ? 227  TYR D CE1   1 
ATOM 7070  C CE2   . TYR D 1 220 ? -42.115  -40.993 -65.663  1.00 166.44 ? 227  TYR D CE2   1 
ATOM 7071  C CZ    . TYR D 1 220 ? -43.371  -41.466 -65.288  1.00 166.76 ? 227  TYR D CZ    1 
ATOM 7072  O OH    . TYR D 1 220 ? -43.535  -42.793 -64.953  1.00 166.89 ? 227  TYR D OH    1 
ATOM 7073  N N     . ILE D 1 221 ? -40.753  -35.176 -66.698  1.00 162.71 ? 228  ILE D N     1 
ATOM 7074  C CA    . ILE D 1 221 ? -40.252  -33.979 -67.381  1.00 161.13 ? 228  ILE D CA    1 
ATOM 7075  C C     . ILE D 1 221 ? -40.765  -33.870 -68.832  1.00 160.28 ? 228  ILE D C     1 
ATOM 7076  O O     . ILE D 1 221 ? -40.600  -34.787 -69.652  1.00 159.97 ? 228  ILE D O     1 
ATOM 7077  C CB    . ILE D 1 221 ? -38.707  -33.876 -67.328  1.00 160.95 ? 228  ILE D CB    1 
ATOM 7078  C CG1   . ILE D 1 221 ? -38.210  -34.029 -65.890  1.00 160.68 ? 228  ILE D CG1   1 
ATOM 7079  C CG2   . ILE D 1 221 ? -38.242  -32.546 -67.878  1.00 160.73 ? 228  ILE D CG2   1 
ATOM 7080  C CD1   . ILE D 1 221 ? -36.769  -33.604 -65.684  1.00 160.03 ? 228  ILE D CD1   1 
ATOM 7081  N N     . HIS D 1 222 ? -41.400  -32.735 -69.117  1.00 159.23 ? 229  HIS D N     1 
ATOM 7082  C CA    . HIS D 1 222 ? -41.937  -32.429 -70.434  1.00 158.25 ? 229  HIS D CA    1 
ATOM 7083  C C     . HIS D 1 222 ? -41.106  -31.309 -71.075  1.00 157.71 ? 229  HIS D C     1 
ATOM 7084  O O     . HIS D 1 222 ? -40.603  -30.422 -70.373  1.00 157.45 ? 229  HIS D O     1 
ATOM 7085  C CB    . HIS D 1 222 ? -43.407  -32.000 -70.321  1.00 158.25 ? 229  HIS D CB    1 
ATOM 7086  C CG    . HIS D 1 222 ? -44.292  -33.008 -69.649  1.00 157.82 ? 229  HIS D CG    1 
ATOM 7087  N ND1   . HIS D 1 222 ? -44.457  -33.062 -68.280  1.00 157.34 ? 229  HIS D ND1   1 
ATOM 7088  C CD2   . HIS D 1 222 ? -45.078  -33.984 -70.161  1.00 157.21 ? 229  HIS D CD2   1 
ATOM 7089  C CE1   . HIS D 1 222 ? -45.291  -34.043 -67.978  1.00 157.26 ? 229  HIS D CE1   1 
ATOM 7090  N NE2   . HIS D 1 222 ? -45.681  -34.619 -69.102  1.00 157.16 ? 229  HIS D NE2   1 
ATOM 7091  N N     . TYR D 1 223 ? -40.962  -31.355 -72.401  1.00 157.05 ? 230  TYR D N     1 
ATOM 7092  C CA    . TYR D 1 223 ? -40.206  -30.340 -73.141  1.00 156.37 ? 230  TYR D CA    1 
ATOM 7093  C C     . TYR D 1 223 ? -40.737  -28.952 -72.864  1.00 156.16 ? 230  TYR D C     1 
ATOM 7094  O O     . TYR D 1 223 ? -41.945  -28.730 -72.859  1.00 156.20 ? 230  TYR D O     1 
ATOM 7095  C CB    . TYR D 1 223 ? -40.291  -30.579 -74.645  1.00 156.29 ? 230  TYR D CB    1 
ATOM 7096  C CG    . TYR D 1 223 ? -39.440  -31.702 -75.171  1.00 155.72 ? 230  TYR D CG    1 
ATOM 7097  C CD1   . TYR D 1 223 ? -40.027  -32.813 -75.781  1.00 155.40 ? 230  TYR D CD1   1 
ATOM 7098  C CD2   . TYR D 1 223 ? -38.043  -31.651 -75.082  1.00 155.33 ? 230  TYR D CD2   1 
ATOM 7099  C CE1   . TYR D 1 223 ? -39.243  -33.858 -76.284  1.00 155.39 ? 230  TYR D CE1   1 
ATOM 7100  C CE2   . TYR D 1 223 ? -37.248  -32.691 -75.577  1.00 155.26 ? 230  TYR D CE2   1 
ATOM 7101  C CZ    . TYR D 1 223 ? -37.856  -33.789 -76.176  1.00 155.23 ? 230  TYR D CZ    1 
ATOM 7102  O OH    . TYR D 1 223 ? -37.078  -34.810 -76.661  1.00 154.58 ? 230  TYR D OH    1 
ATOM 7103  N N     . GLY D 1 224 ? -39.832  -28.014 -72.647  1.00 155.86 ? 231  GLY D N     1 
ATOM 7104  C CA    . GLY D 1 224 ? -40.241  -26.652 -72.402  1.00 155.76 ? 231  GLY D CA    1 
ATOM 7105  C C     . GLY D 1 224 ? -40.000  -26.273 -70.966  1.00 155.69 ? 231  GLY D C     1 
ATOM 7106  O O     . GLY D 1 224 ? -39.813  -25.100 -70.667  1.00 155.72 ? 231  GLY D O     1 
ATOM 7107  N N     . GLN D 1 225 ? -39.999  -27.259 -70.072  1.00 155.77 ? 232  GLN D N     1 
ATOM 7108  C CA    . GLN D 1 225 ? -39.747  -26.986 -68.650  1.00 156.02 ? 232  GLN D CA    1 
ATOM 7109  C C     . GLN D 1 225 ? -38.375  -26.366 -68.396  1.00 156.07 ? 232  GLN D C     1 
ATOM 7110  O O     . GLN D 1 225 ? -37.478  -26.413 -69.249  1.00 155.90 ? 232  GLN D O     1 
ATOM 7111  C CB    . GLN D 1 225 ? -39.907  -28.241 -67.775  1.00 156.02 ? 232  GLN D CB    1 
ATOM 7112  C CG    . GLN D 1 225 ? -41.085  -28.200 -66.793  1.00 156.00 ? 232  GLN D CG    1 
ATOM 7113  C CD    . GLN D 1 225 ? -42.153  -29.222 -67.128  1.00 156.26 ? 232  GLN D CD    1 
ATOM 7114  O OE1   . GLN D 1 225 ? -42.928  -29.043 -68.066  1.00 156.97 ? 232  GLN D OE1   1 
ATOM 7115  N NE2   . GLN D 1 225 ? -42.197  -30.306 -66.362  1.00 156.26 ? 232  GLN D NE2   1 
ATOM 7116  N N     . THR D 1 226 ? -38.244  -25.766 -67.217  1.00 156.32 ? 233  THR D N     1 
ATOM 7117  C CA    . THR D 1 226 ? -36.965  -25.275 -66.736  1.00 156.76 ? 233  THR D CA    1 
ATOM 7118  C C     . THR D 1 226 ? -36.349  -26.350 -65.834  1.00 157.13 ? 233  THR D C     1 
ATOM 7119  O O     . THR D 1 226 ? -37.000  -26.847 -64.906  1.00 157.20 ? 233  THR D O     1 
ATOM 7120  C CB    . THR D 1 226 ? -37.097  -23.913 -65.992  1.00 156.71 ? 233  THR D CB    1 
ATOM 7121  O OG1   . THR D 1 226 ? -37.784  -22.972 -66.829  1.00 156.77 ? 233  THR D OG1   1 
ATOM 7122  C CG2   . THR D 1 226 ? -35.712  -23.338 -65.613  1.00 156.47 ? 233  THR D CG2   1 
ATOM 7123  N N     . VAL D 1 227 ? -35.097  -26.702 -66.134  1.00 157.47 ? 234  VAL D N     1 
ATOM 7124  C CA    . VAL D 1 227 ? -34.373  -27.786 -65.469  1.00 157.65 ? 234  VAL D CA    1 
ATOM 7125  C C     . VAL D 1 227 ? -32.894  -27.444 -65.239  1.00 158.06 ? 234  VAL D C     1 
ATOM 7126  O O     . VAL D 1 227 ? -32.111  -27.308 -66.190  1.00 158.14 ? 234  VAL D O     1 
ATOM 7127  C CB    . VAL D 1 227 ? -34.472  -29.113 -66.273  1.00 157.53 ? 234  VAL D CB    1 
ATOM 7128  C CG1   . VAL D 1 227 ? -35.859  -29.741 -66.138  1.00 157.55 ? 234  VAL D CG1   1 
ATOM 7129  C CG2   . VAL D 1 227 ? -34.131  -28.885 -67.745  1.00 157.68 ? 234  VAL D CG2   1 
ATOM 7130  N N     . LYS D 1 228 ? -32.522  -27.291 -63.970  1.00 158.58 ? 235  LYS D N     1 
ATOM 7131  C CA    . LYS D 1 228 ? -31.114  -27.177 -63.582  1.00 159.12 ? 235  LYS D CA    1 
ATOM 7132  C C     . LYS D 1 228 ? -30.526  -28.598 -63.592  1.00 159.38 ? 235  LYS D C     1 
ATOM 7133  O O     . LYS D 1 228 ? -31.271  -29.574 -63.441  1.00 159.54 ? 235  LYS D O     1 
ATOM 7134  C CB    . LYS D 1 228 ? -30.999  -26.533 -62.189  1.00 159.06 ? 235  LYS D CB    1 
ATOM 7135  C CG    . LYS D 1 228 ? -29.748  -25.669 -61.962  1.00 159.50 ? 235  LYS D CG    1 
ATOM 7136  C CD    . LYS D 1 228 ? -29.813  -24.931 -60.611  1.00 160.23 ? 235  LYS D CD    1 
ATOM 7137  C CE    . LYS D 1 228 ? -28.513  -24.169 -60.281  1.00 160.55 ? 235  LYS D CE    1 
ATOM 7138  N NZ    . LYS D 1 228 ? -28.405  -22.828 -60.942  1.00 160.45 ? 235  LYS D NZ    1 
ATOM 7139  N N     . LEU D 1 229 ? -29.216  -28.728 -63.809  1.00 159.67 ? 236  LEU D N     1 
ATOM 7140  C CA    . LEU D 1 229 ? -28.546  -30.038 -63.671  1.00 159.81 ? 236  LEU D CA    1 
ATOM 7141  C C     . LEU D 1 229 ? -27.281  -29.994 -62.807  1.00 160.04 ? 236  LEU D C     1 
ATOM 7142  O O     . LEU D 1 229 ? -26.313  -29.303 -63.133  1.00 160.02 ? 236  LEU D O     1 
ATOM 7143  C CB    . LEU D 1 229 ? -28.302  -30.746 -65.025  1.00 159.64 ? 236  LEU D CB    1 
ATOM 7144  C CG    . LEU D 1 229 ? -28.514  -30.096 -66.401  1.00 159.35 ? 236  LEU D CG    1 
ATOM 7145  C CD1   . LEU D 1 229 ? -27.885  -30.951 -67.483  1.00 159.05 ? 236  LEU D CD1   1 
ATOM 7146  C CD2   . LEU D 1 229 ? -29.984  -29.896 -66.721  1.00 159.36 ? 236  LEU D CD2   1 
ATOM 7147  N N     . VAL D 1 230 ? -27.321  -30.716 -61.687  1.00 160.36 ? 237  VAL D N     1 
ATOM 7148  C CA    . VAL D 1 230 ? -26.179  -30.811 -60.776  1.00 160.70 ? 237  VAL D CA    1 
ATOM 7149  C C     . VAL D 1 230 ? -25.420  -32.116 -61.035  1.00 161.10 ? 237  VAL D C     1 
ATOM 7150  O O     . VAL D 1 230 ? -26.023  -33.196 -61.127  1.00 161.13 ? 237  VAL D O     1 
ATOM 7151  C CB    . VAL D 1 230 ? -26.603  -30.695 -59.282  1.00 160.60 ? 237  VAL D CB    1 
ATOM 7152  C CG1   . VAL D 1 230 ? -25.453  -31.087 -58.343  1.00 160.47 ? 237  VAL D CG1   1 
ATOM 7153  C CG2   . VAL D 1 230 ? -27.101  -29.283 -58.973  1.00 160.32 ? 237  VAL D CG2   1 
ATOM 7154  N N     . CYS D 1 231 ? -24.100  -31.997 -61.178  1.00 161.48 ? 238  CYS D N     1 
ATOM 7155  C CA    . CYS D 1 231 ? -23.239  -33.154 -61.370  1.00 161.76 ? 238  CYS D CA    1 
ATOM 7156  C C     . CYS D 1 231 ? -22.962  -33.783 -60.011  1.00 162.13 ? 238  CYS D C     1 
ATOM 7157  O O     . CYS D 1 231 ? -22.643  -33.088 -59.044  1.00 162.22 ? 238  CYS D O     1 
ATOM 7158  C CB    . CYS D 1 231 ? -21.929  -32.757 -62.063  1.00 161.61 ? 238  CYS D CB    1 
ATOM 7159  S SG    . CYS D 1 231 ? -21.209  -34.053 -63.114  1.00 160.97 ? 238  CYS D SG    1 
ATOM 7160  N N     . SER D 1 232 ? -23.124  -35.098 -59.935  1.00 162.56 ? 239  SER D N     1 
ATOM 7161  C CA    . SER D 1 232 ? -22.659  -35.852 -58.781  1.00 162.92 ? 239  SER D CA    1 
ATOM 7162  C C     . SER D 1 232 ? -21.128  -35.865 -58.746  1.00 163.13 ? 239  SER D C     1 
ATOM 7163  O O     . SER D 1 232 ? -20.548  -35.912 -57.663  1.00 162.97 ? 239  SER D O     1 
ATOM 7164  C CB    . SER D 1 232 ? -23.210  -37.282 -58.808  1.00 162.98 ? 239  SER D CB    1 
ATOM 7165  O OG    . SER D 1 232 ? -23.060  -37.868 -60.094  1.00 163.09 ? 239  SER D OG    1 
ATOM 7166  N N     . VAL D 1 233 ? -20.494  -35.808 -59.930  1.00 163.60 ? 240  VAL D N     1 
ATOM 7167  C CA    . VAL D 1 233 ? -19.011  -35.852 -60.076  1.00 163.91 ? 240  VAL D CA    1 
ATOM 7168  C C     . VAL D 1 233 ? -18.260  -34.658 -59.457  1.00 164.18 ? 240  VAL D C     1 
ATOM 7169  O O     . VAL D 1 233 ? -17.546  -34.846 -58.473  1.00 164.22 ? 240  VAL D O     1 
ATOM 7170  C CB    . VAL D 1 233 ? -18.471  -36.278 -61.543  1.00 163.89 ? 240  VAL D CB    1 
ATOM 7171  C CG1   . VAL D 1 233 ? -19.447  -35.977 -62.674  1.00 163.67 ? 240  VAL D CG1   1 
ATOM 7172  C CG2   . VAL D 1 233 ? -17.061  -35.735 -61.844  1.00 163.52 ? 240  VAL D CG2   1 
ATOM 7173  N N     . THR D 1 234 ? -18.411  -33.449 -60.000  1.00 164.47 ? 241  THR D N     1 
ATOM 7174  C CA    . THR D 1 234 ? -17.777  -32.278 -59.361  1.00 164.71 ? 241  THR D CA    1 
ATOM 7175  C C     . THR D 1 234 ? -18.676  -31.567 -58.322  1.00 164.62 ? 241  THR D C     1 
ATOM 7176  O O     . THR D 1 234 ? -18.180  -30.791 -57.504  1.00 164.80 ? 241  THR D O     1 
ATOM 7177  C CB    . THR D 1 234 ? -17.129  -31.247 -60.377  1.00 164.80 ? 241  THR D CB    1 
ATOM 7178  O OG1   . THR D 1 234 ? -18.113  -30.737 -61.289  1.00 165.20 ? 241  THR D OG1   1 
ATOM 7179  C CG2   . THR D 1 234 ? -15.962  -31.878 -61.150  1.00 164.69 ? 241  THR D CG2   1 
ATOM 7180  N N     . GLY D 1 235 ? -19.978  -31.850 -58.337  1.00 164.44 ? 242  GLY D N     1 
ATOM 7181  C CA    . GLY D 1 235 ? -20.926  -31.152 -57.466  1.00 164.17 ? 242  GLY D CA    1 
ATOM 7182  C C     . GLY D 1 235 ? -21.505  -29.931 -58.157  1.00 164.08 ? 242  GLY D C     1 
ATOM 7183  O O     . GLY D 1 235 ? -22.586  -29.462 -57.788  1.00 164.08 ? 242  GLY D O     1 
ATOM 7184  N N     . MET D 1 236 ? -20.781  -29.442 -59.172  1.00 163.90 ? 243  MET D N     1 
ATOM 7185  C CA    . MET D 1 236 ? -21.100  -28.214 -59.922  1.00 163.71 ? 243  MET D CA    1 
ATOM 7186  C C     . MET D 1 236 ? -22.489  -28.270 -60.583  1.00 163.32 ? 243  MET D C     1 
ATOM 7187  O O     . MET D 1 236 ? -23.057  -29.358 -60.766  1.00 163.26 ? 243  MET D O     1 
ATOM 7188  C CB    . MET D 1 236 ? -20.015  -27.914 -60.983  1.00 163.84 ? 243  MET D CB    1 
ATOM 7189  C CG    . MET D 1 236 ? -18.639  -27.455 -60.451  1.00 164.93 ? 243  MET D CG    1 
ATOM 7190  S SD    . MET D 1 236 ? -18.552  -25.733 -59.867  1.00 167.28 ? 243  MET D SD    1 
ATOM 7191  C CE    . MET D 1 236 ? -16.781  -25.490 -59.607  1.00 166.63 ? 243  MET D CE    1 
ATOM 7192  N N     . ALA D 1 237 ? -23.018  -27.088 -60.924  1.00 162.80 ? 244  ALA D N     1 
ATOM 7193  C CA    . ALA D 1 237 ? -24.328  -26.926 -61.575  1.00 162.11 ? 244  ALA D CA    1 
ATOM 7194  C C     . ALA D 1 237 ? -24.257  -25.921 -62.728  1.00 161.62 ? 244  ALA D C     1 
ATOM 7195  O O     . ALA D 1 237 ? -23.604  -24.881 -62.609  1.00 161.62 ? 244  ALA D O     1 
ATOM 7196  C CB    . ALA D 1 237 ? -25.379  -26.480 -60.553  1.00 162.13 ? 244  ALA D CB    1 
ATOM 7197  N N     . LEU D 1 238 ? -24.922  -26.242 -63.837  1.00 160.94 ? 245  LEU D N     1 
ATOM 7198  C CA    . LEU D 1 238 ? -25.079  -25.310 -64.956  1.00 160.34 ? 245  LEU D CA    1 
ATOM 7199  C C     . LEU D 1 238 ? -26.254  -24.366 -64.700  1.00 160.09 ? 245  LEU D C     1 
ATOM 7200  O O     . LEU D 1 238 ? -27.219  -24.763 -64.032  1.00 160.04 ? 245  LEU D O     1 
ATOM 7201  C CB    . LEU D 1 238 ? -25.301  -26.060 -66.271  1.00 160.19 ? 245  LEU D CB    1 
ATOM 7202  C CG    . LEU D 1 238 ? -24.075  -26.605 -67.004  1.00 159.96 ? 245  LEU D CG    1 
ATOM 7203  C CD1   . LEU D 1 238 ? -24.508  -27.436 -68.203  1.00 159.38 ? 245  LEU D CD1   1 
ATOM 7204  C CD2   . LEU D 1 238 ? -23.131  -25.481 -67.433  1.00 159.67 ? 245  LEU D CD2   1 
ATOM 7205  N N     . PRO D 1 239 ? -26.179  -23.114 -65.226  1.00 159.77 ? 246  PRO D N     1 
ATOM 7206  C CA    . PRO D 1 239 ? -27.276  -22.144 -65.083  1.00 159.46 ? 246  PRO D CA    1 
ATOM 7207  C C     . PRO D 1 239 ? -28.631  -22.744 -65.460  1.00 159.12 ? 246  PRO D C     1 
ATOM 7208  O O     . PRO D 1 239 ? -28.682  -23.796 -66.104  1.00 159.08 ? 246  PRO D O     1 
ATOM 7209  C CB    . PRO D 1 239 ? -26.888  -21.031 -66.066  1.00 159.40 ? 246  PRO D CB    1 
ATOM 7210  C CG    . PRO D 1 239 ? -25.404  -21.054 -66.065  1.00 159.52 ? 246  PRO D CG    1 
ATOM 7211  C CD    . PRO D 1 239 ? -25.025  -22.516 -65.931  1.00 159.77 ? 246  PRO D CD    1 
ATOM 7212  N N     . ARG D 1 240 ? -29.711  -22.086 -65.046  1.00 158.65 ? 247  ARG D N     1 
ATOM 7213  C CA    . ARG D 1 240 ? -31.066  -22.576 -65.312  1.00 158.19 ? 247  ARG D CA    1 
ATOM 7214  C C     . ARG D 1 240 ? -31.312  -22.716 -66.837  1.00 157.90 ? 247  ARG D C     1 
ATOM 7215  O O     . ARG D 1 240 ? -31.249  -21.725 -67.569  1.00 158.11 ? 247  ARG D O     1 
ATOM 7216  C CB    . ARG D 1 240 ? -32.095  -21.654 -64.637  1.00 158.04 ? 247  ARG D CB    1 
ATOM 7217  C CG    . ARG D 1 240 ? -31.570  -20.998 -63.360  1.00 157.68 ? 247  ARG D CG    1 
ATOM 7218  C CD    . ARG D 1 240 ? -32.685  -20.483 -62.472  1.00 157.14 ? 247  ARG D CD    1 
ATOM 7219  N NE    . ARG D 1 240 ? -33.272  -19.252 -62.984  0.50 156.43 ? 247  ARG D NE    1 
ATOM 7220  C CZ    . ARG D 1 240 ? -34.049  -18.438 -62.281  0.50 155.82 ? 247  ARG D CZ    1 
ATOM 7221  N NH1   . ARG D 1 240 ? -34.344  -18.719 -61.022  0.50 155.76 ? 247  ARG D NH1   1 
ATOM 7222  N NH2   . ARG D 1 240 ? -34.529  -17.338 -62.839  0.50 155.29 ? 247  ARG D NH2   1 
ATOM 7223  N N     . LEU D 1 241 ? -31.541  -23.945 -67.314  1.00 157.25 ? 248  LEU D N     1 
ATOM 7224  C CA    . LEU D 1 241 ? -31.736  -24.201 -68.752  1.00 156.66 ? 248  LEU D CA    1 
ATOM 7225  C C     . LEU D 1 241 ? -33.189  -24.519 -69.084  1.00 156.24 ? 248  LEU D C     1 
ATOM 7226  O O     . LEU D 1 241 ? -33.956  -24.884 -68.202  1.00 156.30 ? 248  LEU D O     1 
ATOM 7227  C CB    . LEU D 1 241 ? -30.850  -25.353 -69.246  1.00 156.76 ? 248  LEU D CB    1 
ATOM 7228  C CG    . LEU D 1 241 ? -29.317  -25.403 -69.109  1.00 157.01 ? 248  LEU D CG    1 
ATOM 7229  C CD1   . LEU D 1 241 ? -28.646  -24.049 -69.364  1.00 157.19 ? 248  LEU D CD1   1 
ATOM 7230  C CD2   . LEU D 1 241 ? -28.896  -25.992 -67.756  1.00 157.29 ? 248  LEU D CD2   1 
ATOM 7231  N N     . ILE D 1 242 ? -33.565  -24.378 -70.353  1.00 155.66 ? 249  ILE D N     1 
ATOM 7232  C CA    . ILE D 1 242 ? -34.912  -24.727 -70.793  1.00 155.11 ? 249  ILE D CA    1 
ATOM 7233  C C     . ILE D 1 242 ? -34.815  -25.754 -71.905  1.00 154.96 ? 249  ILE D C     1 
ATOM 7234  O O     . ILE D 1 242 ? -34.287  -25.471 -72.982  1.00 154.84 ? 249  ILE D O     1 
ATOM 7235  C CB    . ILE D 1 242 ? -35.732  -23.489 -71.242  1.00 155.05 ? 249  ILE D CB    1 
ATOM 7236  C CG1   . ILE D 1 242 ? -36.063  -22.602 -70.028  1.00 154.89 ? 249  ILE D CG1   1 
ATOM 7237  C CG2   . ILE D 1 242 ? -37.012  -23.930 -71.967  1.00 154.87 ? 249  ILE D CG2   1 
ATOM 7238  C CD1   . ILE D 1 242 ? -36.428  -21.143 -70.347  1.00 154.11 ? 249  ILE D CD1   1 
ATOM 7239  N N     . ILE D 1 243 ? -35.311  -26.954 -71.623  1.00 154.90 ? 250  ILE D N     1 
ATOM 7240  C CA    . ILE D 1 243 ? -35.263  -28.058 -72.586  1.00 154.84 ? 250  ILE D CA    1 
ATOM 7241  C C     . ILE D 1 243 ? -36.357  -27.933 -73.633  1.00 154.89 ? 250  ILE D C     1 
ATOM 7242  O O     . ILE D 1 243 ? -37.533  -27.757 -73.296  1.00 154.88 ? 250  ILE D O     1 
ATOM 7243  C CB    . ILE D 1 243 ? -35.390  -29.452 -71.910  1.00 154.74 ? 250  ILE D CB    1 
ATOM 7244  C CG1   . ILE D 1 243 ? -36.326  -29.381 -70.703  1.00 154.56 ? 250  ILE D CG1   1 
ATOM 7245  C CG2   . ILE D 1 243 ? -34.019  -30.008 -71.531  1.00 154.24 ? 250  ILE D CG2   1 
ATOM 7246  C CD1   . ILE D 1 243 ? -36.918  -30.700 -70.340  1.00 154.76 ? 250  ILE D CD1   1 
ATOM 7247  N N     . ARG D 1 244 ? -35.963  -28.023 -74.900  1.00 154.94 ? 251  ARG D N     1 
ATOM 7248  C CA    . ARG D 1 244 ? -36.924  -28.024 -75.994  1.00 155.18 ? 251  ARG D CA    1 
ATOM 7249  C C     . ARG D 1 244 ? -36.541  -29.092 -77.015  1.00 155.20 ? 251  ARG D C     1 
ATOM 7250  O O     . ARG D 1 244 ? -35.358  -29.426 -77.167  1.00 155.12 ? 251  ARG D O     1 
ATOM 7251  C CB    . ARG D 1 244 ? -37.037  -26.629 -76.636  1.00 155.29 ? 251  ARG D CB    1 
ATOM 7252  C CG    . ARG D 1 244 ? -36.902  -25.452 -75.642  1.00 155.80 ? 251  ARG D CG    1 
ATOM 7253  C CD    . ARG D 1 244 ? -37.535  -24.142 -76.124  1.00 156.07 ? 251  ARG D CD    1 
ATOM 7254  N NE    . ARG D 1 244 ? -36.809  -22.970 -75.615  1.00 155.83 ? 251  ARG D NE    1 
ATOM 7255  C CZ    . ARG D 1 244 ? -37.334  -21.760 -75.437  1.00 155.37 ? 251  ARG D CZ    1 
ATOM 7256  N NH1   . ARG D 1 244 ? -38.613  -21.530 -75.708  1.00 155.39 ? 251  ARG D NH1   1 
ATOM 7257  N NH2   . ARG D 1 244 ? -36.577  -20.777 -74.977  1.00 154.74 ? 251  ARG D NH2   1 
ATOM 7258  N N     . LYS D 1 245 ? -37.551  -29.627 -77.700  1.00 155.28 ? 252  LYS D N     1 
ATOM 7259  C CA    . LYS D 1 245 ? -37.358  -30.685 -78.692  1.00 155.56 ? 252  LYS D CA    1 
ATOM 7260  C C     . LYS D 1 245 ? -36.488  -30.204 -79.860  1.00 155.92 ? 252  LYS D C     1 
ATOM 7261  O O     . LYS D 1 245 ? -36.165  -29.020 -79.939  1.00 155.96 ? 252  LYS D O     1 
ATOM 7262  C CB    . LYS D 1 245 ? -38.719  -31.177 -79.191  1.00 155.36 ? 252  LYS D CB    1 
ATOM 7263  C CG    . LYS D 1 245 ? -38.691  -32.586 -79.759  1.00 155.46 ? 252  LYS D CG    1 
ATOM 7264  C CD    . LYS D 1 245 ? -40.087  -33.144 -79.977  1.00 155.82 ? 252  LYS D CD    1 
ATOM 7265  C CE    . LYS D 1 245 ? -40.019  -34.474 -80.715  1.00 156.28 ? 252  LYS D CE    1 
ATOM 7266  N NZ    . LYS D 1 245 ? -41.299  -35.219 -80.653  1.00 156.43 ? 252  LYS D NZ    1 
ATOM 7267  N N     . VAL D 1 246 ? -36.088  -31.115 -80.749  1.00 156.45 ? 253  VAL D N     1 
ATOM 7268  C CA    . VAL D 1 246 ? -35.404  -30.724 -81.996  1.00 156.92 ? 253  VAL D CA    1 
ATOM 7269  C C     . VAL D 1 246 ? -35.747  -31.622 -83.200  1.00 157.39 ? 253  VAL D C     1 
ATOM 7270  O O     . VAL D 1 246 ? -35.719  -32.854 -83.100  1.00 157.20 ? 253  VAL D O     1 
ATOM 7271  C CB    . VAL D 1 246 ? -33.847  -30.509 -81.811  1.00 156.73 ? 253  VAL D CB    1 
ATOM 7272  C CG1   . VAL D 1 246 ? -33.148  -31.776 -81.442  1.00 156.58 ? 253  VAL D CG1   1 
ATOM 7273  C CG2   . VAL D 1 246 ? -33.210  -29.929 -83.064  1.00 156.82 ? 253  VAL D CG2   1 
ATOM 7274  N N     . ASP D 1 247 ? -36.099  -30.976 -84.317  1.00 158.15 ? 254  ASP D N     1 
ATOM 7275  C CA    . ASP D 1 247 ? -36.332  -31.635 -85.613  1.00 158.80 ? 254  ASP D CA    1 
ATOM 7276  C C     . ASP D 1 247 ? -35.522  -30.938 -86.725  1.00 159.27 ? 254  ASP D C     1 
ATOM 7277  O O     . ASP D 1 247 ? -35.698  -29.736 -86.954  1.00 159.36 ? 254  ASP D O     1 
ATOM 7278  C CB    . ASP D 1 247 ? -37.829  -31.622 -85.959  1.00 158.68 ? 254  ASP D CB    1 
ATOM 7279  C CG    . ASP D 1 247 ? -38.183  -32.576 -87.093  1.00 158.49 ? 254  ASP D CG    1 
ATOM 7280  O OD1   . ASP D 1 247 ? -39.389  -32.698 -87.396  1.00 158.32 ? 254  ASP D OD1   1 
ATOM 7281  O OD2   . ASP D 1 247 ? -37.272  -33.206 -87.675  1.00 158.10 ? 254  ASP D OD2   1 
ATOM 7282  N N     . LYS D 1 248 ? -34.652  -31.700 -87.405  1.00 159.74 ? 255  LYS D N     1 
ATOM 7283  C CA    . LYS D 1 248 ? -33.707  -31.175 -88.421  1.00 160.05 ? 255  LYS D CA    1 
ATOM 7284  C C     . LYS D 1 248 ? -33.005  -29.872 -87.999  1.00 160.32 ? 255  LYS D C     1 
ATOM 7285  O O     . LYS D 1 248 ? -33.220  -28.818 -88.605  1.00 160.40 ? 255  LYS D O     1 
ATOM 7286  C CB    . LYS D 1 248 ? -34.389  -31.008 -89.789  1.00 159.96 ? 255  LYS D CB    1 
ATOM 7287  C CG    . LYS D 1 248 ? -33.949  -31.999 -90.851  1.00 159.99 ? 255  LYS D CG    1 
ATOM 7288  C CD    . LYS D 1 248 ? -34.888  -33.190 -90.967  1.00 160.08 ? 255  LYS D CD    1 
ATOM 7289  C CE    . LYS D 1 248 ? -34.425  -34.366 -90.125  1.00 159.93 ? 255  LYS D CE    1 
ATOM 7290  N NZ    . LYS D 1 248 ? -35.306  -35.546 -90.323  1.00 160.01 ? 255  LYS D NZ    1 
ATOM 7291  N N     . GLN D 1 249 ? -32.167  -29.969 -86.963  1.00 160.65 ? 256  GLN D N     1 
ATOM 7292  C CA    . GLN D 1 249 ? -31.492  -28.822 -86.306  1.00 160.97 ? 256  GLN D CA    1 
ATOM 7293  C C     . GLN D 1 249 ? -32.333  -27.538 -86.159  1.00 161.14 ? 256  GLN D C     1 
ATOM 7294  O O     . GLN D 1 249 ? -31.821  -26.428 -86.338  1.00 161.04 ? 256  GLN D O     1 
ATOM 7295  C CB    . GLN D 1 249 ? -30.084  -28.542 -86.895  1.00 160.99 ? 256  GLN D CB    1 
ATOM 7296  C CG    . GLN D 1 249 ? -30.033  -27.964 -88.319  1.00 161.24 ? 256  GLN D CG    1 
ATOM 7297  C CD    . GLN D 1 249 ? -29.806  -29.023 -89.376  1.00 161.26 ? 256  GLN D CD    1 
ATOM 7298  O OE1   . GLN D 1 249 ? -30.699  -29.329 -90.164  1.00 161.13 ? 256  GLN D OE1   1 
ATOM 7299  N NE2   . GLN D 1 249 ? -28.607  -29.594 -89.394  1.00 161.31 ? 256  GLN D NE2   1 
ATOM 7300  N N     . THR D 1 250 ? -33.622  -27.709 -85.840  1.00 161.45 ? 257  THR D N     1 
ATOM 7301  C CA    . THR D 1 250 ? -34.526  -26.594 -85.471  1.00 161.75 ? 257  THR D CA    1 
ATOM 7302  C C     . THR D 1 250 ? -35.252  -26.862 -84.136  1.00 161.69 ? 257  THR D C     1 
ATOM 7303  O O     . THR D 1 250 ? -35.999  -27.845 -84.006  1.00 161.75 ? 257  THR D O     1 
ATOM 7304  C CB    . THR D 1 250 ? -35.590  -26.261 -86.567  1.00 161.83 ? 257  THR D CB    1 
ATOM 7305  O OG1   . THR D 1 250 ? -36.499  -27.364 -86.720  1.00 161.91 ? 257  THR D OG1   1 
ATOM 7306  C CG2   . THR D 1 250 ? -34.932  -25.910 -87.915  1.00 162.07 ? 257  THR D CG2   1 
ATOM 7307  N N     . ALA D 1 251 ? -35.042  -25.968 -83.167  1.00 161.54 ? 258  ALA D N     1 
ATOM 7308  C CA    . ALA D 1 251 ? -35.525  -26.147 -81.792  1.00 161.40 ? 258  ALA D CA    1 
ATOM 7309  C C     . ALA D 1 251 ? -36.949  -25.610 -81.525  1.00 161.31 ? 258  ALA D C     1 
ATOM 7310  O O     . ALA D 1 251 ? -37.115  -24.496 -81.017  1.00 161.13 ? 258  ALA D O     1 
ATOM 7311  C CB    . ALA D 1 251 ? -34.517  -25.538 -80.809  1.00 161.36 ? 258  ALA D CB    1 
ATOM 7312  N N     . LEU D 1 252 ? -37.961  -26.421 -81.845  1.00 161.31 ? 259  LEU D N     1 
ATOM 7313  C CA    . LEU D 1 252 ? -39.373  -26.033 -81.697  1.00 161.48 ? 259  LEU D CA    1 
ATOM 7314  C C     . LEU D 1 252 ? -39.679  -25.591 -80.258  1.00 161.75 ? 259  LEU D C     1 
ATOM 7315  O O     . LEU D 1 252 ? -39.665  -26.419 -79.347  1.00 162.07 ? 259  LEU D O     1 
ATOM 7316  C CB    . LEU D 1 252 ? -40.323  -27.181 -82.106  1.00 161.27 ? 259  LEU D CB    1 
ATOM 7317  C CG    . LEU D 1 252 ? -39.895  -28.491 -82.795  1.00 160.93 ? 259  LEU D CG    1 
ATOM 7318  C CD1   . LEU D 1 252 ? -41.102  -29.400 -82.910  1.00 160.90 ? 259  LEU D CD1   1 
ATOM 7319  C CD2   . LEU D 1 252 ? -39.245  -28.317 -84.167  1.00 160.54 ? 259  LEU D CD2   1 
ATOM 7320  N N     . LEU D 1 253 ? -39.953  -24.298 -80.057  1.00 161.91 ? 260  LEU D N     1 
ATOM 7321  C CA    . LEU D 1 253 ? -40.179  -23.744 -78.706  1.00 161.98 ? 260  LEU D CA    1 
ATOM 7322  C C     . LEU D 1 253 ? -41.426  -24.279 -78.001  1.00 162.02 ? 260  LEU D C     1 
ATOM 7323  O O     . LEU D 1 253 ? -41.448  -24.364 -76.771  1.00 162.00 ? 260  LEU D O     1 
ATOM 7324  C CB    . LEU D 1 253 ? -40.241  -22.206 -78.711  1.00 162.07 ? 260  LEU D CB    1 
ATOM 7325  C CG    . LEU D 1 253 ? -39.145  -21.286 -79.271  1.00 162.24 ? 260  LEU D CG    1 
ATOM 7326  C CD1   . LEU D 1 253 ? -39.307  -19.877 -78.718  1.00 162.18 ? 260  LEU D CD1   1 
ATOM 7327  C CD2   . LEU D 1 253 ? -37.744  -21.790 -78.994  1.00 162.73 ? 260  LEU D CD2   1 
ATOM 7328  N N     . ASP D 1 254 ? -42.454  -24.629 -78.778  1.00 162.08 ? 261  ASP D N     1 
ATOM 7329  C CA    . ASP D 1 254 ? -43.728  -25.109 -78.234  1.00 162.20 ? 261  ASP D CA    1 
ATOM 7330  C C     . ASP D 1 254 ? -43.891  -26.620 -78.357  1.00 162.13 ? 261  ASP D C     1 
ATOM 7331  O O     . ASP D 1 254 ? -44.772  -27.107 -79.073  1.00 162.20 ? 261  ASP D O     1 
ATOM 7332  C CB    . ASP D 1 254 ? -44.910  -24.397 -78.898  1.00 162.34 ? 261  ASP D CB    1 
ATOM 7333  C CG    . ASP D 1 254 ? -44.914  -22.904 -78.637  1.00 162.99 ? 261  ASP D CG    1 
ATOM 7334  O OD1   . ASP D 1 254 ? -45.207  -22.129 -79.581  1.00 163.80 ? 261  ASP D OD1   1 
ATOM 7335  O OD2   . ASP D 1 254 ? -44.620  -22.504 -77.487  1.00 163.53 ? 261  ASP D OD2   1 
ATOM 7336  N N     . ALA D 1 255 ? -43.027  -27.354 -77.659  1.00 162.00 ? 262  ALA D N     1 
ATOM 7337  C CA    . ALA D 1 255 ? -43.165  -28.801 -77.526  1.00 161.74 ? 262  ALA D CA    1 
ATOM 7338  C C     . ALA D 1 255 ? -43.744  -29.115 -76.141  1.00 161.58 ? 262  ALA D C     1 
ATOM 7339  O O     . ALA D 1 255 ? -43.078  -28.930 -75.117  1.00 161.57 ? 262  ALA D O     1 
ATOM 7340  C CB    . ALA D 1 255 ? -41.822  -29.494 -77.745  1.00 161.73 ? 262  ALA D CB    1 
ATOM 7341  N N     . ASP D 1 256 ? -44.998  -29.562 -76.123  1.00 161.25 ? 263  ASP D N     1 
ATOM 7342  C CA    . ASP D 1 256 ? -45.732  -29.804 -74.879  1.00 160.77 ? 263  ASP D CA    1 
ATOM 7343  C C     . ASP D 1 256 ? -45.731  -31.280 -74.451  1.00 160.22 ? 263  ASP D C     1 
ATOM 7344  O O     . ASP D 1 256 ? -46.342  -31.628 -73.443  1.00 160.23 ? 263  ASP D O     1 
ATOM 7345  C CB    . ASP D 1 256 ? -47.169  -29.267 -74.996  1.00 160.92 ? 263  ASP D CB    1 
ATOM 7346  C CG    . ASP D 1 256 ? -47.915  -29.827 -76.215  1.00 161.30 ? 263  ASP D CG    1 
ATOM 7347  O OD1   . ASP D 1 256 ? -48.098  -31.066 -76.306  1.00 161.83 ? 263  ASP D OD1   1 
ATOM 7348  O OD2   . ASP D 1 256 ? -48.326  -29.020 -77.081  1.00 160.96 ? 263  ASP D OD2   1 
ATOM 7349  N N     . ASP D 1 257 ? -45.052  -32.136 -75.220  1.00 159.43 ? 264  ASP D N     1 
ATOM 7350  C CA    . ASP D 1 257 ? -44.943  -33.572 -74.910  1.00 158.58 ? 264  ASP D CA    1 
ATOM 7351  C C     . ASP D 1 257 ? -43.783  -33.874 -73.940  1.00 157.93 ? 264  ASP D C     1 
ATOM 7352  O O     . ASP D 1 257 ? -42.884  -33.036 -73.780  1.00 157.87 ? 264  ASP D O     1 
ATOM 7353  C CB    . ASP D 1 257 ? -44.828  -34.416 -76.192  1.00 158.56 ? 264  ASP D CB    1 
ATOM 7354  C CG    . ASP D 1 257 ? -43.840  -33.843 -77.190  1.00 158.39 ? 264  ASP D CG    1 
ATOM 7355  O OD1   . ASP D 1 257 ? -44.142  -32.775 -77.764  1.00 159.11 ? 264  ASP D OD1   1 
ATOM 7356  O OD2   . ASP D 1 257 ? -42.778  -34.462 -77.418  1.00 157.29 ? 264  ASP D OD2   1 
ATOM 7357  N N     . PRO D 1 258 ? -43.809  -35.061 -73.280  1.00 157.13 ? 265  PRO D N     1 
ATOM 7358  C CA    . PRO D 1 258 ? -42.803  -35.437 -72.277  1.00 156.32 ? 265  PRO D CA    1 
ATOM 7359  C C     . PRO D 1 258 ? -41.563  -36.065 -72.888  1.00 155.41 ? 265  PRO D C     1 
ATOM 7360  O O     . PRO D 1 258 ? -41.674  -36.880 -73.810  1.00 155.31 ? 265  PRO D O     1 
ATOM 7361  C CB    . PRO D 1 258 ? -43.530  -36.474 -71.403  1.00 156.48 ? 265  PRO D CB    1 
ATOM 7362  C CG    . PRO D 1 258 ? -44.898  -36.676 -72.031  1.00 156.85 ? 265  PRO D CG    1 
ATOM 7363  C CD    . PRO D 1 258 ? -44.839  -36.105 -73.409  1.00 157.10 ? 265  PRO D CD    1 
ATOM 7364  N N     . VAL D 1 259 ? -40.400  -35.688 -72.358  1.00 154.33 ? 266  VAL D N     1 
ATOM 7365  C CA    . VAL D 1 259 ? -39.105  -36.163 -72.843  1.00 153.29 ? 266  VAL D CA    1 
ATOM 7366  C C     . VAL D 1 259 ? -39.035  -37.689 -72.802  1.00 152.99 ? 266  VAL D C     1 
ATOM 7367  O O     . VAL D 1 259 ? -39.001  -38.274 -71.718  1.00 153.13 ? 266  VAL D O     1 
ATOM 7368  C CB    . VAL D 1 259 ? -37.938  -35.596 -71.988  1.00 153.08 ? 266  VAL D CB    1 
ATOM 7369  C CG1   . VAL D 1 259 ? -36.596  -36.008 -72.566  1.00 152.60 ? 266  VAL D CG1   1 
ATOM 7370  C CG2   . VAL D 1 259 ? -38.026  -34.088 -71.876  1.00 152.51 ? 266  VAL D CG2   1 
ATOM 7371  N N     . SER D 1 260 ? -39.029  -38.329 -73.973  1.00 152.41 ? 267  SER D N     1 
ATOM 7372  C CA    . SER D 1 260 ? -38.834  -39.782 -74.049  1.00 151.85 ? 267  SER D CA    1 
ATOM 7373  C C     . SER D 1 260 ? -37.340  -40.135 -74.145  1.00 151.61 ? 267  SER D C     1 
ATOM 7374  O O     . SER D 1 260 ? -36.491  -39.250 -74.264  1.00 151.64 ? 267  SER D O     1 
ATOM 7375  C CB    . SER D 1 260 ? -39.643  -40.393 -75.197  1.00 151.84 ? 267  SER D CB    1 
ATOM 7376  O OG    . SER D 1 260 ? -39.458  -41.801 -75.288  1.00 151.53 ? 267  SER D OG    1 
ATOM 7377  N N     . GLN D 1 261 ? -37.024  -41.425 -74.085  1.00 151.29 ? 268  GLN D N     1 
ATOM 7378  C CA    . GLN D 1 261 ? -35.642  -41.875 -73.938  1.00 150.98 ? 268  GLN D CA    1 
ATOM 7379  C C     . GLN D 1 261 ? -34.907  -41.859 -75.275  1.00 151.12 ? 268  GLN D C     1 
ATOM 7380  O O     . GLN D 1 261 ? -35.462  -42.274 -76.300  1.00 151.01 ? 268  GLN D O     1 
ATOM 7381  C CB    . GLN D 1 261 ? -35.610  -43.273 -73.301  1.00 150.87 ? 268  GLN D CB    1 
ATOM 7382  C CG    . GLN D 1 261 ? -34.304  -43.646 -72.601  1.00 149.74 ? 268  GLN D CG    1 
ATOM 7383  C CD    . GLN D 1 261 ? -34.167  -43.126 -71.168  1.00 148.43 ? 268  GLN D CD    1 
ATOM 7384  O OE1   . GLN D 1 261 ? -33.094  -43.219 -70.581  1.00 147.78 ? 268  GLN D OE1   1 
ATOM 7385  N NE2   . GLN D 1 261 ? -35.241  -42.589 -70.607  1.00 148.34 ? 268  GLN D NE2   1 
ATOM 7386  N N     . LEU D 1 262 ? -33.656  -41.388 -75.235  1.00 151.41 ? 269  LEU D N     1 
ATOM 7387  C CA    . LEU D 1 262 ? -32.794  -41.174 -76.416  1.00 151.79 ? 269  LEU D CA    1 
ATOM 7388  C C     . LEU D 1 262 ? -33.386  -40.159 -77.410  1.00 152.37 ? 269  LEU D C     1 
ATOM 7389  O O     . LEU D 1 262 ? -33.560  -40.455 -78.599  1.00 152.56 ? 269  LEU D O     1 
ATOM 7390  C CB    . LEU D 1 262 ? -32.428  -42.490 -77.124  1.00 151.51 ? 269  LEU D CB    1 
ATOM 7391  C CG    . LEU D 1 262 ? -31.273  -43.374 -76.649  1.00 150.85 ? 269  LEU D CG    1 
ATOM 7392  C CD1   . LEU D 1 262 ? -31.058  -44.500 -77.665  1.00 150.51 ? 269  LEU D CD1   1 
ATOM 7393  C CD2   . LEU D 1 262 ? -29.994  -42.593 -76.442  1.00 150.13 ? 269  LEU D CD2   1 
ATOM 7394  N N     . HIS D 1 263 ? -33.680  -38.963 -76.908  1.00 152.88 ? 270  HIS D N     1 
ATOM 7395  C CA    . HIS D 1 263 ? -34.306  -37.908 -77.698  1.00 153.39 ? 270  HIS D CA    1 
ATOM 7396  C C     . HIS D 1 263 ? -33.357  -36.726 -77.920  1.00 153.90 ? 270  HIS D C     1 
ATOM 7397  O O     . HIS D 1 263 ? -32.632  -36.325 -77.010  1.00 154.12 ? 270  HIS D O     1 
ATOM 7398  C CB    . HIS D 1 263 ? -35.578  -37.436 -76.995  1.00 153.29 ? 270  HIS D CB    1 
ATOM 7399  C CG    . HIS D 1 263 ? -36.832  -38.077 -77.506  1.00 153.27 ? 270  HIS D CG    1 
ATOM 7400  N ND1   . HIS D 1 263 ? -38.080  -37.520 -77.314  1.00 153.19 ? 270  HIS D ND1   1 
ATOM 7401  C CD2   . HIS D 1 263 ? -37.033  -39.215 -78.217  1.00 153.23 ? 270  HIS D CD2   1 
ATOM 7402  C CE1   . HIS D 1 263 ? -38.995  -38.290 -77.878  1.00 153.25 ? 270  HIS D CE1   1 
ATOM 7403  N NE2   . HIS D 1 263 ? -38.386  -39.324 -78.433  1.00 153.30 ? 270  HIS D NE2   1 
ATOM 7404  N N     . LYS D 1 264 ? -33.359  -36.175 -79.130  1.00 154.40 ? 271  LYS D N     1 
ATOM 7405  C CA    . LYS D 1 264 ? -32.544  -35.003 -79.435  1.00 154.83 ? 271  LYS D CA    1 
ATOM 7406  C C     . LYS D 1 264 ? -33.222  -33.772 -78.835  1.00 155.11 ? 271  LYS D C     1 
ATOM 7407  O O     . LYS D 1 264 ? -34.447  -33.705 -78.786  1.00 155.04 ? 271  LYS D O     1 
ATOM 7408  C CB    . LYS D 1 264 ? -32.367  -34.853 -80.951  1.00 154.93 ? 271  LYS D CB    1 
ATOM 7409  C CG    . LYS D 1 264 ? -32.081  -36.154 -81.718  1.00 155.40 ? 271  LYS D CG    1 
ATOM 7410  C CD    . LYS D 1 264 ? -30.592  -36.473 -81.766  1.00 156.37 ? 271  LYS D CD    1 
ATOM 7411  C CE    . LYS D 1 264 ? -30.342  -37.812 -82.444  1.00 156.72 ? 271  LYS D CE    1 
ATOM 7412  N NZ    . LYS D 1 264 ? -28.899  -38.017 -82.741  1.00 157.08 ? 271  LYS D NZ    1 
ATOM 7413  N N     . CYS D 1 265 ? -32.433  -32.806 -78.371  1.00 155.83 ? 272  CYS D N     1 
ATOM 7414  C CA    . CYS D 1 265 ? -32.978  -31.580 -77.765  1.00 156.63 ? 272  CYS D CA    1 
ATOM 7415  C C     . CYS D 1 265 ? -31.972  -30.422 -77.724  1.00 157.05 ? 272  CYS D C     1 
ATOM 7416  O O     . CYS D 1 265 ? -30.861  -30.527 -78.253  1.00 157.10 ? 272  CYS D O     1 
ATOM 7417  C CB    . CYS D 1 265 ? -33.451  -31.871 -76.344  1.00 156.66 ? 272  CYS D CB    1 
ATOM 7418  S SG    . CYS D 1 265 ? -32.088  -31.988 -75.186  1.00 157.47 ? 272  CYS D SG    1 
ATOM 7419  N N     . ALA D 1 266 ? -32.362  -29.325 -77.076  1.00 157.73 ? 273  ALA D N     1 
ATOM 7420  C CA    . ALA D 1 266 ? -31.477  -28.169 -76.905  1.00 158.58 ? 273  ALA D CA    1 
ATOM 7421  C C     . ALA D 1 266 ? -31.804  -27.369 -75.645  1.00 159.23 ? 273  ALA D C     1 
ATOM 7422  O O     . ALA D 1 266 ? -32.960  -27.332 -75.211  1.00 159.15 ? 273  ALA D O     1 
ATOM 7423  C CB    . ALA D 1 266 ? -31.530  -27.275 -78.129  1.00 158.53 ? 273  ALA D CB    1 
ATOM 7424  N N     . PHE D 1 267 ? -30.781  -26.722 -75.079  1.00 160.17 ? 274  PHE D N     1 
ATOM 7425  C CA    . PHE D 1 267 ? -30.889  -26.024 -73.786  1.00 161.21 ? 274  PHE D CA    1 
ATOM 7426  C C     . PHE D 1 267 ? -30.762  -24.502 -73.891  1.00 162.05 ? 274  PHE D C     1 
ATOM 7427  O O     . PHE D 1 267 ? -29.656  -23.961 -73.987  1.00 162.14 ? 274  PHE D O     1 
ATOM 7428  C CB    . PHE D 1 267 ? -29.834  -26.533 -72.799  1.00 161.03 ? 274  PHE D CB    1 
ATOM 7429  C CG    . PHE D 1 267 ? -30.048  -27.943 -72.342  1.00 161.11 ? 274  PHE D CG    1 
ATOM 7430  C CD1   . PHE D 1 267 ? -30.458  -28.207 -71.041  1.00 161.27 ? 274  PHE D CD1   1 
ATOM 7431  C CD2   . PHE D 1 267 ? -29.821  -29.015 -73.205  1.00 161.20 ? 274  PHE D CD2   1 
ATOM 7432  C CE1   . PHE D 1 267 ? -30.647  -29.521 -70.599  1.00 161.31 ? 274  PHE D CE1   1 
ATOM 7433  C CE2   . PHE D 1 267 ? -30.015  -30.331 -72.779  1.00 161.01 ? 274  PHE D CE2   1 
ATOM 7434  C CZ    . PHE D 1 267 ? -30.430  -30.584 -71.470  1.00 161.02 ? 274  PHE D CZ    1 
ATOM 7435  N N     . TYR D 1 268 ? -31.904  -23.819 -73.854  1.00 163.17 ? 275  TYR D N     1 
ATOM 7436  C CA    . TYR D 1 268 ? -31.944  -22.357 -73.816  1.00 164.11 ? 275  TYR D CA    1 
ATOM 7437  C C     . TYR D 1 268 ? -31.527  -21.900 -72.426  1.00 164.79 ? 275  TYR D C     1 
ATOM 7438  O O     . TYR D 1 268 ? -32.227  -22.176 -71.450  1.00 164.96 ? 275  TYR D O     1 
ATOM 7439  C CB    . TYR D 1 268 ? -33.360  -21.852 -74.159  1.00 164.07 ? 275  TYR D CB    1 
ATOM 7440  C CG    . TYR D 1 268 ? -33.597  -20.356 -73.988  1.00 164.19 ? 275  TYR D CG    1 
ATOM 7441  C CD1   . TYR D 1 268 ? -33.233  -19.446 -74.989  1.00 164.56 ? 275  TYR D CD1   1 
ATOM 7442  C CD2   . TYR D 1 268 ? -34.212  -19.856 -72.836  1.00 164.06 ? 275  TYR D CD2   1 
ATOM 7443  C CE1   . TYR D 1 268 ? -33.461  -18.073 -74.839  1.00 164.39 ? 275  TYR D CE1   1 
ATOM 7444  C CE2   . TYR D 1 268 ? -34.445  -18.488 -72.676  1.00 164.18 ? 275  TYR D CE2   1 
ATOM 7445  C CZ    . TYR D 1 268 ? -34.067  -17.604 -73.677  1.00 164.28 ? 275  TYR D CZ    1 
ATOM 7446  O OH    . TYR D 1 268 ? -34.301  -16.259 -73.503  1.00 164.07 ? 275  TYR D OH    1 
ATOM 7447  N N     . LEU D 1 269 ? -30.376  -21.236 -72.336  1.00 165.62 ? 276  LEU D N     1 
ATOM 7448  C CA    . LEU D 1 269 ? -30.002  -20.523 -71.116  1.00 166.52 ? 276  LEU D CA    1 
ATOM 7449  C C     . LEU D 1 269 ? -31.072  -19.458 -70.868  1.00 167.35 ? 276  LEU D C     1 
ATOM 7450  O O     . LEU D 1 269 ? -31.311  -18.609 -71.731  1.00 167.50 ? 276  LEU D O     1 
ATOM 7451  C CB    . LEU D 1 269 ? -28.634  -19.845 -71.273  1.00 166.40 ? 276  LEU D CB    1 
ATOM 7452  C CG    . LEU D 1 269 ? -27.261  -20.540 -71.211  1.00 166.11 ? 276  LEU D CG    1 
ATOM 7453  C CD1   . LEU D 1 269 ? -26.812  -20.762 -69.773  1.00 166.11 ? 276  LEU D CD1   1 
ATOM 7454  C CD2   . LEU D 1 269 ? -27.184  -21.832 -72.021  1.00 165.66 ? 276  LEU D CD2   1 
ATOM 7455  N N     . LYS D 1 270 ? -31.737  -19.528 -69.713  1.00 168.46 ? 277  LYS D N     1 
ATOM 7456  C CA    . LYS D 1 270 ? -32.775  -18.553 -69.340  1.00 169.59 ? 277  LYS D CA    1 
ATOM 7457  C C     . LYS D 1 270 ? -32.201  -17.140 -69.329  1.00 170.19 ? 277  LYS D C     1 
ATOM 7458  O O     . LYS D 1 270 ? -31.079  -16.919 -68.846  1.00 170.31 ? 277  LYS D O     1 
ATOM 7459  C CB    . LYS D 1 270 ? -33.384  -18.855 -67.955  1.00 169.67 ? 277  LYS D CB    1 
ATOM 7460  C CG    . LYS D 1 270 ? -32.367  -18.768 -66.792  1.00 170.54 ? 277  LYS D CG    1 
ATOM 7461  C CD    . LYS D 1 270 ? -32.737  -17.741 -65.720  1.00 171.34 ? 277  LYS D CD    1 
ATOM 7462  C CE    . LYS D 1 270 ? -31.513  -17.386 -64.854  1.00 171.50 ? 277  LYS D CE    1 
ATOM 7463  N NZ    . LYS D 1 270 ? -31.840  -16.575 -63.636  1.00 171.43 ? 277  LYS D NZ    1 
ATOM 7464  N N     . ASP D 1 271 ? -32.970  -16.198 -69.872  1.00 170.91 ? 278  ASP D N     1 
ATOM 7465  C CA    . ASP D 1 271 ? -32.670  -14.768 -69.758  1.00 171.65 ? 278  ASP D CA    1 
ATOM 7466  C C     . ASP D 1 271 ? -31.241  -14.397 -70.229  1.00 172.17 ? 278  ASP D C     1 
ATOM 7467  O O     . ASP D 1 271 ? -30.515  -13.698 -69.511  1.00 172.20 ? 278  ASP D O     1 
ATOM 7468  C CB    . ASP D 1 271 ? -32.912  -14.275 -68.303  1.00 171.65 ? 278  ASP D CB    1 
ATOM 7469  C CG    . ASP D 1 271 ? -34.286  -14.701 -67.722  1.00 171.75 ? 278  ASP D CG    1 
ATOM 7470  O OD1   . ASP D 1 271 ? -34.486  -14.555 -66.489  1.00 170.99 ? 278  ASP D OD1   1 
ATOM 7471  O OD2   . ASP D 1 271 ? -35.165  -15.174 -68.480  1.00 172.03 ? 278  ASP D OD2   1 
ATOM 7472  N N     . THR D 1 272 ? -30.846  -14.874 -71.419  1.00 172.87 ? 279  THR D N     1 
ATOM 7473  C CA    . THR D 1 272 ? -29.520  -14.563 -72.030  1.00 173.50 ? 279  THR D CA    1 
ATOM 7474  C C     . THR D 1 272 ? -29.594  -14.145 -73.521  1.00 173.98 ? 279  THR D C     1 
ATOM 7475  O O     . THR D 1 272 ? -28.644  -14.367 -74.293  1.00 174.16 ? 279  THR D O     1 
ATOM 7476  C CB    . THR D 1 272 ? -28.496  -15.745 -71.903  1.00 173.47 ? 279  THR D CB    1 
ATOM 7477  O OG1   . THR D 1 272 ? -29.106  -16.969 -72.336  1.00 173.43 ? 279  THR D OG1   1 
ATOM 7478  C CG2   . THR D 1 272 ? -27.959  -15.892 -70.474  1.00 173.34 ? 279  THR D CG2   1 
ATOM 7479  N N     . GLU D 1 273 ? -30.709  -13.512 -73.897  1.00 174.42 ? 280  GLU D N     1 
ATOM 7480  C CA    . GLU D 1 273 ? -31.092  -13.243 -75.297  1.00 174.67 ? 280  GLU D CA    1 
ATOM 7481  C C     . GLU D 1 273 ? -31.670  -14.528 -75.912  1.00 174.92 ? 280  GLU D C     1 
