data_3NBV
# 
_entry.id   3NBV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NBV         
RCSB  RCSB059634   
WWPDB D_1000059634 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3NBW 'same protein complexed with a pyrazole compound'         unspecified 
PDB 3NC2 'same protein complexed with a quinozaline'               unspecified 
PDB 3NC9 'same protein complexed with a indazole compound'         unspecified 
PDB 3NCA 'same protein complexed with a thieno pyridinol compound' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3NBV 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Abad, M.C.'  1 
'Gibbs, A.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Electron density guided fragment-based lead discovery of ketohexokinase inhibitors.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            53 
_citation.page_first                7979 
_citation.page_last                 7991 
_citation.year                      2010 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21033679 
_citation.pdbx_database_id_DOI      10.1021/jm100677s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gibbs, A.C.'       1 ? 
primary 'Abad, M.C.'        2 ? 
primary 'Zhang, X.'         3 ? 
primary 'Tounge, B.A.'      4 ? 
primary 'Lewandowski, F.A.' 5 ? 
primary 'Struble, G.T.'     6 ? 
primary 'Sun, W.'           7 ? 
primary 'Sui, Z.'           8 ? 
primary 'Kuo, L.C.'         9 ? 
# 
_cell.entry_id           3NBV 
_cell.length_a           82.845 
_cell.length_b           86.035 
_cell.length_c           136.961 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NBV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Ketohexokinase                                34076.586 2   2.7.1.3 ? ? ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   2   ?       ? ? ? 
3 non-polymer man beta-D-fructofuranose                         180.156   1   ?       ? ? ? 
4 non-polymer syn 'SULFATE ION'                                 96.063    1   ?       ? ? ? 
5 water       nat water                                         18.015    120 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Hepatic fructokinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAP
GHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEGRNASE
QVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAW
AEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAP
GHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEGRNASE
QVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAW
AEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  GLN n 
1 21  ILE n 
1 22  LEU n 
1 23  CYS n 
1 24  VAL n 
1 25  GLY n 
1 26  LEU n 
1 27  VAL n 
1 28  VAL n 
1 29  LEU n 
1 30  ASP n 
1 31  VAL n 
1 32  ILE n 
1 33  SER n 
1 34  LEU n 
1 35  VAL n 
1 36  ASP n 
1 37  LYS n 
1 38  TYR n 
1 39  PRO n 
1 40  LYS n 
1 41  GLU n 
1 42  ASP n 
1 43  SER n 
1 44  GLU n 
1 45  ILE n 
1 46  ARG n 
1 47  CYS n 
1 48  LEU n 
1 49  SER n 
1 50  GLN n 
1 51  ARG n 
1 52  TRP n 
1 53  GLN n 
1 54  ARG n 
1 55  GLY n 
1 56  GLY n 
1 57  ASN n 
1 58  ALA n 
1 59  SER n 
1 60  ASN n 
1 61  SER n 
1 62  CYS n 
1 63  THR n 
1 64  VAL n 
1 65  LEU n 
1 66  SER n 
1 67  LEU n 
1 68  LEU n 
1 69  GLY n 
1 70  ALA n 
1 71  PRO n 
1 72  CYS n 
1 73  ALA n 
1 74  PHE n 
1 75  MET n 
1 76  GLY n 
1 77  SER n 
1 78  MET n 
1 79  ALA n 
1 80  PRO n 
1 81  GLY n 
1 82  HIS n 
1 83  VAL n 
1 84  ALA n 
1 85  ASP n 
1 86  PHE n 
1 87  LEU n 
1 88  VAL n 
1 89  ALA n 
1 90  ASP n 
1 91  PHE n 
1 92  ARG n 
1 93  ARG n 
1 94  ARG n 
1 95  GLY n 
1 96  VAL n 
1 97  ASP n 
1 98  VAL n 
1 99  SER n 
1 100 GLN n 
1 101 VAL n 
1 102 ALA n 
1 103 TRP n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 GLY n 
1 108 ASP n 
1 109 THR n 
1 110 PRO n 
1 111 SER n 
1 112 SER n 
1 113 CYS n 
1 114 CYS n 
1 115 ILE n 
1 116 ILE n 
1 117 ASN n 
1 118 ASN n 
1 119 SER n 
1 120 ASN n 
1 121 GLY n 
1 122 ASN n 
1 123 ARG n 
1 124 THR n 
1 125 ILE n 
1 126 VAL n 
1 127 LEU n 
1 128 HIS n 
1 129 ASP n 
1 130 THR n 
1 131 SER n 
1 132 LEU n 
1 133 PRO n 
1 134 ASP n 
1 135 VAL n 
1 136 SER n 
1 137 ALA n 
1 138 THR n 
1 139 ASP n 
1 140 PHE n 
1 141 GLU n 
1 142 LYS n 
1 143 VAL n 
1 144 ASP n 
1 145 LEU n 
1 146 THR n 
1 147 GLN n 
1 148 PHE n 
1 149 LYS n 
1 150 TRP n 
1 151 ILE n 
1 152 HIS n 
1 153 ILE n 
1 154 GLU n 
1 155 GLY n 
1 156 ARG n 
1 157 ASN n 
1 158 ALA n 
1 159 SER n 
1 160 GLU n 
1 161 GLN n 
1 162 VAL n 
1 163 LYS n 
1 164 MET n 
1 165 LEU n 
1 166 GLN n 
1 167 ARG n 
1 168 ILE n 
1 169 ASP n 
1 170 ALA n 
1 171 HIS n 
1 172 ASN n 
1 173 THR n 
1 174 ARG n 
1 175 GLN n 
1 176 PRO n 
1 177 PRO n 
1 178 GLU n 
1 179 GLN n 
1 180 LYS n 
1 181 ILE n 
1 182 ARG n 
1 183 VAL n 
1 184 SER n 
1 185 VAL n 
1 186 GLU n 
1 187 VAL n 
1 188 GLU n 
1 189 LYS n 
1 190 PRO n 
1 191 ARG n 
1 192 GLU n 
1 193 GLU n 
1 194 LEU n 
1 195 PHE n 
1 196 GLN n 
1 197 LEU n 
1 198 PHE n 
1 199 GLY n 
1 200 TYR n 
1 201 GLY n 
1 202 ASP n 
1 203 VAL n 
1 204 VAL n 
1 205 PHE n 
1 206 VAL n 
1 207 SER n 
1 208 LYS n 
1 209 ASP n 
1 210 VAL n 
1 211 ALA n 
1 212 LYS n 
1 213 HIS n 
1 214 LEU n 
1 215 GLY n 
1 216 PHE n 
1 217 GLN n 
1 218 SER n 
1 219 ALA n 
1 220 GLU n 
1 221 GLU n 
1 222 ALA n 
1 223 LEU n 
1 224 ARG n 
1 225 GLY n 
1 226 LEU n 
1 227 TYR n 
1 228 GLY n 
1 229 ARG n 
1 230 VAL n 
1 231 ARG n 
1 232 LYS n 
1 233 GLY n 
1 234 ALA n 
1 235 VAL n 
1 236 LEU n 
1 237 VAL n 
1 238 CYS n 
1 239 ALA n 
1 240 TRP n 
1 241 ALA n 
1 242 GLU n 
1 243 GLU n 
1 244 GLY n 
1 245 ALA n 
1 246 ASP n 
1 247 ALA n 
1 248 LEU n 
1 249 GLY n 
1 250 PRO n 
1 251 ASP n 
1 252 GLY n 
1 253 LYS n 
1 254 LEU n 
1 255 LEU n 
1 256 HIS n 
1 257 SER n 
1 258 ASP n 
1 259 ALA n 
1 260 PHE n 
1 261 PRO n 
1 262 PRO n 
1 263 PRO n 
1 264 ARG n 
1 265 VAL n 
1 266 VAL n 
1 267 ASP n 
1 268 THR n 
1 269 LEU n 
1 270 GLY n 
1 271 ALA n 
1 272 GLY n 
1 273 ASP n 
1 274 THR n 
1 275 PHE n 
1 276 ASN n 
1 277 ALA n 
1 278 SER n 
1 279 VAL n 
1 280 ILE n 
1 281 PHE n 
1 282 SER n 
1 283 LEU n 
1 284 SER n 
1 285 GLN n 
1 286 GLY n 
1 287 ARG n 
1 288 SER n 
1 289 VAL n 
1 290 GLN n 
1 291 GLU n 
1 292 ALA n 
1 293 LEU n 
1 294 ARG n 
1 295 PHE n 
1 296 GLY n 
1 297 CYS n 
1 298 GLN n 
1 299 VAL n 
1 300 ALA n 
1 301 GLY n 
1 302 LYS n 
1 303 LYS n 
1 304 CYS n 
1 305 GLY n 
1 306 LEU n 
1 307 GLN n 
1 308 GLY n 
1 309 PHE n 
1 310 ASP n 
1 311 GLY n 
1 312 ILE n 
1 313 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 KHK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28s 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KHK_HUMAN 
_struct_ref.pdbx_db_accession          P50053-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFLVADFRRRGVDVS
QVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQ
KIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDA
FPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NBV A 20 ? 313 ? P50053-2 5 ? 298 ? 5 298 
2 1 3NBV B 20 ? 313 ? P50053-2 5 ? 298 ? 5 298 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NBV MET A 1  ? UNP P50053-2 ? ? 'expression tag' -14 1  
1 3NBV GLY A 2  ? UNP P50053-2 ? ? 'expression tag' -13 2  
1 3NBV SER A 3  ? UNP P50053-2 ? ? 'expression tag' -12 3  
1 3NBV SER A 4  ? UNP P50053-2 ? ? 'expression tag' -11 4  
1 3NBV HIS A 5  ? UNP P50053-2 ? ? 'expression tag' -10 5  
1 3NBV HIS A 6  ? UNP P50053-2 ? ? 'expression tag' -9  6  
1 3NBV HIS A 7  ? UNP P50053-2 ? ? 'expression tag' -8  7  
1 3NBV HIS A 8  ? UNP P50053-2 ? ? 'expression tag' -7  8  
1 3NBV HIS A 9  ? UNP P50053-2 ? ? 'expression tag' -6  9  
1 3NBV HIS A 10 ? UNP P50053-2 ? ? 'expression tag' -5  10 
1 3NBV SER A 11 ? UNP P50053-2 ? ? 'expression tag' -4  11 
1 3NBV SER A 12 ? UNP P50053-2 ? ? 'expression tag' -3  12 
1 3NBV GLY A 13 ? UNP P50053-2 ? ? 'expression tag' -2  13 
1 3NBV LEU A 14 ? UNP P50053-2 ? ? 'expression tag' -1  14 
1 3NBV VAL A 15 ? UNP P50053-2 ? ? 'expression tag' 0   15 
1 3NBV PRO A 16 ? UNP P50053-2 ? ? 'expression tag' 1   16 
1 3NBV ARG A 17 ? UNP P50053-2 ? ? 'expression tag' 2   17 
1 3NBV GLY A 18 ? UNP P50053-2 ? ? 'expression tag' 3   18 
1 3NBV SER A 19 ? UNP P50053-2 ? ? 'expression tag' 4   19 
2 3NBV MET B 1  ? UNP P50053-2 ? ? 'expression tag' -14 20 
2 3NBV GLY B 2  ? UNP P50053-2 ? ? 'expression tag' -13 21 
2 3NBV SER B 3  ? UNP P50053-2 ? ? 'expression tag' -12 22 
2 3NBV SER B 4  ? UNP P50053-2 ? ? 'expression tag' -11 23 
2 3NBV HIS B 5  ? UNP P50053-2 ? ? 'expression tag' -10 24 
2 3NBV HIS B 6  ? UNP P50053-2 ? ? 'expression tag' -9  25 
2 3NBV HIS B 7  ? UNP P50053-2 ? ? 'expression tag' -8  26 
2 3NBV HIS B 8  ? UNP P50053-2 ? ? 'expression tag' -7  27 
2 3NBV HIS B 9  ? UNP P50053-2 ? ? 'expression tag' -6  28 
2 3NBV HIS B 10 ? UNP P50053-2 ? ? 'expression tag' -5  29 
2 3NBV SER B 11 ? UNP P50053-2 ? ? 'expression tag' -4  30 
2 3NBV SER B 12 ? UNP P50053-2 ? ? 'expression tag' -3  31 
2 3NBV GLY B 13 B UNP P50053-2 ? ? 'expression tag' -2  32 
2 3NBV LEU B 14 A UNP P50053-2 ? ? 'expression tag' -1  33 
2 3NBV VAL B 15 ? UNP P50053-2 ? ? 'expression tag' 0   34 
2 3NBV PRO B 16 ? UNP P50053-2 ? ? 'expression tag' 1   35 
2 3NBV ARG B 17 ? UNP P50053-2 ? ? 'expression tag' 2   36 
2 3NBV GLY B 18 ? UNP P50053-2 ? ? 'expression tag' 3   37 
2 3NBV SER B 19 ? UNP P50053-2 ? ? 'expression tag' 4   38 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer                  . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking'          y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'          y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
FRU 'D-saccharide, beta linking' . beta-D-fructofuranose                         ? 'C6 H12 O6'         180.156 
GLN 'L-peptide linking'          y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'            y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'          y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                  . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'          y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'          y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'          y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'          y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'          y SERINE                                        ? 'C3 H7 N O3'        105.093 
SO4 non-polymer                  . 'SULFATE ION'                                 ? 'O4 S -2'           96.063  
THR 'L-peptide linking'          y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'          y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'          y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3NBV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.58 
_exptl_crystal.density_percent_sol   65.65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
'17% PEG 8k, 0.1M Na-Citrate, 0.2M Ammonium sulfate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-04-05 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal mono, Si(111) from Accel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     3NBV 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   49441 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.071 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        18.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.meanI_over_sigI_obs    2.85 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4843 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3NBV 
_refine.ls_number_reflns_obs                     43397 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.041 
_refine.ls_d_res_high                            2.300 
_refine.ls_percent_reflns_obs                    98.22 
_refine.ls_R_factor_obs                          0.2073 
_refine.ls_R_factor_R_work                       0.2060 
_refine.ls_R_factor_R_free                       0.2366 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.04 
_refine.ls_number_reflns_R_free                  1754 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.5427 
_refine.aniso_B[2][2]                            9.1730 
_refine.aniso_B[3][3]                            -4.6303 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.400 
_refine.solvent_model_param_bsol                 62.236 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2HLZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.32 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4555 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         79 
_refine_hist.number_atoms_solvent             120 
_refine_hist.number_atoms_total               4754 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        41.041 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 4722 'X-RAY DIFFRACTION' ? 
f_angle_d          1.096  ? ? 6406 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.483 ? ? 1794 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.067  ? ? 710  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 835  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.3000 2.3622  3128 0.2617 98.00  0.3218 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.3622 2.4317  3167 0.2560 98.00  0.3001 . . 123 . . . . 'X-RAY DIFFRACTION' 
. 2.4317 2.5102  3174 0.2470 99.00  0.3246 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 2.5102 2.5999  3184 0.2370 99.00  0.2779 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 2.5999 2.7040  3161 0.2272 99.00  0.2420 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 2.7040 2.8270  3209 0.2175 99.00  0.2550 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 2.8270 2.9760  3211 0.2233 99.00  0.3267 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 2.9760 3.1624  3204 0.2245 99.00  0.2550 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 3.1624 3.4064  3251 0.2094 100.00 0.2307 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 3.4064 3.7490  3262 0.1842 100.00 0.2057 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.7490 4.2910  3276 0.1779 100.00 0.1972 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 4.2910 5.4043  3304 0.1650 99.00  0.1867 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 5.4043 41.0473 3112 0.2120 90.00  0.2509 . . 129 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3NBV 
_struct.title                     'X-ray Structure of Ketohexokinase in complex with AMP-PNP and fructose' 
_struct.pdbx_descriptor           'Ketohexokinase (E.C.2.7.1.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NBV 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'ketohexokinase, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 56  ? GLY A 69  ? GLY A 41  GLY A 54  1 ? 14 
HELX_P HELX_P2  2  GLY A 81  ? ARG A 94  ? GLY A 66  ARG A 79  1 ? 14 
HELX_P HELX_P3  3  SER A 136 ? GLU A 141 ? SER A 121 GLU A 126 1 ? 6  
HELX_P HELX_P4  4  LYS A 142 ? VAL A 143 ? LYS A 127 VAL A 128 5 ? 2  
HELX_P HELX_P5  5  ASP A 144 ? THR A 146 ? ASP A 129 THR A 131 5 ? 3  
HELX_P HELX_P6  6  ASN A 157 ? THR A 173 ? ASN A 142 THR A 158 1 ? 17 
HELX_P HELX_P7  7  ARG A 174 ? GLN A 175 ? ARG A 159 GLN A 160 5 ? 2  
HELX_P HELX_P8  8  PRO A 176 ? LYS A 180 ? PRO A 161 LYS A 165 5 ? 5  
HELX_P HELX_P9  9  ARG A 191 ? TYR A 200 ? ARG A 176 TYR A 185 5 ? 10 
HELX_P HELX_P10 10 SER A 207 ? LEU A 214 ? SER A 192 LEU A 199 1 ? 8  
HELX_P HELX_P11 11 SER A 218 ? TYR A 227 ? SER A 203 TYR A 212 1 ? 10 
HELX_P HELX_P12 12 GLY A 228 ? VAL A 230 ? GLY A 213 VAL A 215 5 ? 3  
HELX_P HELX_P13 13 ALA A 241 ? GLU A 243 ? ALA A 226 GLU A 228 5 ? 3  
HELX_P HELX_P14 14 GLY A 270 ? GLN A 285 ? GLY A 255 GLN A 270 1 ? 16 
HELX_P HELX_P15 15 SER A 288 ? GLY A 305 ? SER A 273 GLY A 290 1 ? 18 
HELX_P HELX_P16 16 GLY B 56  ? GLY B 69  ? GLY B 41  GLY B 54  1 ? 14 
HELX_P HELX_P17 17 GLY B 81  ? ARG B 94  ? GLY B 66  ARG B 79  1 ? 14 
HELX_P HELX_P18 18 SER B 136 ? LYS B 142 ? SER B 121 LYS B 127 1 ? 7  
HELX_P HELX_P19 19 ASN B 157 ? ARG B 174 ? ASN B 142 ARG B 159 1 ? 18 
HELX_P HELX_P20 20 GLN B 175 ? LYS B 180 ? GLN B 160 LYS B 165 5 ? 6  
HELX_P HELX_P21 21 ARG B 191 ? TYR B 200 ? ARG B 176 TYR B 185 5 ? 10 
HELX_P HELX_P22 22 SER B 207 ? LEU B 214 ? SER B 192 LEU B 199 1 ? 8  
HELX_P HELX_P23 23 SER B 218 ? TYR B 227 ? SER B 203 TYR B 212 1 ? 10 
HELX_P HELX_P24 24 GLY B 228 ? VAL B 230 ? GLY B 213 VAL B 215 5 ? 3  
HELX_P HELX_P25 25 ALA B 241 ? GLU B 243 ? ALA B 226 GLU B 228 5 ? 3  
HELX_P HELX_P26 26 GLY B 270 ? GLN B 285 ? GLY B 255 GLN B 270 1 ? 16 
HELX_P HELX_P27 27 SER B 288 ? GLY B 305 ? SER B 273 GLY B 290 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 5 ? 
C ? 5 ? 
D ? 2 ? 