ATOM 7482  O O     . GLU D 1 273 ? -32.565  -15.154 -75.328  1.00 174.93 ? 280  GLU D O     1 
ATOM 7483  C CB    . GLU D 1 273 ? -29.941  -12.631 -76.137  1.00 174.63 ? 280  GLU D CB    1 
ATOM 7484  C CG    . GLU D 1 273 ? -29.394  -11.266 -75.633  1.00 174.34 ? 280  GLU D CG    1 
ATOM 7485  C CD    . GLU D 1 273 ? -30.229  -10.043 -76.051  1.00 173.74 ? 280  GLU D CD    1 
ATOM 7486  O OE1   . GLU D 1 273 ? -29.646  -8.945  -76.172  1.00 173.15 ? 280  GLU D OE1   1 
ATOM 7487  O OE2   . GLU D 1 273 ? -31.457  -10.162 -76.252  1.00 173.24 ? 280  GLU D OE2   1 
ATOM 7488  N N     . ARG D 1 274 ? -31.164  -14.928 -77.072  1.00 175.18 ? 281  ARG D N     1 
ATOM 7489  C CA    . ARG D 1 274 ? -31.668  -16.127 -77.724  1.00 175.51 ? 281  ARG D CA    1 
ATOM 7490  C C     . ARG D 1 274 ? -30.600  -17.212 -77.697  1.00 175.55 ? 281  ARG D C     1 
ATOM 7491  O O     . ARG D 1 274 ? -30.673  -18.193 -78.444  1.00 175.61 ? 281  ARG D O     1 
ATOM 7492  C CB    . ARG D 1 274 ? -32.122  -15.807 -79.150  1.00 175.58 ? 281  ARG D CB    1 
ATOM 7493  C CG    . ARG D 1 274 ? -33.406  -16.501 -79.545  1.00 176.06 ? 281  ARG D CG    1 
ATOM 7494  C CD    . ARG D 1 274 ? -34.345  -15.568 -80.292  1.00 177.24 ? 281  ARG D CD    1 
ATOM 7495  N NE    . ARG D 1 274 ? -33.644  -14.712 -81.247  1.00 178.30 ? 281  ARG D NE    1 
ATOM 7496  C CZ    . ARG D 1 274 ? -33.449  -14.997 -82.535  1.00 179.41 ? 281  ARG D CZ    1 
ATOM 7497  N NH1   . ARG D 1 274 ? -33.897  -16.129 -83.068  1.00 179.63 ? 281  ARG D NH1   1 
ATOM 7498  N NH2   . ARG D 1 274 ? -32.798  -14.133 -83.302  1.00 179.93 ? 281  ARG D NH2   1 
ATOM 7499  N N     . MET D 1 275 ? -29.619  -17.020 -76.814  1.00 175.61 ? 282  MET D N     1 
ATOM 7500  C CA    . MET D 1 275 ? -28.504  -17.950 -76.633  1.00 175.76 ? 282  MET D CA    1 
ATOM 7501  C C     . MET D 1 275 ? -28.953  -19.326 -76.097  1.00 175.78 ? 282  MET D C     1 
ATOM 7502  O O     . MET D 1 275 ? -29.919  -19.422 -75.328  1.00 175.88 ? 282  MET D O     1 
ATOM 7503  C CB    . MET D 1 275 ? -27.439  -17.338 -75.710  1.00 175.79 ? 282  MET D CB    1 
ATOM 7504  C CG    . MET D 1 275 ? -26.605  -16.200 -76.322  1.00 176.50 ? 282  MET D CG    1 
ATOM 7505  S SD    . MET D 1 275 ? -25.223  -16.743 -77.373  1.00 178.34 ? 282  MET D SD    1 
ATOM 7506  C CE    . MET D 1 275 ? -24.070  -15.364 -77.242  1.00 177.66 ? 282  MET D CE    1 
ATOM 7507  N N     . TYR D 1 276 ? -28.245  -20.374 -76.532  1.00 175.71 ? 283  TYR D N     1 
ATOM 7508  C CA    . TYR D 1 276 ? -28.458  -21.781 -76.129  1.00 175.46 ? 283  TYR D CA    1 
ATOM 7509  C C     . TYR D 1 276 ? -27.119  -22.362 -75.643  1.00 175.58 ? 283  TYR D C     1 
ATOM 7510  O O     . TYR D 1 276 ? -26.114  -21.655 -75.638  1.00 175.58 ? 283  TYR D O     1 
ATOM 7511  C CB    . TYR D 1 276 ? -28.976  -22.599 -77.324  1.00 175.27 ? 283  TYR D CB    1 
ATOM 7512  C CG    . TYR D 1 276 ? -30.480  -22.612 -77.501  1.00 174.61 ? 283  TYR D CG    1 
ATOM 7513  C CD1   . TYR D 1 276 ? -31.203  -21.428 -77.624  1.00 174.23 ? 283  TYR D CD1   1 
ATOM 7514  C CD2   . TYR D 1 276 ? -31.176  -23.815 -77.568  1.00 174.18 ? 283  TYR D CD2   1 
ATOM 7515  C CE1   . TYR D 1 276 ? -32.582  -21.444 -77.786  1.00 174.10 ? 283  TYR D CE1   1 
ATOM 7516  C CE2   . TYR D 1 276 ? -32.554  -23.843 -77.735  1.00 173.83 ? 283  TYR D CE2   1 
ATOM 7517  C CZ    . TYR D 1 276 ? -33.249  -22.656 -77.842  1.00 173.85 ? 283  TYR D CZ    1 
ATOM 7518  O OH    . TYR D 1 276 ? -34.612  -22.682 -78.009  1.00 173.66 ? 283  TYR D OH    1 
ATOM 7519  N N     . LEU D 1 277 ? -27.089  -23.632 -75.233  1.00 175.68 ? 284  LEU D N     1 
ATOM 7520  C CA    . LEU D 1 277 ? -25.807  -24.281 -74.915  1.00 175.74 ? 284  LEU D CA    1 
ATOM 7521  C C     . LEU D 1 277 ? -25.380  -25.181 -76.075  1.00 176.05 ? 284  LEU D C     1 
ATOM 7522  O O     . LEU D 1 277 ? -26.177  -25.988 -76.575  1.00 175.96 ? 284  LEU D O     1 
ATOM 7523  C CB    . LEU D 1 277 ? -25.858  -25.033 -73.575  1.00 175.58 ? 284  LEU D CB    1 
ATOM 7524  C CG    . LEU D 1 277 ? -25.725  -26.553 -73.439  1.00 175.36 ? 284  LEU D CG    1 
ATOM 7525  C CD1   . LEU D 1 277 ? -24.275  -26.989 -73.570  1.00 175.14 ? 284  LEU D CD1   1 
ATOM 7526  C CD2   . LEU D 1 277 ? -26.268  -27.001 -72.099  1.00 175.43 ? 284  LEU D CD2   1 
ATOM 7527  N N     . CYS D 1 278 ? -24.122  -25.031 -76.493  1.00 176.45 ? 285  CYS D N     1 
ATOM 7528  C CA    . CYS D 1 278 ? -23.643  -25.628 -77.741  1.00 176.87 ? 285  CYS D CA    1 
ATOM 7529  C C     . CYS D 1 278 ? -22.266  -26.282 -77.653  1.00 177.29 ? 285  CYS D C     1 
ATOM 7530  O O     . CYS D 1 278 ? -21.384  -25.816 -76.926  1.00 177.24 ? 285  CYS D O     1 
ATOM 7531  C CB    . CYS D 1 278 ? -23.651  -24.583 -78.861  1.00 176.83 ? 285  CYS D CB    1 
ATOM 7532  S SG    . CYS D 1 278 ? -22.766  -25.070 -80.352  1.00 176.43 ? 285  CYS D SG    1 
ATOM 7533  N N     . LEU D 1 279 ? -22.104  -27.352 -78.433  1.00 177.89 ? 286  LEU D N     1 
ATOM 7534  C CA    . LEU D 1 279 ? -20.871  -28.134 -78.502  1.00 178.51 ? 286  LEU D CA    1 
ATOM 7535  C C     . LEU D 1 279 ? -19.767  -27.343 -79.162  1.00 178.91 ? 286  LEU D C     1 
ATOM 7536  O O     . LEU D 1 279 ? -19.937  -26.768 -80.243  1.00 178.95 ? 286  LEU D O     1 
ATOM 7537  C CB    . LEU D 1 279 ? -21.094  -29.459 -79.256  1.00 178.49 ? 286  LEU D CB    1 
ATOM 7538  C CG    . LEU D 1 279 ? -20.027  -30.563 -79.412  1.00 178.63 ? 286  LEU D CG    1 
ATOM 7539  C CD1   . LEU D 1 279 ? -19.106  -30.356 -80.630  1.00 178.56 ? 286  LEU D CD1   1 
ATOM 7540  C CD2   . LEU D 1 279 ? -19.222  -30.800 -78.133  1.00 178.42 ? 286  LEU D CD2   1 
ATOM 7541  N N     . SER D 1 280 ? -18.630  -27.328 -78.490  1.00 179.45 ? 287  SER D N     1 
ATOM 7542  C CA    . SER D 1 280 ? -17.452  -26.696 -79.022  1.00 180.00 ? 287  SER D CA    1 
ATOM 7543  C C     . SER D 1 280 ? -16.565  -27.777 -79.605  1.00 180.25 ? 287  SER D C     1 
ATOM 7544  O O     . SER D 1 280 ? -16.309  -28.803 -78.957  1.00 180.23 ? 287  SER D O     1 
ATOM 7545  C CB    . SER D 1 280 ? -16.724  -25.950 -77.917  1.00 180.01 ? 287  SER D CB    1 
ATOM 7546  O OG    . SER D 1 280 ? -17.651  -25.417 -76.990  1.00 180.33 ? 287  SER D OG    1 
ATOM 7547  N N     . GLN D 1 281 ? -16.113  -27.551 -80.837  1.00 180.60 ? 288  GLN D N     1 
ATOM 7548  C CA    . GLN D 1 281 ? -15.101  -28.399 -81.457  1.00 180.83 ? 288  GLN D CA    1 
ATOM 7549  C C     . GLN D 1 281 ? -13.828  -28.200 -80.628  1.00 181.07 ? 288  GLN D C     1 
ATOM 7550  O O     . GLN D 1 281 ? -12.705  -28.270 -81.135  1.00 181.06 ? 288  GLN D O     1 
ATOM 7551  C CB    . GLN D 1 281 ? -14.890  -28.027 -82.934  1.00 180.79 ? 288  GLN D CB    1 
ATOM 7552  C CG    . GLN D 1 281 ? -16.060  -27.278 -83.630  1.00 180.61 ? 288  GLN D CG    1 
ATOM 7553  C CD    . GLN D 1 281 ? -17.408  -27.991 -83.557  1.00 180.15 ? 288  GLN D CD    1 
ATOM 7554  O OE1   . GLN D 1 281 ? -18.440  -27.358 -83.332  1.00 179.56 ? 288  GLN D OE1   1 
ATOM 7555  N NE2   . GLN D 1 281 ? -17.403  -29.304 -83.746  1.00 180.18 ? 288  GLN D NE2   1 
ATOM 7556  N N     . GLU D 1 282 ? -14.064  -27.949 -79.334  1.00 181.39 ? 289  GLU D N     1 
ATOM 7557  C CA    . GLU D 1 282 ? -13.073  -27.620 -78.300  1.00 181.63 ? 289  GLU D CA    1 
ATOM 7558  C C     . GLU D 1 282 ? -13.737  -27.683 -76.896  1.00 181.73 ? 289  GLU D C     1 
ATOM 7559  O O     . GLU D 1 282 ? -14.415  -28.674 -76.575  1.00 181.63 ? 289  GLU D O     1 
ATOM 7560  C CB    . GLU D 1 282 ? -12.413  -26.246 -78.564  1.00 181.61 ? 289  GLU D CB    1 
ATOM 7561  C CG    . GLU D 1 282 ? -13.371  -25.112 -78.963  1.00 181.40 ? 289  GLU D CG    1 
ATOM 7562  C CD    . GLU D 1 282 ? -12.792  -23.723 -78.727  1.00 181.14 ? 289  GLU D CD    1 
ATOM 7563  O OE1   . GLU D 1 282 ? -11.583  -23.518 -78.964  1.00 180.84 ? 289  GLU D OE1   1 
ATOM 7564  O OE2   . GLU D 1 282 ? -13.555  -22.828 -78.309  1.00 181.14 ? 289  GLU D OE2   1 
ATOM 7565  N N     . ARG D 1 283 ? -13.540  -26.631 -76.084  1.00 181.82 ? 290  ARG D N     1 
ATOM 7566  C CA    . ARG D 1 283 ? -14.101  -26.506 -74.719  1.00 181.77 ? 290  ARG D CA    1 
ATOM 7567  C C     . ARG D 1 283 ? -15.420  -25.717 -74.748  1.00 181.65 ? 290  ARG D C     1 
ATOM 7568  O O     . ARG D 1 283 ? -15.510  -24.686 -75.420  1.00 181.69 ? 290  ARG D O     1 
ATOM 7569  C CB    . ARG D 1 283 ? -13.088  -25.843 -73.764  1.00 181.76 ? 290  ARG D CB    1 
ATOM 7570  C CG    . ARG D 1 283 ? -11.615  -26.258 -73.967  1.00 181.85 ? 290  ARG D CG    1 
ATOM 7571  C CD    . ARG D 1 283 ? -11.245  -27.590 -73.296  1.00 182.26 ? 290  ARG D CD    1 
ATOM 7572  N NE    . ARG D 1 283 ? -12.002  -28.747 -73.794  1.00 182.56 ? 290  ARG D NE    1 
ATOM 7573  C CZ    . ARG D 1 283 ? -11.693  -29.470 -74.873  1.00 182.47 ? 290  ARG D CZ    1 
ATOM 7574  N NH1   . ARG D 1 283 ? -10.633  -29.172 -75.615  1.00 182.35 ? 290  ARG D NH1   1 
ATOM 7575  N NH2   . ARG D 1 283 ? -12.456  -30.498 -75.219  1.00 182.15 ? 290  ARG D NH2   1 
ATOM 7576  N N     . ILE D 1 284 ? -16.418  -26.188 -73.997  1.00 181.49 ? 291  ILE D N     1 
ATOM 7577  C CA    . ILE D 1 284 ? -17.836  -25.858 -74.250  1.00 181.33 ? 291  ILE D CA    1 
ATOM 7578  C C     . ILE D 1 284 ? -18.327  -24.421 -73.992  1.00 181.24 ? 291  ILE D C     1 
ATOM 7579  O O     . ILE D 1 284 ? -18.064  -23.840 -72.935  1.00 181.13 ? 291  ILE D O     1 
ATOM 7580  C CB    . ILE D 1 284 ? -18.788  -26.897 -73.597  1.00 181.40 ? 291  ILE D CB    1 
ATOM 7581  C CG1   . ILE D 1 284 ? -20.088  -26.982 -74.394  1.00 181.40 ? 291  ILE D CG1   1 
ATOM 7582  C CG2   . ILE D 1 284 ? -19.036  -26.597 -72.109  1.00 181.10 ? 291  ILE D CG2   1 
ATOM 7583  C CD1   . ILE D 1 284 ? -20.532  -28.387 -74.660  1.00 181.59 ? 291  ILE D CD1   1 
ATOM 7584  N N     . ILE D 1 285 ? -19.052  -23.876 -74.977  1.00 181.19 ? 292  ILE D N     1 
ATOM 7585  C CA    . ILE D 1 285 ? -19.616  -22.517 -74.902  1.00 181.21 ? 292  ILE D CA    1 
ATOM 7586  C C     . ILE D 1 285 ? -21.113  -22.442 -75.260  1.00 181.38 ? 292  ILE D C     1 
ATOM 7587  O O     . ILE D 1 285 ? -21.794  -23.471 -75.364  1.00 181.26 ? 292  ILE D O     1 
ATOM 7588  C CB    . ILE D 1 285 ? -18.799  -21.451 -75.752  1.00 181.17 ? 292  ILE D CB    1 
ATOM 7589  C CG1   . ILE D 1 285 ? -19.138  -21.491 -77.267  1.00 180.75 ? 292  ILE D CG1   1 
ATOM 7590  C CG2   . ILE D 1 285 ? -17.292  -21.473 -75.413  1.00 181.18 ? 292  ILE D CG2   1 
ATOM 7591  C CD1   . ILE D 1 285 ? -18.536  -22.614 -78.092  1.00 179.93 ? 292  ILE D CD1   1 
ATOM 7592  N N     . GLN D 1 286 ? -21.603  -21.207 -75.426  1.00 181.60 ? 293  GLN D N     1 
ATOM 7593  C CA    . GLN D 1 286 ? -22.977  -20.910 -75.869  1.00 181.71 ? 293  GLN D CA    1 
ATOM 7594  C C     . GLN D 1 286 ? -23.067  -20.362 -77.321  1.00 181.78 ? 293  GLN D C     1 
ATOM 7595  O O     . GLN D 1 286 ? -22.059  -19.935 -77.897  1.00 181.78 ? 293  GLN D O     1 
ATOM 7596  C CB    . GLN D 1 286 ? -23.703  -19.993 -74.858  1.00 181.65 ? 293  GLN D CB    1 
ATOM 7597  C CG    . GLN D 1 286 ? -22.846  -18.943 -74.159  1.00 181.48 ? 293  GLN D CG    1 
ATOM 7598  C CD    . GLN D 1 286 ? -23.673  -17.996 -73.307  1.00 181.40 ? 293  GLN D CD    1 
ATOM 7599  O OE1   . GLN D 1 286 ? -24.467  -17.209 -73.824  1.00 181.41 ? 293  GLN D OE1   1 
ATOM 7600  N NE2   . GLN D 1 286 ? -23.484  -18.063 -71.993  1.00 181.28 ? 293  GLN D NE2   1 
ATOM 7601  N N     . PHE D 1 287 ? -24.276  -20.387 -77.895  1.00 181.83 ? 294  PHE D N     1 
ATOM 7602  C CA    . PHE D 1 287 ? -24.516  -20.055 -79.312  1.00 181.93 ? 294  PHE D CA    1 
ATOM 7603  C C     . PHE D 1 287 ? -25.832  -19.280 -79.493  1.00 182.09 ? 294  PHE D C     1 
ATOM 7604  O O     . PHE D 1 287 ? -26.796  -19.526 -78.779  1.00 182.16 ? 294  PHE D O     1 
ATOM 7605  C CB    . PHE D 1 287 ? -24.528  -21.351 -80.137  1.00 181.80 ? 294  PHE D CB    1 
ATOM 7606  C CG    . PHE D 1 287 ? -24.621  -21.140 -81.622  1.00 181.65 ? 294  PHE D CG    1 
ATOM 7607  C CD1   . PHE D 1 287 ? -23.534  -20.658 -82.344  1.00 181.66 ? 294  PHE D CD1   1 
ATOM 7608  C CD2   . PHE D 1 287 ? -25.789  -21.450 -82.305  1.00 181.52 ? 294  PHE D CD2   1 
ATOM 7609  C CE1   . PHE D 1 287 ? -23.619  -20.469 -83.728  1.00 181.84 ? 294  PHE D CE1   1 
ATOM 7610  C CE2   . PHE D 1 287 ? -25.884  -21.266 -83.682  1.00 181.84 ? 294  PHE D CE2   1 
ATOM 7611  C CZ    . PHE D 1 287 ? -24.796  -20.776 -84.395  1.00 181.87 ? 294  PHE D CZ    1 
ATOM 7612  N N     . GLN D 1 288 ? -25.874  -18.349 -80.445  1.00 182.30 ? 295  GLN D N     1 
ATOM 7613  C CA    . GLN D 1 288 ? -27.031  -17.454 -80.599  1.00 182.54 ? 295  GLN D CA    1 
ATOM 7614  C C     . GLN D 1 288 ? -28.274  -18.049 -81.282  1.00 182.76 ? 295  GLN D C     1 
ATOM 7615  O O     . GLN D 1 288 ? -29.385  -17.548 -81.083  1.00 182.65 ? 295  GLN D O     1 
ATOM 7616  C CB    . GLN D 1 288 ? -26.617  -16.155 -81.305  1.00 182.54 ? 295  GLN D CB    1 
ATOM 7617  C CG    . GLN D 1 288 ? -26.186  -15.023 -80.371  1.00 182.53 ? 295  GLN D CG    1 
ATOM 7618  C CD    . GLN D 1 288 ? -27.356  -14.241 -79.778  1.00 182.57 ? 295  GLN D CD    1 
ATOM 7619  O OE1   . GLN D 1 288 ? -28.260  -14.808 -79.163  1.00 182.68 ? 295  GLN D OE1   1 
ATOM 7620  N NE2   . GLN D 1 288 ? -27.328  -12.925 -79.951  1.00 182.59 ? 295  GLN D NE2   1 
ATOM 7621  N N     . ALA D 1 289 ? -28.085  -19.100 -82.079  1.00 183.18 ? 296  ALA D N     1 
ATOM 7622  C CA    . ALA D 1 289 ? -29.155  -19.685 -82.898  1.00 183.79 ? 296  ALA D CA    1 
ATOM 7623  C C     . ALA D 1 289 ? -29.580  -18.761 -84.047  1.00 184.32 ? 296  ALA D C     1 
ATOM 7624  O O     . ALA D 1 289 ? -29.851  -17.575 -83.833  1.00 184.40 ? 296  ALA D O     1 
ATOM 7625  C CB    . ALA D 1 289 ? -30.360  -20.075 -82.039  1.00 183.68 ? 296  ALA D CB    1 
ATOM 7626  N N     . THR D 1 290 ? -29.649  -19.327 -85.258  1.00 184.95 ? 297  THR D N     1 
ATOM 7627  C CA    . THR D 1 290 ? -29.944  -18.595 -86.513  1.00 185.42 ? 297  THR D CA    1 
ATOM 7628  C C     . THR D 1 290 ? -31.320  -17.875 -86.473  1.00 185.73 ? 297  THR D C     1 
ATOM 7629  O O     . THR D 1 290 ? -32.041  -17.970 -85.466  1.00 185.61 ? 297  THR D O     1 
ATOM 7630  C CB    . THR D 1 290 ? -29.837  -19.552 -87.777  1.00 185.48 ? 297  THR D CB    1 
ATOM 7631  O OG1   . THR D 1 290 ? -29.167  -20.772 -87.433  1.00 185.60 ? 297  THR D OG1   1 
ATOM 7632  C CG2   . THR D 1 290 ? -29.081  -18.886 -88.933  1.00 185.17 ? 297  THR D CG2   1 
ATOM 7633  N N     . PRO D 1 291 ? -31.667  -17.113 -87.542  1.00 186.11 ? 298  PRO D N     1 
ATOM 7634  C CA    . PRO D 1 291 ? -33.036  -16.591 -87.725  1.00 186.32 ? 298  PRO D CA    1 
ATOM 7635  C C     . PRO D 1 291 ? -34.199  -17.612 -87.612  1.00 186.40 ? 298  PRO D C     1 
ATOM 7636  O O     . PRO D 1 291 ? -33.980  -18.819 -87.456  1.00 186.38 ? 298  PRO D O     1 
ATOM 7637  C CB    . PRO D 1 291 ? -32.996  -15.971 -89.143  1.00 186.33 ? 298  PRO D CB    1 
ATOM 7638  C CG    . PRO D 1 291 ? -31.540  -16.040 -89.608  1.00 186.24 ? 298  PRO D CG    1 
ATOM 7639  C CD    . PRO D 1 291 ? -30.718  -16.371 -88.398  1.00 186.17 ? 298  PRO D CD    1 
ATOM 7640  N N     . CYS D 1 292 ? -35.424  -17.095 -87.696  1.00 186.48 ? 299  CYS D N     1 
ATOM 7641  C CA    . CYS D 1 292 ? -36.652  -17.877 -87.547  1.00 186.44 ? 299  CYS D CA    1 
ATOM 7642  C C     . CYS D 1 292 ? -37.809  -17.205 -88.320  1.00 186.65 ? 299  CYS D C     1 
ATOM 7643  O O     . CYS D 1 292 ? -38.810  -16.806 -87.706  1.00 186.79 ? 299  CYS D O     1 
ATOM 7644  C CB    . CYS D 1 292 ? -36.991  -18.012 -86.056  1.00 186.34 ? 299  CYS D CB    1 
ATOM 7645  S SG    . CYS D 1 292 ? -36.397  -16.630 -85.024  1.00 185.47 ? 299  CYS D SG    1 
ATOM 7646  N N     . PRO D 1 293 ? -37.681  -17.090 -89.670  1.00 186.63 ? 300  PRO D N     1 
ATOM 7647  C CA    . PRO D 1 293 ? -38.555  -16.206 -90.459  1.00 186.50 ? 300  PRO D CA    1 
ATOM 7648  C C     . PRO D 1 293 ? -39.871  -16.835 -90.961  1.00 186.41 ? 300  PRO D C     1 
ATOM 7649  O O     . PRO D 1 293 ? -40.955  -16.367 -90.581  1.00 186.32 ? 300  PRO D O     1 
ATOM 7650  C CB    . PRO D 1 293 ? -37.657  -15.798 -91.639  1.00 186.54 ? 300  PRO D CB    1 
ATOM 7651  C CG    . PRO D 1 293 ? -36.544  -16.860 -91.699  1.00 186.57 ? 300  PRO D CG    1 
ATOM 7652  C CD    . PRO D 1 293 ? -36.741  -17.816 -90.547  1.00 186.60 ? 300  PRO D CD    1 
ATOM 7653  N N     . LYS D 1 294 ? -39.773  -17.865 -91.809  1.00 186.30 ? 301  LYS D N     1 
ATOM 7654  C CA    . LYS D 1 294 ? -40.952  -18.574 -92.343  1.00 186.09 ? 301  LYS D CA    1 
ATOM 7655  C C     . LYS D 1 294 ? -41.715  -19.353 -91.258  1.00 185.97 ? 301  LYS D C     1 
ATOM 7656  O O     . LYS D 1 294 ? -42.954  -19.321 -91.220  1.00 185.93 ? 301  LYS D O     1 
ATOM 7657  C CB    . LYS D 1 294 ? -40.593  -19.478 -93.548  1.00 186.07 ? 301  LYS D CB    1 
ATOM 7658  C CG    . LYS D 1 294 ? -39.327  -20.343 -93.400  1.00 185.91 ? 301  LYS D CG    1 
ATOM 7659  C CD    . LYS D 1 294 ? -39.224  -21.396 -94.509  1.00 185.41 ? 301  LYS D CD    1 
ATOM 7660  C CE    . LYS D 1 294 ? -39.805  -22.749 -94.085  1.00 184.97 ? 301  LYS D CE    1 
ATOM 7661  N NZ    . LYS D 1 294 ? -38.860  -23.554 -93.257  1.00 184.25 ? 301  LYS D NZ    1 
ATOM 7662  N N     . GLU D 1 295 ? -40.965  -20.040 -90.388  1.00 185.70 ? 302  GLU D N     1 
ATOM 7663  C CA    . GLU D 1 295 ? -41.515  -20.720 -89.208  1.00 185.34 ? 302  GLU D CA    1 
ATOM 7664  C C     . GLU D 1 295 ? -41.370  -19.770 -88.002  1.00 184.91 ? 302  GLU D C     1 
ATOM 7665  O O     . GLU D 1 295 ? -40.241  -19.402 -87.638  1.00 184.86 ? 302  GLU D O     1 
ATOM 7666  C CB    . GLU D 1 295 ? -40.799  -22.057 -88.946  1.00 185.44 ? 302  GLU D CB    1 
ATOM 7667  C CG    . GLU D 1 295 ? -40.009  -22.643 -90.130  1.00 185.86 ? 302  GLU D CG    1 
ATOM 7668  C CD    . GLU D 1 295 ? -38.502  -22.346 -90.071  1.00 186.54 ? 302  GLU D CD    1 
ATOM 7669  O OE1   . GLU D 1 295 ? -37.714  -23.226 -90.483  1.00 186.72 ? 302  GLU D OE1   1 
ATOM 7670  O OE2   . GLU D 1 295 ? -38.101  -21.247 -89.618  1.00 186.57 ? 302  GLU D OE2   1 
ATOM 7671  N N     . PRO D 1 296 ? -42.507  -19.380 -87.377  1.00 184.40 ? 303  PRO D N     1 
ATOM 7672  C CA    . PRO D 1 296 ? -42.552  -18.245 -86.426  1.00 183.90 ? 303  PRO D CA    1 
ATOM 7673  C C     . PRO D 1 296 ? -41.835  -18.457 -85.068  1.00 183.32 ? 303  PRO D C     1 
ATOM 7674  O O     . PRO D 1 296 ? -40.886  -17.721 -84.744  1.00 183.13 ? 303  PRO D O     1 
ATOM 7675  C CB    . PRO D 1 296 ? -44.062  -18.006 -86.223  1.00 183.95 ? 303  PRO D CB    1 
ATOM 7676  C CG    . PRO D 1 296 ? -44.777  -18.998 -87.128  1.00 184.12 ? 303  PRO D CG    1 
ATOM 7677  C CD    . PRO D 1 296 ? -43.804  -20.077 -87.454  1.00 184.27 ? 303  PRO D CD    1 
ATOM 7678  N N     . ASN D 1 297 ? -42.301  -19.447 -84.299  1.00 182.57 ? 304  ASN D N     1 
ATOM 7679  C CA    . ASN D 1 297 ? -41.741  -19.808 -82.985  1.00 181.67 ? 304  ASN D CA    1 
ATOM 7680  C C     . ASN D 1 297 ? -40.762  -20.993 -83.048  1.00 181.04 ? 304  ASN D C     1 
ATOM 7681  O O     . ASN D 1 297 ? -40.449  -21.607 -82.026  1.00 180.98 ? 304  ASN D O     1 
ATOM 7682  C CB    . ASN D 1 297 ? -42.880  -20.136 -82.013  1.00 181.64 ? 304  ASN D CB    1 
ATOM 7683  C CG    . ASN D 1 297 ? -43.710  -21.322 -82.472  1.00 181.53 ? 304  ASN D CG    1 
ATOM 7684  O OD1   . ASN D 1 297 ? -43.258  -22.469 -82.427  1.00 181.44 ? 304  ASN D OD1   1 
ATOM 7685  N ND2   . ASN D 1 297 ? -44.931  -21.051 -82.924  1.00 181.49 ? 304  ASN D ND2   1 
ATOM 7686  N N     . LYS D 1 298 ? -40.294  -21.304 -84.255  1.00 180.15 ? 305  LYS D N     1 
ATOM 7687  C CA    . LYS D 1 298 ? -39.422  -22.451 -84.507  1.00 179.17 ? 305  LYS D CA    1 
ATOM 7688  C C     . LYS D 1 298 ? -38.020  -21.983 -84.952  1.00 178.46 ? 305  LYS D C     1 
ATOM 7689  O O     . LYS D 1 298 ? -37.787  -21.715 -86.142  1.00 178.53 ? 305  LYS D O     1 
ATOM 7690  C CB    . LYS D 1 298 ? -40.076  -23.361 -85.558  1.00 179.21 ? 305  LYS D CB    1 
ATOM 7691  C CG    . LYS D 1 298 ? -39.679  -24.826 -85.494  1.00 179.14 ? 305  LYS D CG    1 
ATOM 7692  C CD    . LYS D 1 298 ? -40.366  -25.638 -86.591  1.00 178.73 ? 305  LYS D CD    1 
ATOM 7693  C CE    . LYS D 1 298 ? -39.588  -25.591 -87.899  1.00 178.18 ? 305  LYS D CE    1 
ATOM 7694  N NZ    . LYS D 1 298 ? -40.272  -26.370 -88.956  1.00 177.92 ? 305  LYS D NZ    1 
ATOM 7695  N N     . GLU D 1 299 ? -37.101  -21.877 -83.987  1.00 177.37 ? 306  GLU D N     1 
ATOM 7696  C CA    . GLU D 1 299 ? -35.732  -21.394 -84.232  1.00 176.33 ? 306  GLU D CA    1 
ATOM 7697  C C     . GLU D 1 299 ? -34.835  -22.451 -84.868  1.00 175.71 ? 306  GLU D C     1 
ATOM 7698  O O     . GLU D 1 299 ? -34.833  -23.604 -84.440  1.00 175.71 ? 306  GLU D O     1 
ATOM 7699  C CB    . GLU D 1 299 ? -35.079  -20.936 -82.931  1.00 176.24 ? 306  GLU D CB    1 
ATOM 7700  C CG    . GLU D 1 299 ? -35.804  -19.820 -82.219  1.00 176.07 ? 306  GLU D CG    1 
ATOM 7701  C CD    . GLU D 1 299 ? -34.952  -19.173 -81.141  1.00 176.12 ? 306  GLU D CD    1 
ATOM 7702  O OE1   . GLU D 1 299 ? -33.740  -18.955 -81.382  1.00 176.09 ? 306  GLU D OE1   1 
ATOM 7703  O OE2   . GLU D 1 299 ? -35.499  -18.874 -80.054  1.00 176.10 ? 306  GLU D OE2   1 
ATOM 7704  N N     . MET D 1 300 ? -34.070  -22.047 -85.884  1.00 174.82 ? 307  MET D N     1 
ATOM 7705  C CA    . MET D 1 300 ? -33.047  -22.909 -86.494  1.00 173.78 ? 307  MET D CA    1 
ATOM 7706  C C     . MET D 1 300 ? -31.816  -22.913 -85.571  1.00 172.65 ? 307  MET D C     1 
ATOM 7707  O O     . MET D 1 300 ? -31.521  -21.900 -84.918  1.00 172.48 ? 307  MET D O     1 
ATOM 7708  C CB    . MET D 1 300 ? -32.690  -22.437 -87.923  1.00 174.09 ? 307  MET D CB    1 
ATOM 7709  C CG    . MET D 1 300 ? -33.872  -22.423 -88.932  1.00 174.87 ? 307  MET D CG    1 
ATOM 7710  S SD    . MET D 1 300 ? -33.638  -21.300 -90.349  1.00 176.49 ? 307  MET D SD    1 
ATOM 7711  C CE    . MET D 1 300 ? -35.175  -21.501 -91.256  1.00 175.79 ? 307  MET D CE    1 
ATOM 7712  N N     . ILE D 1 301 ? -31.116  -24.051 -85.503  1.00 171.19 ? 308  ILE D N     1 
ATOM 7713  C CA    . ILE D 1 301 ? -30.031  -24.241 -84.522  1.00 169.63 ? 308  ILE D CA    1 
ATOM 7714  C C     . ILE D 1 301 ? -28.818  -25.051 -85.047  1.00 168.49 ? 308  ILE D C     1 
ATOM 7715  O O     . ILE D 1 301 ? -28.910  -25.780 -86.049  1.00 168.45 ? 308  ILE D O     1 
ATOM 7716  C CB    . ILE D 1 301 ? -30.589  -24.810 -83.153  1.00 169.68 ? 308  ILE D CB    1 
ATOM 7717  C CG1   . ILE D 1 301 ? -30.199  -23.920 -81.958  1.00 169.56 ? 308  ILE D CG1   1 
ATOM 7718  C CG2   . ILE D 1 301 ? -30.274  -26.310 -82.954  1.00 169.47 ? 308  ILE D CG2   1 
ATOM 7719  C CD1   . ILE D 1 301 ? -28.768  -23.430 -81.935  1.00 169.63 ? 308  ILE D CD1   1 
ATOM 7720  N N     . ASN D 1 302 ? -27.694  -24.898 -84.345  1.00 166.76 ? 309  ASN D N     1 
ATOM 7721  C CA    . ASN D 1 302 ? -26.398  -25.481 -84.699  1.00 165.08 ? 309  ASN D CA    1 
ATOM 7722  C C     . ASN D 1 302 ? -26.325  -27.020 -84.588  1.00 163.89 ? 309  ASN D C     1 
ATOM 7723  O O     . ASN D 1 302 ? -27.168  -27.646 -83.932  1.00 163.89 ? 309  ASN D O     1 
ATOM 7724  C CB    . ASN D 1 302 ? -25.325  -24.827 -83.811  1.00 165.06 ? 309  ASN D CB    1 
ATOM 7725  C CG    . ASN D 1 302 ? -23.913  -25.108 -84.281  1.00 164.83 ? 309  ASN D CG    1 
ATOM 7726  O OD1   . ASN D 1 302 ? -23.132  -25.751 -83.580  1.00 164.23 ? 309  ASN D OD1   1 
ATOM 7727  N ND2   . ASN D 1 302 ? -23.578  -24.628 -85.472  1.00 165.09 ? 309  ASN D ND2   1 
ATOM 7728  N N     . ASP D 1 303 ? -25.321  -27.614 -85.245  1.00 162.23 ? 310  ASP D N     1 
ATOM 7729  C CA    . ASP D 1 303 ? -24.932  -29.028 -85.045  1.00 160.41 ? 310  ASP D CA    1 
ATOM 7730  C C     . ASP D 1 303 ? -24.635  -29.338 -83.580  1.00 158.95 ? 310  ASP D C     1 
ATOM 7731  O O     . ASP D 1 303 ? -24.989  -30.406 -83.073  1.00 158.68 ? 310  ASP D O     1 
ATOM 7732  C CB    . ASP D 1 303 ? -23.672  -29.364 -85.859  1.00 160.48 ? 310  ASP D CB    1 
ATOM 7733  C CG    . ASP D 1 303 ? -23.975  -29.700 -87.292  1.00 160.35 ? 310  ASP D CG    1 
ATOM 7734  O OD1   . ASP D 1 303 ? -24.900  -29.088 -87.864  1.00 160.89 ? 310  ASP D OD1   1 
ATOM 7735  O OD2   . ASP D 1 303 ? -23.283  -30.575 -87.847  1.00 159.95 ? 310  ASP D OD2   1 
ATOM 7736  N N     . GLY D 1 304 ? -23.979  -28.382 -82.923  1.00 157.26 ? 311  GLY D N     1 
ATOM 7737  C CA    . GLY D 1 304 ? -23.451  -28.553 -81.577  1.00 155.05 ? 311  GLY D CA    1 
ATOM 7738  C C     . GLY D 1 304 ? -24.382  -28.246 -80.415  1.00 153.45 ? 311  GLY D C     1 
ATOM 7739  O O     . GLY D 1 304 ? -24.088  -28.629 -79.283  1.00 153.40 ? 311  GLY D O     1 
ATOM 7740  N N     . ALA D 1 305 ? -25.490  -27.546 -80.668  1.00 151.64 ? 312  ALA D N     1 
ATOM 7741  C CA    . ALA D 1 305 ? -26.514  -27.357 -79.631  1.00 149.64 ? 312  ALA D CA    1 
ATOM 7742  C C     . ALA D 1 305 ? -27.601  -28.446 -79.715  1.00 148.29 ? 312  ALA D C     1 
ATOM 7743  O O     . ALA D 1 305 ? -28.644  -28.349 -79.054  1.00 148.22 ? 312  ALA D O     1 
ATOM 7744  C CB    . ALA D 1 305 ? -27.112  -25.954 -79.694  1.00 149.60 ? 312  ALA D CB    1 
ATOM 7745  N N     . SER D 1 306 ? -27.326  -29.488 -80.512  1.00 146.26 ? 313  SER D N     1 
ATOM 7746  C CA    . SER D 1 306 ? -28.216  -30.641 -80.665  1.00 144.29 ? 313  SER D CA    1 
ATOM 7747  C C     . SER D 1 306 ? -27.672  -31.916 -79.981  1.00 142.76 ? 313  SER D C     1 
ATOM 7748  O O     . SER D 1 306 ? -26.902  -32.688 -80.569  1.00 142.42 ? 313  SER D O     1 
ATOM 7749  C CB    . SER D 1 306 ? -28.516  -30.886 -82.148  1.00 144.47 ? 313  SER D CB    1 
ATOM 7750  O OG    . SER D 1 306 ? -29.780  -31.513 -82.318  1.00 144.73 ? 313  SER D OG    1 
ATOM 7751  N N     . TRP D 1 307 ? -28.097  -32.116 -78.733  1.00 140.88 ? 314  TRP D N     1 
ATOM 7752  C CA    . TRP D 1 307 ? -27.687  -33.253 -77.895  1.00 138.92 ? 314  TRP D CA    1 
ATOM 7753  C C     . TRP D 1 307 ? -28.666  -34.427 -77.924  1.00 137.47 ? 314  TRP D C     1 
ATOM 7754  O O     . TRP D 1 307 ? -29.874  -34.241 -78.081  1.00 137.47 ? 314  TRP D O     1 
ATOM 7755  C CB    . TRP D 1 307 ? -27.590  -32.813 -76.438  1.00 138.89 ? 314  TRP D CB    1 
ATOM 7756  C CG    . TRP D 1 307 ? -26.681  -31.690 -76.197  1.00 138.66 ? 314  TRP D CG    1 
ATOM 7757  C CD1   . TRP D 1 307 ? -26.974  -30.364 -76.313  1.00 138.76 ? 314  TRP D CD1   1 
ATOM 7758  C CD2   . TRP D 1 307 ? -25.316  -31.772 -75.770  1.00 138.70 ? 314  TRP D CD2   1 
ATOM 7759  N NE1   . TRP D 1 307 ? -25.868  -29.607 -75.992  1.00 139.24 ? 314  TRP D NE1   1 
ATOM 7760  C CE2   . TRP D 1 307 ? -24.837  -30.446 -75.651  1.00 138.72 ? 314  TRP D CE2   1 
ATOM 7761  C CE3   . TRP D 1 307 ? -24.452  -32.834 -75.471  1.00 138.60 ? 314  TRP D CE3   1 
ATOM 7762  C CZ2   . TRP D 1 307 ? -23.524  -30.152 -75.250  1.00 138.19 ? 314  TRP D CZ2   1 
ATOM 7763  C CZ3   . TRP D 1 307 ? -23.145  -32.542 -75.071  1.00 138.58 ? 314  TRP D CZ3   1 
ATOM 7764  C CH2   . TRP D 1 307 ? -22.696  -31.210 -74.969  1.00 138.12 ? 314  TRP D CH2   1 
ATOM 7765  N N     . THR D 1 308 ? -28.142  -35.633 -77.734  1.00 135.41 ? 315  THR D N     1 
ATOM 7766  C CA    . THR D 1 308 ? -28.992  -36.769 -77.406  1.00 133.52 ? 315  THR D CA    1 
ATOM 7767  C C     . THR D 1 308 ? -28.911  -37.020 -75.894  1.00 132.36 ? 315  THR D C     1 
ATOM 7768  O O     . THR D 1 308 ? -27.831  -36.923 -75.291  1.00 132.28 ? 315  THR D O     1 
ATOM 7769  C CB    . THR D 1 308 ? -28.612  -38.021 -78.195  1.00 133.48 ? 315  THR D CB    1 
ATOM 7770  O OG1   . THR D 1 308 ? -28.292  -37.654 -79.539  1.00 133.31 ? 315  THR D OG1   1 
ATOM 7771  C CG2   . THR D 1 308 ? -29.768  -38.998 -78.225  1.00 133.25 ? 315  THR D CG2   1 
ATOM 7772  N N     . ILE D 1 309 ? -30.063  -37.328 -75.295  1.00 130.63 ? 316  ILE D N     1 
ATOM 7773  C CA    . ILE D 1 309 ? -30.209  -37.427 -73.832  1.00 128.75 ? 316  ILE D CA    1 
ATOM 7774  C C     . ILE D 1 309 ? -30.734  -38.805 -73.432  1.00 127.56 ? 316  ILE D C     1 
ATOM 7775  O O     . ILE D 1 309 ? -31.716  -39.303 -74.002  1.00 127.45 ? 316  ILE D O     1 
ATOM 7776  C CB    . ILE D 1 309 ? -31.133  -36.292 -73.254  1.00 128.69 ? 316  ILE D CB    1 
ATOM 7777  C CG1   . ILE D 1 309 ? -30.834  -36.012 -71.775  1.00 128.37 ? 316  ILE D CG1   1 
ATOM 7778  C CG2   . ILE D 1 309 ? -32.617  -36.602 -73.489  1.00 128.22 ? 316  ILE D CG2   1 
ATOM 7779  C CD1   . ILE D 1 309 ? -31.857  -36.557 -70.811  1.00 128.48 ? 316  ILE D CD1   1 
ATOM 7780  N N     . ILE D 1 310 ? -30.065  -39.413 -72.454  1.00 125.84 ? 317  ILE D N     1 
ATOM 7781  C CA    . ILE D 1 310 ? -30.433  -40.738 -71.967  1.00 124.00 ? 317  ILE D CA    1 
ATOM 7782  C C     . ILE D 1 310 ? -30.342  -40.777 -70.437  1.00 123.08 ? 317  ILE D C     1 
ATOM 7783  O O     . ILE D 1 310 ? -29.433  -40.170 -69.837  1.00 122.85 ? 317  ILE D O     1 
ATOM 7784  C CB    . ILE D 1 310 ? -29.589  -41.850 -72.652  1.00 123.76 ? 317  ILE D CB    1 
ATOM 7785  C CG1   . ILE D 1 310 ? -29.801  -43.207 -71.980  1.00 123.52 ? 317  ILE D CG1   1 
ATOM 7786  C CG2   . ILE D 1 310 ? -28.121  -41.482 -72.683  1.00 123.54 ? 317  ILE D CG2   1 
ATOM 7787  C CD1   . ILE D 1 310 ? -30.567  -44.208 -72.807  1.00 122.81 ? 317  ILE D CD1   1 
ATOM 7788  N N     . SER D 1 311 ? -31.318  -41.454 -69.824  1.00 121.80 ? 318  SER D N     1 
ATOM 7789  C CA    . SER D 1 311 ? -31.367  -41.644 -68.376  1.00 120.49 ? 318  SER D CA    1 
ATOM 7790  C C     . SER D 1 311 ? -30.346  -42.726 -68.006  1.00 119.89 ? 318  SER D C     1 
ATOM 7791  O O     . SER D 1 311 ? -30.157  -43.707 -68.728  1.00 119.70 ? 318  SER D O     1 
ATOM 7792  C CB    . SER D 1 311 ? -32.789  -42.007 -67.923  1.00 120.09 ? 318  SER D CB    1 
ATOM 7793  O OG    . SER D 1 311 ? -33.115  -41.390 -66.695  1.00 119.29 ? 318  SER D OG    1 
ATOM 7794  N N     . THR D 1 312 ? -29.653  -42.537 -66.897  1.00 119.18 ? 319  THR D N     1 
ATOM 7795  C CA    . THR D 1 312 ? -28.587  -43.461 -66.567  1.00 118.43 ? 319  THR D CA    1 
ATOM 7796  C C     . THR D 1 312 ? -28.800  -44.199 -65.231  1.00 118.07 ? 319  THR D C     1 
ATOM 7797  O O     . THR D 1 312 ? -29.857  -44.081 -64.586  1.00 117.88 ? 319  THR D O     1 
ATOM 7798  C CB    . THR D 1 312 ? -27.219  -42.751 -66.643  1.00 118.38 ? 319  THR D CB    1 
ATOM 7799  O OG1   . THR D 1 312 ? -26.269  -43.646 -67.214  1.00 118.68 ? 319  THR D OG1   1 
ATOM 7800  C CG2   . THR D 1 312 ? -26.732  -42.263 -65.267  1.00 118.31 ? 319  THR D CG2   1 
ATOM 7801  N N     . ASP D 1 313 ? -27.796  -44.983 -64.844  1.00 117.54 ? 320  ASP D N     1 
ATOM 7802  C CA    . ASP D 1 313 ? -27.809  -45.705 -63.576  1.00 116.77 ? 320  ASP D CA    1 
ATOM 7803  C C     . ASP D 1 313 ? -26.385  -46.007 -63.100  1.00 116.18 ? 320  ASP D C     1 
ATOM 7804  O O     . ASP D 1 313 ? -25.439  -46.043 -63.909  1.00 116.15 ? 320  ASP D O     1 
ATOM 7805  C CB    . ASP D 1 313 ? -28.613  -47.001 -63.704  1.00 116.60 ? 320  ASP D CB    1 
ATOM 7806  C CG    . ASP D 1 313 ? -29.489  -47.262 -62.492  1.00 116.91 ? 320  ASP D CG    1 
ATOM 7807  O OD1   . ASP D 1 313 ? -29.172  -46.743 -61.393  1.00 117.10 ? 320  ASP D OD1   1 
ATOM 7808  O OD2   . ASP D 1 313 ? -30.506  -47.980 -62.640  1.00 116.94 ? 320  ASP D OD2   1 
ATOM 7809  N N     . LYS D 1 314 ? -26.239  -46.186 -61.784  1.00 115.22 ? 321  LYS D N     1 
ATOM 7810  C CA    . LYS D 1 314 ? -24.982  -46.651 -61.190  1.00 114.06 ? 321  LYS D CA    1 
ATOM 7811  C C     . LYS D 1 314 ? -25.229  -48.002 -60.509  1.00 113.23 ? 321  LYS D C     1 
ATOM 7812  O O     . LYS D 1 314 ? -26.372  -48.358 -60.209  1.00 112.94 ? 321  LYS D O     1 
ATOM 7813  C CB    . LYS D 1 314 ? -24.374  -45.619 -60.220  1.00 113.99 ? 321  LYS D CB    1 
ATOM 7814  C CG    . LYS D 1 314 ? -24.889  -45.715 -58.805  1.00 114.20 ? 321  LYS D CG    1 
ATOM 7815  C CD    . LYS D 1 314 ? -24.329  -44.630 -57.882  1.00 115.91 ? 321  LYS D CD    1 
ATOM 7816  C CE    . LYS D 1 314 ? -25.042  -44.717 -56.499  1.00 117.17 ? 321  LYS D CE    1 
ATOM 7817  N NZ    . LYS D 1 314 ? -24.947  -43.521 -55.597  1.00 116.36 ? 321  LYS D NZ    1 
ATOM 7818  N N     . ALA D 1 315 ? -24.147  -48.754 -60.306  1.00 112.48 ? 322  ALA D N     1 
ATOM 7819  C CA    . ALA D 1 315 ? -24.177  -50.080 -59.689  1.00 111.39 ? 322  ALA D CA    1 
ATOM 7820  C C     . ALA D 1 315 ? -22.940  -50.195 -58.806  1.00 110.66 ? 322  ALA D C     1 
ATOM 7821  O O     . ALA D 1 315 ? -21.928  -50.747 -59.233  1.00 110.63 ? 322  ALA D O     1 
ATOM 7822  C CB    . ALA D 1 315 ? -24.194  -51.195 -60.769  1.00 111.21 ? 322  ALA D CB    1 
ATOM 7823  N N     . GLU D 1 316 ? -23.021  -49.647 -57.593  1.00 109.81 ? 323  GLU D N     1 
ATOM 7824  C CA    . GLU D 1 316 ? -21.919  -49.689 -56.638  1.00 109.31 ? 323  GLU D CA    1 
ATOM 7825  C C     . GLU D 1 316 ? -21.795  -51.056 -55.899  1.00 109.09 ? 323  GLU D C     1 
ATOM 7826  O O     . GLU D 1 316 ? -22.743  -51.850 -55.861  1.00 109.25 ? 323  GLU D O     1 
ATOM 7827  C CB    . GLU D 1 316 ? -22.090  -48.543 -55.661  1.00 109.22 ? 323  GLU D CB    1 
ATOM 7828  C CG    . GLU D 1 316 ? -20.799  -47.951 -55.187  1.00 109.44 ? 323  GLU D CG    1 
ATOM 7829  C CD    . GLU D 1 316 ? -20.989  -46.570 -54.583  1.00 110.68 ? 323  GLU D CD    1 
ATOM 7830  O OE1   . GLU D 1 316 ? -22.151  -46.114 -54.434  1.00 111.06 ? 323  GLU D OE1   1 
ATOM 7831  O OE2   . GLU D 1 316 ? -19.969  -45.931 -54.258  1.00 111.19 ? 323  GLU D OE2   1 
ATOM 7832  N N     . TYR D 1 317 ? -20.616  -51.328 -55.335  1.00 108.49 ? 324  TYR D N     1 
ATOM 7833  C CA    . TYR D 1 317 ? -20.304  -52.587 -54.643  1.00 107.80 ? 324  TYR D CA    1 
ATOM 7834  C C     . TYR D 1 317 ? -19.032  -52.448 -53.798  1.00 107.82 ? 324  TYR D C     1 
ATOM 7835  O O     . TYR D 1 317 ? -17.934  -52.599 -54.308  1.00 107.80 ? 324  TYR D O     1 
ATOM 7836  C CB    . TYR D 1 317 ? -20.010  -53.690 -55.652  1.00 107.48 ? 324  TYR D CB    1 
ATOM 7837  C CG    . TYR D 1 317 ? -21.136  -54.165 -56.517  1.00 106.61 ? 324  TYR D CG    1 
ATOM 7838  C CD1   . TYR D 1 317 ? -21.378  -53.590 -57.755  1.00 106.71 ? 324  TYR D CD1   1 
ATOM 7839  C CD2   . TYR D 1 317 ? -21.910  -55.242 -56.138  1.00 106.29 ? 324  TYR D CD2   1 
ATOM 7840  C CE1   . TYR D 1 317 ? -22.403  -54.048 -58.584  1.00 107.05 ? 324  TYR D CE1   1 
ATOM 7841  C CE2   . TYR D 1 317 ? -22.931  -55.717 -56.948  1.00 107.47 ? 324  TYR D CE2   1 
ATOM 7842  C CZ    . TYR D 1 317 ? -23.180  -55.109 -58.171  1.00 107.59 ? 324  TYR D CZ    1 
ATOM 7843  O OH    . TYR D 1 317 ? -24.198  -55.577 -58.979  1.00 108.31 ? 324  TYR D OH    1 
ATOM 7844  N N     . THR D 1 318 ? -19.142  -52.192 -52.509  1.00 107.98 ? 325  THR D N     1 
ATOM 7845  C CA    . THR D 1 318 ? -17.918  -52.146 -51.697  1.00 108.22 ? 325  THR D CA    1 
ATOM 7846  C C     . THR D 1 318 ? -17.599  -53.497 -51.000  1.00 108.67 ? 325  THR D C     1 
ATOM 7847  O O     . THR D 1 318 ? -18.486  -54.350 -50.864  1.00 108.94 ? 325  THR D O     1 
ATOM 7848  C CB    . THR D 1 318 ? -17.903  -50.922 -50.713  1.00 108.15 ? 325  THR D CB    1 
ATOM 7849  O OG1   . THR D 1 318 ? -18.284  -51.320 -49.383  1.00 107.81 ? 325  THR D OG1   1 
ATOM 7850  C CG2   . THR D 1 318 ? -18.787  -49.751 -51.252  1.00 107.72 ? 325  THR D CG2   1 
ATOM 7851  N N     . PHE D 1 319 ? -16.343  -53.692 -50.578  1.00 108.79 ? 326  PHE D N     1 
ATOM 7852  C CA    . PHE D 1 319 ? -15.890  -54.977 -50.015  1.00 108.91 ? 326  PHE D CA    1 
ATOM 7853  C C     . PHE D 1 319 ? -14.402  -54.998 -49.654  1.00 109.59 ? 326  PHE D C     1 
ATOM 7854  O O     . PHE D 1 319 ? -13.551  -54.747 -50.494  1.00 109.67 ? 326  PHE D O     1 
ATOM 7855  C CB    . PHE D 1 319 ? -16.188  -56.122 -50.982  1.00 108.54 ? 326  PHE D CB    1 
ATOM 7856  C CG    . PHE D 1 319 ? -15.318  -56.127 -52.202  1.00 107.55 ? 326  PHE D CG    1 
ATOM 7857  C CD1   . PHE D 1 319 ? -14.473  -57.198 -52.454  1.00 105.54 ? 326  PHE D CD1   1 
ATOM 7858  C CD2   . PHE D 1 319 ? -15.329  -55.047 -53.095  1.00 106.74 ? 326  PHE D CD2   1 
ATOM 7859  C CE1   . PHE D 1 319 ? -13.674  -57.195 -53.567  1.00 104.97 ? 326  PHE D CE1   1 
ATOM 7860  C CE2   . PHE D 1 319 ? -14.521  -55.040 -54.211  1.00 105.51 ? 326  PHE D CE2   1 
ATOM 7861  C CZ    . PHE D 1 319 ? -13.702  -56.116 -54.456  1.00 105.21 ? 326  PHE D CZ    1 
ATOM 7862  N N     . TYR D 1 320 ? -14.116  -55.346 -48.401  1.00 110.57 ? 327  TYR D N     1 
ATOM 7863  C CA    . TYR D 1 320 ? -12.771  -55.305 -47.775  1.00 111.30 ? 327  TYR D CA    1 
ATOM 7864  C C     . TYR D 1 320 ? -12.272  -56.739 -47.451  1.00 111.18 ? 327  TYR D C     1 
ATOM 7865  O O     . TYR D 1 320 ? -13.086  -57.658 -47.282  1.00 111.56 ? 327  TYR D O     1 
ATOM 7866  C CB    . TYR D 1 320 ? -12.855  -54.447 -46.503  1.00 111.27 ? 327  TYR D CB    1 
ATOM 7867  C CG    . TYR D 1 320 ? -11.572  -54.228 -45.745  1.00 113.35 ? 327  TYR D CG    1 
ATOM 7868  C CD1   . TYR D 1 320 ? -10.843  -53.053 -45.919  1.00 116.13 ? 327  TYR D CD1   1 
ATOM 7869  C CD2   . TYR D 1 320 ? -11.104  -55.161 -44.819  1.00 115.33 ? 327  TYR D CD2   1 
ATOM 7870  C CE1   . TYR D 1 320 ? -9.657   -52.799 -45.197  1.00 117.80 ? 327  TYR D CE1   1 
ATOM 7871  C CE2   . TYR D 1 320 ? -9.918   -54.933 -44.088  1.00 117.90 ? 327  TYR D CE2   1 
ATOM 7872  C CZ    . TYR D 1 320 ? -9.199   -53.743 -44.281  1.00 118.88 ? 327  TYR D CZ    1 
ATOM 7873  O OH    . TYR D 1 320 ? -8.032   -53.503 -43.569  1.00 119.38 ? 327  TYR D OH    1 
ATOM 7874  N N     . GLU D 1 321 ? -10.957  -56.937 -47.354  1.00 110.90 ? 328  GLU D N     1 
ATOM 7875  C CA    . GLU D 1 321 ? -10.423  -58.301 -47.240  1.00 110.56 ? 328  GLU D CA    1 
ATOM 7876  C C     . GLU D 1 321 ? -10.185  -58.822 -45.816  1.00 110.14 ? 328  GLU D C     1 
ATOM 7877  O O     . GLU D 1 321 ? -9.708   -59.954 -45.652  1.00 110.16 ? 328  GLU D O     1 
ATOM 7878  C CB    . GLU D 1 321 ? -9.173   -58.496 -48.110  1.00 110.74 ? 328  GLU D CB    1 
ATOM 7879  C CG    . GLU D 1 321 ? -9.454   -58.493 -49.601  1.00 110.81 ? 328  GLU D CG    1 
ATOM 7880  C CD    . GLU D 1 321 ? -8.494   -59.367 -50.388  1.00 111.81 ? 328  GLU D CD    1 
ATOM 7881  O OE1   . GLU D 1 321 ? -7.820   -60.245 -49.802  1.00 111.58 ? 328  GLU D OE1   1 
ATOM 7882  O OE2   . GLU D 1 321 ? -8.423   -59.176 -51.616  1.00 113.19 ? 328  GLU D OE2   1 
ATOM 7883  N N     . GLY D 1 322 ? -10.526  -58.004 -44.817  1.00 109.35 ? 329  GLY D N     1 
ATOM 7884  C CA    . GLY D 1 322 ? -10.522  -58.370 -43.384  1.00 108.74 ? 329  GLY D CA    1 
ATOM 7885  C C     . GLY D 1 322 ? -9.833   -59.617 -42.809  1.00 108.31 ? 329  GLY D C     1 
ATOM 7886  O O     . GLY D 1 322 ? -9.720   -59.733 -41.584  1.00 108.16 ? 329  GLY D O     1 
ATOM 7887  N N     . MET D 1 323 ? -9.404   -60.548 -43.670  1.00 107.81 ? 330  MET D N     1 
ATOM 7888  C CA    . MET D 1 323 ? -8.624   -61.747 -43.294  1.00 107.42 ? 330  MET D CA    1 
ATOM 7889  C C     . MET D 1 323 ? -7.661   -62.139 -44.421  1.00 107.43 ? 330  MET D C     1 
ATOM 7890  O O     . MET D 1 323 ? -7.332   -63.333 -44.591  1.00 107.39 ? 330  MET D O     1 
ATOM 7891  C CB    . MET D 1 323 ? -9.543   -62.942 -42.954  1.00 107.42 ? 330  MET D CB    1 
ATOM 7892  C CG    . MET D 1 323 ? -9.481   -63.452 -41.504  1.00 106.71 ? 330  MET D CG    1 
ATOM 7893  S SD    . MET D 1 323 ? -9.817   -62.207 -40.211  1.00 106.58 ? 330  MET D SD    1 
ATOM 7894  C CE    . MET D 1 323 ? -9.099   -63.033 -38.780  1.00 105.93 ? 330  MET D CE    1 