E ? 8 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
E 7 8 ? anti-parallel 
F 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 72  ? MET A 75  ? CYS A 57  MET A 60  
A 2 GLN A 20  ? VAL A 24  ? GLN A 5   VAL A 9   
A 3 PHE A 148 ? GLU A 154 ? PHE A 133 GLU A 139 
A 4 ARG A 182 ? VAL A 187 ? ARG A 167 VAL A 172 
A 5 VAL A 203 ? VAL A 206 ? VAL A 188 VAL A 191 
A 6 VAL A 235 ? ALA A 239 ? VAL A 220 ALA A 224 
A 7 ALA A 245 ? LEU A 248 ? ALA A 230 LEU A 233 
A 8 LEU A 254 ? SER A 257 ? LEU A 239 SER A 242 
B 1 SER A 49  ? GLY A 55  ? SER A 34  GLY A 40  
B 2 VAL A 28  ? VAL A 35  ? VAL A 13  VAL A 20  
B 3 SER A 111 ? ASN A 117 ? SER A 96  ASN A 102 
B 4 ARG A 123 ? HIS A 128 ? ARG A 108 HIS A 113 
B 5 GLU B 44  ? ARG B 46  ? GLU B 29  ARG B 31  
C 1 GLU A 44  ? ARG A 46  ? GLU A 29  ARG A 31  
C 2 ARG B 123 ? LEU B 127 ? ARG B 108 LEU B 112 
C 3 SER B 111 ? ASN B 117 ? SER B 96  ASN B 102 
C 4 VAL B 28  ? VAL B 35  ? VAL B 13  VAL B 20  
C 5 SER B 49  ? GLY B 55  ? SER B 34  GLY B 40  
D 1 SER A 77  ? MET A 78  ? SER A 62  MET A 63  
D 2 ALA A 102 ? TRP A 103 ? ALA A 87  TRP A 88  
E 1 CYS B 72  ? MET B 75  ? CYS B 57  MET B 60  
E 2 GLN B 20  ? VAL B 24  ? GLN B 5   VAL B 9   
E 3 PHE B 148 ? GLU B 154 ? PHE B 133 GLU B 139 
E 4 ARG B 182 ? VAL B 187 ? ARG B 167 VAL B 172 
E 5 VAL B 203 ? VAL B 206 ? VAL B 188 VAL B 191 
E 6 VAL B 235 ? ALA B 239 ? VAL B 220 ALA B 224 
E 7 ALA B 245 ? LEU B 248 ? ALA B 230 LEU B 233 
E 8 LEU B 254 ? SER B 257 ? LEU B 239 SER B 242 
F 1 SER B 77  ? MET B 78  ? SER B 62  MET B 63  
F 2 ALA B 102 ? TRP B 103 ? ALA B 87  TRP B 88  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 73  ? O ALA A 58  N ILE A 21  ? N ILE A 6   
A 2 3 N LEU A 22  ? N LEU A 7   O HIS A 152 ? O HIS A 137 
A 3 4 N ILE A 153 ? N ILE A 138 O SER A 184 ? O SER A 169 
A 4 5 N VAL A 187 ? N VAL A 172 O PHE A 205 ? O PHE A 190 
A 5 6 N VAL A 204 ? N VAL A 189 O VAL A 237 ? O VAL A 222 
A 6 7 N LEU A 236 ? N LEU A 221 O LEU A 248 ? O LEU A 233 
A 7 8 N ALA A 247 ? N ALA A 232 O LEU A 255 ? O LEU A 240 
B 1 2 O GLY A 55  ? O GLY A 40  N VAL A 28  ? N VAL A 13  
B 2 3 N SER A 33  ? N SER A 18  O ILE A 116 ? O ILE A 101 
B 3 4 N CYS A 113 ? N CYS A 98  O VAL A 126 ? O VAL A 111 
B 4 5 N LEU A 127 ? N LEU A 112 O ILE B 45  ? O ILE B 30  
C 1 2 N ILE A 45  ? N ILE A 30  O LEU B 127 ? O LEU B 112 
C 2 3 O VAL B 126 ? O VAL B 111 N CYS B 113 ? N CYS B 98  
C 3 4 O ILE B 116 ? O ILE B 101 N SER B 33  ? N SER B 18  
C 4 5 N ASP B 30  ? N ASP B 15  O GLN B 53  ? O GLN B 38  
D 1 2 N MET A 78  ? N MET A 63  O ALA A 102 ? O ALA A 87  
E 1 2 O MET B 75  ? O MET B 60  N CYS B 23  ? N CYS B 8   
E 2 3 N LEU B 22  ? N LEU B 7   O HIS B 152 ? O HIS B 137 
E 3 4 N ILE B 151 ? N ILE B 136 O ARG B 182 ? O ARG B 167 
E 4 5 N VAL B 185 ? N VAL B 170 O PHE B 205 ? O PHE B 190 
E 5 6 N VAL B 204 ? N VAL B 189 O VAL B 237 ? O VAL B 222 
E 6 7 N CYS B 238 ? N CYS B 223 O ASP B 246 ? O ASP B 231 
E 7 8 N ALA B 247 ? N ALA B 232 O LEU B 255 ? O LEU B 240 
F 1 2 N MET B 78  ? N MET B 63  O ALA B 102 ? O ALA B 87  
# 
_database_PDB_matrix.entry_id          3NBV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3NBV 
_atom_sites.fract_transf_matrix[1][1]   0.012071 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011623 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007301 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 18  ? 19.753  18.237  6.308   1.00   71.84  ? 3   GLY A N     1 
ATOM   2    C CA    . GLY A 1 18  ? 18.329  17.966  6.188   1.00   77.82  ? 3   GLY A CA    1 
ATOM   3    C C     . GLY A 1 18  ? 17.946  16.598  6.736   1.00   75.98  ? 3   GLY A C     1 
ATOM   4    O O     . GLY A 1 18  ? 17.492  15.727  5.991   1.00   72.83  ? 3   GLY A O     1 
ATOM   5    N N     . SER A 1 19  ? 18.118  16.410  8.043   1.00   71.44  ? 4   SER A N     1 
ATOM   6    C CA    . SER A 1 19  ? 17.945  15.096  8.656   1.00   73.34  ? 4   SER A CA    1 
ATOM   7    C C     . SER A 1 19  ? 17.166  15.128  9.978   1.00   73.29  ? 4   SER A C     1 
ATOM   8    O O     . SER A 1 19  ? 17.457  14.353  10.893  1.00   69.08  ? 4   SER A O     1 
ATOM   9    C CB    . SER A 1 19  ? 19.310  14.449  8.886   1.00   74.52  ? 4   SER A CB    1 
ATOM   10   O OG    . SER A 1 19  ? 20.063  15.203  9.821   1.00   73.54  ? 4   SER A OG    1 
ATOM   11   N N     . GLN A 1 20  ? 16.184  16.020  10.074  1.00   69.15  ? 5   GLN A N     1 
ATOM   12   C CA    . GLN A 1 20  ? 15.314  16.082  11.238  1.00   64.19  ? 5   GLN A CA    1 
ATOM   13   C C     . GLN A 1 20  ? 13.858  15.918  10.823  1.00   66.55  ? 5   GLN A C     1 
ATOM   14   O O     . GLN A 1 20  ? 13.425  16.479  9.818   1.00   68.16  ? 5   GLN A O     1 
ATOM   15   C CB    . GLN A 1 20  ? 15.467  17.419  11.962  1.00   68.16  ? 5   GLN A CB    1 
ATOM   16   C CG    . GLN A 1 20  ? 16.601  17.484  12.963  1.00   69.13  ? 5   GLN A CG    1 
ATOM   17   C CD    . GLN A 1 20  ? 16.429  18.631  13.948  1.00   74.92  ? 5   GLN A CD    1 
ATOM   18   O OE1   . GLN A 1 20  ? 17.191  18.758  14.908  1.00   79.66  ? 5   GLN A OE1   1 
ATOM   19   N NE2   . GLN A 1 20  ? 15.420  19.471  13.716  1.00   72.64  ? 5   GLN A NE2   1 
ATOM   20   N N     . ILE A 1 21  ? 13.091  15.167  11.606  1.00   62.39  ? 6   ILE A N     1 
ATOM   21   C CA    . ILE A 1 21  ? 11.659  15.078  11.360  1.00   58.08  ? 6   ILE A CA    1 
ATOM   22   C C     . ILE A 1 21  ? 10.931  16.093  12.224  1.00   55.87  ? 6   ILE A C     1 
ATOM   23   O O     . ILE A 1 21  ? 11.230  16.242  13.404  1.00   59.09  ? 6   ILE A O     1 
ATOM   24   C CB    . ILE A 1 21  ? 11.110  13.665  11.621  1.00   56.95  ? 6   ILE A CB    1 
ATOM   25   C CG1   . ILE A 1 21  ? 11.877  12.635  10.791  1.00   57.01  ? 6   ILE A CG1   1 
ATOM   26   C CG2   . ILE A 1 21  ? 9.633   13.609  11.286  1.00   55.47  ? 6   ILE A CG2   1 
ATOM   27   C CD1   . ILE A 1 21  ? 11.719  11.215  11.275  1.00   56.93  ? 6   ILE A CD1   1 
ATOM   28   N N     . LEU A 1 22  ? 9.980   16.796  11.628  1.00   53.95  ? 7   LEU A N     1 
ATOM   29   C CA    . LEU A 1 22  ? 9.225   17.803  12.342  1.00   55.48  ? 7   LEU A CA    1 
ATOM   30   C C     . LEU A 1 22  ? 7.764   17.406  12.461  1.00   55.05  ? 7   LEU A C     1 
ATOM   31   O O     . LEU A 1 22  ? 7.116   17.119  11.459  1.00   59.82  ? 7   LEU A O     1 
ATOM   32   C CB    . LEU A 1 22  ? 9.313   19.138  11.601  1.00   60.64  ? 7   LEU A CB    1 
ATOM   33   C CG    . LEU A 1 22  ? 8.383   20.229  12.142  1.00   60.61  ? 7   LEU A CG    1 
ATOM   34   C CD1   . LEU A 1 22  ? 9.035   20.929  13.326  1.00   56.85  ? 7   LEU A CD1   1 
ATOM   35   C CD2   . LEU A 1 22  ? 8.021   21.229  11.054  1.00   61.00  ? 7   LEU A CD2   1 
ATOM   36   N N     . CYS A 1 23  ? 7.232   17.399  13.678  1.00   55.47  ? 8   CYS A N     1 
ATOM   37   C CA    . CYS A 1 23  ? 5.792   17.215  13.849  1.00   56.57  ? 8   CYS A CA    1 
ATOM   38   C C     . CYS A 1 23  ? 5.137   18.496  14.326  1.00   56.14  ? 8   CYS A C     1 
ATOM   39   O O     . CYS A 1 23  ? 5.594   19.138  15.273  1.00   58.28  ? 8   CYS A O     1 
ATOM   40   C CB    . CYS A 1 23  ? 5.466   16.079  14.814  1.00   51.72  ? 8   CYS A CB    1 
ATOM   41   S SG    . CYS A 1 23  ? 6.474   14.649  14.565  1.00   60.95  ? 8   CYS A SG    1 
ATOM   42   N N     . VAL A 1 24  ? 4.052   18.842  13.654  1.00   54.73  ? 9   VAL A N     1 
ATOM   43   C CA    . VAL A 1 24  ? 3.344   20.074  13.888  1.00   55.68  ? 9   VAL A CA    1 
ATOM   44   C C     . VAL A 1 24  ? 1.983   19.701  14.410  1.00   55.62  ? 9   VAL A C     1 
ATOM   45   O O     . VAL A 1 24  ? 1.230   19.009  13.733  1.00   53.33  ? 9   VAL A O     1 
ATOM   46   C CB    . VAL A 1 24  ? 3.148   20.840  12.559  1.00   55.49  ? 9   VAL A CB    1 
ATOM   47   C CG1   . VAL A 1 24  ? 2.199   22.017  12.740  1.00   54.74  ? 9   VAL A CG1   1 
ATOM   48   C CG2   . VAL A 1 24  ? 4.493   21.277  11.991  1.00   57.22  ? 9   VAL A CG2   1 
ATOM   49   N N     . GLY A 1 25  ? 1.665   20.153  15.615  1.00   57.71  ? 10  GLY A N     1 
ATOM   50   C CA    . GLY A 1 25  ? 0.360   19.900  16.188  1.00   51.04  ? 10  GLY A CA    1 
ATOM   51   C C     . GLY A 1 25  ? 0.273   20.286  17.649  1.00   56.37  ? 10  GLY A C     1 
ATOM   52   O O     . GLY A 1 25  ? 0.967   21.183  18.124  1.00   55.80  ? 10  GLY A O     1 
ATOM   53   N N     . LEU A 1 26  ? -0.585  19.576  18.367  1.00   60.49  ? 11  LEU A N     1 
ATOM   54   C CA    . LEU A 1 26  ? -0.910  19.897  19.746  1.00   55.89  ? 11  LEU A CA    1 
ATOM   55   C C     . LEU A 1 26  ? 0.020   19.219  20.770  1.00   56.42  ? 11  LEU A C     1 
ATOM   56   O O     . LEU A 1 26  ? 0.524   18.112  20.544  1.00   57.92  ? 11  LEU A O     1 
ATOM   57   C CB    . LEU A 1 26  ? -2.363  19.509  19.994  1.00   54.93  ? 11  LEU A CB    1 
ATOM   58   C CG    . LEU A 1 26  ? -2.938  19.972  21.317  1.00   61.01  ? 11  LEU A CG    1 
ATOM   59   C CD1   . LEU A 1 26  ? -2.642  21.456  21.517  1.00   63.06  ? 11  LEU A CD1   1 
ATOM   60   C CD2   . LEU A 1 26  ? -4.431  19.681  21.360  1.00   66.95  ? 11  LEU A CD2   1 
ATOM   61   N N     . VAL A 1 27  ? 0.275   19.905  21.882  1.00   55.56  ? 12  VAL A N     1 
ATOM   62   C CA    . VAL A 1 27  ? 0.937   19.300  23.033  1.00   48.15  ? 12  VAL A CA    1 
ATOM   63   C C     . VAL A 1 27  ? 0.079   19.595  24.253  1.00   51.32  ? 12  VAL A C     1 
ATOM   64   O O     . VAL A 1 27  ? -0.302  20.734  24.477  1.00   55.69  ? 12  VAL A O     1 
ATOM   65   C CB    . VAL A 1 27  ? 2.384   19.808  23.240  1.00   51.77  ? 12  VAL A CB    1 
ATOM   66   C CG1   . VAL A 1 27  ? 2.426   21.325  23.411  1.00   55.03  ? 12  VAL A CG1   1 
ATOM   67   C CG2   . VAL A 1 27  ? 3.037   19.114  24.437  1.00   49.02  ? 12  VAL A CG2   1 
ATOM   68   N N     . VAL A 1 28  ? -0.271  18.568  25.017  1.00   49.37  ? 13  VAL A N     1 
ATOM   69   C CA    . VAL A 1 28  ? -1.124  18.781  26.179  1.00   49.00  ? 13  VAL A CA    1 
ATOM   70   C C     . VAL A 1 28  ? -0.635  17.995  27.384  1.00   48.03  ? 13  VAL A C     1 
ATOM   71   O O     . VAL A 1 28  ? 0.052   16.988  27.236  1.00   45.94  ? 13  VAL A O     1 
ATOM   72   C CB    . VAL A 1 28  ? -2.615  18.441  25.913  1.00   51.06  ? 13  VAL A CB    1 
ATOM   73   C CG1   . VAL A 1 28  ? -2.878  18.220  24.438  1.00   49.05  ? 13  VAL A CG1   1 
ATOM   74   C CG2   . VAL A 1 28  ? -3.044  17.235  26.727  1.00   49.54  ? 13  VAL A CG2   1 
ATOM   75   N N     . LEU A 1 29  ? -0.977  18.481  28.577  1.00   45.82  ? 14  LEU A N     1 
ATOM   76   C CA    . LEU A 1 29  ? -0.646  17.787  29.812  1.00   49.01  ? 14  LEU A CA    1 
ATOM   77   C C     . LEU A 1 29  ? -1.722  16.763  30.135  1.00   47.97  ? 14  LEU A C     1 
ATOM   78   O O     . LEU A 1 29  ? -2.874  17.119  30.382  1.00   45.30  ? 14  LEU A O     1 
ATOM   79   C CB    . LEU A 1 29  ? -0.513  18.762  30.977  1.00   41.76  ? 14  LEU A CB    1 
ATOM   80   C CG    . LEU A 1 29  ? -0.373  18.094  32.339  1.00   42.13  ? 14  LEU A CG    1 
ATOM   81   C CD1   . LEU A 1 29  ? 0.880   17.253  32.356  1.00   51.13  ? 14  LEU A CD1   1 
ATOM   82   C CD2   . LEU A 1 29  ? -0.324  19.134  33.448  1.00   43.82  ? 14  LEU A CD2   1 
ATOM   83   N N     . ASP A 1 30  ? -1.331  15.493  30.127  1.00   44.78  ? 15  ASP A N     1 
ATOM   84   C CA    . ASP A 1 30  ? -2.244  14.408  30.459  1.00   47.45  ? 15  ASP A CA    1 
ATOM   85   C C     . ASP A 1 30  ? -2.126  14.039  31.928  1.00   38.76  ? 15  ASP A C     1 
ATOM   86   O O     . ASP A 1 30  ? -1.097  13.553  32.378  1.00   42.33  ? 15  ASP A O     1 
ATOM   87   C CB    . ASP A 1 30  ? -1.963  13.167  29.600  1.00   45.78  ? 15  ASP A CB    1 
ATOM   88   C CG    . ASP A 1 30  ? -2.474  13.303  28.184  1.00   47.67  ? 15  ASP A CG    1 
ATOM   89   O OD1   . ASP A 1 30  ? -3.358  14.158  27.926  1.00   45.52  ? 15  ASP A OD1   1 
ATOM   90   O OD2   . ASP A 1 30  ? -1.993  12.531  27.326  1.00   47.89  ? 15  ASP A OD2   1 
ATOM   91   N N     . VAL A 1 31  ? -3.190  14.286  32.665  1.00   38.47  ? 16  VAL A N     1 
ATOM   92   C CA    . VAL A 1 31  ? -3.273  13.900  34.054  1.00   42.41  ? 16  VAL A CA    1 
ATOM   93   C C     . VAL A 1 31  ? -4.015  12.576  34.082  1.00   42.58  ? 16  VAL A C     1 
ATOM   94   O O     . VAL A 1 31  ? -5.204  12.510  33.771  1.00   42.12  ? 16  VAL A O     1 
ATOM   95   C CB    . VAL A 1 31  ? -4.061  14.944  34.860  1.00   47.94  ? 16  VAL A CB    1 
ATOM   96   C CG1   . VAL A 1 31  ? -4.181  14.512  36.333  1.00   38.31  ? 16  VAL A CG1   1 
ATOM   97   C CG2   . VAL A 1 31  ? -3.400  16.316  34.711  1.00   46.04  ? 16  VAL A CG2   1 
ATOM   98   N N     . ILE A 1 32  ? -3.302  11.525  34.458  1.00   39.57  ? 17  ILE A N     1 
ATOM   99   C CA    . ILE A 1 32  ? -3.751  10.173  34.184  1.00   40.67  ? 17  ILE A CA    1 
ATOM   100  C C     . ILE A 1 32  ? -4.012  9.415   35.455  1.00   36.63  ? 17  ILE A C     1 
ATOM   101  O O     . ILE A 1 32  ? -3.204  9.461   36.386  1.00   36.62  ? 17  ILE A O     1 
ATOM   102  C CB    . ILE A 1 32  ? -2.676  9.400   33.378  1.00   42.07  ? 17  ILE A CB    1 
ATOM   103  C CG1   . ILE A 1 32  ? -2.597  9.928   31.946  1.00   39.54  ? 17  ILE A CG1   1 
ATOM   104  C CG2   . ILE A 1 32  ? -2.935  7.887   33.414  1.00   40.00  ? 17  ILE A CG2   1 
ATOM   105  C CD1   . ILE A 1 32  ? -1.342  9.475   31.210  1.00   42.42  ? 17  ILE A CD1   1 
ATOM   106  N N     . SER A 1 33  ? -5.147  8.720   35.487  1.00   35.65  ? 18  SER A N     1 
ATOM   107  C CA    . SER A 1 33  ? -5.461  7.804   36.583  1.00   40.96  ? 18  SER A CA    1 
ATOM   108  C C     . SER A 1 33  ? -5.635  6.405   36.028  1.00   38.92  ? 18  SER A C     1 
ATOM   109  O O     . SER A 1 33  ? -6.382  6.198   35.077  1.00   39.19  ? 18  SER A O     1 
ATOM   110  C CB    . SER A 1 33  ? -6.769  8.197   37.281  1.00   43.93  ? 18  SER A CB    1 
ATOM   111  O OG    . SER A 1 33  ? -6.698  9.493   37.836  1.00   50.75  ? 18  SER A OG    1 
ATOM   112  N N     . LEU A 1 34  ? -4.976  5.438   36.636  1.00   37.02  ? 19  LEU A N     1 
ATOM   113  C CA    . LEU A 1 34  ? -5.118  4.071   36.169  1.00   40.52  ? 19  LEU A CA    1 
ATOM   114  C C     . LEU A 1 34  ? -6.070  3.359   37.107  1.00   39.14  ? 19  LEU A C     1 
ATOM   115  O O     . LEU A 1 34  ? -5.801  3.272   38.296  1.00   42.31  ? 19  LEU A O     1 
ATOM   116  C CB    . LEU A 1 34  ? -3.749  3.383   36.121  1.00   37.72  ? 19  LEU A CB    1 
ATOM   117  C CG    . LEU A 1 34  ? -3.674  1.913   35.713  1.00   43.53  ? 19  LEU A CG    1 
ATOM   118  C CD1   . LEU A 1 34  ? -4.055  1.709   34.245  1.00   39.43  ? 19  LEU A CD1   1 
ATOM   119  C CD2   . LEU A 1 34  ? -2.280  1.383   35.987  1.00   40.72  ? 19  LEU A CD2   1 
ATOM   120  N N     . VAL A 1 35  ? -7.200  2.892   36.583  1.00   38.11  ? 20  VAL A N     1 
ATOM   121  C CA    . VAL A 1 35  ? -8.223  2.223   37.395  1.00   40.47  ? 20  VAL A CA    1 
ATOM   122  C C     . VAL A 1 35  ? -8.379  0.784   36.916  1.00   49.16  ? 20  VAL A C     1 
ATOM   123  O O     . VAL A 1 35  ? -7.980  0.463   35.795  1.00   45.66  ? 20  VAL A O     1 
ATOM   124  C CB    . VAL A 1 35  ? -9.593  2.910   37.270  1.00   41.00  ? 20  VAL A CB    1 
ATOM   125  C CG1   . VAL A 1 35  ? -9.518  4.360   37.745  1.00   41.50  ? 20  VAL A CG1   1 
ATOM   126  C CG2   . VAL A 1 35  ? -10.091 2.846   35.833  1.00   41.85  ? 20  VAL A CG2   1 
ATOM   127  N N     . ASP A 1 36  ? -8.956  -0.088  37.740  1.00   48.66  ? 21  ASP A N     1 
ATOM   128  C CA    . ASP A 1 36  ? -9.131  -1.478  37.303  1.00   54.70  ? 21  ASP A CA    1 
ATOM   129  C C     . ASP A 1 36  ? -10.510 -1.774  36.731  1.00   54.55  ? 21  ASP A C     1 
ATOM   130  O O     . ASP A 1 36  ? -10.746 -2.841  36.163  1.00   60.73  ? 21  ASP A O     1 
ATOM   131  C CB    . ASP A 1 36  ? -8.712  -2.509  38.367  1.00   56.28  ? 21  ASP A CB    1 
ATOM   132  C CG    . ASP A 1 36  ? -9.483  -2.381  39.658  1.00   61.28  ? 21  ASP A CG    1 
ATOM   133  O OD1   . ASP A 1 36  ? -10.599 -1.817  39.643  1.00   63.95  ? 21  ASP A OD1   1 
ATOM   134  O OD2   . ASP A 1 36  ? -8.965  -2.866  40.692  1.00   65.90  ? 21  ASP A OD2   1 
ATOM   135  N N     . LYS A 1 37  ? -11.413 -0.816  36.865  1.00   53.19  ? 22  LYS A N     1 
ATOM   136  C CA    . LYS A 1 37  ? -12.686 -0.887  36.176  1.00   52.21  ? 22  LYS A CA    1 
ATOM   137  C C     . LYS A 1 37  ? -13.137 0.538   35.927  1.00   54.61  ? 22  LYS A C     1 
ATOM   138  O O     . LYS A 1 37  ? -12.876 1.427   36.743  1.00   55.90  ? 22  LYS A O     1 
ATOM   139  C CB    . LYS A 1 37  ? -13.712 -1.629  37.022  1.00   60.77  ? 22  LYS A CB    1 
ATOM   140  C CG    . LYS A 1 37  ? -13.860 -1.070  38.426  1.00   69.45  ? 22  LYS A CG    1 
ATOM   141  C CD    . LYS A 1 37  ? -15.029 -1.716  39.172  1.00   77.72  ? 22  LYS A CD    1 
ATOM   142  C CE    . LYS A 1 37  ? -15.049 -1.297  40.639  1.00   80.18  ? 22  LYS A CE    1 
ATOM   143  N NZ    . LYS A 1 37  ? -16.280 -1.774  41.334  1.00   90.67  ? 22  LYS A NZ    1 
ATOM   144  N N     . TYR A 1 38  ? -13.785 0.764   34.790  1.00   53.49  ? 23  TYR A N     1 
ATOM   145  C CA    . TYR A 1 38  ? -14.328 2.077   34.488  1.00   54.38  ? 23  TYR A CA    1 
ATOM   146  C C     . TYR A 1 38  ? -15.504 2.325   35.426  1.00   54.13  ? 23  TYR A C     1 
ATOM   147  O O     . TYR A 1 38  ? -16.326 1.436   35.627  1.00   58.24  ? 23  TYR A O     1 
ATOM   148  C CB    . TYR A 1 38  ? -14.776 2.138   33.033  1.00   52.78  ? 23  TYR A CB    1 
ATOM   149  C CG    . TYR A 1 38  ? -15.123 3.527   32.567  1.00   55.14  ? 23  TYR A CG    1 
ATOM   150  C CD1   . TYR A 1 38  ? -14.156 4.526   32.519  1.00   53.78  ? 23  TYR A CD1   1 
ATOM   151  C CD2   . TYR A 1 38  ? -16.412 3.842   32.167  1.00   55.37  ? 23  TYR A CD2   1 
ATOM   152  C CE1   . TYR A 1 38  ? -14.468 5.804   32.091  1.00   55.35  ? 23  TYR A CE1   1 
ATOM   153  C CE2   . TYR A 1 38  ? -16.737 5.112   31.732  1.00   54.65  ? 23  TYR A CE2   1 
ATOM   154  C CZ    . TYR A 1 38  ? -15.762 6.093   31.697  1.00   59.32  ? 23  TYR A CZ    1 
ATOM   155  O OH    . TYR A 1 38  ? -16.088 7.365   31.271  1.00   59.58  ? 23  TYR A OH    1 
ATOM   156  N N     . PRO A 1 39  ? -15.579 3.526   36.021  1.00   56.30  ? 24  PRO A N     1 
ATOM   157  C CA    . PRO A 1 39  ? -16.608 3.817   37.033  1.00   54.31  ? 24  PRO A CA    1 
ATOM   158  C C     . PRO A 1 39  ? -17.967 4.140   36.416  1.00   54.40  ? 24  PRO A C     1 
ATOM   159  O O     . PRO A 1 39  ? -18.029 4.846   35.414  1.00   54.14  ? 24  PRO A O     1 
ATOM   160  C CB    . PRO A 1 39  ? -16.048 5.052   37.736  1.00   51.94  ? 24  PRO A CB    1 