ATOM 7895  N N     . GLY D 1 324 ? -7.230   -61.133 -45.193  1.00 107.11 ? 331  GLY D N     1 
ATOM 7896  C CA    . GLY D 1 324 ? -6.317   -61.331 -46.318  1.00 106.57 ? 331  GLY D CA    1 
ATOM 7897  C C     . GLY D 1 324 ? -6.926   -62.181 -47.418  1.00 106.35 ? 331  GLY D C     1 
ATOM 7898  O O     . GLY D 1 324 ? -8.130   -62.446 -47.397  1.00 106.18 ? 331  GLY D O     1 
ATOM 7899  N N     . PRO D 1 325 ? -6.096   -62.601 -48.398  1.00 106.46 ? 332  PRO D N     1 
ATOM 7900  C CA    . PRO D 1 325 ? -6.497   -63.468 -49.520  1.00 106.21 ? 332  PRO D CA    1 
ATOM 7901  C C     . PRO D 1 325 ? -7.554   -64.495 -49.192  1.00 105.52 ? 332  PRO D C     1 
ATOM 7902  O O     . PRO D 1 325 ? -7.528   -65.094 -48.135  1.00 105.44 ? 332  PRO D O     1 
ATOM 7903  C CB    . PRO D 1 325 ? -5.184   -64.172 -49.901  1.00 106.38 ? 332  PRO D CB    1 
ATOM 7904  C CG    . PRO D 1 325 ? -4.077   -63.116 -49.563  1.00 106.72 ? 332  PRO D CG    1 
ATOM 7905  C CD    . PRO D 1 325 ? -4.722   -62.085 -48.604  1.00 106.78 ? 332  PRO D CD    1 
ATOM 7906  N N     . VAL D 1 326 ? -8.475   -64.670 -50.119  1.00 105.12 ? 333  VAL D N     1 
ATOM 7907  C CA    . VAL D 1 326 ? -9.537   -65.640 -50.020  1.00 104.94 ? 333  VAL D CA    1 
ATOM 7908  C C     . VAL D 1 326 ? -9.590   -66.294 -51.396  1.00 104.60 ? 333  VAL D C     1 
ATOM 7909  O O     . VAL D 1 326 ? -9.522   -65.603 -52.409  1.00 104.41 ? 333  VAL D O     1 
ATOM 7910  C CB    . VAL D 1 326 ? -10.883  -64.949 -49.679  1.00 105.22 ? 333  VAL D CB    1 
ATOM 7911  C CG1   . VAL D 1 326 ? -10.873  -64.352 -48.262  1.00 105.31 ? 333  VAL D CG1   1 
ATOM 7912  C CG2   . VAL D 1 326 ? -11.204  -63.853 -50.682  1.00 105.93 ? 333  VAL D CG2   1 
ATOM 7913  N N     . LEU D 1 327 ? -9.687   -67.615 -51.457  1.00 104.51 ? 334  LEU D N     1 
ATOM 7914  C CA    . LEU D 1 327 ? -9.503   -68.304 -52.752  1.00 104.70 ? 334  LEU D CA    1 
ATOM 7915  C C     . LEU D 1 327 ? -10.636  -68.055 -53.779  1.00 104.41 ? 334  LEU D C     1 
ATOM 7916  O O     . LEU D 1 327 ? -10.366  -67.880 -54.985  1.00 105.17 ? 334  LEU D O     1 
ATOM 7917  C CB    . LEU D 1 327 ? -9.213   -69.812 -52.573  1.00 104.86 ? 334  LEU D CB    1 
ATOM 7918  C CG    . LEU D 1 327 ? -10.323  -70.849 -52.261  1.00 106.45 ? 334  LEU D CG    1 
ATOM 7919  C CD1   . LEU D 1 327 ? -11.374  -70.337 -51.196  1.00 107.80 ? 334  LEU D CD1   1 
ATOM 7920  C CD2   . LEU D 1 327 ? -11.018  -71.416 -53.550  1.00 106.06 ? 334  LEU D CD2   1 
ATOM 7921  N N     . ALA D 1 328 ? -11.887  -68.044 -53.311  1.00 103.22 ? 335  ALA D N     1 
ATOM 7922  C CA    . ALA D 1 328 ? -13.038  -67.903 -54.203  1.00 101.64 ? 335  ALA D CA    1 
ATOM 7923  C C     . ALA D 1 328 ? -13.431  -66.445 -54.397  1.00 100.53 ? 335  ALA D C     1 
ATOM 7924  O O     . ALA D 1 328 ? -13.058  -65.585 -53.585  1.00 100.09 ? 335  ALA D O     1 
ATOM 7925  C CB    . ALA D 1 328 ? -14.201  -68.703 -53.684  1.00 102.00 ? 335  ALA D CB    1 
ATOM 7926  N N     . PRO D 1 329 ? -14.189  -66.158 -55.471  1.00 99.59  ? 336  PRO D N     1 
ATOM 7927  C CA    . PRO D 1 329 ? -14.505  -64.783 -55.808  1.00 99.15  ? 336  PRO D CA    1 
ATOM 7928  C C     . PRO D 1 329 ? -15.270  -64.134 -54.687  1.00 98.84  ? 336  PRO D C     1 
ATOM 7929  O O     . PRO D 1 329 ? -16.060  -64.798 -54.012  1.00 99.14  ? 336  PRO D O     1 
ATOM 7930  C CB    . PRO D 1 329 ? -15.406  -64.922 -57.033  1.00 98.95  ? 336  PRO D CB    1 
ATOM 7931  C CG    . PRO D 1 329 ? -15.065  -66.233 -57.597  1.00 99.10  ? 336  PRO D CG    1 
ATOM 7932  C CD    . PRO D 1 329 ? -14.852  -67.085 -56.395  1.00 99.66  ? 336  PRO D CD    1 
ATOM 7933  N N     . VAL D 1 330 ? -15.023  -62.848 -54.497  1.00 98.13  ? 337  VAL D N     1 
ATOM 7934  C CA    . VAL D 1 330 ? -15.659  -62.057 -53.445  1.00 97.71  ? 337  VAL D CA    1 
ATOM 7935  C C     . VAL D 1 330 ? -17.095  -61.647 -53.803  1.00 96.85  ? 337  VAL D C     1 
ATOM 7936  O O     . VAL D 1 330 ? -17.667  -60.715 -53.233  1.00 96.90  ? 337  VAL D O     1 
ATOM 7937  C CB    . VAL D 1 330 ? -14.834  -60.799 -53.197  1.00 98.07  ? 337  VAL D CB    1 
ATOM 7938  C CG1   . VAL D 1 330 ? -13.701  -61.099 -52.245  1.00 98.21  ? 337  VAL D CG1   1 
ATOM 7939  C CG2   . VAL D 1 330 ? -14.298  -60.279 -54.539  1.00 98.46  ? 337  VAL D CG2   1 
ATOM 7940  N N     . THR D 1 331 ? -17.663  -62.382 -54.741  1.00 95.85  ? 338  THR D N     1 
ATOM 7941  C CA    . THR D 1 331 ? -18.895  -62.038 -55.407  1.00 95.12  ? 338  THR D CA    1 
ATOM 7942  C C     . THR D 1 331 ? -19.814  -63.222 -55.198  1.00 94.70  ? 338  THR D C     1 
ATOM 7943  O O     . THR D 1 331 ? -19.311  -64.337 -55.041  1.00 95.74  ? 338  THR D O     1 
ATOM 7944  C CB    . THR D 1 331 ? -18.585  -61.878 -56.920  1.00 95.38  ? 338  THR D CB    1 
ATOM 7945  O OG1   . THR D 1 331 ? -19.074  -60.607 -57.387  1.00 96.00  ? 338  THR D OG1   1 
ATOM 7946  C CG2   . THR D 1 331 ? -19.069  -63.104 -57.821  1.00 94.03  ? 338  THR D CG2   1 
ATOM 7947  N N     . PRO D 1 332 ? -21.147  -63.029 -55.200  1.00 93.59  ? 339  PRO D N     1 
ATOM 7948  C CA    . PRO D 1 332 ? -21.983  -61.856 -55.299  1.00 92.74  ? 339  PRO D CA    1 
ATOM 7949  C C     . PRO D 1 332 ? -21.859  -60.975 -54.084  1.00 92.03  ? 339  PRO D C     1 
ATOM 7950  O O     . PRO D 1 332 ? -21.648  -61.456 -52.976  1.00 92.20  ? 339  PRO D O     1 
ATOM 7951  C CB    . PRO D 1 332 ? -23.389  -62.452 -55.339  1.00 92.90  ? 339  PRO D CB    1 
ATOM 7952  C CG    . PRO D 1 332 ? -23.244  -63.823 -54.717  1.00 92.81  ? 339  PRO D CG    1 
ATOM 7953  C CD    . PRO D 1 332 ? -21.961  -64.258 -55.248  1.00 93.33  ? 339  PRO D CD    1 
ATOM 7954  N N     . VAL D 1 333 ? -22.032  -59.688 -54.304  1.00 91.19  ? 340  VAL D N     1 
ATOM 7955  C CA    . VAL D 1 333 ? -21.794  -58.710 -53.267  1.00 90.63  ? 340  VAL D CA    1 
ATOM 7956  C C     . VAL D 1 333 ? -23.094  -58.171 -52.692  1.00 90.02  ? 340  VAL D C     1 
ATOM 7957  O O     . VAL D 1 333 ? -23.941  -57.622 -53.405  1.00 90.08  ? 340  VAL D O     1 
ATOM 7958  C CB    . VAL D 1 333 ? -20.953  -57.549 -53.790  1.00 90.81  ? 340  VAL D CB    1 
ATOM 7959  C CG1   . VAL D 1 333 ? -20.717  -56.494 -52.691  1.00 90.83  ? 340  VAL D CG1   1 
ATOM 7960  C CG2   . VAL D 1 333 ? -19.650  -58.073 -54.369  1.00 91.46  ? 340  VAL D CG2   1 
ATOM 7961  N N     . PRO D 1 334 ? -23.252  -58.342 -51.384  1.00 89.28  ? 341  PRO D N     1 
ATOM 7962  C CA    . PRO D 1 334 ? -24.421  -57.926 -50.635  1.00 88.49  ? 341  PRO D CA    1 
ATOM 7963  C C     . PRO D 1 334 ? -24.610  -56.418 -50.612  1.00 87.89  ? 341  PRO D C     1 
ATOM 7964  O O     . PRO D 1 334 ? -23.716  -55.673 -50.200  1.00 87.75  ? 341  PRO D O     1 
ATOM 7965  C CB    . PRO D 1 334 ? -24.117  -58.457 -49.246  1.00 88.37  ? 341  PRO D CB    1 
ATOM 7966  C CG    . PRO D 1 334 ? -23.353  -59.721 -49.536  1.00 89.11  ? 341  PRO D CG    1 
ATOM 7967  C CD    . PRO D 1 334 ? -22.429  -59.297 -50.622  1.00 89.26  ? 341  PRO D CD    1 
ATOM 7968  N N     . VAL D 1 335 ? -25.786  -55.992 -51.062  1.00 87.40  ? 342  VAL D N     1 
ATOM 7969  C CA    . VAL D 1 335 ? -26.189  -54.584 -51.030  1.00 86.74  ? 342  VAL D CA    1 
ATOM 7970  C C     . VAL D 1 335 ? -27.535  -54.435 -50.299  1.00 86.43  ? 342  VAL D C     1 
ATOM 7971  O O     . VAL D 1 335 ? -28.472  -55.234 -50.502  1.00 85.61  ? 342  VAL D O     1 
ATOM 7972  C CB    . VAL D 1 335 ? -26.143  -53.921 -52.462  1.00 86.68  ? 342  VAL D CB    1 
ATOM 7973  C CG1   . VAL D 1 335 ? -25.862  -54.958 -53.568  1.00 86.01  ? 342  VAL D CG1   1 
ATOM 7974  C CG2   . VAL D 1 335 ? -27.414  -53.098 -52.762  1.00 86.98  ? 342  VAL D CG2   1 
ATOM 7975  N N     . VAL D 1 336 ? -27.601  -53.424 -49.434  1.00 86.54  ? 343  VAL D N     1 
ATOM 7976  C CA    . VAL D 1 336 ? -28.658  -53.361 -48.430  1.00 87.35  ? 343  VAL D CA    1 
ATOM 7977  C C     . VAL D 1 336 ? -29.531  -52.134 -48.503  1.00 88.50  ? 343  VAL D C     1 
ATOM 7978  O O     . VAL D 1 336 ? -29.236  -51.113 -47.877  1.00 88.53  ? 343  VAL D O     1 
ATOM 7979  C CB    . VAL D 1 336 ? -28.093  -53.471 -47.000  1.00 87.29  ? 343  VAL D CB    1 
ATOM 7980  C CG1   . VAL D 1 336 ? -29.025  -52.809 -45.962  1.00 86.18  ? 343  VAL D CG1   1 
ATOM 7981  C CG2   . VAL D 1 336 ? -27.843  -54.939 -46.649  1.00 86.77  ? 343  VAL D CG2   1 
ATOM 7982  N N     . GLU D 1 337 ? -30.631  -52.269 -49.243  1.00 90.01  ? 344  GLU D N     1 
ATOM 7983  C CA    . GLU D 1 337 ? -31.617  -51.200 -49.439  1.00 91.26  ? 344  GLU D CA    1 
ATOM 7984  C C     . GLU D 1 337 ? -32.251  -50.671 -48.151  1.00 91.91  ? 344  GLU D C     1 
ATOM 7985  O O     . GLU D 1 337 ? -32.320  -49.463 -47.935  1.00 91.73  ? 344  GLU D O     1 
ATOM 7986  C CB    . GLU D 1 337 ? -32.697  -51.670 -50.397  1.00 91.08  ? 344  GLU D CB    1 
ATOM 7987  C CG    . GLU D 1 337 ? -32.330  -51.418 -51.798  1.00 93.22  ? 344  GLU D CG    1 
ATOM 7988  C CD    . GLU D 1 337 ? -32.372  -52.676 -52.643  1.00 97.53  ? 344  GLU D CD    1 
ATOM 7989  O OE1   . GLU D 1 337 ? -33.415  -53.407 -52.609  1.00 98.46  ? 344  GLU D OE1   1 
ATOM 7990  O OE2   . GLU D 1 337 ? -31.352  -52.909 -53.361  1.00 98.68  ? 344  GLU D OE2   1 
ATOM 7991  N N     . SER D 1 338 ? -32.727  -51.559 -47.292  1.00 93.18  ? 345  SER D N     1 
ATOM 7992  C CA    . SER D 1 338 ? -33.411  -51.075 -46.099  1.00 94.57  ? 345  SER D CA    1 
ATOM 7993  C C     . SER D 1 338 ? -33.239  -51.923 -44.854  1.00 94.80  ? 345  SER D C     1 
ATOM 7994  O O     . SER D 1 338 ? -33.058  -53.160 -44.923  1.00 94.98  ? 345  SER D O     1 
ATOM 7995  C CB    . SER D 1 338 ? -34.909  -50.848 -46.362  1.00 95.04  ? 345  SER D CB    1 
ATOM 7996  O OG    . SER D 1 338 ? -35.516  -50.243 -45.215  1.00 96.52  ? 345  SER D OG    1 
ATOM 7997  N N     . LEU D 1 339 ? -33.350  -51.234 -43.721  1.00 94.79  ? 346  LEU D N     1 
ATOM 7998  C CA    . LEU D 1 339 ? -33.124  -51.838 -42.434  1.00 94.95  ? 346  LEU D CA    1 
ATOM 7999  C C     . LEU D 1 339 ? -34.284  -51.563 -41.502  1.00 95.22  ? 346  LEU D C     1 
ATOM 8000  O O     . LEU D 1 339 ? -34.466  -50.438 -41.034  1.00 95.14  ? 346  LEU D O     1 
ATOM 8001  C CB    . LEU D 1 339 ? -31.837  -51.284 -41.873  1.00 94.98  ? 346  LEU D CB    1 
ATOM 8002  C CG    . LEU D 1 339 ? -31.364  -51.684 -40.489  1.00 94.92  ? 346  LEU D CG    1 
ATOM 8003  C CD1   . LEU D 1 339 ? -29.883  -51.962 -40.589  1.00 93.99  ? 346  LEU D CD1   1 
ATOM 8004  C CD2   . LEU D 1 339 ? -31.665  -50.551 -39.476  1.00 95.33  ? 346  LEU D CD2   1 
ATOM 8005  N N     . GLN D 1 340 ? -35.054  -52.616 -41.233  1.00 95.71  ? 347  GLN D N     1 
ATOM 8006  C CA    . GLN D 1 340 ? -36.281  -52.546 -40.442  1.00 96.18  ? 347  GLN D CA    1 
ATOM 8007  C C     . GLN D 1 340 ? -36.128  -53.082 -39.044  1.00 95.99  ? 347  GLN D C     1 
ATOM 8008  O O     . GLN D 1 340 ? -35.495  -54.116 -38.793  1.00 95.69  ? 347  GLN D O     1 
ATOM 8009  C CB    . GLN D 1 340 ? -37.393  -53.344 -41.106  1.00 96.59  ? 347  GLN D CB    1 
ATOM 8010  C CG    . GLN D 1 340 ? -38.519  -52.526 -41.667  1.00 98.96  ? 347  GLN D CG    1 
ATOM 8011  C CD    . GLN D 1 340 ? -38.138  -51.849 -42.947  1.00 102.45 ? 347  GLN D CD    1 
ATOM 8012  O OE1   . GLN D 1 340 ? -38.140  -50.626 -43.010  1.00 104.92 ? 347  GLN D OE1   1 
ATOM 8013  N NE2   . GLN D 1 340 ? -37.780  -52.629 -43.974  1.00 102.43 ? 347  GLN D NE2   1 
ATOM 8014  N N     . LEU D 1 341 ? -36.782  -52.394 -38.138  1.00 96.12  ? 348  LEU D N     1 
ATOM 8015  C CA    . LEU D 1 341 ? -36.737  -52.780 -36.765  1.00 96.64  ? 348  LEU D CA    1 
ATOM 8016  C C     . LEU D 1 341 ? -37.991  -53.578 -36.362  1.00 96.58  ? 348  LEU D C     1 
ATOM 8017  O O     . LEU D 1 341 ? -39.029  -52.997 -36.084  1.00 96.71  ? 348  LEU D O     1 
ATOM 8018  C CB    . LEU D 1 341 ? -36.545  -51.510 -35.938  1.00 96.77  ? 348  LEU D CB    1 
ATOM 8019  C CG    . LEU D 1 341 ? -36.433  -51.526 -34.411  1.00 98.46  ? 348  LEU D CG    1 
ATOM 8020  C CD1   . LEU D 1 341 ? -37.769  -51.117 -33.817  1.00 99.51  ? 348  LEU D CD1   1 
ATOM 8021  C CD2   . LEU D 1 341 ? -35.898  -52.849 -33.779  1.00 99.77  ? 348  LEU D CD2   1 
ATOM 8022  N N     . ASN D 1 342 ? -37.888  -54.908 -36.352  1.00 96.76  ? 349  ASN D N     1 
ATOM 8023  C CA    . ASN D 1 342 ? -38.959  -55.785 -35.854  1.00 97.01  ? 349  ASN D CA    1 
ATOM 8024  C C     . ASN D 1 342 ? -38.889  -55.905 -34.351  1.00 97.57  ? 349  ASN D C     1 
ATOM 8025  O O     . ASN D 1 342 ? -37.812  -56.094 -33.801  1.00 98.08  ? 349  ASN D O     1 
ATOM 8026  C CB    . ASN D 1 342 ? -38.811  -57.192 -36.406  1.00 96.66  ? 349  ASN D CB    1 
ATOM 8027  C CG    . ASN D 1 342 ? -38.864  -57.241 -37.909  1.00 96.48  ? 349  ASN D CG    1 
ATOM 8028  O OD1   . ASN D 1 342 ? -38.864  -58.320 -38.493  1.00 95.94  ? 349  ASN D OD1   1 
ATOM 8029  N ND2   . ASN D 1 342 ? -38.917  -56.079 -38.550  1.00 95.94  ? 349  ASN D ND2   1 
ATOM 8030  N N     . GLY D 1 343 ? -40.023  -55.815 -33.674  1.00 97.82  ? 350  GLY D N     1 
ATOM 8031  C CA    . GLY D 1 343 ? -40.032  -56.002 -32.230  1.00 98.06  ? 350  GLY D CA    1 
ATOM 8032  C C     . GLY D 1 343 ? -39.343  -54.906 -31.446  1.00 98.29  ? 350  GLY D C     1 
ATOM 8033  O O     . GLY D 1 343 ? -38.928  -53.898 -32.007  1.00 97.67  ? 350  GLY D O     1 
ATOM 8034  N N     . GLY D 1 344 ? -39.214  -55.133 -30.141  1.00 99.24  ? 351  GLY D N     1 
ATOM 8035  C CA    . GLY D 1 344 ? -38.693  -54.141 -29.191  1.00 100.60 ? 351  GLY D CA    1 
ATOM 8036  C C     . GLY D 1 344 ? -37.876  -54.687 -28.022  1.00 101.35 ? 351  GLY D C     1 
ATOM 8037  O O     . GLY D 1 344 ? -38.124  -55.805 -27.523  1.00 101.50 ? 351  GLY D O     1 
ATOM 8038  N N     . GLY D 1 345 ? -36.891  -53.890 -27.593  1.00 101.76 ? 352  GLY D N     1 
ATOM 8039  C CA    . GLY D 1 345 ? -36.063  -54.205 -26.417  1.00 102.22 ? 352  GLY D CA    1 
ATOM 8040  C C     . GLY D 1 345 ? -35.486  -55.616 -26.336  1.00 102.27 ? 352  GLY D C     1 
ATOM 8041  O O     . GLY D 1 345 ? -34.669  -56.006 -27.191  1.00 102.45 ? 352  GLY D O     1 
ATOM 8042  N N     . ASP D 1 346 ? -35.908  -56.375 -25.313  1.00 102.01 ? 353  ASP D N     1 
ATOM 8043  C CA    . ASP D 1 346 ? -35.292  -57.682 -25.003  1.00 102.09 ? 353  ASP D CA    1 
ATOM 8044  C C     . ASP D 1 346 ? -35.582  -58.749 -26.055  1.00 101.16 ? 353  ASP D C     1 
ATOM 8045  O O     . ASP D 1 346 ? -34.887  -59.770 -26.126  1.00 101.32 ? 353  ASP D O     1 
ATOM 8046  C CB    . ASP D 1 346 ? -35.671  -58.182 -23.603  1.00 102.99 ? 353  ASP D CB    1 
ATOM 8047  C CG    . ASP D 1 346 ? -37.172  -58.045 -23.307  1.00 105.79 ? 353  ASP D CG    1 
ATOM 8048  O OD1   . ASP D 1 346 ? -37.863  -59.098 -23.236  1.00 107.97 ? 353  ASP D OD1   1 
ATOM 8049  O OD2   . ASP D 1 346 ? -37.651  -56.887 -23.148  1.00 107.44 ? 353  ASP D OD2   1 
ATOM 8050  N N     . VAL D 1 347 ? -36.590  -58.492 -26.887  1.00 99.75  ? 354  VAL D N     1 
ATOM 8051  C CA    . VAL D 1 347 ? -36.880  -59.340 -28.042  1.00 97.91  ? 354  VAL D CA    1 
ATOM 8052  C C     . VAL D 1 347 ? -36.366  -58.738 -29.359  1.00 96.89  ? 354  VAL D C     1 
ATOM 8053  O O     . VAL D 1 347 ? -36.239  -59.472 -30.349  1.00 97.41  ? 354  VAL D O     1 
ATOM 8054  C CB    . VAL D 1 347 ? -38.370  -59.567 -28.176  1.00 97.78  ? 354  VAL D CB    1 
ATOM 8055  C CG1   . VAL D 1 347 ? -38.645  -60.825 -28.988  1.00 97.26  ? 354  VAL D CG1   1 
ATOM 8056  C CG2   . VAL D 1 347 ? -38.994  -59.634 -26.796  1.00 97.59  ? 354  VAL D CG2   1 
ATOM 8057  N N     . ALA D 1 348 ? -36.069  -57.429 -29.358  1.00 94.62  ? 355  ALA D N     1 
ATOM 8058  C CA    . ALA D 1 348 ? -35.664  -56.679 -30.556  1.00 92.63  ? 355  ALA D CA    1 
ATOM 8059  C C     . ALA D 1 348 ? -34.816  -57.440 -31.556  1.00 91.27  ? 355  ALA D C     1 
ATOM 8060  O O     . ALA D 1 348 ? -33.754  -57.961 -31.224  1.00 91.17  ? 355  ALA D O     1 
ATOM 8061  C CB    . ALA D 1 348 ? -34.975  -55.393 -30.176  1.00 92.84  ? 355  ALA D CB    1 
ATOM 8062  N N     . MET D 1 349 ? -35.330  -57.508 -32.777  1.00 89.63  ? 356  MET D N     1 
ATOM 8063  C CA    . MET D 1 349 ? -34.587  -57.970 -33.937  1.00 88.15  ? 356  MET D CA    1 
ATOM 8064  C C     . MET D 1 349 ? -34.593  -56.892 -35.026  1.00 87.63  ? 356  MET D C     1 
ATOM 8065  O O     . MET D 1 349 ? -34.996  -55.742 -34.797  1.00 87.63  ? 356  MET D O     1 
ATOM 8066  C CB    . MET D 1 349 ? -35.179  -59.249 -34.487  1.00 87.62  ? 356  MET D CB    1 
ATOM 8067  C CG    . MET D 1 349 ? -34.979  -60.431 -33.619  1.00 87.37  ? 356  MET D CG    1 
ATOM 8068  S SD    . MET D 1 349 ? -35.707  -61.925 -34.331  1.00 89.07  ? 356  MET D SD    1 
ATOM 8069  C CE    . MET D 1 349 ? -35.283  -61.754 -36.073  1.00 88.86  ? 356  MET D CE    1 
ATOM 8070  N N     . LEU D 1 350 ? -34.172  -57.279 -36.219  1.00 86.53  ? 357  LEU D N     1 
ATOM 8071  C CA    . LEU D 1 350 ? -33.918  -56.347 -37.262  1.00 85.48  ? 357  LEU D CA    1 
ATOM 8072  C C     . LEU D 1 350 ? -34.068  -57.129 -38.538  1.00 85.45  ? 357  LEU D C     1 
ATOM 8073  O O     . LEU D 1 350 ? -33.477  -58.225 -38.687  1.00 85.64  ? 357  LEU D O     1 
ATOM 8074  C CB    . LEU D 1 350 ? -32.478  -55.936 -37.107  1.00 85.45  ? 357  LEU D CB    1 
ATOM 8075  C CG    . LEU D 1 350 ? -32.029  -54.571 -37.568  1.00 85.87  ? 357  LEU D CG    1 
ATOM 8076  C CD1   . LEU D 1 350 ? -32.428  -53.512 -36.522  1.00 86.69  ? 357  LEU D CD1   1 
ATOM 8077  C CD2   . LEU D 1 350 ? -30.538  -54.589 -37.786  1.00 84.20  ? 357  LEU D CD2   1 
ATOM 8078  N N     . GLU D 1 351 ? -34.869  -56.606 -39.460  1.00 85.18  ? 358  GLU D N     1 
ATOM 8079  C CA    . GLU D 1 351 ? -34.963  -57.232 -40.780  1.00 85.07  ? 358  GLU D CA    1 
ATOM 8080  C C     . GLU D 1 351 ? -34.210  -56.431 -41.835  1.00 85.11  ? 358  GLU D C     1 
ATOM 8081  O O     . GLU D 1 351 ? -34.271  -55.203 -41.869  1.00 85.20  ? 358  GLU D O     1 
ATOM 8082  C CB    . GLU D 1 351 ? -36.401  -57.450 -41.213  1.00 84.98  ? 358  GLU D CB    1 
ATOM 8083  C CG    . GLU D 1 351 ? -36.517  -58.572 -42.228  1.00 85.48  ? 358  GLU D CG    1 
ATOM 8084  C CD    . GLU D 1 351 ? -37.766  -58.513 -43.121  1.00 86.21  ? 358  GLU D CD    1 
ATOM 8085  O OE1   . GLU D 1 351 ? -37.802  -59.304 -44.102  1.00 86.31  ? 358  GLU D OE1   1 
ATOM 8086  O OE2   . GLU D 1 351 ? -38.692  -57.701 -42.856  1.00 85.18  ? 358  GLU D OE2   1 
ATOM 8087  N N     . LEU D 1 352 ? -33.460  -57.128 -42.672  1.00 85.09  ? 359  LEU D N     1 
ATOM 8088  C CA    . LEU D 1 352 ? -32.661  -56.462 -43.675  1.00 84.96  ? 359  LEU D CA    1 
ATOM 8089  C C     . LEU D 1 352 ? -33.173  -56.911 -45.025  1.00 85.40  ? 359  LEU D C     1 
ATOM 8090  O O     . LEU D 1 352 ? -33.342  -58.122 -45.312  1.00 85.28  ? 359  LEU D O     1 
ATOM 8091  C CB    . LEU D 1 352 ? -31.172  -56.775 -43.495  1.00 84.83  ? 359  LEU D CB    1 
ATOM 8092  C CG    . LEU D 1 352 ? -30.270  -55.859 -42.665  1.00 84.28  ? 359  LEU D CG    1 
ATOM 8093  C CD1   . LEU D 1 352 ? -30.965  -55.401 -41.397  1.00 84.87  ? 359  LEU D CD1   1 
ATOM 8094  C CD2   . LEU D 1 352 ? -28.906  -56.509 -42.343  1.00 83.21  ? 359  LEU D CD2   1 
ATOM 8095  N N     . THR D 1 353 ? -33.462  -55.907 -45.836  1.00 85.53  ? 360  THR D N     1 
ATOM 8096  C CA    . THR D 1 353 ? -33.955  -56.116 -47.176  1.00 85.60  ? 360  THR D CA    1 
ATOM 8097  C C     . THR D 1 353 ? -32.922  -55.494 -48.076  1.00 85.16  ? 360  THR D C     1 
ATOM 8098  O O     . THR D 1 353 ? -32.483  -54.378 -47.831  1.00 85.30  ? 360  THR D O     1 
ATOM 8099  C CB    . THR D 1 353 ? -35.301  -55.404 -47.361  1.00 85.93  ? 360  THR D CB    1 
ATOM 8100  O OG1   . THR D 1 353 ? -35.156  -54.010 -47.028  1.00 86.26  ? 360  THR D OG1   1 
ATOM 8101  C CG2   . THR D 1 353 ? -36.382  -56.051 -46.464  1.00 85.33  ? 360  THR D CG2   1 
ATOM 8102  N N     . GLY D 1 354 ? -32.507  -56.227 -49.088  1.00 84.65  ? 361  GLY D N     1 
ATOM 8103  C CA    . GLY D 1 354 ? -31.468  -55.758 -49.979  1.00 84.69  ? 361  GLY D CA    1 
ATOM 8104  C C     . GLY D 1 354 ? -31.528  -56.698 -51.146  1.00 84.95  ? 361  GLY D C     1 
ATOM 8105  O O     . GLY D 1 354 ? -32.634  -57.057 -51.592  1.00 85.46  ? 361  GLY D O     1 
ATOM 8106  N N     . GLN D 1 355 ? -30.367  -57.105 -51.652  1.00 84.75  ? 362  GLN D N     1 
ATOM 8107  C CA    . GLN D 1 355 ? -30.331  -58.140 -52.696  1.00 85.11  ? 362  GLN D CA    1 
ATOM 8108  C C     . GLN D 1 355 ? -28.962  -58.769 -52.742  1.00 85.11  ? 362  GLN D C     1 
ATOM 8109  O O     . GLN D 1 355 ? -28.006  -58.221 -52.138  1.00 85.10  ? 362  GLN D O     1 
ATOM 8110  C CB    . GLN D 1 355 ? -30.728  -57.599 -54.074  1.00 85.32  ? 362  GLN D CB    1 
ATOM 8111  C CG    . GLN D 1 355 ? -30.650  -56.077 -54.151  1.00 86.95  ? 362  GLN D CG    1 
ATOM 8112  C CD    . GLN D 1 355 ? -30.578  -55.531 -55.546  1.00 88.49  ? 362  GLN D CD    1 
ATOM 8113  O OE1   . GLN D 1 355 ? -30.269  -56.269 -56.506  1.00 89.73  ? 362  GLN D OE1   1 
ATOM 8114  N NE2   . GLN D 1 355 ? -30.840  -54.216 -55.678  1.00 88.05  ? 362  GLN D NE2   1 
ATOM 8115  N N     . ASN D 1 356 ? -28.888  -59.911 -53.448  1.00 84.92  ? 363  ASN D N     1 
ATOM 8116  C CA    . ASN D 1 356 ? -27.743  -60.821 -53.404  1.00 84.93  ? 363  ASN D CA    1 
ATOM 8117  C C     . ASN D 1 356 ? -27.377  -61.256 -51.987  1.00 84.67  ? 363  ASN D C     1 
ATOM 8118  O O     . ASN D 1 356 ? -26.178  -61.238 -51.626  1.00 85.49  ? 363  ASN D O     1 
ATOM 8119  C CB    . ASN D 1 356 ? -26.485  -60.160 -53.988  1.00 85.13  ? 363  ASN D CB    1 
ATOM 8120  C CG    . ASN D 1 356 ? -26.690  -59.631 -55.367  1.00 86.04  ? 363  ASN D CG    1 
ATOM 8121  O OD1   . ASN D 1 356 ? -26.969  -60.392 -56.312  1.00 87.71  ? 363  ASN D OD1   1 
ATOM 8122  N ND2   . ASN D 1 356 ? -26.529  -58.313 -55.514  1.00 86.73  ? 363  ASN D ND2   1 
ATOM 8123  N N     . PHE D 1 357 ? -28.349  -61.601 -51.151  1.00 83.48  ? 364  PHE D N     1 
ATOM 8124  C CA    . PHE D 1 357 ? -27.926  -62.116 -49.867  1.00 82.38  ? 364  PHE D CA    1 
ATOM 8125  C C     . PHE D 1 357 ? -27.632  -63.589 -50.043  1.00 82.01  ? 364  PHE D C     1 
ATOM 8126  O O     . PHE D 1 357 ? -27.938  -64.173 -51.087  1.00 81.51  ? 364  PHE D O     1 
ATOM 8127  C CB    . PHE D 1 357 ? -28.909  -61.841 -48.753  1.00 82.26  ? 364  PHE D CB    1 
ATOM 8128  C CG    . PHE D 1 357 ? -29.084  -60.397 -48.447  1.00 81.40  ? 364  PHE D CG    1 
ATOM 8129  C CD1   . PHE D 1 357 ? -30.068  -59.990 -47.551  1.00 80.84  ? 364  PHE D CD1   1 
ATOM 8130  C CD2   . PHE D 1 357 ? -28.296  -59.445 -49.044  1.00 81.77  ? 364  PHE D CD2   1 
ATOM 8131  C CE1   . PHE D 1 357 ? -30.264  -58.663 -47.225  1.00 80.15  ? 364  PHE D CE1   1 
ATOM 8132  C CE2   . PHE D 1 357 ? -28.487  -58.091 -48.733  1.00 83.39  ? 364  PHE D CE2   1 
ATOM 8133  C CZ    . PHE D 1 357 ? -29.479  -57.706 -47.805  1.00 81.64  ? 364  PHE D CZ    1 
ATOM 8134  N N     . THR D 1 358 ? -26.983  -64.151 -49.031  1.00 81.79  ? 365  THR D N     1 
ATOM 8135  C CA    . THR D 1 358 ? -26.440  -65.498 -49.073  1.00 81.54  ? 365  THR D CA    1 
ATOM 8136  C C     . THR D 1 358 ? -26.374  -66.020 -47.644  1.00 81.37  ? 365  THR D C     1 
ATOM 8137  O O     . THR D 1 358 ? -26.087  -65.258 -46.707  1.00 81.70  ? 365  THR D O     1 
ATOM 8138  C CB    . THR D 1 358 ? -25.011  -65.556 -49.757  1.00 81.54  ? 365  THR D CB    1 
ATOM 8139  O OG1   . THR D 1 358 ? -24.401  -64.250 -49.782  1.00 81.76  ? 365  THR D OG1   1 
ATOM 8140  C CG2   . THR D 1 358 ? -25.111  -66.085 -51.174  1.00 80.86  ? 365  THR D CG2   1 
ATOM 8141  N N     . PRO D 1 359 ? -26.612  -67.322 -47.463  1.00 81.09  ? 366  PRO D N     1 
ATOM 8142  C CA    . PRO D 1 359 ? -26.707  -67.795 -46.105  1.00 81.40  ? 366  PRO D CA    1 
ATOM 8143  C C     . PRO D 1 359 ? -25.439  -67.545 -45.316  1.00 81.63  ? 366  PRO D C     1 
ATOM 8144  O O     . PRO D 1 359 ? -25.510  -67.375 -44.114  1.00 81.57  ? 366  PRO D O     1 
ATOM 8145  C CB    . PRO D 1 359 ? -26.927  -69.296 -46.283  1.00 81.25  ? 366  PRO D CB    1 
ATOM 8146  C CG    . PRO D 1 359 ? -27.284  -69.495 -47.715  1.00 80.65  ? 366  PRO D CG    1 
ATOM 8147  C CD    . PRO D 1 359 ? -26.550  -68.440 -48.411  1.00 81.11  ? 366  PRO D CD    1 
ATOM 8148  N N     . ASN D 1 360 ? -24.306  -67.490 -46.015  1.00 82.20  ? 367  ASN D N     1 
ATOM 8149  C CA    . ASN D 1 360 ? -22.972  -67.368 -45.407  1.00 82.76  ? 367  ASN D CA    1 
ATOM 8150  C C     . ASN D 1 360 ? -22.537  -65.939 -45.003  1.00 82.67  ? 367  ASN D C     1 
ATOM 8151  O O     . ASN D 1 360 ? -21.368  -65.568 -45.151  1.00 82.83  ? 367  ASN D O     1 
ATOM 8152  C CB    . ASN D 1 360 ? -21.927  -68.001 -46.339  1.00 82.91  ? 367  ASN D CB    1 
ATOM 8153  C CG    . ASN D 1 360 ? -21.787  -67.252 -47.669  1.00 84.63  ? 367  ASN D CG    1 
ATOM 8154  O OD1   . ASN D 1 360 ? -22.523  -66.312 -47.972  1.00 86.05  ? 367  ASN D OD1   1 
ATOM 8155  N ND2   . ASN D 1 360 ? -20.830  -67.681 -48.471  1.00 87.32  ? 367  ASN D ND2   1 
ATOM 8156  N N     . LEU D 1 361 ? -23.475  -65.148 -44.508  1.00 82.64  ? 368  LEU D N     1 
ATOM 8157  C CA    . LEU D 1 361 ? -23.168  -63.819 -44.030  1.00 82.96  ? 368  LEU D CA    1 
ATOM 8158  C C     . LEU D 1 361 ? -23.640  -63.738 -42.608  1.00 83.48  ? 368  LEU D C     1 
ATOM 8159  O O     . LEU D 1 361 ? -24.150  -64.721 -42.091  1.00 83.85  ? 368  LEU D O     1 
ATOM 8160  C CB    . LEU D 1 361 ? -23.891  -62.789 -44.882  1.00 83.07  ? 368  LEU D CB    1 
ATOM 8161  C CG    . LEU D 1 361 ? -23.261  -62.523 -46.267  1.00 83.12  ? 368  LEU D CG    1 
ATOM 8162  C CD1   . LEU D 1 361 ? -23.926  -63.296 -47.367  1.00 81.47  ? 368  LEU D CD1   1 
ATOM 8163  C CD2   . LEU D 1 361 ? -23.266  -61.025 -46.603  1.00 82.76  ? 368  LEU D CD2   1 
ATOM 8164  N N     . ARG D 1 362 ? -23.496  -62.584 -41.970  1.00 83.85  ? 369  ARG D N     1 
ATOM 8165  C CA    . ARG D 1 362 ? -23.820  -62.443 -40.546  1.00 84.49  ? 369  ARG D CA    1 
ATOM 8166  C C     . ARG D 1 362 ? -23.655  -60.969 -40.316  1.00 84.59  ? 369  ARG D C     1 
ATOM 8167  O O     . ARG D 1 362 ? -22.579  -60.433 -40.508  1.00 84.38  ? 369  ARG D O     1 
ATOM 8168  C CB    . ARG D 1 362 ? -22.837  -63.221 -39.623  1.00 84.74  ? 369  ARG D CB    1 
ATOM 8169  C CG    . ARG D 1 362 ? -23.357  -64.397 -38.729  1.00 85.21  ? 369  ARG D CG    1 
ATOM 8170  C CD    . ARG D 1 362 ? -23.992  -65.531 -39.539  1.00 88.29  ? 369  ARG D CD    1 
ATOM 8171  N NE    . ARG D 1 362 ? -23.356  -66.858 -39.375  1.00 90.91  ? 369  ARG D NE    1 
ATOM 8172  C CZ    . ARG D 1 362 ? -23.435  -67.874 -40.257  1.00 90.24  ? 369  ARG D CZ    1 
ATOM 8173  N NH1   . ARG D 1 362 ? -24.105  -67.735 -41.390  1.00 88.69  ? 369  ARG D NH1   1 
ATOM 8174  N NH2   . ARG D 1 362 ? -22.823  -69.034 -40.016  1.00 90.13  ? 369  ARG D NH2   1 
ATOM 8175  N N     . VAL D 1 363 ? -24.721  -60.306 -39.919  1.00 85.29  ? 370  VAL D N     1 
ATOM 8176  C CA    . VAL D 1 363 ? -24.665  -58.867 -39.723  1.00 86.21  ? 370  VAL D CA    1 
ATOM 8177  C C     . VAL D 1 363 ? -24.006  -58.533 -38.402  1.00 87.14  ? 370  VAL D C     1 
ATOM 8178  O O     . VAL D 1 363 ? -24.418  -59.058 -37.388  1.00 87.75  ? 370  VAL D O     1 
ATOM 8179  C CB    . VAL D 1 363 ? -26.075  -58.210 -39.845  1.00 85.97  ? 370  VAL D CB    1 
ATOM 8180  C CG1   . VAL D 1 363 ? -27.147  -59.263 -39.919  1.00 85.70  ? 370  VAL D CG1   1 
ATOM 8181  C CG2   . VAL D 1 363 ? -26.330  -57.200 -38.725  1.00 85.42  ? 370  VAL D CG2   1 
ATOM 8182  N N     . TRP D 1 364 ? -22.978  -57.684 -38.421  1.00 88.35  ? 371  TRP D N     1 
ATOM 8183  C CA    . TRP D 1 364 ? -22.282  -57.254 -37.204  1.00 89.59  ? 371  TRP D CA    1 
ATOM 8184  C C     . TRP D 1 364 ? -22.705  -55.876 -36.777  1.00 90.50  ? 371  TRP D C     1 
ATOM 8185  O O     . TRP D 1 364 ? -22.646  -54.918 -37.559  1.00 90.55  ? 371  TRP D O     1 
ATOM 8186  C CB    . TRP D 1 364 ? -20.794  -57.167 -37.437  1.00 89.59  ? 371  TRP D CB    1 
ATOM 8187  C CG    . TRP D 1 364 ? -20.089  -58.418 -37.496  1.00 90.67  ? 371  TRP D CG    1 
ATOM 8188  C CD1   . TRP D 1 364 ? -20.385  -59.492 -38.260  1.00 92.91  ? 371  TRP D CD1   1 
ATOM 8189  C CD2   . TRP D 1 364 ? -18.899  -58.730 -36.799  1.00 91.27  ? 371  TRP D CD2   1 
ATOM 8190  N NE1   . TRP D 1 364 ? -19.449  -60.481 -38.078  1.00 92.91  ? 371  TRP D NE1   1 
ATOM 8191  C CE2   . TRP D 1 364 ? -18.524  -60.036 -37.178  1.00 91.70  ? 371  TRP D CE2   1 
ATOM 8192  C CE3   . TRP D 1 364 ? -18.108  -58.032 -35.888  1.00 90.37  ? 371  TRP D CE3   1 
ATOM 8193  C CZ2   . TRP D 1 364 ? -17.404  -60.664 -36.670  1.00 91.11  ? 371  TRP D CZ2   1 
ATOM 8194  C CZ3   . TRP D 1 364 ? -17.006  -58.646 -35.385  1.00 90.28  ? 371  TRP D CZ3   1 
ATOM 8195  C CH2   . TRP D 1 364 ? -16.659  -59.959 -35.770  1.00 91.47  ? 371  TRP D CH2   1 
ATOM 8196  N N     . PHE D 1 365 ? -23.089  -55.762 -35.517  1.00 91.97  ? 372  PHE D N     1 
ATOM 8197  C CA    . PHE D 1 365 ? -23.361  -54.447 -34.934  1.00 93.65  ? 372  PHE D CA    1 
ATOM 8198  C C     . PHE D 1 365 ? -22.042  -53.947 -34.393  1.00 94.56  ? 372  PHE D C     1 
ATOM 8199  O O     . PHE D 1 365 ? -21.582  -54.421 -33.352  1.00 95.11  ? 372  PHE D O     1 
ATOM 8200  C CB    . PHE D 1 365 ? -24.428  -54.526 -33.830  1.00 93.58  ? 372  PHE D CB    1 
ATOM 8201  C CG    . PHE D 1 365 ? -25.801  -54.924 -34.336  1.00 93.93  ? 372  PHE D CG    1 
ATOM 8202  C CD1   . PHE D 1 365 ? -25.984  -56.124 -35.059  1.00 92.68  ? 372  PHE D CD1   1 
ATOM 8203  C CD2   . PHE D 1 365 ? -26.909  -54.098 -34.095  1.00 93.72  ? 372  PHE D CD2   1 
ATOM 8204  C CE1   . PHE D 1 365 ? -27.228  -56.487 -35.524  1.00 92.00  ? 372  PHE D CE1   1 
ATOM 8205  C CE2   . PHE D 1 365 ? -28.164  -54.453 -34.562  1.00 93.92  ? 372  PHE D CE2   1 
ATOM 8206  C CZ    . PHE D 1 365 ? -28.325  -55.662 -35.276  1.00 93.59  ? 372  PHE D CZ    1 
ATOM 8207  N N     . GLY D 1 366 ? -21.418  -53.022 -35.123  1.00 95.39  ? 373  GLY D N     1 
ATOM 8208  C CA    . GLY D 1 366 ? -20.055  -52.601 -34.818  1.00 95.82  ? 373  GLY D CA    1 
ATOM 8209  C C     . GLY D 1 366 ? -19.144  -53.809 -34.853  1.00 96.08  ? 373  GLY D C     1 
ATOM 8210  O O     . GLY D 1 366 ? -19.017  -54.461 -35.896  1.00 95.99  ? 373  GLY D O     1 
ATOM 8211  N N     . ASP D 1 367 ? -18.545  -54.112 -33.695  1.00 96.36  ? 374  ASP D N     1 
ATOM 8212  C CA    . ASP D 1 367 ? -17.571  -55.213 -33.548  1.00 96.46  ? 374  ASP D CA    1 
ATOM 8213  C C     . ASP D 1 367 ? -18.141  -56.490 -32.929  1.00 96.57  ? 374  ASP D C     1 
ATOM 8214  O O     . ASP D 1 367 ? -17.424  -57.485 -32.812  1.00 96.82  ? 374  ASP D O     1 
ATOM 8215  C CB    . ASP D 1 367 ? -16.357  -54.765 -32.727  1.00 96.32  ? 374  ASP D CB    1 
ATOM 8216  C CG    . ASP D 1 367 ? -16.715  -54.400 -31.311  1.00 96.27  ? 374  ASP D CG    1 
ATOM 8217  O OD1   . ASP D 1 367 ? -17.433  -53.399 -31.106  1.00 96.76  ? 374  ASP D OD1   1 
ATOM 8218  O OD2   . ASP D 1 367 ? -16.262  -55.118 -30.411  1.00 96.08  ? 374  ASP D OD2   1 
ATOM 8219  N N     . VAL D 1 368 ? -19.420  -56.459 -32.528  1.00 96.43  ? 375  VAL D N     1 
ATOM 8220  C CA    . VAL D 1 368 ? -20.119  -57.628 -31.960  1.00 95.77  ? 375  VAL D CA    1 
ATOM 8221  C C     . VAL D 1 368 ? -20.912  -58.342 -33.037  1.00 95.34  ? 375  VAL D C     1 
ATOM 8222  O O     . VAL D 1 368 ? -21.839  -57.766 -33.609  1.00 95.12  ? 375  VAL D O     1 
ATOM 8223  C CB    . VAL D 1 368 ? -21.100  -57.228 -30.841  1.00 95.85  ? 375  VAL D CB    1 
ATOM 8224  C CG1   . VAL D 1 368 ? -21.153  -58.320 -29.779  1.00 96.91  ? 375  VAL D CG1   1 
ATOM 8225  C CG2   . VAL D 1 368 ? -20.704  -55.908 -30.204  1.00 95.50  ? 375  VAL D CG2   1 
ATOM 8226  N N     . GLU D 1 369 ? -20.531  -59.579 -33.335  1.00 95.09  ? 376  GLU D N     1 
ATOM 8227  C CA    . GLU D 1 369 ? -21.258  -60.366 -34.326  1.00 95.30  ? 376  GLU D CA    1 
ATOM 8228  C C     . GLU D 1 369 ? -22.610  -60.724 -33.706  1.00 95.71  ? 376  GLU D C     1 
ATOM 8229  O O     . GLU D 1 369 ? -22.674  -61.060 -32.509  1.00 96.32  ? 376  GLU D O     1 
ATOM 8230  C CB    . GLU D 1 369 ? -20.481  -61.617 -34.720  1.00 94.87  ? 376  GLU D CB    1 
ATOM 8231  C CG    . GLU D 1 369 ? -21.228  -62.583 -35.598  1.00 95.90  ? 376  GLU D CG    1 
ATOM 8232  C CD    . GLU D 1 369 ? -20.290  -63.516 -36.371  1.00 99.40  ? 376  GLU D CD    1 
ATOM 8233  O OE1   . GLU D 1 369 ? -19.632  -63.083 -37.354  1.00 100.77 ? 376  GLU D OE1   1 
ATOM 8234  O OE2   . GLU D 1 369 ? -20.210  -64.706 -36.015  1.00 100.24 ? 376  GLU D OE2   1 
ATOM 8235  N N     . ALA D 1 370 ? -23.685  -60.602 -34.498  1.00 95.53  ? 377  ALA D N     1 
ATOM 8236  C CA    . ALA D 1 370 ? -25.053  -60.906 -34.051  1.00 94.74  ? 377  ALA D CA    1 
ATOM 8237  C C     . ALA D 1 370 ? -25.579  -62.069 -34.845  1.00 94.34  ? 377  ALA D C     1 
ATOM 8238  O O     . ALA D 1 370 ? -25.282  -62.204 -36.039  1.00 94.06  ? 377  ALA D O     1 
ATOM 8239  C CB    . ALA D 1 370 ? -25.951  -59.721 -34.217  1.00 94.64  ? 377  ALA D CB    1 
ATOM 8240  N N     . GLU D 1 371 ? -26.348  -62.918 -34.171  1.00 94.08  ? 378  GLU D N     1 
ATOM 8241  C CA    . GLU D 1 371 ? -26.841  -64.136 -34.796  1.00 93.84  ? 378  GLU D CA    1 
ATOM 8242  C C     . GLU D 1 371 ? -27.742  -63.771 -35.957  1.00 92.97  ? 378  GLU D C     1 
ATOM 8243  O O     . GLU D 1 371 ? -28.610  -62.880 -35.855  1.00 92.67  ? 378  GLU D O     1 
ATOM 8244  C CB    . GLU D 1 371 ? -27.589  -65.016 -33.802  1.00 94.19  ? 378  GLU D CB    1 
ATOM 8245  C CG    . GLU D 1 371 ? -28.089  -66.312 -34.426  1.00 96.11  ? 378  GLU D CG    1 
ATOM 8246  C CD    . GLU D 1 371 ? -29.167  -66.968 -33.605  1.00 98.42  ? 378  GLU D CD    1 
ATOM 8247  O OE1   . GLU D 1 371 ? -29.652  -66.294 -32.659  1.00 98.11  ? 378  GLU D OE1   1 
ATOM 8248  O OE2   . GLU D 1 371 ? -29.512  -68.146 -33.907  1.00 99.14  ? 378  GLU D OE2   1 
ATOM 8249  N N     . THR D 1 372 ? -27.532  -64.472 -37.058  1.00 91.74  ? 379  THR D N     1 
ATOM 8250  C CA    . THR D 1 372 ? -28.147  -64.050 -38.273  1.00 90.79  ? 379  THR D CA    1 
ATOM 8251  C C     . THR D 1 372 ? -28.962  -65.143 -38.898  1.00 90.15  ? 379  THR D C     1 
ATOM 8252  O O     . THR D 1 372 ? -28.451  -66.213 -39.200  1.00 90.19  ? 379  THR D O     1 
ATOM 8253  C CB    . THR D 1 372 ? -27.083  -63.513 -39.195  1.00 90.80  ? 379  THR D CB    1 
ATOM 8254  O OG1   . THR D 1 372 ? -26.668  -62.246 -38.680  1.00 91.10  ? 379  THR D OG1   1 
ATOM 8255  C CG2   . THR D 1 372 ? -27.603  -63.326 -40.599  1.00 91.17  ? 379  THR D CG2   1 
ATOM 8256  N N     . MET D 1 373 ? -30.251  -64.863 -39.047  1.00 89.25  ? 380  MET D N     1 
ATOM 8257  C CA    . MET D 1 373 ? -31.149  -65.718 -39.797  1.00 88.33  ? 380  MET D CA    1 
ATOM 8258  C C     . MET D 1 373 ? -31.320  -65.172 -41.209  1.00 87.04  ? 380  MET D C     1 
ATOM 8259  O O     . MET D 1 373 ? -31.689  -64.010 -41.419  1.00 86.95  ? 380  MET D O     1 
ATOM 8260  C CB    . MET D 1 373 ? -32.521  -65.833 -39.128  1.00 88.87  ? 380  MET D CB    1 
ATOM 8261  C CG    . MET D 1 373 ? -32.614  -66.811 -37.984  1.00 90.71  ? 380  MET D CG    1 
ATOM 8262  S SD    . MET D 1 373 ? -32.189  -66.036 -36.413  1.00 96.47  ? 380  MET D SD    1 
ATOM 8263  C CE    . MET D 1 373 ? -33.509  -64.855 -36.161  1.00 94.27  ? 380  MET D CE    1 
ATOM 8264  N N     . TYR D 1 374 ? -31.060  -66.040 -42.171  1.00 85.31  ? 381  TYR D N     1 
ATOM 8265  C CA    . TYR D 1 374 ? -31.188  -65.737 -43.573  1.00 83.80  ? 381  TYR D CA    1 
ATOM 8266  C C     . TYR D 1 374 ? -32.591  -66.155 -44.017  1.00 83.49  ? 381  TYR D C     1 
ATOM 8267  O O     . TYR D 1 374 ? -32.930  -67.329 -43.971  1.00 84.07  ? 381  TYR D O     1 
ATOM 8268  C CB    . TYR D 1 374 ? -30.094  -66.520 -44.302  1.00 83.28  ? 381  TYR D CB    1 
ATOM 8269  C CG    . TYR D 1 374 ? -30.307  -66.673 -45.759  1.00 82.30  ? 381  TYR D CG    1 
ATOM 8270  C CD1   . TYR D 1 374 ? -30.047  -65.618 -46.631  1.00 82.82  ? 381  TYR D CD1   1 
ATOM 8271  C CD2   . TYR D 1 374 ? -30.762  -67.867 -46.284  1.00 82.33  ? 381  TYR D CD2   1 
ATOM 8272  C CE1   . TYR D 1 374 ? -30.249  -65.746 -48.013  1.00 82.88  ? 381  TYR D CE1   1 
ATOM 8273  C CE2   . TYR D 1 374 ? -30.977  -68.007 -47.659  1.00 83.78  ? 381  TYR D CE2   1 
ATOM 8274  C CZ    . TYR D 1 374 ? -30.718  -66.944 -48.519  1.00 83.07  ? 381  TYR D CZ    1 
ATOM 8275  O OH    . TYR D 1 374 ? -30.937  -67.091 -49.868  1.00 82.34  ? 381  TYR D OH    1 
ATOM 8276  N N     . ARG D 1 375 ? -33.444  -65.214 -44.404  1.00 82.84  ? 382  ARG D N     1 
ATOM 8277  C CA    . ARG D 1 375 ? -34.752  -65.623 -44.918  1.00 82.16  ? 382  ARG D CA    1 
ATOM 8278  C C     . ARG D 1 375 ? -34.710  -65.937 -46.392  1.00 81.83  ? 382  ARG D C     1 
ATOM 8279  O O     . ARG D 1 375 ? -35.152  -66.995 -46.813  1.00 81.64  ? 382  ARG D O     1 
ATOM 8280  C CB    . ARG D 1 375 ? -35.855  -64.628 -44.601  1.00 82.24  ? 382  ARG D CB    1 
ATOM 8281  C CG    . ARG D 1 375 ? -36.341  -64.669 -43.146  1.00 83.52  ? 382  ARG D CG    1 
ATOM 8282  C CD    . ARG D 1 375 ? -36.641  -66.094 -42.609  1.00 84.63  ? 382  ARG D CD    1 
ATOM 8283  N NE    . ARG D 1 375 ? -38.037  -66.447 -42.804  1.00 86.49  ? 382  ARG D NE    1 
ATOM 8284  C CZ    . ARG D 1 375 ? -38.478  -67.667 -43.127  1.00 89.21  ? 382  ARG D CZ    1 
ATOM 8285  N NH1   . ARG D 1 375 ? -37.639  -68.687 -43.308  1.00 89.40  ? 382  ARG D NH1   1 
ATOM 8286  N NH2   . ARG D 1 375 ? -39.780  -67.876 -43.299  1.00 91.33  ? 382  ARG D NH2   1 
ATOM 8287  N N     . CYS D 1 376 ? -34.165  -65.027 -47.187  1.00 81.97  ? 383  CYS D N     1 
ATOM 8288  C CA    . CYS D 1 376 ? -33.900  -65.325 -48.600  1.00 82.09  ? 383  CYS D CA    1 
ATOM 8289  C C     . CYS D 1 376 ? -33.061  -64.232 -49.237  1.00 81.75  ? 383  CYS D C     1 
ATOM 8290  O O     . CYS D 1 376 ? -32.956  -63.139 -48.681  1.00 80.94  ? 383  CYS D O     1 
ATOM 8291  C CB    . CYS D 1 376 ? -35.224  -65.430 -49.381  1.00 82.45  ? 383  CYS D CB    1 
ATOM 8292  S SG    . CYS D 1 376 ? -35.985  -63.785 -49.735  1.00 82.78  ? 383  CYS D SG    1 
ATOM 8293  N N     . GLY D 1 377 ? -32.517  -64.539 -50.421  1.00 81.71  ? 384  GLY D N     1 
ATOM 8294  C CA    . GLY D 1 377 ? -31.913  -63.554 -51.327  1.00 82.35  ? 384  GLY D CA    1 
ATOM 8295  C C     . GLY D 1 377 ? -32.073  -62.064 -50.990  1.00 82.87  ? 384  GLY D C     1 
ATOM 8296  O O     . GLY D 1 377 ? -31.090  -61.302 -50.951  1.00 83.15  ? 384  GLY D O     1 
ATOM 8297  N N     . GLU D 1 378 ? -33.293  -61.625 -50.727  1.00 82.73  ? 385  GLU D N     1 
ATOM 8298  C CA    . GLU D 1 378 ? -33.504  -60.201 -50.623  1.00 83.13  ? 385  GLU D CA    1 
ATOM 8299  C C     . GLU D 1 378 ? -33.995  -59.736 -49.242  1.00 83.87  ? 385  GLU D C     1 
ATOM 8300  O O     . GLU D 1 378 ? -34.368  -58.565 -49.053  1.00 83.72  ? 385  GLU D O     1 
ATOM 8301  C CB    . GLU D 1 378 ? -34.361  -59.713 -51.789  1.00 82.72  ? 385  GLU D CB    1 
ATOM 8302  C CG    . GLU D 1 378 ? -35.249  -60.796 -52.439  1.00 83.53  ? 385  GLU D CG    1 
ATOM 8303  C CD    . GLU D 1 378 ? -34.505  -61.834 -53.340  1.00 83.82  ? 385  GLU D CD    1 
ATOM 8304  O OE1   . GLU D 1 378 ? -33.319  -61.629 -53.705  1.00 84.87  ? 385  GLU D OE1   1 
ATOM 8305  O OE2   . GLU D 1 378 ? -35.132  -62.867 -53.696  1.00 82.32  ? 385  GLU D OE2   1 
ATOM 8306  N N     . SER D 1 379 ? -33.923  -60.659 -48.277  1.00 84.90  ? 386  SER D N     1 
ATOM 8307  C CA    . SER D 1 379 ? -34.361  -60.439 -46.881  1.00 85.67  ? 386  SER D CA    1 
ATOM 8308  C C     . SER D 1 379 ? -33.475  -61.204 -45.901  1.00 86.28  ? 386  SER D C     1 
ATOM 8309  O O     . SER D 1 379 ? -33.181  -62.389 -46.136  1.00 86.53  ? 386  SER D O     1 
ATOM 8310  C CB    . SER D 1 379 ? -35.764  -61.010 -46.697  1.00 85.73  ? 386  SER D CB    1 
ATOM 8311  O OG    . SER D 1 379 ? -35.713  -62.414 -46.945  1.00 85.04  ? 386  SER D OG    1 
ATOM 8312  N N     . MET D 1 380 ? -33.092  -60.560 -44.797  1.00 86.56  ? 387  MET D N     1 
ATOM 8313  C CA    . MET D 1 380 ? -32.400  -61.255 -43.713  1.00 87.35  ? 387  MET D CA    1 
ATOM 8314  C C     . MET D 1 380 ? -32.820  -60.727 -42.376  1.00 88.17  ? 387  MET D C     1 
ATOM 8315  O O     . MET D 1 380 ? -33.411  -59.657 -42.288  1.00 88.38  ? 387  MET D O     1 
ATOM 8316  C CB    . MET D 1 380 ? -30.903  -61.087 -43.825  1.00 87.25  ? 387  MET D CB    1 
ATOM 8317  C CG    . MET D 1 380 ? -30.187  -62.254 -44.415  1.00 87.31  ? 387  MET D CG    1 
ATOM 8318  S SD    . MET D 1 380 ? -28.574  -61.682 -44.924  1.00 88.73  ? 387  MET D SD    1 
ATOM 8319  C CE    . MET D 1 380 ? -28.089  -60.588 -43.558  1.00 86.28  ? 387  MET D CE    1 
ATOM 8320  N N     . LEU D 1 381 ? -32.469  -61.471 -41.332  1.00 89.15  ? 388  LEU D N     1 
ATOM 8321  C CA    . LEU D 1 381 ? -32.919  -61.194 -39.969  1.00 89.67  ? 388  LEU D CA    1 
ATOM 8322  C C     . LEU D 1 381 ? -31.818  -61.446 -38.982  1.00 90.19  ? 388  LEU D C     1 
ATOM 8323  O O     . LEU D 1 381 ? -31.108  -62.454 -39.071  1.00 89.89  ? 388  LEU D O     1 
ATOM 8324  C CB    . LEU D 1 381 ? -34.050  -62.147 -39.603  1.00 89.64  ? 388  LEU D CB    1 
ATOM 8325  C CG    . LEU D 1 381 ? -35.455  -61.928 -40.114  1.00 88.54  ? 388  LEU D CG    1 
ATOM 8326  C CD1   . LEU D 1 381 ? -36.207  -63.186 -39.897  1.00 88.02  ? 388  LEU D CD1   1 
ATOM 8327  C CD2   . LEU D 1 381 ? -36.067  -60.815 -39.319  1.00 87.93  ? 388  LEU D CD2   1 
ATOM 8328  N N     . CYS D 1 382 ? -31.701  -60.562 -38.007  1.00 91.18  ? 389  CYS D N     1 
ATOM 8329  C CA    . CYS D 1 382 ? -30.669  -60.744 -36.981  1.00 92.70  ? 389  CYS D CA    1 
ATOM 8330  C C     . CYS D 1 382 ? -31.088  -60.211 -35.621  1.00 93.20  ? 389  CYS D C     1 
ATOM 8331  O O     . CYS D 1 382 ? -31.968  -59.342 -35.526  1.00 93.16  ? 389  CYS D O     1 
ATOM 8332  C CB    . CYS D 1 382 ? -29.383  -60.062 -37.413  1.00 92.79  ? 389  CYS D CB    1 
ATOM 8333  S SG    . CYS D 1 382 ? -29.642  -58.300 -37.681  1.00 93.94  ? 389  CYS D SG    1 
ATOM 8334  N N     . VAL D 1 383 ? -30.451  -60.720 -34.571  1.00 94.01  ? 390  VAL D N     1 
ATOM 8335  C CA    . VAL D 1 383 ? -30.882  -60.367 -33.225  1.00 95.14  ? 390  VAL D CA    1 
ATOM 8336  C C     . VAL D 1 383 ? -30.066  -59.244 -32.605  1.00 96.52  ? 390  VAL D C     1 
ATOM 8337  O O     . VAL D 1 383 ? -28.929  -59.446 -32.175  1.00 96.43  ? 390  VAL D O     1 
ATOM 8338  C CB    . VAL D 1 383 ? -30.884  -61.568 -32.270  1.00 94.89  ? 390  VAL D CB    1 
ATOM 8339  C CG1   . VAL D 1 383 ? -31.559  -61.180 -30.973  1.00 93.94  ? 390  VAL D CG1   1 
ATOM 8340  C CG2   . VAL D 1 383 ? -31.548  -62.784 -32.915  1.00 94.13  ? 390  VAL D CG2   1 
ATOM 8341  N N     . VAL D 1 384 ? -30.675  -58.064 -32.569  1.00 98.37  ? 391  VAL D N     1 
ATOM 8342  C CA    . VAL D 1 384 ? -30.133  -56.886 -31.917  1.00 100.19 ? 391  VAL D CA    1 
ATOM 8343  C C     . VAL D 1 384 ? -29.449  -57.311 -30.631  1.00 101.99 ? 391  VAL D C     1 
ATOM 8344  O O     . VAL D 1 384 ? -30.138  -57.645 -29.686  1.00 102.49 ? 391  VAL D O     1 
ATOM 8345  C CB    . VAL D 1 384 ? -31.276  -55.929 -31.570  1.00 99.79  ? 391  VAL D CB    1 
ATOM 8346  C CG1   . VAL D 1 384 ? -30.802  -54.775 -30.733  1.00 99.92  ? 391  VAL D CG1   1 
ATOM 8347  C CG2   . VAL D 1 384 ? -31.896  -55.420 -32.816  1.00 99.85  ? 391  VAL D CG2   1 
ATOM 8348  N N     . PRO D 1 385 ? -28.097  -57.306 -30.585  1.00 103.82 ? 392  PRO D N     1 
ATOM 8349  C CA    . PRO D 1 385 ? -27.403  -57.782 -29.384  1.00 105.50 ? 392  PRO D CA    1 
ATOM 8350  C C     . PRO D 1 385 ? -27.608  -56.816 -28.222  1.00 107.29 ? 392  PRO D C     1 
ATOM 8351  O O     . PRO D 1 385 ? -27.904  -55.645 -28.451  1.00 107.08 ? 392  PRO D O     1 
ATOM 8352  C CB    . PRO D 1 385 ? -25.935  -57.817 -29.818  1.00 105.43 ? 392  PRO D CB    1 
ATOM 8353  C CG    . PRO D 1 385 ? -25.834  -56.763 -30.853  1.00 104.57 ? 392  PRO D CG    1 
ATOM 8354  C CD    . PRO D 1 385 ? -27.158  -56.736 -31.568  1.00 103.92 ? 392  PRO D CD    1 
ATOM 8355  N N     . ASP D 1 386 ? -27.466  -57.305 -26.990  1.00 109.68 ? 393  ASP D N     1 
ATOM 8356  C CA    . ASP D 1 386 ? -27.760  -56.483 -25.795  1.00 112.15 ? 393  ASP D CA    1 
ATOM 8357  C C     . ASP D 1 386 ? -26.892  -55.222 -25.736  1.00 113.12 ? 393  ASP D C     1 
ATOM 8358  O O     . ASP D 1 386 ? -25.761  -55.244 -26.212  1.00 113.09 ? 393  ASP D O     1 
ATOM 8359  C CB    . ASP D 1 386 ? -27.629  -57.298 -24.489  1.00 112.30 ? 393  ASP D CB    1 
ATOM 8360  C CG    . ASP D 1 386 ? -28.447  -56.694 -23.338  1.00 114.42 ? 393  ASP D CG    1 
ATOM 8361  O OD1   . ASP D 1 386 ? -29.692  -56.872 -23.327  1.00 117.15 ? 393  ASP D OD1   1 
ATOM 8362  O OD2   . ASP D 1 386 ? -27.856  -56.037 -22.449  1.00 115.45 ? 393  ASP D OD2   1 
ATOM 8363  N N     . ILE D 1 387 ? -27.409  -54.132 -25.163  1.00 114.62 ? 394  ILE D N     1 
ATOM 8364  C CA    . ILE D 1 387 ? -26.620  -52.895 -25.090  1.00 116.45 ? 394  ILE D CA    1 
ATOM 8365  C C     . ILE D 1 387 ? -25.275  -53.117 -24.402  1.00 118.18 ? 394  ILE D C     1 
ATOM 8366  O O     . ILE D 1 387 ? -24.237  -52.584 -24.821  1.00 118.71 ? 394  ILE D O     1 
ATOM 8367  C CB    . ILE D 1 387 ? -27.376  -51.723 -24.442  1.00 116.16 ? 394  ILE D CB    1 
ATOM 8368  C CG1   . ILE D 1 387 ? -26.418  -50.566 -24.149  1.00 115.73 ? 394  ILE D CG1   1 
ATOM 8369  C CG2   . ILE D 1 387 ? -28.055  -52.162 -23.180  1.00 116.18 ? 394  ILE D CG2   1 
ATOM 8370  C CD1   . ILE D 1 387 ? -26.871  -49.246 -24.678  1.00 115.35 ? 394  ILE D CD1   1 
ATOM 8371  N N     . SER D 1 388 ? -25.294  -53.937 -23.360  1.00 120.21 ? 395  SER D N     1 
ATOM 8372  C CA    . SER D 1 388 ? -24.075  -54.354 -22.671  1.00 121.83 ? 395  SER D CA    1 
ATOM 8373  C C     . SER D 1 388 ? -23.177  -55.245 -23.545  1.00 122.92 ? 395  SER D C     1 
ATOM 8374  O O     . SER D 1 388 ? -22.592  -56.198 -23.043  1.00 123.37 ? 395  SER D O     1 
ATOM 8375  C CB    . SER D 1 388 ? -24.442  -55.064 -21.357  1.00 121.83 ? 395  SER D CB    1 
ATOM 8376  O OG    . SER D 1 388 ? -25.494  -56.008 -21.549  1.00 122.05 ? 395  SER D OG    1 
ATOM 8377  N N     . ALA D 1 389 ? -23.099  -54.959 -24.845  1.00 124.16 ? 396  ALA D N     1 
ATOM 8378  C CA    . ALA D 1 389 ? -22.119  -55.592 -25.714  1.00 125.56 ? 396  ALA D CA    1 
ATOM 8379  C C     . ALA D 1 389 ? -21.168  -54.498 -26.113  1.00 126.70 ? 396  ALA D C     1 
ATOM 8380  O O     . ALA D 1 389 ? -20.080  -54.752 -26.620  1.00 126.85 ? 396  ALA D O     1 
ATOM 8381  C CB    . ALA D 1 389 ? -22.770  -56.205 -26.931  1.00 125.39 ? 396  ALA D CB    1 
ATOM 8382  N N     . PHE D 1 390 ? -21.592  -53.270 -25.855  1.00 128.24 ? 397  PHE D N     1 
ATOM 8383  C CA    . PHE D 1 390 ? -20.837  -52.106 -26.235  1.00 129.94 ? 397  PHE D CA    1 
ATOM 8384  C C     . PHE D 1 390 ? -20.441  -51.348 -24.993  1.00 131.61 ? 397  PHE D C     1 
ATOM 8385  O O     . PHE D 1 390 ? -19.251  -51.180 -24.723  1.00 132.13 ? 397  PHE D O     1 
ATOM 8386  C CB    . PHE D 1 390 ? -21.666  -51.238 -27.165  1.00 129.62 ? 397  PHE D CB    1 
ATOM 8387  C CG    . PHE D 1 390 ? -22.129  -51.953 -28.399  1.00 128.58 ? 397  PHE D CG    1 
ATOM 8388  C CD1   . PHE D 1 390 ? -21.234  -52.298 -29.395  1.00 127.94 ? 397  PHE D CD1   1 
ATOM 8389  C CD2   . PHE D 1 390 ? -23.456  -52.281 -28.568  1.00 127.75 ? 397  PHE D CD2   1 
ATOM 8390  C CE1   . PHE D 1 390 ? -21.662  -52.948 -30.540  1.00 127.24 ? 397  PHE D CE1   1 
ATOM 8391  C CE2   . PHE D 1 390 ? -23.885  -52.940 -29.714  1.00 127.31 ? 397  PHE D CE2   1 
ATOM 8392  C CZ    . PHE D 1 390 ? -22.990  -53.269 -30.699  1.00 126.72 ? 397  PHE D CZ    1 
ATOM 8393  N N     . ARG D 1 391 ? -21.433  -50.904 -24.230  1.00 133.40 ? 398  ARG D N     1 
ATOM 8394  C CA    . ARG D 1 391 ? -21.172  -50.313 -22.925  1.00 135.22 ? 398  ARG D CA    1 
ATOM 8395  C C     . ARG D 1 391 ? -21.315  -51.417 -21.900  1.00 137.24 ? 398  ARG D C     1 
ATOM 8396  O O     . ARG D 1 391 ? -22.431  -51.841 -21.620  1.00 137.69 ? 398  ARG D O     1 
ATOM 8397  C CB    . ARG D 1 391 ? -22.145  -49.174 -22.644  1.00 134.62 ? 398  ARG D CB    1 
ATOM 8398  C CG    . ARG D 1 391 ? -22.176  -48.167 -23.750  1.00 132.58 ? 398  ARG D CG    1 
ATOM 8399  C CD    . ARG D 1 391 ? -20.772  -47.850 -24.203  1.00 128.86 ? 398  ARG D CD    1 
ATOM 8400  N NE    . ARG D 1 391 ? -20.742  -47.346 -25.561  1.00 125.35 ? 398  ARG D NE    1 
ATOM 8401  C CZ    . ARG D 1 391 ? -21.179  -46.144 -25.901  1.00 123.96 ? 398  ARG D CZ    1 
ATOM 8402  N NH1   . ARG D 1 391 ? -21.687  -45.340 -24.972  1.00 122.84 ? 398  ARG D NH1   1 
ATOM 8403  N NH2   . ARG D 1 391 ? -21.113  -45.752 -27.164  1.00 123.67 ? 398  ARG D NH2   1 
ATOM 8404  N N     . GLU D 1 392 ? -20.191  -51.901 -21.363  1.00 139.39 ? 399  GLU D N     1 
ATOM 8405  C CA    . GLU D 1 392 ? -20.205  -53.123 -20.537  1.00 141.53 ? 399  GLU D CA    1 
ATOM 8406  C C     . GLU D 1 392 ? -20.994  -53.017 -19.230  1.00 142.49 ? 399  GLU D C     1 
ATOM 8407  O O     . GLU D 1 392 ? -21.582  -54.006 -18.788  1.00 142.63 ? 399  GLU D O     1 
ATOM 8408  C CB    . GLU D 1 392 ? -18.809  -53.757 -20.333  1.00 141.84 ? 399  GLU D CB    1 
ATOM 8409  C CG    . GLU D 1 392 ? -17.628  -52.890 -20.701  1.00 143.94 ? 399  GLU D CG    1 
ATOM 8410  C CD    . GLU D 1 392 ? -17.547  -51.651 -19.845  1.00 146.69 ? 399  GLU D CD    1 
ATOM 8411  O OE1   . GLU D 1 392 ? -16.970  -51.746 -18.736  1.00 147.48 ? 399  GLU D OE1   1 
ATOM 8412  O OE2   . GLU D 1 392 ? -18.066  -50.594 -20.291  1.00 147.92 ? 399  GLU D OE2   1 
ATOM 8413  N N     . GLY D 1 393 ? -21.032  -51.825 -18.633  1.00 143.69 ? 400  GLY D N     1 
ATOM 8414  C CA    . GLY D 1 393 ? -22.005  -51.536 -17.571  1.00 145.35 ? 400  GLY D CA    1 
ATOM 8415  C C     . GLY D 1 393 ? -23.424  -51.459 -18.139  1.00 146.61 ? 400  GLY D C     1 
ATOM 8416  O O     . GLY D 1 393 ? -23.618  -51.562 -19.351  1.00 146.80 ? 400  GLY D O     1 
ATOM 8417  N N     . TRP D 1 394 ? -24.415  -51.262 -17.269  1.00 147.70 ? 401  TRP D N     1 
ATOM 8418  C CA    . TRP D 1 394 ? -25.844  -51.145 -17.650  1.00 148.77 ? 401  TRP D CA    1 
ATOM 8419  C C     . TRP D 1 394 ? -26.498  -52.472 -18.068  1.00 149.08 ? 401  TRP D C     1 
ATOM 8420  O O     . TRP D 1 394 ? -25.956  -53.220 -18.888  1.00 149.08 ? 401  TRP D O     1 
ATOM 8421  C CB    . TRP D 1 394 ? -26.119  -50.101 -18.770  1.00 149.18 ? 401  TRP D CB    1 
ATOM 8422  C CG    . TRP D 1 394 ? -25.173  -48.890 -18.974  1.00 150.22 ? 401  TRP D CG    1 
ATOM 8423  C CD1   . TRP D 1 394 ? -24.305  -48.351 -18.072  1.00 151.11 ? 401  TRP D CD1   1 
ATOM 8424  C CD2   . TRP D 1 394 ? -25.068  -48.073 -20.158  1.00 150.26 ? 401  TRP D CD2   1 
ATOM 8425  N NE1   . TRP D 1 394 ? -23.656  -47.273 -18.624  1.00 151.30 ? 401  TRP D NE1   1 
ATOM 8426  C CE2   . TRP D 1 394 ? -24.106  -47.082 -19.899  1.00 150.28 ? 401  TRP D CE2   1 
ATOM 8427  C CE3   . TRP D 1 394 ? -25.696  -48.090 -21.408  1.00 150.05 ? 401  TRP D CE3   1 
ATOM 8428  C CZ2   . TRP D 1 394 ? -23.755  -46.119 -20.836  1.00 149.86 ? 401  TRP D CZ2   1 
ATOM 8429  C CZ3   . TRP D 1 394 ? -25.343  -47.131 -22.338  1.00 149.73 ? 401  TRP D CZ3   1 
ATOM 8430  C CH2   . TRP D 1 394 ? -24.378  -46.162 -22.047  1.00 149.44 ? 401  TRP D CH2   1 
ATOM 8431  N N     . ARG D 1 395 ? -27.676  -52.744 -17.516  1.00 149.49 ? 402  ARG D N     1 
ATOM 8432  C CA    . ARG D 1 395 ? -28.512  -53.847 -17.996  1.00 149.98 ? 402  ARG D CA    1 
ATOM 8433  C C     . ARG D 1 395 ? -29.538  -53.296 -18.990  1.00 149.43 ? 402  ARG D C     1 
ATOM 8434  O O     . ARG D 1 395 ? -30.156  -54.051 -19.758  1.00 149.34 ? 402  ARG D O     1 
ATOM 8435  C CB    . ARG D 1 395 ? -29.187  -54.572 -16.817  1.00 150.56 ? 402  ARG D CB    1 
ATOM 8436  C CG    . ARG D 1 395 ? -30.234  -55.668 -17.173  1.00 152.44 ? 402  ARG D CG    1 
ATOM 8437  C CD    . ARG D 1 395 ? -29.634  -56.897 -17.873  1.00 155.41 ? 402  ARG D CD    1 
ATOM 8438  N NE    . ARG D 1 395 ? -30.570  -58.027 -17.910  1.00 157.29 ? 402  ARG D NE    1 
ATOM 8439  C CZ    . ARG D 1 395 ? -30.477  -59.129 -17.158  1.00 157.90 ? 402  ARG D CZ    1 
ATOM 8440  N NH1   . ARG D 1 395 ? -29.475  -59.279 -16.295  1.00 157.99 ? 402  ARG D NH1   1 
ATOM 8441  N NH2   . ARG D 1 395 ? -31.389  -60.094 -17.277  1.00 157.70 ? 402  ARG D NH2   1 
ATOM 8442  N N     . TRP D 1 396 ? -29.679  -51.968 -18.967  1.00 148.80 ? 403  TRP D N     1 
ATOM 8443  C CA    . TRP D 1 396 ? -30.577  -51.214 -19.855  1.00 148.31 ? 403  TRP D CA    1 
ATOM 8444  C C     . TRP D 1 396 ? -29.874  -50.160 -20.734  1.00 147.26 ? 403  TRP D C     1 
ATOM 8445  O O     . TRP D 1 396 ? -28.739  -49.776 -20.470  1.00 147.32 ? 403  TRP D O     1 
ATOM 8446  C CB    . TRP D 1 396 ? -31.708  -50.560 -19.051  1.00 148.72 ? 403  TRP D CB    1 
ATOM 8447  C CG    . TRP D 1 396 ? -31.276  -49.810 -17.807  1.00 150.33 ? 403  TRP D CG    1 
ATOM 8448  C CD1   . TRP D 1 396 ? -30.604  -50.317 -16.717  1.00 151.06 ? 403  TRP D CD1   1 
ATOM 8449  C CD2   . TRP D 1 396 ? -31.535  -48.434 -17.509  1.00 151.58 ? 403  TRP D CD2   1 
ATOM 8450  N NE1   . TRP D 1 396 ? -30.416  -49.332 -15.773  1.00 151.13 ? 403  TRP D NE1   1 
ATOM 8451  C CE2   . TRP D 1 396 ? -30.977  -48.169 -16.229  1.00 151.53 ? 403  TRP D CE2   1 
ATOM 8452  C CE3   . TRP D 1 396 ? -32.181  -47.395 -18.199  1.00 152.17 ? 403  TRP D CE3   1 
ATOM 8453  C CZ2   . TRP D 1 396 ? -31.045  -46.911 -15.628  1.00 151.76 ? 403  TRP D CZ2   1 
ATOM 8454  C CZ3   . TRP D 1 396 ? -32.248  -46.138 -17.600  1.00 152.78 ? 403  TRP D CZ3   1 
ATOM 8455  C CH2   . TRP D 1 396 ? -31.679  -45.910 -16.322  1.00 152.53 ? 403  TRP D CH2   1 
ATOM 8456  N N     . VAL D 1 397 ? -30.560  -49.710 -21.786  1.00 145.81 ? 404  VAL D N     1 
ATOM 8457  C CA    . VAL D 1 397 ? -30.035  -48.691 -22.696  1.00 144.09 ? 404  VAL D CA    1 
ATOM 8458  C C     . VAL D 1 397 ? -30.283  -47.318 -22.090  1.00 142.80 ? 404  VAL D C     1 
ATOM 8459  O O     . VAL D 1 397 ? -31.301  -46.685 -22.347  1.00 142.61 ? 404  VAL D O     1 
ATOM 8460  C CB    . VAL D 1 397 ? -30.632  -48.825 -24.136  1.00 144.27 ? 404  VAL D CB    1 
ATOM 8461  C CG1   . VAL D 1 397 ? -32.151  -49.135 -24.113  1.00 144.00 ? 404  VAL D CG1   1 
ATOM 8462  C CG2   . VAL D 1 397 ? -30.301  -47.598 -24.993  1.00 144.41 ? 404  VAL D CG2   1 
ATOM 8463  N N     . ARG D 1 398 ? -29.341  -46.868 -21.272  1.00 141.26 ? 405  ARG D N     1 
ATOM 8464  C CA    . ARG D 1 398 ? -29.569  -45.692 -20.428  1.00 139.76 ? 405  ARG D CA    1 
ATOM 8465  C C     . ARG D 1 398 ? -29.538  -44.371 -21.174  1.00 137.86 ? 405  ARG D C     1 
ATOM 8466  O O     . ARG D 1 398 ? -30.111  -43.388 -20.689  1.00 137.62 ? 405  ARG D O     1 
ATOM 8467  C CB    . ARG D 1 398 ? -28.603  -45.651 -19.247  1.00 140.27 ? 405  ARG D CB    1 
ATOM 8468  C CG    . ARG D 1 398 ? -27.161  -45.359 -19.632  1.00 142.05 ? 405  ARG D CG    1 
ATOM 8469  C CD    . ARG D 1 398 ? -26.330  -44.944 -18.425  1.00 144.34 ? 405  ARG D CD    1 
ATOM 8470  N NE    . ARG D 1 398 ? -26.104  -46.050 -17.507  1.00 145.08 ? 405  ARG D NE    1 
ATOM 8471  C CZ    . ARG D 1 398 ? -25.966  -45.912 -16.200  1.00 145.91 ? 405  ARG D CZ    1 
ATOM 8472  N NH1   . ARG D 1 398 ? -26.052  -44.715 -15.639  1.00 146.11 ? 405  ARG D NH1   1 
ATOM 8473  N NH2   . ARG D 1 398 ? -25.764  -46.980 -15.454  1.00 146.77 ? 405  ARG D NH2   1 
ATOM 8474  N N     . GLN D 1 399 ? -28.853  -44.347 -22.324  1.00 135.43 ? 406  GLN D N     1 
ATOM 8475  C CA    . GLN D 1 399 ? -28.941  -43.218 -23.273  1.00 133.14 ? 406  GLN D CA    1 
ATOM 8476  C C     . GLN D 1 399 ? -28.214  -43.443 -24.611  1.00 130.82 ? 406  GLN D C     1 
ATOM 8477  O O     . GLN D 1 399 ? -27.240  -44.186 -24.651  1.00 130.91 ? 406  GLN D O     1 
ATOM 8478  C CB    . GLN D 1 399 ? -28.487  -41.935 -22.617  1.00 133.24 ? 406  GLN D CB    1 
ATOM 8479  C CG    . GLN D 1 399 ? -27.175  -42.064 -21.977  1.00 134.13 ? 406  GLN D CG    1 
ATOM 8480  C CD    . GLN D 1 399 ? -26.478  -40.762 -21.991  1.00 136.06 ? 406  GLN D CD    1 
ATOM 8481  O OE1   . GLN D 1 399 ? -27.010  -39.755 -21.514  1.00 136.85 ? 406  GLN D OE1   1 
ATOM 8482  N NE2   . GLN D 1 399 ? -25.288  -40.743 -22.574  1.00 136.88 ? 406  GLN D NE2   1 
ATOM 8483  N N     . PRO D 1 400 ? -28.679  -42.771 -25.693  1.00 128.30 ? 407  PRO D N     1 
ATOM 8484  C CA    . PRO D 1 400 ? -28.444  -43.116 -27.110  1.00 126.23 ? 407  PRO D CA    1 
ATOM 8485  C C     . PRO D 1 400 ? -27.038  -43.579 -27.508  1.00 123.98 ? 407  PRO D C     1 
ATOM 8486  O O     . PRO D 1 400 ? -26.056  -42.886 -27.273  1.00 123.86 ? 407  PRO D O     1 
ATOM 8487  C CB    . PRO D 1 400 ? -28.822  -41.829 -27.846  1.00 126.43 ? 407  PRO D CB    1 
ATOM 8488  C CG    . PRO D 1 400 ? -29.858  -41.217 -26.977  1.00 127.25 ? 407  PRO D CG    1 
ATOM 8489  C CD    . PRO D 1 400 ? -29.411  -41.496 -25.575  1.00 128.01 ? 407  PRO D CD    1 
ATOM 8490  N N     . VAL D 1 401 ? -26.964  -44.750 -28.120  1.00 121.33 ? 408  VAL D N     1 
ATOM 8491  C CA    . VAL D 1 401 ? -25.708  -45.305 -28.599  1.00 118.91 ? 408  VAL D CA    1 
ATOM 8492  C C     . VAL D 1 401 ? -25.880  -45.747 -30.046  1.00 117.37 ? 408  VAL D C     1 
ATOM 8493  O O     . VAL D 1 401 ? -26.873  -46.381 -30.387  1.00 117.48 ? 408  VAL D O     1 
ATOM 8494  C CB    . VAL D 1 401 ? -25.296  -46.521 -27.766  1.00 118.85 ? 408  VAL D CB    1 
ATOM 8495  C CG1   . VAL D 1 401 ? -24.089  -47.206 -28.364  1.00 118.54 ? 408  VAL D CG1   1 
ATOM 8496  C CG2   . VAL D 1 401 ? -25.025  -46.121 -26.340  1.00 118.69 ? 408  VAL D CG2   1 
ATOM 8497  N N     . GLN D 1 402 ? -24.916  -45.428 -30.899  1.00 115.04 ? 409  GLN D N     1 
ATOM 8498  C CA    . GLN D 1 402 ? -25.065  -45.725 -32.308  1.00 112.94 ? 409  GLN D CA    1 
ATOM 8499  C C     . GLN D 1 402 ? -23.874  -46.464 -32.879  1.00 111.11 ? 409  GLN D C     1 
ATOM 8500  O O     . GLN D 1 402 ? -22.784  -45.934 -32.942  1.00 110.91 ? 409  GLN D O     1 
ATOM 8501  C CB    . GLN D 1 402 ? -25.315  -44.441 -33.093  1.00 113.20 ? 409  GLN D CB    1 
ATOM 8502  C CG    . GLN D 1 402 ? -25.283  -44.623 -34.600  1.00 114.24 ? 409  GLN D CG    1 
ATOM 8503  C CD    . GLN D 1 402 ? -25.117  -43.317 -35.304  1.00 115.95 ? 409  GLN D CD    1 
ATOM 8504  O OE1   . GLN D 1 402 ? -24.154  -43.130 -36.059  1.00 116.77 ? 409  GLN D OE1   1 
ATOM 8505  N NE2   . GLN D 1 402 ? -26.036  -42.376 -35.041  1.00 115.84 ? 409  GLN D NE2   1 
ATOM 8506  N N     . VAL D 1 403 ? -24.088  -47.689 -33.320  1.00 109.09 ? 410  VAL D N     1 
ATOM 8507  C CA    . VAL D 1 403 ? -23.007  -48.441 -33.919  1.00 107.19 ? 410  VAL D CA    1 
ATOM 8508  C C     . VAL D 1 403 ? -23.333  -48.673 -35.373  1.00 105.60 ? 410  VAL D C     1 
ATOM 8509  O O     . VAL D 1 403 ? -24.492  -48.594 -35.757  1.00 105.62 ? 410  VAL D O     1 
ATOM 8510  C CB    . VAL D 1 403 ? -22.730  -49.769 -33.160  1.00 107.44 ? 410  VAL D CB    1 
ATOM 8511  C CG1   . VAL D 1 403 ? -22.862  -49.559 -31.659  1.00 107.58 ? 410  VAL D CG1   1 
ATOM 8512  C CG2   . VAL D 1 403 ? -23.651  -50.891 -33.599  1.00 107.21 ? 410  VAL D CG2   1 
ATOM 8513  N N     . PRO D 1 404 ? -22.320  -48.946 -36.195  1.00 104.06 ? 411  PRO D N     1 
ATOM 8514  C CA    . PRO D 1 404 ? -22.597  -49.130 -37.602  1.00 102.95 ? 411  PRO D CA    1 
ATOM 8515  C C     . PRO D 1 404 ? -22.846  -50.578 -37.910  1.00 101.73 ? 411  PRO D C     1 
ATOM 8516  O O     . PRO D 1 404 ? -22.137  -51.466 -37.430  1.00 101.83 ? 411  PRO D O     1 
ATOM 8517  C CB    . PRO D 1 404 ? -21.302  -48.689 -38.264  1.00 103.18 ? 411  PRO D CB    1 
ATOM 8518  C CG    . PRO D 1 404 ? -20.267  -49.161 -37.308  1.00 103.79 ? 411  PRO D CG    1 
ATOM 8519  C CD    . PRO D 1 404 ? -20.881  -49.038 -35.918  1.00 104.21 ? 411  PRO D CD    1 
ATOM 8520  N N     . VAL D 1 405 ? -23.847  -50.802 -38.732  1.00 100.15 ? 412  VAL D N     1 
ATOM 8521  C CA    . VAL D 1 405 ? -24.238  -52.139 -39.105  1.00 98.68  ? 412  VAL D CA    1 
ATOM 8522  C C     . VAL D 1 405 ? -23.500  -52.573 -40.362  1.00 97.52  ? 412  VAL D C     1 
ATOM 8523  O O     . VAL D 1 405 ? -23.369  -51.792 -41.289  1.00 97.99  ? 412  VAL D O     1 
ATOM 8524  C CB    . VAL D 1 405 ? -25.724  -52.137 -39.380  1.00 98.84  ? 412  VAL D CB    1 
ATOM 8525  C CG1   . VAL D 1 405 ? -26.179  -53.487 -39.951  1.00 98.61  ? 412  VAL D CG1   1 
ATOM 8526  C CG2   . VAL D 1 405 ? -26.487  -51.725 -38.092  1.00 98.64  ? 412  VAL D CG2   1 
ATOM 8527  N N     . THR D 1 406 ? -23.022  -53.810 -40.407  1.00 95.72  ? 413  THR D N     1 
ATOM 8528  C CA    . THR D 1 406 ? -22.300  -54.265 -41.585  1.00 94.18  ? 413  THR D CA    1 
ATOM 8529  C C     . THR D 1 406 ? -22.333  -55.778 -41.813  1.00 92.97  ? 413  THR D C     1 
ATOM 8530  O O     . THR D 1 406 ? -22.300  -56.557 -40.884  1.00 92.51  ? 413  THR D O     1 
ATOM 8531  C CB    . THR D 1 406 ? -20.842  -53.686 -41.614  1.00 94.30  ? 413  THR D CB    1 
ATOM 8532  O OG1   . THR D 1 406 ? -20.069  -54.335 -42.641  1.00 94.39  ? 413  THR D OG1   1 
ATOM 8533  C CG2   . THR D 1 406 ? -20.154  -53.799 -40.223  1.00 93.95  ? 413  THR D CG2   1 
ATOM 8534  N N     . LEU D 1 407 ? -22.397  -56.182 -43.071  1.00 92.07  ? 414  LEU D N     1 
ATOM 8535  C CA    . LEU D 1 407 ? -22.353  -57.594 -43.426  1.00 91.61  ? 414  LEU D CA    1 
ATOM 8536  C C     . LEU D 1 407 ? -20.927  -58.111 -43.552  1.00 91.63  ? 414  LEU D C     1 
ATOM 8537  O O     . LEU D 1 407 ? -20.057  -57.425 -44.071  1.00 91.66  ? 414  LEU D O     1 
ATOM 8538  C CB    . LEU D 1 407 ? -23.081  -57.864 -44.746  1.00 91.47  ? 414  LEU D CB    1 
ATOM 8539  C CG    . LEU D 1 407 ? -24.467  -57.294 -45.034  1.00 90.56  ? 414  LEU D CG    1 
ATOM 8540  C CD1   . LEU D 1 407 ? -24.958  -57.910 -46.302  1.00 88.78  ? 414  LEU D CD1   1 
ATOM 8541  C CD2   . LEU D 1 407 ? -25.445  -57.554 -43.909  1.00 90.79  ? 414  LEU D CD2   1 
ATOM 8542  N N     . VAL D 1 408 ? -20.724  -59.345 -43.102  1.00 91.61  ? 415  VAL D N     1 
ATOM 8543  C CA    . VAL D 1 408 ? -19.428  -59.992 -43.001  1.00 91.45  ? 415  VAL D CA    1 
ATOM 8544  C C     . VAL D 1 408 ? -19.635  -61.405 -43.525  1.00 91.91  ? 415  VAL D C     1 
ATOM 8545  O O     . VAL D 1 408 ? -20.532  -62.126 -43.063  1.00 91.83  ? 415  VAL D O     1 
ATOM 8546  C CB    . VAL D 1 408 ? -18.979  -60.056 -41.512  1.00 91.38  ? 415  VAL D CB    1 
ATOM 8547  C CG1   . VAL D 1 408 ? -17.860  -61.064 -41.299  1.00 91.18  ? 415  VAL D CG1   1 
ATOM 8548  C CG2   . VAL D 1 408 ? -18.602  -58.679 -40.978  1.00 90.40  ? 415  VAL D CG2   1 
ATOM 8549  N N     . ARG D 1 409 ? -18.824  -61.812 -44.485  1.00 92.39  ? 416  ARG D N     1 
ATOM 8550  C CA    . ARG D 1 409 ? -18.922  -63.162 -44.999  1.00 93.51  ? 416  ARG D CA    1 
ATOM 8551  C C     . ARG D 1 409 ? -18.194  -64.179 -44.079  1.00 94.26  ? 416  ARG D C     1 
ATOM 8552  O O     . ARG D 1 409 ? -17.649  -63.804 -43.035  1.00 94.20  ? 416  ARG D O     1 
ATOM 8553  C CB    . ARG D 1 409 ? -18.382  -63.196 -46.424  1.00 93.43  ? 416  ARG D CB    1 
ATOM 8554  C CG    . ARG D 1 409 ? -19.038  -64.233 -47.296  1.00 94.29  ? 416  ARG D CG    1 
ATOM 8555  C CD    . ARG D 1 409 ? -18.008  -64.898 -48.194  1.00 96.97  ? 416  ARG D CD    1 
ATOM 8556  N NE    . ARG D 1 409 ? -17.887  -64.249 -49.497  1.00 98.35  ? 416  ARG D NE    1 
ATOM 8557  C CZ    . ARG D 1 409 ? -17.265  -64.777 -50.549  1.00 98.83  ? 416  ARG D CZ    1 
ATOM 8558  N NH1   . ARG D 1 409 ? -16.687  -65.972 -50.478  1.00 98.44  ? 416  ARG D NH1   1 
ATOM 8559  N NH2   . ARG D 1 409 ? -17.227  -64.102 -51.683  1.00 98.77  ? 416  ARG D NH2   1 
ATOM 8560  N N     . ASN D 1 410 ? -18.199  -65.458 -44.465  1.00 95.34  ? 417  ASN D N     1 
ATOM 8561  C CA    . ASN D 1 410 ? -17.390  -66.489 -43.787  1.00 96.42  ? 417  ASN D CA    1 
ATOM 8562  C C     . ASN D 1 410 ? -15.870  -66.322 -43.863  1.00 97.15  ? 417  ASN D C     1 
ATOM 8563  O O     . ASN D 1 410 ? -15.301  -65.806 -42.900  1.00 97.85  ? 417  ASN D O     1 
ATOM 8564  C CB    . ASN D 1 410 ? -17.824  -67.898 -44.155  1.00 96.37  ? 417  ASN D CB    1 
ATOM 8565  C CG    . ASN D 1 410 ? -19.064  -68.294 -43.412  1.00 96.87  ? 417  ASN D CG    1 
ATOM 8566  O OD1   . ASN D 1 410 ? -19.404  -67.681 -42.366  1.00 95.10  ? 417  ASN D OD1   1 
ATOM 8567  N ND2   . ASN D 1 410 ? -19.780  -69.298 -43.947  1.00 97.59  ? 417  ASN D ND2   1 
ATOM 8568  N N     . ASP D 1 411 ? -15.196  -66.720 -44.953  1.00 97.47  ? 418  ASP D N     1 
ATOM 8569  C CA    . ASP D 1 411 ? -13.808  -66.219 -45.127  1.00 97.55  ? 418  ASP D CA    1 
ATOM 8570  C C     . ASP D 1 411 ? -13.877  -64.708 -45.125  1.00 97.13  ? 418  ASP D C     1 
ATOM 8571  O O     . ASP D 1 411 ? -14.448  -64.114 -46.035  1.00 97.10  ? 418  ASP D O     1 
ATOM 8572  C CB    . ASP D 1 411 ? -13.105  -66.734 -46.384  1.00 98.02  ? 418  ASP D CB    1 
ATOM 8573  C CG    . ASP D 1 411 ? -14.002  -66.751 -47.618  1.00 99.18  ? 418  ASP D CG    1 
ATOM 8574  O OD1   . ASP D 1 411 ? -15.000  -65.985 -47.680  1.00 98.54  ? 418  ASP D OD1   1 
ATOM 8575  O OD2   . ASP D 1 411 ? -13.672  -67.550 -48.541  1.00 102.36 ? 418  ASP D OD2   1 
ATOM 8576  N N     . GLY D 1 412 ? -13.327  -64.110 -44.072  1.00 96.89  ? 419  GLY D N     1 
ATOM 8577  C CA    . GLY D 1 412 ? -13.679  -62.745 -43.645  1.00 97.04  ? 419  GLY D CA    1 
ATOM 8578  C C     . GLY D 1 412 ? -13.630  -61.571 -44.630  1.00 97.23  ? 419  GLY D C     1 
ATOM 8579  O O     . GLY D 1 412 ? -12.976  -60.551 -44.348  1.00 97.37  ? 419  GLY D O     1 
ATOM 8580  N N     . ILE D 1 413 ? -14.314  -61.700 -45.775  1.00 96.86  ? 420  ILE D N     1 
ATOM 8581  C CA    . ILE D 1 413 ? -14.533  -60.581 -46.686  1.00 96.20  ? 420  ILE D CA    1 
ATOM 8582  C C     . ILE D 1 413 ? -15.603  -59.756 -46.025  1.00 96.20  ? 420  ILE D C     1 
ATOM 8583  O O     . ILE D 1 413 ? -16.566  -60.322 -45.522  1.00 96.77  ? 420  ILE D O     1 
ATOM 8584  C CB    . ILE D 1 413 ? -15.074  -61.060 -48.007  1.00 95.83  ? 420  ILE D CB    1 
ATOM 8585  C CG1   . ILE D 1 413 ? -14.056  -61.944 -48.697  1.00 96.48  ? 420  ILE D CG1   1 
ATOM 8586  C CG2   . ILE D 1 413 ? -15.396  -59.915 -48.885  1.00 95.97  ? 420  ILE D CG2   1 
ATOM 8587  C CD1   . ILE D 1 413 ? -14.553  -63.365 -48.902  1.00 98.03  ? 420  ILE D CD1   1 
ATOM 8588  N N     . ILE D 1 414 ? -15.459  -58.440 -45.977  1.00 95.92  ? 421  ILE D N     1 
ATOM 8589  C CA    . ILE D 1 414 ? -16.488  -57.670 -45.310  1.00 96.14  ? 421  ILE D CA    1 
ATOM 8590  C C     . ILE D 1 414 ? -17.090  -56.590 -46.185  1.00 96.84  ? 421  ILE D C     1 
ATOM 8591  O O     . ILE D 1 414 ? -16.407  -55.652 -46.575  1.00 97.32  ? 421  ILE D O     1 
ATOM 8592  C CB    . ILE D 1 414 ? -16.049  -57.169 -43.912  1.00 95.89  ? 421  ILE D CB    1 
ATOM 8593  C CG1   . ILE D 1 414 ? -15.708  -55.680 -43.881  1.00 95.54  ? 421  ILE D CG1   1 
ATOM 8594  C CG2   . ILE D 1 414 ? -14.916  -58.029 -43.386  1.00 95.65  ? 421  ILE D CG2   1 
ATOM 8595  C CD1   . ILE D 1 414 ? -15.057  -55.241 -42.561  1.00 95.33  ? 421  ILE D CD1   1 
ATOM 8596  N N     . TYR D 1 415 ? -18.380  -56.753 -46.492  1.00 97.40  ? 422  TYR D N     1 
ATOM 8597  C CA    . TYR D 1 415 ? -19.185  -55.793 -47.275  1.00 97.46  ? 422  TYR D CA    1 
ATOM 8598  C C     . TYR D 1 415 ? -19.825  -54.657 -46.414  1.00 98.69  ? 422  TYR D C     1 
ATOM 8599  O O     . TYR D 1 415 ? -20.709  -54.907 -45.568  1.00 98.34  ? 422  TYR D O     1 
ATOM 8600  C CB    . TYR D 1 415 ? -20.259  -56.558 -48.035  1.00 96.52  ? 422  TYR D CB    1 
ATOM 8601  C CG    . TYR D 1 415 ? -19.797  -57.880 -48.613  1.00 93.92  ? 422  TYR D CG    1 
ATOM 8602  C CD1   . TYR D 1 415 ? -19.947  -59.057 -47.914  1.00 92.29  ? 422  TYR D CD1   1 
ATOM 8603  C CD2   . TYR D 1 415 ? -19.237  -57.955 -49.882  1.00 92.62  ? 422  TYR D CD2   1 
ATOM 8604  C CE1   . TYR D 1 415 ? -19.542  -60.276 -48.467  1.00 91.46  ? 422  TYR D CE1   1 
ATOM 8605  C CE2   . TYR D 1 415 ? -18.831  -59.164 -50.439  1.00 90.20  ? 422  TYR D CE2   1 
ATOM 8606  C CZ    . TYR D 1 415 ? -18.985  -60.306 -49.726  1.00 90.42  ? 422  TYR D CZ    1 
ATOM 8607  O OH    . TYR D 1 415 ? -18.586  -61.494 -50.261  1.00 91.21  ? 422  TYR D OH    1 
ATOM 8608  N N     . SER D 1 416 ? -19.366  -53.417 -46.620  1.00 99.99  ? 423  SER D N     1 
ATOM 8609  C CA    . SER D 1 416 ? -19.797  -52.301 -45.774  1.00 101.43 ? 423  SER D CA    1 
ATOM 8610  C C     . SER D 1 416 ? -21.189  -51.850 -46.156  1.00 102.51 ? 423  SER D C     1 
ATOM 8611  O O     . SER D 1 416 ? -21.693  -52.254 -47.203  1.00 102.88 ? 423  SER D O     1 
ATOM 8612  C CB    . SER D 1 416 ? -18.836  -51.129 -45.897  1.00 101.36 ? 423  SER D CB    1 
ATOM 8613  O OG    . SER D 1 416 ? -19.425  -49.964 -45.340  1.00 101.93 ? 423  SER D OG    1 
ATOM 8614  N N     . THR D 1 417 ? -21.813  -51.011 -45.329  1.00 103.85 ? 424  THR D N     1 
ATOM 8615  C CA    . THR D 1 417 ? -23.201  -50.610 -45.601  1.00 105.20 ? 424  THR D CA    1 
ATOM 8616  C C     . THR D 1 417 ? -23.571  -49.152 -45.355  1.00 106.30 ? 424  THR D C     1 
ATOM 8617  O O     . THR D 1 417 ? -24.590  -48.673 -45.890  1.00 106.55 ? 424  THR D O     1 
ATOM 8618  C CB    . THR D 1 417 ? -24.239  -51.442 -44.809  1.00 105.01 ? 424  THR D CB    1 
ATOM 8619  O OG1   . THR D 1 417 ? -24.367  -50.914 -43.479  1.00 105.04 ? 424  THR D OG1   1 
ATOM 8620  C CG2   . THR D 1 417 ? -23.884  -52.925 -44.780  1.00 104.74 ? 424  THR D CG2   1 
ATOM 8621  N N     . SER D 1 418 ? -22.800  -48.458 -44.521  1.00 107.50 ? 425  SER D N     1 
ATOM 8622  C CA    . SER D 1 418 ? -23.125  -47.057 -44.187  1.00 108.84 ? 425  SER D CA    1 
ATOM 8623  C C     . SER D 1 418 ? -24.525  -46.914 -43.557  1.00 109.68 ? 425  SER D C     1 
ATOM 8624  O O     . SER D 1 418 ? -25.133  -45.830 -43.580  1.00 109.66 ? 425  SER D O     1 
ATOM 8625  C CB    . SER D 1 418 ? -23.059  -46.160 -45.429  1.00 108.64 ? 425  SER D CB    1 
ATOM 8626  O OG    . SER D 1 418 ? -24.332  -46.159 -46.065  1.00 108.13 ? 425  SER D OG    1 
ATOM 8627  N N     . LEU D 1 419 ? -25.047  -48.012 -43.025  1.00 110.64 ? 426  LEU D N     1 
ATOM 8628  C CA    . LEU D 1 419 ? -26.279  -47.941 -42.270  1.00 111.67 ? 426  LEU D CA    1 
ATOM 8629  C C     . LEU D 1 419 ? -25.949  -48.147 -40.810  1.00 112.39 ? 426  LEU D C     1 
ATOM 8630  O O     . LEU D 1 419 ? -24.987  -48.843 -40.473  1.00 112.54 ? 426  LEU D O     1 
ATOM 8631  C CB    . LEU D 1 419 ? -27.295  -48.956 -42.782  1.00 111.53 ? 426  LEU D CB    1 
ATOM 8632  C CG    . LEU D 1 419 ? -27.967  -48.499 -44.082  1.00 111.81 ? 426  LEU D CG    1 
ATOM 8633  C CD1   . LEU D 1 419 ? -28.496  -49.688 -44.854  1.00 111.37 ? 426  LEU D CD1   1 
ATOM 8634  C CD2   . LEU D 1 419 ? -29.063  -47.434 -43.845  1.00 111.33 ? 426  LEU D CD2   1 
ATOM 8635  N N     . THR D 1 420 ? -26.725  -47.518 -39.938  1.00 113.23 ? 427  THR D N     1 
ATOM 8636  C CA    . THR D 1 420 ? -26.374  -47.516 -38.532  1.00 114.09 ? 427  THR D CA    1 
ATOM 8637  C C     . THR D 1 420 ? -27.571  -47.773 -37.642  1.00 114.97 ? 427  THR D C     1 
ATOM 8638  O O     . THR D 1 420 ? -28.555  -47.033 -37.708  1.00 115.26 ? 427  THR D O     1 
ATOM 8639  C CB    . THR D 1 420 ? -25.696  -46.170 -38.116  1.00 113.97 ? 427  THR D CB    1 
ATOM 8640  O OG1   . THR D 1 420 ? -26.670  -45.261 -37.571  1.00 113.62 ? 427  THR D OG1   1 
ATOM 8641  C CG2   . THR D 1 420 ? -24.945  -45.530 -39.314  1.00 113.56 ? 427  THR D CG2   1 
ATOM 8642  N N     . PHE D 1 421 ? -27.485  -48.811 -36.808  1.00 115.91 ? 428  PHE D N     1 
ATOM 8643  C CA    . PHE D 1 421 ? -28.449  -48.974 -35.715  1.00 117.14 ? 428  PHE D CA    1 
ATOM 8644  C C     . PHE D 1 421 ? -28.152  -48.021 -34.556  1.00 117.60 ? 428  PHE D C     1 
ATOM 8645  O O     . PHE D 1 421 ? -27.014  -47.913 -34.116  1.00 117.57 ? 428  PHE D O     1 
ATOM 8646  C CB    . PHE D 1 421 ? -28.485  -50.411 -35.173  1.00 117.40 ? 428  PHE D CB    1 
ATOM 8647  C CG    . PHE D 1 421 ? -29.555  -50.633 -34.116  1.00 118.26 ? 428  PHE D CG    1 
ATOM 8648  C CD1   . PHE D 1 421 ? -29.552  -49.912 -32.930  1.00 118.66 ? 428  PHE D CD1   1 
ATOM 8649  C CD2   . PHE D 1 421 ? -30.566  -51.548 -34.316  1.00 119.49 ? 428  PHE D CD2   1 
ATOM 8650  C CE1   . PHE D 1 421 ? -30.538  -50.087 -31.976  1.00 118.88 ? 428  PHE D CE1   1 
ATOM 8651  C CE2   . PHE D 1 421 ? -31.554  -51.730 -33.351  1.00 120.27 ? 428  PHE D CE2   1 
ATOM 8652  C CZ    . PHE D 1 421 ? -31.532  -50.995 -32.180  1.00 119.66 ? 428  PHE D CZ    1 
ATOM 8653  N N     . THR D 1 422 ? -29.199  -47.380 -34.044  1.00 118.46 ? 429  THR D N     1 
ATOM 8654  C CA    . THR D 1 422 ? -29.111  -46.430 -32.941  1.00 119.40 ? 429  THR D CA    1 
ATOM 8655  C C     . THR D 1 422 ? -29.933  -46.890 -31.733  1.00 120.38 ? 429  THR D C     1 
ATOM 8656  O O     . THR D 1 422 ? -31.147  -46.709 -31.706  1.00 120.85 ? 429  THR D O     1 
ATOM 8657  C CB    . THR D 1 422 ? -29.674  -45.085 -33.394  1.00 119.32 ? 429  THR D CB    1 
ATOM 8658  O OG1   . THR D 1 422 ? -29.126  -44.755 -34.678  1.00 119.56 ? 429  THR D OG1   1 
ATOM 8659  C CG2   . THR D 1 422 ? -29.392  -43.987 -32.369  1.00 118.81 ? 429  THR D CG2   1 
ATOM 8660  N N     . TYR D 1 423 ? -29.293  -47.481 -30.731  1.00 121.45 ? 430  TYR D N     1 
ATOM 8661  C CA    . TYR D 1 423 ? -29.994  -47.817 -29.487  1.00 122.58 ? 430  TYR D CA    1 
ATOM 8662  C C     . TYR D 1 423 ? -30.675  -46.572 -28.945  1.00 124.70 ? 430  TYR D C     1 
ATOM 8663  O O     . TYR D 1 423 ? -30.183  -45.475 -29.142  1.00 125.23 ? 430  TYR D O     1 
ATOM 8664  C CB    . TYR D 1 423 ? -29.023  -48.365 -28.439  1.00 121.67 ? 430  TYR D CB    1 
ATOM 8665  C CG    . TYR D 1 423 ? -28.526  -49.758 -28.733  1.00 118.36 ? 430  TYR D CG    1 
ATOM 8666  C CD1   . TYR D 1 423 ? -27.461  -49.969 -29.580  1.00 115.44 ? 430  TYR D CD1   1 
ATOM 8667  C CD2   . TYR D 1 423 ? -29.126  -50.860 -28.170  1.00 115.05 ? 430  TYR D CD2   1 
ATOM 8668  C CE1   . TYR D 1 423 ? -27.024  -51.223 -29.854  1.00 112.99 ? 430  TYR D CE1   1 
ATOM 8669  C CE2   . TYR D 1 423 ? -28.685  -52.116 -28.447  1.00 112.69 ? 430  TYR D CE2   1 
ATOM 8670  C CZ    . TYR D 1 423 ? -27.638  -52.283 -29.285  1.00 111.72 ? 430  TYR D CZ    1 
ATOM 8671  O OH    . TYR D 1 423 ? -27.193  -53.530 -29.571  1.00 111.56 ? 430  TYR D OH    1 
ATOM 8672  N N     . THR D 1 424 ? -31.808  -46.733 -28.277  1.00 127.18 ? 431  THR D N     1 
ATOM 8673  C CA    . THR D 1 424 ? -32.536  -45.596 -27.726  1.00 129.73 ? 431  THR D CA    1 
ATOM 8674  C C     . THR D 1 424 ? -33.228  -46.031 -26.462  1.00 131.58 ? 431  THR D C     1 
ATOM 8675  O O     . THR D 1 424 ? -33.747  -47.150 -26.420  1.00 131.71 ? 431  THR D O     1 
ATOM 8676  C CB    . THR D 1 424 ? -33.631  -45.142 -28.676  1.00 129.75 ? 431  THR D CB    1 
ATOM 8677  O OG1   . THR D 1 424 ? -34.229  -46.303 -29.270  1.00 130.68 ? 431  THR D OG1   1 
ATOM 8678  C CG2   . THR D 1 424 ? -33.074  -44.228 -29.770  1.00 130.07 ? 431  THR D CG2   1 
ATOM 8679  N N     . PRO D 1 425 ? -33.251  -45.156 -25.432  1.00 133.65 ? 432  PRO D N     1 
ATOM 8680  C CA    . PRO D 1 425 ? -33.986  -45.407 -24.178  1.00 135.38 ? 432  PRO D CA    1 
ATOM 8681  C C     . PRO D 1 425 ? -35.486  -45.574 -24.433  1.00 137.15 ? 432  PRO D C     1 
ATOM 8682  O O     . PRO D 1 425 ? -36.048  -44.835 -25.253  1.00 137.29 ? 432  PRO D O     1 
ATOM 8683  C CB    . PRO D 1 425 ? -33.712  -44.152 -23.331  1.00 135.13 ? 432  PRO D CB    1 
ATOM 8684  C CG    . PRO D 1 425 ? -33.259  -43.134 -24.266  1.00 134.53 ? 432  PRO D CG    1 
ATOM 8685  C CD    . PRO D 1 425 ? -32.568  -43.854 -25.397  1.00 133.90 ? 432  PRO D CD    1 
ATOM 8686  N N     . GLU D 1 426 ? -36.110  -46.544 -23.748  1.00 139.17 ? 433  GLU D N     1 
ATOM 8687  C CA    . GLU D 1 426 ? -37.508  -46.961 -24.026  1.00 141.19 ? 433  GLU D CA    1 
ATOM 8688  C C     . GLU D 1 426 ? -38.546  -45.855 -23.705  1.00 142.13 ? 433  GLU D C     1 
ATOM 8689  O O     . GLU D 1 426 ? -38.415  -45.145 -22.685  1.00 142.39 ? 433  GLU D O     1 
ATOM 8690  C CB    . GLU D 1 426 ? -37.852  -48.301 -23.335  1.00 141.34 ? 433  GLU D CB    1 
ATOM 8691  C CG    . GLU D 1 426 ? -37.266  -49.576 -24.013  1.00 142.86 ? 433  GLU D CG    1 
ATOM 8692  C CD    . GLU D 1 426 ? -35.768  -49.836 -23.720  1.00 144.94 ? 433  GLU D CD    1 
ATOM 8693  O OE1   . GLU D 1 426 ? -35.222  -50.844 -24.241  1.00 145.59 ? 433  GLU D OE1   1 
ATOM 8694  O OE2   . GLU D 1 426 ? -35.135  -49.053 -22.970  1.00 144.91 ? 433  GLU D OE2   1 
ATOM 8695  N N     . PRO D 1 427 ? -39.555  -45.681 -24.595  1.00 142.95 ? 434  PRO D N     1 
ATOM 8696  C CA    . PRO D 1 427 ? -40.484  -44.538 -24.466  1.00 143.43 ? 434  PRO D CA    1 
ATOM 8697  C C     . PRO D 1 427 ? -41.741  -44.820 -23.603  1.00 143.82 ? 434  PRO D C     1 
ATOM 8698  O O     . PRO D 1 427 ? -42.728  -45.463 -24.000  1.00 144.04 ? 434  PRO D O     1 
ATOM 8699  C CB    . PRO D 1 427 ? -40.846  -44.203 -25.936  1.00 143.53 ? 434  PRO D CB    1 
ATOM 8700  C CG    . PRO D 1 427 ? -40.153  -45.298 -26.817  1.00 143.18 ? 434  PRO D CG    1 
ATOM 8701  C CD    . PRO D 1 427 ? -39.769  -46.410 -25.864  1.00 142.89 ? 434  PRO D CD    1 
ATOM 8702  N N     . GLN E 2 53  ? -45.884  -38.341 -33.069  1.00 156.78 ? 1924 GLN E N     1 
ATOM 8703  C CA    . GLN E 2 53  ? -44.558  -38.633 -33.675  1.00 156.76 ? 1924 GLN E CA    1 
ATOM 8704  C C     . GLN E 2 53  ? -43.407  -38.293 -32.707  1.00 156.58 ? 1924 GLN E C     1 
ATOM 8705  O O     . GLN E 2 53  ? -43.135  -37.108 -32.456  1.00 156.49 ? 1924 GLN E O     1 
ATOM 8706  C CB    . GLN E 2 53  ? -44.417  -37.860 -34.997  1.00 156.87 ? 1924 GLN E CB    1 
ATOM 8707  C CG    . GLN E 2 53  ? -43.222  -38.289 -35.847  1.00 157.25 ? 1924 GLN E CG    1 
ATOM 8708  C CD    . GLN E 2 53  ? -42.733  -37.223 -36.819  1.00 157.13 ? 1924 GLN E CD    1 
ATOM 8709  O OE1   . GLN E 2 53  ? -42.975  -36.024 -36.635  1.00 157.01 ? 1924 GLN E OE1   1 
ATOM 8710  N NE2   . GLN E 2 53  ? -42.023  -37.662 -37.857  1.00 156.73 ? 1924 GLN E NE2   1 
ATOM 8711  N N     . THR E 2 54  ? -42.739  -39.328 -32.170  1.00 156.37 ? 1925 THR E N     1 
ATOM 8712  C CA    . THR E 2 54  ? -41.522  -39.155 -31.326  1.00 156.12 ? 1925 THR E CA    1 
ATOM 8713  C C     . THR E 2 54  ? -40.352  -38.556 -32.173  1.00 155.80 ? 1925 THR E C     1 
ATOM 8714  O O     . THR E 2 54  ? -39.244  -38.301 -31.654  1.00 155.90 ? 1925 THR E O     1 
ATOM 8715  C CB    . THR E 2 54  ? -41.088  -40.495 -30.557  1.00 156.20 ? 1925 THR E CB    1 
ATOM 8716  O OG1   . THR E 2 54  ? -42.234  -41.215 -30.086  1.00 155.93 ? 1925 THR E OG1   1 
ATOM 8717  C CG2   . THR E 2 54  ? -40.195  -40.202 -29.347  1.00 156.13 ? 1925 THR E CG2   1 
ATOM 8718  N N     . ASP E 2 55  ? -40.653  -38.315 -33.464  1.00 154.98 ? 1926 ASP E N     1 