ATOM   161  C CG    . PRO A 1 39  ? -15.281 5.756   36.681  1.00   52.70  ? 24  PRO A CG    1 
ATOM   162  C CD    . PRO A 1 39  ? -14.675 4.673   35.811  1.00   51.38  ? 24  PRO A CD    1 
ATOM   163  N N     . LYS A 1 40  ? -19.047 3.629   36.997  1.00   59.14  ? 25  LYS A N     1 
ATOM   164  C CA    . LYS A 1 40  ? -20.379 3.976   36.497  1.00   63.27  ? 25  LYS A CA    1 
ATOM   165  C C     . LYS A 1 40  ? -20.692 5.446   36.816  1.00   57.93  ? 25  LYS A C     1 
ATOM   166  O O     . LYS A 1 40  ? -20.115 6.026   37.735  1.00   55.91  ? 25  LYS A O     1 
ATOM   167  C CB    . LYS A 1 40  ? -21.456 3.047   37.079  1.00   62.91  ? 25  LYS A CB    1 
ATOM   168  C CG    . LYS A 1 40  ? -21.918 3.444   38.473  1.00   70.30  ? 25  LYS A CG    1 
ATOM   169  C CD    . LYS A 1 40  ? -23.144 2.649   38.928  1.00   72.50  ? 25  LYS A CD    1 
ATOM   170  C CE    . LYS A 1 40  ? -24.001 3.473   39.893  1.00   69.24  ? 25  LYS A CE    1 
ATOM   171  N NZ    . LYS A 1 40  ? -23.228 4.046   41.034  1.00   72.06  ? 25  LYS A NZ    1 
ATOM   172  N N     . GLU A 1 41  ? -21.591 6.053   36.053  1.00   59.94  ? 26  GLU A N     1 
ATOM   173  C CA    . GLU A 1 41  ? -21.923 7.452   36.294  1.00   63.74  ? 26  GLU A CA    1 
ATOM   174  C C     . GLU A 1 41  ? -22.350 7.656   37.743  1.00   63.95  ? 26  GLU A C     1 
ATOM   175  O O     . GLU A 1 41  ? -22.958 6.775   38.352  1.00   64.05  ? 26  GLU A O     1 
ATOM   176  C CB    . GLU A 1 41  ? -23.012 7.947   35.340  1.00   62.76  ? 26  GLU A CB    1 
ATOM   177  C CG    . GLU A 1 41  ? -23.428 9.399   35.590  1.00   64.80  ? 26  GLU A CG    1 
ATOM   178  C CD    . GLU A 1 41  ? -24.109 10.048  34.388  1.00   69.46  ? 26  GLU A CD    1 
ATOM   179  O OE1   . GLU A 1 41  ? -24.293 11.284  34.421  1.00   68.92  ? 26  GLU A OE1   1 
ATOM   180  O OE2   . GLU A 1 41  ? -24.456 9.332   33.415  1.00   65.91  ? 26  GLU A OE2   1 
ATOM   181  N N     . ASP A 1 42  ? -21.998 8.812   38.296  1.00   63.40  ? 27  ASP A N     1 
ATOM   182  C CA    . ASP A 1 42  ? -22.456 9.189   39.625  1.00   64.58  ? 27  ASP A CA    1 
ATOM   183  C C     . ASP A 1 42  ? -21.969 8.201   40.674  1.00   63.08  ? 27  ASP A C     1 
ATOM   184  O O     . ASP A 1 42  ? -22.585 8.049   41.723  1.00   69.15  ? 27  ASP A O     1 
ATOM   185  C CB    . ASP A 1 42  ? -23.987 9.289   39.641  1.00   68.93  ? 27  ASP A CB    1 
ATOM   186  C CG    . ASP A 1 42  ? -24.543 9.655   41.007  1.00   76.13  ? 27  ASP A CG    1 
ATOM   187  O OD1   . ASP A 1 42  ? -25.696 9.258   41.299  1.00   78.19  ? 27  ASP A OD1   1 
ATOM   188  O OD2   . ASP A 1 42  ? -23.835 10.337  41.788  1.00   76.30  ? 27  ASP A OD2   1 
ATOM   189  N N     . SER A 1 43  ? -20.862 7.525   40.387  1.00   61.94  ? 28  SER A N     1 
ATOM   190  C CA    . SER A 1 43  ? -20.241 6.638   41.370  1.00   58.86  ? 28  SER A CA    1 
ATOM   191  C C     . SER A 1 43  ? -18.867 7.154   41.787  1.00   54.80  ? 28  SER A C     1 
ATOM   192  O O     . SER A 1 43  ? -18.405 8.193   41.317  1.00   54.29  ? 28  SER A O     1 
ATOM   193  C CB    . SER A 1 43  ? -20.124 5.207   40.831  1.00   63.24  ? 28  SER A CB    1 
ATOM   194  O OG    . SER A 1 43  ? -19.159 5.118   39.790  1.00   59.59  ? 28  SER A OG    1 
ATOM   195  N N     . GLU A 1 44  ? -18.215 6.415   42.669  1.00   53.85  ? 29  GLU A N     1 
ATOM   196  C CA    . GLU A 1 44  ? -16.921 6.818   43.179  1.00   55.00  ? 29  GLU A CA    1 
ATOM   197  C C     . GLU A 1 44  ? -16.012 5.595   43.332  1.00   58.75  ? 29  GLU A C     1 
ATOM   198  O O     . GLU A 1 44  ? -16.367 4.635   44.012  1.00   62.22  ? 29  GLU A O     1 
ATOM   199  C CB    . GLU A 1 44  ? -17.114 7.542   44.512  1.00   61.21  ? 29  GLU A CB    1 
ATOM   200  C CG    . GLU A 1 44  ? -15.874 7.639   45.377  1.00   63.86  ? 29  GLU A CG    1 
ATOM   201  C CD    . GLU A 1 44  ? -16.114 8.380   46.700  1.00   75.21  ? 29  GLU A CD    1 
ATOM   202  O OE1   . GLU A 1 44  ? -16.529 7.724   47.684  1.00   78.24  ? 29  GLU A OE1   1 
ATOM   203  O OE2   . GLU A 1 44  ? -15.879 9.613   46.758  1.00   70.80  ? 29  GLU A OE2   1 
ATOM   204  N N     . ILE A 1 45  ? -14.851 5.627   42.681  1.00   54.66  ? 30  ILE A N     1 
ATOM   205  C CA    . ILE A 1 45  ? -13.894 4.523   42.742  1.00   54.39  ? 30  ILE A CA    1 
ATOM   206  C C     . ILE A 1 45  ? -12.455 5.005   42.948  1.00   52.42  ? 30  ILE A C     1 
ATOM   207  O O     . ILE A 1 45  ? -12.089 6.101   42.518  1.00   51.45  ? 30  ILE A O     1 
ATOM   208  C CB    . ILE A 1 45  ? -13.942 3.669   41.461  1.00   56.14  ? 30  ILE A CB    1 
ATOM   209  C CG1   . ILE A 1 45  ? -13.660 4.532   40.239  1.00   54.83  ? 30  ILE A CG1   1 
ATOM   210  C CG2   . ILE A 1 45  ? -15.308 3.024   41.296  1.00   63.54  ? 30  ILE A CG2   1 
ATOM   211  C CD1   . ILE A 1 45  ? -12.248 4.526   39.800  1.00   51.72  ? 30  ILE A CD1   1 
ATOM   212  N N     . ARG A 1 46  ? -11.637 4.177   43.592  1.00   46.47  ? 31  ARG A N     1 
ATOM   213  C CA    . ARG A 1 46  ? -10.248 4.533   43.853  1.00   49.45  ? 31  ARG A CA    1 
ATOM   214  C C     . ARG A 1 46  ? -9.328  4.080   42.715  1.00   48.99  ? 31  ARG A C     1 
ATOM   215  O O     . ARG A 1 46  ? -9.499  3.002   42.163  1.00   48.08  ? 31  ARG A O     1 
ATOM   216  C CB    . ARG A 1 46  ? -9.788  3.921   45.169  1.00   47.36  ? 31  ARG A CB    1 
ATOM   217  C CG    . ARG A 1 46  ? -8.455  4.461   45.648  1.00   55.50  ? 31  ARG A CG    1 
ATOM   218  C CD    . ARG A 1 46  ? -8.174  4.077   47.090  1.00   53.46  ? 31  ARG A CD    1 
ATOM   219  N NE    . ARG A 1 46  ? -9.200  4.547   48.025  1.00   51.91  ? 31  ARG A NE    1 
ATOM   220  C CZ    . ARG A 1 46  ? -9.270  5.787   48.505  1.00   56.98  ? 31  ARG A CZ    1 
ATOM   221  N NH1   . ARG A 1 46  ? -8.402  6.709   48.111  1.00   53.75  ? 31  ARG A NH1   1 
ATOM   222  N NH2   . ARG A 1 46  ? -10.227 6.113   49.366  1.00   65.34  ? 31  ARG A NH2   1 
ATOM   223  N N     . CYS A 1 47  ? -8.349  4.899   42.361  1.00   46.39  ? 32  CYS A N     1 
ATOM   224  C CA    . CYS A 1 47  ? -7.463  4.529   41.266  1.00   43.36  ? 32  CYS A CA    1 
ATOM   225  C C     . CYS A 1 47  ? -6.246  3.758   41.765  1.00   47.29  ? 32  CYS A C     1 
ATOM   226  O O     . CYS A 1 47  ? -5.785  3.966   42.887  1.00   48.25  ? 32  CYS A O     1 
ATOM   227  C CB    . CYS A 1 47  ? -7.033  5.762   40.470  1.00   47.34  ? 32  CYS A CB    1 
ATOM   228  S SG    . CYS A 1 47  ? -5.796  6.762   41.284  1.00   50.32  ? 32  CYS A SG    1 
ATOM   229  N N     . LEU A 1 48  ? -5.733  2.869   40.921  1.00   45.48  ? 33  LEU A N     1 
ATOM   230  C CA    . LEU A 1 48  ? -4.572  2.053   41.260  1.00   47.29  ? 33  LEU A CA    1 
ATOM   231  C C     . LEU A 1 48  ? -3.305  2.888   41.375  1.00   46.94  ? 33  LEU A C     1 
ATOM   232  O O     . LEU A 1 48  ? -2.480  2.655   42.254  1.00   44.12  ? 33  LEU A O     1 
ATOM   233  C CB    . LEU A 1 48  ? -4.363  0.972   40.202  1.00   45.13  ? 33  LEU A CB    1 
ATOM   234  C CG    . LEU A 1 48  ? -5.610  0.151   39.877  1.00   49.24  ? 33  LEU A CG    1 
ATOM   235  C CD1   . LEU A 1 48  ? -5.295  -0.849  38.784  1.00   46.09  ? 33  LEU A CD1   1 
ATOM   236  C CD2   . LEU A 1 48  ? -6.114  -0.558  41.125  1.00   50.57  ? 33  LEU A CD2   1 
ATOM   237  N N     . SER A 1 49  ? -3.145  3.843   40.466  1.00   40.56  ? 34  SER A N     1 
ATOM   238  C CA    . SER A 1 49  ? -1.982  4.722   40.474  1.00   43.79  ? 34  SER A CA    1 
ATOM   239  C C     . SER A 1 49  ? -2.276  5.918   39.605  1.00   39.74  ? 34  SER A C     1 
ATOM   240  O O     . SER A 1 49  ? -3.306  5.976   38.948  1.00   44.83  ? 34  SER A O     1 
ATOM   241  C CB    . SER A 1 49  ? -0.721  4.013   39.958  1.00   47.23  ? 34  SER A CB    1 
ATOM   242  O OG    . SER A 1 49  ? -0.904  3.535   38.637  1.00   45.45  ? 34  SER A OG    1 
ATOM   243  N N     . GLN A 1 50  ? -1.381  6.888   39.620  1.00   39.98  ? 35  GLN A N     1 
ATOM   244  C CA    . GLN A 1 50  ? -1.605  8.089   38.839  1.00   43.99  ? 35  GLN A CA    1 
ATOM   245  C C     . GLN A 1 50  ? -0.288  8.644   38.341  1.00   41.16  ? 35  GLN A C     1 
ATOM   246  O O     . GLN A 1 50  ? 0.762   8.317   38.875  1.00   41.66  ? 35  GLN A O     1 
ATOM   247  C CB    . GLN A 1 50  ? -2.419  9.134   39.625  1.00   48.68  ? 35  GLN A CB    1 
ATOM   248  C CG    . GLN A 1 50  ? -2.098  9.260   41.106  1.00   53.01  ? 35  GLN A CG    1 
ATOM   249  C CD    . GLN A 1 50  ? -3.267  9.860   41.911  1.00   57.59  ? 35  GLN A CD    1 
ATOM   250  O OE1   . GLN A 1 50  ? -3.193  10.016  43.156  1.00   50.17  ? 35  GLN A OE1   1 
ATOM   251  N NE2   . GLN A 1 50  ? -4.361  10.187  41.200  1.00   56.21  ? 35  GLN A NE2   1 
ATOM   252  N N     . ARG A 1 51  ? -0.341  9.450   37.290  1.00   37.01  ? 36  ARG A N     1 
ATOM   253  C CA    . ARG A 1 51  ? 0.872   10.035  36.755  1.00   41.45  ? 36  ARG A CA    1 
ATOM   254  C C     . ARG A 1 51  ? 0.520   11.174  35.821  1.00   40.21  ? 36  ARG A C     1 
ATOM   255  O O     . ARG A 1 51  ? -0.633  11.312  35.399  1.00   39.12  ? 36  ARG A O     1 
ATOM   256  C CB    . ARG A 1 51  ? 1.684   8.970   35.996  1.00   42.27  ? 36  ARG A CB    1 
ATOM   257  C CG    . ARG A 1 51  ? 1.000   8.465   34.709  1.00   44.61  ? 36  ARG A CG    1 
ATOM   258  C CD    . ARG A 1 51  ? 1.766   7.284   34.084  1.00   42.68  ? 36  ARG A CD    1 
ATOM   259  N NE    . ARG A 1 51  ? 1.260   6.924   32.759  1.00   44.49  ? 36  ARG A NE    1 
ATOM   260  C CZ    . ARG A 1 51  ? 0.379   5.955   32.511  1.00   46.64  ? 36  ARG A CZ    1 
ATOM   261  N NH1   . ARG A 1 51  ? -0.127  5.218   33.499  1.00   43.57  ? 36  ARG A NH1   1 
ATOM   262  N NH2   . ARG A 1 51  ? 0.004   5.712   31.265  1.00   41.56  ? 36  ARG A NH2   1 
ATOM   263  N N     . TRP A 1 52  ? 1.523   11.987  35.506  1.00   41.74  ? 37  TRP A N     1 
ATOM   264  C CA    . TRP A 1 52  ? 1.407   13.006  34.471  1.00   43.05  ? 37  TRP A CA    1 
ATOM   265  C C     . TRP A 1 52  ? 2.207   12.560  33.266  1.00   41.62  ? 37  TRP A C     1 
ATOM   266  O O     . TRP A 1 52  ? 3.295   12.006  33.407  1.00   42.51  ? 37  TRP A O     1 
ATOM   267  C CB    . TRP A 1 52  ? 1.994   14.334  34.940  1.00   44.98  ? 37  TRP A CB    1 
ATOM   268  C CG    . TRP A 1 52  ? 1.143   15.138  35.882  1.00   48.96  ? 37  TRP A CG    1 
ATOM   269  C CD1   . TRP A 1 52  ? 0.040   14.719  36.564  1.00   41.99  ? 37  TRP A CD1   1 
ATOM   270  C CD2   . TRP A 1 52  ? 1.344   16.511  36.246  1.00   47.84  ? 37  TRP A CD2   1 
ATOM   271  N NE1   . TRP A 1 52  ? -0.457  15.745  37.330  1.00   45.83  ? 37  TRP A NE1   1 
ATOM   272  C CE2   . TRP A 1 52  ? 0.324   16.857  37.152  1.00   45.09  ? 37  TRP A CE2   1 
ATOM   273  C CE3   . TRP A 1 52  ? 2.287   17.484  35.886  1.00   48.18  ? 37  TRP A CE3   1 
ATOM   274  C CZ2   . TRP A 1 52  ? 0.213   18.132  37.708  1.00   45.39  ? 37  TRP A CZ2   1 
ATOM   275  C CZ3   . TRP A 1 52  ? 2.178   18.755  36.438  1.00   50.44  ? 37  TRP A CZ3   1 
ATOM   276  C CH2   . TRP A 1 52  ? 1.147   19.065  37.339  1.00   47.06  ? 37  TRP A CH2   1 
ATOM   277  N N     . GLN A 1 53  ? 1.676   12.822  32.082  1.00   40.80  ? 38  GLN A N     1 
ATOM   278  C CA    . GLN A 1 53  ? 2.409   12.581  30.852  1.00   44.99  ? 38  GLN A CA    1 
ATOM   279  C C     . GLN A 1 53  ? 2.270   13.775  29.944  1.00   42.44  ? 38  GLN A C     1 
ATOM   280  O O     . GLN A 1 53  ? 1.210   14.392  29.884  1.00   43.67  ? 38  GLN A O     1 
ATOM   281  C CB    . GLN A 1 53  ? 1.863   11.354  30.109  1.00   42.53  ? 38  GLN A CB    1 
ATOM   282  C CG    . GLN A 1 53  ? 2.605   10.069  30.393  1.00   48.42  ? 38  GLN A CG    1 
ATOM   283  C CD    . GLN A 1 53  ? 1.963   8.855   29.732  1.00   44.55  ? 38  GLN A CD    1 
ATOM   284  O OE1   . GLN A 1 53  ? 1.312   8.968   28.694  1.00   42.68  ? 38  GLN A OE1   1 
ATOM   285  N NE2   . GLN A 1 53  ? 2.138   7.687   30.345  1.00   44.50  ? 38  GLN A NE2   1 
ATOM   286  N N     . ARG A 1 54  ? 3.343   14.083  29.227  1.00   43.28  ? 39  ARG A N     1 
ATOM   287  C CA    . ARG A 1 54  ? 3.263   14.947  28.058  1.00   42.86  ? 39  ARG A CA    1 
ATOM   288  C C     . ARG A 1 54  ? 2.511   14.185  26.970  1.00   49.53  ? 39  ARG A C     1 
ATOM   289  O O     . ARG A 1 54  ? 2.910   13.076  26.602  1.00   48.83  ? 39  ARG A O     1 
ATOM   290  C CB    . ARG A 1 54  ? 4.665   15.299  27.562  1.00   43.94  ? 39  ARG A CB    1 
ATOM   291  C CG    . ARG A 1 54  ? 4.660   16.269  26.408  1.00   48.44  ? 39  ARG A CG    1 
ATOM   292  C CD    . ARG A 1 54  ? 6.053   16.727  26.074  1.00   46.42  ? 39  ARG A CD    1 
ATOM   293  N NE    . ARG A 1 54  ? 6.980   15.606  25.970  1.00   48.55  ? 39  ARG A NE    1 
ATOM   294  C CZ    . ARG A 1 54  ? 7.089   14.828  24.900  1.00   43.52  ? 39  ARG A CZ    1 
ATOM   295  N NH1   . ARG A 1 54  ? 6.319   15.037  23.846  1.00   41.29  ? 39  ARG A NH1   1 
ATOM   296  N NH2   . ARG A 1 54  ? 7.951   13.832  24.893  1.00   44.04  ? 39  ARG A NH2   1 
ATOM   297  N N     . GLY A 1 55  ? 1.422   14.769  26.477  1.00   46.62  ? 40  GLY A N     1 
ATOM   298  C CA    . GLY A 1 55  ? 0.615   14.166  25.435  1.00   41.45  ? 40  GLY A CA    1 
ATOM   299  C C     . GLY A 1 55  ? 0.320   15.119  24.283  1.00   45.16  ? 40  GLY A C     1 
ATOM   300  O O     . GLY A 1 55  ? 1.074   16.056  24.033  1.00   43.62  ? 40  GLY A O     1 
ATOM   301  N N     . GLY A 1 56  ? -0.799  14.892  23.602  1.00   42.86  ? 41  GLY A N     1 
ATOM   302  C CA    . GLY A 1 56  ? -1.058  15.504  22.308  1.00   46.04  ? 41  GLY A CA    1 
ATOM   303  C C     . GLY A 1 56  ? -0.457  14.629  21.216  1.00   44.38  ? 41  GLY A C     1 
ATOM   304  O O     . GLY A 1 56  ? 0.605   14.032  21.424  1.00   43.08  ? 41  GLY A O     1 
ATOM   305  N N     . ASN A 1 57  ? -1.113  14.556  20.060  1.00   42.13  ? 42  ASN A N     1 
ATOM   306  C CA    . ASN A 1 57  ? -0.679  13.640  19.001  1.00   42.79  ? 42  ASN A CA    1 
ATOM   307  C C     . ASN A 1 57  ? 0.720   13.911  18.470  1.00   46.27  ? 42  ASN A C     1 
ATOM   308  O O     . ASN A 1 57  ? 1.605   13.046  18.532  1.00   44.18  ? 42  ASN A O     1 
ATOM   309  C CB    . ASN A 1 57  ? -1.673  13.630  17.853  1.00   48.42  ? 42  ASN A CB    1 
ATOM   310  C CG    . ASN A 1 57  ? -3.012  13.055  18.250  1.00   53.10  ? 42  ASN A CG    1 
ATOM   311  O OD1   . ASN A 1 57  ? -3.333  12.951  19.434  1.00   53.52  ? 42  ASN A OD1   1 
ATOM   312  N ND2   . ASN A 1 57  ? -3.804  12.669  17.262  1.00   53.51  ? 42  ASN A ND2   1 
ATOM   313  N N     . ALA A 1 58  ? 0.927   15.117  17.957  1.00   46.03  ? 43  ALA A N     1 
ATOM   314  C CA    . ALA A 1 58  ? 2.233   15.478  17.419  1.00   46.97  ? 43  ALA A CA    1 
ATOM   315  C C     . ALA A 1 58  ? 3.310   15.313  18.484  1.00   44.45  ? 43  ALA A C     1 
ATOM   316  O O     . ALA A 1 58  ? 4.439   14.903  18.201  1.00   45.30  ? 43  ALA A O     1 
ATOM   317  C CB    . ALA A 1 58  ? 2.214   16.909  16.887  1.00   51.80  ? 43  ALA A CB    1 
ATOM   318  N N     . SER A 1 59  ? 2.947   15.628  19.720  1.00   45.67  ? 44  SER A N     1 
ATOM   319  C CA    . SER A 1 59  ? 3.880   15.534  20.836  1.00   45.51  ? 44  SER A CA    1 
ATOM   320  C C     . SER A 1 59  ? 4.210   14.078  21.179  1.00   43.00  ? 44  SER A C     1 
ATOM   321  O O     . SER A 1 59  ? 5.374   13.722  21.334  1.00   44.45  ? 44  SER A O     1 
ATOM   322  C CB    . SER A 1 59  ? 3.301   16.232  22.062  1.00   44.29  ? 44  SER A CB    1 
ATOM   323  O OG    . SER A 1 59  ? 3.975   15.803  23.227  1.00   44.64  ? 44  SER A OG    1 
ATOM   324  N N     . ASN A 1 60  ? 3.181   13.245  21.311  1.00   42.62  ? 45  ASN A N     1 
ATOM   325  C CA    . ASN A 1 60  ? 3.379   11.806  21.475  1.00   40.41  ? 45  ASN A CA    1 
ATOM   326  C C     . ASN A 1 60  ? 4.234   11.193  20.350  1.00   39.77  ? 45  ASN A C     1 
ATOM   327  O O     . ASN A 1 60  ? 5.085   10.339  20.598  1.00   41.08  ? 45  ASN A O     1 
ATOM   328  C CB    . ASN A 1 60  ? 2.037   11.080  21.591  1.00   38.40  ? 45  ASN A CB    1 
ATOM   329  C CG    . ASN A 1 60  ? 1.405   11.218  22.973  1.00   43.93  ? 45  ASN A CG    1 
ATOM   330  O OD1   . ASN A 1 60  ? 2.104   11.282  23.989  1.00   40.51  ? 45  ASN A OD1   1 
ATOM   331  N ND2   . ASN A 1 60  ? 0.070   11.254  23.016  1.00   40.32  ? 45  ASN A ND2   1 
ATOM   332  N N     . SER A 1 61  ? 4.023   11.634  19.118  1.00   37.07  ? 46  SER A N     1 
ATOM   333  C CA    . SER A 1 61  ? 4.839   11.135  18.011  1.00   41.84  ? 46  SER A CA    1 
ATOM   334  C C     . SER A 1 61  ? 6.330   11.466  18.161  1.00   43.62  ? 46  SER A C     1 
ATOM   335  O O     . SER A 1 61  ? 7.195   10.631  17.872  1.00   44.32  ? 46  SER A O     1 
ATOM   336  C CB    . SER A 1 61  ? 4.308   11.656  16.683  1.00   44.78  ? 46  SER A CB    1 
ATOM   337  O OG    . SER A 1 61  ? 3.006   11.162  16.462  1.00   42.57  ? 46  SER A OG    1 
ATOM   338  N N     . CYS A 1 62  ? 6.637   12.672  18.625  1.00   43.02  ? 47  CYS A N     1 
ATOM   339  C CA    . CYS A 1 62  ? 8.032   13.040  18.879  1.00   44.62  ? 47  CYS A CA    1 
ATOM   340  C C     . CYS A 1 62  ? 8.678   12.134  19.921  1.00   42.33  ? 47  CYS A C     1 
ATOM   341  O O     . CYS A 1 62  ? 9.834   11.721  19.780  1.00   43.72  ? 47  CYS A O     1 
ATOM   342  C CB    . CYS A 1 62  ? 8.139   14.504  19.308  1.00   49.36  ? 47  CYS A CB    1 
ATOM   343  S SG    . CYS A 1 62  ? 7.822   15.642  17.956  1.00   57.16  ? 47  CYS A SG    1 
ATOM   344  N N     . THR A 1 63  ? 7.924   11.820  20.969  1.00   43.33  ? 48  THR A N     1 
ATOM   345  C CA    . THR A 1 63  ? 8.396   10.883  21.983  1.00   38.24  ? 48  THR A CA    1 
ATOM   346  C C     . THR A 1 63  ? 8.825   9.594   21.306  1.00   40.47  ? 48  THR A C     1 
ATOM   347  O O     . THR A 1 63  ? 9.907   9.068   21.555  1.00   43.14  ? 48  THR A O     1 
ATOM   348  C CB    . THR A 1 63  ? 7.280   10.575  23.015  1.00   43.40  ? 48  THR A CB    1 
ATOM   349  O OG1   . THR A 1 63  ? 6.830   11.798  23.614  1.00   42.22  ? 48  THR A OG1   1 
ATOM   350  C CG2   . THR A 1 63  ? 7.776   9.624   24.113  1.00   38.59  ? 48  THR A CG2   1 
ATOM   351  N N     . VAL A 1 64  ? 7.968   9.094   20.425  1.00   43.81  ? 49  VAL A N     1 
ATOM   352  C CA    . VAL A 1 64  ? 8.210   7.815   19.782  1.00   40.87  ? 49  VAL A CA    1 
ATOM   353  C C     . VAL A 1 64  ? 9.403   7.895   18.819  1.00   42.12  ? 49  VAL A C     1 
ATOM   354  O O     . VAL A 1 64  ? 10.295  7.044   18.857  1.00   39.30  ? 49  VAL A O     1 
ATOM   355  C CB    . VAL A 1 64  ? 6.930   7.305   19.089  1.00   43.90  ? 49  VAL A CB    1 
ATOM   356  C CG1   . VAL A 1 64  ? 7.156   5.925   18.484  1.00   38.84  ? 49  VAL A CG1   1 
ATOM   357  C CG2   . VAL A 1 64  ? 5.786   7.252   20.105  1.00   44.68  ? 49  VAL A CG2   1 
ATOM   358  N N     . LEU A 1 65  ? 9.423   8.922   17.971  1.00   42.94  ? 50  LEU A N     1 
ATOM   359  C CA    . LEU A 1 65  ? 10.573  9.158   17.087  1.00   46.73  ? 50  LEU A CA    1 
ATOM   360  C C     . LEU A 1 65  ? 11.882  9.197   17.860  1.00   46.71  ? 50  LEU A C     1 
ATOM   361  O O     . LEU A 1 65  ? 12.842  8.515   17.506  1.00   49.93  ? 50  LEU A O     1 
ATOM   362  C CB    . LEU A 1 65  ? 10.398  10.451  16.308  1.00   45.31  ? 50  LEU A CB    1 
ATOM   363  C CG    . LEU A 1 65  ? 9.291   10.349  15.266  1.00   50.18  ? 50  LEU A CG    1 
ATOM   364  C CD1   . LEU A 1 65  ? 8.985   11.733  14.711  1.00   49.21  ? 50  LEU A CD1   1 
ATOM   365  C CD2   . LEU A 1 65  ? 9.659   9.331   14.160  1.00   41.77  ? 50  LEU A CD2   1 
ATOM   366  N N     . SER A 1 66  ? 11.904  9.980   18.932  1.00   46.14  ? 51  SER A N     1 
ATOM   367  C CA    . SER A 1 66  ? 13.066  10.045  19.799  1.00   44.67  ? 51  SER A CA    1 
ATOM   368  C C     . SER A 1 66  ? 13.479  8.678   20.297  1.00   49.68  ? 51  SER A C     1 
ATOM   369  O O     . SER A 1 66  ? 14.657  8.345   20.282  1.00   51.40  ? 51  SER A O     1 
ATOM   370  C CB    . SER A 1 66  ? 12.778  10.927  21.009  1.00   53.49  ? 51  SER A CB    1 
ATOM   371  O OG    . SER A 1 66  ? 13.611  10.548  22.101  1.00   58.52  ? 51  SER A OG    1 
ATOM   372  N N     . LEU A 1 67  ? 12.523  7.889   20.777  1.00   48.71  ? 52  LEU A N     1 
ATOM   373  C CA    . LEU A 1 67  ? 12.875  6.585   21.332  1.00   46.44  ? 52  LEU A CA    1 
ATOM   374  C C     . LEU A 1 67  ? 13.410  5.688   20.226  1.00   45.71  ? 52  LEU A C     1 
ATOM   375  O O     . LEU A 1 67  ? 14.192  4.783   20.477  1.00   47.09  ? 52  LEU A O     1 
ATOM   376  C CB    . LEU A 1 67  ? 11.668  5.921   21.996  1.00   49.75  ? 52  LEU A CB    1 
ATOM   377  C CG    . LEU A 1 67  ? 11.094  6.550   23.269  1.00   50.48  ? 52  LEU A CG    1 
ATOM   378  C CD1   . LEU A 1 67  ? 9.821   5.836   23.686  1.00   48.99  ? 52  LEU A CD1   1 
ATOM   379  C CD2   . LEU A 1 67  ? 12.105  6.486   24.376  1.00   49.37  ? 52  LEU A CD2   1 
ATOM   380  N N     . LEU A 1 68  ? 12.978  5.946   19.000  1.00   45.04  ? 53  LEU A N     1 
ATOM   381  C CA    . LEU A 1 68  ? 13.403  5.148   17.857  1.00   49.20  ? 53  LEU A CA    1 
ATOM   382  C C     . LEU A 1 68  ? 14.747  5.609   17.300  1.00   51.91  ? 53  LEU A C     1 
ATOM   383  O O     . LEU A 1 68  ? 15.296  4.968   16.407  1.00   51.74  ? 53  LEU A O     1 
ATOM   384  C CB    . LEU A 1 68  ? 12.347  5.172   16.747  1.00   44.98  ? 53  LEU A CB    1 
ATOM   385  C CG    . LEU A 1 68  ? 11.024  4.436   16.987  1.00   42.39  ? 53  LEU A CG    1 
ATOM   386  C CD1   . LEU A 1 68  ? 9.992   4.819   15.926  1.00   41.32  ? 53  LEU A CD1   1 
ATOM   387  C CD2   . LEU A 1 68  ? 11.237  2.935   17.041  1.00   41.82  ? 53  LEU A CD2   1 
ATOM   388  N N     . GLY A 1 69  ? 15.263  6.723   17.818  1.00   52.66  ? 54  GLY A N     1 
ATOM   389  C CA    . GLY A 1 69  ? 16.583  7.200   17.436  1.00   52.39  ? 54  GLY A CA    1 
ATOM   390  C C     . GLY A 1 69  ? 16.586  8.266   16.352  1.00   56.27  ? 54  GLY A C     1 
ATOM   391  O O     . GLY A 1 69  ? 17.642  8.663   15.864  1.00   61.99  ? 54  GLY A O     1 
ATOM   392  N N     . ALA A 1 70  ? 15.407  8.740   15.975  1.00   51.06  ? 55  ALA A N     1 
ATOM   393  C CA    . ALA A 1 70  ? 15.302  9.748   14.940  1.00   51.72  ? 55  ALA A CA    1 
ATOM   394  C C     . ALA A 1 70  ? 15.354  11.147  15.524  1.00   59.61  ? 55  ALA A C     1 
ATOM   395  O O     . ALA A 1 70  ? 14.519  11.517  16.357  1.00   58.74  ? 55  ALA A O     1 
ATOM   396  C CB    . ALA A 1 70  ? 14.029  9.562   14.151  1.00   52.49  ? 55  ALA A CB    1 
ATOM   397  N N     . PRO A 1 71  ? 16.356  11.930  15.109  1.00   62.61  ? 56  PRO A N     1 
ATOM   398  C CA    . PRO A 1 71  ? 16.390  13.335  15.512  1.00   59.09  ? 56  PRO A CA    1 
ATOM   399  C C     . PRO A 1 71  ? 15.127  13.992  15.027  1.00   56.32  ? 56  PRO A C     1 
ATOM   400  O O     . PRO A 1 71  ? 14.797  13.890  13.848  1.00   62.73  ? 56  PRO A O     1 
ATOM   401  C CB    . PRO A 1 71  ? 17.598  13.879  14.757  1.00   59.95  ? 56  PRO A CB    1 
ATOM   402  C CG    . PRO A 1 71  ? 18.521  12.689  14.674  1.00   62.90  ? 56  PRO A CG    1 
ATOM   403  C CD    . PRO A 1 71  ? 17.600  11.515  14.439  1.00   60.51  ? 56  PRO A CD    1 
ATOM   404  N N     . CYS A 1 72  ? 14.411  14.643  15.929  1.00   52.91  ? 57  CYS A N     1 
ATOM   405  C CA    . CYS A 1 72  ? 13.141  15.237  15.559  1.00   57.10  ? 57  CYS A CA    1 
ATOM   406  C C     . CYS A 1 72  ? 12.920  16.499  16.360  1.00   53.78  ? 57  CYS A C     1 
ATOM   407  O O     . CYS A 1 72  ? 13.657  16.792  17.298  1.00   55.17  ? 57  CYS A O     1 
ATOM   408  C CB    . CYS A 1 72  ? 11.994  14.251  15.810  1.00   59.72  ? 57  CYS A CB    1 
ATOM   409  S SG    . CYS A 1 72  ? 11.661  13.902  17.575  1.00   55.92  ? 57  CYS A SG    1 
ATOM   410  N N     . ALA A 1 73  ? 11.894  17.240  15.984  1.00   50.81  ? 58  ALA A N     1 
ATOM   411  C CA    . ALA A 1 73  ? 11.603  18.502  16.616  1.00   56.41  ? 58  ALA A CA    1 
ATOM   412  C C     . ALA A 1 73  ? 10.108  18.682  16.607  1.00   55.26  ? 58  ALA A C     1 
ATOM   413  O O     . ALA A 1 73  ? 9.423   18.164  15.724  1.00   57.16  ? 58  ALA A O     1 
ATOM   414  C CB    . ALA A 1 73  ? 12.266  19.630  15.841  1.00   63.35  ? 58  ALA A CB    1 
ATOM   415  N N     . PHE A 1 74  ? 9.607   19.432  17.578  1.00   52.68  ? 59  PHE A N     1 
ATOM   416  C CA    . PHE A 1 74  ? 8.179   19.678  17.698  1.00   53.97  ? 59  PHE A CA    1 
ATOM   417  C C     . PHE A 1 74  ? 7.880   21.145  17.503  1.00   56.26  ? 59  PHE A C     1 
ATOM   418  O O     . PHE A 1 74  ? 8.691   22.003  17.838  1.00   63.97  ? 59  PHE A O     1 
ATOM   419  C CB    . PHE A 1 74  ? 7.692   19.253  19.089  1.00   55.60  ? 59  PHE A CB    1 
ATOM   420  C CG    . PHE A 1 74  ? 6.328   19.783  19.451  1.00   54.67  ? 59  PHE A CG    1 
ATOM   421  C CD1   . PHE A 1 74  ? 5.182   19.136  19.028  1.00   52.84  ? 59  PHE A CD1   1 
ATOM   422  C CD2   . PHE A 1 74  ? 6.195   20.915  20.237  1.00   56.23  ? 59  PHE A CD2   1 
ATOM   423  C CE1   . PHE A 1 74  ? 3.934   19.611  19.372  1.00   50.02  ? 59  PHE A CE1   1 
ATOM   424  C CE2   . PHE A 1 74  ? 4.946   21.395  20.580  1.00   49.22  ? 59  PHE A CE2   1 
ATOM   425  C CZ    . PHE A 1 74  ? 3.818   20.744  20.146  1.00   53.18  ? 59  PHE A CZ    1 
ATOM   426  N N     . MET A 1 75  ? 6.694   21.430  16.991  1.00   58.88  ? 60  MET A N     1 
ATOM   427  C CA    . MET A 1 75  ? 6.248   22.798  16.821  1.00   62.05  ? 60  MET A CA    1 
ATOM   428  C C     . MET A 1 75  ? 4.777   22.897  17.156  1.00   57.06  ? 60  MET A C     1 
ATOM   429  O O     . MET A 1 75  ? 3.947   22.238  16.545  1.00   58.08  ? 60  MET A O     1 
ATOM   430  C CB    . MET A 1 75  ? 6.473   23.266  15.382  1.00   64.71  ? 60  MET A CB    1 
ATOM   431  C CG    . MET A 1 75  ? 5.649   24.497  15.002  1.00   65.99  ? 60  MET A CG    1 
ATOM   432  S SD    . MET A 1 75  ? 6.106   25.182  13.394  1.00   79.61  ? 60  MET A SD    1 
ATOM   433  C CE    . MET A 1 75  ? 5.325   26.792  13.474  1.00   74.92  ? 60  MET A CE    1 
ATOM   434  N N     . GLY A 1 76  ? 4.459   23.732  18.131  1.00   59.86  ? 61  GLY A N     1 
ATOM   435  C CA    . GLY A 1 76  ? 3.080   23.960  18.508  1.00   63.02  ? 61  GLY A CA    1 
ATOM   436  C C     . GLY A 1 76  ? 3.004   25.085  19.519  1.00   67.05  ? 61  GLY A C     1 
ATOM   437  O O     . GLY A 1 76  ? 4.032   25.539  20.030  1.00   65.03  ? 61  GLY A O     1 
ATOM   438  N N     . SER A 1 77  ? 1.785   25.530  19.806  1.00   66.10  ? 62  SER A N     1 
ATOM   439  C CA    . SER A 1 77  ? 1.556   26.579  20.789  1.00   68.35  ? 62  SER A CA    1 
ATOM   440  C C     . SER A 1 77  ? 1.744   26.110  22.229  1.00   71.96  ? 62  SER A C     1 
ATOM   441  O O     . SER A 1 77  ? 1.206   25.083  22.641  1.00   70.65  ? 62  SER A O     1 
ATOM   442  C CB    . SER A 1 77  ? 0.145   27.139  20.637  1.00   68.98  ? 62  SER A CB    1 
ATOM   443  O OG    . SER A 1 77  ? 0.023   27.857  19.432  1.00   76.89  ? 62  SER A OG    1 
ATOM   444  N N     . MET A 1 78  ? 2.507   26.882  22.993  1.00   72.72  ? 63  MET A N     1 
ATOM   445  C CA    . MET A 1 78  ? 2.553   26.722  24.442  1.00   70.72  ? 63  MET A CA    1 
ATOM   446  C C     . MET A 1 78  ? 2.543   28.093  25.118  1.00   72.72  ? 63  MET A C     1 
ATOM   447  O O     . MET A 1 78  ? 3.148   29.043  24.619  1.00   72.12  ? 63  MET A O     1 
ATOM   448  C CB    . MET A 1 78  ? 3.791   25.934  24.862  1.00   67.83  ? 63  MET A CB    1 
ATOM   449  C CG    . MET A 1 78  ? 3.782   24.479  24.435  1.00   70.15  ? 63  MET A CG    1 
ATOM   450  S SD    . MET A 1 78  ? 5.130   23.534  25.180  1.00   80.20  ? 63  MET A SD    1 
ATOM   451  C CE    . MET A 1 78  ? 6.518   24.017  24.165  1.00   58.27  ? 63  MET A CE    1 
ATOM   452  N N     . ALA A 1 79  ? 1.841   28.196  26.242  1.00   71.98  ? 64  ALA A N     1 
ATOM   453  C CA    . ALA A 1 79  ? 1.835   29.421  27.037  1.00   70.00  ? 64  ALA A CA    1 
ATOM   454  C C     . ALA A 1 79  ? 2.814   29.280  28.194  1.00   67.39  ? 64  ALA A C     1 
ATOM   455  O O     . ALA A 1 79  ? 2.776   28.284  28.919  1.00   68.13  ? 64  ALA A O     1 
ATOM   456  C CB    . ALA A 1 79  ? 0.426   29.720  27.561  1.00   69.13  ? 64  ALA A CB    1 
ATOM   457  N N     . PRO A 1 80  ? 3.704   30.271  28.369  1.00   68.69  ? 65  PRO A N     1 
ATOM   458  C CA    . PRO A 1 80  ? 4.629   30.223  29.505  1.00   64.99  ? 65  PRO A CA    1 
ATOM   459  C C     . PRO A 1 80  ? 3.879   29.996  30.817  1.00   63.82  ? 65  PRO A C     1 
ATOM   460  O O     . PRO A 1 80  ? 2.787   30.546  31.013  1.00   62.58  ? 65  PRO A O     1 
ATOM   461  C CB    . PRO A 1 80  ? 5.283   31.607  29.474  1.00   69.05  ? 65  PRO A CB    1 
ATOM   462  C CG    . PRO A 1 80  ? 5.249   31.993  28.034  1.00   65.28  ? 65  PRO A CG    1 
ATOM   463  C CD    . PRO A 1 80  ? 3.939   31.451  27.516  1.00   69.31  ? 65  PRO A CD    1 
ATOM   464  N N     . GLY A 1 81  ? 4.459   29.173  31.690  1.00   60.57  ? 66  GLY A N     1 
ATOM   465  C CA    . GLY A 1 81  ? 3.822   28.784  32.936  1.00   62.68  ? 66  GLY A CA    1 
ATOM   466  C C     . GLY A 1 81  ? 4.514   27.587  33.568  1.00   62.66  ? 66  GLY A C     1 
ATOM   467  O O     . GLY A 1 81  ? 5.543   27.129  33.068  1.00   63.72  ? 66  GLY A O     1 
ATOM   468  N N     . HIS A 1 82  ? 3.960   27.072  34.663  1.00   61.14  ? 67  HIS A N     1 
ATOM   469  C CA    . HIS A 1 82  ? 4.549   25.896  35.308  1.00   63.90  ? 67  HIS A CA    1 
ATOM   470  C C     . HIS A 1 82  ? 4.283   24.597  34.538  1.00   61.13  ? 67  HIS A C     1 
ATOM   471  O O     . HIS A 1 82  ? 5.162   23.742  34.439  1.00   63.33  ? 67  HIS A O     1 
ATOM   472  C CB    . HIS A 1 82  ? 4.093   25.765  36.762  1.00   65.58  ? 67  HIS A CB    1 
ATOM   473  C CG    . HIS A 1 82  ? 4.713   26.774  37.679  1.00   70.78  ? 67  HIS A CG    1 
ATOM   474  N ND1   . HIS A 1 82  ? 4.080   27.945  38.031  1.00   65.33  ? 67  HIS A ND1   1 
ATOM   475  C CD2   . HIS A 1 82  ? 5.915   26.786  38.303  1.00   75.29  ? 67  HIS A CD2   1 
ATOM   476  C CE1   . HIS A 1 82  ? 4.865   28.638  38.842  1.00   73.43  ? 67  HIS A CE1   1 
ATOM   477  N NE2   . HIS A 1 82  ? 5.980   27.956  39.023  1.00   78.04  ? 67  HIS A NE2   1 
ATOM   478  N N     . VAL A 1 83  ? 3.077   24.456  33.998  1.00   56.20  ? 68  VAL A N     1 
ATOM   479  C CA    . VAL A 1 83  ? 2.757   23.321  33.142  1.00   60.49  ? 68  VAL A CA    1 
ATOM   480  C C     . VAL A 1 83  ? 3.718   23.253  31.959  1.00   60.47  ? 68  VAL A C     1 
ATOM   481  O O     . VAL A 1 83  ? 4.478   22.287  31.816  1.00   57.82  ? 68  VAL A O     1 
ATOM   482  C CB    . VAL A 1 83  ? 1.312   23.382  32.634  1.00   57.37  ? 68  VAL A CB    1 
ATOM   483  C CG1   . VAL A 1 83  ? 1.065   22.281  31.620  1.00   55.15  ? 68  VAL A CG1   1 
ATOM   484  C CG2   . VAL A 1 83  ? 0.350   23.249  33.804  1.00   55.71  ? 68  VAL A CG2   1 
ATOM   485  N N     . ALA A 1 84  ? 3.688   24.285  31.122  1.00   57.94  ? 69  ALA A N     1 
ATOM   486  C CA    . ALA A 1 84  ? 4.601   24.371  29.992  1.00   58.23  ? 69  ALA A CA    1 
ATOM   487  C C     . ALA A 1 84  ? 6.025   24.035  30.423  1.00   62.21  ? 69  ALA A C     1 
ATOM   488  O O     . ALA A 1 84  ? 6.759   23.349  29.699  1.00   62.01  ? 69  ALA A O     1 
ATOM   489  C CB    . ALA A 1 84  ? 4.550   25.751  29.359  1.00   61.35  ? 69  ALA A CB    1 
ATOM   490  N N     . ASP A 1 85  ? 6.420   24.508  31.601  1.00   58.78  ? 70  ASP A N     1 
ATOM   491  C CA    . ASP A 1 85  ? 7.762   24.222  32.077  1.00   59.69  ? 70  ASP A CA    1 
ATOM   492  C C     . ASP A 1 85  ? 7.941   22.711  32.204  1.00   60.51  ? 70  ASP A C     1 
ATOM   493  O O     . ASP A 1 85  ? 8.954   22.159  31.772  1.00   60.91  ? 70  ASP A O     1 
ATOM   494  C CB    . ASP A 1 85  ? 8.051   24.927  33.409  1.00   65.27  ? 70  ASP A CB    1 
ATOM   495  C CG    . ASP A 1 85  ? 8.330   26.429  33.245  1.00   73.92  ? 70  ASP A CG    1 
ATOM   496  O OD1   . ASP A 1 85  ? 8.666   26.880  32.115  1.00   65.40  ? 70  ASP A OD1   1 
ATOM   497  O OD2   . ASP A 1 85  ? 8.227   27.158  34.265  1.00   72.96  ? 70  ASP A OD2   1 
ATOM   498  N N     . PHE A 1 86  ? 6.952   22.039  32.790  1.00   59.09  ? 71  PHE A N     1 
ATOM   499  C CA    . PHE A 1 86  ? 6.982   20.580  32.866  1.00   57.59  ? 71  PHE A CA    1 
ATOM   500  C C     . PHE A 1 86  ? 7.110   19.955  31.472  1.00   52.13  ? 71  PHE A C     1 
ATOM   501  O O     . PHE A 1 86  ? 7.991   19.137  31.221  1.00   53.71  ? 71  PHE A O     1 
ATOM   502  C CB    . PHE A 1 86  ? 5.731   20.046  33.554  1.00   57.78  ? 71  PHE A CB    1 
ATOM   503  C CG    . PHE A 1 86  ? 5.533   18.572  33.375  1.00   54.68  ? 71  PHE A CG    1 
ATOM   504  C CD1   . PHE A 1 86  ? 6.125   17.668  34.248  1.00   55.71  ? 71  PHE A CD1   1 
ATOM   505  C CD2   . PHE A 1 86  ? 4.762   18.086  32.327  1.00   50.85  ? 71  PHE A CD2   1 
ATOM   506  C CE1   . PHE A 1 86  ? 5.946   16.294  34.081  1.00   53.45  ? 71  PHE A CE1   1 
ATOM   507  C CE2   . PHE A 1 86  ? 4.582   16.717  32.149  1.00   51.77  ? 71  PHE A CE2   1 
ATOM   508  C CZ    . PHE A 1 86  ? 5.166   15.822  33.028  1.00   51.15  ? 71  PHE A CZ    1 
ATOM   509  N N     . LEU A 1 87  ? 6.224   20.354  30.576  1.00   51.65  ? 72  LEU A N     1 
ATOM   510  C CA    . LEU A 1 87  ? 6.242   19.872  29.202  1.00   52.07  ? 72  LEU A CA    1 
ATOM   511  C C     . LEU A 1 87  ? 7.609   20.043  28.516  1.00   56.86  ? 72  LEU A C     1 
ATOM   512  O O     . LEU A 1 87  ? 8.174   19.072  27.980  1.00   51.34  ? 72  LEU A O     1 
ATOM   513  C CB    . LEU A 1 87  ? 5.119   20.542  28.411  1.00   44.63  ? 72  LEU A CB    1 
ATOM   514  C CG    . LEU A 1 87  ? 3.720   20.229  28.986  1.00   49.78  ? 72  LEU A CG    1 
ATOM   515  C CD1   . LEU A 1 87  ? 2.597   20.967  28.267  1.00   47.48  ? 72  LEU A CD1   1 
ATOM   516  C CD2   . LEU A 1 87  ? 3.426   18.727  28.985  1.00   46.18  ? 72  LEU A CD2   1 
ATOM   517  N N     . VAL A 1 88  ? 8.147   21.263  28.546  1.00   57.50  ? 73  VAL A N     1 
ATOM   518  C CA    . VAL A 1 88  ? 9.442   21.534  27.918  1.00   54.85  ? 73  VAL A CA    1 
ATOM   519  C C     . VAL A 1 88  ? 10.535  20.633  28.485  1.00   55.52  ? 73  VAL A C     1 
ATOM   520  O O     . VAL A 1 88  ? 11.371  20.083  27.750  1.00   57.10  ? 73  VAL A O     1 
ATOM   521  C CB    . VAL A 1 88  ? 9.869   23.008  28.076  1.00   62.17  ? 73  VAL A CB    1 
ATOM   522  C CG1   . VAL A 1 88  ? 11.317  23.199  27.624  1.00   66.64  ? 73  VAL A CG1   1 
ATOM   523  C CG2   . VAL A 1 88  ? 8.942   23.919  27.299  1.00   59.90  ? 73  VAL A CG2   1 
ATOM   524  N N     . ALA A 1 89  ? 10.523  20.476  29.798  1.00   53.27  ? 74  ALA A N     1 
ATOM   525  C CA    . ALA A 1 89  ? 11.508  19.636  30.452  1.00   56.40  ? 74  ALA A CA    1 
ATOM   526  C C     . ALA A 1 89  ? 11.403  18.222  29.898  1.00   56.79  ? 74  ALA A C     1 
ATOM   527  O O     . ALA A 1 89  ? 12.415  17.573  29.627  1.00   58.06  ? 74  ALA A O     1 
ATOM   528  C CB    . ALA A 1 89  ? 11.290  19.638  31.959  1.00   55.60  ? 74  ALA A CB    1 
ATOM   529  N N     . ASP A 1 90  ? 10.170  17.752  29.727  1.00   56.86  ? 75  ASP A N     1 
ATOM   530  C CA    . ASP A 1 90  ? 9.931   16.417  29.185  1.00   58.02  ? 75  ASP A CA    1 
ATOM   531  C C     . ASP A 1 90  ? 10.455  16.325  27.761  1.00   51.72  ? 75  ASP A C     1 
ATOM   532  O O     . ASP A 1 90  ? 11.200  15.411  27.422  1.00   53.94  ? 75  ASP A O     1 
ATOM   533  C CB    . ASP A 1 90  ? 8.443   16.070  29.207  1.00   56.76  ? 75  ASP A CB    1 
ATOM   534  C CG    . ASP A 1 90  ? 8.195   14.586  28.980  1.00   62.07  ? 75  ASP A CG    1 
ATOM   535  O OD1   . ASP A 1 90  ? 8.231   13.831  29.980  1.00   62.07  ? 75  ASP A OD1   1 
ATOM   536  O OD2   . ASP A 1 90  ? 7.986   14.173  27.810  1.00   56.09  ? 75  ASP A OD2   1 
ATOM   537  N N     . PHE A 1 91  ? 10.057  17.281  26.931  1.00   50.38  ? 76  PHE A N     1 
ATOM   538  C CA    . PHE A 1 91  ? 10.595  17.394  25.584  1.00   48.05  ? 76  PHE A CA    1 
ATOM   539  C C     . PHE A 1 91  ? 12.111  17.267  25.589  1.00   56.38  ? 76  PHE A C     1 
ATOM   540  O O     . PHE A 1 91  ? 12.677  16.455  24.856  1.00   55.33  ? 76  PHE A O     1 
ATOM   541  C CB    . PHE A 1 91  ? 10.192  18.729  24.985  1.00   49.07  ? 76  PHE A CB    1 
ATOM   542  C CG    . PHE A 1 91  ? 8.865   18.706  24.280  1.00   47.87  ? 76  PHE A CG    1 
ATOM   543  C CD1   . PHE A 1 91  ? 7.919   19.670  24.541  1.00   46.98  ? 76  PHE A CD1   1 
ATOM   544  C CD2   . PHE A 1 91  ? 8.584   17.737  23.329  1.00   46.97  ? 76  PHE A CD2   1 
ATOM   545  C CE1   . PHE A 1 91  ? 6.705   19.658  23.892  1.00   47.34  ? 76  PHE A CE1   1 
ATOM   546  C CE2   . PHE A 1 91  ? 7.374   17.727  22.662  1.00   46.61  ? 76  PHE A CE2   1 
ATOM   547  C CZ    . PHE A 1 91  ? 6.432   18.688  22.946  1.00   47.29  ? 76  PHE A CZ    1 
ATOM   548  N N     . ARG A 1 92  ? 12.768  18.056  26.435  1.00   55.80  ? 77  ARG A N     1 
ATOM   549  C CA    . ARG A 1 92  ? 14.227  18.065  26.469  1.00   54.62  ? 77  ARG A CA    1 
ATOM   550  C C     . ARG A 1 92  ? 14.833  16.757  26.946  1.00   57.66  ? 77  ARG A C     1 
ATOM   551  O O     . ARG A 1 92  ? 15.857  16.324  26.422  1.00   59.04  ? 77  ARG A O     1 
ATOM   552  C CB    . ARG A 1 92  ? 14.752  19.234  27.304  1.00   64.06  ? 77  ARG A CB    1 