ATOM 8719  C CA    . ASP E 2 55  ? -39.736  -37.851 -34.559  1.00 153.83 ? 1926 ASP E CA    1 
ATOM 8720  C C     . ASP E 2 55  ? -38.340  -38.512 -34.699  1.00 152.63 ? 1926 ASP E C     1 
ATOM 8721  O O     . ASP E 2 55  ? -37.600  -38.213 -35.641  1.00 152.58 ? 1926 ASP E O     1 
ATOM 8722  C CB    . ASP E 2 55  ? -39.744  -36.301 -34.781  1.00 154.13 ? 1926 ASP E CB    1 
ATOM 8723  C CG    . ASP E 2 55  ? -38.911  -35.510 -33.754  1.00 154.42 ? 1926 ASP E CG    1 
ATOM 8724  O OD1   . ASP E 2 55  ? -37.804  -35.956 -33.364  1.00 154.58 ? 1926 ASP E OD1   1 
ATOM 8725  O OD2   . ASP E 2 55  ? -39.363  -34.400 -33.372  1.00 154.33 ? 1926 ASP E OD2   1 
ATOM 8726  N N     . ARG E 2 56  ? -38.001  -39.402 -33.769  1.00 151.04 ? 1927 ARG E N     1 
ATOM 8727  C CA    . ARG E 2 56  ? -36.829  -40.252 -33.909  1.00 149.50 ? 1927 ARG E CA    1 
ATOM 8728  C C     . ARG E 2 56  ? -37.059  -41.205 -35.095  1.00 148.08 ? 1927 ARG E C     1 
ATOM 8729  O O     . ARG E 2 56  ? -36.245  -41.262 -36.031  1.00 148.06 ? 1927 ARG E O     1 
ATOM 8730  C CB    . ARG E 2 56  ? -36.541  -41.009 -32.591  1.00 149.71 ? 1927 ARG E CB    1 
ATOM 8731  C CG    . ARG E 2 56  ? -35.372  -42.023 -32.632  1.00 150.22 ? 1927 ARG E CG    1 
ATOM 8732  C CD    . ARG E 2 56  ? -34.045  -41.407 -33.116  1.00 151.17 ? 1927 ARG E CD    1 
ATOM 8733  N NE    . ARG E 2 56  ? -33.393  -42.269 -34.108  1.00 152.17 ? 1927 ARG E NE    1 
ATOM 8734  C CZ    . ARG E 2 56  ? -32.570  -41.851 -35.074  1.00 152.39 ? 1927 ARG E CZ    1 
ATOM 8735  N NH1   . ARG E 2 56  ? -32.268  -40.562 -35.204  1.00 152.77 ? 1927 ARG E NH1   1 
ATOM 8736  N NH2   . ARG E 2 56  ? -32.051  -42.730 -35.924  1.00 151.75 ? 1927 ARG E NH2   1 
ATOM 8737  N N     . THR E 2 57  ? -38.190  -41.910 -35.062  1.00 145.98 ? 1928 THR E N     1 
ATOM 8738  C CA    . THR E 2 57  ? -38.526  -42.914 -36.072  1.00 143.74 ? 1928 THR E CA    1 
ATOM 8739  C C     . THR E 2 57  ? -39.816  -42.564 -36.802  1.00 142.07 ? 1928 THR E C     1 
ATOM 8740  O O     . THR E 2 57  ? -40.169  -43.207 -37.795  1.00 141.70 ? 1928 THR E O     1 
ATOM 8741  C CB    . THR E 2 57  ? -38.662  -44.318 -35.442  1.00 143.87 ? 1928 THR E CB    1 
ATOM 8742  O OG1   . THR E 2 57  ? -39.628  -44.277 -34.386  1.00 143.80 ? 1928 THR E OG1   1 
ATOM 8743  C CG2   . THR E 2 57  ? -37.328  -44.781 -34.869  1.00 143.65 ? 1928 THR E CG2   1 
ATOM 8744  N N     . GLY E 2 58  ? -40.503  -41.536 -36.304  1.00 140.22 ? 1929 GLY E N     1 
ATOM 8745  C CA    . GLY E 2 58  ? -41.774  -41.085 -36.868  1.00 137.91 ? 1929 GLY E CA    1 
ATOM 8746  C C     . GLY E 2 58  ? -42.959  -41.872 -36.354  1.00 136.15 ? 1929 GLY E C     1 
ATOM 8747  O O     . GLY E 2 58  ? -44.067  -41.746 -36.871  1.00 135.84 ? 1929 GLY E O     1 
ATOM 8748  N N     . GLU E 2 59  ? -42.713  -42.657 -35.310  1.00 134.53 ? 1930 GLU E N     1 
ATOM 8749  C CA    . GLU E 2 59  ? -43.651  -43.652 -34.805  1.00 132.95 ? 1930 GLU E CA    1 
ATOM 8750  C C     . GLU E 2 59  ? -44.653  -43.062 -33.817  1.00 131.66 ? 1930 GLU E C     1 
ATOM 8751  O O     . GLU E 2 59  ? -44.301  -42.225 -32.989  1.00 131.30 ? 1930 GLU E O     1 
ATOM 8752  C CB    . GLU E 2 59  ? -42.875  -44.776 -34.125  1.00 133.08 ? 1930 GLU E CB    1 
ATOM 8753  C CG    . GLU E 2 59  ? -43.128  -46.172 -34.688  1.00 133.75 ? 1930 GLU E CG    1 
ATOM 8754  C CD    . GLU E 2 59  ? -42.185  -47.222 -34.111  1.00 134.74 ? 1930 GLU E CD    1 
ATOM 8755  O OE1   . GLU E 2 59  ? -41.331  -46.856 -33.266  1.00 134.73 ? 1930 GLU E OE1   1 
ATOM 8756  O OE2   . GLU E 2 59  ? -42.295  -48.411 -34.503  1.00 134.83 ? 1930 GLU E OE2   1 
ATOM 8757  N N     . THR E 2 60  ? -45.902  -43.515 -33.915  1.00 130.26 ? 1931 THR E N     1 
ATOM 8758  C CA    . THR E 2 60  ? -46.980  -43.022 -33.064  1.00 128.78 ? 1931 THR E CA    1 
ATOM 8759  C C     . THR E 2 60  ? -47.144  -43.837 -31.792  1.00 127.83 ? 1931 THR E C     1 
ATOM 8760  O O     . THR E 2 60  ? -46.515  -44.878 -31.626  1.00 127.69 ? 1931 THR E O     1 
ATOM 8761  C CB    . THR E 2 60  ? -48.343  -42.939 -33.791  1.00 128.68 ? 1931 THR E CB    1 
ATOM 8762  O OG1   . THR E 2 60  ? -49.304  -42.408 -32.879  1.00 128.78 ? 1931 THR E OG1   1 
ATOM 8763  C CG2   . THR E 2 60  ? -48.830  -44.299 -34.245  1.00 128.38 ? 1931 THR E CG2   1 
ATOM 8764  N N     . ALA E 2 61  ? -48.001  -43.351 -30.902  1.00 126.60 ? 1932 ALA E N     1 
ATOM 8765  C CA    . ALA E 2 61  ? -48.328  -44.059 -29.678  1.00 125.57 ? 1932 ALA E CA    1 
ATOM 8766  C C     . ALA E 2 61  ? -48.884  -45.456 -29.982  1.00 124.82 ? 1932 ALA E C     1 
ATOM 8767  O O     . ALA E 2 61  ? -48.609  -46.422 -29.265  1.00 124.60 ? 1932 ALA E O     1 
ATOM 8768  C CB    . ALA E 2 61  ? -49.307  -43.245 -28.855  1.00 125.52 ? 1932 ALA E CB    1 
ATOM 8769  N N     . LEU E 2 62  ? -49.645  -45.564 -31.064  1.00 123.97 ? 1933 LEU E N     1 
ATOM 8770  C CA    . LEU E 2 62  ? -50.186  -46.851 -31.471  1.00 123.23 ? 1933 LEU E CA    1 
ATOM 8771  C C     . LEU E 2 62  ? -49.063  -47.762 -31.961  1.00 122.84 ? 1933 LEU E C     1 
ATOM 8772  O O     . LEU E 2 62  ? -48.827  -48.807 -31.360  1.00 122.87 ? 1933 LEU E O     1 
ATOM 8773  C CB    . LEU E 2 62  ? -51.305  -46.690 -32.517  1.00 123.17 ? 1933 LEU E CB    1 
ATOM 8774  C CG    . LEU E 2 62  ? -52.563  -47.575 -32.398  1.00 122.39 ? 1933 LEU E CG    1 
ATOM 8775  C CD1   . LEU E 2 62  ? -52.382  -48.888 -33.082  1.00 122.37 ? 1933 LEU E CD1   1 
ATOM 8776  C CD2   . LEU E 2 62  ? -52.959  -47.832 -30.966  1.00 121.98 ? 1933 LEU E CD2   1 
ATOM 8777  N N     . HIS E 2 63  ? -48.363  -47.351 -33.025  1.00 122.22 ? 1934 HIS E N     1 
ATOM 8778  C CA    . HIS E 2 63  ? -47.154  -48.037 -33.523  1.00 121.41 ? 1934 HIS E CA    1 
ATOM 8779  C C     . HIS E 2 63  ? -46.338  -48.717 -32.416  1.00 121.17 ? 1934 HIS E C     1 
ATOM 8780  O O     . HIS E 2 63  ? -45.954  -49.889 -32.534  1.00 120.90 ? 1934 HIS E O     1 
ATOM 8781  C CB    . HIS E 2 63  ? -46.239  -47.043 -34.222  1.00 121.15 ? 1934 HIS E CB    1 
ATOM 8782  C CG    . HIS E 2 63  ? -46.642  -46.705 -35.622  1.00 120.51 ? 1934 HIS E CG    1 
ATOM 8783  N ND1   . HIS E 2 63  ? -46.947  -45.422 -36.017  1.00 119.71 ? 1934 HIS E ND1   1 
ATOM 8784  C CD2   . HIS E 2 63  ? -46.734  -47.470 -36.733  1.00 120.22 ? 1934 HIS E CD2   1 
ATOM 8785  C CE1   . HIS E 2 63  ? -47.225  -45.414 -37.307  1.00 119.39 ? 1934 HIS E CE1   1 
ATOM 8786  N NE2   . HIS E 2 63  ? -47.114  -46.647 -37.764  1.00 119.28 ? 1934 HIS E NE2   1 
ATOM 8787  N N     . LEU E 2 64  ? -46.081  -47.960 -31.346  1.00 120.94 ? 1935 LEU E N     1 
ATOM 8788  C CA    . LEU E 2 64  ? -45.298  -48.431 -30.213  1.00 120.66 ? 1935 LEU E CA    1 
ATOM 8789  C C     . LEU E 2 64  ? -45.961  -49.621 -29.558  1.00 120.64 ? 1935 LEU E C     1 
ATOM 8790  O O     . LEU E 2 64  ? -45.411  -50.717 -29.577  1.00 120.83 ? 1935 LEU E O     1 
ATOM 8791  C CB    . LEU E 2 64  ? -45.092  -47.320 -29.186  1.00 120.55 ? 1935 LEU E CB    1 
ATOM 8792  C CG    . LEU E 2 64  ? -44.114  -46.181 -29.490  1.00 120.29 ? 1935 LEU E CG    1 
ATOM 8793  C CD1   . LEU E 2 64  ? -43.943  -45.279 -28.258  1.00 119.88 ? 1935 LEU E CD1   1 
ATOM 8794  C CD2   . LEU E 2 64  ? -42.761  -46.689 -29.988  1.00 119.44 ? 1935 LEU E CD2   1 
ATOM 8795  N N     . ALA E 2 65  ? -47.150  -49.409 -29.000  1.00 120.52 ? 1936 ALA E N     1 
ATOM 8796  C CA    . ALA E 2 65  ? -47.904  -50.492 -28.367  1.00 120.41 ? 1936 ALA E CA    1 
ATOM 8797  C C     . ALA E 2 65  ? -48.055  -51.726 -29.266  1.00 120.23 ? 1936 ALA E C     1 
ATOM 8798  O O     . ALA E 2 65  ? -48.173  -52.845 -28.767  1.00 120.12 ? 1936 ALA E O     1 
ATOM 8799  C CB    . ALA E 2 65  ? -49.260  -49.994 -27.899  1.00 120.56 ? 1936 ALA E CB    1 
ATOM 8800  N N     . ALA E 2 66  ? -48.036  -51.516 -30.581  1.00 120.17 ? 1937 ALA E N     1 
ATOM 8801  C CA    . ALA E 2 66  ? -48.055  -52.615 -31.528  1.00 120.30 ? 1937 ALA E CA    1 
ATOM 8802  C C     . ALA E 2 66  ? -46.763  -53.384 -31.432  1.00 120.46 ? 1937 ALA E C     1 
ATOM 8803  O O     . ALA E 2 66  ? -46.779  -54.575 -31.165  1.00 120.46 ? 1937 ALA E O     1 
ATOM 8804  C CB    . ALA E 2 66  ? -48.247  -52.113 -32.916  1.00 120.48 ? 1937 ALA E CB    1 
ATOM 8805  N N     . ARG E 2 67  ? -45.647  -52.692 -31.624  1.00 120.69 ? 1938 ARG E N     1 
ATOM 8806  C CA    . ARG E 2 67  ? -44.334  -53.317 -31.557  1.00 121.18 ? 1938 ARG E CA    1 
ATOM 8807  C C     . ARG E 2 67  ? -43.988  -53.898 -30.193  1.00 121.46 ? 1938 ARG E C     1 
ATOM 8808  O O     . ARG E 2 67  ? -43.317  -54.920 -30.104  1.00 121.38 ? 1938 ARG E O     1 
ATOM 8809  C CB    . ARG E 2 67  ? -43.272  -52.305 -31.924  1.00 121.26 ? 1938 ARG E CB    1 
ATOM 8810  C CG    . ARG E 2 67  ? -42.058  -52.923 -32.572  1.00 121.81 ? 1938 ARG E CG    1 
ATOM 8811  C CD    . ARG E 2 67  ? -41.074  -51.847 -32.943  1.00 121.50 ? 1938 ARG E CD    1 
ATOM 8812  N NE    . ARG E 2 67  ? -40.455  -51.286 -31.750  1.00 120.83 ? 1938 ARG E NE    1 
ATOM 8813  C CZ    . ARG E 2 67  ? -40.142  -50.010 -31.620  1.00 120.16 ? 1938 ARG E CZ    1 
ATOM 8814  N NH1   . ARG E 2 67  ? -40.406  -49.179 -32.613  1.00 119.82 ? 1938 ARG E NH1   1 
ATOM 8815  N NH2   . ARG E 2 67  ? -39.574  -49.571 -30.508  1.00 119.45 ? 1938 ARG E NH2   1 
ATOM 8816  N N     . TYR E 2 68  ? -44.438  -53.233 -29.137  1.00 122.17 ? 1939 TYR E N     1 
ATOM 8817  C CA    . TYR E 2 68  ? -44.153  -53.652 -27.769  1.00 122.95 ? 1939 TYR E CA    1 
ATOM 8818  C C     . TYR E 2 68  ? -45.129  -54.691 -27.236  1.00 123.02 ? 1939 TYR E C     1 
ATOM 8819  O O     . TYR E 2 68  ? -44.956  -55.198 -26.128  1.00 123.02 ? 1939 TYR E O     1 
ATOM 8820  C CB    . TYR E 2 68  ? -44.064  -52.426 -26.851  1.00 123.31 ? 1939 TYR E CB    1 
ATOM 8821  C CG    . TYR E 2 68  ? -42.646  -51.889 -26.771  1.00 125.52 ? 1939 TYR E CG    1 
ATOM 8822  C CD1   . TYR E 2 68  ? -41.824  -51.887 -27.910  1.00 127.31 ? 1939 TYR E CD1   1 
ATOM 8823  C CD2   . TYR E 2 68  ? -42.112  -51.405 -25.562  1.00 127.49 ? 1939 TYR E CD2   1 
ATOM 8824  C CE1   . TYR E 2 68  ? -40.519  -51.425 -27.864  1.00 128.65 ? 1939 TYR E CE1   1 
ATOM 8825  C CE2   . TYR E 2 68  ? -40.795  -50.933 -25.501  1.00 129.30 ? 1939 TYR E CE2   1 
ATOM 8826  C CZ    . TYR E 2 68  ? -40.004  -50.950 -26.669  1.00 129.95 ? 1939 TYR E CZ    1 
ATOM 8827  O OH    . TYR E 2 68  ? -38.695  -50.501 -26.672  1.00 131.51 ? 1939 TYR E OH    1 
ATOM 8828  N N     . SER E 2 69  ? -46.138  -55.010 -28.048  1.00 123.26 ? 1940 SER E N     1 
ATOM 8829  C CA    . SER E 2 69  ? -47.118  -56.065 -27.774  1.00 123.48 ? 1940 SER E CA    1 
ATOM 8830  C C     . SER E 2 69  ? -47.980  -55.779 -26.548  1.00 123.90 ? 1940 SER E C     1 
ATOM 8831  O O     . SER E 2 69  ? -48.417  -56.695 -25.864  1.00 123.88 ? 1940 SER E O     1 
ATOM 8832  C CB    . SER E 2 69  ? -46.434  -57.438 -27.662  1.00 123.24 ? 1940 SER E CB    1 
ATOM 8833  O OG    . SER E 2 69  ? -47.315  -58.479 -28.041  1.00 123.01 ? 1940 SER E OG    1 
ATOM 8834  N N     . ARG E 2 70  ? -48.221  -54.505 -26.277  1.00 124.61 ? 1941 ARG E N     1 
ATOM 8835  C CA    . ARG E 2 70  ? -49.140  -54.117 -25.226  1.00 125.75 ? 1941 ARG E CA    1 
ATOM 8836  C C     . ARG E 2 70  ? -50.555  -54.188 -25.806  1.00 126.24 ? 1941 ARG E C     1 
ATOM 8837  O O     . ARG E 2 70  ? -51.045  -53.218 -26.389  1.00 126.20 ? 1941 ARG E O     1 
ATOM 8838  C CB    . ARG E 2 70  ? -48.838  -52.697 -24.752  1.00 126.12 ? 1941 ARG E CB    1 
ATOM 8839  C CG    . ARG E 2 70  ? -47.372  -52.366 -24.555  1.00 127.26 ? 1941 ARG E CG    1 
ATOM 8840  C CD    . ARG E 2 70  ? -47.034  -52.171 -23.102  1.00 129.26 ? 1941 ARG E CD    1 
ATOM 8841  N NE    . ARG E 2 70  ? -45.621  -52.455 -22.876  1.00 131.09 ? 1941 ARG E NE    1 
ATOM 8842  C CZ    . ARG E 2 70  ? -45.120  -53.673 -22.656  1.00 132.01 ? 1941 ARG E CZ    1 
ATOM 8843  N NH1   . ARG E 2 70  ? -45.921  -54.737 -22.624  1.00 131.93 ? 1941 ARG E NH1   1 
ATOM 8844  N NH2   . ARG E 2 70  ? -43.811  -53.832 -22.464  1.00 132.33 ? 1941 ARG E NH2   1 
ATOM 8845  N N     . SER E 2 71  ? -51.208  -55.338 -25.640  1.00 127.00 ? 1942 SER E N     1 
ATOM 8846  C CA    . SER E 2 71  ? -52.448  -55.650 -26.374  1.00 127.57 ? 1942 SER E CA    1 
ATOM 8847  C C     . SER E 2 71  ? -53.673  -54.834 -25.977  1.00 127.91 ? 1942 SER E C     1 
ATOM 8848  O O     . SER E 2 71  ? -54.564  -54.614 -26.800  1.00 127.98 ? 1942 SER E O     1 
ATOM 8849  C CB    . SER E 2 71  ? -52.766  -57.155 -26.349  1.00 127.57 ? 1942 SER E CB    1 
ATOM 8850  O OG    . SER E 2 71  ? -53.102  -57.609 -25.053  1.00 127.70 ? 1942 SER E OG    1 
ATOM 8851  N N     . ASP E 2 72  ? -53.727  -54.393 -24.727  1.00 128.37 ? 1943 ASP E N     1 
ATOM 8852  C CA    . ASP E 2 72  ? -54.841  -53.547 -24.302  1.00 128.85 ? 1943 ASP E CA    1 
ATOM 8853  C C     . ASP E 2 72  ? -54.427  -52.077 -24.193  1.00 128.46 ? 1943 ASP E C     1 
ATOM 8854  O O     . ASP E 2 72  ? -55.272  -51.185 -24.195  1.00 128.44 ? 1943 ASP E O     1 
ATOM 8855  C CB    . ASP E 2 72  ? -55.500  -54.066 -23.011  1.00 129.24 ? 1943 ASP E CB    1 
ATOM 8856  C CG    . ASP E 2 72  ? -54.610  -53.916 -21.799  1.00 130.65 ? 1943 ASP E CG    1 
ATOM 8857  O OD1   . ASP E 2 72  ? -53.363  -53.982 -21.968  1.00 132.92 ? 1943 ASP E OD1   1 
ATOM 8858  O OD2   . ASP E 2 72  ? -55.162  -53.729 -20.686  1.00 131.12 ? 1943 ASP E OD2   1 
ATOM 8859  N N     . ALA E 2 73  ? -53.127  -51.829 -24.110  1.00 128.22 ? 1944 ALA E N     1 
ATOM 8860  C CA    . ALA E 2 73  ? -52.626  -50.475 -24.257  1.00 128.20 ? 1944 ALA E CA    1 
ATOM 8861  C C     . ALA E 2 73  ? -53.134  -49.927 -25.587  1.00 128.11 ? 1944 ALA E C     1 
ATOM 8862  O O     . ALA E 2 73  ? -53.584  -48.783 -25.670  1.00 127.83 ? 1944 ALA E O     1 
ATOM 8863  C CB    . ALA E 2 73  ? -51.111  -50.465 -24.215  1.00 128.31 ? 1944 ALA E CB    1 
ATOM 8864  N N     . ALA E 2 74  ? -53.079  -50.775 -26.610  1.00 128.20 ? 1945 ALA E N     1 
ATOM 8865  C CA    . ALA E 2 74  ? -53.584  -50.455 -27.927  1.00 128.41 ? 1945 ALA E CA    1 
ATOM 8866  C C     . ALA E 2 74  ? -55.074  -50.213 -27.888  1.00 128.75 ? 1945 ALA E C     1 
ATOM 8867  O O     . ALA E 2 74  ? -55.558  -49.298 -28.544  1.00 128.99 ? 1945 ALA E O     1 
ATOM 8868  C CB    . ALA E 2 74  ? -53.276  -51.565 -28.877  1.00 128.36 ? 1945 ALA E CB    1 
ATOM 8869  N N     . LYS E 2 75  ? -55.795  -51.024 -27.112  1.00 129.08 ? 1946 LYS E N     1 
ATOM 8870  C CA    . LYS E 2 75  ? -57.258  -50.926 -27.028  1.00 129.42 ? 1946 LYS E CA    1 
ATOM 8871  C C     . LYS E 2 75  ? -57.778  -49.532 -26.656  1.00 129.59 ? 1946 LYS E C     1 
ATOM 8872  O O     . LYS E 2 75  ? -58.620  -48.993 -27.375  1.00 129.60 ? 1946 LYS E O     1 
ATOM 8873  C CB    . LYS E 2 75  ? -57.835  -51.978 -26.091  1.00 129.45 ? 1946 LYS E CB    1 
ATOM 8874  C CG    . LYS E 2 75  ? -58.977  -52.738 -26.715  1.00 130.29 ? 1946 LYS E CG    1 
ATOM 8875  C CD    . LYS E 2 75  ? -59.304  -54.011 -25.945  1.00 132.70 ? 1946 LYS E CD    1 
ATOM 8876  C CE    . LYS E 2 75  ? -60.433  -53.784 -24.936  1.00 133.78 ? 1946 LYS E CE    1 
ATOM 8877  N NZ    . LYS E 2 75  ? -61.205  -55.056 -24.676  1.00 134.53 ? 1946 LYS E NZ    1 
ATOM 8878  N N     . ARG E 2 76  ? -57.275  -48.947 -25.562  1.00 129.82 ? 1947 ARG E N     1 
ATOM 8879  C CA    . ARG E 2 76  ? -57.666  -47.569 -25.164  1.00 130.19 ? 1947 ARG E CA    1 
ATOM 8880  C C     . ARG E 2 76  ? -57.325  -46.487 -26.205  1.00 129.83 ? 1947 ARG E C     1 
ATOM 8881  O O     . ARG E 2 76  ? -58.063  -45.503 -26.388  1.00 129.86 ? 1947 ARG E O     1 
ATOM 8882  C CB    . ARG E 2 76  ? -57.146  -47.157 -23.771  1.00 130.49 ? 1947 ARG E CB    1 
ATOM 8883  C CG    . ARG E 2 76  ? -55.950  -47.913 -23.233  1.00 132.06 ? 1947 ARG E CG    1 
ATOM 8884  C CD    . ARG E 2 76  ? -56.362  -48.871 -22.102  1.00 135.22 ? 1947 ARG E CD    1 
ATOM 8885  N NE    . ARG E 2 76  ? -55.198  -49.277 -21.303  1.00 138.15 ? 1947 ARG E NE    1 
ATOM 8886  C CZ    . ARG E 2 76  ? -55.140  -50.329 -20.478  1.00 139.07 ? 1947 ARG E CZ    1 
ATOM 8887  N NH1   . ARG E 2 76  ? -56.191  -51.131 -20.312  1.00 139.75 ? 1947 ARG E NH1   1 
ATOM 8888  N NH2   . ARG E 2 76  ? -54.011  -50.583 -19.819  1.00 138.66 ? 1947 ARG E NH2   1 
ATOM 8889  N N     . LEU E 2 77  ? -56.204  -46.691 -26.888  1.00 129.23 ? 1948 LEU E N     1 
ATOM 8890  C CA    . LEU E 2 77  ? -55.764  -45.801 -27.942  1.00 128.32 ? 1948 LEU E CA    1 
ATOM 8891  C C     . LEU E 2 77  ? -56.738  -45.911 -29.104  1.00 127.97 ? 1948 LEU E C     1 
ATOM 8892  O O     . LEU E 2 77  ? -56.812  -45.030 -29.950  1.00 128.14 ? 1948 LEU E O     1 
ATOM 8893  C CB    . LEU E 2 77  ? -54.352  -46.185 -28.364  1.00 128.01 ? 1948 LEU E CB    1 
ATOM 8894  C CG    . LEU E 2 77  ? -53.151  -45.816 -27.479  1.00 127.77 ? 1948 LEU E CG    1 
ATOM 8895  C CD1   . LEU E 2 77  ? -52.189  -44.966 -28.269  1.00 127.56 ? 1948 LEU E CD1   1 
ATOM 8896  C CD2   . LEU E 2 77  ? -53.482  -45.150 -26.114  1.00 127.97 ? 1948 LEU E CD2   1 
ATOM 8897  N N     . LEU E 2 78  ? -57.498  -46.994 -29.133  1.00 127.32 ? 1949 LEU E N     1 
ATOM 8898  C CA    . LEU E 2 78  ? -58.521  -47.136 -30.133  1.00 126.89 ? 1949 LEU E CA    1 
ATOM 8899  C C     . LEU E 2 78  ? -59.871  -46.637 -29.627  1.00 127.13 ? 1949 LEU E C     1 
ATOM 8900  O O     . LEU E 2 78  ? -60.691  -46.183 -30.437  1.00 127.11 ? 1949 LEU E O     1 
ATOM 8901  C CB    . LEU E 2 78  ? -58.596  -48.576 -30.646  1.00 126.65 ? 1949 LEU E CB    1 
ATOM 8902  C CG    . LEU E 2 78  ? -57.968  -48.877 -32.010  1.00 125.37 ? 1949 LEU E CG    1 
ATOM 8903  C CD1   . LEU E 2 78  ? -58.746  -48.228 -33.158  1.00 124.85 ? 1949 LEU E CD1   1 
ATOM 8904  C CD2   . LEU E 2 78  ? -56.520  -48.466 -32.056  1.00 124.35 ? 1949 LEU E CD2   1 
ATOM 8905  N N     . GLU E 2 79  ? -60.107  -46.716 -28.308  1.00 127.23 ? 1950 GLU E N     1 
ATOM 8906  C CA    . GLU E 2 79  ? -61.304  -46.089 -27.708  1.00 127.34 ? 1950 GLU E CA    1 
ATOM 8907  C C     . GLU E 2 79  ? -61.245  -44.610 -28.083  1.00 127.35 ? 1950 GLU E C     1 
ATOM 8908  O O     . GLU E 2 79  ? -62.203  -44.059 -28.646  1.00 127.43 ? 1950 GLU E O     1 
ATOM 8909  C CB    . GLU E 2 79  ? -61.389  -46.241 -26.178  1.00 127.36 ? 1950 GLU E CB    1 
ATOM 8910  C CG    . GLU E 2 79  ? -60.864  -47.546 -25.557  1.00 127.14 ? 1950 GLU E CG    1 
ATOM 8911  C CD    . GLU E 2 79  ? -61.614  -48.813 -25.958  1.00 126.43 ? 1950 GLU E CD    1 
ATOM 8912  O OE1   . GLU E 2 79  ? -61.857  -49.651 -25.051  1.00 125.73 ? 1950 GLU E OE1   1 
ATOM 8913  O OE2   . GLU E 2 79  ? -61.932  -48.981 -27.162  1.00 125.72 ? 1950 GLU E OE2   1 
ATOM 8914  N N     . ALA E 2 80  ? -60.102  -43.985 -27.793  1.00 127.06 ? 1951 ALA E N     1 
ATOM 8915  C CA    . ALA E 2 80  ? -59.748  -42.721 -28.418  1.00 126.89 ? 1951 ALA E CA    1 
ATOM 8916  C C     . ALA E 2 80  ? -59.834  -42.918 -29.926  1.00 126.75 ? 1951 ALA E C     1 
ATOM 8917  O O     . ALA E 2 80  ? -59.223  -43.846 -30.483  1.00 126.84 ? 1951 ALA E O     1 
ATOM 8918  C CB    . ALA E 2 80  ? -58.347  -42.305 -28.020  1.00 127.00 ? 1951 ALA E CB    1 
ATOM 8919  N N     . SER E 2 81  ? -60.605  -42.055 -30.581  1.00 126.29 ? 1952 SER E N     1 
ATOM 8920  C CA    . SER E 2 81  ? -60.809  -42.137 -32.031  1.00 125.77 ? 1952 SER E CA    1 
ATOM 8921  C C     . SER E 2 81  ? -59.517  -41.916 -32.820  1.00 125.20 ? 1952 SER E C     1 
ATOM 8922  O O     . SER E 2 81  ? -59.531  -41.328 -33.912  1.00 125.08 ? 1952 SER E O     1 
ATOM 8923  C CB    . SER E 2 81  ? -61.900  -41.156 -32.468  1.00 125.96 ? 1952 SER E CB    1 
ATOM 8924  O OG    . SER E 2 81  ? -63.149  -41.501 -31.881  1.00 126.21 ? 1952 SER E OG    1 
ATOM 8925  N N     . ALA E 2 82  ? -58.419  -42.417 -32.241  1.00 124.42 ? 1953 ALA E N     1 
ATOM 8926  C CA    . ALA E 2 82  ? -57.057  -42.288 -32.759  1.00 123.43 ? 1953 ALA E CA    1 
ATOM 8927  C C     . ALA E 2 82  ? -56.872  -43.059 -34.058  1.00 122.63 ? 1953 ALA E C     1 
ATOM 8928  O O     . ALA E 2 82  ? -57.203  -44.239 -34.136  1.00 122.61 ? 1953 ALA E O     1 
ATOM 8929  C CB    . ALA E 2 82  ? -56.062  -42.756 -31.723  1.00 123.39 ? 1953 ALA E CB    1 
ATOM 8930  N N     . ASP E 2 83  ? -56.347  -42.380 -35.073  1.00 121.52 ? 1954 ASP E N     1 
ATOM 8931  C CA    . ASP E 2 83  ? -56.219  -42.970 -36.394  1.00 120.59 ? 1954 ASP E CA    1 
ATOM 8932  C C     . ASP E 2 83  ? -55.208  -44.104 -36.354  1.00 119.90 ? 1954 ASP E C     1 
ATOM 8933  O O     . ASP E 2 83  ? -54.090  -43.935 -35.878  1.00 119.79 ? 1954 ASP E O     1 
ATOM 8934  C CB    . ASP E 2 83  ? -55.826  -41.906 -37.432  1.00 120.72 ? 1954 ASP E CB    1 
ATOM 8935  C CG    . ASP E 2 83  ? -55.944  -42.405 -38.876  1.00 120.35 ? 1954 ASP E CG    1 
ATOM 8936  O OD1   . ASP E 2 83  ? -55.274  -41.828 -39.755  1.00 119.18 ? 1954 ASP E OD1   1 
ATOM 8937  O OD2   . ASP E 2 83  ? -56.698  -43.369 -39.139  1.00 120.54 ? 1954 ASP E OD2   1 
ATOM 8938  N N     . ALA E 2 84  ? -55.624  -45.264 -36.843  1.00 119.15 ? 1955 ALA E N     1 
ATOM 8939  C CA    . ALA E 2 84  ? -54.790  -46.456 -36.825  1.00 118.54 ? 1955 ALA E CA    1 
ATOM 8940  C C     . ALA E 2 84  ? -54.096  -46.699 -38.152  1.00 118.06 ? 1955 ALA E C     1 
ATOM 8941  O O     . ALA E 2 84  ? -53.600  -47.803 -38.393  1.00 118.18 ? 1955 ALA E O     1 
ATOM 8942  C CB    . ALA E 2 84  ? -55.614  -47.678 -36.431  1.00 118.54 ? 1955 ALA E CB    1 
ATOM 8943  N N     . ASN E 2 85  ? -54.062  -45.685 -39.010  1.00 117.27 ? 1956 ASN E N     1 
ATOM 8944  C CA    . ASN E 2 85  ? -53.344  -45.811 -40.269  1.00 116.83 ? 1956 ASN E CA    1 
ATOM 8945  C C     . ASN E 2 85  ? -52.308  -44.714 -40.485  1.00 116.81 ? 1956 ASN E C     1 
ATOM 8946  O O     . ASN E 2 85  ? -52.024  -44.310 -41.630  1.00 116.64 ? 1956 ASN E O     1 
ATOM 8947  C CB    . ASN E 2 85  ? -54.311  -45.940 -41.446  1.00 116.83 ? 1956 ASN E CB    1 
ATOM 8948  C CG    . ASN E 2 85  ? -55.073  -47.245 -41.425  1.00 116.33 ? 1956 ASN E CG    1 
ATOM 8949  O OD1   . ASN E 2 85  ? -54.660  -48.230 -42.033  1.00 115.80 ? 1956 ASN E OD1   1 
ATOM 8950  N ND2   . ASN E 2 85  ? -56.175  -47.264 -40.701  1.00 115.98 ? 1956 ASN E ND2   1 
ATOM 8951  N N     . ILE E 2 86  ? -51.741  -44.254 -39.366  1.00 116.73 ? 1957 ILE E N     1 
ATOM 8952  C CA    . ILE E 2 86  ? -50.614  -43.319 -39.363  1.00 116.80 ? 1957 ILE E CA    1 
ATOM 8953  C C     . ILE E 2 86  ? -49.343  -44.000 -39.887  1.00 117.10 ? 1957 ILE E C     1 
ATOM 8954  O O     . ILE E 2 86  ? -49.103  -45.180 -39.604  1.00 117.28 ? 1957 ILE E O     1 
ATOM 8955  C CB    . ILE E 2 86  ? -50.352  -42.773 -37.955  1.00 116.57 ? 1957 ILE E CB    1 
ATOM 8956  C CG1   . ILE E 2 86  ? -51.629  -42.195 -37.359  1.00 117.17 ? 1957 ILE E CG1   1 
ATOM 8957  C CG2   . ILE E 2 86  ? -49.269  -41.721 -37.983  1.00 116.37 ? 1957 ILE E CG2   1 
ATOM 8958  C CD1   . ILE E 2 86  ? -52.288  -41.080 -38.208  1.00 118.64 ? 1957 ILE E CD1   1 
ATOM 8959  N N     . GLN E 2 87  ? -48.543  -43.267 -40.659  1.00 117.27 ? 1958 GLN E N     1 
ATOM 8960  C CA    . GLN E 2 87  ? -47.286  -43.802 -41.193  1.00 117.37 ? 1958 GLN E CA    1 
ATOM 8961  C C     . GLN E 2 87  ? -46.082  -43.273 -40.413  1.00 117.22 ? 1958 GLN E C     1 
ATOM 8962  O O     . GLN E 2 87  ? -45.985  -42.070 -40.144  1.00 117.40 ? 1958 GLN E O     1 
ATOM 8963  C CB    . GLN E 2 87  ? -47.116  -43.451 -42.670  1.00 117.42 ? 1958 GLN E CB    1 
ATOM 8964  C CG    . GLN E 2 87  ? -48.299  -43.755 -43.547  1.00 117.80 ? 1958 GLN E CG    1 
ATOM 8965  C CD    . GLN E 2 87  ? -47.849  -44.347 -44.869  1.00 119.41 ? 1958 GLN E CD    1 
ATOM 8966  O OE1   . GLN E 2 87  ? -47.619  -43.629 -45.851  1.00 120.00 ? 1958 GLN E OE1   1 
ATOM 8967  N NE2   . GLN E 2 87  ? -47.686  -45.669 -44.894  1.00 119.57 ? 1958 GLN E NE2   1 
ATOM 8968  N N     . ASP E 2 88  ? -45.170  -44.171 -40.043  1.00 116.82 ? 1959 ASP E N     1 
ATOM 8969  C CA    . ASP E 2 88  ? -43.889  -43.762 -39.465  1.00 116.21 ? 1959 ASP E CA    1 
ATOM 8970  C C     . ASP E 2 88  ? -42.933  -43.538 -40.622  1.00 115.53 ? 1959 ASP E C     1 
ATOM 8971  O O     . ASP E 2 88  ? -43.329  -43.702 -41.769  1.00 115.43 ? 1959 ASP E O     1 
ATOM 8972  C CB    . ASP E 2 88  ? -43.363  -44.799 -38.460  1.00 116.36 ? 1959 ASP E CB    1 
ATOM 8973  C CG    . ASP E 2 88  ? -43.244  -46.187 -39.050  1.00 116.63 ? 1959 ASP E CG    1 
ATOM 8974  O OD1   . ASP E 2 88  ? -43.478  -46.337 -40.274  1.00 117.37 ? 1959 ASP E OD1   1 
ATOM 8975  O OD2   . ASP E 2 88  ? -42.911  -47.122 -38.282  1.00 116.05 ? 1959 ASP E OD2   1 
ATOM 8976  N N     . ASN E 2 89  ? -41.691  -43.172 -40.332  1.00 114.86 ? 1960 ASN E N     1 
ATOM 8977  C CA    . ASN E 2 89  ? -40.742  -42.788 -41.381  1.00 114.55 ? 1960 ASN E CA    1 
ATOM 8978  C C     . ASN E 2 89  ? -40.374  -43.909 -42.359  1.00 113.33 ? 1960 ASN E C     1 
ATOM 8979  O O     . ASN E 2 89  ? -39.866  -43.649 -43.452  1.00 113.04 ? 1960 ASN E O     1 
ATOM 8980  C CB    . ASN E 2 89  ? -39.492  -42.156 -40.762  1.00 115.35 ? 1960 ASN E CB    1 
ATOM 8981  C CG    . ASN E 2 89  ? -39.825  -40.966 -39.835  1.00 117.89 ? 1960 ASN E CG    1 
ATOM 8982  O OD1   . ASN E 2 89  ? -40.882  -40.320 -39.963  1.00 120.42 ? 1960 ASN E OD1   1 
ATOM 8983  N ND2   . ASN E 2 89  ? -38.919  -40.679 -38.894  1.00 120.22 ? 1960 ASN E ND2   1 
ATOM 8984  N N     . MET E 2 90  ? -40.646  -45.147 -41.956  1.00 111.94 ? 1961 MET E N     1 
ATOM 8985  C CA    . MET E 2 90  ? -40.512  -46.305 -42.833  1.00 110.58 ? 1961 MET E CA    1 
ATOM 8986  C C     . MET E 2 90  ? -41.731  -46.412 -43.722  1.00 109.61 ? 1961 MET E C     1 
ATOM 8987  O O     . MET E 2 90  ? -41.744  -47.127 -44.735  1.00 109.25 ? 1961 MET E O     1 
ATOM 8988  C CB    . MET E 2 90  ? -40.384  -47.592 -42.009  1.00 110.70 ? 1961 MET E CB    1 
ATOM 8989  C CG    . MET E 2 90  ? -39.026  -47.817 -41.301  1.00 110.36 ? 1961 MET E CG    1 
ATOM 8990  S SD    . MET E 2 90  ? -37.484  -47.337 -42.173  1.00 108.33 ? 1961 MET E SD    1 
ATOM 8991  C CE    . MET E 2 90  ? -37.739  -47.950 -43.866  1.00 107.75 ? 1961 MET E CE    1 
ATOM 8992  N N     . GLY E 2 91  ? -42.764  -45.687 -43.318  1.00 108.69 ? 1962 GLY E N     1 
ATOM 8993  C CA    . GLY E 2 91  ? -44.042  -45.704 -43.998  1.00 107.46 ? 1962 GLY E CA    1 
ATOM 8994  C C     . GLY E 2 91  ? -44.787  -46.957 -43.626  1.00 106.33 ? 1962 GLY E C     1 
ATOM 8995  O O     . GLY E 2 91  ? -45.209  -47.703 -44.504  1.00 106.45 ? 1962 GLY E O     1 
ATOM 8996  N N     . ARG E 2 92  ? -44.928  -47.197 -42.325  1.00 104.78 ? 1963 ARG E N     1 
ATOM 8997  C CA    . ARG E 2 92  ? -45.699  -48.339 -41.869  1.00 103.46 ? 1963 ARG E CA    1 
ATOM 8998  C C     . ARG E 2 92  ? -46.743  -47.973 -40.816  1.00 102.38 ? 1963 ARG E C     1 
ATOM 8999  O O     . ARG E 2 92  ? -46.468  -47.210 -39.896  1.00 102.38 ? 1963 ARG E O     1 
ATOM 9000  C CB    . ARG E 2 92  ? -44.807  -49.527 -41.455  1.00 103.52 ? 1963 ARG E CB    1 
ATOM 9001  C CG    . ARG E 2 92  ? -43.529  -49.206 -40.686  1.00 104.69 ? 1963 ARG E CG    1 
ATOM 9002  C CD    . ARG E 2 92  ? -42.488  -50.342 -40.749  1.00 107.16 ? 1963 ARG E CD    1 
ATOM 9003  N NE    . ARG E 2 92  ? -42.419  -51.143 -39.522  1.00 108.77 ? 1963 ARG E NE    1 
ATOM 9004  C CZ    . ARG E 2 92  ? -41.987  -52.408 -39.455  1.00 109.74 ? 1963 ARG E CZ    1 
ATOM 9005  N NH1   . ARG E 2 92  ? -41.583  -53.060 -40.552  1.00 109.92 ? 1963 ARG E NH1   1 
ATOM 9006  N NH2   . ARG E 2 92  ? -41.966  -53.035 -38.282  1.00 110.14 ? 1963 ARG E NH2   1 
ATOM 9007  N N     . THR E 2 93  ? -47.955  -48.494 -41.011  1.00 100.81 ? 1964 THR E N     1 
ATOM 9008  C CA    . THR E 2 93  ? -49.065  -48.363 -40.078  1.00 98.97  ? 1964 THR E CA    1 
ATOM 9009  C C     . THR E 2 93  ? -48.790  -49.294 -38.920  1.00 97.64  ? 1964 THR E C     1 
ATOM 9010  O O     . THR E 2 93  ? -48.137  -50.322 -39.105  1.00 97.04  ? 1964 THR E O     1 
ATOM 9011  C CB    . THR E 2 93  ? -50.434  -48.720 -40.767  1.00 99.19  ? 1964 THR E CB    1 
ATOM 9012  O OG1   . THR E 2 93  ? -51.302  -49.444 -39.879  1.00 99.13  ? 1964 THR E OG1   1 
ATOM 9013  C CG2   . THR E 2 93  ? -50.208  -49.578 -41.971  1.00 99.33  ? 1964 THR E CG2   1 
ATOM 9014  N N     . PRO E 2 94  ? -49.285  -48.943 -37.716  1.00 96.47  ? 1965 PRO E N     1 
ATOM 9015  C CA    . PRO E 2 94  ? -49.163  -49.827 -36.554  1.00 95.52  ? 1965 PRO E CA    1 
ATOM 9016  C C     . PRO E 2 94  ? -49.404  -51.314 -36.852  1.00 94.43  ? 1965 PRO E C     1 
ATOM 9017  O O     . PRO E 2 94  ? -48.664  -52.144 -36.353  1.00 94.28  ? 1965 PRO E O     1 
ATOM 9018  C CB    . PRO E 2 94  ? -50.195  -49.256 -35.582  1.00 95.35  ? 1965 PRO E CB    1 
ATOM 9019  C CG    . PRO E 2 94  ? -50.149  -47.818 -35.849  1.00 95.42  ? 1965 PRO E CG    1 
ATOM 9020  C CD    . PRO E 2 94  ? -49.976  -47.693 -37.352  1.00 96.20  ? 1965 PRO E CD    1 
ATOM 9021  N N     . LEU E 2 95  ? -50.391  -51.650 -37.678  1.00 93.33  ? 1966 LEU E N     1 
ATOM 9022  C CA    . LEU E 2 95  ? -50.578  -53.049 -38.095  1.00 92.30  ? 1966 LEU E CA    1 
ATOM 9023  C C     . LEU E 2 95  ? -49.278  -53.713 -38.589  1.00 91.88  ? 1966 LEU E C     1 
ATOM 9024  O O     . LEU E 2 95  ? -48.972  -54.847 -38.210  1.00 91.41  ? 1966 LEU E O     1 
ATOM 9025  C CB    . LEU E 2 95  ? -51.677  -53.175 -39.161  1.00 92.12  ? 1966 LEU E CB    1 
ATOM 9026  C CG    . LEU E 2 95  ? -51.828  -54.567 -39.795  1.00 90.93  ? 1966 LEU E CG    1 
ATOM 9027  C CD1   . LEU E 2 95  ? -52.530  -55.492 -38.816  1.00 89.60  ? 1966 LEU E CD1   1 
ATOM 9028  C CD2   . LEU E 2 95  ? -52.567  -54.524 -41.113  1.00 89.94  ? 1966 LEU E CD2   1 
ATOM 9029  N N     . HIS E 2 96  ? -48.535  -52.990 -39.435  1.00 91.60  ? 1967 HIS E N     1 
ATOM 9030  C CA    . HIS E 2 96  ? -47.234  -53.429 -39.959  1.00 91.01  ? 1967 HIS E CA    1 
ATOM 9031  C C     . HIS E 2 96  ? -46.290  -53.723 -38.821  1.00 90.75  ? 1967 HIS E C     1 
ATOM 9032  O O     . HIS E 2 96  ? -45.538  -54.688 -38.890  1.00 90.38  ? 1967 HIS E O     1 
ATOM 9033  C CB    . HIS E 2 96  ? -46.585  -52.335 -40.802  1.00 90.89  ? 1967 HIS E CB    1 
ATOM 9034  C CG    . HIS E 2 96  ? -47.043  -52.279 -42.229  1.00 90.27  ? 1967 HIS E CG    1 
ATOM 9035  N ND1   . HIS E 2 96  ? -47.633  -51.158 -42.770  1.00 88.35  ? 1967 HIS E ND1   1 
ATOM 9036  C CD2   . HIS E 2 96  ? -46.945  -53.179 -43.241  1.00 89.47  ? 1967 HIS E CD2   1 
ATOM 9037  C CE1   . HIS E 2 96  ? -47.887  -51.373 -44.049  1.00 88.73  ? 1967 HIS E CE1   1 
ATOM 9038  N NE2   . HIS E 2 96  ? -47.481  -52.592 -44.360  1.00 88.54  ? 1967 HIS E NE2   1 
ATOM 9039  N N     . ALA E 2 97  ? -46.331  -52.864 -37.792  1.00 90.79  ? 1968 ALA E N     1 
ATOM 9040  C CA    . ALA E 2 97  ? -45.527  -53.009 -36.566  1.00 90.77  ? 1968 ALA E CA    1 
ATOM 9041  C C     . ALA E 2 97  ? -45.938  -54.243 -35.801  1.00 90.67  ? 1968 ALA E C     1 
ATOM 9042  O O     . ALA E 2 97  ? -45.092  -55.056 -35.417  1.00 91.10  ? 1968 ALA E O     1 
ATOM 9043  C CB    . ALA E 2 97  ? -45.683  -51.804 -35.682  1.00 90.73  ? 1968 ALA E CB    1 
ATOM 9044  N N     . ALA E 2 98  ? -47.249  -54.365 -35.596  1.00 90.07  ? 1969 ALA E N     1 
ATOM 9045  C CA    . ALA E 2 98  ? -47.857  -55.534 -34.983  1.00 89.46  ? 1969 ALA E CA    1 
ATOM 9046  C C     . ALA E 2 98  ? -47.467  -56.845 -35.678  1.00 89.25  ? 1969 ALA E C     1 
ATOM 9047  O O     . ALA E 2 98  ? -47.024  -57.775 -35.007  1.00 89.46  ? 1969 ALA E O     1 
ATOM 9048  C CB    . ALA E 2 98  ? -49.347  -55.380 -34.916  1.00 89.25  ? 1969 ALA E CB    1 
ATOM 9049  N N     . VAL E 2 99  ? -47.610  -56.930 -36.998  1.00 88.82  ? 1970 VAL E N     1 
ATOM 9050  C CA    . VAL E 2 99  ? -47.174  -58.132 -37.702  1.00 88.53  ? 1970 VAL E CA    1 
ATOM 9051  C C     . VAL E 2 99  ? -45.694  -58.367 -37.484  1.00 88.79  ? 1970 VAL E C     1 
ATOM 9052  O O     . VAL E 2 99  ? -45.295  -59.482 -37.133  1.00 89.03  ? 1970 VAL E O     1 
ATOM 9053  C CB    . VAL E 2 99  ? -47.417  -58.075 -39.212  1.00 88.37  ? 1970 VAL E CB    1 
ATOM 9054  C CG1   . VAL E 2 99  ? -46.959  -59.372 -39.877  1.00 87.85  ? 1970 VAL E CG1   1 
ATOM 9055  C CG2   . VAL E 2 99  ? -48.864  -57.851 -39.497  1.00 88.57  ? 1970 VAL E CG2   1 
ATOM 9056  N N     . SER E 2 100 ? -44.888  -57.322 -37.686  1.00 88.88  ? 1971 SER E N     1 
ATOM 9057  C CA    . SER E 2 100 ? -43.435  -57.429 -37.620  1.00 89.12  ? 1971 SER E CA    1 
ATOM 9058  C C     . SER E 2 100 ? -43.004  -58.004 -36.295  1.00 89.32  ? 1971 SER E C     1 
ATOM 9059  O O     . SER E 2 100 ? -42.059  -58.795 -36.220  1.00 89.07  ? 1971 SER E O     1 
ATOM 9060  C CB    . SER E 2 100 ? -42.779  -56.064 -37.821  1.00 89.13  ? 1971 SER E CB    1 
ATOM 9061  O OG    . SER E 2 100 ? -42.269  -55.939 -39.142  1.00 89.99  ? 1971 SER E OG    1 
ATOM 9062  N N     . ALA E 2 101 ? -43.740  -57.609 -35.259  1.00 89.75  ? 1972 ALA E N     1 
ATOM 9063  C CA    . ALA E 2 101 ? -43.403  -57.913 -33.871  1.00 89.97  ? 1972 ALA E CA    1 
ATOM 9064  C C     . ALA E 2 101 ? -44.057  -59.186 -33.349  1.00 90.03  ? 1972 ALA E C     1 
ATOM 9065  O O     . ALA E 2 101 ? -44.122  -59.367 -32.143  1.00 90.53  ? 1972 ALA E O     1 
ATOM 9066  C CB    . ALA E 2 101 ? -43.759  -56.708 -32.962  1.00 89.72  ? 1972 ALA E CB    1 
ATOM 9067  N N     . ASP E 2 102 ? -44.513  -60.061 -34.248  1.00 90.00  ? 1973 ASP E N     1 
ATOM 9068  C CA    . ASP E 2 102 ? -45.357  -61.214 -33.908  1.00 90.01  ? 1973 ASP E CA    1 
ATOM 9069  C C     . ASP E 2 102 ? -46.234  -60.990 -32.690  1.00 90.27  ? 1973 ASP E C     1 
ATOM 9070  O O     . ASP E 2 102 ? -46.244  -61.822 -31.776  1.00 90.12  ? 1973 ASP E O     1 
ATOM 9071  C CB    . ASP E 2 102 ? -44.522  -62.469 -33.691  1.00 89.86  ? 1973 ASP E CB    1 
ATOM 9072  C CG    . ASP E 2 102 ? -45.352  -63.757 -33.814  1.00 90.66  ? 1973 ASP E CG    1 
ATOM 9073  O OD1   . ASP E 2 102 ? -46.607  -63.672 -33.779  1.00 90.14  ? 1973 ASP E OD1   1 
ATOM 9074  O OD2   . ASP E 2 102 ? -44.754  -64.860 -33.957  1.00 91.25  ? 1973 ASP E OD2   1 
ATOM 9075  N N     . ALA E 2 103 ? -46.958  -59.870 -32.681  1.00 90.82  ? 1974 ALA E N     1 
ATOM 9076  C CA    . ALA E 2 103 ? -47.741  -59.467 -31.519  1.00 91.72  ? 1974 ALA E CA    1 
ATOM 9077  C C     . ALA E 2 103 ? -49.232  -59.850 -31.659  1.00 92.56  ? 1974 ALA E C     1 
ATOM 9078  O O     . ALA E 2 103 ? -50.054  -58.970 -31.917  1.00 92.83  ? 1974 ALA E O     1 
ATOM 9079  C CB    . ALA E 2 103 ? -47.577  -57.978 -31.287  1.00 91.18  ? 1974 ALA E CB    1 
ATOM 9080  N N     . GLN E 2 104 ? -49.582  -61.142 -31.479  1.00 93.34  ? 1975 GLN E N     1 
ATOM 9081  C CA    . GLN E 2 104 ? -50.920  -61.633 -31.873  1.00 94.00  ? 1975 GLN E CA    1 
ATOM 9082  C C     . GLN E 2 104 ? -51.962  -60.782 -31.177  1.00 94.24  ? 1975 GLN E C     1 
ATOM 9083  O O     . GLN E 2 104 ? -52.948  -60.389 -31.804  1.00 94.46  ? 1975 GLN E O     1 
ATOM 9084  C CB    . GLN E 2 104 ? -51.138  -63.162 -31.676  1.00 94.07  ? 1975 GLN E CB    1 
ATOM 9085  C CG    . GLN E 2 104 ? -52.546  -63.734 -32.217  1.00 96.93  ? 1975 GLN E CG    1 
ATOM 9086  C CD    . GLN E 2 104 ? -52.621  -64.340 -33.709  1.00 99.05  ? 1975 GLN E CD    1 
ATOM 9087  O OE1   . GLN E 2 104 ? -52.025  -65.384 -34.008  1.00 100.88 ? 1975 GLN E OE1   1 
ATOM 9088  N NE2   . GLN E 2 104 ? -53.431  -63.713 -34.582  1.00 97.35  ? 1975 GLN E NE2   1 
ATOM 9089  N N     . GLY E 2 105 ? -51.697  -60.431 -29.913  1.00 94.43  ? 1976 GLY E N     1 
ATOM 9090  C CA    . GLY E 2 105 ? -52.611  -59.607 -29.109  1.00 94.17  ? 1976 GLY E CA    1 
ATOM 9091  C C     . GLY E 2 105 ? -53.108  -58.386 -29.844  1.00 94.01  ? 1976 GLY E C     1 
ATOM 9092  O O     . GLY E 2 105 ? -54.272  -58.317 -30.217  1.00 93.46  ? 1976 GLY E O     1 
ATOM 9093  N N     . VAL E 2 106 ? -52.197  -57.443 -30.067  1.00 94.43  ? 1977 VAL E N     1 
ATOM 9094  C CA    . VAL E 2 106 ? -52.480  -56.174 -30.757  1.00 94.83  ? 1977 VAL E CA    1 
ATOM 9095  C C     . VAL E 2 106 ? -52.974  -56.372 -32.183  1.00 94.96  ? 1977 VAL E C     1 
ATOM 9096  O O     . VAL E 2 106 ? -53.968  -55.789 -32.576  1.00 94.80  ? 1977 VAL E O     1 
ATOM 9097  C CB    . VAL E 2 106 ? -51.220  -55.292 -30.804  1.00 95.00  ? 1977 VAL E CB    1 
ATOM 9098  C CG1   . VAL E 2 106 ? -51.553  -53.881 -31.261  1.00 94.55  ? 1977 VAL E CG1   1 
ATOM 9099  C CG2   . VAL E 2 106 ? -50.521  -55.291 -29.439  1.00 95.62  ? 1977 VAL E CG2   1 
ATOM 9100  N N     . PHE E 2 107 ? -52.245  -57.171 -32.954  1.00 95.51  ? 1978 PHE E N     1 
ATOM 9101  C CA    . PHE E 2 107 ? -52.664  -57.613 -34.270  1.00 96.27  ? 1978 PHE E CA    1 
ATOM 9102  C C     . PHE E 2 107 ? -54.177  -57.790 -34.300  1.00 97.43  ? 1978 PHE E C     1 
ATOM 9103  O O     . PHE E 2 107 ? -54.897  -56.907 -34.787  1.00 97.91  ? 1978 PHE E O     1 
ATOM 9104  C CB    . PHE E 2 107 ? -51.971  -58.920 -34.588  1.00 95.79  ? 1978 PHE E CB    1 
ATOM 9105  C CG    . PHE E 2 107 ? -52.340  -59.498 -35.900  1.00 94.74  ? 1978 PHE E CG    1 
ATOM 9106  C CD1   . PHE E 2 107 ? -52.219  -58.769 -37.048  1.00 93.64  ? 1978 PHE E CD1   1 
ATOM 9107  C CD2   . PHE E 2 107 ? -52.774  -60.809 -35.991  1.00 94.88  ? 1978 PHE E CD2   1 
ATOM 9108  C CE1   . PHE E 2 107 ? -52.541  -59.342 -38.269  1.00 94.30  ? 1978 PHE E CE1   1 
ATOM 9109  C CE2   . PHE E 2 107 ? -53.092  -61.393 -37.215  1.00 94.15  ? 1978 PHE E CE2   1 
ATOM 9110  C CZ    . PHE E 2 107 ? -52.975  -60.666 -38.351  1.00 93.41  ? 1978 PHE E CZ    1 
ATOM 9111  N N     . GLN E 2 108 ? -54.652  -58.907 -33.743  1.00 98.17  ? 1979 GLN E N     1 
ATOM 9112  C CA    . GLN E 2 108 ? -56.087  -59.176 -33.532  1.00 98.71  ? 1979 GLN E CA    1 
ATOM 9113  C C     . GLN E 2 108 ? -56.983  -57.980 -33.270  1.00 98.37  ? 1979 GLN E C     1 
ATOM 9114  O O     . GLN E 2 108 ? -58.076  -57.912 -33.815  1.00 98.42  ? 1979 GLN E O     1 
ATOM 9115  C CB    . GLN E 2 108 ? -56.287  -60.178 -32.400  1.00 99.19  ? 1979 GLN E CB    1 
ATOM 9116  C CG    . GLN E 2 108 ? -56.164  -61.604 -32.870  1.00 101.90 ? 1979 GLN E CG    1 
ATOM 9117  C CD    . GLN E 2 108 ? -56.977  -61.840 -34.129  1.00 105.86 ? 1979 GLN E CD    1 
ATOM 9118  O OE1   . GLN E 2 108 ? -56.414  -62.101 -35.204  1.00 106.89 ? 1979 GLN E OE1   1 
ATOM 9119  N NE2   . GLN E 2 108 ? -58.314  -61.720 -34.013  1.00 107.25 ? 1979 GLN E NE2   1 
ATOM 9120  N N     . ILE E 2 109 ? -56.539  -57.056 -32.424  1.00 98.16  ? 1980 ILE E N     1 
ATOM 9121  C CA    . ILE E 2 109 ? -57.287  -55.827 -32.219  1.00 98.09  ? 1980 ILE E CA    1 
ATOM 9122  C C     . ILE E 2 109 ? -57.440  -55.128 -33.559  1.00 98.23  ? 1980 ILE E C     1 
ATOM 9123  O O     . ILE E 2 109 ? -58.557  -54.997 -34.067  1.00 98.70  ? 1980 ILE E O     1 
ATOM 9124  C CB    . ILE E 2 109 ? -56.631  -54.888 -31.177  1.00 97.86  ? 1980 ILE E CB    1 
ATOM 9125  C CG1   . ILE E 2 109 ? -56.842  -55.413 -29.756  1.00 98.38  ? 1980 ILE E CG1   1 
ATOM 9126  C CG2   . ILE E 2 109 ? -57.232  -53.492 -31.257  1.00 96.92  ? 1980 ILE E CG2   1 
ATOM 9127  C CD1   . ILE E 2 109 ? -57.135  -56.928 -29.641  1.00 100.64 ? 1980 ILE E CD1   1 
ATOM 9128  N N     . LEU E 2 110 ? -56.322  -54.735 -34.153  1.00 98.07  ? 1981 LEU E N     1 
ATOM 9129  C CA    . LEU E 2 110 ? -56.371  -53.830 -35.288  1.00 98.20  ? 1981 LEU E CA    1 
ATOM 9130  C C     . LEU E 2 110 ? -57.148  -54.400 -36.455  1.00 98.02  ? 1981 LEU E C     1 
ATOM 9131  O O     . LEU E 2 110 ? -57.851  -53.664 -37.136  1.00 98.09  ? 1981 LEU E O     1 