ATOM   553  C CG    . ARG A 1 92  ? 14.583  20.584  26.609  1.00   71.84  ? 77  ARG A CG    1 
ATOM   554  C CD    . ARG A 1 92  ? 15.016  21.750  27.489  1.00   76.27  ? 77  ARG A CD    1 
ATOM   555  N NE    . ARG A 1 92  ? 14.668  23.027  26.868  1.00   80.61  ? 77  ARG A NE    1 
ATOM   556  C CZ    . ARG A 1 92  ? 14.768  24.207  27.469  1.00   81.75  ? 77  ARG A CZ    1 
ATOM   557  N NH1   . ARG A 1 92  ? 15.208  24.289  28.722  1.00   77.26  ? 77  ARG A NH1   1 
ATOM   558  N NH2   . ARG A 1 92  ? 14.421  25.307  26.814  1.00   81.08  ? 77  ARG A NH2   1 
ATOM   559  N N     . ARG A 1 93  ? 14.215  16.122  27.935  1.00   54.86  ? 78  ARG A N     1 
ATOM   560  C CA    . ARG A 1 93  ? 14.717  14.838  28.407  1.00   55.16  ? 78  ARG A CA    1 
ATOM   561  C C     . ARG A 1 93  ? 14.666  13.792  27.289  1.00   55.63  ? 78  ARG A C     1 
ATOM   562  O O     . ARG A 1 93  ? 15.426  12.826  27.290  1.00   56.86  ? 78  ARG A O     1 
ATOM   563  C CB    . ARG A 1 93  ? 13.922  14.355  29.620  1.00   62.25  ? 78  ARG A CB    1 
ATOM   564  C CG    . ARG A 1 93  ? 14.482  13.080  30.256  1.00   68.08  ? 78  ARG A CG    1 
ATOM   565  C CD    . ARG A 1 93  ? 13.631  12.620  31.426  1.00   70.88  ? 78  ARG A CD    1 
ATOM   566  N NE    . ARG A 1 93  ? 13.215  13.750  32.250  1.00   80.06  ? 78  ARG A NE    1 
ATOM   567  C CZ    . ARG A 1 93  ? 12.019  14.330  32.175  1.00   77.40  ? 78  ARG A CZ    1 
ATOM   568  N NH1   . ARG A 1 93  ? 11.111  13.873  31.317  1.00   75.40  ? 78  ARG A NH1   1 
ATOM   569  N NH2   . ARG A 1 93  ? 11.729  15.362  32.960  1.00   70.18  ? 78  ARG A NH2   1 
ATOM   570  N N     . ARG A 1 94  ? 13.763  13.990  26.336  1.00   54.48  ? 79  ARG A N     1 
ATOM   571  C CA    . ARG A 1 94  ? 13.645  13.087  25.198  1.00   57.25  ? 79  ARG A CA    1 
ATOM   572  C C     . ARG A 1 94  ? 14.573  13.522  24.057  1.00   61.36  ? 79  ARG A C     1 
ATOM   573  O O     . ARG A 1 94  ? 14.755  12.797  23.079  1.00   59.48  ? 79  ARG A O     1 
ATOM   574  C CB    . ARG A 1 94  ? 12.199  13.047  24.700  1.00   55.77  ? 79  ARG A CB    1 
ATOM   575  C CG    . ARG A 1 94  ? 11.192  12.485  25.698  1.00   57.74  ? 79  ARG A CG    1 
ATOM   576  C CD    . ARG A 1 94  ? 11.398  10.989  25.919  1.00   56.05  ? 79  ARG A CD    1 
ATOM   577  N NE    . ARG A 1 94  ? 10.389  10.420  26.811  1.00   58.34  ? 79  ARG A NE    1 
ATOM   578  C CZ    . ARG A 1 94  ? 10.533  9.257   27.440  1.00   60.59  ? 79  ARG A CZ    1 
ATOM   579  N NH1   . ARG A 1 94  ? 11.649  8.554   27.281  1.00   59.82  ? 79  ARG A NH1   1 
ATOM   580  N NH2   . ARG A 1 94  ? 9.571   8.800   28.231  1.00   60.45  ? 79  ARG A NH2   1 
ATOM   581  N N     . GLY A 1 95  ? 15.149  14.713  24.178  1.00   59.22  ? 80  GLY A N     1 
ATOM   582  C CA    . GLY A 1 95  ? 16.025  15.227  23.145  1.00   55.55  ? 80  GLY A CA    1 
ATOM   583  C C     . GLY A 1 95  ? 15.256  15.823  21.986  1.00   59.03  ? 80  GLY A C     1 
ATOM   584  O O     . GLY A 1 95  ? 15.795  15.971  20.885  1.00   59.89  ? 80  GLY A O     1 
ATOM   585  N N     . VAL A 1 96  ? 13.993  16.169  22.223  1.00   55.69  ? 81  VAL A N     1 
ATOM   586  C CA    . VAL A 1 96  ? 13.189  16.792  21.184  1.00   54.44  ? 81  VAL A CA    1 
ATOM   587  C C     . VAL A 1 96  ? 13.500  18.275  21.097  1.00   60.21  ? 81  VAL A C     1 
ATOM   588  O O     . VAL A 1 96  ? 13.493  18.977  22.103  1.00   62.78  ? 81  VAL A O     1 
ATOM   589  C CB    . VAL A 1 96  ? 11.686  16.618  21.431  1.00   52.65  ? 81  VAL A CB    1 
ATOM   590  C CG1   . VAL A 1 96  ? 10.881  17.249  20.293  1.00   51.57  ? 81  VAL A CG1   1 
ATOM   591  C CG2   . VAL A 1 96  ? 11.349  15.152  21.579  1.00   53.16  ? 81  VAL A CG2   1 
ATOM   592  N N     . ASP A 1 97  ? 13.783  18.739  19.885  1.00   64.85  ? 82  ASP A N     1 
ATOM   593  C CA    . ASP A 1 97  ? 14.009  20.150  19.613  1.00   62.05  ? 82  ASP A CA    1 
ATOM   594  C C     . ASP A 1 97  ? 12.687  20.887  19.752  1.00   60.64  ? 82  ASP A C     1 
ATOM   595  O O     . ASP A 1 97  ? 11.709  20.538  19.105  1.00   62.91  ? 82  ASP A O     1 
ATOM   596  C CB    . ASP A 1 97  ? 14.573  20.303  18.198  1.00   63.56  ? 82  ASP A CB    1 
ATOM   597  C CG    . ASP A 1 97  ? 14.891  21.749  17.827  1.00   73.45  ? 82  ASP A CG    1 
ATOM   598  O OD1   . ASP A 1 97  ? 16.017  22.000  17.339  1.00   79.06  ? 82  ASP A OD1   1 
ATOM   599  O OD2   . ASP A 1 97  ? 14.017  22.627  17.989  1.00   72.67  ? 82  ASP A OD2   1 
ATOM   600  N N     . VAL A 1 98  ? 12.655  21.906  20.602  1.00   65.58  ? 83  VAL A N     1 
ATOM   601  C CA    . VAL A 1 98  ? 11.431  22.676  20.822  1.00   66.02  ? 83  VAL A CA    1 
ATOM   602  C C     . VAL A 1 98  ? 11.569  24.113  20.299  1.00   70.81  ? 83  VAL A C     1 
ATOM   603  O O     . VAL A 1 98  ? 10.650  24.926  20.427  1.00   66.96  ? 83  VAL A O     1 
ATOM   604  C CB    . VAL A 1 98  ? 11.068  22.710  22.319  1.00   66.53  ? 83  VAL A CB    1 
ATOM   605  C CG1   . VAL A 1 98  ? 10.833  21.300  22.837  1.00   58.80  ? 83  VAL A CG1   1 
ATOM   606  C CG2   . VAL A 1 98  ? 12.182  23.377  23.115  1.00   67.14  ? 83  VAL A CG2   1 
ATOM   607  N N     . SER A 1 99  ? 12.715  24.408  19.689  1.00   69.90  ? 84  SER A N     1 
ATOM   608  C CA    . SER A 1 99  ? 13.051  25.777  19.288  1.00   73.87  ? 84  SER A CA    1 
ATOM   609  C C     . SER A 1 99  ? 12.002  26.454  18.410  1.00   71.30  ? 84  SER A C     1 
ATOM   610  O O     . SER A 1 99  ? 11.900  27.678  18.402  1.00   72.23  ? 84  SER A O     1 
ATOM   611  C CB    . SER A 1 99  ? 14.427  25.834  18.613  1.00   70.26  ? 84  SER A CB    1 
ATOM   612  O OG    . SER A 1 99  ? 14.389  25.231  17.334  1.00   78.23  ? 84  SER A OG    1 
ATOM   613  N N     . GLN A 1 100 ? 11.211  25.672  17.685  1.00   70.35  ? 85  GLN A N     1 
ATOM   614  C CA    . GLN A 1 100 ? 10.205  26.272  16.806  1.00   71.70  ? 85  GLN A CA    1 
ATOM   615  C C     . GLN A 1 100 ? 8.843   26.410  17.461  1.00   66.93  ? 85  GLN A C     1 
ATOM   616  O O     . GLN A 1 100 ? 7.847   26.667  16.781  1.00   67.40  ? 85  GLN A O     1 
ATOM   617  C CB    . GLN A 1 100 ? 10.078  25.507  15.482  1.00   75.65  ? 85  GLN A CB    1 
ATOM   618  C CG    . GLN A 1 100 ? 10.942  26.068  14.358  1.00   77.94  ? 85  GLN A CG    1 
ATOM   619  C CD    . GLN A 1 100 ? 12.371  25.561  14.403  1.00   81.95  ? 85  GLN A CD    1 
ATOM   620  O OE1   . GLN A 1 100 ? 12.640  24.469  14.909  1.00   80.86  ? 85  GLN A OE1   1 
ATOM   621  N NE2   . GLN A 1 100 ? 13.297  26.350  13.866  1.00   86.99  ? 85  GLN A NE2   1 
ATOM   622  N N     . VAL A 1 101 ? 8.801   26.249  18.781  1.00   66.84  ? 86  VAL A N     1 
ATOM   623  C CA    . VAL A 1 101 ? 7.545   26.382  19.512  1.00   67.51  ? 86  VAL A CA    1 
ATOM   624  C C     . VAL A 1 101 ? 6.967   27.787  19.385  1.00   67.80  ? 86  VAL A C     1 
ATOM   625  O O     . VAL A 1 101 ? 7.688   28.776  19.499  1.00   67.50  ? 86  VAL A O     1 
ATOM   626  C CB    . VAL A 1 101 ? 7.704   26.041  21.003  1.00   67.45  ? 86  VAL A CB    1 
ATOM   627  C CG1   . VAL A 1 101 ? 6.435   26.415  21.758  1.00   63.77  ? 86  VAL A CG1   1 
ATOM   628  C CG2   . VAL A 1 101 ? 8.026   24.565  21.178  1.00   66.23  ? 86  VAL A CG2   1 
ATOM   629  N N     . ALA A 1 102 ? 5.661   27.864  19.157  1.00   67.52  ? 87  ALA A N     1 
ATOM   630  C CA    . ALA A 1 102 ? 4.976   29.142  19.014  1.00   66.84  ? 87  ALA A CA    1 
ATOM   631  C C     . ALA A 1 102 ? 4.514   29.670  20.354  1.00   67.66  ? 87  ALA A C     1 
ATOM   632  O O     . ALA A 1 102 ? 3.315   29.650  20.644  1.00   72.96  ? 87  ALA A O     1 
ATOM   633  C CB    . ALA A 1 102 ? 3.779   28.999  18.082  1.00   71.95  ? 87  ALA A CB    1 
ATOM   634  N N     . TRP A 1 103 ? 5.453   30.154  21.162  1.00   66.31  ? 88  TRP A N     1 
ATOM   635  C CA    . TRP A 1 103 ? 5.126   30.685  22.489  1.00   68.98  ? 88  TRP A CA    1 
ATOM   636  C C     . TRP A 1 103 ? 4.086   31.785  22.440  1.00   72.53  ? 88  TRP A C     1 
ATOM   637  O O     . TRP A 1 103 ? 3.949   32.490  21.440  1.00   74.64  ? 88  TRP A O     1 
ATOM   638  C CB    . TRP A 1 103 ? 6.365   31.197  23.201  1.00   64.22  ? 88  TRP A CB    1 
ATOM   639  C CG    . TRP A 1 103 ? 7.244   30.111  23.653  1.00   65.78  ? 88  TRP A CG    1 
ATOM   640  C CD1   . TRP A 1 103 ? 8.434   29.739  23.108  1.00   65.58  ? 88  TRP A CD1   1 
ATOM   641  C CD2   . TRP A 1 103 ? 6.999   29.223  24.743  1.00   65.06  ? 88  TRP A CD2   1 
ATOM   642  N NE1   . TRP A 1 103 ? 8.962   28.680  23.804  1.00   68.72  ? 88  TRP A NE1   1 
ATOM   643  C CE2   . TRP A 1 103 ? 8.100   28.344  24.812  1.00   67.62  ? 88  TRP A CE2   1 
ATOM   644  C CE3   . TRP A 1 103 ? 5.966   29.092  25.672  1.00   66.12  ? 88  TRP A CE3   1 
ATOM   645  C CZ2   . TRP A 1 103 ? 8.192   27.344  25.776  1.00   66.86  ? 88  TRP A CZ2   1 
ATOM   646  C CZ3   . TRP A 1 103 ? 6.059   28.103  26.631  1.00   68.40  ? 88  TRP A CZ3   1 
ATOM   647  C CH2   . TRP A 1 103 ? 7.164   27.237  26.675  1.00   69.64  ? 88  TRP A CH2   1 
ATOM   648  N N     . GLN A 1 104 ? 3.362   31.938  23.539  1.00   74.08  ? 89  GLN A N     1 
ATOM   649  C CA    . GLN A 1 104 ? 2.220   32.829  23.557  1.00   75.52  ? 89  GLN A CA    1 
ATOM   650  C C     . GLN A 1 104 ? 2.080   33.655  24.830  1.00   80.88  ? 89  GLN A C     1 
ATOM   651  O O     . GLN A 1 104 ? 2.970   33.677  25.688  1.00   78.34  ? 89  GLN A O     1 
ATOM   652  C CB    . GLN A 1 104 ? 0.967   32.017  23.323  1.00   70.51  ? 89  GLN A CB    1 
ATOM   653  C CG    . GLN A 1 104 ? 1.055   31.229  22.061  1.00   73.13  ? 89  GLN A CG    1 
ATOM   654  C CD    . GLN A 1 104 ? -0.240  31.265  21.316  1.00   80.51  ? 89  GLN A CD    1 
ATOM   655  O OE1   . GLN A 1 104 ? -1.303  31.354  21.925  1.00   84.10  ? 89  GLN A OE1   1 
ATOM   656  N NE2   . GLN A 1 104 ? -0.172  31.218  19.994  1.00   80.27  ? 89  GLN A NE2   1 
ATOM   657  N N     . SER A 1 105 ? 0.949   34.342  24.929  1.00   83.08  ? 90  SER A N     1 
ATOM   658  C CA    . SER A 1 105 ? 0.667   35.210  26.058  1.00   83.41  ? 90  SER A CA    1 
ATOM   659  C C     . SER A 1 105 ? -0.833  35.260  26.280  1.00   84.78  ? 90  SER A C     1 
ATOM   660  O O     . SER A 1 105 ? -1.303  35.822  27.263  1.00   86.20  ? 90  SER A O     1 
ATOM   661  C CB    . SER A 1 105 ? 1.223   36.611  25.806  1.00   87.92  ? 90  SER A CB    1 
ATOM   662  O OG    . SER A 1 105 ? 0.780   37.118  24.558  1.00   87.93  ? 90  SER A OG    1 
ATOM   663  N N     . LYS A 1 106 ? -1.577  34.666  25.352  1.00   87.47  ? 91  LYS A N     1 
ATOM   664  C CA    . LYS A 1 106 ? -3.021  34.502  25.496  1.00   92.61  ? 91  LYS A CA    1 
ATOM   665  C C     . LYS A 1 106 ? -3.366  33.023  25.671  1.00   91.81  ? 91  LYS A C     1 
ATOM   666  O O     . LYS A 1 106 ? -2.882  32.180  24.910  1.00   87.08  ? 91  LYS A O     1 
ATOM   667  C CB    . LYS A 1 106 ? -3.747  35.036  24.261  1.00   93.05  ? 91  LYS A CB    1 
ATOM   668  C CG    . LYS A 1 106 ? -3.831  36.547  24.151  1.00   98.11  ? 91  LYS A CG    1 
ATOM   669  C CD    . LYS A 1 106 ? -4.733  36.929  22.979  1.00   103.42 ? 91  LYS A CD    1 
ATOM   670  C CE    . LYS A 1 106 ? -5.068  38.412  22.966  1.00   102.10 ? 91  LYS A CE    1 
ATOM   671  N NZ    . LYS A 1 106 ? -6.031  38.738  21.874  1.00   97.65  ? 91  LYS A NZ    1 
ATOM   672  N N     . GLY A 1 107 ? -4.201  32.711  26.663  1.00   88.45  ? 92  GLY A N     1 
ATOM   673  C CA    . GLY A 1 107 ? -4.660  31.346  26.884  1.00   83.84  ? 92  GLY A CA    1 
ATOM   674  C C     . GLY A 1 107 ? -3.754  30.453  27.727  1.00   80.94  ? 92  GLY A C     1 
ATOM   675  O O     . GLY A 1 107 ? -2.579  30.763  27.955  1.00   79.38  ? 92  GLY A O     1 
ATOM   676  N N     . ASP A 1 108 ? -4.310  29.332  28.183  1.00   79.27  ? 93  ASP A N     1 
ATOM   677  C CA    . ASP A 1 108 ? -3.570  28.354  28.985  1.00   74.14  ? 93  ASP A CA    1 
ATOM   678  C C     . ASP A 1 108 ? -3.083  27.188  28.132  1.00   68.56  ? 93  ASP A C     1 
ATOM   679  O O     . ASP A 1 108 ? -3.495  27.035  26.992  1.00   69.86  ? 93  ASP A O     1 
ATOM   680  C CB    . ASP A 1 108 ? -4.458  27.823  30.105  1.00   74.91  ? 93  ASP A CB    1 
ATOM   681  C CG    . ASP A 1 108 ? -4.987  28.926  30.994  1.00   84.88  ? 93  ASP A CG    1 
ATOM   682  O OD1   . ASP A 1 108 ? -4.189  29.810  31.376  1.00   88.14  ? 93  ASP A OD1   1 
ATOM   683  O OD2   . ASP A 1 108 ? -6.200  28.915  31.302  1.00   86.19  ? 93  ASP A OD2   1 
ATOM   684  N N     . THR A 1 109 ? -2.195  26.363  28.669  1.00   66.81  ? 94  THR A N     1 
ATOM   685  C CA    . THR A 1 109 ? -1.793  25.183  27.924  1.00   65.69  ? 94  THR A CA    1 
ATOM   686  C C     . THR A 1 109 ? -2.835  24.110  28.164  1.00   63.30  ? 94  THR A C     1 
ATOM   687  O O     . THR A 1 109 ? -3.247  23.898  29.306  1.00   61.41  ? 94  THR A O     1 
ATOM   688  C CB    . THR A 1 109 ? -0.388  24.691  28.306  1.00   64.78  ? 94  THR A CB    1 
ATOM   689  O OG1   . THR A 1 109 ? -0.422  24.049  29.584  1.00   68.15  ? 94  THR A OG1   1 
ATOM   690  C CG2   . THR A 1 109 ? 0.577   25.859  28.351  1.00   63.93  ? 94  THR A CG2   1 
ATOM   691  N N     . PRO A 1 110 ? -3.282  23.444  27.086  1.00   62.03  ? 95  PRO A N     1 
ATOM   692  C CA    . PRO A 1 110 ? -4.355  22.451  27.202  1.00   55.12  ? 95  PRO A CA    1 
ATOM   693  C C     . PRO A 1 110 ? -3.941  21.325  28.136  1.00   53.24  ? 95  PRO A C     1 
ATOM   694  O O     . PRO A 1 110 ? -2.756  21.020  28.282  1.00   51.51  ? 95  PRO A O     1 
ATOM   695  C CB    . PRO A 1 110 ? -4.504  21.911  25.773  1.00   58.60  ? 95  PRO A CB    1 
ATOM   696  C CG    . PRO A 1 110 ? -3.766  22.858  24.896  1.00   60.00  ? 95  PRO A CG    1 
ATOM   697  C CD    . PRO A 1 110 ? -2.693  23.469  25.737  1.00   59.74  ? 95  PRO A CD    1 
ATOM   698  N N     . SER A 1 111 ? -4.918  20.723  28.789  1.00   49.00  ? 96  SER A N     1 
ATOM   699  C CA    . SER A 1 111 ? -4.646  19.552  29.595  1.00   49.78  ? 96  SER A CA    1 
ATOM   700  C C     . SER A 1 111 ? -5.871  18.677  29.548  1.00   48.66  ? 96  SER A C     1 
ATOM   701  O O     . SER A 1 111 ? -6.900  19.056  28.992  1.00   49.58  ? 96  SER A O     1 
ATOM   702  C CB    . SER A 1 111 ? -4.320  19.925  31.032  1.00   51.85  ? 96  SER A CB    1 
ATOM   703  O OG    . SER A 1 111 ? -5.457  20.490  31.657  1.00   59.72  ? 96  SER A OG    1 
ATOM   704  N N     . SER A 1 112 ? -5.756  17.490  30.113  1.00   45.29  ? 97  SER A N     1 
ATOM   705  C CA    . SER A 1 112 ? -6.858  16.557  30.053  1.00   50.77  ? 97  SER A CA    1 
ATOM   706  C C     . SER A 1 112 ? -6.833  15.676  31.269  1.00   50.05  ? 97  SER A C     1 
ATOM   707  O O     . SER A 1 112 ? -5.800  15.538  31.928  1.00   51.93  ? 97  SER A O     1 
ATOM   708  C CB    . SER A 1 112 ? -6.691  15.655  28.845  1.00   50.04  ? 97  SER A CB    1 
ATOM   709  O OG    . SER A 1 112 ? -5.677  14.714  29.144  1.00   52.00  ? 97  SER A OG    1 
ATOM   710  N N     . CYS A 1 113 ? -7.975  15.066  31.553  1.00   47.78  ? 98  CYS A N     1 
ATOM   711  C CA    . CYS A 1 113 ? -8.023  13.962  32.489  1.00   47.42  ? 98  CYS A CA    1 
ATOM   712  C C     . CYS A 1 113 ? -8.175  12.702  31.685  1.00   45.81  ? 98  CYS A C     1 
ATOM   713  O O     . CYS A 1 113 ? -9.053  12.602  30.835  1.00   45.41  ? 98  CYS A O     1 
ATOM   714  C CB    . CYS A 1 113 ? -9.189  14.114  33.455  1.00   54.65  ? 98  CYS A CB    1 
ATOM   715  S SG    . CYS A 1 113 ? -8.843  15.356  34.672  1.00   68.92  ? 98  CYS A SG    1 
ATOM   716  N N     . CYS A 1 114 ? -7.296  11.746  31.934  1.00   45.93  ? 99  CYS A N     1 
ATOM   717  C CA    . CYS A 1 114 ? -7.373  10.480  31.233  1.00   42.57  ? 99  CYS A CA    1 
ATOM   718  C C     . CYS A 1 114 ? -7.605  9.372   32.242  1.00   44.05  ? 99  CYS A C     1 
ATOM   719  O O     . CYS A 1 114 ? -6.858  9.223   33.213  1.00   42.84  ? 99  CYS A O     1 
ATOM   720  C CB    . CYS A 1 114 ? -6.099  10.222  30.419  1.00   43.47  ? 99  CYS A CB    1 
ATOM   721  S SG    . CYS A 1 114 ? -5.649  11.579  29.270  1.00   54.97  ? 99  CYS A SG    1 
ATOM   722  N N     . ILE A 1 115 ? -8.656  8.599   32.017  1.00   43.61  ? 100 ILE A N     1 
ATOM   723  C CA    . ILE A 1 115 ? -8.868  7.404   32.808  1.00   41.65  ? 100 ILE A CA    1 
ATOM   724  C C     . ILE A 1 115 ? -8.428  6.210   31.971  1.00   42.06  ? 100 ILE A C     1 
ATOM   725  O O     . ILE A 1 115 ? -8.920  6.001   30.855  1.00   38.57  ? 100 ILE A O     1 
ATOM   726  C CB    . ILE A 1 115 ? -10.332 7.262   33.209  1.00   40.82  ? 100 ILE A CB    1 
ATOM   727  C CG1   . ILE A 1 115 ? -10.719 8.416   34.129  1.00   46.12  ? 100 ILE A CG1   1 
ATOM   728  C CG2   . ILE A 1 115 ? -10.566 5.950   33.901  1.00   37.42  ? 100 ILE A CG2   1 
ATOM   729  C CD1   . ILE A 1 115 ? -12.200 8.451   34.454  1.00   52.20  ? 100 ILE A CD1   1 
ATOM   730  N N     . ILE A 1 116 ? -7.475  5.447   32.495  1.00   38.47  ? 101 ILE A N     1 
ATOM   731  C CA    . ILE A 1 116 ? -7.018  4.256   31.794  1.00   40.26  ? 101 ILE A CA    1 
ATOM   732  C C     . ILE A 1 116 ? -7.485  3.017   32.540  1.00   38.57  ? 101 ILE A C     1 
ATOM   733  O O     . ILE A 1 116 ? -7.153  2.821   33.704  1.00   40.13  ? 101 ILE A O     1 
ATOM   734  C CB    . ILE A 1 116 ? -5.485  4.242   31.618  1.00   39.11  ? 101 ILE A CB    1 
ATOM   735  C CG1   . ILE A 1 116 ? -5.053  5.459   30.809  1.00   41.37  ? 101 ILE A CG1   1 
ATOM   736  C CG2   . ILE A 1 116 ? -5.039  2.973   30.884  1.00   38.79  ? 101 ILE A CG2   1 
ATOM   737  C CD1   . ILE A 1 116 ? -3.563  5.498   30.529  1.00   49.00  ? 101 ILE A CD1   1 
ATOM   738  N N     . ASN A 1 117 ? -8.284  2.206   31.863  1.00   38.16  ? 102 ASN A N     1 
ATOM   739  C CA    . ASN A 1 117 ? -8.776  0.954   32.414  1.00   42.38  ? 102 ASN A CA    1 
ATOM   740  C C     . ASN A 1 117 ? -7.697  -0.115  32.288  1.00   41.69  ? 102 ASN A C     1 
ATOM   741  O O     . ASN A 1 117 ? -7.412  -0.606  31.196  1.00   41.45  ? 102 ASN A O     1 
ATOM   742  C CB    . ASN A 1 117 ? -10.017 0.515   31.648  1.00   40.69  ? 102 ASN A CB    1 
ATOM   743  C CG    . ASN A 1 117 ? -10.677 -0.707  32.251  1.00   47.98  ? 102 ASN A CG    1 
ATOM   744  O OD1   . ASN A 1 117 ? -10.093 -1.406  33.078  1.00   46.32  ? 102 ASN A OD1   1 
ATOM   745  N ND2   . ASN A 1 117 ? -11.905 -0.983  31.819  1.00   48.59  ? 102 ASN A ND2   1 
ATOM   746  N N     . ASN A 1 118 ? -7.103  -0.471  33.410  1.00   40.37  ? 103 ASN A N     1 
ATOM   747  C CA    . ASN A 1 118 ? -5.976  -1.390  33.422  1.00   46.36  ? 103 ASN A CA    1 
ATOM   748  C C     . ASN A 1 118 ? -6.364  -2.815  33.050  1.00   48.53  ? 103 ASN A C     1 
ATOM   749  O O     . ASN A 1 118 ? -5.498  -3.657  32.843  1.00   49.71  ? 103 ASN A O     1 
ATOM   750  C CB    . ASN A 1 118 ? -5.294  -1.373  34.791  1.00   43.56  ? 103 ASN A CB    1 
ATOM   751  C CG    . ASN A 1 118 ? -4.016  -2.171  34.810  1.00   47.88  ? 103 ASN A CG    1 
ATOM   752  O OD1   . ASN A 1 118 ? -3.919  -3.203  35.479  1.00   51.93  ? 103 ASN A OD1   1 
ATOM   753  N ND2   . ASN A 1 118 ? -3.021  -1.701  34.070  1.00   44.65  ? 103 ASN A ND2   1 
ATOM   754  N N     . SER A 1 119 ? -7.659  -3.088  32.952  1.00   42.40  ? 104 SER A N     1 
ATOM   755  C CA    . SER A 1 119 ? -8.081  -4.444  32.655  1.00   47.16  ? 104 SER A CA    1 
ATOM   756  C C     . SER A 1 119 ? -8.178  -4.707  31.146  1.00   48.44  ? 104 SER A C     1 
ATOM   757  O O     . SER A 1 119 ? -8.145  -5.852  30.719  1.00   48.93  ? 104 SER A O     1 
ATOM   758  C CB    . SER A 1 119 ? -9.399  -4.783  33.369  1.00   48.27  ? 104 SER A CB    1 
ATOM   759  O OG    . SER A 1 119 ? -10.487 -4.112  32.765  1.00   52.74  ? 104 SER A OG    1 
ATOM   760  N N     . ASN A 1 120 ? -8.275  -3.659  30.339  1.00   43.57  ? 105 ASN A N     1 
ATOM   761  C CA    . ASN A 1 120 ? -8.357  -3.856  28.901  1.00   41.42  ? 105 ASN A CA    1 
ATOM   762  C C     . ASN A 1 120 ? -7.664  -2.759  28.076  1.00   41.53  ? 105 ASN A C     1 
ATOM   763  O O     . ASN A 1 120 ? -7.759  -2.729  26.842  1.00   41.93  ? 105 ASN A O     1 
ATOM   764  C CB    . ASN A 1 120 ? -9.815  -3.978  28.490  1.00   40.94  ? 105 ASN A CB    1 
ATOM   765  C CG    . ASN A 1 120 ? -10.644 -2.784  28.929  1.00   50.44  ? 105 ASN A CG    1 
ATOM   766  O OD1   . ASN A 1 120 ? -11.872 -2.861  29.000  1.00   51.02  ? 105 ASN A OD1   1 
ATOM   767  N ND2   . ASN A 1 120 ? -9.979  -1.677  29.222  1.00   41.99  ? 105 ASN A ND2   1 
ATOM   768  N N     . GLY A 1 121 ? -6.999  -1.840  28.761  1.00   39.12  ? 106 GLY A N     1 
ATOM   769  C CA    . GLY A 1 121 ? -6.296  -0.771  28.091  1.00   38.80  ? 106 GLY A CA    1 
ATOM   770  C C     . GLY A 1 121 ? -7.172  0.338   27.551  1.00   39.17  ? 106 GLY A C     1 
ATOM   771  O O     . GLY A 1 121 ? -6.673  1.285   26.938  1.00   40.08  ? 106 GLY A O     1 
ATOM   772  N N     . ASN A 1 122 ? -8.474  0.241   27.769  1.00   37.62  ? 107 ASN A N     1 
ATOM   773  C CA    . ASN A 1 122 ? -9.356  1.309   27.335  1.00   41.06  ? 107 ASN A CA    1 
ATOM   774  C C     . ASN A 1 122 ? -8.925  2.635   27.964  1.00   40.15  ? 107 ASN A C     1 
ATOM   775  O O     . ASN A 1 122 ? -8.495  2.686   29.120  1.00   41.75  ? 107 ASN A O     1 
ATOM   776  C CB    . ASN A 1 122 ? -10.804 1.004   27.717  1.00   45.87  ? 107 ASN A CB    1 
ATOM   777  C CG    . ASN A 1 122 ? -11.522 0.148   26.687  1.00   52.89  ? 107 ASN A CG    1 
ATOM   778  O OD1   . ASN A 1 122 ? -11.032 -0.065  25.573  1.00   48.12  ? 107 ASN A OD1   1 
ATOM   779  N ND2   . ASN A 1 122 ? -12.709 -0.331  27.053  1.00   52.23  ? 107 ASN A ND2   1 
ATOM   780  N N     . ARG A 1 123 ? -9.040  3.717   27.216  1.00   41.11  ? 108 ARG A N     1 
ATOM   781  C CA    . ARG A 1 123 ? -8.677  5.004   27.781  1.00   41.13  ? 108 ARG A CA    1 
ATOM   782  C C     . ARG A 1 123 ? -9.769  6.013   27.477  1.00   45.05  ? 108 ARG A C     1 
ATOM   783  O O     . ARG A 1 123 ? -10.269 6.087   26.353  1.00   42.89  ? 108 ARG A O     1 
ATOM   784  C CB    . ARG A 1 123 ? -7.292  5.477   27.300  1.00   39.00  ? 108 ARG A CB    1 
ATOM   785  C CG    . ARG A 1 123 ? -7.283  6.237   25.980  1.00   42.65  ? 108 ARG A CG    1 
ATOM   786  C CD    . ARG A 1 123 ? -7.636  5.326   24.812  1.00   43.86  ? 108 ARG A CD    1 
ATOM   787  N NE    . ARG A 1 123 ? -7.712  6.062   23.550  1.00   45.39  ? 108 ARG A NE    1 
ATOM   788  C CZ    . ARG A 1 123 ? -8.843  6.389   22.932  1.00   50.55  ? 108 ARG A CZ    1 
ATOM   789  N NH1   . ARG A 1 123 ? -10.017 6.054   23.451  1.00   51.21  ? 108 ARG A NH1   1 
ATOM   790  N NH2   . ARG A 1 123 ? -8.800  7.050   21.783  1.00   51.93  ? 108 ARG A NH2   1 
ATOM   791  N N     . THR A 1 124 ? -10.166 6.753   28.510  1.00   44.17  ? 109 THR A N     1 
ATOM   792  C CA    . THR A 1 124 ? -11.217 7.750   28.387  1.00   43.83  ? 109 THR A CA    1 
ATOM   793  C C     . THR A 1 124 ? -10.589 9.107   28.637  1.00   41.60  ? 109 THR A C     1 
ATOM   794  O O     . THR A 1 124 ? -9.934  9.315   29.653  1.00   42.36  ? 109 THR A O     1 
ATOM   795  C CB    . THR A 1 124 ? -12.382 7.454   29.363  1.00   48.21  ? 109 THR A CB    1 
ATOM   796  O OG1   . THR A 1 124 ? -12.964 6.191   29.023  1.00   49.40  ? 109 THR A OG1   1 
ATOM   797  C CG2   . THR A 1 124 ? -13.465 8.521   29.280  1.00   49.30  ? 109 THR A CG2   1 
ATOM   798  N N     . ILE A 1 125 ? -10.765 10.016  27.685  1.00   44.11  ? 110 ILE A N     1 
ATOM   799  C CA    . ILE A 1 125 ? -10.070 11.293  27.716  1.00   44.73  ? 110 ILE A CA    1 
ATOM   800  C C     . ILE A 1 125 ? -11.022 12.465  27.822  1.00   47.14  ? 110 ILE A C     1 
ATOM   801  O O     . ILE A 1 125 ? -11.876 12.652  26.965  1.00   50.30  ? 110 ILE A O     1 
ATOM   802  C CB    . ILE A 1 125 ? -9.257  11.510  26.431  1.00   47.27  ? 110 ILE A CB    1 
ATOM   803  C CG1   . ILE A 1 125 ? -8.129  10.486  26.339  1.00   47.27  ? 110 ILE A CG1   1 
ATOM   804  C CG2   . ILE A 1 125 ? -8.713  12.934  26.383  1.00   47.17  ? 110 ILE A CG2   1 
ATOM   805  C CD1   . ILE A 1 125 ? -7.271  10.635  25.116  1.00   51.91  ? 110 ILE A CD1   1 
ATOM   806  N N     . VAL A 1 126 ? -10.866 13.265  28.866  1.00   46.72  ? 111 VAL A N     1 
ATOM   807  C CA    . VAL A 1 126 ? -11.634 14.501  28.974  1.00   47.44  ? 111 VAL A CA    1 
ATOM   808  C C     . VAL A 1 126 ? -10.702 15.686  28.767  1.00   45.53  ? 111 VAL A C     1 
ATOM   809  O O     . VAL A 1 126 ? -9.835  15.968  29.593  1.00   46.11  ? 111 VAL A O     1 
ATOM   810  C CB    . VAL A 1 126 ? -12.409 14.602  30.295  1.00   49.00  ? 111 VAL A CB    1 
ATOM   811  C CG1   . VAL A 1 126 ? -13.083 15.961  30.399  1.00   51.27  ? 111 VAL A CG1   1 
ATOM   812  C CG2   . VAL A 1 126 ? -13.438 13.475  30.385  1.00   45.04  ? 111 VAL A CG2   1 
ATOM   813  N N     . LEU A 1 127 ? -10.889 16.357  27.636  1.00   44.99  ? 112 LEU A N     1 
ATOM   814  C CA    . LEU A 1 127 ? -9.936  17.324  27.120  1.00   50.53  ? 112 LEU A CA    1 
ATOM   815  C C     . LEU A 1 127 ? -10.352 18.789  27.336  1.00   55.65  ? 112 LEU A C     1 
ATOM   816  O O     . LEU A 1 127 ? -11.512 19.156  27.160  1.00   52.77  ? 112 LEU A O     1 
ATOM   817  C CB    . LEU A 1 127 ? -9.688  17.044  25.632  1.00   47.17  ? 112 LEU A CB    1 
ATOM   818  C CG    . LEU A 1 127 ? -8.734  17.949  24.849  1.00   57.97  ? 112 LEU A CG    1 
ATOM   819  C CD1   . LEU A 1 127 ? -7.401  18.112  25.554  1.00   47.98  ? 112 LEU A CD1   1 
ATOM   820  C CD2   . LEU A 1 127 ? -8.538  17.435  23.418  1.00   56.54  ? 112 LEU A CD2   1 
ATOM   821  N N     . HIS A 1 128 ? -9.375  19.612  27.710  1.00   56.57  ? 113 HIS A N     1 
ATOM   822  C CA    . HIS A 1 128 ? -9.562  21.038  27.936  1.00   57.14  ? 113 HIS A CA    1 
ATOM   823  C C     . HIS A 1 128 ? -8.721  21.874  26.961  1.00   60.62  ? 113 HIS A C     1 
ATOM   824  O O     . HIS A 1 128 ? -7.571  22.205  27.281  1.00   62.02  ? 113 HIS A O     1 
ATOM   825  C CB    . HIS A 1 128 ? -9.129  21.343  29.373  1.00   60.79  ? 113 HIS A CB    1 
ATOM   826  C CG    . HIS A 1 128 ? -9.342  22.764  29.799  1.00   64.15  ? 113 HIS A CG    1 
ATOM   827  N ND1   . HIS A 1 128 ? -10.455 23.495  29.443  1.00   61.96  ? 113 HIS A ND1   1 
ATOM   828  C CD2   . HIS A 1 128 ? -8.591  23.575  30.584  1.00   61.53  ? 113 HIS A CD2   1 
ATOM   829  C CE1   . HIS A 1 128 ? -10.375 24.701  29.978  1.00   62.57  ? 113 HIS A CE1   1 
ATOM   830  N NE2   . HIS A 1 128 ? -9.255  24.776  30.674  1.00   64.23  ? 113 HIS A NE2   1 
ATOM   831  N N     . ASP A 1 129 ? -9.277  22.193  25.783  1.00   64.24  ? 114 ASP A N     1 
ATOM   832  C CA    . ASP A 1 129 ? -8.640  23.099  24.805  1.00   66.22  ? 114 ASP A CA    1 
ATOM   833  C C     . ASP A 1 129 ? -8.795  24.550  25.214  1.00   73.90  ? 114 ASP A C     1 
ATOM   834  O O     . ASP A 1 129 ? -9.860  25.155  25.048  1.00   75.31  ? 114 ASP A O     1 
ATOM   835  C CB    . ASP A 1 129 ? -9.248  22.952  23.421  1.00   72.02  ? 114 ASP A CB    1 
ATOM   836  C CG    . ASP A 1 129 ? -9.190  21.545  22.918  1.00   75.90  ? 114 ASP A CG    1 
ATOM   837  O OD1   . ASP A 1 129 ? -10.079 20.753  23.304  1.00   70.56  ? 114 ASP A OD1   1 
ATOM   838  O OD2   . ASP A 1 129 ? -8.259  21.234  22.143  1.00   74.28  ? 114 ASP A OD2   1 
ATOM   839  N N     . THR A 1 130 ? -7.692  25.108  25.688  1.00   73.01  ? 115 THR A N     1 
ATOM   840  C CA    . THR A 1 130 ? -7.672  26.338  26.458  1.00   76.63  ? 115 THR A CA    1 
ATOM   841  C C     . THR A 1 130 ? -7.791  27.643  25.654  1.00   79.29  ? 115 THR A C     1 
ATOM   842  O O     . THR A 1 130 ? -7.361  28.700  26.120  1.00   79.88  ? 115 THR A O     1 
ATOM   843  C CB    . THR A 1 130 ? -6.361  26.371  27.225  1.00   74.24  ? 115 THR A CB    1 
ATOM   844  O OG1   . THR A 1 130 ? -5.317  25.990  26.324  1.00   69.38  ? 115 THR A OG1   1 
ATOM   845  C CG2   . THR A 1 130 ? -6.399  25.367  28.381  1.00   69.91  ? 115 THR A CG2   1 
ATOM   846  N N     . SER A 1 131 ? -8.376  27.574  24.464  1.00   75.89  ? 116 SER A N     1 
ATOM   847  C CA    . SER A 1 131 ? -8.469  28.746  23.598  1.00   81.03  ? 116 SER A CA    1 
ATOM   848  C C     . SER A 1 131 ? -7.095  29.144  23.062  1.00   84.33  ? 116 SER A C     1 
ATOM   849  O O     . SER A 1 131 ? -6.995  29.908  22.097  1.00   84.03  ? 116 SER A O     1 
ATOM   850  C CB    . SER A 1 131 ? -9.129  29.929  24.327  1.00   85.67  ? 116 SER A CB    1 
ATOM   851  O OG    . SER A 1 131 ? -8.174  30.910  24.717  1.00   80.64  ? 116 SER A OG    1 
ATOM   852  N N     . LEU A 1 132 ? -6.041  28.626  23.689  1.00   78.84  ? 117 LEU A N     1 
ATOM   853  C CA    . LEU A 1 132 ? -4.696  28.832  23.180  1.00   78.02  ? 117 LEU A CA    1 
ATOM   854  C C     . LEU A 1 132 ? -4.791  28.827  21.661  1.00   81.20  ? 117 LEU A C     1 
ATOM   855  O O     . LEU A 1 132 ? -5.258  27.861  21.065  1.00   81.12  ? 117 LEU A O     1 
ATOM   856  C CB    . LEU A 1 132 ? -3.752  27.728  23.667  1.00   75.61  ? 117 LEU A CB    1 
ATOM   857  C CG    . LEU A 1 132 ? -2.243  28.005  23.655  1.00   76.50  ? 117 LEU A CG    1 
ATOM   858  C CD1   . LEU A 1 132 ? -1.831  28.832  24.862  1.00   74.36  ? 117 LEU A CD1   1 
ATOM   859  C CD2   . LEU A 1 132 ? -1.446  26.708  23.618  1.00   74.96  ? 117 LEU A CD2   1 
ATOM   860  N N     . PRO A 1 133 ? -4.407  29.941  21.031  1.00   82.37  ? 118 PRO A N     1 
ATOM   861  C CA    . PRO A 1 133 ? -4.487  30.053  19.573  1.00   79.77  ? 118 PRO A CA    1 
ATOM   862  C C     . PRO A 1 133 ? -3.511  29.131  18.848  1.00   77.82  ? 118 PRO A C     1 
ATOM   863  O O     . PRO A 1 133 ? -2.369  28.954  19.278  1.00   72.22  ? 118 PRO A O     1 
ATOM   864  C CB    . PRO A 1 133 ? -4.155  31.528  19.311  1.00   81.94  ? 118 PRO A CB    1 
ATOM   865  C CG    . PRO A 1 133 ? -3.490  32.013  20.533  1.00   82.78  ? 118 PRO A CG    1 
ATOM   866  C CD    . PRO A 1 133 ? -4.064  31.221  21.668  1.00   84.22  ? 118 PRO A CD    1 
ATOM   867  N N     . ASP A 1 134 ? -3.980  28.558  17.744  1.00   77.80  ? 119 ASP A N     1 
ATOM   868  C CA    . ASP A 1 134 ? -3.228  27.568  16.982  1.00   75.81  ? 119 ASP A CA    1 
ATOM   869  C C     . ASP A 1 134 ? -2.065  28.162  16.199  1.00   76.97  ? 119 ASP A C     1 
ATOM   870  O O     . ASP A 1 134 ? -2.088  29.339  15.838  1.00   79.11  ? 119 ASP A O     1 
ATOM   871  C CB    . ASP A 1 134 ? -4.172  26.835  16.030  1.00   71.78  ? 119 ASP A CB    1 
ATOM   872  C CG    . ASP A 1 134 ? -5.062  25.844  16.750  1.00   74.62  ? 119 ASP A CG    1 
ATOM   873  O OD1   . ASP A 1 134 ? -4.512  24.996  17.482  1.00   73.03  ? 119 ASP A OD1   1 
ATOM   874  O OD2   . ASP A 1 134 ? -6.302  25.919  16.601  1.00   71.75  ? 119 ASP A OD2   1 
ATOM   875  N N     . VAL A 1 135 ? -1.046  27.342  15.949  1.00   74.90  ? 120 VAL A N     1 
ATOM   876  C CA    . VAL A 1 135 ? 0.085   27.740  15.119  1.00   74.24  ? 120 VAL A CA    1 
ATOM   877  C C     . VAL A 1 135 ? -0.424  28.255  13.778  1.00   77.59  ? 120 VAL A C     1 
ATOM   878  O O     . VAL A 1 135 ? -1.403  27.738  13.246  1.00   79.18  ? 120 VAL A O     1 
ATOM   879  C CB    . VAL A 1 135 ? 1.030   26.558  14.880  1.00   76.05  ? 120 VAL A CB    1 
ATOM   880  C CG1   . VAL A 1 135 ? 2.110   26.929  13.884  1.00   74.24  ? 120 VAL A CG1   1 
ATOM   881  C CG2   . VAL A 1 135 ? 1.639   26.105  16.192  1.00   72.94  ? 120 VAL A CG2   1 
ATOM   882  N N     . SER A 1 136 ? 0.229   29.279  13.238  1.00   81.77  ? 121 SER A N     1 
ATOM   883  C CA    . SER A 1 136 ? -0.257  29.923  12.019  1.00   81.39  ? 121 SER A CA    1 
ATOM   884  C C     . SER A 1 136 ? 0.750   29.851  10.875  1.00   80.61  ? 121 SER A C     1 
ATOM   885  O O     . SER A 1 136 ? 1.947   29.631  11.092  1.00   78.19  ? 121 SER A O     1 
ATOM   886  C CB    . SER A 1 136 ? -0.597  31.390  12.294  1.00   81.41  ? 121 SER A CB    1 
ATOM   887  O OG    . SER A 1 136 ? 0.590   32.155  12.444  1.00   79.56  ? 121 SER A OG    1 
ATOM   888  N N     . ALA A 1 137 ? 0.248   30.045  9.658   1.00   84.01  ? 122 ALA A N     1 
ATOM   889  C CA    . ALA A 1 137 ? 1.089   30.157  8.471   1.00   83.70  ? 122 ALA A CA    1 
ATOM   890  C C     . ALA A 1 137 ? 2.207   31.154  8.730   1.00   81.25  ? 122 ALA A C     1 
ATOM   891  O O     . ALA A 1 137 ? 3.363   30.921  8.368   1.00   80.76  ? 122 ALA A O     1 
ATOM   892  C CB    . ALA A 1 137 ? 0.259   30.596  7.276   1.00   78.48  ? 122 ALA A CB    1 
ATOM   893  N N     . THR A 1 138 ? 1.847   32.265  9.366   1.00   80.13  ? 123 THR A N     1 
ATOM   894  C CA    . THR A 1 138 ? 2.805   33.295  9.736   1.00   81.70  ? 123 THR A CA    1 
ATOM   895  C C     . THR A 1 138 ? 3.961   32.699  10.533  1.00   85.76  ? 123 THR A C     1 
ATOM   896  O O     . THR A 1 138 ? 5.134   32.953  10.234  1.00   85.38  ? 123 THR A O     1 
ATOM   897  C CB    . THR A 1 138 ? 2.135   34.390  10.576  1.00   86.66  ? 123 THR A CB    1 
ATOM   898  O OG1   . THR A 1 138 ? 0.928   34.814  9.930   1.00   92.13  ? 123 THR A OG1   1 
ATOM   899  C CG2   . THR A 1 138 ? 3.071   35.581  10.754  1.00   86.55  ? 123 THR A CG2   1 
ATOM   900  N N     . ASP A 1 139 ? 3.625   31.905  11.547  1.00   82.53  ? 124 ASP A N     1 
ATOM   901  C CA    . ASP A 1 139 ? 4.632   31.255  12.379  1.00   80.58  ? 124 ASP A CA    1 
ATOM   902  C C     . ASP A 1 139 ? 5.473   30.289  11.559  1.00   80.97  ? 124 ASP A C     1 
ATOM   903  O O     . ASP A 1 139 ? 6.698   30.254  11.682  1.00   78.42  ? 124 ASP A O     1 
ATOM   904  C CB    . ASP A 1 139 ? 3.963   30.498  13.524  1.00   83.92  ? 124 ASP A CB    1 
ATOM   905  C CG    . ASP A 1 139 ? 3.067   31.385  14.362  1.00   83.89  ? 124 ASP A CG    1 
ATOM   906  O OD1   . ASP A 1 139 ? 3.490   32.522  14.670  1.00   87.97  ? 124 ASP A OD1   1 
ATOM   907  O OD2   . ASP A 1 139 ? 1.944   30.950  14.705  1.00   75.49  ? 124 ASP A OD2   1 
ATOM   908  N N     . PHE A 1 140 ? 4.805   29.504  10.720  1.00   82.26  ? 125 PHE A N     1 
ATOM   909  C CA    . PHE A 1 140 ? 5.482   28.478  9.937   1.00   80.88  ? 125 PHE A CA    1 
ATOM   910  C C     . PHE A 1 140 ? 6.478   29.058  8.929   1.00   82.24  ? 125 PHE A C     1 
ATOM   911  O O     . PHE A 1 140 ? 7.617   28.586  8.835   1.00   77.07  ? 125 PHE A O     1 
ATOM   912  C CB    . PHE A 1 140 ? 4.469   27.565  9.236   1.00   80.45  ? 125 PHE A CB    1 
ATOM   913  C CG    . PHE A 1 140 ? 5.088   26.335  8.637   1.00   82.25  ? 125 PHE A CG    1 
ATOM   914  C CD1   . PHE A 1 140 ? 5.678   25.380  9.449   1.00   79.30  ? 125 PHE A CD1   1 
ATOM   915  C CD2   . PHE A 1 140 ? 5.097   26.138  7.268   1.00   82.17  ? 125 PHE A CD2   1 
ATOM   916  C CE1   . PHE A 1 140 ? 6.263   24.252  8.904   1.00   78.32  ? 125 PHE A CE1   1 
ATOM   917  C CE2   . PHE A 1 140 ? 5.681   25.007  6.718   1.00   81.81  ? 125 PHE A CE2   1 
ATOM   918  C CZ    . PHE A 1 140 ? 6.265   24.065  7.537   1.00   75.83  ? 125 PHE A CZ    1 
ATOM   919  N N     . GLU A 1 141 ? 6.051   30.080  8.185   1.00   85.03  ? 126 GLU A N     1 
ATOM   920  C CA    . GLU A 1 141 ? 6.901   30.720  7.171   1.00   84.24  ? 126 GLU A CA    1 
ATOM   921  C C     . GLU A 1 141 ? 8.242   31.153  7.763   1.00   82.31  ? 126 GLU A C     1 
ATOM   922  O O     . GLU A 1 141 ? 9.181   31.480  7.042   1.00   83.86  ? 126 GLU A O     1 
ATOM   923  C CB    . GLU A 1 141 ? 6.184   31.923  6.544   1.00   83.53  ? 126 GLU A CB    1 
ATOM   924  C CG    . GLU A 1 141 ? 6.891   32.537  5.333   1.00   88.68  ? 126 GLU A CG    1 
ATOM   925  C CD    . GLU A 1 141 ? 6.849   31.639  4.099   1.00   92.71  ? 126 GLU A CD    1 
ATOM   926  O OE1   . GLU A 1 141 ? 6.213   30.565  4.172   1.00   93.42  ? 126 GLU A OE1   1 
ATOM   927  O OE2   . GLU A 1 141 ? 7.446   32.007  3.056   1.00   87.03  ? 126 GLU A OE2   1 
ATOM   928  N N     . LYS A 1 142 ? 8.323   31.133  9.087   1.00   82.68  ? 127 LYS A N     1 
ATOM   929  C CA    . LYS A 1 142 ? 9.501   31.585  9.802   1.00   79.86  ? 127 LYS A CA    1 
ATOM   930  C C     . LYS A 1 142 ? 10.480  30.437  10.042  1.00   81.70  ? 127 LYS A C     1 
ATOM   931  O O     . LYS A 1 142 ? 11.480  30.610  10.730  1.00   87.93  ? 127 LYS A O     1 
ATOM   932  C CB    . LYS A 1 142 ? 9.065   32.191  11.136  1.00   81.16  ? 127 LYS A CB    1 
ATOM   933  C CG    . LYS A 1 142 ? 9.950   33.300  11.661  1.00   85.91  ? 127 LYS A CG    1 
ATOM   934  C CD    . LYS A 1 142 ? 9.339   33.934  12.906  1.00   89.19  ? 127 LYS A CD    1 
ATOM   935  C CE    . LYS A 1 142 ? 7.948   34.487  12.623  1.00   91.46  ? 127 LYS A CE    1 
ATOM   936  N NZ    . LYS A 1 142 ? 7.307   35.077  13.840  1.00   90.14  ? 127 LYS A NZ    1 
ATOM   937  N N     . VAL A 1 143 ? 10.195  29.269  9.472   1.00   80.53  ? 128 VAL A N     1 
ATOM   938  C CA    . VAL A 1 143 ? 10.960  28.058  9.779   1.00   79.48  ? 128 VAL A CA    1 
ATOM   939  C C     . VAL A 1 143 ? 11.934  27.649  8.673   1.00   80.89  ? 128 VAL A C     1 
ATOM   940  O O     . VAL A 1 143 ? 11.564  27.586  7.499   1.00   80.82  ? 128 VAL A O     1 
ATOM   941  C CB    . VAL A 1 143 ? 10.018  26.868  10.084  1.00   82.19  ? 128 VAL A CB    1 
ATOM   942  C CG1   . VAL A 1 143 ? 10.800  25.563  10.184  1.00   76.73  ? 128 VAL A CG1   1 
ATOM   943  C CG2   . VAL A 1 143 ? 9.233   27.128  11.361  1.00   80.04  ? 128 VAL A CG2   1 