ATOM 9132  C CB    . LEU E 2 110 ? -54.970  -53.409 -35.748  1.00 98.50  ? 1981 LEU E CB    1 
ATOM 9133  C CG    . LEU E 2 110 ? -53.938  -52.972 -34.707  1.00 98.63  ? 1981 LEU E CG    1 
ATOM 9134  C CD1   . LEU E 2 110 ? -52.883  -54.032 -34.634  1.00 98.52  ? 1981 LEU E CD1   1 
ATOM 9135  C CD2   . LEU E 2 110 ? -53.318  -51.651 -35.086  1.00 98.60  ? 1981 LEU E CD2   1 
ATOM 9136  N N     . ILE E 2 111 ? -57.020  -55.703 -36.677  1.00 97.78  ? 1982 ILE E N     1 
ATOM 9137  C CA    . ILE E 2 111 ? -57.683  -56.361 -37.795  1.00 97.73  ? 1982 ILE E CA    1 
ATOM 9138  C C     . ILE E 2 111 ? -59.200  -56.534 -37.511  1.00 98.45  ? 1982 ILE E C     1 
ATOM 9139  O O     . ILE E 2 111 ? -60.034  -56.477 -38.426  1.00 98.54  ? 1982 ILE E O     1 
ATOM 9140  C CB    . ILE E 2 111 ? -56.930  -57.659 -38.203  1.00 97.05  ? 1982 ILE E CB    1 
ATOM 9141  C CG1   . ILE E 2 111 ? -57.860  -58.681 -38.842  1.00 96.98  ? 1982 ILE E CG1   1 
ATOM 9142  C CG2   . ILE E 2 111 ? -56.275  -58.286 -37.016  1.00 96.77  ? 1982 ILE E CG2   1 
ATOM 9143  C CD1   . ILE E 2 111 ? -57.261  -60.069 -38.985  1.00 96.53  ? 1982 ILE E CD1   1 
ATOM 9144  N N     . ARG E 2 112 ? -59.559  -56.711 -36.241  1.00 99.00  ? 1983 ARG E N     1 
ATOM 9145  C CA    . ARG E 2 112 ? -60.959  -56.831 -35.871  1.00 99.55  ? 1983 ARG E CA    1 
ATOM 9146  C C     . ARG E 2 112 ? -61.643  -55.470 -36.004  1.00 99.37  ? 1983 ARG E C     1 
ATOM 9147  O O     . ARG E 2 112 ? -62.864  -55.385 -36.170  1.00 99.57  ? 1983 ARG E O     1 
ATOM 9148  C CB    . ARG E 2 112 ? -61.116  -57.430 -34.464  1.00 99.93  ? 1983 ARG E CB    1 
ATOM 9149  C CG    . ARG E 2 112 ? -61.045  -58.975 -34.427  1.00 102.41 ? 1983 ARG E CG    1 
ATOM 9150  C CD    . ARG E 2 112 ? -61.900  -59.585 -33.291  1.00 107.47 ? 1983 ARG E CD    1 
ATOM 9151  N NE    . ARG E 2 112 ? -61.427  -59.201 -31.951  1.00 112.34 ? 1983 ARG E NE    1 
ATOM 9152  C CZ    . ARG E 2 112 ? -60.656  -59.959 -31.160  1.00 114.70 ? 1983 ARG E CZ    1 
ATOM 9153  N NH1   . ARG E 2 112 ? -60.260  -61.169 -31.563  1.00 115.30 ? 1983 ARG E NH1   1 
ATOM 9154  N NH2   . ARG E 2 112 ? -60.272  -59.509 -29.961  1.00 114.99 ? 1983 ARG E NH2   1 
ATOM 9155  N N     . ASN E 2 113 ? -60.835  -54.414 -35.952  1.00 99.13  ? 1984 ASN E N     1 
ATOM 9156  C CA    . ASN E 2 113 ? -61.287  -53.031 -36.158  1.00 98.87  ? 1984 ASN E CA    1 
ATOM 9157  C C     . ASN E 2 113 ? -61.455  -52.663 -37.648  1.00 98.43  ? 1984 ASN E C     1 
ATOM 9158  O O     . ASN E 2 113 ? -60.571  -52.897 -38.476  1.00 98.33  ? 1984 ASN E O     1 
ATOM 9159  C CB    . ASN E 2 113 ? -60.340  -52.062 -35.418  1.00 98.95  ? 1984 ASN E CB    1 
ATOM 9160  C CG    . ASN E 2 113 ? -60.482  -50.612 -35.866  1.00 99.02  ? 1984 ASN E CG    1 
ATOM 9161  O OD1   . ASN E 2 113 ? -60.925  -49.755 -35.100  1.00 99.15  ? 1984 ASN E OD1   1 
ATOM 9162  N ND2   . ASN E 2 113 ? -60.066  -50.328 -37.096  1.00 99.21  ? 1984 ASN E ND2   1 
ATOM 9163  N N     . ARG E 2 114 ? -62.595  -52.070 -37.970  1.00 97.86  ? 1985 ARG E N     1 
ATOM 9164  C CA    . ARG E 2 114 ? -62.968  -51.830 -39.351  1.00 97.36  ? 1985 ARG E CA    1 
ATOM 9165  C C     . ARG E 2 114 ? -62.193  -50.696 -40.017  1.00 97.30  ? 1985 ARG E C     1 
ATOM 9166  O O     . ARG E 2 114 ? -61.937  -50.749 -41.222  1.00 97.52  ? 1985 ARG E O     1 
ATOM 9167  C CB    . ARG E 2 114 ? -64.479  -51.606 -39.442  1.00 97.24  ? 1985 ARG E CB    1 
ATOM 9168  C CG    . ARG E 2 114 ? -64.977  -50.831 -40.657  1.00 96.08  ? 1985 ARG E CG    1 
ATOM 9169  C CD    . ARG E 2 114 ? -66.434  -50.455 -40.446  1.00 94.39  ? 1985 ARG E CD    1 
ATOM 9170  N NE    . ARG E 2 114 ? -67.228  -51.634 -40.121  1.00 92.37  ? 1985 ARG E NE    1 
ATOM 9171  C CZ    . ARG E 2 114 ? -67.871  -52.373 -41.016  1.00 91.27  ? 1985 ARG E CZ    1 
ATOM 9172  N NH1   . ARG E 2 114 ? -67.841  -52.048 -42.301  1.00 90.68  ? 1985 ARG E NH1   1 
ATOM 9173  N NH2   . ARG E 2 114 ? -68.554  -53.437 -40.623  1.00 90.81  ? 1985 ARG E NH2   1 
ATOM 9174  N N     . ALA E 2 115 ? -61.821  -49.676 -39.248  1.00 97.16  ? 1986 ALA E N     1 
ATOM 9175  C CA    . ALA E 2 115 ? -61.167  -48.481 -39.820  1.00 96.99  ? 1986 ALA E CA    1 
ATOM 9176  C C     . ALA E 2 115 ? -59.889  -48.848 -40.547  1.00 96.71  ? 1986 ALA E C     1 
ATOM 9177  O O     . ALA E 2 115 ? -59.639  -48.363 -41.655  1.00 96.95  ? 1986 ALA E O     1 
ATOM 9178  C CB    . ALA E 2 115 ? -60.895  -47.404 -38.745  1.00 96.97  ? 1986 ALA E CB    1 
ATOM 9179  N N     . THR E 2 116 ? -59.143  -49.762 -39.929  1.00 96.14  ? 1987 THR E N     1 
ATOM 9180  C CA    . THR E 2 116 ? -57.773  -50.143 -40.281  1.00 95.70  ? 1987 THR E CA    1 
ATOM 9181  C C     . THR E 2 116 ? -57.532  -50.653 -41.698  1.00 95.10  ? 1987 THR E C     1 
ATOM 9182  O O     . THR E 2 116 ? -58.051  -51.707 -42.068  1.00 95.27  ? 1987 THR E O     1 
ATOM 9183  C CB    . THR E 2 116 ? -57.337  -51.255 -39.342  1.00 95.87  ? 1987 THR E CB    1 
ATOM 9184  O OG1   . THR E 2 116 ? -57.674  -50.889 -37.996  1.00 96.61  ? 1987 THR E OG1   1 
ATOM 9185  C CG2   . THR E 2 116 ? -55.845  -51.516 -39.463  1.00 96.36  ? 1987 THR E CG2   1 
ATOM 9186  N N     . ASP E 2 117 ? -56.717  -49.934 -42.470  1.00 94.26  ? 1988 ASP E N     1 
ATOM 9187  C CA    . ASP E 2 117 ? -56.345  -50.390 -43.813  1.00 93.63  ? 1988 ASP E CA    1 
ATOM 9188  C C     . ASP E 2 117 ? -55.520  -51.669 -43.730  1.00 93.20  ? 1988 ASP E C     1 
ATOM 9189  O O     . ASP E 2 117 ? -54.380  -51.659 -43.268  1.00 93.46  ? 1988 ASP E O     1 
ATOM 9190  C CB    . ASP E 2 117 ? -55.553  -49.320 -44.572  1.00 93.71  ? 1988 ASP E CB    1 
ATOM 9191  C CG    . ASP E 2 117 ? -55.253  -49.720 -46.023  1.00 93.99  ? 1988 ASP E CG    1 
ATOM 9192  O OD1   . ASP E 2 117 ? -55.645  -50.826 -46.444  1.00 95.08  ? 1988 ASP E OD1   1 
ATOM 9193  O OD2   . ASP E 2 117 ? -54.638  -48.924 -46.761  1.00 93.89  ? 1988 ASP E OD2   1 
ATOM 9194  N N     . LEU E 2 118 ? -56.096  -52.771 -44.186  1.00 92.35  ? 1989 LEU E N     1 
ATOM 9195  C CA    . LEU E 2 118 ? -55.392  -54.048 -44.168  1.00 91.48  ? 1989 LEU E CA    1 
ATOM 9196  C C     . LEU E 2 118 ? -54.418  -54.182 -45.323  1.00 91.03  ? 1989 LEU E C     1 
ATOM 9197  O O     . LEU E 2 118 ? -53.580  -55.082 -45.344  1.00 90.94  ? 1989 LEU E O     1 
ATOM 9198  C CB    . LEU E 2 118 ? -56.373  -55.220 -44.218  1.00 91.36  ? 1989 LEU E CB    1 
ATOM 9199  C CG    . LEU E 2 118 ? -57.445  -55.412 -43.148  1.00 91.41  ? 1989 LEU E CG    1 
ATOM 9200  C CD1   . LEU E 2 118 ? -58.017  -56.810 -43.305  1.00 90.32  ? 1989 LEU E CD1   1 
ATOM 9201  C CD2   . LEU E 2 118 ? -56.934  -55.179 -41.722  1.00 91.47  ? 1989 LEU E CD2   1 
ATOM 9202  N N     . ASP E 2 119 ? -54.528  -53.306 -46.300  1.00 90.71  ? 1990 ASP E N     1 
ATOM 9203  C CA    . ASP E 2 119 ? -53.681  -53.445 -47.447  1.00 90.95  ? 1990 ASP E CA    1 
ATOM 9204  C C     . ASP E 2 119 ? -52.694  -52.313 -47.593  1.00 90.99  ? 1990 ASP E C     1 
ATOM 9205  O O     . ASP E 2 119 ? -52.147  -52.087 -48.687  1.00 91.28  ? 1990 ASP E O     1 
ATOM 9206  C CB    . ASP E 2 119 ? -54.524  -53.669 -48.680  1.00 91.14  ? 1990 ASP E CB    1 
ATOM 9207  C CG    . ASP E 2 119 ? -55.045  -55.085 -48.745  1.00 92.94  ? 1990 ASP E CG    1 
ATOM 9208  O OD1   . ASP E 2 119 ? -54.187  -56.011 -48.686  1.00 94.72  ? 1990 ASP E OD1   1 
ATOM 9209  O OD2   . ASP E 2 119 ? -56.287  -55.285 -48.841  1.00 94.33  ? 1990 ASP E OD2   1 
ATOM 9210  N N     . ALA E 2 120 ? -52.436  -51.644 -46.468  1.00 90.67  ? 1991 ALA E N     1 
ATOM 9211  C CA    . ALA E 2 120 ? -51.589  -50.473 -46.431  1.00 90.70  ? 1991 ALA E CA    1 
ATOM 9212  C C     . ALA E 2 120 ? -50.216  -50.856 -46.879  1.00 91.10  ? 1991 ALA E C     1 
ATOM 9213  O O     . ALA E 2 120 ? -49.764  -51.966 -46.590  1.00 91.11  ? 1991 ALA E O     1 
ATOM 9214  C CB    . ALA E 2 120 ? -51.547  -49.911 -45.053  1.00 90.47  ? 1991 ALA E CB    1 
ATOM 9215  N N     . ARG E 2 121 ? -49.561  -49.957 -47.610  1.00 91.89  ? 1992 ARG E N     1 
ATOM 9216  C CA    . ARG E 2 121 ? -48.183  -50.209 -48.058  1.00 92.68  ? 1992 ARG E CA    1 
ATOM 9217  C C     . ARG E 2 121 ? -47.116  -49.402 -47.328  1.00 92.99  ? 1992 ARG E C     1 
ATOM 9218  O O     . ARG E 2 121 ? -47.419  -48.457 -46.595  1.00 93.06  ? 1992 ARG E O     1 
ATOM 9219  C CB    . ARG E 2 121 ? -48.057  -50.053 -49.569  1.00 92.63  ? 1992 ARG E CB    1 
ATOM 9220  C CG    . ARG E 2 121 ? -48.410  -48.682 -50.140  1.00 93.33  ? 1992 ARG E CG    1 
ATOM 9221  C CD    . ARG E 2 121 ? -48.423  -48.752 -51.675  1.00 93.48  ? 1992 ARG E CD    1 
ATOM 9222  N NE    . ARG E 2 121 ? -49.020  -50.016 -52.087  1.00 92.47  ? 1992 ARG E NE    1 
ATOM 9223  C CZ    . ARG E 2 121 ? -48.383  -50.983 -52.735  1.00 92.99  ? 1992 ARG E CZ    1 
ATOM 9224  N NH1   . ARG E 2 121 ? -49.037  -52.094 -53.033  1.00 93.63  ? 1992 ARG E NH1   1 
ATOM 9225  N NH2   . ARG E 2 121 ? -47.109  -50.846 -53.098  1.00 93.36  ? 1992 ARG E NH2   1 
ATOM 9226  N N     . MET E 2 122 ? -45.867  -49.808 -47.510  1.00 93.76  ? 1993 MET E N     1 
ATOM 9227  C CA    . MET E 2 122 ? -44.724  -49.117 -46.875  1.00 94.43  ? 1993 MET E CA    1 
ATOM 9228  C C     . MET E 2 122 ? -43.973  -48.338 -47.932  1.00 94.49  ? 1993 MET E C     1 
ATOM 9229  O O     . MET E 2 122 ? -44.387  -48.334 -49.103  1.00 94.67  ? 1993 MET E O     1 
ATOM 9230  C CB    . MET E 2 122 ? -43.762  -50.096 -46.186  1.00 94.51  ? 1993 MET E CB    1 
ATOM 9231  C CG    . MET E 2 122 ? -44.347  -50.957 -45.065  1.00 94.53  ? 1993 MET E CG    1 
ATOM 9232  S SD    . MET E 2 122 ? -42.975  -51.771 -44.236  1.00 95.26  ? 1993 MET E SD    1 
ATOM 9233  C CE    . MET E 2 122 ? -43.774  -53.011 -43.251  1.00 96.14  ? 1993 MET E CE    1 
ATOM 9234  N N     . HIS E 2 123 ? -42.872  -47.697 -47.551  1.00 94.31  ? 1994 HIS E N     1 
ATOM 9235  C CA    . HIS E 2 123 ? -42.164  -46.905 -48.538  1.00 94.63  ? 1994 HIS E CA    1 
ATOM 9236  C C     . HIS E 2 123 ? -41.692  -47.791 -49.694  1.00 94.07  ? 1994 HIS E C     1 
ATOM 9237  O O     . HIS E 2 123 ? -41.543  -47.326 -50.826  1.00 94.51  ? 1994 HIS E O     1 
ATOM 9238  C CB    . HIS E 2 123 ? -41.039  -46.076 -47.915  1.00 95.23  ? 1994 HIS E CB    1 
ATOM 9239  C CG    . HIS E 2 123 ? -41.519  -44.979 -47.000  1.00 97.83  ? 1994 HIS E CG    1 
ATOM 9240  N ND1   . HIS E 2 123 ? -42.756  -44.377 -47.125  1.00 99.73  ? 1994 HIS E ND1   1 
ATOM 9241  C CD2   . HIS E 2 123 ? -40.911  -44.357 -45.960  1.00 99.85  ? 1994 HIS E CD2   1 
ATOM 9242  C CE1   . HIS E 2 123 ? -42.895  -43.444 -46.199  1.00 99.77  ? 1994 HIS E CE1   1 
ATOM 9243  N NE2   . HIS E 2 123 ? -41.790  -43.415 -45.475  1.00 100.44 ? 1994 HIS E NE2   1 
ATOM 9244  N N     . ASP E 2 124 ? -41.515  -49.076 -49.414  1.00 93.21  ? 1995 ASP E N     1 
ATOM 9245  C CA    . ASP E 2 124 ? -41.109  -50.040 -50.430  1.00 92.70  ? 1995 ASP E CA    1 
ATOM 9246  C C     . ASP E 2 124 ? -42.324  -50.799 -50.864  1.00 92.16  ? 1995 ASP E C     1 
ATOM 9247  O O     . ASP E 2 124 ? -42.232  -51.813 -51.606  1.00 92.11  ? 1995 ASP E O     1 
ATOM 9248  C CB    . ASP E 2 124 ? -40.069  -51.025 -49.887  1.00 93.19  ? 1995 ASP E CB    1 
ATOM 9249  C CG    . ASP E 2 124 ? -40.364  -51.479 -48.459  1.00 93.59  ? 1995 ASP E CG    1 
ATOM 9250  O OD1   . ASP E 2 124 ? -40.188  -52.687 -48.159  1.00 93.90  ? 1995 ASP E OD1   1 
ATOM 9251  O OD2   . ASP E 2 124 ? -40.754  -50.614 -47.638  1.00 94.72  ? 1995 ASP E OD2   1 
ATOM 9252  N N     . GLY E 2 125 ? -43.459  -50.294 -50.372  1.00 91.41  ? 1996 GLY E N     1 
ATOM 9253  C CA    . GLY E 2 125 ? -44.799  -50.839 -50.637  1.00 90.42  ? 1996 GLY E CA    1 
ATOM 9254  C C     . GLY E 2 125 ? -45.067  -52.243 -50.108  1.00 89.43  ? 1996 GLY E C     1 
ATOM 9255  O O     . GLY E 2 125 ? -45.673  -53.077 -50.790  1.00 89.22  ? 1996 GLY E O     1 
ATOM 9256  N N     . THR E 2 126 ? -44.602  -52.529 -48.901  1.00 88.45  ? 1997 THR E N     1 
ATOM 9257  C CA    . THR E 2 126 ? -44.853  -53.851 -48.368  1.00 87.58  ? 1997 THR E CA    1 
ATOM 9258  C C     . THR E 2 126 ? -46.185  -53.850 -47.590  1.00 87.25  ? 1997 THR E C     1 
ATOM 9259  O O     . THR E 2 126 ? -46.470  -52.948 -46.775  1.00 87.12  ? 1997 THR E O     1 
ATOM 9260  C CB    . THR E 2 126 ? -43.630  -54.451 -47.590  1.00 87.43  ? 1997 THR E CB    1 
ATOM 9261  O OG1   . THR E 2 126 ? -42.945  -53.407 -46.906  1.00 86.42  ? 1997 THR E OG1   1 
ATOM 9262  C CG2   . THR E 2 126 ? -42.647  -55.156 -48.551  1.00 86.95  ? 1997 THR E CG2   1 
ATOM 9263  N N     . THR E 2 127 ? -47.009  -54.846 -47.903  1.00 86.24  ? 1998 THR E N     1 
ATOM 9264  C CA    . THR E 2 127 ? -48.294  -55.038 -47.265  1.00 85.36  ? 1998 THR E CA    1 
ATOM 9265  C C     . THR E 2 127 ? -48.056  -55.916 -46.063  1.00 84.68  ? 1998 THR E C     1 
ATOM 9266  O O     . THR E 2 127 ? -47.118  -56.713 -46.095  1.00 85.27  ? 1998 THR E O     1 
ATOM 9267  C CB    . THR E 2 127 ? -49.218  -55.821 -48.202  1.00 85.80  ? 1998 THR E CB    1 
ATOM 9268  O OG1   . THR E 2 127 ? -48.684  -57.138 -48.457  1.00 85.00  ? 1998 THR E OG1   1 
ATOM 9269  C CG2   . THR E 2 127 ? -49.407  -55.065 -49.525  1.00 86.64  ? 1998 THR E CG2   1 
ATOM 9270  N N     . PRO E 2 128 ? -48.897  -55.814 -45.008  1.00 83.37  ? 1999 PRO E N     1 
ATOM 9271  C CA    . PRO E 2 128 ? -48.764  -56.747 -43.884  1.00 81.97  ? 1999 PRO E CA    1 
ATOM 9272  C C     . PRO E 2 128 ? -48.874  -58.182 -44.341  1.00 80.40  ? 1999 PRO E C     1 
ATOM 9273  O O     . PRO E 2 128 ? -48.142  -59.023 -43.898  1.00 79.40  ? 1999 PRO E O     1 
ATOM 9274  C CB    . PRO E 2 128 ? -49.932  -56.357 -42.977  1.00 82.19  ? 1999 PRO E CB    1 
ATOM 9275  C CG    . PRO E 2 128 ? -50.071  -54.895 -43.194  1.00 82.55  ? 1999 PRO E CG    1 
ATOM 9276  C CD    . PRO E 2 128 ? -49.892  -54.772 -44.709  1.00 83.40  ? 1999 PRO E CD    1 
ATOM 9277  N N     . LEU E 2 129 ? -49.761  -58.437 -45.274  1.00 79.90  ? 2000 LEU E N     1 
ATOM 9278  C CA    . LEU E 2 129 ? -49.808  -59.733 -45.891  1.00 79.49  ? 2000 LEU E CA    1 
ATOM 9279  C C     . LEU E 2 129 ? -48.433  -60.154 -46.426  1.00 79.59  ? 2000 LEU E C     1 
ATOM 9280  O O     . LEU E 2 129 ? -48.144  -61.352 -46.532  1.00 79.87  ? 2000 LEU E O     1 
ATOM 9281  C CB    . LEU E 2 129 ? -50.861  -59.772 -47.009  1.00 79.37  ? 2000 LEU E CB    1 
ATOM 9282  C CG    . LEU E 2 129 ? -51.698  -61.068 -47.060  1.00 77.70  ? 2000 LEU E CG    1 
ATOM 9283  C CD1   . LEU E 2 129 ? -51.352  -62.109 -48.154  1.00 74.40  ? 2000 LEU E CD1   1 
ATOM 9284  C CD2   . LEU E 2 129 ? -51.688  -61.701 -45.688  1.00 77.25  ? 2000 LEU E CD2   1 
ATOM 9285  N N     . ILE E 2 130 ? -47.582  -59.185 -46.765  1.00 79.49  ? 2001 ILE E N     1 
ATOM 9286  C CA    . ILE E 2 130 ? -46.213  -59.511 -47.246  1.00 79.16  ? 2001 ILE E CA    1 
ATOM 9287  C C     . ILE E 2 130 ? -45.304  -59.967 -46.092  1.00 78.46  ? 2001 ILE E C     1 
ATOM 9288  O O     . ILE E 2 130 ? -44.846  -61.120 -46.087  1.00 78.06  ? 2001 ILE E O     1 
ATOM 9289  C CB    . ILE E 2 130 ? -45.539  -58.366 -48.098  1.00 79.09  ? 2001 ILE E CB    1 
ATOM 9290  C CG1   . ILE E 2 130 ? -46.351  -58.070 -49.352  1.00 79.42  ? 2001 ILE E CG1   1 
ATOM 9291  C CG2   . ILE E 2 130 ? -44.146  -58.784 -48.549  1.00 79.01  ? 2001 ILE E CG2   1 
ATOM 9292  C CD1   . ILE E 2 130 ? -46.294  -59.185 -50.446  1.00 79.37  ? 2001 ILE E CD1   1 
ATOM 9293  N N     . LEU E 2 131 ? -45.053  -59.078 -45.132  1.00 77.55  ? 2002 LEU E N     1 
ATOM 9294  C CA    . LEU E 2 131 ? -44.356  -59.468 -43.930  1.00 77.61  ? 2002 LEU E CA    1 
ATOM 9295  C C     . LEU E 2 131 ? -44.913  -60.807 -43.398  1.00 77.97  ? 2002 LEU E C     1 
ATOM 9296  O O     . LEU E 2 131 ? -44.177  -61.801 -43.239  1.00 78.59  ? 2002 LEU E O     1 
ATOM 9297  C CB    . LEU E 2 131 ? -44.520  -58.419 -42.846  1.00 77.45  ? 2002 LEU E CB    1 
ATOM 9298  C CG    . LEU E 2 131 ? -44.525  -56.950 -43.211  1.00 77.98  ? 2002 LEU E CG    1 
ATOM 9299  C CD1   . LEU E 2 131 ? -44.817  -56.098 -41.954  1.00 77.49  ? 2002 LEU E CD1   1 
ATOM 9300  C CD2   . LEU E 2 131 ? -43.202  -56.609 -43.849  1.00 79.95  ? 2002 LEU E CD2   1 
ATOM 9301  N N     . ALA E 2 132 ? -46.210  -60.836 -43.127  1.00 77.57  ? 2003 ALA E N     1 
ATOM 9302  C CA    . ALA E 2 132 ? -46.844  -62.045 -42.698  1.00 77.27  ? 2003 ALA E CA    1 
ATOM 9303  C C     . ALA E 2 132 ? -46.216  -63.231 -43.381  1.00 77.44  ? 2003 ALA E C     1 
ATOM 9304  O O     . ALA E 2 132 ? -45.791  -64.172 -42.701  1.00 77.60  ? 2003 ALA E O     1 
ATOM 9305  C CB    . ALA E 2 132 ? -48.270  -61.997 -43.030  1.00 77.71  ? 2003 ALA E CB    1 
ATOM 9306  N N     . ALA E 2 133 ? -46.148  -63.177 -44.714  1.00 77.43  ? 2004 ALA E N     1 
ATOM 9307  C CA    . ALA E 2 133 ? -45.623  -64.287 -45.527  1.00 77.84  ? 2004 ALA E CA    1 
ATOM 9308  C C     . ALA E 2 133 ? -44.135  -64.571 -45.369  1.00 78.27  ? 2004 ALA E C     1 
ATOM 9309  O O     . ALA E 2 133 ? -43.709  -65.737 -45.356  1.00 78.12  ? 2004 ALA E O     1 
ATOM 9310  C CB    . ALA E 2 133 ? -45.929  -64.075 -46.961  1.00 77.84  ? 2004 ALA E CB    1 
ATOM 9311  N N     . ARG E 2 134 ? -43.332  -63.522 -45.259  1.00 78.89  ? 2005 ARG E N     1 
ATOM 9312  C CA    . ARG E 2 134 ? -41.893  -63.744 -45.164  1.00 79.69  ? 2005 ARG E CA    1 
ATOM 9313  C C     . ARG E 2 134 ? -41.440  -63.968 -43.714  1.00 80.28  ? 2005 ARG E C     1 
ATOM 9314  O O     . ARG E 2 134 ? -40.826  -65.012 -43.440  1.00 81.09  ? 2005 ARG E O     1 
ATOM 9315  C CB    . ARG E 2 134 ? -41.073  -62.674 -45.922  1.00 79.31  ? 2005 ARG E CB    1 
ATOM 9316  C CG    . ARG E 2 134 ? -40.998  -61.333 -45.209  1.00 79.20  ? 2005 ARG E CG    1 
ATOM 9317  C CD    . ARG E 2 134 ? -40.656  -60.189 -46.150  1.00 77.82  ? 2005 ARG E CD    1 
ATOM 9318  N NE    . ARG E 2 134 ? -40.481  -58.925 -45.423  1.00 75.92  ? 2005 ARG E NE    1 
ATOM 9319  C CZ    . ARG E 2 134 ? -40.339  -57.750 -46.025  1.00 75.68  ? 2005 ARG E CZ    1 
ATOM 9320  N NH1   . ARG E 2 134 ? -40.376  -57.686 -47.363  1.00 77.09  ? 2005 ARG E NH1   1 
ATOM 9321  N NH2   . ARG E 2 134 ? -40.173  -56.650 -45.302  1.00 73.95  ? 2005 ARG E NH2   1 
ATOM 9322  N N     . LEU E 2 135 ? -41.783  -63.037 -42.810  1.00 80.10  ? 2006 LEU E N     1 
ATOM 9323  C CA    . LEU E 2 135 ? -41.426  -63.117 -41.393  1.00 80.44  ? 2006 LEU E CA    1 
ATOM 9324  C C     . LEU E 2 135 ? -41.867  -64.374 -40.645  1.00 81.24  ? 2006 LEU E C     1 
ATOM 9325  O O     . LEU E 2 135 ? -41.721  -64.443 -39.400  1.00 81.67  ? 2006 LEU E O     1 
ATOM 9326  C CB    . LEU E 2 135 ? -42.007  -61.941 -40.639  1.00 80.05  ? 2006 LEU E CB    1 
ATOM 9327  C CG    . LEU E 2 135 ? -41.382  -60.609 -40.968  1.00 80.12  ? 2006 LEU E CG    1 
ATOM 9328  C CD1   . LEU E 2 135 ? -41.717  -59.573 -39.877  1.00 79.49  ? 2006 LEU E CD1   1 
ATOM 9329  C CD2   . LEU E 2 135 ? -39.886  -60.796 -41.155  1.00 80.11  ? 2006 LEU E CD2   1 
ATOM 9330  N N     . ALA E 2 136 ? -42.407  -65.342 -41.393  1.00 81.60  ? 2007 ALA E N     1 
ATOM 9331  C CA    . ALA E 2 136 ? -42.885  -66.628 -40.885  1.00 81.96  ? 2007 ALA E CA    1 
ATOM 9332  C C     . ALA E 2 136 ? -43.486  -66.527 -39.489  1.00 82.49  ? 2007 ALA E C     1 
ATOM 9333  O O     . ALA E 2 136 ? -42.868  -66.939 -38.518  1.00 82.73  ? 2007 ALA E O     1 
ATOM 9334  C CB    . ALA E 2 136 ? -41.775  -67.653 -40.923  1.00 81.50  ? 2007 ALA E CB    1 
ATOM 9335  N N     . VAL E 2 137 ? -44.669  -65.934 -39.386  1.00 83.06  ? 2008 VAL E N     1 
ATOM 9336  C CA    . VAL E 2 137 ? -45.389  -65.895 -38.122  1.00 83.94  ? 2008 VAL E CA    1 
ATOM 9337  C C     . VAL E 2 137 ? -46.535  -66.896 -38.227  1.00 85.05  ? 2008 VAL E C     1 
ATOM 9338  O O     . VAL E 2 137 ? -46.956  -67.201 -39.333  1.00 85.68  ? 2008 VAL E O     1 
ATOM 9339  C CB    . VAL E 2 137 ? -45.963  -64.514 -37.870  1.00 83.61  ? 2008 VAL E CB    1 
ATOM 9340  C CG1   . VAL E 2 137 ? -44.873  -63.535 -37.521  1.00 83.44  ? 2008 VAL E CG1   1 
ATOM 9341  C CG2   . VAL E 2 137 ? -46.713  -64.047 -39.087  1.00 83.93  ? 2008 VAL E CG2   1 
ATOM 9342  N N     . GLU E 2 138 ? -47.055  -67.403 -37.107  1.00 85.98  ? 2009 GLU E N     1 
ATOM 9343  C CA    . GLU E 2 138 ? -48.191  -68.350 -37.163  1.00 86.96  ? 2009 GLU E CA    1 
ATOM 9344  C C     . GLU E 2 138 ? -49.508  -67.598 -37.312  1.00 86.70  ? 2009 GLU E C     1 
ATOM 9345  O O     . GLU E 2 138 ? -49.655  -66.483 -36.804  1.00 86.90  ? 2009 GLU E O     1 
ATOM 9346  C CB    . GLU E 2 138 ? -48.237  -69.266 -35.926  1.00 87.28  ? 2009 GLU E CB    1 
ATOM 9347  C CG    . GLU E 2 138 ? -47.040  -70.215 -35.819  1.00 91.84  ? 2009 GLU E CG    1 
ATOM 9348  C CD    . GLU E 2 138 ? -47.162  -71.317 -34.746  1.00 98.16  ? 2009 GLU E CD    1 
ATOM 9349  O OE1   . GLU E 2 138 ? -47.684  -71.029 -33.643  1.00 101.20 ? 2009 GLU E OE1   1 
ATOM 9350  O OE2   . GLU E 2 138 ? -46.702  -72.474 -34.994  1.00 99.84  ? 2009 GLU E OE2   1 
ATOM 9351  N N     . GLY E 2 139 ? -50.469  -68.193 -38.009  1.00 86.54  ? 2010 GLY E N     1 
ATOM 9352  C CA    . GLY E 2 139 ? -51.820  -67.618 -38.055  1.00 86.18  ? 2010 GLY E CA    1 
ATOM 9353  C C     . GLY E 2 139 ? -52.028  -66.332 -38.847  1.00 85.70  ? 2010 GLY E C     1 
ATOM 9354  O O     . GLY E 2 139 ? -52.830  -66.309 -39.775  1.00 85.93  ? 2010 GLY E O     1 
ATOM 9355  N N     . MET E 2 140 ? -51.311  -65.267 -38.498  1.00 85.09  ? 2011 MET E N     1 
ATOM 9356  C CA    . MET E 2 140 ? -51.481  -63.933 -39.132  1.00 84.66  ? 2011 MET E CA    1 
ATOM 9357  C C     . MET E 2 140 ? -51.871  -63.898 -40.602  1.00 83.98  ? 2011 MET E C     1 
ATOM 9358  O O     . MET E 2 140 ? -52.841  -63.253 -40.971  1.00 83.56  ? 2011 MET E O     1 
ATOM 9359  C CB    . MET E 2 140 ? -50.237  -63.076 -38.940  1.00 84.62  ? 2011 MET E CB    1 
ATOM 9360  C CG    . MET E 2 140 ? -49.788  -63.031 -37.512  1.00 85.95  ? 2011 MET E CG    1 
ATOM 9361  S SD    . MET E 2 140 ? -49.285  -61.397 -36.984  1.00 88.62  ? 2011 MET E SD    1 
ATOM 9362  C CE    . MET E 2 140 ? -48.233  -61.801 -35.603  1.00 88.85  ? 2011 MET E CE    1 
ATOM 9363  N N     . LEU E 2 141 ? -51.091  -64.581 -41.428  1.00 83.77  ? 2012 LEU E N     1 
ATOM 9364  C CA    . LEU E 2 141 ? -51.350  -64.669 -42.842  1.00 83.62  ? 2012 LEU E CA    1 
ATOM 9365  C C     . LEU E 2 141 ? -52.804  -65.003 -43.062  1.00 84.81  ? 2012 LEU E C     1 
ATOM 9366  O O     . LEU E 2 141 ? -53.530  -64.259 -43.724  1.00 85.08  ? 2012 LEU E O     1 
ATOM 9367  C CB    . LEU E 2 141 ? -50.522  -65.766 -43.461  1.00 82.75  ? 2012 LEU E CB    1 
ATOM 9368  C CG    . LEU E 2 141 ? -50.731  -65.702 -44.953  1.00 80.48  ? 2012 LEU E CG    1 
ATOM 9369  C CD1   . LEU E 2 141 ? -49.746  -64.740 -45.511  1.00 79.27  ? 2012 LEU E CD1   1 
ATOM 9370  C CD2   . LEU E 2 141 ? -50.517  -67.039 -45.542  1.00 78.20  ? 2012 LEU E CD2   1 
ATOM 9371  N N     . GLU E 2 142 ? -53.221  -66.137 -42.504  1.00 85.83  ? 2013 GLU E N     1 
ATOM 9372  C CA    . GLU E 2 142 ? -54.602  -66.593 -42.576  1.00 86.57  ? 2013 GLU E CA    1 
ATOM 9373  C C     . GLU E 2 142 ? -55.607  -65.550 -42.074  1.00 86.15  ? 2013 GLU E C     1 
ATOM 9374  O O     . GLU E 2 142 ? -56.526  -65.218 -42.797  1.00 86.41  ? 2013 GLU E O     1 
ATOM 9375  C CB    . GLU E 2 142 ? -54.771  -67.877 -41.785  1.00 87.16  ? 2013 GLU E CB    1 
ATOM 9376  C CG    . GLU E 2 142 ? -54.527  -69.148 -42.549  1.00 90.30  ? 2013 GLU E CG    1 
ATOM 9377  C CD    . GLU E 2 142 ? -55.647  -70.182 -42.290  1.00 95.38  ? 2013 GLU E CD    1 
ATOM 9378  O OE1   . GLU E 2 142 ? -56.843  -69.785 -42.436  1.00 96.76  ? 2013 GLU E OE1   1 
ATOM 9379  O OE2   . GLU E 2 142 ? -55.338  -71.372 -41.955  1.00 96.54  ? 2013 GLU E OE2   1 
ATOM 9380  N N     . ASP E 2 143 ? -55.439  -65.029 -40.863  1.00 85.59  ? 2014 ASP E N     1 
ATOM 9381  C CA    . ASP E 2 143 ? -56.407  -64.082 -40.323  1.00 85.67  ? 2014 ASP E CA    1 
ATOM 9382  C C     . ASP E 2 143 ? -56.571  -62.853 -41.205  1.00 85.45  ? 2014 ASP E C     1 
ATOM 9383  O O     . ASP E 2 143 ? -57.692  -62.361 -41.408  1.00 85.67  ? 2014 ASP E O     1 
ATOM 9384  C CB    . ASP E 2 143 ? -56.035  -63.646 -38.917  1.00 86.16  ? 2014 ASP E CB    1 
ATOM 9385  C CG    . ASP E 2 143 ? -55.951  -64.808 -37.943  1.00 88.45  ? 2014 ASP E CG    1 
ATOM 9386  O OD1   . ASP E 2 143 ? -56.240  -65.963 -38.359  1.00 90.12  ? 2014 ASP E OD1   1 
ATOM 9387  O OD2   . ASP E 2 143 ? -55.572  -64.561 -36.763  1.00 90.54  ? 2014 ASP E OD2   1 
ATOM 9388  N N     . LEU E 2 144 ? -55.460  -62.351 -41.739  1.00 85.02  ? 2015 LEU E N     1 
ATOM 9389  C CA    . LEU E 2 144 ? -55.539  -61.274 -42.718  1.00 84.19  ? 2015 LEU E CA    1 
ATOM 9390  C C     . LEU E 2 144 ? -56.282  -61.736 -43.949  1.00 84.02  ? 2015 LEU E C     1 
ATOM 9391  O O     . LEU E 2 144 ? -57.122  -61.004 -44.425  1.00 84.26  ? 2015 LEU E O     1 
ATOM 9392  C CB    . LEU E 2 144 ? -54.173  -60.749 -43.122  1.00 83.92  ? 2015 LEU E CB    1 
ATOM 9393  C CG    . LEU E 2 144 ? -53.371  -59.909 -42.137  1.00 83.67  ? 2015 LEU E CG    1 
ATOM 9394  C CD1   . LEU E 2 144 ? -51.998  -59.656 -42.749  1.00 84.16  ? 2015 LEU E CD1   1 
ATOM 9395  C CD2   . LEU E 2 144 ? -54.042  -58.594 -41.770  1.00 82.23  ? 2015 LEU E CD2   1 
ATOM 9396  N N     . ILE E 2 145 ? -55.993  -62.935 -44.457  1.00 83.78  ? 2016 ILE E N     1 
ATOM 9397  C CA    . ILE E 2 145 ? -56.712  -63.432 -45.629  1.00 83.98  ? 2016 ILE E CA    1 
ATOM 9398  C C     . ILE E 2 145 ? -58.217  -63.456 -45.372  1.00 84.16  ? 2016 ILE E C     1 
ATOM 9399  O O     . ILE E 2 145 ? -58.986  -62.853 -46.131  1.00 83.82  ? 2016 ILE E O     1 
ATOM 9400  C CB    . ILE E 2 145 ? -56.161  -64.775 -46.134  1.00 84.20  ? 2016 ILE E CB    1 
ATOM 9401  C CG1   . ILE E 2 145 ? -54.786  -64.518 -46.774  1.00 84.92  ? 2016 ILE E CG1   1 
ATOM 9402  C CG2   . ILE E 2 145 ? -57.157  -65.465 -47.113  1.00 83.15  ? 2016 ILE E CG2   1 
ATOM 9403  C CD1   . ILE E 2 145 ? -54.063  -65.748 -47.328  1.00 87.22  ? 2016 ILE E CD1   1 
ATOM 9404  N N     . ASN E 2 146 ? -58.617  -64.115 -44.284  1.00 84.62  ? 2017 ASN E N     1 
ATOM 9405  C CA    . ASN E 2 146 ? -60.014  -64.164 -43.851  1.00 85.10  ? 2017 ASN E CA    1 
ATOM 9406  C C     . ASN E 2 146 ? -60.648  -62.800 -43.690  1.00 85.51  ? 2017 ASN E C     1 
ATOM 9407  O O     . ASN E 2 146 ? -61.781  -62.597 -44.119  1.00 86.08  ? 2017 ASN E O     1 
ATOM 9408  C CB    . ASN E 2 146 ? -60.180  -64.988 -42.582  1.00 84.69  ? 2017 ASN E CB    1 
ATOM 9409  C CG    . ASN E 2 146 ? -59.885  -66.447 -42.815  1.00 85.51  ? 2017 ASN E CG    1 
ATOM 9410  O OD1   . ASN E 2 146 ? -59.942  -66.942 -43.952  1.00 85.65  ? 2017 ASN E OD1   1 
ATOM 9411  N ND2   . ASN E 2 146 ? -59.546  -67.153 -41.746  1.00 86.73  ? 2017 ASN E ND2   1 
ATOM 9412  N N     . SER E 2 147 ? -59.925  -61.847 -43.122  1.00 85.48  ? 2018 SER E N     1 
ATOM 9413  C CA    . SER E 2 147 ? -60.477  -60.512 -43.055  1.00 85.87  ? 2018 SER E CA    1 
ATOM 9414  C C     . SER E 2 147 ? -60.525  -59.780 -44.416  1.00 86.45  ? 2018 SER E C     1 
ATOM 9415  O O     . SER E 2 147 ? -60.876  -58.596 -44.497  1.00 86.79  ? 2018 SER E O     1 
ATOM 9416  C CB    . SER E 2 147 ? -59.773  -59.719 -41.973  1.00 85.65  ? 2018 SER E CB    1 
ATOM 9417  O OG    . SER E 2 147 ? -60.102  -60.278 -40.714  1.00 86.06  ? 2018 SER E OG    1 
ATOM 9418  N N     . HIS E 2 148 ? -60.194  -60.505 -45.486  1.00 86.96  ? 2019 HIS E N     1 
ATOM 9419  C CA    . HIS E 2 148 ? -60.303  -60.014 -46.873  1.00 87.39  ? 2019 HIS E CA    1 
ATOM 9420  C C     . HIS E 2 148 ? -59.271  -58.964 -47.243  1.00 87.02  ? 2019 HIS E C     1 
ATOM 9421  O O     . HIS E 2 148 ? -59.582  -57.884 -47.719  1.00 86.86  ? 2019 HIS E O     1 
ATOM 9422  C CB    . HIS E 2 148 ? -61.740  -59.576 -47.197  1.00 88.07  ? 2019 HIS E CB    1 
ATOM 9423  C CG    . HIS E 2 148 ? -62.745  -60.658 -46.967  1.00 89.88  ? 2019 HIS E CG    1 
ATOM 9424  N ND1   . HIS E 2 148 ? -63.523  -60.721 -45.825  1.00 91.42  ? 2019 HIS E ND1   1 
ATOM 9425  C CD2   . HIS E 2 148 ? -63.055  -61.757 -47.701  1.00 91.38  ? 2019 HIS E CD2   1 
ATOM 9426  C CE1   . HIS E 2 148 ? -64.287  -61.801 -45.877  1.00 92.97  ? 2019 HIS E CE1   1 
ATOM 9427  N NE2   . HIS E 2 148 ? -64.014  -62.451 -47.000  1.00 93.72  ? 2019 HIS E NE2   1 
ATOM 9428  N N     . ALA E 2 149 ? -58.019  -59.299 -47.005  1.00 87.02  ? 2020 ALA E N     1 
ATOM 9429  C CA    . ALA E 2 149 ? -56.920  -58.521 -47.508  1.00 86.73  ? 2020 ALA E CA    1 
ATOM 9430  C C     . ALA E 2 149 ? -56.739  -58.877 -48.985  1.00 86.81  ? 2020 ALA E C     1 
ATOM 9431  O O     . ALA E 2 149 ? -57.018  -60.018 -49.432  1.00 86.89  ? 2020 ALA E O     1 
ATOM 9432  C CB    . ALA E 2 149 ? -55.685  -58.835 -46.723  1.00 86.58  ? 2020 ALA E CB    1 
ATOM 9433  N N     . ASP E 2 150 ? -56.317  -57.885 -49.759  1.00 86.41  ? 2021 ASP E N     1 
ATOM 9434  C CA    . ASP E 2 150 ? -56.015  -58.129 -51.153  1.00 86.15  ? 2021 ASP E CA    1 
ATOM 9435  C C     . ASP E 2 150 ? -54.882  -59.133 -51.185  1.00 85.09  ? 2021 ASP E C     1 
ATOM 9436  O O     . ASP E 2 150 ? -53.749  -58.848 -50.784  1.00 85.32  ? 2021 ASP E O     1 
ATOM 9437  C CB    . ASP E 2 150 ? -55.642  -56.841 -51.877  1.00 86.65  ? 2021 ASP E CB    1 
ATOM 9438  C CG    . ASP E 2 150 ? -55.487  -57.036 -53.376  1.00 89.59  ? 2021 ASP E CG    1 
ATOM 9439  O OD1   . ASP E 2 150 ? -55.250  -58.181 -53.859  1.00 91.80  ? 2021 ASP E OD1   1 
ATOM 9440  O OD2   . ASP E 2 150 ? -55.603  -56.010 -54.085  1.00 94.21  ? 2021 ASP E OD2   1 
ATOM 9441  N N     . VAL E 2 151 ? -55.199  -60.332 -51.630  1.00 83.84  ? 2022 VAL E N     1 
ATOM 9442  C CA    . VAL E 2 151 ? -54.207  -61.378 -51.586  1.00 82.93  ? 2022 VAL E CA    1 
ATOM 9443  C C     . VAL E 2 151 ? -53.196  -61.185 -52.704  1.00 82.40  ? 2022 VAL E C     1 
ATOM 9444  O O     . VAL E 2 151 ? -52.043  -61.612 -52.567  1.00 82.62  ? 2022 VAL E O     1 
ATOM 9445  C CB    . VAL E 2 151 ? -54.876  -62.765 -51.582  1.00 83.06  ? 2022 VAL E CB    1 
ATOM 9446  C CG1   . VAL E 2 151 ? -56.399  -62.565 -51.440  1.00 84.32  ? 2022 VAL E CG1   1 
ATOM 9447  C CG2   . VAL E 2 151 ? -54.524  -63.625 -52.816  1.00 81.31  ? 2022 VAL E CG2   1 
ATOM 9448  N N     . ASN E 2 152 ? -53.605  -60.507 -53.782  1.00 81.34  ? 2023 ASN E N     1 
ATOM 9449  C CA    . ASN E 2 152 ? -52.708  -60.314 -54.915  1.00 80.38  ? 2023 ASN E CA    1 
ATOM 9450  C C     . ASN E 2 152 ? -51.937  -59.010 -54.967  1.00 79.97  ? 2023 ASN E C     1 
ATOM 9451  O O     . ASN E 2 152 ? -51.098  -58.834 -55.872  1.00 79.78  ? 2023 ASN E O     1 
ATOM 9452  C CB    . ASN E 2 152 ? -53.424  -60.602 -56.200  1.00 80.19  ? 2023 ASN E CB    1 
ATOM 9453  C CG    . ASN E 2 152 ? -53.803  -62.036 -56.297  1.00 81.44  ? 2023 ASN E CG    1 
ATOM 9454  O OD1   . ASN E 2 152 ? -54.185  -62.645 -55.305  1.00 82.52  ? 2023 ASN E OD1   1 
ATOM 9455  N ND2   . ASN E 2 152 ? -53.679  -62.607 -57.480  1.00 83.20  ? 2023 ASN E ND2   1 
ATOM 9456  N N     . ALA E 2 153 ? -52.201  -58.143 -53.974  1.00 79.34  ? 2024 ALA E N     1 
ATOM 9457  C CA    . ALA E 2 153 ? -51.510  -56.872 -53.771  1.00 79.34  ? 2024 ALA E CA    1 
ATOM 9458  C C     . ALA E 2 153 ? -50.018  -57.048 -53.853  1.00 79.81  ? 2024 ALA E C     1 
ATOM 9459  O O     . ALA E 2 153 ? -49.497  -58.076 -53.390  1.00 80.14  ? 2024 ALA E O     1 
ATOM 9460  C CB    . ALA E 2 153 ? -51.854  -56.340 -52.445  1.00 79.43  ? 2024 ALA E CB    1 
ATOM 9461  N N     . VAL E 2 154 ? -49.315  -56.071 -54.435  1.00 80.18  ? 2025 VAL E N     1 
ATOM 9462  C CA    . VAL E 2 154 ? -47.843  -56.210 -54.592  1.00 80.68  ? 2025 VAL E CA    1 
ATOM 9463  C C     . VAL E 2 154 ? -47.025  -55.023 -54.046  1.00 81.39  ? 2025 VAL E C     1 
ATOM 9464  O O     . VAL E 2 154 ? -47.507  -53.879 -54.039  1.00 81.17  ? 2025 VAL E O     1 
ATOM 9465  C CB    . VAL E 2 154 ? -47.370  -56.594 -56.075  1.00 80.18  ? 2025 VAL E CB    1 
ATOM 9466  C CG1   . VAL E 2 154 ? -48.062  -57.842 -56.607  1.00 79.10  ? 2025 VAL E CG1   1 
ATOM 9467  C CG2   . VAL E 2 154 ? -47.574  -55.469 -57.011  1.00 80.29  ? 2025 VAL E CG2   1 
ATOM 9468  N N     . ASP E 2 155 ? -45.796  -55.317 -53.589  1.00 82.26  ? 2026 ASP E N     1 
ATOM 9469  C CA    . ASP E 2 155 ? -44.776  -54.270 -53.267  1.00 82.95  ? 2026 ASP E CA    1 
ATOM 9470  C C     . ASP E 2 155 ? -44.134  -53.627 -54.523  1.00 82.55  ? 2026 ASP E C     1 
ATOM 9471  O O     . ASP E 2 155 ? -44.266  -54.158 -55.652  1.00 82.68  ? 2026 ASP E O     1 
ATOM 9472  C CB    . ASP E 2 155 ? -43.667  -54.822 -52.341  1.00 83.31  ? 2026 ASP E CB    1 
ATOM 9473  C CG    . ASP E 2 155 ? -42.912  -56.068 -52.943  1.00 85.48  ? 2026 ASP E CG    1 
ATOM 9474  O OD1   . ASP E 2 155 ? -43.190  -56.508 -54.109  1.00 85.04  ? 2026 ASP E OD1   1 
ATOM 9475  O OD2   . ASP E 2 155 ? -42.026  -56.599 -52.203  1.00 87.34  ? 2026 ASP E OD2   1 
ATOM 9476  N N     . ASP E 2 156 ? -43.408  -52.526 -54.319  1.00 81.40  ? 2027 ASP E N     1 
ATOM 9477  C CA    . ASP E 2 156 ? -42.755  -51.833 -55.430  1.00 80.67  ? 2027 ASP E CA    1 
ATOM 9478  C C     . ASP E 2 156 ? -42.007  -52.730 -56.442  1.00 79.90  ? 2027 ASP E C     1 
ATOM 9479  O O     . ASP E 2 156 ? -41.929  -52.388 -57.625  1.00 80.50  ? 2027 ASP E O     1 
ATOM 9480  C CB    . ASP E 2 156 ? -41.856  -50.730 -54.910  1.00 80.91  ? 2027 ASP E CB    1 
ATOM 9481  C CG    . ASP E 2 156 ? -42.588  -49.809 -53.939  1.00 83.51  ? 2027 ASP E CG    1 
ATOM 9482  O OD1   . ASP E 2 156 ? -43.818  -50.032 -53.768  1.00 86.24  ? 2027 ASP E OD1   1 
ATOM 9483  O OD2   . ASP E 2 156 ? -41.950  -48.881 -53.339  1.00 85.15  ? 2027 ASP E OD2   1 
ATOM 9484  N N     . LEU E 2 157 ? -41.480  -53.879 -56.026  1.00 78.29  ? 2028 LEU E N     1 
ATOM 9485  C CA    . LEU E 2 157 ? -40.758  -54.709 -56.979  1.00 76.59  ? 2028 LEU E CA    1 
ATOM 9486  C C     . LEU E 2 157 ? -41.747  -55.620 -57.616  1.00 76.28  ? 2028 LEU E C     1 
ATOM 9487  O O     . LEU E 2 157 ? -41.393  -56.511 -58.439  1.00 75.52  ? 2028 LEU E O     1 
ATOM 9488  C CB    . LEU E 2 157 ? -39.653  -55.475 -56.298  1.00 76.39  ? 2028 LEU E CB    1 
ATOM 9489  C CG    . LEU E 2 157 ? -38.428  -54.608 -56.061  1.00 75.81  ? 2028 LEU E CG    1 
ATOM 9490  C CD1   . LEU E 2 157 ? -38.579  -53.707 -54.768  1.00 75.32  ? 2028 LEU E CD1   1 
ATOM 9491  C CD2   . LEU E 2 157 ? -37.160  -55.490 -56.075  1.00 74.49  ? 2028 LEU E CD2   1 
ATOM 9492  N N     . GLY E 2 158 ? -43.000  -55.362 -57.217  1.00 76.02  ? 2029 GLY E N     1 
ATOM 9493  C CA    . GLY E 2 158 ? -44.187  -56.055 -57.720  1.00 76.54  ? 2029 GLY E CA    1 
ATOM 9494  C C     . GLY E 2 158 ? -44.167  -57.556 -57.467  1.00 76.70  ? 2029 GLY E C     1 
ATOM 9495  O O     . GLY E 2 158 ? -44.376  -58.357 -58.391  1.00 76.73  ? 2029 GLY E O     1 
ATOM 9496  N N     . LYS E 2 159 ? -43.879  -57.922 -56.212  1.00 76.55  ? 2030 LYS E N     1 
ATOM 9497  C CA    . LYS E 2 159 ? -43.825  -59.306 -55.766  1.00 76.02  ? 2030 LYS E CA    1 
ATOM 9498  C C     . LYS E 2 159 ? -44.993  -59.458 -54.819  1.00 76.14  ? 2030 LYS E C     1 
ATOM 9499  O O     . LYS E 2 159 ? -45.209  -58.598 -53.895  1.00 75.65  ? 2030 LYS E O     1 
ATOM 9500  C CB    . LYS E 2 159 ? -42.527  -59.563 -55.000  1.00 76.21  ? 2030 LYS E CB    1 
ATOM 9501  C CG    . LYS E 2 159 ? -41.283  -59.802 -55.871  1.00 77.03  ? 2030 LYS E CG    1 
ATOM 9502  C CD    . LYS E 2 159 ? -39.969  -59.884 -55.066  1.00 77.72  ? 2030 LYS E CD    1 
ATOM 9503  C CE    . LYS E 2 159 ? -39.729  -58.630 -54.211  1.00 78.55  ? 2030 LYS E CE    1 
ATOM 9504  N NZ    . LYS E 2 159 ? -38.295  -58.430 -53.742  1.00 79.60  ? 2030 LYS E NZ    1 
ATOM 9505  N N     . SER E 2 160 ? -45.752  -60.531 -55.050  1.00 75.84  ? 2031 SER E N     1 
ATOM 9506  C CA    . SER E 2 160 ? -46.901  -60.836 -54.203  1.00 76.16  ? 2031 SER E CA    1 
ATOM 9507  C C     . SER E 2 160 ? -46.482  -61.674 -52.982  1.00 76.00  ? 2031 SER E C     1 
ATOM 9508  O O     . SER E 2 160 ? -45.420  -62.328 -52.983  1.00 75.85  ? 2031 SER E O     1 
ATOM 9509  C CB    . SER E 2 160 ? -47.940  -61.598 -55.011  1.00 76.47  ? 2031 SER E CB    1 
ATOM 9510  O OG    . SER E 2 160 ? -47.421  -62.855 -55.453  1.00 77.38  ? 2031 SER E OG    1 
ATOM 9511  N N     . ALA E 2 161 ? -47.311  -61.683 -51.941  1.00 75.52  ? 2032 ALA E N     1 
ATOM 9512  C CA    . ALA E 2 161 ? -46.981  -62.516 -50.793  1.00 74.95  ? 2032 ALA E CA    1 
ATOM 9513  C C     . ALA E 2 161 ? -46.761  -63.971 -51.215  1.00 74.60  ? 2032 ALA E C     1 
ATOM 9514  O O     . ALA E 2 161 ? -46.009  -64.679 -50.562  1.00 74.49  ? 2032 ALA E O     1 
ATOM 9515  C CB    . ALA E 2 161 ? -48.028  -62.405 -49.692  1.00 74.92  ? 2032 ALA E CB    1 
ATOM 9516  N N     . LEU E 2 162 ? -47.398  -64.406 -52.307  1.00 74.60  ? 2033 LEU E N     1 
ATOM 9517  C CA    . LEU E 2 162 ? -47.134  -65.744 -52.861  1.00 74.45  ? 2033 LEU E CA    1 
ATOM 9518  C C     . LEU E 2 162 ? -45.719  -65.841 -53.364  1.00 75.07  ? 2033 LEU E C     1 
ATOM 9519  O O     . LEU E 2 162 ? -45.031  -66.839 -53.141  1.00 75.00  ? 2033 LEU E O     1 
ATOM 9520  C CB    . LEU E 2 162 ? -48.050  -66.090 -54.015  1.00 74.05  ? 2033 LEU E CB    1 
ATOM 9521  C CG    . LEU E 2 162 ? -47.753  -67.535 -54.401  1.00 73.14  ? 2033 LEU E CG    1 
ATOM 9522  C CD1   . LEU E 2 162 ? -48.205  -68.421 -53.292  1.00 72.84  ? 2033 LEU E CD1   1 
ATOM 9523  C CD2   . LEU E 2 162 ? -48.430  -67.934 -55.693  1.00 73.82  ? 2033 LEU E CD2   1 
ATOM 9524  N N     . HIS E 2 163 ? -45.296  -64.800 -54.065  1.00 76.25  ? 2034 HIS E N     1 
ATOM 9525  C CA    . HIS E 2 163 ? -43.903  -64.665 -54.478  1.00 77.30  ? 2034 HIS E CA    1 
ATOM 9526  C C     . HIS E 2 163 ? -42.978  -64.861 -53.278  1.00 77.16  ? 2034 HIS E C     1 
ATOM 9527  O O     . HIS E 2 163 ? -42.301  -65.895 -53.184  1.00 77.00  ? 2034 HIS E O     1 
ATOM 9528  C CB    . HIS E 2 163 ? -43.651  -63.298 -55.155  1.00 77.90  ? 2034 HIS E CB    1 
ATOM 9529  C CG    . HIS E 2 163 ? -43.882  -63.301 -56.640  1.00 79.37  ? 2034 HIS E CG    1 
ATOM 9530  N ND1   . HIS E 2 163 ? -44.549  -62.282 -57.293  1.00 79.29  ? 2034 HIS E ND1   1 
ATOM 9531  C CD2   . HIS E 2 163 ? -43.525  -64.198 -57.594  1.00 79.03  ? 2034 HIS E CD2   1 
ATOM 9532  C CE1   . HIS E 2 163 ? -44.590  -62.562 -58.588  1.00 79.65  ? 2034 HIS E CE1   1 
ATOM 9533  N NE2   . HIS E 2 163 ? -43.983  -63.720 -58.795  1.00 78.40  ? 2034 HIS E NE2   1 
ATOM 9534  N N     . TRP E 2 164 ? -42.974  -63.890 -52.354  1.00 77.02  ? 2035 TRP E N     1 
ATOM 9535  C CA    . TRP E 2 164 ? -42.166  -63.988 -51.120  1.00 76.88  ? 2035 TRP E CA    1 
ATOM 9536  C C     . TRP E 2 164 ? -42.255  -65.346 -50.422  1.00 75.92  ? 2035 TRP E C     1 
ATOM 9537  O O     . TRP E 2 164 ? -41.250  -66.006 -50.243  1.00 76.11  ? 2035 TRP E O     1 
ATOM 9538  C CB    . TRP E 2 164 ? -42.595  -62.948 -50.139  1.00 77.14  ? 2035 TRP E CB    1 
ATOM 9539  C CG    . TRP E 2 164 ? -42.190  -61.612 -50.479  1.00 79.67  ? 2035 TRP E CG    1 
ATOM 9540  C CD1   . TRP E 2 164 ? -42.927  -60.678 -51.133  1.00 80.99  ? 2035 TRP E CD1   1 
ATOM 9541  C CD2   . TRP E 2 164 ? -40.956  -60.985 -50.122  1.00 83.50  ? 2035 TRP E CD2   1 
ATOM 9542  N NE1   . TRP E 2 164 ? -42.225  -59.493 -51.214  1.00 83.13  ? 2035 TRP E NE1   1 
ATOM 9543  C CE2   . TRP E 2 164 ? -41.012  -59.651 -50.593  1.00 84.52  ? 2035 TRP E CE2   1 