ATOM   944  N N     . ASP A 1 144 ? 13.176  27.357  9.058   1.00   80.19  ? 129 ASP A N     1 
ATOM   945  C CA    . ASP A 1 144 ? 14.197  26.939  8.098   1.00   83.20  ? 129 ASP A CA    1 
ATOM   946  C C     . ASP A 1 144 ? 14.014  25.491  7.648   1.00   82.03  ? 129 ASP A C     1 
ATOM   947  O O     . ASP A 1 144 ? 14.543  24.557  8.259   1.00   80.06  ? 129 ASP A O     1 
ATOM   948  C CB    . ASP A 1 144 ? 15.607  27.134  8.657   1.00   81.12  ? 129 ASP A CB    1 
ATOM   949  C CG    . ASP A 1 144 ? 16.675  26.589  7.726   1.00   83.35  ? 129 ASP A CG    1 
ATOM   950  O OD1   . ASP A 1 144 ? 16.367  26.415  6.525   1.00   81.47  ? 129 ASP A OD1   1 
ATOM   951  O OD2   . ASP A 1 144 ? 17.811  26.333  8.188   1.00   83.20  ? 129 ASP A OD2   1 
ATOM   952  N N     . LEU A 1 145 ? 13.286  25.323  6.553   1.00   80.27  ? 130 LEU A N     1 
ATOM   953  C CA    . LEU A 1 145 ? 12.925  24.002  6.070   1.00   78.68  ? 130 LEU A CA    1 
ATOM   954  C C     . LEU A 1 145 ? 14.117  23.137  5.689   1.00   80.99  ? 130 LEU A C     1 
ATOM   955  O O     . LEU A 1 145 ? 13.967  21.932  5.509   1.00   83.13  ? 130 LEU A O     1 
ATOM   956  C CB    . LEU A 1 145 ? 11.966  24.120  4.893   1.00   73.03  ? 130 LEU A CB    1 
ATOM   957  C CG    . LEU A 1 145 ? 10.733  24.950  5.230   1.00   75.21  ? 130 LEU A CG    1 
ATOM   958  C CD1   . LEU A 1 145 ? 9.734   24.914  4.086   1.00   76.40  ? 130 LEU A CD1   1 
ATOM   959  C CD2   . LEU A 1 145 ? 10.104  24.443  6.513   1.00   77.43  ? 130 LEU A CD2   1 
ATOM   960  N N     . THR A 1 146 ? 15.299  23.732  5.569   1.00   80.14  ? 131 THR A N     1 
ATOM   961  C CA    . THR A 1 146 ? 16.467  22.953  5.153   1.00   83.98  ? 131 THR A CA    1 
ATOM   962  C C     . THR A 1 146 ? 16.908  21.951  6.228   1.00   80.28  ? 131 THR A C     1 
ATOM   963  O O     . THR A 1 146 ? 17.760  21.089  5.983   1.00   77.66  ? 131 THR A O     1 
ATOM   964  C CB    . THR A 1 146 ? 17.661  23.850  4.710   1.00   86.16  ? 131 THR A CB    1 
ATOM   965  O OG1   . THR A 1 146 ? 18.319  24.410  5.858   1.00   81.91  ? 131 THR A OG1   1 
ATOM   966  C CG2   . THR A 1 146 ? 17.181  24.965  3.780   1.00   82.32  ? 131 THR A CG2   1 
ATOM   967  N N     . GLN A 1 147 ? 16.306  22.057  7.409   1.00   80.30  ? 132 GLN A N     1 
ATOM   968  C CA    . GLN A 1 147 ? 16.658  21.185  8.528   1.00   79.41  ? 132 GLN A CA    1 
ATOM   969  C C     . GLN A 1 147 ? 15.992  19.808  8.452   1.00   73.52  ? 132 GLN A C     1 
ATOM   970  O O     . GLN A 1 147 ? 16.446  18.861  9.095   1.00   71.44  ? 132 GLN A O     1 
ATOM   971  C CB    . GLN A 1 147 ? 16.281  21.853  9.853   1.00   80.70  ? 132 GLN A CB    1 
ATOM   972  C CG    . GLN A 1 147 ? 16.930  23.210  10.094  1.00   85.12  ? 132 GLN A CG    1 
ATOM   973  C CD    . GLN A 1 147 ? 16.631  23.757  11.484  1.00   93.63  ? 132 GLN A CD    1 
ATOM   974  O OE1   . GLN A 1 147 ? 15.759  23.245  12.192  1.00   89.40  ? 132 GLN A OE1   1 
ATOM   975  N NE2   . GLN A 1 147 ? 17.360  24.801  11.884  1.00   94.44  ? 132 GLN A NE2   1 
ATOM   976  N N     . PHE A 1 148 ? 14.938  19.697  7.645   1.00   73.97  ? 133 PHE A N     1 
ATOM   977  C CA    . PHE A 1 148 ? 14.004  18.574  7.745   1.00   72.19  ? 133 PHE A CA    1 
ATOM   978  C C     . PHE A 1 148 ? 13.941  17.610  6.554   1.00   71.52  ? 133 PHE A C     1 
ATOM   979  O O     . PHE A 1 148 ? 13.872  18.035  5.399   1.00   75.08  ? 133 PHE A O     1 
ATOM   980  C CB    . PHE A 1 148 ? 12.609  19.117  8.049   1.00   68.40  ? 133 PHE A CB    1 
ATOM   981  C CG    . PHE A 1 148 ? 12.573  20.019  9.244   1.00   71.58  ? 133 PHE A CG    1 
ATOM   982  C CD1   . PHE A 1 148 ? 13.009  19.565  10.479  1.00   68.50  ? 133 PHE A CD1   1 
ATOM   983  C CD2   . PHE A 1 148 ? 12.118  21.322  9.136   1.00   76.03  ? 133 PHE A CD2   1 
ATOM   984  C CE1   . PHE A 1 148 ? 12.991  20.392  11.584  1.00   68.27  ? 133 PHE A CE1   1 
ATOM   985  C CE2   . PHE A 1 148 ? 12.092  22.155  10.243  1.00   76.54  ? 133 PHE A CE2   1 
ATOM   986  C CZ    . PHE A 1 148 ? 12.529  21.686  11.468  1.00   72.19  ? 133 PHE A CZ    1 
ATOM   987  N N     . LYS A 1 149 ? 13.947  16.309  6.850   1.00   69.06  ? 134 LYS A N     1 
ATOM   988  C CA    . LYS A 1 149 ? 13.760  15.272  5.830   1.00   64.87  ? 134 LYS A CA    1 
ATOM   989  C C     . LYS A 1 149 ? 12.284  14.892  5.676   1.00   64.63  ? 134 LYS A C     1 
ATOM   990  O O     . LYS A 1 149 ? 11.875  14.358  4.640   1.00   61.62  ? 134 LYS A O     1 
ATOM   991  C CB    . LYS A 1 149 ? 14.594  14.026  6.149   1.00   62.82  ? 134 LYS A CB    1 
ATOM   992  C CG    . LYS A 1 149 ? 14.380  13.458  7.544   1.00   69.06  ? 134 LYS A CG    1 
ATOM   993  C CD    . LYS A 1 149 ? 14.527  11.938  7.577   1.00   66.04  ? 134 LYS A CD    1 
ATOM   994  C CE    . LYS A 1 149 ? 15.946  11.467  7.285   1.00   62.69  ? 134 LYS A CE    1 
ATOM   995  N NZ    . LYS A 1 149 ? 15.956  10.037  6.822   1.00   54.98  ? 134 LYS A NZ    1 
ATOM   996  N N     . TRP A 1 150 ? 11.496  15.181  6.712   1.00   61.36  ? 135 TRP A N     1 
ATOM   997  C CA    . TRP A 1 150 ? 10.082  14.813  6.763   1.00   57.85  ? 135 TRP A CA    1 
ATOM   998  C C     . TRP A 1 150 ? 9.339   15.829  7.617   1.00   51.78  ? 135 TRP A C     1 
ATOM   999  O O     . TRP A 1 150 ? 9.858   16.288  8.623   1.00   59.08  ? 135 TRP A O     1 
ATOM   1000 C CB    . TRP A 1 150 ? 9.915   13.407  7.377   1.00   53.74  ? 135 TRP A CB    1 
ATOM   1001 C CG    . TRP A 1 150 ? 8.535   12.829  7.195   1.00   53.96  ? 135 TRP A CG    1 
ATOM   1002 C CD1   . TRP A 1 150 ? 7.372   13.315  7.709   1.00   50.28  ? 135 TRP A CD1   1 
ATOM   1003 C CD2   . TRP A 1 150 ? 8.181   11.663  6.435   1.00   52.43  ? 135 TRP A CD2   1 
ATOM   1004 N NE1   . TRP A 1 150 ? 6.314   12.537  7.309   1.00   50.96  ? 135 TRP A NE1   1 
ATOM   1005 C CE2   . TRP A 1 150 ? 6.784   11.515  6.528   1.00   50.00  ? 135 TRP A CE2   1 
ATOM   1006 C CE3   . TRP A 1 150 ? 8.911   10.737  5.681   1.00   51.79  ? 135 TRP A CE3   1 
ATOM   1007 C CZ2   . TRP A 1 150 ? 6.099   10.475  5.902   1.00   49.27  ? 135 TRP A CZ2   1 
ATOM   1008 C CZ3   . TRP A 1 150 ? 8.231   9.704   5.064   1.00   47.69  ? 135 TRP A CZ3   1 
ATOM   1009 C CH2   . TRP A 1 150 ? 6.838   9.582   5.178   1.00   48.32  ? 135 TRP A CH2   1 
ATOM   1010 N N     . ILE A 1 151 ? 8.130   16.191  7.225   1.00   52.84  ? 136 ILE A N     1 
ATOM   1011 C CA    . ILE A 1 151 ? 7.315   17.062  8.060   1.00   54.34  ? 136 ILE A CA    1 
ATOM   1012 C C     . ILE A 1 151 ? 5.938   16.447  8.240   1.00   54.61  ? 136 ILE A C     1 
ATOM   1013 O O     . ILE A 1 151 ? 5.207   16.262  7.269   1.00   53.42  ? 136 ILE A O     1 
ATOM   1014 C CB    . ILE A 1 151 ? 7.154   18.474  7.451   1.00   57.09  ? 136 ILE A CB    1 
ATOM   1015 C CG1   . ILE A 1 151 ? 8.498   19.193  7.374   1.00   59.16  ? 136 ILE A CG1   1 
ATOM   1016 C CG2   . ILE A 1 151 ? 6.178   19.312  8.262   1.00   52.70  ? 136 ILE A CG2   1 
ATOM   1017 C CD1   . ILE A 1 151 ? 8.370   20.630  6.907   1.00   63.43  ? 136 ILE A CD1   1 
ATOM   1018 N N     . HIS A 1 152 ? 5.584   16.126  9.482   1.00   54.54  ? 137 HIS A N     1 
ATOM   1019 C CA    . HIS A 1 152 ? 4.254   15.591  9.766   1.00   53.89  ? 137 HIS A CA    1 
ATOM   1020 C C     . HIS A 1 152 ? 3.324   16.640  10.384  1.00   49.22  ? 137 HIS A C     1 
ATOM   1021 O O     . HIS A 1 152 ? 3.695   17.344  11.320  1.00   53.27  ? 137 HIS A O     1 
ATOM   1022 C CB    . HIS A 1 152 ? 4.346   14.351  10.671  1.00   54.56  ? 137 HIS A CB    1 
ATOM   1023 C CG    . HIS A 1 152 ? 3.011   13.773  11.029  1.00   49.94  ? 137 HIS A CG    1 
ATOM   1024 N ND1   . HIS A 1 152 ? 2.237   13.073  10.128  1.00   49.91  ? 137 HIS A ND1   1 
ATOM   1025 C CD2   . HIS A 1 152 ? 2.299   13.819  12.178  1.00   48.26  ? 137 HIS A CD2   1 
ATOM   1026 C CE1   . HIS A 1 152 ? 1.106   12.713  10.706  1.00   47.07  ? 137 HIS A CE1   1 
ATOM   1027 N NE2   . HIS A 1 152 ? 1.120   13.152  11.951  1.00   53.19  ? 137 HIS A NE2   1 
ATOM   1028 N N     . ILE A 1 153 ? 2.104   16.723  9.873   1.00   48.33  ? 138 ILE A N     1 
ATOM   1029 C CA    . ILE A 1 153 ? 1.157   17.730  10.337  1.00   50.93  ? 138 ILE A CA    1 
ATOM   1030 C C     . ILE A 1 153 ? -0.133  17.136  10.883  1.00   52.26  ? 138 ILE A C     1 
ATOM   1031 O O     . ILE A 1 153 ? -0.926  16.548  10.139  1.00   48.60  ? 138 ILE A O     1 
ATOM   1032 C CB    . ILE A 1 153 ? 0.793   18.738  9.213   1.00   59.94  ? 138 ILE A CB    1 
ATOM   1033 C CG1   . ILE A 1 153 ? 2.016   19.577  8.826   1.00   59.68  ? 138 ILE A CG1   1 
ATOM   1034 C CG2   . ILE A 1 153 ? -0.348  19.643  9.650   1.00   58.10  ? 138 ILE A CG2   1 
ATOM   1035 C CD1   . ILE A 1 153 ? 1.651   20.875  8.159   1.00   66.02  ? 138 ILE A CD1   1 
ATOM   1036 N N     . GLU A 1 154 ? -0.342  17.316  12.185  1.00   53.83  ? 139 GLU A N     1 
ATOM   1037 C CA    . GLU A 1 154 ? -1.574  16.907  12.844  1.00   55.49  ? 139 GLU A CA    1 
ATOM   1038 C C     . GLU A 1 154 ? -2.718  17.854  12.511  1.00   57.59  ? 139 GLU A C     1 
ATOM   1039 O O     . GLU A 1 154 ? -2.745  18.988  12.980  1.00   63.98  ? 139 GLU A O     1 
ATOM   1040 C CB    . GLU A 1 154 ? -1.375  16.868  14.364  1.00   56.58  ? 139 GLU A CB    1 
ATOM   1041 C CG    . GLU A 1 154 ? -2.671  16.656  15.147  1.00   58.42  ? 139 GLU A CG    1 
ATOM   1042 C CD    . GLU A 1 154 ? -2.516  16.924  16.641  1.00   58.76  ? 139 GLU A CD    1 
ATOM   1043 O OE1   . GLU A 1 154 ? -1.374  17.150  17.104  1.00   54.69  ? 139 GLU A OE1   1 
ATOM   1044 O OE2   . GLU A 1 154 ? -3.545  16.900  17.350  1.00   58.18  ? 139 GLU A OE2   1 
ATOM   1045 N N     . GLY A 1 155 ? -3.673  17.377  11.724  1.00   57.98  ? 140 GLY A N     1 
ATOM   1046 C CA    . GLY A 1 155 ? -4.779  18.196  11.267  1.00   56.94  ? 140 GLY A CA    1 
ATOM   1047 C C     . GLY A 1 155 ? -5.616  18.846  12.348  1.00   60.53  ? 140 GLY A C     1 
ATOM   1048 O O     . GLY A 1 155 ? -6.436  18.189  12.983  1.00   66.53  ? 140 GLY A O     1 
ATOM   1049 N N     . ARG A 1 156 ? -5.433  20.148  12.541  1.00   65.70  ? 141 ARG A N     1 
ATOM   1050 C CA    . ARG A 1 156 ? -6.235  20.890  13.519  1.00   69.29  ? 141 ARG A CA    1 
ATOM   1051 C C     . ARG A 1 156 ? -6.922  22.123  12.918  1.00   68.87  ? 141 ARG A C     1 
ATOM   1052 O O     . ARG A 1 156 ? -8.137  22.120  12.700  1.00   64.23  ? 141 ARG A O     1 
ATOM   1053 C CB    . ARG A 1 156 ? -5.390  21.299  14.729  1.00   66.94  ? 141 ARG A CB    1 
ATOM   1054 C CG    . ARG A 1 156 ? -6.206  21.978  15.815  1.00   71.16  ? 141 ARG A CG    1 
ATOM   1055 C CD    . ARG A 1 156 ? -5.397  22.245  17.076  1.00   69.95  ? 141 ARG A CD    1 
ATOM   1056 N NE    . ARG A 1 156 ? -6.255  22.757  18.141  1.00   72.06  ? 141 ARG A NE    1 
ATOM   1057 C CZ    . ARG A 1 156 ? -6.895  21.989  19.019  1.00   74.29  ? 141 ARG A CZ    1 
ATOM   1058 N NH1   . ARG A 1 156 ? -6.768  20.667  18.970  1.00   70.66  ? 141 ARG A NH1   1 
ATOM   1059 N NH2   . ARG A 1 156 ? -7.662  22.542  19.948  1.00   77.07  ? 141 ARG A NH2   1 
ATOM   1060 N N     . ASN A 1 157 ? -6.141  23.176  12.679  1.00   67.55  ? 142 ASN A N     1 
ATOM   1061 C CA    . ASN A 1 157 ? -6.637  24.381  12.010  1.00   72.40  ? 142 ASN A CA    1 
ATOM   1062 C C     . ASN A 1 157 ? -6.382  24.319  10.498  1.00   71.79  ? 142 ASN A C     1 
ATOM   1063 O O     . ASN A 1 157 ? -5.344  24.766  10.010  1.00   73.62  ? 142 ASN A O     1 
ATOM   1064 C CB    . ASN A 1 157 ? -6.029  25.649  12.632  1.00   70.18  ? 142 ASN A CB    1 
ATOM   1065 C CG    . ASN A 1 157 ? -4.506  25.597  12.728  1.00   73.12  ? 142 ASN A CG    1 
ATOM   1066 O OD1   . ASN A 1 157 ? -3.901  24.523  12.725  1.00   71.67  ? 142 ASN A OD1   1 
ATOM   1067 N ND2   . ASN A 1 157 ? -3.884  26.769  12.832  1.00   71.04  ? 142 ASN A ND2   1 
ATOM   1068 N N     . ALA A 1 158 ? -7.343  23.759  9.771   1.00   68.53  ? 143 ALA A N     1 
ATOM   1069 C CA    . ALA A 1 158 ? -7.135  23.337  8.387   1.00   72.94  ? 143 ALA A CA    1 
ATOM   1070 C C     . ALA A 1 158 ? -6.766  24.472  7.431   1.00   78.14  ? 143 ALA A C     1 
ATOM   1071 O O     . ALA A 1 158 ? -5.686  24.467  6.829   1.00   72.60  ? 143 ALA A O     1 
ATOM   1072 C CB    . ALA A 1 158 ? -8.369  22.601  7.880   1.00   76.01  ? 143 ALA A CB    1 
ATOM   1073 N N     . SER A 1 159 ? -7.672  25.434  7.279   1.00   78.83  ? 144 SER A N     1 
ATOM   1074 C CA    . SER A 1 159 ? -7.443  26.549  6.365   1.00   77.52  ? 144 SER A CA    1 
ATOM   1075 C C     . SER A 1 159 ? -6.064  27.184  6.566   1.00   75.91  ? 144 SER A C     1 
ATOM   1076 O O     . SER A 1 159 ? -5.414  27.578  5.599   1.00   79.66  ? 144 SER A O     1 
ATOM   1077 C CB    . SER A 1 159 ? -8.560  27.591  6.485   1.00   80.31  ? 144 SER A CB    1 
ATOM   1078 O OG    . SER A 1 159 ? -8.853  27.875  7.842   1.00   88.19  ? 144 SER A OG    1 
ATOM   1079 N N     . GLU A 1 160 ? -5.614  27.261  7.815   1.00   72.52  ? 145 GLU A N     1 
ATOM   1080 C CA    . GLU A 1 160 ? -4.305  27.835  8.124   1.00   74.64  ? 145 GLU A CA    1 
ATOM   1081 C C     . GLU A 1 160 ? -3.148  26.836  7.944   1.00   75.65  ? 145 GLU A C     1 
ATOM   1082 O O     . GLU A 1 160 ? -1.978  27.222  7.897   1.00   76.58  ? 145 GLU A O     1 
ATOM   1083 C CB    . GLU A 1 160 ? -4.301  28.403  9.550   1.00   78.31  ? 145 GLU A CB    1 
ATOM   1084 C CG    . GLU A 1 160 ? -3.056  29.228  9.913   1.00   81.68  ? 145 GLU A CG    1 
ATOM   1085 C CD    . GLU A 1 160 ? -3.011  30.579  9.202   1.00   84.77  ? 145 GLU A CD    1 
ATOM   1086 O OE1   . GLU A 1 160 ? -4.065  31.026  8.693   1.00   80.80  ? 145 GLU A OE1   1 
ATOM   1087 O OE2   . GLU A 1 160 ? -1.921  31.192  9.151   1.00   83.54  ? 145 GLU A OE2   1 
ATOM   1088 N N     . GLN A 1 161 ? -3.479  25.552  7.857   1.00   74.88  ? 146 GLN A N     1 
ATOM   1089 C CA    . GLN A 1 161 ? -2.473  24.511  7.665   1.00   74.84  ? 146 GLN A CA    1 
ATOM   1090 C C     . GLN A 1 161 ? -2.303  24.183  6.183   1.00   73.13  ? 146 GLN A C     1 
ATOM   1091 O O     . GLN A 1 161 ? -1.201  23.872  5.724   1.00   67.55  ? 146 GLN A O     1 
ATOM   1092 C CB    . GLN A 1 161 ? -2.850  23.247  8.446   1.00   75.07  ? 146 GLN A CB    1 
ATOM   1093 C CG    . GLN A 1 161 ? -2.592  23.323  9.946   1.00   70.42  ? 146 GLN A CG    1 
ATOM   1094 C CD    . GLN A 1 161 ? -3.127  22.115  10.701  1.00   66.82  ? 146 GLN A CD    1 
ATOM   1095 O OE1   . GLN A 1 161 ? -4.227  21.630  10.429  1.00   64.44  ? 146 GLN A OE1   1 
ATOM   1096 N NE2   . GLN A 1 161 ? -2.348  21.628  11.658  1.00   63.22  ? 146 GLN A NE2   1 
ATOM   1097 N N     . VAL A 1 162 ? -3.403  24.246  5.438   1.00   72.46  ? 147 VAL A N     1 
ATOM   1098 C CA    . VAL A 1 162 ? -3.346  24.057  3.997   1.00   70.87  ? 147 VAL A CA    1 
ATOM   1099 C C     . VAL A 1 162 ? -2.322  25.024  3.423   1.00   74.27  ? 147 VAL A C     1 
ATOM   1100 O O     . VAL A 1 162 ? -1.652  24.728  2.434   1.00   73.93  ? 147 VAL A O     1 
ATOM   1101 C CB    . VAL A 1 162 ? -4.710  24.297  3.337   1.00   73.63  ? 147 VAL A CB    1 
ATOM   1102 C CG1   . VAL A 1 162 ? -4.569  24.315  1.827   1.00   77.07  ? 147 VAL A CG1   1 
ATOM   1103 C CG2   . VAL A 1 162 ? -5.709  23.234  3.766   1.00   72.43  ? 147 VAL A CG2   1 
ATOM   1104 N N     . LYS A 1 163 ? -2.197  26.177  4.073   1.00   75.23  ? 148 LYS A N     1 
ATOM   1105 C CA    . LYS A 1 163 ? -1.237  27.199  3.681   1.00   73.43  ? 148 LYS A CA    1 
ATOM   1106 C C     . LYS A 1 163 ? 0.196   26.713  3.900   1.00   75.65  ? 148 LYS A C     1 
ATOM   1107 O O     . LYS A 1 163 ? 1.025   26.768  2.989   1.00   75.40  ? 148 LYS A O     1 
ATOM   1108 C CB    . LYS A 1 163 ? -1.504  28.488  4.465   1.00   75.96  ? 148 LYS A CB    1 
ATOM   1109 C CG    . LYS A 1 163 ? -1.605  29.740  3.600   1.00   81.77  ? 148 LYS A CG    1 
ATOM   1110 C CD    . LYS A 1 163 ? -2.423  30.848  4.268   1.00   79.02  ? 148 LYS A CD    1 
ATOM   1111 C CE    . LYS A 1 163 ? -3.909  30.524  4.259   1.00   75.12  ? 148 LYS A CE    1 
ATOM   1112 N NZ    . LYS A 1 163 ? -4.717  31.704  4.658   1.00   70.40  ? 148 LYS A NZ    1 
ATOM   1113 N N     . MET A 1 164 ? 0.475   26.237  5.115   1.00   77.51  ? 149 MET A N     1 
ATOM   1114 C CA    . MET A 1 164 ? 1.763   25.630  5.450   1.00   75.47  ? 149 MET A CA    1 
ATOM   1115 C C     . MET A 1 164 ? 2.117   24.527  4.456   1.00   72.52  ? 149 MET A C     1 
ATOM   1116 O O     . MET A 1 164 ? 3.269   24.381  4.044   1.00   71.31  ? 149 MET A O     1 
ATOM   1117 C CB    . MET A 1 164 ? 1.722   25.032  6.862   1.00   78.24  ? 149 MET A CB    1 
ATOM   1118 C CG    . MET A 1 164 ? 1.924   26.020  7.999   1.00   82.17  ? 149 MET A CG    1 
ATOM   1119 S SD    . MET A 1 164 ? 1.757   25.269  9.651   1.00   81.18  ? 149 MET A SD    1 
ATOM   1120 C CE    . MET A 1 164 ? 0.020   25.577  9.967   1.00   72.26  ? 149 MET A CE    1 
ATOM   1121 N N     . LEU A 1 165 ? 1.114   23.740  4.086   1.00   70.98  ? 150 LEU A N     1 
ATOM   1122 C CA    . LEU A 1 165 ? 1.315   22.656  3.139   1.00   73.50  ? 150 LEU A CA    1 
ATOM   1123 C C     . LEU A 1 165 ? 1.789   23.227  1.800   1.00   75.33  ? 150 LEU A C     1 
ATOM   1124 O O     . LEU A 1 165 ? 2.846   22.845  1.288   1.00   74.77  ? 150 LEU A O     1 
ATOM   1125 C CB    . LEU A 1 165 ? 0.029   21.834  2.988   1.00   72.95  ? 150 LEU A CB    1 
ATOM   1126 C CG    . LEU A 1 165 ? -0.445  21.136  4.275   1.00   68.44  ? 150 LEU A CG    1 
ATOM   1127 C CD1   . LEU A 1 165 ? -1.858  20.591  4.144   1.00   70.24  ? 150 LEU A CD1   1 
ATOM   1128 C CD2   . LEU A 1 165 ? 0.509   20.032  4.681   1.00   59.93  ? 150 LEU A CD2   1 
ATOM   1129 N N     . GLN A 1 166 ? 1.022   24.168  1.258   1.00   75.10  ? 151 GLN A N     1 
ATOM   1130 C CA    . GLN A 1 166 ? 1.385   24.828  0.005   1.00   74.49  ? 151 GLN A CA    1 
ATOM   1131 C C     . GLN A 1 166 ? 2.794   25.395  0.068   1.00   72.34  ? 151 GLN A C     1 
ATOM   1132 O O     . GLN A 1 166 ? 3.560   25.276  -0.886  1.00   73.19  ? 151 GLN A O     1 
ATOM   1133 C CB    . GLN A 1 166 ? 0.390   25.934  -0.332  1.00   70.93  ? 151 GLN A CB    1 
ATOM   1134 C CG    . GLN A 1 166 ? -1.039  25.448  -0.424  1.00   75.21  ? 151 GLN A CG    1 
ATOM   1135 C CD    . GLN A 1 166 ? -2.013  26.561  -0.734  1.00   82.62  ? 151 GLN A CD    1 
ATOM   1136 O OE1   . GLN A 1 166 ? -3.211  26.458  -0.445  1.00   83.11  ? 151 GLN A OE1   1 
ATOM   1137 N NE2   . GLN A 1 166 ? -1.507  27.635  -1.334  1.00   90.42  ? 151 GLN A NE2   1 
ATOM   1138 N N     . ARG A 1 167 ? 3.141   26.005  1.194   1.00   73.27  ? 152 ARG A N     1 
ATOM   1139 C CA    . ARG A 1 167 ? 4.490   26.519  1.351   1.00   72.07  ? 152 ARG A CA    1 