ATOM 9544  C CE3   . TRP E 2 164 ? -39.811  -61.411 -49.431  1.00 84.26  ? 2035 TRP E CE3   1 
ATOM 9545  C CZ2   . TRP E 2 164 ? -39.952  -58.740 -50.405  1.00 85.07  ? 2035 TRP E CZ2   1 
ATOM 9546  C CZ3   . TRP E 2 164 ? -38.761  -60.506 -49.251  1.00 83.65  ? 2035 TRP E CZ3   1 
ATOM 9547  C CH2   . TRP E 2 164 ? -38.840  -59.196 -49.742  1.00 84.06  ? 2035 TRP E CH2   1 
ATOM 9548  N N     . ALA E 2 165 ? -43.453  -65.762 -50.034  1.00 74.74  ? 2036 ALA E N     1 
ATOM 9549  C CA    . ALA E 2 165 ? -43.653  -67.123 -49.569  1.00 73.96  ? 2036 ALA E CA    1 
ATOM 9550  C C     . ALA E 2 165 ? -42.961  -68.197 -50.398  1.00 73.15  ? 2036 ALA E C     1 
ATOM 9551  O O     . ALA E 2 165 ? -42.606  -69.230 -49.871  1.00 73.49  ? 2036 ALA E O     1 
ATOM 9552  C CB    . ALA E 2 165 ? -45.109  -67.441 -49.455  1.00 74.40  ? 2036 ALA E CB    1 
ATOM 9553  N N     . ALA E 2 166 ? -42.758  -67.990 -51.680  1.00 72.06  ? 2037 ALA E N     1 
ATOM 9554  C CA    . ALA E 2 166 ? -41.966  -68.987 -52.403  1.00 71.78  ? 2037 ALA E CA    1 
ATOM 9555  C C     . ALA E 2 166 ? -40.434  -68.716 -52.358  1.00 71.08  ? 2037 ALA E C     1 
ATOM 9556  O O     . ALA E 2 166 ? -39.592  -69.601 -52.550  1.00 69.92  ? 2037 ALA E O     1 
ATOM 9557  C CB    . ALA E 2 166 ? -42.475  -69.116 -53.843  1.00 72.41  ? 2037 ALA E CB    1 
ATOM 9558  N N     . ALA E 2 167 ? -40.106  -67.457 -52.121  1.00 70.52  ? 2038 ALA E N     1 
ATOM 9559  C CA    . ALA E 2 167 ? -38.750  -67.063 -51.909  1.00 70.21  ? 2038 ALA E CA    1 
ATOM 9560  C C     . ALA E 2 167 ? -38.286  -67.659 -50.581  1.00 70.09  ? 2038 ALA E C     1 
ATOM 9561  O O     . ALA E 2 167 ? -37.198  -68.212 -50.496  1.00 70.69  ? 2038 ALA E O     1 
ATOM 9562  C CB    . ALA E 2 167 ? -38.669  -65.571 -51.877  1.00 70.04  ? 2038 ALA E CB    1 
ATOM 9563  N N     . VAL E 2 168 ? -39.123  -67.580 -49.554  1.00 69.52  ? 2039 VAL E N     1 
ATOM 9564  C CA    . VAL E 2 168 ? -38.718  -68.062 -48.258  1.00 69.28  ? 2039 VAL E CA    1 
ATOM 9565  C C     . VAL E 2 168 ? -39.178  -69.491 -47.979  1.00 69.31  ? 2039 VAL E C     1 
ATOM 9566  O O     . VAL E 2 168 ? -39.246  -69.915 -46.817  1.00 69.45  ? 2039 VAL E O     1 
ATOM 9567  C CB    . VAL E 2 168 ? -39.160  -67.121 -47.131  1.00 69.31  ? 2039 VAL E CB    1 
ATOM 9568  C CG1   . VAL E 2 168 ? -38.680  -65.720 -47.392  1.00 69.19  ? 2039 VAL E CG1   1 
ATOM 9569  C CG2   . VAL E 2 168 ? -40.659  -67.149 -46.952  1.00 70.11  ? 2039 VAL E CG2   1 
ATOM 9570  N N     . ASN E 2 169 ? -39.414  -70.250 -49.051  1.00 69.41  ? 2040 ASN E N     1 
ATOM 9571  C CA    . ASN E 2 169 ? -39.924  -71.622 -48.982  1.00 69.13  ? 2040 ASN E CA    1 
ATOM 9572  C C     . ASN E 2 169 ? -40.866  -71.765 -47.837  1.00 69.60  ? 2040 ASN E C     1 
ATOM 9573  O O     . ASN E 2 169 ? -40.634  -72.592 -46.967  1.00 69.74  ? 2040 ASN E O     1 
ATOM 9574  C CB    . ASN E 2 169 ? -38.819  -72.648 -48.803  1.00 68.67  ? 2040 ASN E CB    1 
ATOM 9575  C CG    . ASN E 2 169 ? -39.287  -74.092 -49.077  1.00 68.54  ? 2040 ASN E CG    1 
ATOM 9576  O OD1   . ASN E 2 169 ? -40.181  -74.358 -49.887  1.00 67.17  ? 2040 ASN E OD1   1 
ATOM 9577  N ND2   . ASN E 2 169 ? -38.638  -75.034 -48.419  1.00 69.87  ? 2040 ASN E ND2   1 
ATOM 9578  N N     . ASN E 2 170 ? -41.908  -70.938 -47.825  1.00 70.07  ? 2041 ASN E N     1 
ATOM 9579  C CA    . ASN E 2 170 ? -42.917  -70.939 -46.775  1.00 70.31  ? 2041 ASN E CA    1 
ATOM 9580  C C     . ASN E 2 170 ? -44.125  -71.763 -47.166  1.00 70.27  ? 2041 ASN E C     1 
ATOM 9581  O O     . ASN E 2 170 ? -45.220  -71.216 -47.334  1.00 70.14  ? 2041 ASN E O     1 
ATOM 9582  C CB    . ASN E 2 170 ? -43.347  -69.505 -46.484  1.00 70.47  ? 2041 ASN E CB    1 
ATOM 9583  C CG    . ASN E 2 170 ? -44.386  -69.423 -45.402  1.00 72.07  ? 2041 ASN E CG    1 
ATOM 9584  O OD1   . ASN E 2 170 ? -45.207  -70.315 -45.264  1.00 73.79  ? 2041 ASN E OD1   1 
ATOM 9585  N ND2   . ASN E 2 170 ? -44.364  -68.347 -44.624  1.00 75.16  ? 2041 ASN E ND2   1 
ATOM 9586  N N     . VAL E 2 171 ? -43.936  -73.069 -47.294  1.00 70.38  ? 2042 VAL E N     1 
ATOM 9587  C CA    . VAL E 2 171 ? -44.956  -73.899 -47.902  1.00 71.58  ? 2042 VAL E CA    1 
ATOM 9588  C C     . VAL E 2 171 ? -46.368  -73.602 -47.390  1.00 72.68  ? 2042 VAL E C     1 
ATOM 9589  O O     . VAL E 2 171 ? -47.290  -73.395 -48.194  1.00 72.50  ? 2042 VAL E O     1 
ATOM 9590  C CB    . VAL E 2 171 ? -44.631  -75.382 -47.796  1.00 71.34  ? 2042 VAL E CB    1 
ATOM 9591  C CG1   . VAL E 2 171 ? -45.725  -76.197 -48.415  1.00 71.81  ? 2042 VAL E CG1   1 
ATOM 9592  C CG2   . VAL E 2 171 ? -43.393  -75.667 -48.541  1.00 71.17  ? 2042 VAL E CG2   1 
ATOM 9593  N N     . ASP E 2 172 ? -46.532  -73.571 -46.067  1.00 74.12  ? 2043 ASP E N     1 
ATOM 9594  C CA    . ASP E 2 172 ? -47.852  -73.296 -45.460  1.00 75.48  ? 2043 ASP E CA    1 
ATOM 9595  C C     . ASP E 2 172 ? -48.524  -72.067 -46.048  1.00 75.07  ? 2043 ASP E C     1 
ATOM 9596  O O     . ASP E 2 172 ? -49.617  -72.170 -46.612  1.00 75.15  ? 2043 ASP E O     1 
ATOM 9597  C CB    . ASP E 2 172 ? -47.768  -73.180 -43.933  1.00 76.35  ? 2043 ASP E CB    1 
ATOM 9598  C CG    . ASP E 2 172 ? -47.605  -74.539 -43.260  1.00 79.18  ? 2043 ASP E CG    1 
ATOM 9599  O OD1   . ASP E 2 172 ? -47.315  -75.539 -43.981  1.00 80.66  ? 2043 ASP E OD1   1 
ATOM 9600  O OD2   . ASP E 2 172 ? -47.774  -74.609 -42.012  1.00 82.59  ? 2043 ASP E OD2   1 
ATOM 9601  N N     . ALA E 2 173 ? -47.853  -70.922 -45.937  1.00 74.78  ? 2044 ALA E N     1 
ATOM 9602  C CA    . ALA E 2 173 ? -48.323  -69.678 -46.537  1.00 74.59  ? 2044 ALA E CA    1 
ATOM 9603  C C     . ALA E 2 173 ? -48.765  -69.872 -47.992  1.00 74.34  ? 2044 ALA E C     1 
ATOM 9604  O O     . ALA E 2 173 ? -49.865  -69.449 -48.381  1.00 74.04  ? 2044 ALA E O     1 
ATOM 9605  C CB    . ALA E 2 173 ? -47.254  -68.618 -46.445  1.00 74.74  ? 2044 ALA E CB    1 
ATOM 9606  N N     . ALA E 2 174 ? -47.919  -70.536 -48.780  1.00 73.86  ? 2045 ALA E N     1 
ATOM 9607  C CA    . ALA E 2 174 ? -48.208  -70.735 -50.194  1.00 73.42  ? 2045 ALA E CA    1 
ATOM 9608  C C     . ALA E 2 174 ? -49.522  -71.461 -50.393  1.00 73.07  ? 2045 ALA E C     1 
ATOM 9609  O O     . ALA E 2 174 ? -50.328  -71.074 -51.237  1.00 72.71  ? 2045 ALA E O     1 
ATOM 9610  C CB    . ALA E 2 174 ? -47.092  -71.470 -50.874  1.00 73.43  ? 2045 ALA E CB    1 
ATOM 9611  N N     . VAL E 2 175 ? -49.747  -72.497 -49.596  1.00 72.77  ? 2046 VAL E N     1 
ATOM 9612  C CA    . VAL E 2 175 ? -50.964  -73.275 -49.737  1.00 72.75  ? 2046 VAL E CA    1 
ATOM 9613  C C     . VAL E 2 175 ? -52.224  -72.477 -49.380  1.00 72.73  ? 2046 VAL E C     1 
ATOM 9614  O O     . VAL E 2 175 ? -53.099  -72.311 -50.230  1.00 73.33  ? 2046 VAL E O     1 
ATOM 9615  C CB    . VAL E 2 175 ? -50.909  -74.572 -48.963  1.00 72.66  ? 2046 VAL E CB    1 
ATOM 9616  C CG1   . VAL E 2 175 ? -52.210  -75.338 -49.177  1.00 72.94  ? 2046 VAL E CG1   1 
ATOM 9617  C CG2   . VAL E 2 175 ? -49.721  -75.391 -49.424  1.00 72.59  ? 2046 VAL E CG2   1 
ATOM 9618  N N     . VAL E 2 176 ? -52.323  -71.986 -48.151  1.00 72.15  ? 2047 VAL E N     1 
ATOM 9619  C CA    . VAL E 2 176 ? -53.363  -71.041 -47.828  1.00 72.10  ? 2047 VAL E CA    1 
ATOM 9620  C C     . VAL E 2 176 ? -53.532  -69.997 -48.935  1.00 73.38  ? 2047 VAL E C     1 
ATOM 9621  O O     . VAL E 2 176 ? -54.659  -69.783 -49.423  1.00 74.14  ? 2047 VAL E O     1 
ATOM 9622  C CB    . VAL E 2 176 ? -53.023  -70.303 -46.591  1.00 71.39  ? 2047 VAL E CB    1 
ATOM 9623  C CG1   . VAL E 2 176 ? -53.944  -69.115 -46.406  1.00 70.70  ? 2047 VAL E CG1   1 
ATOM 9624  C CG2   . VAL E 2 176 ? -53.128  -71.209 -45.448  1.00 71.62  ? 2047 VAL E CG2   1 
ATOM 9625  N N     . LEU E 2 177 ? -52.437  -69.351 -49.350  1.00 74.10  ? 2048 LEU E N     1 
ATOM 9626  C CA    . LEU E 2 177 ? -52.539  -68.349 -50.416  1.00 74.71  ? 2048 LEU E CA    1 
ATOM 9627  C C     . LEU E 2 177 ? -53.102  -68.911 -51.730  1.00 75.40  ? 2048 LEU E C     1 
ATOM 9628  O O     . LEU E 2 177 ? -53.834  -68.234 -52.443  1.00 75.31  ? 2048 LEU E O     1 
ATOM 9629  C CB    . LEU E 2 177 ? -51.210  -67.662 -50.677  1.00 74.41  ? 2048 LEU E CB    1 
ATOM 9630  C CG    . LEU E 2 177 ? -51.033  -66.349 -49.950  1.00 73.85  ? 2048 LEU E CG    1 
ATOM 9631  C CD1   . LEU E 2 177 ? -49.934  -66.510 -48.940  1.00 74.86  ? 2048 LEU E CD1   1 
ATOM 9632  C CD2   . LEU E 2 177 ? -50.610  -65.335 -50.933  1.00 73.66  ? 2048 LEU E CD2   1 
ATOM 9633  N N     . LEU E 2 178 ? -52.776  -70.146 -52.065  1.00 76.23  ? 2049 LEU E N     1 
ATOM 9634  C CA    . LEU E 2 178 ? -53.261  -70.629 -53.327  1.00 77.52  ? 2049 LEU E CA    1 
ATOM 9635  C C     . LEU E 2 178 ? -54.749  -70.795 -53.267  1.00 78.73  ? 2049 LEU E C     1 
ATOM 9636  O O     . LEU E 2 178 ? -55.456  -70.296 -54.158  1.00 79.29  ? 2049 LEU E O     1 
ATOM 9637  C CB    . LEU E 2 178 ? -52.548  -71.885 -53.759  1.00 77.44  ? 2049 LEU E CB    1 
ATOM 9638  C CG    . LEU E 2 178 ? -51.187  -71.477 -54.357  1.00 77.08  ? 2049 LEU E CG    1 
ATOM 9639  C CD1   . LEU E 2 178 ? -50.173  -72.586 -54.216  1.00 78.54  ? 2049 LEU E CD1   1 
ATOM 9640  C CD2   . LEU E 2 178 ? -51.257  -71.032 -55.798  1.00 74.70  ? 2049 LEU E CD2   1 
ATOM 9641  N N     . LYS E 2 179 ? -55.223  -71.434 -52.186  1.00 79.77  ? 2050 LYS E N     1 
ATOM 9642  C CA    . LYS E 2 179 ? -56.663  -71.641 -51.937  1.00 80.40  ? 2050 LYS E CA    1 
ATOM 9643  C C     . LYS E 2 179 ? -57.379  -70.351 -51.560  1.00 80.41  ? 2050 LYS E C     1 
ATOM 9644  O O     . LYS E 2 179 ? -58.422  -70.386 -50.918  1.00 80.94  ? 2050 LYS E O     1 
ATOM 9645  C CB    . LYS E 2 179 ? -56.922  -72.652 -50.832  1.00 80.25  ? 2050 LYS E CB    1 
ATOM 9646  C CG    . LYS E 2 179 ? -55.958  -73.787 -50.733  1.00 83.24  ? 2050 LYS E CG    1 
ATOM 9647  C CD    . LYS E 2 179 ? -56.236  -74.905 -51.758  1.00 87.51  ? 2050 LYS E CD    1 
ATOM 9648  C CE    . LYS E 2 179 ? -56.285  -76.328 -51.103  1.00 88.40  ? 2050 LYS E CE    1 
ATOM 9649  N NZ    . LYS E 2 179 ? -55.644  -76.456 -49.734  1.00 87.89  ? 2050 LYS E NZ    1 
ATOM 9650  N N     . ASN E 2 180 ? -56.842  -69.204 -51.936  1.00 80.27  ? 2051 ASN E N     1 
ATOM 9651  C CA    . ASN E 2 180 ? -57.603  -67.996 -51.734  1.00 80.34  ? 2051 ASN E CA    1 
ATOM 9652  C C     . ASN E 2 180 ? -57.407  -67.048 -52.874  1.00 80.21  ? 2051 ASN E C     1 
ATOM 9653  O O     . ASN E 2 180 ? -57.207  -65.851 -52.710  1.00 79.35  ? 2051 ASN E O     1 
ATOM 9654  C CB    . ASN E 2 180 ? -57.332  -67.391 -50.352  1.00 80.67  ? 2051 ASN E CB    1 
ATOM 9655  C CG    . ASN E 2 180 ? -58.052  -68.145 -49.256  1.00 81.08  ? 2051 ASN E CG    1 
ATOM 9656  O OD1   . ASN E 2 180 ? -57.497  -69.058 -48.655  1.00 81.87  ? 2051 ASN E OD1   1 
ATOM 9657  N ND2   . ASN E 2 180 ? -59.319  -67.812 -49.041  1.00 81.90  ? 2051 ASN E ND2   1 
ATOM 9658  N N     . GLY E 2 181 ? -57.500  -67.620 -54.059  1.00 80.88  ? 2052 GLY E N     1 
ATOM 9659  C CA    . GLY E 2 181 ? -57.316  -66.834 -55.264  1.00 82.30  ? 2052 GLY E CA    1 
ATOM 9660  C C     . GLY E 2 181 ? -55.854  -66.895 -55.609  1.00 82.94  ? 2052 GLY E C     1 
ATOM 9661  O O     . GLY E 2 181 ? -55.367  -67.984 -55.993  1.00 83.65  ? 2052 GLY E O     1 
ATOM 9662  N N     . ALA E 2 182 ? -55.150  -65.763 -55.434  1.00 82.63  ? 2053 ALA E N     1 
ATOM 9663  C CA    . ALA E 2 182 ? -53.683  -65.700 -55.595  1.00 82.27  ? 2053 ALA E CA    1 
ATOM 9664  C C     . ALA E 2 182 ? -53.306  -66.090 -56.982  1.00 82.03  ? 2053 ALA E C     1 
ATOM 9665  O O     . ALA E 2 182 ? -53.370  -67.250 -57.373  1.00 81.94  ? 2053 ALA E O     1 
ATOM 9666  C CB    . ALA E 2 182 ? -52.939  -66.591 -54.587  1.00 81.96  ? 2053 ALA E CB    1 
ATOM 9667  N N     . ASN E 2 183 ? -52.919  -65.107 -57.747  1.00 82.15  ? 2054 ASN E N     1 
ATOM 9668  C CA    . ASN E 2 183 ? -52.406  -65.408 -59.033  1.00 82.74  ? 2054 ASN E CA    1 
ATOM 9669  C C     . ASN E 2 183 ? -51.113  -66.218 -58.852  1.00 82.54  ? 2054 ASN E C     1 
ATOM 9670  O O     . ASN E 2 183 ? -50.085  -65.702 -58.380  1.00 82.31  ? 2054 ASN E O     1 
ATOM 9671  C CB    . ASN E 2 183 ? -52.174  -64.114 -59.791  1.00 83.27  ? 2054 ASN E CB    1 
ATOM 9672  C CG    . ASN E 2 183 ? -51.811  -64.348 -61.235  1.00 85.01  ? 2054 ASN E CG    1 
ATOM 9673  O OD1   . ASN E 2 183 ? -51.459  -65.478 -61.646  1.00 85.53  ? 2054 ASN E OD1   1 
ATOM 9674  N ND2   . ASN E 2 183 ? -51.881  -63.272 -62.031  1.00 86.68  ? 2054 ASN E ND2   1 
ATOM 9675  N N     . LYS E 2 184 ? -51.204  -67.506 -59.200  1.00 82.09  ? 2055 LYS E N     1 
ATOM 9676  C CA    . LYS E 2 184 ? -50.096  -68.443 -59.026  1.00 81.17  ? 2055 LYS E CA    1 
ATOM 9677  C C     . LYS E 2 184 ? -49.053  -68.213 -60.086  1.00 81.10  ? 2055 LYS E C     1 
ATOM 9678  O O     . LYS E 2 184 ? -47.927  -68.759 -60.013  1.00 81.50  ? 2055 LYS E O     1 
ATOM 9679  C CB    . LYS E 2 184 ? -50.580  -69.891 -59.109  1.00 80.80  ? 2055 LYS E CB    1 
ATOM 9680  C CG    . LYS E 2 184 ? -50.880  -70.404 -60.489  1.00 80.64  ? 2055 LYS E CG    1 
ATOM 9681  C CD    . LYS E 2 184 ? -51.256  -71.879 -60.451  1.00 82.30  ? 2055 LYS E CD    1 
ATOM 9682  C CE    . LYS E 2 184 ? -52.182  -72.291 -61.621  1.00 82.90  ? 2055 LYS E CE    1 
ATOM 9683  N NZ    . LYS E 2 184 ? -53.473  -71.539 -61.707  1.00 84.34  ? 2055 LYS E NZ    1 
ATOM 9684  N N     . ASP E 2 185 ? -49.432  -67.431 -61.094  1.00 80.47  ? 2056 ASP E N     1 
ATOM 9685  C CA    . ASP E 2 185 ? -48.543  -67.236 -62.207  1.00 80.04  ? 2056 ASP E CA    1 
ATOM 9686  C C     . ASP E 2 185 ? -48.138  -65.812 -62.395  1.00 79.83  ? 2056 ASP E C     1 
ATOM 9687  O O     . ASP E 2 185 ? -47.418  -65.506 -63.375  1.00 80.49  ? 2056 ASP E O     1 
ATOM 9688  C CB    . ASP E 2 185 ? -49.097  -67.861 -63.463  1.00 79.58  ? 2056 ASP E CB    1 
ATOM 9689  C CG    . ASP E 2 185 ? -48.887  -69.344 -63.470  1.00 81.01  ? 2056 ASP E CG    1 
ATOM 9690  O OD1   . ASP E 2 185 ? -47.768  -69.821 -63.044  1.00 80.49  ? 2056 ASP E OD1   1 
ATOM 9691  O OD2   . ASP E 2 185 ? -49.860  -70.024 -63.879  1.00 82.55  ? 2056 ASP E OD2   1 
ATOM 9692  N N     . MET E 2 186 ? -48.555  -64.970 -61.438  1.00 78.75  ? 2057 MET E N     1 
ATOM 9693  C CA    . MET E 2 186 ? -48.231  -63.564 -61.433  1.00 78.30  ? 2057 MET E CA    1 
ATOM 9694  C C     . MET E 2 186 ? -46.751  -63.304 -61.698  1.00 79.24  ? 2057 MET E C     1 
ATOM 9695  O O     . MET E 2 186 ? -45.889  -64.147 -61.353  1.00 79.42  ? 2057 MET E O     1 
ATOM 9696  C CB    . MET E 2 186 ? -48.584  -63.022 -60.098  1.00 77.48  ? 2057 MET E CB    1 
ATOM 9697  C CG    . MET E 2 186 ? -47.882  -61.777 -59.794  1.00 76.53  ? 2057 MET E CG    1 
ATOM 9698  S SD    . MET E 2 186 ? -48.867  -60.854 -58.632  1.00 79.16  ? 2057 MET E SD    1 
ATOM 9699  C CE    . MET E 2 186 ? -50.152  -62.011 -58.083  1.00 77.21  ? 2057 MET E CE    1 
ATOM 9700  N N     . GLN E 2 187 ? -46.443  -62.166 -62.333  1.00 80.03  ? 2058 GLN E N     1 
ATOM 9701  C CA    . GLN E 2 187 ? -45.038  -61.780 -62.508  1.00 80.91  ? 2058 GLN E CA    1 
ATOM 9702  C C     . GLN E 2 187 ? -44.718  -60.496 -61.783  1.00 81.13  ? 2058 GLN E C     1 
ATOM 9703  O O     . GLN E 2 187 ? -45.610  -59.772 -61.352  1.00 80.91  ? 2058 GLN E O     1 
ATOM 9704  C CB    . GLN E 2 187 ? -44.655  -61.722 -63.977  1.00 80.88  ? 2058 GLN E CB    1 
ATOM 9705  C CG    . GLN E 2 187 ? -45.014  -63.005 -64.711  1.00 82.81  ? 2058 GLN E CG    1 
ATOM 9706  C CD    . GLN E 2 187 ? -44.678  -62.995 -66.205  1.00 86.15  ? 2058 GLN E CD    1 
ATOM 9707  O OE1   . GLN E 2 187 ? -45.574  -63.033 -67.053  1.00 87.73  ? 2058 GLN E OE1   1 
ATOM 9708  N NE2   . GLN E 2 187 ? -43.382  -62.973 -66.533  1.00 87.05  ? 2058 GLN E NE2   1 
ATOM 9709  N N     . ASN E 2 188 ? -43.435  -60.245 -61.604  1.00 82.09  ? 2059 ASN E N     1 
ATOM 9710  C CA    . ASN E 2 188 ? -42.981  -59.041 -60.890  1.00 83.33  ? 2059 ASN E CA    1 
ATOM 9711  C C     . ASN E 2 188 ? -42.186  -58.230 -61.882  1.00 83.65  ? 2059 ASN E C     1 
ATOM 9712  O O     . ASN E 2 188 ? -41.831  -58.773 -62.945  1.00 83.54  ? 2059 ASN E O     1 
ATOM 9713  C CB    . ASN E 2 188 ? -42.091  -59.414 -59.697  1.00 83.55  ? 2059 ASN E CB    1 
ATOM 9714  C CG    . ASN E 2 188 ? -40.959  -60.399 -60.085  1.00 84.31  ? 2059 ASN E CG    1 
ATOM 9715  O OD1   . ASN E 2 188 ? -41.117  -61.257 -60.965  1.00 81.91  ? 2059 ASN E OD1   1 
ATOM 9716  N ND2   . ASN E 2 188 ? -39.811  -60.258 -59.422  1.00 84.63  ? 2059 ASN E ND2   1 
ATOM 9717  N N     . ASN E 2 189 ? -41.886  -56.965 -61.573  1.00 83.77  ? 2060 ASN E N     1 
ATOM 9718  C CA    . ASN E 2 189 ? -41.116  -56.205 -62.538  1.00 84.48  ? 2060 ASN E CA    1 
ATOM 9719  C C     . ASN E 2 189 ? -39.731  -56.776 -62.643  1.00 85.15  ? 2060 ASN E C     1 
ATOM 9720  O O     . ASN E 2 189 ? -38.749  -56.055 -62.476  1.00 85.88  ? 2060 ASN E O     1 
ATOM 9721  C CB    . ASN E 2 189 ? -41.093  -54.692 -62.308  1.00 84.52  ? 2060 ASN E CB    1 
ATOM 9722  C CG    . ASN E 2 189 ? -41.353  -54.298 -60.870  1.00 86.69  ? 2060 ASN E CG    1 
ATOM 9723  O OD1   . ASN E 2 189 ? -42.411  -54.618 -60.325  1.00 90.85  ? 2060 ASN E OD1   1 
ATOM 9724  N ND2   . ASN E 2 189 ? -40.418  -53.546 -60.261  1.00 86.29  ? 2060 ASN E ND2   1 
ATOM 9725  N N     . ARG E 2 190 ? -39.669  -58.093 -62.830  1.00 85.92  ? 2061 ARG E N     1 
ATOM 9726  C CA    . ARG E 2 190 ? -38.545  -58.765 -63.465  1.00 87.32  ? 2061 ARG E CA    1 
ATOM 9727  C C     . ARG E 2 190 ? -39.109  -59.970 -64.198  1.00 87.90  ? 2061 ARG E C     1 
ATOM 9728  O O     . ARG E 2 190 ? -38.357  -60.852 -64.644  1.00 88.10  ? 2061 ARG E O     1 
ATOM 9729  C CB    . ARG E 2 190 ? -37.416  -59.140 -62.490  1.00 87.47  ? 2061 ARG E CB    1 
ATOM 9730  C CG    . ARG E 2 190 ? -36.555  -57.940 -62.016  1.00 90.58  ? 2061 ARG E CG    1 
ATOM 9731  C CD    . ARG E 2 190 ? -35.243  -58.337 -61.328  1.00 94.84  ? 2061 ARG E CD    1 
ATOM 9732  N NE    . ARG E 2 190 ? -34.810  -57.325 -60.348  1.00 97.25  ? 2061 ARG E NE    1 
ATOM 9733  C CZ    . ARG E 2 190 ? -33.547  -57.119 -59.966  1.00 97.41  ? 2061 ARG E CZ    1 
ATOM 9734  N NH1   . ARG E 2 190 ? -33.264  -56.190 -59.054  1.00 95.97  ? 2061 ARG E NH1   1 
ATOM 9735  N NH2   . ARG E 2 190 ? -32.568  -57.831 -60.505  1.00 98.43  ? 2061 ARG E NH2   1 
ATOM 9736  N N     . GLU E 2 191 ? -40.443  -59.973 -64.352  1.00 88.82  ? 2062 GLU E N     1 
ATOM 9737  C CA    . GLU E 2 191 ? -41.193  -61.046 -65.045  1.00 89.49  ? 2062 GLU E CA    1 
ATOM 9738  C C     . GLU E 2 191 ? -40.993  -62.394 -64.337  1.00 89.00  ? 2062 GLU E C     1 
ATOM 9739  O O     . GLU E 2 191 ? -40.887  -63.444 -64.981  1.00 89.17  ? 2062 GLU E O     1 
ATOM 9740  C CB    . GLU E 2 191 ? -40.820  -61.129 -66.551  1.00 89.75  ? 2062 GLU E CB    1 
ATOM 9741  C CG    . GLU E 2 191 ? -41.855  -60.492 -67.513  1.00 93.31  ? 2062 GLU E CG    1 
ATOM 9742  C CD    . GLU E 2 191 ? -41.241  -59.856 -68.790  1.00 97.82  ? 2062 GLU E CD    1 
ATOM 9743  O OE1   . GLU E 2 191 ? -41.364  -60.454 -69.898  1.00 97.67  ? 2062 GLU E OE1   1 
ATOM 9744  O OE2   . GLU E 2 191 ? -40.649  -58.743 -68.679  1.00 100.39 ? 2062 GLU E OE2   1 
ATOM 9745  N N     . GLU E 2 192 ? -40.918  -62.358 -63.007  1.00 88.10  ? 2063 GLU E N     1 
ATOM 9746  C CA    . GLU E 2 192 ? -40.563  -63.557 -62.265  1.00 86.84  ? 2063 GLU E CA    1 
ATOM 9747  C C     . GLU E 2 192 ? -41.842  -64.208 -61.693  1.00 86.14  ? 2063 GLU E C     1 
ATOM 9748  O O     . GLU E 2 192 ? -42.540  -63.639 -60.828  1.00 85.75  ? 2063 GLU E O     1 
ATOM 9749  C CB    . GLU E 2 192 ? -39.553  -63.232 -61.155  1.00 86.70  ? 2063 GLU E CB    1 
ATOM 9750  C CG    . GLU E 2 192 ? -38.108  -62.946 -61.558  1.00 86.30  ? 2063 GLU E CG    1 
ATOM 9751  C CD    . GLU E 2 192 ? -37.313  -62.207 -60.429  1.00 86.44  ? 2063 GLU E CD    1 
ATOM 9752  O OE1   . GLU E 2 192 ? -37.929  -61.434 -59.662  1.00 84.67  ? 2063 GLU E OE1   1 
ATOM 9753  O OE2   . GLU E 2 192 ? -36.069  -62.367 -60.309  1.00 86.85  ? 2063 GLU E OE2   1 
ATOM 9754  N N     . THR E 2 193 ? -42.145  -65.393 -62.215  1.00 84.80  ? 2064 THR E N     1 
ATOM 9755  C CA    . THR E 2 193 ? -43.201  -66.229 -61.699  1.00 83.71  ? 2064 THR E CA    1 
ATOM 9756  C C     . THR E 2 193 ? -42.792  -66.632 -60.269  1.00 82.92  ? 2064 THR E C     1 
ATOM 9757  O O     . THR E 2 193 ? -41.594  -66.733 -59.995  1.00 81.92  ? 2064 THR E O     1 
ATOM 9758  C CB    . THR E 2 193 ? -43.430  -67.443 -62.672  1.00 83.80  ? 2064 THR E CB    1 
ATOM 9759  O OG1   . THR E 2 193 ? -44.435  -68.329 -62.159  1.00 86.21  ? 2064 THR E OG1   1 
ATOM 9760  C CG2   . THR E 2 193 ? -42.166  -68.237 -62.934  1.00 82.72  ? 2064 THR E CG2   1 
ATOM 9761  N N     . PRO E 2 194 ? -43.770  -66.827 -59.331  1.00 82.49  ? 2065 PRO E N     1 
ATOM 9762  C CA    . PRO E 2 194 ? -43.258  -67.202 -58.017  1.00 81.63  ? 2065 PRO E CA    1 
ATOM 9763  C C     . PRO E 2 194 ? -42.643  -68.595 -58.066  1.00 80.64  ? 2065 PRO E C     1 
ATOM 9764  O O     . PRO E 2 194 ? -41.701  -68.838 -57.314  1.00 81.01  ? 2065 PRO E O     1 
ATOM 9765  C CB    . PRO E 2 194 ? -44.496  -67.167 -57.108  1.00 81.61  ? 2065 PRO E CB    1 
ATOM 9766  C CG    . PRO E 2 194 ? -45.583  -66.625 -57.916  1.00 81.53  ? 2065 PRO E CG    1 
ATOM 9767  C CD    . PRO E 2 194 ? -45.240  -66.915 -59.341  1.00 82.23  ? 2065 PRO E CD    1 
ATOM 9768  N N     . LEU E 2 195 ? -43.124  -69.476 -58.950  1.00 78.84  ? 2066 LEU E N     1 
ATOM 9769  C CA    . LEU E 2 195 ? -42.398  -70.700 -59.196  1.00 77.65  ? 2066 LEU E CA    1 
ATOM 9770  C C     . LEU E 2 195 ? -40.927  -70.423 -59.486  1.00 77.85  ? 2066 LEU E C     1 
ATOM 9771  O O     . LEU E 2 195 ? -40.061  -71.247 -59.222  1.00 77.52  ? 2066 LEU E O     1 
ATOM 9772  C CB    . LEU E 2 195 ? -42.991  -71.476 -60.347  1.00 77.43  ? 2066 LEU E CB    1 
ATOM 9773  C CG    . LEU E 2 195 ? -42.203  -72.771 -60.594  1.00 76.09  ? 2066 LEU E CG    1 
ATOM 9774  C CD1   . LEU E 2 195 ? -42.349  -73.573 -59.360  1.00 77.90  ? 2066 LEU E CD1   1 
ATOM 9775  C CD2   . LEU E 2 195 ? -42.629  -73.615 -61.781  1.00 73.16  ? 2066 LEU E CD2   1 
ATOM 9776  N N     . PHE E 2 196 ? -40.643  -69.241 -60.017  1.00 78.41  ? 2067 PHE E N     1 
ATOM 9777  C CA    . PHE E 2 196 ? -39.246  -68.830 -60.317  1.00 78.68  ? 2067 PHE E CA    1 
ATOM 9778  C C     . PHE E 2 196 ? -38.419  -68.608 -59.072  1.00 77.96  ? 2067 PHE E C     1 
ATOM 9779  O O     . PHE E 2 196 ? -37.489  -69.359 -58.821  1.00 77.26  ? 2067 PHE E O     1 
ATOM 9780  C CB    . PHE E 2 196 ? -39.227  -67.539 -61.179  1.00 79.49  ? 2067 PHE E CB    1 
ATOM 9781  C CG    . PHE E 2 196 ? -37.885  -67.222 -61.811  1.00 78.65  ? 2067 PHE E CG    1 
ATOM 9782  C CD1   . PHE E 2 196 ? -37.408  -67.993 -62.887  1.00 77.84  ? 2067 PHE E CD1   1 
ATOM 9783  C CD2   . PHE E 2 196 ? -37.138  -66.128 -61.341  1.00 76.51  ? 2067 PHE E CD2   1 
ATOM 9784  C CE1   . PHE E 2 196 ? -36.193  -67.695 -63.447  1.00 78.51  ? 2067 PHE E CE1   1 
ATOM 9785  C CE2   . PHE E 2 196 ? -35.929  -65.802 -61.888  1.00 76.24  ? 2067 PHE E CE2   1 
ATOM 9786  C CZ    . PHE E 2 196 ? -35.434  -66.578 -62.932  1.00 78.46  ? 2067 PHE E CZ    1 
ATOM 9787  N N     . LEU E 2 197 ? -38.771  -67.565 -58.319  1.00 77.60  ? 2068 LEU E N     1 
ATOM 9788  C CA    . LEU E 2 197 ? -38.105  -67.294 -57.042  1.00 77.81  ? 2068 LEU E CA    1 
ATOM 9789  C C     . LEU E 2 197 ? -37.840  -68.571 -56.251  1.00 77.87  ? 2068 LEU E C     1 
ATOM 9790  O O     . LEU E 2 197 ? -36.705  -68.784 -55.789  1.00 78.10  ? 2068 LEU E O     1 
ATOM 9791  C CB    . LEU E 2 197 ? -38.839  -66.265 -56.162  1.00 77.63  ? 2068 LEU E CB    1 
ATOM 9792  C CG    . LEU E 2 197 ? -38.753  -64.817 -56.625  1.00 76.63  ? 2068 LEU E CG    1 
ATOM 9793  C CD1   . LEU E 2 197 ? -39.618  -64.801 -57.849  1.00 78.22  ? 2068 LEU E CD1   1 
ATOM 9794  C CD2   . LEU E 2 197 ? -39.271  -63.802 -55.614  1.00 73.76  ? 2068 LEU E CD2   1 
ATOM 9795  N N     . ALA E 2 198 ? -38.856  -69.422 -56.118  1.00 77.53  ? 2069 ALA E N     1 
ATOM 9796  C CA    . ALA E 2 198 ? -38.619  -70.735 -55.573  1.00 77.87  ? 2069 ALA E CA    1 
ATOM 9797  C C     . ALA E 2 198 ? -37.394  -71.357 -56.268  1.00 78.44  ? 2069 ALA E C     1 
ATOM 9798  O O     . ALA E 2 198 ? -36.324  -71.456 -55.670  1.00 78.10  ? 2069 ALA E O     1 
ATOM 9799  C CB    . ALA E 2 198 ? -39.821  -71.591 -55.711  1.00 77.63  ? 2069 ALA E CB    1 
ATOM 9800  N N     . ALA E 2 199 ? -37.519  -71.717 -57.540  1.00 79.43  ? 2070 ALA E N     1 
ATOM 9801  C CA    . ALA E 2 199 ? -36.394  -72.351 -58.260  1.00 80.34  ? 2070 ALA E CA    1 
ATOM 9802  C C     . ALA E 2 199 ? -35.050  -71.588 -58.211  1.00 81.02  ? 2070 ALA E C     1 
ATOM 9803  O O     . ALA E 2 199 ? -33.987  -72.202 -58.412  1.00 81.15  ? 2070 ALA E O     1 
ATOM 9804  C CB    . ALA E 2 199 ? -36.764  -72.633 -59.686  1.00 80.32  ? 2070 ALA E CB    1 
ATOM 9805  N N     . ARG E 2 200 ? -35.086  -70.266 -57.986  1.00 81.40  ? 2071 ARG E N     1 
ATOM 9806  C CA    . ARG E 2 200 ? -33.845  -69.541 -57.758  1.00 81.85  ? 2071 ARG E CA    1 
ATOM 9807  C C     . ARG E 2 200 ? -33.306  -69.981 -56.389  1.00 82.07  ? 2071 ARG E C     1 
ATOM 9808  O O     . ARG E 2 200 ? -32.316  -70.762 -56.341  1.00 82.18  ? 2071 ARG E O     1 
ATOM 9809  C CB    . ARG E 2 200 ? -33.999  -68.014 -57.832  1.00 81.99  ? 2071 ARG E CB    1 
ATOM 9810  C CG    . ARG E 2 200 ? -32.701  -67.283 -57.414  1.00 83.80  ? 2071 ARG E CG    1 
ATOM 9811  C CD    . ARG E 2 200 ? -32.515  -65.891 -57.989  1.00 87.76  ? 2071 ARG E CD    1 
ATOM 9812  N NE    . ARG E 2 200 ? -33.436  -64.915 -57.410  1.00 91.34  ? 2071 ARG E NE    1 
ATOM 9813  C CZ    . ARG E 2 200 ? -33.510  -64.593 -56.120  1.00 94.33  ? 2071 ARG E CZ    1 
ATOM 9814  N NH1   . ARG E 2 200 ? -32.727  -65.180 -55.219  1.00 96.35  ? 2071 ARG E NH1   1 
ATOM 9815  N NH2   . ARG E 2 200 ? -34.392  -63.683 -55.727  1.00 94.83  ? 2071 ARG E NH2   1 
ATOM 9816  N N     . GLU E 2 201 ? -33.967  -69.498 -55.304  1.00 81.52  ? 2072 GLU E N     1 
ATOM 9817  C CA    . GLU E 2 201 ? -33.605  -69.795 -53.892  1.00 80.42  ? 2072 GLU E CA    1 
ATOM 9818  C C     . GLU E 2 201 ? -33.507  -71.283 -53.670  1.00 79.85  ? 2072 GLU E C     1 
ATOM 9819  O O     . GLU E 2 201 ? -32.920  -71.749 -52.688  1.00 80.07  ? 2072 GLU E O     1 
ATOM 9820  C CB    . GLU E 2 201 ? -34.663  -69.275 -52.959  1.00 80.05  ? 2072 GLU E CB    1 
ATOM 9821  C CG    . GLU E 2 201 ? -34.787  -67.816 -53.006  1.00 81.97  ? 2072 GLU E CG    1 
ATOM 9822  C CD    . GLU E 2 201 ? -33.798  -67.187 -52.098  1.00 85.48  ? 2072 GLU E CD    1 
ATOM 9823  O OE1   . GLU E 2 201 ? -33.721  -65.926 -52.080  1.00 86.38  ? 2072 GLU E OE1   1 
ATOM 9824  O OE2   . GLU E 2 201 ? -33.106  -67.978 -51.403  1.00 86.11  ? 2072 GLU E OE2   1 
ATOM 9825  N N     . GLY E 2 202 ? -34.107  -72.024 -54.598  1.00 78.79  ? 2073 GLY E N     1 
ATOM 9826  C CA    . GLY E 2 202 ? -34.061  -73.470 -54.577  1.00 77.40  ? 2073 GLY E CA    1 
ATOM 9827  C C     . GLY E 2 202 ? -34.940  -74.089 -53.513  1.00 76.09  ? 2073 GLY E C     1 
ATOM 9828  O O     . GLY E 2 202 ? -34.804  -75.292 -53.210  1.00 76.67  ? 2073 GLY E O     1 
ATOM 9829  N N     . SER E 2 203 ? -35.844  -73.278 -52.969  1.00 74.05  ? 2074 SER E N     1 
ATOM 9830  C CA    . SER E 2 203 ? -36.802  -73.754 -52.041  1.00 72.47  ? 2074 SER E CA    1 
ATOM 9831  C C     . SER E 2 203 ? -37.796  -74.697 -52.766  1.00 71.88  ? 2074 SER E C     1 
ATOM 9832  O O     . SER E 2 203 ? -38.753  -74.279 -53.412  1.00 70.98  ? 2074 SER E O     1 
ATOM 9833  C CB    . SER E 2 203 ? -37.417  -72.566 -51.347  1.00 72.23  ? 2074 SER E CB    1 
ATOM 9834  O OG    . SER E 2 203 ? -38.214  -71.844 -52.229  1.00 72.82  ? 2074 SER E OG    1 
ATOM 9835  N N     . TYR E 2 204 ? -37.488  -75.992 -52.622  1.00 71.78  ? 2075 TYR E N     1 
ATOM 9836  C CA    . TYR E 2 204 ? -38.046  -77.132 -53.348  1.00 71.45  ? 2075 TYR E CA    1 
ATOM 9837  C C     . TYR E 2 204 ? -39.464  -77.455 -52.968  1.00 72.53  ? 2075 TYR E C     1 
ATOM 9838  O O     . TYR E 2 204 ? -40.251  -77.815 -53.832  1.00 72.86  ? 2075 TYR E O     1 
ATOM 9839  C CB    . TYR E 2 204 ? -37.201  -78.363 -53.033  1.00 70.77  ? 2075 TYR E CB    1 
ATOM 9840  C CG    . TYR E 2 204 ? -37.718  -79.692 -53.549  1.00 69.06  ? 2075 TYR E CG    1 
ATOM 9841  C CD1   . TYR E 2 204 ? -37.243  -80.240 -54.734  1.00 69.02  ? 2075 TYR E CD1   1 
ATOM 9842  C CD2   . TYR E 2 204 ? -38.639  -80.421 -52.847  1.00 68.09  ? 2075 TYR E CD2   1 
ATOM 9843  C CE1   . TYR E 2 204 ? -37.696  -81.470 -55.230  1.00 66.69  ? 2075 TYR E CE1   1 
ATOM 9844  C CE2   . TYR E 2 204 ? -39.099  -81.659 -53.334  1.00 67.79  ? 2075 TYR E CE2   1 
ATOM 9845  C CZ    . TYR E 2 204 ? -38.619  -82.168 -54.522  1.00 66.22  ? 2075 TYR E CZ    1 
ATOM 9846  O OH    . TYR E 2 204 ? -39.074  -83.380 -54.982  1.00 65.57  ? 2075 TYR E OH    1 
ATOM 9847  N N     . GLU E 2 205 ? -39.781  -77.374 -51.672  1.00 73.58  ? 2076 GLU E N     1 
ATOM 9848  C CA    . GLU E 2 205 ? -41.087  -77.797 -51.165  1.00 74.19  ? 2076 GLU E CA    1 
ATOM 9849  C C     . GLU E 2 205 ? -42.152  -76.832 -51.639  1.00 74.16  ? 2076 GLU E C     1 
ATOM 9850  O O     . GLU E 2 205 ? -43.167  -77.264 -52.238  1.00 74.89  ? 2076 GLU E O     1 
ATOM 9851  C CB    . GLU E 2 205 ? -41.100  -77.915 -49.650  1.00 74.26  ? 2076 GLU E CB    1 
ATOM 9852  C CG    . GLU E 2 205 ? -40.313  -79.098 -49.139  1.00 77.11  ? 2076 GLU E CG    1 
ATOM 9853  C CD    . GLU E 2 205 ? -38.805  -78.810 -49.056  1.00 80.74  ? 2076 GLU E CD    1 
ATOM 9854  O OE1   . GLU E 2 205 ? -38.024  -79.795 -48.891  1.00 79.96  ? 2076 GLU E OE1   1 
ATOM 9855  O OE2   . GLU E 2 205 ? -38.419  -77.605 -49.162  1.00 81.78  ? 2076 GLU E OE2   1 
ATOM 9856  N N     . THR E 2 206 ? -41.923  -75.536 -51.425  1.00 73.26  ? 2077 THR E N     1 
ATOM 9857  C CA    . THR E 2 206 ? -42.884  -74.560 -51.924  1.00 72.82  ? 2077 THR E CA    1 
ATOM 9858  C C     . THR E 2 206 ? -43.083  -74.784 -53.403  1.00 72.25  ? 2077 THR E C     1 
ATOM 9859  O O     . THR E 2 206 ? -44.206  -74.669 -53.895  1.00 71.62  ? 2077 THR E O     1 
ATOM 9860  C CB    . THR E 2 206 ? -42.486  -73.082 -51.656  1.00 73.04  ? 2077 THR E CB    1 
ATOM 9861  O OG1   . THR E 2 206 ? -42.677  -72.756 -50.270  1.00 72.92  ? 2077 THR E OG1   1 
ATOM 9862  C CG2   . THR E 2 206 ? -43.355  -72.159 -52.457  1.00 72.96  ? 2077 THR E CG2   1 
ATOM 9863  N N     . ALA E 2 207 ? -41.984  -75.137 -54.077  1.00 72.24  ? 2078 ALA E N     1 
ATOM 9864  C CA    . ALA E 2 207 ? -41.963  -75.366 -55.527  1.00 72.56  ? 2078 ALA E CA    1 
ATOM 9865  C C     . ALA E 2 207 ? -42.850  -76.493 -55.956  1.00 72.77  ? 2078 ALA E C     1 
ATOM 9866  O O     . ALA E 2 207 ? -43.650  -76.289 -56.861  1.00 73.22  ? 2078 ALA E O     1 
ATOM 9867  C CB    . ALA E 2 207 ? -40.568  -75.585 -56.038  1.00 72.50  ? 2078 ALA E CB    1 
ATOM 9868  N N     . LYS E 2 208 ? -42.722  -77.655 -55.309  1.00 72.88  ? 2079 LYS E N     1 
ATOM 9869  C CA    . LYS E 2 208 ? -43.628  -78.801 -55.527  1.00 73.61  ? 2079 LYS E CA    1 
ATOM 9870  C C     . LYS E 2 208 ? -45.111  -78.405 -55.410  1.00 73.72  ? 2079 LYS E C     1 
ATOM 9871  O O     . LYS E 2 208 ? -45.986  -78.933 -56.112  1.00 73.16  ? 2079 LYS E O     1 
ATOM 9872  C CB    . LYS E 2 208 ? -43.326  -79.934 -54.533  1.00 74.05  ? 2079 LYS E CB    1 
ATOM 9873  C CG    . LYS E 2 208 ? -43.934  -81.300 -54.869  1.00 74.54  ? 2079 LYS E CG    1 
ATOM 9874  C CD    . LYS E 2 208 ? -44.158  -82.048 -53.573  1.00 79.08  ? 2079 LYS E CD    1 
ATOM 9875  C CE    . LYS E 2 208 ? -43.717  -83.530 -53.650  1.00 83.38  ? 2079 LYS E CE    1 
ATOM 9876  N NZ    . LYS E 2 208 ? -44.845  -84.570 -53.797  1.00 85.24  ? 2079 LYS E NZ    1 
ATOM 9877  N N     . VAL E 2 209 ? -45.380  -77.469 -54.511  1.00 74.05  ? 2080 VAL E N     1 
ATOM 9878  C CA    . VAL E 2 209 ? -46.735  -77.009 -54.290  1.00 74.48  ? 2080 VAL E CA    1 
ATOM 9879  C C     . VAL E 2 209 ? -47.335  -76.186 -55.443  1.00 74.74  ? 2080 VAL E C     1 
ATOM 9880  O O     . VAL E 2 209 ? -48.533  -76.332 -55.724  1.00 75.21  ? 2080 VAL E O     1 
ATOM 9881  C CB    . VAL E 2 209 ? -46.840  -76.279 -52.943  1.00 74.62  ? 2080 VAL E CB    1 
ATOM 9882  C CG1   . VAL E 2 209 ? -47.898  -75.157 -52.998  1.00 74.68  ? 2080 VAL E CG1   1 
ATOM 9883  C CG2   . VAL E 2 209 ? -47.138  -77.295 -51.854  1.00 74.06  ? 2080 VAL E CG2   1 
ATOM 9884  N N     . LEU E 2 210 ? -46.539  -75.328 -56.096  1.00 74.62  ? 2081 LEU E N     1 
ATOM 9885  C CA    . LEU E 2 210 ? -47.069  -74.584 -57.240  1.00 74.53  ? 2081 LEU E CA    1 
ATOM 9886  C C     . LEU E 2 210 ? -47.141  -75.534 -58.418  1.00 75.19  ? 2081 LEU E C     1 
ATOM 9887  O O     . LEU E 2 210 ? -48.167  -75.596 -59.109  1.00 75.35  ? 2081 LEU E O     1 
ATOM 9888  C CB    . LEU E 2 210 ? -46.315  -73.302 -57.564  1.00 73.60  ? 2081 LEU E CB    1 
ATOM 9889  C CG    . LEU E 2 210 ? -45.907  -72.504 -56.334  1.00 74.35  ? 2081 LEU E CG    1 
ATOM 9890  C CD1   . LEU E 2 210 ? -44.462  -72.867 -56.081  1.00 76.31  ? 2081 LEU E CD1   1 
ATOM 9891  C CD2   . LEU E 2 210 ? -46.092  -70.946 -56.360  1.00 71.98  ? 2081 LEU E CD2   1 
ATOM 9892  N N     . LEU E 2 211 ? -46.098  -76.329 -58.618  1.00 75.81  ? 2082 LEU E N     1 
ATOM 9893  C CA    . LEU E 2 211 ? -46.175  -77.372 -59.630  1.00 76.91  ? 2082 LEU E CA    1 
ATOM 9894  C C     . LEU E 2 211 ? -47.414  -78.220 -59.401  1.00 78.09  ? 2082 LEU E C     1 
ATOM 9895  O O     . LEU E 2 211 ? -47.908  -78.922 -60.301  1.00 77.50  ? 2082 LEU E O     1 
ATOM 9896  C CB    . LEU E 2 211 ? -44.936  -78.254 -59.579  1.00 76.85  ? 2082 LEU E CB    1 
ATOM 9897  C CG    . LEU E 2 211 ? -43.794  -77.953 -60.550  1.00 76.68  ? 2082 LEU E CG    1 
ATOM 9898  C CD1   . LEU E 2 211 ? -44.318  -77.963 -61.987  1.00 77.02  ? 2082 LEU E CD1   1 
ATOM 9899  C CD2   . LEU E 2 211 ? -43.064  -76.651 -60.265  1.00 75.52  ? 2082 LEU E CD2   1 
ATOM 9900  N N     . ASP E 2 212 ? -47.898  -78.142 -58.161  1.00 80.17  ? 2083 ASP E N     1 
ATOM 9901  C CA    . ASP E 2 212 ? -49.055  -78.909 -57.711  1.00 82.03  ? 2083 ASP E CA    1 
ATOM 9902  C C     . ASP E 2 212 ? -50.345  -78.282 -58.107  1.00 82.61  ? 2083 ASP E C     1 
ATOM 9903  O O     . ASP E 2 212 ? -51.286  -78.986 -58.451  1.00 83.16  ? 2083 ASP E O     1 
ATOM 9904  C CB    . ASP E 2 212 ? -49.046  -79.104 -56.209  1.00 82.22  ? 2083 ASP E CB    1 
ATOM 9905  C CG    . ASP E 2 212 ? -48.568  -80.466 -55.832  1.00 84.37  ? 2083 ASP E CG    1 
ATOM 9906  O OD1   . ASP E 2 212 ? -48.424  -81.313 -56.766  1.00 85.47  ? 2083 ASP E OD1   1 
ATOM 9907  O OD2   . ASP E 2 212 ? -48.345  -80.685 -54.610  1.00 86.95  ? 2083 ASP E OD2   1 
ATOM 9908  N N     . HIS E 2 213 ? -50.389  -76.962 -58.062  1.00 83.25  ? 2084 HIS E N     1 
ATOM 9909  C CA    . HIS E 2 213 ? -51.551  -76.272 -58.558  1.00 84.48  ? 2084 HIS E CA    1 
ATOM 9910  C C     . HIS E 2 213 ? -51.403  -75.926 -60.021  1.00 84.85  ? 2084 HIS E C     1 
ATOM 9911  O O     . HIS E 2 213 ? -52.117  -75.078 -60.566  1.00 84.90  ? 2084 HIS E O     1 
ATOM 9912  C CB    . HIS E 2 213 ? -51.881  -75.108 -57.643  1.00 84.51  ? 2084 HIS E CB    1 
ATOM 9913  C CG    . HIS E 2 213 ? -52.229  -75.570 -56.274  1.00 85.53  ? 2084 HIS E CG    1 
ATOM 9914  N ND1   . HIS E 2 213 ? -52.104  -74.778 -55.160  1.00 87.38  ? 2084 HIS E ND1   1 
ATOM 9915  C CD2   . HIS E 2 213 ? -52.667  -76.775 -55.836  1.00 86.00  ? 2084 HIS E CD2   1 
ATOM 9916  C CE1   . HIS E 2 213 ? -52.483  -75.461 -54.093  1.00 87.56  ? 2084 HIS E CE1   1 
ATOM 9917  N NE2   . HIS E 2 213 ? -52.824  -76.678 -54.477  1.00 87.43  ? 2084 HIS E NE2   1 
ATOM 9918  N N     . PHE E 2 214 ? -50.512  -76.683 -60.651  1.00 85.53  ? 2085 PHE E N     1 
ATOM 9919  C CA    . PHE E 2 214 ? -49.965  -76.384 -61.969  1.00 86.42  ? 2085 PHE E CA    1 
ATOM 9920  C C     . PHE E 2 214 ? -49.728  -74.894 -62.147  1.00 86.78  ? 2085 PHE E C     1 
ATOM 9921  O O     . PHE E 2 214 ? -50.545  -74.207 -62.784  1.00 87.20  ? 2085 PHE E O     1 
ATOM 9922  C CB    . PHE E 2 214 ? -50.867  -76.879 -63.086  1.00 86.18  ? 2085 PHE E CB    1 
ATOM 9923  C CG    . PHE E 2 214 ? -51.803  -77.941 -62.668  1.00 87.03  ? 2085 PHE E CG    1 
ATOM 9924  C CD1   . PHE E 2 214 ? -51.561  -79.281 -63.039  1.00 88.86  ? 2085 PHE E CD1   1 
ATOM 9925  C CD2   . PHE E 2 214 ? -52.933  -77.618 -61.923  1.00 86.72  ? 2085 PHE E CD2   1 
ATOM 9926  C CE1   . PHE E 2 214 ? -52.436  -80.297 -62.671  1.00 89.41  ? 2085 PHE E CE1   1 
ATOM 9927  C CE2   . PHE E 2 214 ? -53.813  -78.595 -61.537  1.00 89.16  ? 2085 PHE E CE2   1 
ATOM 9928  C CZ    . PHE E 2 214 ? -53.571  -79.956 -61.908  1.00 91.32  ? 2085 PHE E CZ    1 
ATOM 9929  N N     . ALA E 2 215 ? -48.640  -74.383 -61.565  1.00 86.85  ? 2086 ALA E N     1 
ATOM 9930  C CA    . ALA E 2 215 ? -48.143  -73.101 -62.021  1.00 86.89  ? 2086 ALA E CA    1 
ATOM 9931  C C     . ALA E 2 215 ? -47.531  -73.408 -63.362  1.00 86.84  ? 2086 ALA E C     1 
ATOM 9932  O O     . ALA E 2 215 ? -47.136  -74.564 -63.656  1.00 86.21  ? 2086 ALA E O     1 
ATOM 9933  C CB    . ALA E 2 215 ? -47.123  -72.469 -61.069  1.00 86.92  ? 2086 ALA E CB    1 
ATOM 9934  N N     . ASN E 2 216 ? -47.509  -72.377 -64.188  1.00 87.18  ? 2087 ASN E N     1 
ATOM 9935  C CA    . ASN E 2 216 ? -46.922  -72.509 -65.469  1.00 87.76  ? 2087 ASN E CA    1 
ATOM 9936  C C     . ASN E 2 216 ? -45.441  -72.437 -65.299  1.00 87.65  ? 2087 ASN E C     1 
ATOM 9937  O O     . ASN E 2 216 ? -44.897  -71.428 -64.800  1.00 87.10  ? 2087 ASN E O     1 
ATOM 9938  C CB    . ASN E 2 216 ? -47.397  -71.419 -66.390  1.00 88.32  ? 2087 ASN E CB    1 
ATOM 9939  C CG    . ASN E 2 216 ? -46.741  -71.512 -67.737  1.00 90.31  ? 2087 ASN E CG    1 
ATOM 9940  O OD1   . ASN E 2 216 ? -46.395  -72.623 -68.212  1.00 91.24  ? 2087 ASN E OD1   1 
ATOM 9941  N ND2   . ASN E 2 216 ? -46.534  -70.351 -68.369  1.00 91.59  ? 2087 ASN E ND2   1 
ATOM 9942  N N     . ARG E 2 217 ? -44.789  -73.527 -65.682  1.00 88.08  ? 2088 ARG E N     1 
ATOM 9943  C CA    . ARG E 2 217 ? -43.363  -73.610 -65.436  1.00 89.17  ? 2088 ARG E CA    1 
ATOM 9944  C C     . ARG E 2 217 ? -42.594  -72.972 -66.573  1.00 90.51  ? 2088 ARG E C     1 
ATOM 9945  O O     . ARG E 2 217 ? -41.395  -72.695 -66.441  1.00 91.00  ? 2088 ARG E O     1 
ATOM 9946  C CB    . ARG E 2 217 ? -42.902  -75.039 -65.141  1.00 88.72  ? 2088 ARG E CB    1 
ATOM 9947  C CG    . ARG E 2 217 ? -42.700  -75.940 -66.303  1.00 87.85  ? 2088 ARG E CG    1 
ATOM 9948  C CD    . ARG E 2 217 ? -42.438  -77.321 -65.781  1.00 86.84  ? 2088 ARG E CD    1 
ATOM 9949  N NE    . ARG E 2 217 ? -43.686  -77.942 -65.355  1.00 87.38  ? 2088 ARG E NE    1 
ATOM 9950  C CZ    . ARG E 2 217 ? -43.789  -79.116 -64.735  1.00 88.39  ? 2088 ARG E CZ    1 
ATOM 9951  N NH1   . ARG E 2 217 ? -42.710  -79.831 -64.438  1.00 88.70  ? 2088 ARG E NH1   1 
ATOM 9952  N NH2   . ARG E 2 217 ? -44.990  -79.584 -64.406  1.00 89.39  ? 2088 ARG E NH2   1 
ATOM 9953  N N     . ASP E 2 218 ? -43.309  -72.702 -67.674  1.00 91.54  ? 2089 ASP E N     1 
ATOM 9954  C CA    . ASP E 2 218 ? -42.724  -72.136 -68.888  1.00 91.78  ? 2089 ASP E CA    1 
ATOM 9955  C C     . ASP E 2 218 ? -42.671  -70.625 -68.898  1.00 91.72  ? 2089 ASP E C     1 
ATOM 9956  O O     . ASP E 2 218 ? -41.855  -70.074 -69.623  1.00 92.48  ? 2089 ASP E O     1 
ATOM 9957  C CB    . ASP E 2 218 ? -43.424  -72.670 -70.137  1.00 92.07  ? 2089 ASP E CB    1 
ATOM 9958  C CG    . ASP E 2 218 ? -43.249  -74.194 -70.305  1.00 94.14  ? 2089 ASP E CG    1 
ATOM 9959  O OD1   . ASP E 2 218 ? -42.131  -74.704 -70.002  1.00 94.43  ? 2089 ASP E OD1   1 
ATOM 9960  O OD2   . ASP E 2 218 ? -44.232  -74.876 -70.737  1.00 96.32  ? 2089 ASP E OD2   1 
ATOM 9961  N N     . ILE E 2 219 ? -43.497  -69.941 -68.110  1.00 91.54  ? 2090 ILE E N     1 
ATOM 9962  C CA    . ILE E 2 219 ? -43.296  -68.503 -67.977  1.00 91.94  ? 2090 ILE E CA    1 
ATOM 9963  C C     . ILE E 2 219 ? -41.860  -68.294 -67.533  1.00 92.60  ? 2090 ILE E C     1 
ATOM 9964  O O     . ILE E 2 219 ? -41.423  -68.935 -66.597  1.00 92.64  ? 2090 ILE E O     1 
ATOM 9965  C CB    . ILE E 2 219 ? -44.239  -67.844 -66.969  1.00 91.85  ? 2090 ILE E CB    1 
ATOM 9966  C CG1   . ILE E 2 219 ? -45.684  -68.275 -67.246  1.00 92.08  ? 2090 ILE E CG1   1 
ATOM 9967  C CG2   . ILE E 2 219 ? -44.077  -66.299 -67.003  1.00 90.52  ? 2090 ILE E CG2   1 
ATOM 9968  C CD1   . ILE E 2 219 ? -46.718  -67.863 -66.182  1.00 93.73  ? 2090 ILE E CD1   1 
ATOM 9969  N N     . THR E 2 220 ? -41.136  -67.433 -68.246  1.00 93.62  ? 2091 THR E N     1 
ATOM 9970  C CA    . THR E 2 220 ? -39.726  -67.115 -67.978  1.00 94.60  ? 2091 THR E CA    1 
ATOM 9971  C C     . THR E 2 220 ? -39.588  -65.830 -67.134  1.00 95.53  ? 2091 THR E C     1 
ATOM 9972  O O     . THR E 2 220 ? -40.601  -65.333 -66.608  1.00 95.83  ? 2091 THR E O     1 
ATOM 9973  C CB    . THR E 2 220 ? -38.968  -66.909 -69.276  1.00 94.35  ? 2091 THR E CB    1 
ATOM 9974  O OG1   . THR E 2 220 ? -37.982  -65.898 -69.073  1.00 94.07  ? 2091 THR E OG1   1 
ATOM 9975  C CG2   . THR E 2 220 ? -39.914  -66.406 -70.347  1.00 95.34  ? 2091 THR E CG2   1 
ATOM 9976  N N     . ASP E 2 221 ? -38.345  -65.320 -66.990  1.00 96.33  ? 2092 ASP E N     1 
ATOM 9977  C CA    . ASP E 2 221 ? -38.051  -64.019 -66.311  1.00 97.04  ? 2092 ASP E CA    1 
ATOM 9978  C C     . ASP E 2 221 ? -38.009  -62.980 -67.380  1.00 97.36  ? 2092 ASP E C     1 
ATOM 9979  O O     . ASP E 2 221 ? -38.363  -63.278 -68.526  1.00 97.74  ? 2092 ASP E O     1 
ATOM 9980  C CB    . ASP E 2 221 ? -36.713  -63.999 -65.519  1.00 97.07  ? 2092 ASP E CB    1 
ATOM 9981  C CG    . ASP E 2 221 ? -35.574  -64.719 -66.243  1.00 97.80  ? 2092 ASP E CG    1 
ATOM 9982  O OD1   . ASP E 2 221 ? -34.482  -64.914 -65.659  1.00 97.85  ? 2092 ASP E OD1   1 
ATOM 9983  O OD2   . ASP E 2 221 ? -35.780  -65.117 -67.397  1.00 98.88  ? 2092 ASP E OD2   1 
ATOM 9984  N N     . HIS E 2 222 ? -37.565  -61.774 -67.026  1.00 97.83  ? 2093 HIS E N     1 
ATOM 9985  C CA    . HIS E 2 222 ? -37.374  -60.711 -68.023  1.00 98.22  ? 2093 HIS E CA    1 
ATOM 9986  C C     . HIS E 2 222 ? -36.003  -60.789 -68.634  1.00 98.10  ? 2093 HIS E C     1 
ATOM 9987  O O     . HIS E 2 222 ? -35.426  -59.777 -68.902  1.00 98.22  ? 2093 HIS E O     1 
ATOM 9988  C CB    . HIS E 2 222 ? -37.563  -59.320 -67.415  1.00 98.22  ? 2093 HIS E CB    1 
ATOM 9989  C CG    . HIS E 2 222 ? -36.425  -58.880 -66.544  1.00 99.05  ? 2093 HIS E CG    1 
ATOM 9990  N ND1   . HIS E 2 222 ? -36.228  -57.563 -66.186  1.00 99.59  ? 2093 HIS E ND1   1 
ATOM 9991  C CD2   . HIS E 2 222 ? -35.423  -59.584 -65.961  1.00 99.78  ? 2093 HIS E CD2   1 
ATOM 9992  C CE1   . HIS E 2 222 ? -35.162  -57.478 -65.409  1.00 100.26 ? 2093 HIS E CE1   1 
ATOM 9993  N NE2   . HIS E 2 222 ? -34.652  -58.689 -65.262  1.00 100.40 ? 2093 HIS E NE2   1 
ATOM 9994  N N     . MET E 2 223 ? -35.467  -61.985 -68.802  1.00 98.35  ? 2094 MET E N     1 
ATOM 9995  C CA    . MET E 2 223 ? -34.212  -62.184 -69.522  1.00 98.83  ? 2094 MET E CA    1 
ATOM 9996  C C     . MET E 2 223 ? -34.267  -63.530 -70.248  1.00 99.10  ? 2094 MET E C     1 
ATOM 9997  O O     . MET E 2 223 ? -33.266  -64.080 -70.676  1.00 99.31  ? 2094 MET E O     1 
ATOM 9998  C CB    . MET E 2 223 ? -33.005  -62.044 -68.582  1.00 98.67  ? 2094 MET E CB    1 
ATOM 9999  C CG    . MET E 2 223 ? -32.916  -60.634 -67.969  1.00 99.25  ? 2094 MET E CG    1 
ATOM 10000 S SD    . MET E 2 223 ? -31.488  -60.222 -66.934  1.00 101.47 ? 2094 MET E SD    1 
ATOM 10001 C CE    . MET E 2 223 ? -30.242  -61.210 -67.797  1.00 102.52 ? 2094 MET E CE    1 
ATOM 10002 N N     . ASP E 2 224 ? -35.483  -64.043 -70.369  1.00 99.62  ? 2095 ASP E N     1 
ATOM 10003 C CA    . ASP E 2 224 ? -35.792  -65.269 -71.096  1.00 100.19 ? 2095 ASP E CA    1 
ATOM 10004 C C     . ASP E 2 224 ? -35.111  -66.549 -70.603  1.00 99.70  ? 2095 ASP E C     1 
ATOM 10005 O O     . ASP E 2 224 ? -35.008  -67.528 -71.337  1.00 99.68  ? 2095 ASP E O     1 
ATOM 10006 C CB    . ASP E 2 224 ? -35.679  -65.029 -72.596  1.00 100.90 ? 2095 ASP E CB    1 
ATOM 10007 C CG    . ASP E 2 224 ? -36.539  -63.845 -73.035  1.00 104.05 ? 2095 ASP E CG    1 
ATOM 10008 O OD1   . ASP E 2 224 ? -36.551  -62.815 -72.308  1.00 106.23 ? 2095 ASP E OD1   1 
ATOM 10009 O OD2   . ASP E 2 224 ? -37.220  -63.941 -74.082  1.00 107.63 ? 2095 ASP E OD2   1 
ATOM 10010 N N     . ARG E 2 225 ? -34.694  -66.528 -69.335  1.00 99.33  ? 2096 ARG E N     1 
ATOM 10011 C CA    . ARG E 2 225 ? -34.376  -67.727 -68.541  1.00 99.01  ? 2096 ARG E CA    1 
ATOM 10012 C C     . ARG E 2 225 ? -35.619  -68.390 -67.918  1.00 98.49  ? 2096 ARG E C     1 
ATOM 10013 O O     . ARG E 2 225 ? -36.327  -67.771 -67.097  1.00 97.98  ? 2096 ARG E O     1 
ATOM 10014 C CB    . ARG E 2 225 ? -33.457  -67.340 -67.389  1.00 99.20  ? 2096 ARG E CB    1 
ATOM 10015 C CG    . ARG E 2 225 ? -31.977  -67.374 -67.684  1.00 100.44 ? 2096 ARG E CG    1 
ATOM 10016 C CD    . ARG E 2 225 ? -31.201  -66.796 -66.501  1.00 100.65 ? 2096 ARG E CD    1 
ATOM 10017 N NE    . ARG E 2 225 ? -31.875  -65.615 -65.949  1.00 100.23 ? 2096 ARG E NE    1 
ATOM 10018 C CZ    . ARG E 2 225 ? -31.548  -65.037 -64.798  1.00 100.80 ? 2096 ARG E CZ    1 
ATOM 10019 N NH1   . ARG E 2 225 ? -30.554  -65.531 -64.054  1.00 100.65 ? 2096 ARG E NH1   1 
ATOM 10020 N NH2   . ARG E 2 225 ? -32.220  -63.962 -64.391  1.00 100.87 ? 2096 ARG E NH2   1 
ATOM 10021 N N     . LEU E 2 226 ? -35.857  -69.651 -68.284  1.00 97.80  ? 2097 LEU E N     1 
ATOM 10022 C CA    . LEU E 2 226 ? -36.862  -70.480 -67.619  1.00 97.56  ? 2097 LEU E CA    1 
ATOM 10023 C C     . LEU E 2 226 ? -36.569  -70.547 -66.088  1.00 97.89  ? 2097 LEU E C     1 
ATOM 10024 O O     . LEU E 2 226 ? -35.416  -70.306 -65.673  1.00 98.31  ? 2097 LEU E O     1 
ATOM 10025 C CB    . LEU E 2 226 ? -36.889  -71.889 -68.249  1.00 97.12  ? 2097 LEU E CB    1 
ATOM 10026 C CG    . LEU E 2 226 ? -37.673  -72.157 -69.558  1.00 96.84  ? 2097 LEU E CG    1 
ATOM 10027 C CD1   . LEU E 2 226 ? -37.237  -73.424 -70.271  1.00 95.59  ? 2097 LEU E CD1   1 
ATOM 10028 C CD2   . LEU E 2 226 ? -39.198  -72.185 -69.378  1.00 96.28  ? 2097 LEU E CD2   1 
ATOM 10029 N N     . PRO E 2 227 ? -37.597  -70.841 -65.231  1.00 97.68  ? 2098 PRO E N     1 
ATOM 10030 C CA    . PRO E 2 227 ? -37.202  -71.109 -63.844  1.00 97.03  ? 2098 PRO E CA    1 
ATOM 10031 C C     . PRO E 2 227 ? -36.285  -72.335 -63.854  1.00 96.18  ? 2098 PRO E C     1 
ATOM 10032 O O     . PRO E 2 227 ? -35.195  -72.293 -63.276  1.00 95.72  ? 2098 PRO E O     1 
ATOM 10033 C CB    . PRO E 2 227 ? -38.537  -71.384 -63.139  1.00 96.96  ? 2098 PRO E CB    1 
ATOM 10034 C CG    . PRO E 2 227 ? -39.415  -71.883 -64.216  1.00 97.21  ? 2098 PRO E CG    1 
ATOM 10035 C CD    . PRO E 2 227 ? -39.046  -71.051 -65.415  1.00 97.64  ? 2098 PRO E CD    1 
ATOM 10036 N N     . ARG E 2 228 ? -36.705  -73.372 -64.570  1.00 95.26  ? 2099 ARG E N     1 
ATOM 10037 C CA    . ARG E 2 228 ? -35.845  -74.494 -64.896  1.00 95.34  ? 2099 ARG E CA    1 
ATOM 10038 C C     . ARG E 2 228 ? -34.333  -74.157 -65.023  1.00 95.06  ? 2099 ARG E C     1 
ATOM 10039 O O     . ARG E 2 228 ? -33.483  -75.023 -64.810  1.00 94.84  ? 2099 ARG E O     1 
ATOM 10040 C CB    . ARG E 2 228 ? -36.369  -75.166 -66.181  1.00 95.62  ? 2099 ARG E CB    1 
ATOM 10041 C CG    . ARG E 2 228 ? -36.058  -76.665 -66.326  1.00 96.04  ? 2099 ARG E CG    1 
ATOM 10042 C CD    . ARG E 2 228 ? -34.636  -76.900 -66.792  1.00 96.80  ? 2099 ARG E CD    1 
ATOM 10043 N NE    . ARG E 2 228 ? -34.443  -78.274 -67.249  1.00 98.27  ? 2099 ARG E NE    1 
ATOM 10044 C CZ    . ARG E 2 228 ? -33.252  -78.853 -67.423  1.00 98.95  ? 2099 ARG E CZ    1 
ATOM 10045 N NH1   . ARG E 2 228 ? -32.127  -78.182 -67.152  1.00 98.87  ? 2099 ARG E NH1   1 
ATOM 10046 N NH2   . ARG E 2 228 ? -33.185  -80.112 -67.861  1.00 98.65  ? 2099 ARG E NH2   1 
ATOM 10047 N N     . ASP E 2 229 ? -34.003  -72.906 -65.359  1.00 94.95  ? 2100 ASP E N     1 
ATOM 10048 C CA    . ASP E 2 229 ? -32.608  -72.537 -65.694  1.00 94.62  ? 2100 ASP E CA    1 
ATOM 10049 C C     . ASP E 2 229 ? -31.895  -71.977 -64.523  1.00 93.35  ? 2100 ASP E C     1 
ATOM 10050 O O     . ASP E 2 229 ? -30.821  -72.448 -64.193  1.00 93.56  ? 2100 ASP E O     1 
ATOM 10051 C CB    . ASP E 2 229 ? -32.505  -71.536 -66.860  1.00 95.28  ? 2100 ASP E CB    1 
ATOM 10052 C CG    . ASP E 2 229 ? -32.904  -72.155 -68.213  1.00 98.11  ? 2100 ASP E CG    1 
ATOM 10053 O OD1   . ASP E 2 229 ? -32.433  -73.303 -68.550  1.00 99.04  ? 2100 ASP E OD1   1 
ATOM 10054 O OD2   . ASP E 2 229 ? -33.706  -71.468 -68.921  1.00 100.25 ? 2100 ASP E OD2   1 
ATOM 10055 N N     . ILE E 2 230 ? -32.490  -70.969 -63.898  1.00 91.94  ? 2101 ILE E N     1 
ATOM 10056 C CA    . ILE E 2 230 ? -31.918  -70.410 -62.681  1.00 90.87  ? 2101 ILE E CA    1 
ATOM 10057 C C     . ILE E 2 230 ? -31.685  -71.500 -61.599  1.00 90.43  ? 2101 ILE E C     1 
ATOM 10058 O O     . ILE E 2 230 ? -30.899  -71.309 -60.674  1.00 90.35  ? 2101 ILE E O     1 
ATOM 10059 C CB    . ILE E 2 230 ? -32.776  -69.228 -62.164  1.00 90.77  ? 2101 ILE E CB    1 
ATOM 10060 C CG1   . ILE E 2 230 ? -32.049  -68.444 -61.058  1.00 90.51  ? 2101 ILE E CG1   1 
ATOM 10061 C CG2   . ILE E 2 230 ? -34.157  -69.707 -61.719  1.00 90.93  ? 2101 ILE E CG2   1 
ATOM 10062 C CD1   . ILE E 2 230 ? -30.703  -67.911 -61.460  1.00 90.30  ? 2101 ILE E CD1   1 
ATOM 10063 N N     . ALA E 2 231 ? -32.373  -72.637 -61.739  1.00 89.60  ? 2102 ALA E N     1 
ATOM 10064 C CA    . ALA E 2 231 ? -32.081  -73.833 -60.991  1.00 88.63  ? 2102 ALA E CA    1 
ATOM 10065 C C     . ALA E 2 231 ? -30.725  -74.309 -61.425  1.00 88.63  ? 2102 ALA E C     1 
ATOM 10066 O O     . ALA E 2 231 ? -29.740  -73.985 -60.780  1.00 88.52  ? 2102 ALA E O     1 
ATOM 10067 C CB    . ALA E 2 231 ? -33.080  -74.850 -61.283  1.00 88.52  ? 2102 ALA E CB    1 
ATOM 10068 N N     . GLN E 2 232 ? -30.682  -75.058 -62.526  1.00 88.96  ? 2103 GLN E N     1 
ATOM 10069 C CA    . GLN E 2 232 ? -29.436  -75.461 -63.210  1.00 89.61  ? 2103 GLN E CA    1 
ATOM 10070 C C     . GLN E 2 232 ? -28.174  -74.674 -62.853  1.00 89.59  ? 2103 GLN E C     1 
ATOM 10071 O O     . GLN E 2 232 ? -27.139  -75.235 -62.476  1.00 89.29  ? 2103 GLN E O     1 
ATOM 10072 C CB    . GLN E 2 232 ? -29.629  -75.337 -64.715  1.00 89.87  ? 2103 GLN E CB    1 
ATOM 10073 C CG    . GLN E 2 232 ? -29.851  -76.644 -65.418  1.00 91.62  ? 2103 GLN E CG    1 
ATOM 10074 C CD    . GLN E 2 232 ? -28.837  -77.666 -64.995  1.00 94.39  ? 2103 GLN E CD    1 
ATOM 10075 O OE1   . GLN E 2 232 ? -29.180  -78.663 -64.345  1.00 96.23  ? 2103 GLN E OE1   1 
ATOM 10076 N NE2   . GLN E 2 232 ? -27.563  -77.410 -65.317  1.00 95.30  ? 2103 GLN E NE2   1 
ATOM 10077 N N     . GLU E 2 233 ? -28.283  -73.363 -63.021  1.00 89.97  ? 2104 GLU E N     1 
ATOM 10078 C CA    . GLU E 2 233 ? -27.260  -72.405 -62.648  1.00 90.55  ? 2104 GLU E CA    1 
ATOM 10079 C C     . GLU E 2 233 ? -26.890  -72.476 -61.151  1.00 90.09  ? 2104 GLU E C     1 
ATOM 10080 O O     . GLU E 2 233 ? -25.751  -72.836 -60.831  1.00 90.44  ? 2104 GLU E O     1 
ATOM 10081 C CB    . GLU E 2 233 ? -27.702  -70.995 -63.060  1.00 90.89  ? 2104 GLU E CB    1 
ATOM 10082 C CG    . GLU E 2 233 ? -26.824  -69.869 -62.517  1.00 94.47  ? 2104 GLU E CG    1 
ATOM 10083 C CD    . GLU E 2 233 ? -27.135  -68.486 -63.128  1.00 99.82  ? 2104 GLU E CD    1 
ATOM 10084 O OE1   . GLU E 2 233 ? -26.864  -67.471 -62.429  1.00 100.84 ? 2104 GLU E OE1   1 
ATOM 10085 O OE2   . GLU E 2 233 ? -27.636  -68.405 -64.293  1.00 102.15 ? 2104 GLU E OE2   1 
ATOM 10086 N N     . ARG E 2 234 ? -27.841  -72.164 -60.254  1.00 89.31  ? 2105 ARG E N     1 
ATOM 10087 C CA    . ARG E 2 234 ? -27.603  -72.139 -58.790  1.00 88.28  ? 2105 ARG E CA    1 
ATOM 10088 C C     . ARG E 2 234 ? -27.357  -73.517 -58.174  1.00 87.49  ? 2105 ARG E C     1 
ATOM 10089 O O     . ARG E 2 234 ? -27.161  -73.669 -56.968  1.00 86.71  ? 2105 ARG E O     1 
ATOM 10090 C CB    . ARG E 2 234 ? -28.746  -71.460 -58.071  1.00 88.41  ? 2105 ARG E CB    1 
ATOM 10091 C CG    . ARG E 2 234 ? -28.702  -69.984 -58.097  1.00 89.62  ? 2105 ARG E CG    1 
ATOM 10092 C CD    . ARG E 2 234 ? -27.765  -69.427 -57.042  1.00 93.70  ? 2105 ARG E CD    1 
ATOM 10093 N NE    . ARG E 2 234 ? -28.212  -68.094 -56.621  1.00 98.39  ? 2105 ARG E NE    1 
ATOM 10094 C CZ    . ARG E 2 234 ? -28.428  -67.047 -57.436  1.00 99.52  ? 2105 ARG E CZ    1 
ATOM 10095 N NH1   . ARG E 2 234 ? -28.241  -67.139 -58.763  1.00 98.46  ? 2105 ARG E NH1   1 
ATOM 10096 N NH2   . ARG E 2 234 ? -28.848  -65.893 -56.911  1.00 99.18  ? 2105 ARG E NH2   1 
ATOM 10097 N N     . MET E 2 235 ? -27.367  -74.514 -59.042  1.00 87.05  ? 2106 MET E N     1 
ATOM 10098 C CA    . MET E 2 235 ? -26.880  -75.840 -58.725  1.00 86.90  ? 2106 MET E CA    1 
ATOM 10099 C C     . MET E 2 235 ? -27.867  -76.669 -57.913  1.00 86.35  ? 2106 MET E C     1 
ATOM 10100 O O     . MET E 2 235 ? -27.485  -77.698 -57.320  1.00 86.75  ? 2106 MET E O     1 
ATOM 10101 C CB    . MET E 2 235 ? -25.502  -75.763 -58.069  1.00 87.13  ? 2106 MET E CB    1 
ATOM 10102 C CG    . MET E 2 235 ? -24.403  -75.439 -59.068  1.00 89.43  ? 2106 MET E CG    1 
ATOM 10103 S SD    . MET E 2 235 ? -24.309  -76.689 -60.410  1.00 95.13  ? 2106 MET E SD    1 
ATOM 10104 C CE    . MET E 2 235 ? -23.319  -75.757 -61.588  1.00 96.51  ? 2106 MET E CE    1 
ATOM 10105 N N     . HIS E 2 236 ? -29.134  -76.228 -57.918  1.00 85.14  ? 2107 HIS E N     1 
ATOM 10106 C CA    . HIS E 2 236 ? -30.253  -76.981 -57.354  1.00 83.72  ? 2107 HIS E CA    1 
ATOM 10107 C C     . HIS E 2 236 ? -30.751  -78.044 -58.314  1.00 83.64  ? 2107 HIS E C     1 
ATOM 10108 O O     . HIS E 2 236 ? -31.692  -77.833 -59.059  1.00 83.67  ? 2107 HIS E O     1 
ATOM 10109 C CB    . HIS E 2 236 ? -31.373  -76.033 -57.038  1.00 82.77  ? 2107 HIS E CB    1 
ATOM 10110 C CG    . HIS E 2 236 ? -30.931  -74.833 -56.281  1.00 81.43  ? 2107 HIS E CG    1 
ATOM 10111 N ND1   . HIS E 2 236 ? -31.535  -73.601 -56.421  1.00 80.48  ? 2107 HIS E ND1   1 
ATOM 10112 C CD2   . HIS E 2 236 ? -29.950  -74.669 -55.361  1.00 82.47  ? 2107 HIS E CD2   1 
ATOM 10113 C CE1   . HIS E 2 236 ? -30.953  -72.730 -55.612  1.00 81.51  ? 2107 HIS E CE1   1 
ATOM 10114 N NE2   . HIS E 2 236 ? -29.987  -73.351 -54.958  1.00 83.59  ? 2107 HIS E NE2   1 
ATOM 10115 N N     . HIS E 2 237 ? -30.128  -79.202 -58.285  1.00 83.58  ? 2108 HIS E N     1 
ATOM 10116 C CA    . HIS E 2 237 ? -30.478  -80.240 -59.228  1.00 84.07  ? 2108 HIS E CA    1 
ATOM 10117 C C     . HIS E 2 237 ? -31.789  -80.880 -58.870  1.00 83.79  ? 2108 HIS E C     1 
ATOM 10118 O O     . HIS E 2 237 ? -32.363  -81.630 -59.668  1.00 83.74  ? 2108 HIS E O     1 
ATOM 10119 C CB    . HIS E 2 237 ? -29.385  -81.299 -59.257  1.00 84.60  ? 2108 HIS E CB    1 
ATOM 10120 C CG    . HIS E 2 237 ? -28.007  -80.723 -59.302  1.00 86.46  ? 2108 HIS E CG    1 
ATOM 10121 N ND1   . HIS E 2 237 ? -26.906  -81.445 -59.721  1.00 88.52  ? 2108 HIS E ND1   1 
ATOM 10122 C CD2   . HIS E 2 237 ? -27.557  -79.479 -59.004  1.00 87.02  ? 2108 HIS E CD2   1 
ATOM 10123 C CE1   . HIS E 2 237 ? -25.833  -80.673 -59.651  1.00 89.70  ? 2108 HIS E CE1   1 
ATOM 10124 N NE2   . HIS E 2 237 ? -26.203  -79.474 -59.226  1.00 88.98  ? 2108 HIS E NE2   1 
ATOM 10125 N N     . ASP E 2 238 ? -32.250  -80.609 -57.653  1.00 83.80  ? 2109 ASP E N     1 
ATOM 10126 C CA    . ASP E 2 238 ? -33.462  -81.248 -57.187  1.00 83.45  ? 2109 ASP E CA    1 
ATOM 10127 C C     . ASP E 2 238 ? -34.558  -80.477 -57.809  1.00 83.03  ? 2109 ASP E C     1 
ATOM 10128 O O     . ASP E 2 238 ? -35.320  -81.029 -58.607  1.00 83.34  ? 2109 ASP E O     1 
ATOM 10129 C CB    . ASP E 2 238 ? -33.553  -81.343 -55.662  1.00 83.33  ? 2109 ASP E CB    1 
ATOM 10130 C CG    . ASP E 2 238 ? -32.981  -82.683 -55.139  1.00 83.62  ? 2109 ASP E CG    1 
ATOM 10131 O OD1   . ASP E 2 238 ? -32.938  -83.659 -55.928  1.00 80.38  ? 2109 ASP E OD1   1 
ATOM 10132 O OD2   . ASP E 2 238 ? -32.553  -82.751 -53.958  1.00 85.32  ? 2109 ASP E OD2   1 
ATOM 10133 N N     . ILE E 2 239 ? -34.572  -79.182 -57.534  1.00 82.19  ? 2110 ILE E N     1 
ATOM 10134 C CA    . ILE E 2 239 ? -35.544  -78.312 -58.167  1.00 81.24  ? 2110 ILE E CA    1 
ATOM 10135 C C     . ILE E 2 239 ? -35.572  -78.479 -59.672  1.00 80.94  ? 2110 ILE E C     1 
ATOM 10136 O O     . ILE E 2 239 ? -36.641  -78.448 -60.263  1.00 81.01  ? 2110 ILE E O     1 
ATOM 10137 C CB    . ILE E 2 239 ? -35.323  -76.880 -57.766  1.00 81.29  ? 2110 ILE E CB    1 
ATOM 10138 C CG1   . ILE E 2 239 ? -36.190  -76.598 -56.545  1.00 81.09  ? 2110 ILE E CG1   1 
ATOM 10139 C CG2   . ILE E 2 239 ? -35.632  -75.939 -58.911  1.00 80.89  ? 2110 ILE E CG2   1 
ATOM 10140 C CD1   . ILE E 2 239 ? -36.281  -75.181 -56.205  1.00 82.03  ? 2110 ILE E CD1   1 
ATOM 10141 N N     . VAL E 2 240 ? -34.408  -78.691 -60.283  1.00 80.75  ? 2111 VAL E N     1 
ATOM 10142 C CA    . VAL E 2 240 ? -34.362  -79.097 -61.688  1.00 80.76  ? 2111 VAL E CA    1 
ATOM 10143 C C     . VAL E 2 240 ? -35.176  -80.383 -61.935  1.00 81.35  ? 2111 VAL E C     1 
ATOM 10144 O O     . VAL E 2 240 ? -36.154  -80.364 -62.686  1.00 81.26  ? 2111 VAL E O     1 
ATOM 10145 C CB    . VAL E 2 240 ? -32.928  -79.315 -62.188  1.00 80.47  ? 2111 VAL E CB    1 
ATOM 10146 C CG1   . VAL E 2 240 ? -32.945  -79.865 -63.615  1.00 79.67  ? 2111 VAL E CG1   1 
ATOM 10147 C CG2   . VAL E 2 240 ? -32.123  -78.031 -62.118  1.00 80.22  ? 2111 VAL E CG2   1 
ATOM 10148 N N     . ARG E 2 241 ? -34.783  -81.484 -61.284  1.00 82.19  ? 2112 ARG E N     1 
ATOM 10149 C CA    . ARG E 2 241 ? -35.376  -82.798 -61.554  1.00 82.93  ? 2112 ARG E CA    1 
ATOM 10150 C C     . ARG E 2 241 ? -36.891  -82.722 -61.454  1.00 83.76  ? 2112 ARG E C     1 
ATOM 10151 O O     . ARG E 2 241 ? -37.626  -83.451 -62.148  1.00 83.87  ? 2112 ARG E O     1 
ATOM 10152 C CB    . ARG E 2 241 ? -34.838  -83.859 -60.599  1.00 82.45  ? 2112 ARG E CB    1 
ATOM 10153 C CG    . ARG E 2 241 ? -35.201  -85.274 -61.026  1.00 82.01  ? 2112 ARG E CG    1 
ATOM 10154 C CD    . ARG E 2 241 ? -35.580  -86.177 -59.848  1.00 82.13  ? 2112 ARG E CD    1 
ATOM 10155 N NE    . ARG E 2 241 ? -34.505  -86.295 -58.865  1.00 82.08  ? 2112 ARG E NE    1 
ATOM 10156 C CZ    . ARG E 2 241 ? -34.336  -85.509 -57.807  1.00 82.08  ? 2112 ARG E CZ    1 
ATOM 10157 N NH1   . ARG E 2 241 ? -35.160  -84.510 -57.524  1.00 82.38  ? 2112 ARG E NH1   1 
ATOM 10158 N NH2   . ARG E 2 241 ? -33.309  -85.726 -57.024  1.00 83.55  ? 2112 ARG E NH2   1 
ATOM 10159 N N     . LEU E 2 242 ? -37.342  -81.818 -60.591  1.00 84.65  ? 2113 LEU E N     1 
ATOM 10160 C CA    . LEU E 2 242 ? -38.742  -81.680 -60.309  1.00 85.80  ? 2113 LEU E CA    1 
ATOM 10161 C C     . LEU E 2 242 ? -39.377  -80.975 -61.487  1.00 87.22  ? 2113 LEU E C     1 
ATOM 10162 O O     . LEU E 2 242 ? -40.401  -81.440 -62.025  1.00 87.61  ? 2113 LEU E O     1 
ATOM 10163 C CB    . LEU E 2 242 ? -38.938  -80.895 -59.018  1.00 85.30  ? 2113 LEU E CB    1 
ATOM 10164 C CG    . LEU E 2 242 ? -40.390  -80.766 -58.586  1.00 84.27  ? 2113 LEU E CG    1 
ATOM 10165 C CD1   . LEU E 2 242 ? -40.950  -82.138 -58.238  1.00 83.46  ? 2113 LEU E CD1   1 
ATOM 10166 C CD2   . LEU E 2 242 ? -40.485  -79.791 -57.428  1.00 83.58  ? 2113 LEU E CD2   1 
ATOM 10167 N N     . LEU E 2 243 ? -38.744  -79.877 -61.902  1.00 88.66  ? 2114 LEU E N     1 
ATOM 10168 C CA    . LEU E 2 243 ? -39.212  -79.100 -63.032  1.00 90.38  ? 2114 LEU E CA    1 
ATOM 10169 C C     . LEU E 2 243 ? -39.134  -79.904 -64.315  1.00 92.32  ? 2114 LEU E C     1 
ATOM 10170 O O     . LEU E 2 243 ? -39.980  -79.733 -65.188  1.00 93.40  ? 2114 LEU E O     1 
ATOM 10171 C CB    . LEU E 2 243 ? -38.398  -77.832 -63.166  1.00 89.97  ? 2114 LEU E CB    1 
ATOM 10172 C CG    . LEU E 2 243 ? -38.568  -76.840 -62.017  1.00 89.64  ? 2114 LEU E CG    1 
ATOM 10173 C CD1   . LEU E 2 243 ? -37.486  -75.774 -62.054  1.00 87.87  ? 2114 LEU E CD1   1 
ATOM 10174 C CD2   . LEU E 2 243 ? -39.964  -76.210 -62.044  1.00 90.84  ? 2114 LEU E CD2   1 
ATOM 10175 N N     . ASP E 2 244 ? -38.140  -80.787 -64.428  1.00 94.07  ? 2115 ASP E N     1 
ATOM 10176 C CA    . ASP E 2 244 ? -38.016  -81.638 -65.602  1.00 95.83  ? 2115 ASP E CA    1 
ATOM 10177 C C     . ASP E 2 244 ? -39.131  -82.645 -65.689  1.00 97.06  ? 2115 ASP E C     1 
ATOM 10178 O O     . ASP E 2 244 ? -39.644  -82.886 -66.777  1.00 97.26  ? 2115 ASP E O     1 
ATOM 10179 C CB    . ASP E 2 244 ? -36.686  -82.377 -65.609  1.00 96.20  ? 2115 ASP E CB    1 
ATOM 10180 C CG    . ASP E 2 244 ? -35.532  -81.513 -66.107  1.00 97.62  ? 2115 ASP E CG    1 
ATOM 10181 O OD1   . ASP E 2 244 ? -35.767  -80.563 -66.908  1.00 97.97  ? 2115 ASP E OD1   1 
ATOM 10182 O OD2   . ASP E 2 244 ? -34.382  -81.808 -65.695  1.00 98.57  ? 2115 ASP E OD2   1 
ATOM 10183 N N     . GLU E 2 245 ? -39.522  -83.208 -64.539  1.00 98.99  ? 2116 GLU E N     1 
ATOM 10184 C CA    . GLU E 2 245 ? -40.326  -84.453 -64.502  1.00 100.82 ? 2116 GLU E CA    1 
ATOM 10185 C C     . GLU E 2 245 ? -41.560  -84.569 -63.555  1.00 101.47 ? 2116 GLU E C     1 
ATOM 10186 O O     . GLU E 2 245 ? -42.015  -85.694 -63.289  1.00 101.98 ? 2116 GLU E O     1 
ATOM 10187 C CB    . GLU E 2 245 ? -39.398  -85.643 -64.222  1.00 100.72 ? 2116 GLU E CB    1 
ATOM 10188 C CG    . GLU E 2 245 ? -38.540  -86.095 -65.379  1.00 102.84 ? 2116 GLU E CG    1 
ATOM 10189 C CD    . GLU E 2 245 ? -37.505  -87.150 -64.967  1.00 106.67 ? 2116 GLU E CD    1 
ATOM 10190 O OE1   . GLU E 2 245 ? -37.243  -88.094 -65.745  1.00 108.84 ? 2116 GLU E OE1   1 
ATOM 10191 O OE2   . GLU E 2 245 ? -36.939  -87.051 -63.860  1.00 108.46 ? 2116 GLU E OE2   1 
ATOM 10192 N N     . TYR E 2 246 ? -42.122  -83.466 -63.063  1.00 101.94 ? 2117 TYR E N     1 
ATOM 10193 C CA    . TYR E 2 246 ? -43.210  -83.606 -62.084  1.00 102.52 ? 2117 TYR E CA    1 
ATOM 10194 C C     . TYR E 2 246 ? -44.486  -82.870 -62.502  1.00 102.78 ? 2117 TYR E C     1 
ATOM 10195 O O     . TYR E 2 246 ? -44.546  -81.641 -62.442  1.00 102.94 ? 2117 TYR E O     1 
ATOM 10196 C CB    . TYR E 2 246 ? -42.709  -83.184 -60.688  1.00 102.83 ? 2117 TYR E CB    1 
ATOM 10197 C CG    . TYR E 2 246 ? -43.748  -83.234 -59.584  1.00 103.66 ? 2117 TYR E CG    1 
ATOM 10198 C CD1   . TYR E 2 246 ? -43.945  -84.395 -58.824  1.00 104.16 ? 2117 TYR E CD1   1 
ATOM 10199 C CD2   . TYR E 2 246 ? -44.535  -82.108 -59.293  1.00 104.79 ? 2117 TYR E CD2   1 
ATOM 10200 C CE1   . TYR E 2 246 ? -44.923  -84.434 -57.812  1.00 104.79 ? 2117 TYR E CE1   1 
ATOM 10201 C CE2   . TYR E 2 246 ? -45.513  -82.137 -58.289  1.00 105.18 ? 2117 TYR E CE2   1 
ATOM 10202 C CZ    . TYR E 2 246 ? -45.703  -83.295 -57.560  1.00 105.02 ? 2117 TYR E CZ    1 
ATOM 10203 O OH    . TYR E 2 246 ? -46.667  -83.293 -56.586  1.00 105.05 ? 2117 TYR E OH    1 
ATOM 10204 N N     . ASN E 2 247 ? -45.498  -83.635 -62.918  1.00 103.15 ? 2118 ASN E N     1 
ATOM 10205 C CA    . ASN E 2 247 ? -46.746  -83.123 -63.581  1.00 103.72 ? 2118 ASN E CA    1 
ATOM 10206 C C     . ASN E 2 247 ? -46.835  -83.152 -65.131  1.00 104.68 ? 2118 ASN E C     1 
ATOM 10207 O O     . ASN E 2 247 ? -47.014  -84.226 -65.731  1.00 104.90 ? 2118 ASN E O     1 
ATOM 10208 C CB    . ASN E 2 247 ? -47.253  -81.799 -63.004  1.00 103.07 ? 2118 ASN E CB    1 
ATOM 10209 C CG    . ASN E 2 247 ? -48.377  -82.008 -62.025  1.00 101.94 ? 2118 ASN E CG    1 
ATOM 10210 O OD1   . ASN E 2 247 ? -48.756  -83.158 -61.734  1.00 100.10 ? 2118 ASN E OD1   1 
ATOM 10211 N ND2   . ASN E 2 247 ? -48.930  -80.907 -61.511  1.00 100.17 ? 2118 ASN E ND2   1 
ATOM 10212 N N     . LEU E 2 248 ? -46.731  -81.988 -65.773  1.00 105.59 ? 2119 LEU E N     1 
ATOM 10213 C CA    . LEU E 2 248 ? -46.779  -81.907 -67.254  1.00 106.93 ? 2119 LEU E CA    1 
ATOM 10214 C C     . LEU E 2 248 ? -48.156  -82.270 -67.884  1.00 107.61 ? 2119 LEU E C     1 
ATOM 10215 O O     . LEU E 2 248 ? -48.801  -81.449 -68.583  1.00 107.87 ? 2119 LEU E O     1 
ATOM 10216 C CB    . LEU E 2 248 ? -45.666  -82.758 -67.912  1.00 106.90 ? 2119 LEU E CB    1 
ATOM 10217 C CG    . LEU E 2 248 ? -44.170  -82.571 -67.590  1.00 107.52 ? 2119 LEU E CG    1 
ATOM 10218 C CD1   . LEU E 2 248 ? -43.825  -81.079 -67.369  1.00 107.36 ? 2119 LEU E CD1   1 
ATOM 10219 C CD2   . LEU E 2 248 ? -43.627  -83.486 -66.435  1.00 106.52 ? 2119 LEU E CD2   1 
ATOM 10220 N N     . HIS F 3 5   ? -45.983  -65.298 -20.317  1.00 133.88 ? 16   HIS F N     1 
ATOM 10221 C CA    . HIS F 3 5   ? -45.032  -66.304 -20.904  1.00 133.94 ? 16   HIS F CA    1 
ATOM 10222 C C     . HIS F 3 5   ? -45.673  -67.678 -21.226  1.00 133.08 ? 16   HIS F C     1 
ATOM 10223 O O     . HIS F 3 5   ? -46.897  -67.836 -21.153  1.00 132.94 ? 16   HIS F O     1 
ATOM 10224 C CB    . HIS F 3 5   ? -43.784  -66.466 -20.010  1.00 134.44 ? 16   HIS F CB    1 
ATOM 10225 C CG    . HIS F 3 5   ? -42.806  -65.329 -20.108  1.00 136.29 ? 16   HIS F CG    1 
ATOM 10226 N ND1   . HIS F 3 5   ? -42.086  -65.057 -21.256  1.00 137.45 ? 16   HIS F ND1   1 
ATOM 10227 C CD2   . HIS F 3 5   ? -42.411  -64.409 -19.192  1.00 137.71 ? 16   HIS F CD2   1 
ATOM 10228 C CE1   . HIS F 3 5   ? -41.299  -64.015 -21.047  1.00 137.85 ? 16   HIS F CE1   1 
ATOM 10229 N NE2   . HIS F 3 5   ? -41.474  -63.604 -19.802  1.00 138.24 ? 16   HIS F NE2   1 
ATOM 10230 N N     . SER F 3 6   ? -44.817  -68.653 -21.555  1.00 132.07 ? 17   SER F N     1 
ATOM 10231 C CA    . SER F 3 6   ? -45.169  -69.978 -22.135  1.00 130.94 ? 17   SER F CA    1 
ATOM 10232 C C     . SER F 3 6   ? -46.360  -70.002 -23.098  1.00 129.82 ? 17   SER F C     1 
ATOM 10233 O O     . SER F 3 6   ? -46.412  -70.844 -23.988  1.00 130.07 ? 17   SER F O     1 
ATOM 10234 C CB    . SER F 3 6   ? -45.217  -71.119 -21.091  1.00 131.08 ? 17   SER F CB    1 
ATOM 10235 O OG    . SER F 3 6   ? -46.337  -71.026 -20.232  1.00 131.33 ? 17   SER F OG    1 
ATOM 10236 N N     . ALA F 3 7   ? -47.307  -69.088 -22.926  1.00 128.21 ? 18   ALA F N     1 
ATOM 10237 C CA    . ALA F 3 7   ? -48.329  -68.871 -23.934  1.00 126.51 ? 18   ALA F CA    1 
ATOM 10238 C C     . ALA F 3 7   ? -47.577  -68.347 -25.139  1.00 125.18 ? 18   ALA F C     1 
ATOM 10239 O O     . ALA F 3 7   ? -47.477  -69.022 -26.158  1.00 124.62 ? 18   ALA F O     1 
ATOM 10240 C CB    . ALA F 3 7   ? -49.374  -67.854 -23.441  1.00 126.69 ? 18   ALA F CB    1 
ATOM 10241 N N     . VAL F 3 8   ? -46.995  -67.165 -24.976  1.00 123.73 ? 19   VAL F N     1 
ATOM 10242 C CA    . VAL F 3 8   ? -46.210  -66.531 -26.022  1.00 122.36 ? 19   VAL F CA    1 
ATOM 10243 C C     . VAL F 3 8   ? -44.824  -67.135 -26.155  1.00 121.63 ? 19   VAL F C     1 
ATOM 10244 O O     . VAL F 3 8   ? -44.287  -67.230 -27.256  1.00 121.40 ? 19   VAL F O     1 
ATOM 10245 C CB    . VAL F 3 8   ? -46.054  -65.013 -25.794  1.00 122.06 ? 19   VAL F CB    1 
ATOM 10246 C CG1   . VAL F 3 8   ? -47.289  -64.281 -26.238  1.00 121.47 ? 19   VAL F CG1   1 
ATOM 10247 C CG2   . VAL F 3 8   ? -45.745  -64.714 -24.343  1.00 122.29 ? 19   VAL F CG2   1 
ATOM 10248 N N     . MET F 3 9   ? -44.232  -67.522 -25.037  1.00 120.89 ? 20   MET F N     1 
ATOM 10249 C CA    . MET F 3 9   ? -42.859  -67.961 -25.078  1.00 120.37 ? 20   MET F CA    1 
ATOM 10250 C C     . MET F 3 9   ? -42.752  -69.211 -25.930  1.00 119.45 ? 20   MET F C     1 
ATOM 10251 O O     . MET F 3 9   ? -41.831  -69.327 -26.739  1.00 119.57 ? 20   MET F O     1 
ATOM 10252 C CB    . MET F 3 9   ? -42.301  -68.204 -23.684  1.00 120.81 ? 20   MET F CB    1 
ATOM 10253 C CG    . MET F 3 9   ? -40.823  -67.926 -23.586  1.00 122.36 ? 20   MET F CG    1 
ATOM 10254 S SD    . MET F 3 9   ? -40.579  -66.162 -23.772  1.00 126.15 ? 20   MET F SD    1 
ATOM 10255 C CE    . MET F 3 9   ? -38.961  -65.927 -23.005  1.00 126.26 ? 20   MET F CE    1 
ATOM 10256 N N     . GLU F 3 10  ? -43.702  -70.132 -25.770  1.00 118.08 ? 21   GLU F N     1 
ATOM 10257 C CA    . GLU F 3 10  ? -43.711  -71.335 -26.596  1.00 116.70 ? 21   GLU F CA    1 
ATOM 10258 C C     . GLU F 3 10  ? -43.988  -71.015 -28.048  1.00 115.57 ? 21   GLU F C     1 
ATOM 10259 O O     . GLU F 3 10  ? -43.527  -71.721 -28.942  1.00 115.52 ? 21   GLU F O     1 
ATOM 10260 C CB    . GLU F 3 10  ? -44.662  -72.406 -26.071  1.00 116.67 ? 21   GLU F CB    1 
ATOM 10261 C CG    . GLU F 3 10  ? -43.918  -73.572 -25.444  1.00 117.60 ? 21   GLU F CG    1 
ATOM 10262 C CD    . GLU F 3 10  ? -42.833  -74.156 -26.380  1.00 119.52 ? 21   GLU F CD    1 
ATOM 10263 O OE1   . GLU F 3 10  ? -43.168  -74.640 -27.493  1.00 119.98 ? 21   GLU F OE1   1 
ATOM 10264 O OE2   . GLU F 3 10  ? -41.635  -74.135 -26.003  1.00 120.17 ? 21   GLU F OE2   1 
ATOM 10265 N N     . ARG F 3 11  ? -44.711  -69.927 -28.281  1.00 114.16 ? 22   ARG F N     1 
ATOM 10266 C CA    . ARG F 3 11  ? -44.962  -69.471 -29.645  1.00 112.61 ? 22   ARG F CA    1 
ATOM 10267 C C     . ARG F 3 11  ? -43.719  -68.852 -30.267  1.00 111.19 ? 22   ARG F C     1 
ATOM 10268 O O     . ARG F 3 11  ? -43.408  -69.139 -31.420  1.00 111.06 ? 22   ARG F O     1 
ATOM 10269 C CB    . ARG F 3 11  ? -46.140  -68.490 -29.692  1.00 112.84 ? 22   ARG F CB    1 
ATOM 10270 C CG    . ARG F 3 11  ? -46.632  -68.160 -31.097  1.00 112.35 ? 22   ARG F CG    1 
ATOM 10271 C CD    . ARG F 3 11  ? -48.098  -67.725 -31.088  1.00 111.99 ? 22   ARG F CD    1 
ATOM 10272 N NE    . ARG F 3 11  ? -48.476  -67.156 -32.376  1.00 111.45 ? 22   ARG F NE    1 
ATOM 10273 C CZ    . ARG F 3 11  ? -48.107  -65.945 -32.775  1.00 110.56 ? 22   ARG F CZ    1 
ATOM 10274 N NH1   . ARG F 3 11  ? -47.360  -65.192 -31.969  1.00 110.25 ? 22   ARG F NH1   1 
ATOM 10275 N NH2   . ARG F 3 11  ? -48.477  -65.487 -33.970  1.00 108.80 ? 22   ARG F NH2   1 
ATOM 10276 N N     . LEU F 3 12  ? -43.030  -68.007 -29.498  1.00 109.35 ? 23   LEU F N     1 
ATOM 10277 C CA    . LEU F 3 12  ? -41.799  -67.354 -29.937  1.00 107.54 ? 23   LEU F CA    1 
ATOM 10278 C C     . LEU F 3 12  ? -40.627  -68.338 -30.125  1.00 106.88 ? 23   LEU F C     1 
ATOM 10279 O O     . LEU F 3 12  ? -39.916  -68.269 -31.126  1.00 106.80 ? 23   LEU F O     1 
ATOM 10280 C CB    . LEU F 3 12  ? -41.430  -66.215 -28.988  1.00 106.94 ? 23   LEU F CB    1 
ATOM 10281 C CG    . LEU F 3 12  ? -39.978  -65.739 -28.964  1.00 105.29 ? 23   LEU F CG    1 
ATOM 10282 C CD1   . LEU F 3 12  ? -39.598  -64.975 -30.217  1.00 103.12 ? 23   LEU F CD1   1 
ATOM 10283 C CD2   . LEU F 3 12  ? -39.765  -64.881 -27.746  1.00 104.46 ? 23   LEU F CD2   1 
ATOM 10284 N N     . ARG F 3 13  ? -40.431  -69.250 -29.175  1.00 105.89 ? 24   ARG F N     1 
ATOM 10285 C CA    . ARG F 3 13  ? -39.464  -70.337 -29.348  1.00 105.07 ? 24   ARG F CA    1 
ATOM 10286 C C     . ARG F 3 13  ? -39.713  -71.050 -30.681  1.00 103.90 ? 24   ARG F C     1 
ATOM 10287 O O     . ARG F 3 13  ? -38.778  -71.419 -31.393  1.00 103.94 ? 24   ARG F O     1 
ATOM 10288 C CB    . ARG F 3 13  ? -39.564  -71.367 -28.205  1.00 105.47 ? 24   ARG F CB    1 
ATOM 10289 C CG    . ARG F 3 13  ? -39.020  -70.928 -26.854  1.00 107.14 ? 24   ARG F CG    1 
ATOM 10290 C CD    . ARG F 3 13  ? -39.084  -72.049 -25.829  1.00 110.02 ? 24   ARG F CD    1 
ATOM 10291 N NE    . ARG F 3 13  ? -39.115  -71.526 -24.458  1.00 113.94 ? 24   ARG F NE    1 
ATOM 10292 C CZ    . ARG F 3 13  ? -40.073  -71.776 -23.553  1.00 116.17 ? 24   ARG F CZ    1 
ATOM 10293 N NH1   . ARG F 3 13  ? -41.108  -72.566 -23.848  1.00 117.18 ? 24   ARG F NH1   1 
ATOM 10294 N NH2   . ARG F 3 13  ? -39.999  -71.237 -22.331  1.00 116.52 ? 24   ARG F NH2   1 
ATOM 10295 N N     . ARG F 3 14  ? -40.986  -71.243 -31.006  1.00 102.18 ? 25   ARG F N     1 
ATOM 10296 C CA    . ARG F 3 14  ? -41.364  -71.996 -32.179  1.00 100.37 ? 25   ARG F CA    1 
ATOM 10297 C C     . ARG F 3 14  ? -41.076  -71.212 -33.454  1.00 98.35  ? 25   ARG F C     1 
ATOM 10298 O O     . ARG F 3 14  ? -40.643  -71.807 -34.440  1.00 98.29  ? 25   ARG F O     1 
ATOM 10299 C CB    . ARG F 3 14  ? -42.831  -72.434 -32.082  1.00 100.96 ? 25   ARG F CB    1 
ATOM 10300 C CG    . ARG F 3 14  ? -43.365  -73.231 -33.291  1.00 103.55 ? 25   ARG F CG    1 
ATOM 10301 C CD    . ARG F 3 14  ? -44.665  -74.025 -32.985  1.00 107.37 ? 25   ARG F CD    1 
ATOM 10302 N NE    . ARG F 3 14  ? -45.378  -73.560 -31.792  1.00 108.85 ? 25   ARG F NE    1 
ATOM 10303 C CZ    . ARG F 3 14  ? -45.461  -74.239 -30.645  1.00 109.99 ? 25   ARG F CZ    1 
ATOM 10304 N NH1   . ARG F 3 14  ? -44.896  -75.448 -30.513  1.00 107.88 ? 25   ARG F NH1   1 
ATOM 10305 N NH2   . ARG F 3 14  ? -46.126  -73.702 -29.623  1.00 111.01 ? 25   ARG F NH2   1 
ATOM 10306 N N     . ARG F 3 15  ? -41.304  -69.892 -33.425  1.00 95.84  ? 26   ARG F N     1 
ATOM 10307 C CA    . ARG F 3 15  ? -41.091  -69.033 -34.595  1.00 93.16  ? 26   ARG F CA    1 
ATOM 10308 C C     . ARG F 3 15  ? -39.626  -69.043 -34.919  1.00 92.00  ? 26   ARG F C     1 
ATOM 10309 O O     . ARG F 3 15  ? -39.214  -69.517 -35.989  1.00 91.76  ? 26   ARG F O     1 
ATOM 10310 C CB    . ARG F 3 15  ? -41.524  -67.584 -34.357  1.00 92.77  ? 26   ARG F CB    1 
ATOM 10311 C CG    . ARG F 3 15  ? -41.130  -66.675 -35.524  1.00 91.00  ? 26   ARG F CG    1 
ATOM 10312 C CD    . ARG F 3 15  ? -41.903  -65.379 -35.604  1.00 89.31  ? 26   ARG F CD    1 
ATOM 10313 N NE    . ARG F 3 15  ? -41.125  -64.248 -35.115  1.00 88.48  ? 26   ARG F NE    1 
ATOM 10314 C CZ    . ARG F 3 15  ? -41.286  -63.664 -33.926  1.00 87.87  ? 26   ARG F CZ    1 
ATOM 10315 N NH1   . ARG F 3 15  ? -42.220  -64.084 -33.082  1.00 86.72  ? 26   ARG F NH1   1 
ATOM 10316 N NH2   . ARG F 3 15  ? -40.509  -62.642 -33.580  1.00 87.80  ? 26   ARG F NH2   1 
ATOM 10317 N N     . ILE F 3 16  ? -38.847  -68.517 -33.969  1.00 90.28  ? 27   ILE F N     1 
ATOM 10318 C CA    . ILE F 3 16  ? -37.383  -68.449 -34.048  1.00 87.93  ? 27   ILE F CA    1 
ATOM 10319 C C     . ILE F 3 16  ? -36.755  -69.764 -34.567  1.00 87.07  ? 27   ILE F C     1 
ATOM 10320 O O     . ILE F 3 16  ? -35.950  -69.755 -35.505  1.00 87.15  ? 27   ILE F O     1 
ATOM 10321 C CB    . ILE F 3 16  ? -36.813  -67.961 -32.724  1.00 87.08  ? 27   ILE F CB    1 
ATOM 10322 C CG1   . ILE F 3 16  ? -36.773  -66.452 -32.769  1.00 86.37  ? 27   ILE F CG1   1 
ATOM 10323 C CG2   . ILE F 3 16  ? -35.454  -68.511 -32.483  1.00 86.57  ? 27   ILE F CG2   1 
ATOM 10324 C CD1   . ILE F 3 16  ? -36.238  -65.822 -31.505  1.00 88.62  ? 27   ILE F CD1   1 
ATOM 10325 N N     . GLU F 3 17  ? -37.173  -70.889 -34.002  1.00 85.56  ? 28   GLU F N     1 
ATOM 10326 C CA    . GLU F 3 17  ? -36.758  -72.170 -34.510  1.00 84.11  ? 28   GLU F CA    1 
ATOM 10327 C C     . GLU F 3 17  ? -36.971  -72.263 -36.018  1.00 83.74  ? 28   GLU F C     1 
ATOM 10328 O O     . GLU F 3 17  ? -36.138  -72.836 -36.706  1.00 83.94  ? 28   GLU F O     1 
ATOM 10329 C CB    . GLU F 3 17  ? -37.499  -73.303 -33.796  1.00 83.95  ? 28   GLU F CB    1 
ATOM 10330 C CG    . GLU F 3 17  ? -37.265  -74.684 -34.405  1.00 82.62  ? 28   GLU F CG    1 
ATOM 10331 C CD    . GLU F 3 17  ? -35.800  -75.072 -34.394  1.00 80.78  ? 28   GLU F CD    1 
ATOM 10332 O OE1   . GLU F 3 17  ? -35.031  -74.327 -33.750  1.00 80.43  ? 28   GLU F OE1   1 
ATOM 10333 O OE2   . GLU F 3 17  ? -35.427  -76.110 -35.007  1.00 78.90  ? 28   GLU F OE2   1 
ATOM 10334 N N     . LEU F 3 18  ? -38.068  -71.708 -36.537  1.00 83.05  ? 29   LEU F N     1 
ATOM 10335 C CA    . LEU F 3 18  ? -38.389  -71.906 -37.953  1.00 82.24  ? 29   LEU F CA    1 
ATOM 10336 C C     . LEU F 3 18  ? -37.327  -71.238 -38.820  1.00 81.95  ? 29   LEU F C     1 
ATOM 10337 O O     . LEU F 3 18  ? -36.752  -71.878 -39.721  1.00 81.14  ? 29   LEU F O     1 
ATOM 10338 C CB    . LEU F 3 18  ? -39.788  -71.391 -38.311  1.00 81.91  ? 29   LEU F CB    1 
ATOM 10339 C CG    . LEU F 3 18  ? -40.674  -72.369 -39.091  1.00 80.70  ? 29   LEU F CG    1 
ATOM 10340 C CD1   . LEU F 3 18  ? -41.406  -71.636 -40.157  1.00 78.92  ? 29   LEU F CD1   1 
ATOM 10341 C CD2   . LEU F 3 18  ? -39.897  -73.548 -39.716  1.00 81.59  ? 29   LEU F CD2   1 
ATOM 10342 N N     . CYS F 3 19  ? -37.069  -69.963 -38.518  1.00 81.63  ? 30   CYS F N     1 
ATOM 10343 C CA    . CYS F 3 19  ? -35.987  -69.203 -39.137  1.00 81.97  ? 30   CYS F CA    1 
ATOM 10344 C C     . CYS F 3 19  ? -34.645  -69.918 -38.958  1.00 81.88  ? 30   CYS F C     1 
ATOM 10345 O O     . CYS F 3 19  ? -33.934  -70.212 -39.938  1.00 82.03  ? 30   CYS F O     1 
ATOM 10346 C CB    . CYS F 3 19  ? -35.871  -67.834 -38.488  1.00 82.07  ? 30   CYS F CB    1 
ATOM 10347 S SG    . CYS F 3 19  ? -37.401  -67.132 -37.886  1.00 82.57  ? 30   CYS F SG    1 
ATOM 10348 N N     . ARG F 3 20  ? -34.315  -70.181 -37.694  1.00 81.32  ? 31   ARG F N     1 
ATOM 10349 C CA    . ARG F 3 20  ? -33.143  -70.948 -37.326  1.00 80.74  ? 31   ARG F CA    1 
ATOM 10350 C C     . ARG F 3 20  ? -33.043  -72.164 -38.204  1.00 80.26  ? 31   ARG F C     1 
ATOM 10351 O O     . ARG F 3 20  ? -32.098  -72.277 -38.969  1.00 80.88  ? 31   ARG F O     1 
ATOM 10352 C CB    . ARG F 3 20  ? -33.216  -71.373 -35.871  1.00 80.89  ? 31   ARG F CB    1 
ATOM 10353 C CG    . ARG F 3 20  ? -31.964  -71.076 -35.103  1.00 81.82  ? 31   ARG F CG    1 
ATOM 10354 C CD    . ARG F 3 20  ? -32.142  -69.951 -34.129  1.00 81.17  ? 31   ARG F CD    1 
ATOM 10355 N NE    . ARG F 3 20  ? -32.260  -70.513 -32.809  1.00 83.31  ? 31   ARG F NE    1 
ATOM 10356 C CZ    . ARG F 3 20  ? -32.100  -69.837 -31.676  1.00 86.97  ? 31   ARG F CZ    1 
ATOM 10357 N NH1   . ARG F 3 20  ? -31.811  -68.536 -31.687  1.00 85.84  ? 31   ARG F NH1   1 
ATOM 10358 N NH2   . ARG F 3 20  ? -32.237  -70.472 -30.508  1.00 89.80  ? 31   ARG F NH2   1 
ATOM 10359 N N     . ARG F 3 21  ? -34.031  -73.053 -38.142  1.00 79.54  ? 32   ARG F N     1 
ATOM 10360 C CA    . ARG F 3 21  ? -33.980  -74.274 -38.944  1.00 78.80  ? 32   ARG F CA    1 
ATOM 10361 C C     . ARG F 3 21  ? -33.808  -73.973 -40.408  1.00 78.57  ? 32   ARG F C     1 
ATOM 10362 O O     . ARG F 3 21  ? -33.058  -74.668 -41.072  1.00 78.35  ? 32   ARG F O     1 
ATOM 10363 C CB    . ARG F 3 21  ? -35.219  -75.145 -38.764  1.00 78.64  ? 32   ARG F CB    1 
ATOM 10364 C CG    . ARG F 3 21  ? -35.017  -76.593 -39.202  1.00 77.06  ? 32   ARG F CG    1 
ATOM 10365 C CD    . ARG F 3 21  ? -34.927  -76.813 -40.692  1.00 74.47  ? 32   ARG F CD    1 
ATOM 10366 N NE    . ARG F 3 21  ? -35.048  -78.231 -41.010  1.00 75.55  ? 32   ARG F NE    1 
ATOM 10367 C CZ    . ARG F 3 21  ? -34.026  -79.084 -41.119  1.00 74.50  ? 32   ARG F CZ    1 
ATOM 10368 N NH1   . ARG F 3 21  ? -32.786  -78.666 -40.939  1.00 74.12  ? 32   ARG F NH1   1 
ATOM 10