ATOM   1140 C C     . ARG A 1 167 ? 5.486   25.389  1.176   1.00   75.92  ? 152 ARG A C     1 
ATOM   1141 O O     . ARG A 1 167 ? 6.571   25.588  0.632   1.00   77.28  ? 152 ARG A O     1 
ATOM   1142 C CB    . ARG A 1 167 ? 4.700   27.172  2.715   1.00   75.17  ? 152 ARG A CB    1 
ATOM   1143 C CG    . ARG A 1 167 ? 6.052   27.876  2.813   1.00   77.35  ? 152 ARG A CG    1 
ATOM   1144 C CD    . ARG A 1 167 ? 6.737   27.713  4.161   1.00   78.91  ? 152 ARG A CD    1 
ATOM   1145 N NE    . ARG A 1 167 ? 8.095   28.256  4.116   1.00   80.53  ? 152 ARG A NE    1 
ATOM   1146 C CZ    . ARG A 1 167 ? 8.955   28.243  5.129   1.00   80.07  ? 152 ARG A CZ    1 
ATOM   1147 N NH1   . ARG A 1 167 ? 8.611   27.713  6.292   1.00   81.77  ? 152 ARG A NH1   1 
ATOM   1148 N NH2   . ARG A 1 167 ? 10.168  28.756  4.978   1.00   80.05  ? 152 ARG A NH2   1 
ATOM   1149 N N     . ILE A 1 168 ? 5.119   24.199  1.643   1.00   75.68  ? 153 ILE A N     1 
ATOM   1150 C CA    . ILE A 1 168 ? 6.031   23.064  1.557   1.00   77.78  ? 153 ILE A CA    1 
ATOM   1151 C C     . ILE A 1 168 ? 6.146   22.566  0.114   1.00   76.09  ? 153 ILE A C     1 
ATOM   1152 O O     . ILE A 1 168 ? 7.247   22.290  -0.373  1.00   76.00  ? 153 ILE A O     1 
ATOM   1153 C CB    . ILE A 1 168 ? 5.645   21.909  2.519   1.00   74.96  ? 153 ILE A CB    1 
ATOM   1154 C CG1   . ILE A 1 168 ? 5.345   22.452  3.918   1.00   76.72  ? 153 ILE A CG1   1 
ATOM   1155 C CG2   . ILE A 1 168 ? 6.772   20.893  2.603   1.00   68.14  ? 153 ILE A CG2   1 
ATOM   1156 C CD1   . ILE A 1 168 ? 5.475   21.420  5.020   1.00   70.91  ? 153 ILE A CD1   1 
ATOM   1157 N N     . ASP A 1 169 ? 5.013   22.458  -0.570  1.00   74.10  ? 154 ASP A N     1 
ATOM   1158 C CA    . ASP A 1 169 ? 5.030   22.120  -1.986  1.00   79.27  ? 154 ASP A CA    1 
ATOM   1159 C C     . ASP A 1 169 ? 5.958   23.073  -2.739  1.00   82.63  ? 154 ASP A C     1 
ATOM   1160 O O     . ASP A 1 169 ? 6.904   22.639  -3.409  1.00   82.57  ? 154 ASP A O     1 
ATOM   1161 C CB    . ASP A 1 169 ? 3.620   22.175  -2.565  1.00   74.65  ? 154 ASP A CB    1 
ATOM   1162 C CG    . ASP A 1 169 ? 2.708   21.147  -1.942  1.00   82.65  ? 154 ASP A CG    1 
ATOM   1163 O OD1   . ASP A 1 169 ? 3.242   20.223  -1.284  1.00   84.38  ? 154 ASP A OD1   1 
ATOM   1164 O OD2   . ASP A 1 169 ? 1.470   21.254  -2.109  1.00   81.04  ? 154 ASP A OD2   1 
ATOM   1165 N N     . ALA A 1 170 ? 5.683   24.370  -2.610  1.00   79.52  ? 155 ALA A N     1 
ATOM   1166 C CA    . ALA A 1 170 ? 6.525   25.407  -3.195  1.00   80.97  ? 155 ALA A CA    1 
ATOM   1167 C C     . ALA A 1 170 ? 8.003   25.081  -3.027  1.00   80.78  ? 155 ALA A C     1 
ATOM   1168 O O     . ALA A 1 170 ? 8.759   25.075  -3.998  1.00   83.22  ? 155 ALA A O     1 
ATOM   1169 C CB    . ALA A 1 170 ? 6.211   26.759  -2.576  1.00   76.26  ? 155 ALA A CB    1 
ATOM   1170 N N     . HIS A 1 171 ? 8.411   24.806  -1.793  1.00   79.24  ? 156 HIS A N     1 
ATOM   1171 C CA    . HIS A 1 171 ? 9.812   24.515  -1.508  1.00   78.96  ? 156 HIS A CA    1 
ATOM   1172 C C     . HIS A 1 171 ? 10.266  23.283  -2.281  1.00   81.94  ? 156 HIS A C     1 
ATOM   1173 O O     . HIS A 1 171 ? 11.414  23.207  -2.717  1.00   83.70  ? 156 HIS A O     1 
ATOM   1174 C CB    . HIS A 1 171 ? 10.026  24.322  -0.006  1.00   73.79  ? 156 HIS A CB    1 
ATOM   1175 C CG    . HIS A 1 171 ? 11.406  23.873  0.363   1.00   73.85  ? 156 HIS A CG    1 
ATOM   1176 N ND1   . HIS A 1 171 ? 12.344  24.718  0.919   1.00   76.13  ? 156 HIS A ND1   1 
ATOM   1177 C CD2   . HIS A 1 171 ? 12.005  22.661  0.269   1.00   74.35  ? 156 HIS A CD2   1 
ATOM   1178 C CE1   . HIS A 1 171 ? 13.460  24.048  1.146   1.00   73.25  ? 156 HIS A CE1   1 
ATOM   1179 N NE2   . HIS A 1 171 ? 13.278  22.796  0.764   1.00   71.73  ? 156 HIS A NE2   1 
ATOM   1180 N N     . ASN A 1 172 ? 9.358   22.326  -2.460  1.00   81.56  ? 157 ASN A N     1 
ATOM   1181 C CA    . ASN A 1 172 ? 9.683   21.093  -3.173  1.00   84.84  ? 157 ASN A CA    1 
ATOM   1182 C C     . ASN A 1 172 ? 9.834   21.288  -4.676  1.00   87.60  ? 157 ASN A C     1 
ATOM   1183 O O     . ASN A 1 172 ? 10.793  20.801  -5.273  1.00   87.48  ? 157 ASN A O     1 
ATOM   1184 C CB    . ASN A 1 172 ? 8.646   20.007  -2.893  1.00   83.26  ? 157 ASN A CB    1 
ATOM   1185 C CG    . ASN A 1 172 ? 8.808   19.390  -1.521  1.00   81.20  ? 157 ASN A CG    1 
ATOM   1186 O OD1   . ASN A 1 172 ? 7.825   19.146  -0.828  1.00   75.45  ? 157 ASN A OD1   1 
ATOM   1187 N ND2   . ASN A 1 172 ? 10.053  19.145  -1.116  1.00   79.91  ? 157 ASN A ND2   1 
ATOM   1188 N N     . THR A 1 173 ? 8.878   21.986  -5.285  1.00   86.98  ? 158 THR A N     1 
ATOM   1189 C CA    . THR A 1 173 ? 8.954   22.309  -6.711  1.00   87.47  ? 158 THR A CA    1 
ATOM   1190 C C     . THR A 1 173 ? 10.330  22.854  -7.078  1.00   88.79  ? 158 THR A C     1 
ATOM   1191 O O     . THR A 1 173 ? 10.692  22.937  -8.250  1.00   94.31  ? 158 THR A O     1 
ATOM   1192 C CB    . THR A 1 173 ? 7.910   23.370  -7.114  1.00   83.71  ? 158 THR A CB    1 
ATOM   1193 O OG1   . THR A 1 173 ? 8.143   24.579  -6.380  1.00   85.73  ? 158 THR A OG1   1 
ATOM   1194 C CG2   . THR A 1 173 ? 6.496   22.884  -6.836  1.00   85.38  ? 158 THR A CG2   1 
ATOM   1195 N N     . ARG A 1 174 ? 11.105  23.210  -6.064  1.00   87.99  ? 159 ARG A N     1 
ATOM   1196 C CA    . ARG A 1 174 ? 12.371  23.897  -6.271  1.00   87.69  ? 159 ARG A CA    1 
ATOM   1197 C C     . ARG A 1 174 ? 13.578  23.029  -5.883  1.00   90.25  ? 159 ARG A C     1 
ATOM   1198 O O     . ARG A 1 174 ? 14.657  23.545  -5.583  1.00   89.88  ? 159 ARG A O     1 
ATOM   1199 C CB    . ARG A 1 174 ? 12.360  25.189  -5.448  1.00   89.21  ? 159 ARG A CB    1 
ATOM   1200 C CG    . ARG A 1 174 ? 13.458  26.173  -5.759  1.00   92.81  ? 159 ARG A CG    1 
ATOM   1201 C CD    . ARG A 1 174 ? 12.932  27.590  -5.696  1.00   94.65  ? 159 ARG A CD    1 
ATOM   1202 N NE    . ARG A 1 174 ? 12.175  27.863  -4.475  1.00   96.47  ? 159 ARG A NE    1 
ATOM   1203 C CZ    . ARG A 1 174 ? 10.846  27.859  -4.396  1.00   93.62  ? 159 ARG A CZ    1 
ATOM   1204 N NH1   . ARG A 1 174 ? 10.108  27.581  -5.465  1.00   89.83  ? 159 ARG A NH1   1 
ATOM   1205 N NH2   . ARG A 1 174 ? 10.251  28.129  -3.240  1.00   89.37  ? 159 ARG A NH2   1 
ATOM   1206 N N     . GLN A 1 175 ? 13.413  21.710  -5.916  1.00   89.18  ? 160 GLN A N     1 
ATOM   1207 C CA    . GLN A 1 175 ? 14.411  20.819  -5.325  1.00   90.00  ? 160 GLN A CA    1 
ATOM   1208 C C     . GLN A 1 175 ? 14.561  19.502  -6.074  1.00   92.50  ? 160 GLN A C     1 
ATOM   1209 O O     . GLN A 1 175 ? 13.573  18.925  -6.529  1.00   92.83  ? 160 GLN A O     1 
ATOM   1210 C CB    . GLN A 1 175 ? 14.040  20.520  -3.866  1.00   95.06  ? 160 GLN A CB    1 
ATOM   1211 C CG    . GLN A 1 175 ? 14.072  21.730  -2.942  1.00   87.28  ? 160 GLN A CG    1 
ATOM   1212 C CD    . GLN A 1 175 ? 15.462  22.010  -2.421  1.00   90.18  ? 160 GLN A CD    1 
ATOM   1213 O OE1   . GLN A 1 175 ? 16.303  21.109  -2.351  1.00   90.35  ? 160 GLN A OE1   1 
ATOM   1214 N NE2   . GLN A 1 175 ? 15.712  23.258  -2.046  1.00   84.22  ? 160 GLN A NE2   1 
ATOM   1215 N N     . PRO A 1 176 ? 15.804  19.009  -6.184  1.00   94.24  ? 161 PRO A N     1 
ATOM   1216 C CA    . PRO A 1 176 ? 16.065  17.689  -6.772  1.00   97.17  ? 161 PRO A CA    1 
ATOM   1217 C C     . PRO A 1 176 ? 15.284  16.613  -6.025  1.00   98.55  ? 161 PRO A C     1 
ATOM   1218 O O     . PRO A 1 176 ? 15.207  16.682  -4.799  1.00   96.84  ? 161 PRO A O     1 
ATOM   1219 C CB    . PRO A 1 176 ? 17.570  17.495  -6.550  1.00   96.63  ? 161 PRO A CB    1 
ATOM   1220 C CG    . PRO A 1 176 ? 17.948  18.487  -5.479  1.00   95.88  ? 161 PRO A CG    1 
ATOM   1221 C CD    . PRO A 1 176 ? 17.031  19.652  -5.685  1.00   93.32  ? 161 PRO A CD    1 
ATOM   1222 N N     . PRO A 1 177 ? 14.701  15.640  -6.749  1.00   100.85 ? 162 PRO A N     1 
ATOM   1223 C CA    . PRO A 1 177 ? 13.928  14.569  -6.105  1.00   99.94  ? 162 PRO A CA    1 
ATOM   1224 C C     . PRO A 1 177 ? 14.689  13.939  -4.936  1.00   99.96  ? 162 PRO A C     1 
ATOM   1225 O O     . PRO A 1 177 ? 14.075  13.449  -3.989  1.00   98.37  ? 162 PRO A O     1 
ATOM   1226 C CB    . PRO A 1 177 ? 13.742  13.552  -7.235  1.00   98.71  ? 162 PRO A CB    1 
ATOM   1227 C CG    . PRO A 1 177 ? 13.737  14.385  -8.475  1.00   95.90  ? 162 PRO A CG    1 
ATOM   1228 C CD    . PRO A 1 177 ? 14.736  15.488  -8.216  1.00   97.07  ? 162 PRO A CD    1 
ATOM   1229 N N     . GLU A 1 178 ? 16.016  13.967  -5.012  1.00   100.22 ? 163 GLU A N     1 
ATOM   1230 C CA    . GLU A 1 178 ? 16.871  13.417  -3.968  1.00   101.78 ? 163 GLU A CA    1 
ATOM   1231 C C     . GLU A 1 178 ? 16.837  14.290  -2.708  1.00   101.23 ? 163 GLU A C     1 
ATOM   1232 O O     . GLU A 1 178 ? 17.386  13.918  -1.671  1.00   100.29 ? 163 GLU A O     1 
ATOM   1233 C CB    . GLU A 1 178 ? 18.308  13.299  -4.494  1.00   104.36 ? 163 GLU A CB    1 
ATOM   1234 C CG    . GLU A 1 178 ? 18.980  11.944  -4.259  1.00   107.36 ? 163 GLU A CG    1 
ATOM   1235 C CD    . GLU A 1 178 ? 19.919  11.943  -3.056  1.00   112.44 ? 163 GLU A CD    1 
ATOM   1236 O OE1   . GLU A 1 178 ? 20.753  11.015  -2.942  1.00   110.02 ? 163 GLU A OE1   1 
ATOM   1237 O OE2   . GLU A 1 178 ? 19.825  12.872  -2.222  1.00   111.60 ? 163 GLU A OE2   1 
ATOM   1238 N N     . GLN A 1 179 ? 16.177  15.443  -2.796  1.00   97.97  ? 164 GLN A N     1 
ATOM   1239 C CA    . GLN A 1 179 ? 16.241  16.447  -1.735  1.00   93.98  ? 164 GLN A CA    1 
ATOM   1240 C C     . GLN A 1 179 ? 14.888  17.037  -1.359  1.00   89.08  ? 164 GLN A C     1 
ATOM   1241 O O     . GLN A 1 179 ? 14.826  18.072  -0.703  1.00   87.67  ? 164 GLN A O     1 
ATOM   1242 C CB    . GLN A 1 179 ? 17.175  17.586  -2.151  1.00   98.88  ? 164 GLN A CB    1 
ATOM   1243 C CG    . GLN A 1 179 ? 18.626  17.175  -2.343  1.00   100.16 ? 164 GLN A CG    1 
ATOM   1244 C CD    . GLN A 1 179 ? 19.420  17.261  -1.061  1.00   101.98 ? 164 GLN A CD    1 
ATOM   1245 O OE1   . GLN A 1 179 ? 19.355  18.263  -0.346  1.00   101.93 ? 164 GLN A OE1   1 
ATOM   1246 N NE2   . GLN A 1 179 ? 20.171  16.206  -0.754  1.00   100.98 ? 164 GLN A NE2   1 
ATOM   1247 N N     . LYS A 1 180 ? 13.806  16.395  -1.779  1.00   86.67  ? 165 LYS A N     1 
ATOM   1248 C CA    . LYS A 1 180 ? 12.475  16.866  -1.415  1.00   85.01  ? 165 LYS A CA    1 
ATOM   1249 C C     . LYS A 1 180 ? 12.142  16.522  0.040   1.00   81.90  ? 165 LYS A C     1 
ATOM   1250 O O     . LYS A 1 180 ? 12.638  15.536  0.594   1.00   77.23  ? 165 LYS A O     1 
ATOM   1251 C CB    . LYS A 1 180 ? 11.412  16.286  -2.356  1.00   87.94  ? 165 LYS A CB    1 
ATOM   1252 C CG    . LYS A 1 180 ? 11.586  16.693  -3.817  1.00   91.70  ? 165 LYS A CG    1 
ATOM   1253 C CD    . LYS A 1 180 ? 10.482  16.114  -4.694  1.00   95.74  ? 165 LYS A CD    1 
ATOM   1254 C CE    . LYS A 1 180 ? 10.676  16.480  -6.160  1.00   94.22  ? 165 LYS A CE    1 
ATOM   1255 N NZ    . LYS A 1 180 ? 10.650  17.955  -6.372  1.00   90.44  ? 165 LYS A NZ    1 
ATOM   1256 N N     . ILE A 1 181 ? 11.314  17.355  0.658   1.00   78.56  ? 166 ILE A N     1 
ATOM   1257 C CA    . ILE A 1 181 ? 10.836  17.087  2.004   1.00   75.27  ? 166 ILE A CA    1 
ATOM   1258 C C     . ILE A 1 181 ? 9.588   16.219  1.928   1.00   70.60  ? 166 ILE A C     1 
ATOM   1259 O O     . ILE A 1 181 ? 8.579   16.625  1.341   1.00   65.45  ? 166 ILE A O     1 
ATOM   1260 C CB    . ILE A 1 181 ? 10.496  18.388  2.751   1.00   72.07  ? 166 ILE A CB    1 
ATOM   1261 C CG1   . ILE A 1 181 ? 11.773  19.174  3.057   1.00   73.42  ? 166 ILE A CG1   1 
ATOM   1262 C CG2   . ILE A 1 181 ? 9.750   18.083  4.034   1.00   65.90  ? 166 ILE A CG2   1 
ATOM   1263 C CD1   . ILE A 1 181 ? 11.525  20.487  3.776   1.00   72.95  ? 166 ILE A CD1   1 
ATOM   1264 N N     . ARG A 1 182 ? 9.666   15.018  2.500   1.00   64.79  ? 167 ARG A N     1 
ATOM   1265 C CA    . ARG A 1 182 ? 8.501   14.135  2.587   1.00   63.08  ? 167 ARG A CA    1 
ATOM   1266 C C     . ARG A 1 182 ? 7.466   14.739  3.532   1.00   56.00  ? 167 ARG A C     1 
ATOM   1267 O O     . ARG A 1 182 ? 7.817   15.315  4.556   1.00   57.44  ? 167 ARG A O     1 
ATOM   1268 C CB    . ARG A 1 182 ? 8.918   12.747  3.079   1.00   61.20  ? 167 ARG A CB    1 
ATOM   1269 C CG    . ARG A 1 182 ? 9.711   11.926  2.072   1.00   64.64  ? 167 ARG A CG    1 
ATOM   1270 C CD    . ARG A 1 182 ? 8.804   11.457  0.946   1.00   68.92  ? 167 ARG A CD    1 
ATOM   1271 N NE    . ARG A 1 182 ? 9.555   11.043  -0.236  1.00   80.92  ? 167 ARG A NE    1 
ATOM   1272 C CZ    . ARG A 1 182 ? 8.997   10.618  -1.369  1.00   86.40  ? 167 ARG A CZ    1 
ATOM   1273 N NH1   . ARG A 1 182 ? 9.766   10.265  -2.393  1.00   87.62  ? 167 ARG A NH1   1 
ATOM   1274 N NH2   . ARG A 1 182 ? 7.673   10.542  -1.480  1.00   80.47  ? 167 ARG A NH2   1 
ATOM   1275 N N     . VAL A 1 183 ? 6.193   14.603  3.193   1.00   53.36  ? 168 VAL A N     1 
ATOM   1276 C CA    . VAL A 1 183 ? 5.134   15.201  3.993   1.00   53.90  ? 168 VAL A CA    1 
ATOM   1277 C C     . VAL A 1 183 ? 4.036   14.203  4.377   1.00   55.39  ? 168 VAL A C     1 
ATOM   1278 O O     . VAL A 1 183 ? 3.568   13.435  3.535   1.00   52.62  ? 168 VAL A O     1 
ATOM   1279 C CB    . VAL A 1 183 ? 4.486   16.385  3.245   1.00   57.41  ? 168 VAL A CB    1 
ATOM   1280 C CG1   . VAL A 1 183 ? 3.168   16.799  3.904   1.00   56.82  ? 168 VAL A CG1   1 
ATOM   1281 C CG2   . VAL A 1 183 ? 5.455   17.557  3.169   1.00   61.71  ? 168 VAL A CG2   1 
ATOM   1282 N N     . SER A 1 184 ? 3.625   14.224  5.645   1.00   48.46  ? 169 SER A N     1 
ATOM   1283 C CA    . SER A 1 184 ? 2.489   13.418  6.090   1.00   52.11  ? 169 SER A CA    1 
ATOM   1284 C C     . SER A 1 184 ? 1.451   14.239  6.851   1.00   48.15  ? 169 SER A C     1 
ATOM   1285 O O     . SER A 1 184 ? 1.766   15.243  7.474   1.00   50.46  ? 169 SER A O     1 
ATOM   1286 C CB    . SER A 1 184 ? 2.950   12.226  6.936   1.00   50.05  ? 169 SER A CB    1 
ATOM   1287 O OG    . SER A 1 184 ? 3.721   12.644  8.049   1.00   50.26  ? 169 SER A OG    1 
ATOM   1288 N N     . VAL A 1 185 ? 0.212   13.776  6.799   1.00   49.87  ? 170 VAL A N     1 
ATOM   1289 C CA    . VAL A 1 185 ? -0.929  14.482  7.355   1.00   49.82  ? 170 VAL A CA    1 
ATOM   1290 C C     . VAL A 1 185 ? -1.805  13.520  8.156   1.00   50.46  ? 170 VAL A C     1 
ATOM   1291 O O     . VAL A 1 185 ? -2.079  12.417  7.703   1.00   49.30  ? 170 VAL A O     1 
ATOM   1292 C CB    . VAL A 1 185 ? -1.782  15.067  6.211   1.00   51.93  ? 170 VAL A CB    1 
ATOM   1293 C CG1   . VAL A 1 185 ? -3.240  15.228  6.630   1.00   52.38  ? 170 VAL A CG1   1 
ATOM   1294 C CG2   . VAL A 1 185 ? -1.183  16.374  5.724   1.00   55.92  ? 170 VAL A CG2   1 
ATOM   1295 N N     . GLU A 1 186 ? -2.246  13.931  9.343   1.00   51.48  ? 171 GLU A N     1 
ATOM   1296 C CA    . GLU A 1 186 ? -3.197  13.128  10.096  1.00   48.55  ? 171 GLU A CA    1 
ATOM   1297 C C     . GLU A 1 186 ? -4.573  13.771  10.115  1.00   50.20  ? 171 GLU A C     1 
ATOM   1298 O O     . GLU A 1 186 ? -4.739  14.905  10.556  1.00   53.75  ? 171 GLU A O     1 
ATOM   1299 C CB    . GLU A 1 186 ? -2.732  12.885  11.536  1.00   50.39  ? 171 GLU A CB    1 
ATOM   1300 C CG    . GLU A 1 186 ? -3.858  12.290  12.419  1.00   54.02  ? 171 GLU A CG    1 
ATOM   1301 C CD    . GLU A 1 186 ? -3.461  12.061  13.891  1.00   60.80  ? 171 GLU A CD    1 
ATOM   1302 O OE1   . GLU A 1 186 ? -3.013  13.025  14.562  1.00   54.89  ? 171 GLU A OE1   1 
ATOM   1303 O OE2   . GLU A 1 186 ? -3.610  10.907  14.374  1.00   59.96  ? 171 GLU A OE2   1 
ATOM   1304 N N     . VAL A 1 187 ? -5.566  13.036  9.642   1.00   50.22  ? 172 VAL A N     1 
ATOM   1305 C CA    . VAL A 1 187 ? -6.945  13.462  9.768   1.00   52.76  ? 172 VAL A CA    1 
ATOM   1306 C C     . VAL A 1 187 ? -7.623  12.545  10.787  1.00   56.57  ? 172 VAL A C     1 
ATOM   1307 O O     . VAL A 1 187 ? -7.904  11.374  10.506  1.00   54.48  ? 172 VAL A O     1 
ATOM   1308 C CB    . VAL A 1 187 ? -7.673  13.430  8.401   1.00   54.71  ? 172 VAL A CB    1 
ATOM   1309 C CG1   . VAL A 1 187 ? -9.169  13.728  8.562   1.00   50.93  ? 172 VAL A CG1   1 
ATOM   1310 C CG2   . VAL A 1 187 ? -7.012  14.414  7.428   1.00   53.67  ? 172 VAL A CG2   1 
ATOM   1311 N N     . GLU A 1 188 ? -7.875  13.069  11.980  1.00   59.03  ? 173 GLU A N     1 
ATOM   1312 C CA    . GLU A 1 188 ? -8.339  12.209  13.055  1.00   61.47  ? 173 GLU A CA    1 
ATOM   1313 C C     . GLU A 1 188 ? -9.733  12.511  13.580  1.00   61.81  ? 173 GLU A C     1 
ATOM   1314 O O     . GLU A 1 188 ? -10.399 11.625  14.118  1.00   60.96  ? 173 GLU A O     1 
ATOM   1315 C CB    . GLU A 1 188 ? -7.355  12.209  14.212  1.00   59.84  ? 173 GLU A CB    1 
ATOM   1316 C CG    . GLU A 1 188 ? -7.594  11.061  15.173  1.00   63.75  ? 173 GLU A CG    1 
ATOM   1317 C CD    . GLU A 1 188 ? -7.078  11.366  16.549  1.00   69.24  ? 173 GLU A CD    1 
ATOM   1318 O OE1   . GLU A 1 188 ? -7.390  12.468  17.058  1.00   68.05  ? 173 GLU A OE1   1 
ATOM   1319 O OE2   . GLU A 1 188 ? -6.354  10.514  17.113  1.00   69.99  ? 173 GLU A OE2   1 
ATOM   1320 N N     . LYS A 1 189 ? -10.187 13.748  13.448  1.00   64.33  ? 174 LYS A N     1 
ATOM   1321 C CA    . LYS A 1 189 ? -11.514 14.061  13.972  1.00   68.46  ? 174 LYS A CA    1 
ATOM   1322 C C     . LYS A 1 189 ? -12.545 14.139  12.848  1.00   66.31  ? 174 LYS A C     1 
ATOM   1323 O O     . LYS A 1 189 ? -12.260 14.669  11.773  1.00   63.84  ? 174 LYS A O     1 
ATOM   1324 C CB    . LYS A 1 189 ? -11.492 15.332  14.827  1.00   67.22  ? 174 LYS A CB    1 
ATOM   1325 C CG    . LYS A 1 189 ? -10.568 15.245  16.043  1.00   67.27  ? 174 LYS A CG    1 
ATOM   1326 C CD    . LYS A 1 189 ? -9.111  15.467  15.633  1.00   73.56  ? 174 LYS A CD    1 
ATOM   1327 C CE    . LYS A 1 189 ? -8.116  15.167  16.770  1.00   72.31  ? 174 LYS A CE    1 
ATOM   1328 N NZ    . LYS A 1 189 ? -8.253  16.084  17.945  1.00   75.45  ? 174 LYS A NZ    1 
ATOM   1329 N N     . PRO A 1 190 ? -13.737 13.575  13.085  1.00   64.71  ? 175 PRO A N     1 
ATOM   1330 C CA    . PRO A 1 190 ? -14.815 13.599  12.093  1.00   66.58  ? 175 PRO A CA    1 
ATOM   1331 C C     . PRO A 1 190 ? -15.285 15.036  11.942  1.00   71.96  ? 175 PRO A C     1 
ATOM   1332 O O     . PRO A 1 190 ? -16.291 15.436  12.532  1.00   69.90  ? 175 PRO A O     1 
ATOM   1333 C CB    . PRO A 1 190 ? -15.914 12.751  12.739  1.00   69.87  ? 175 PRO A CB    1 
ATOM   1334 C CG    . PRO A 1 190 ? -15.258 12.041  13.900  1.00   71.77  ? 175 PRO A CG    1 
ATOM   1335 C CD    . PRO A 1 190 ? -14.150 12.932  14.341  1.00   67.34  ? 175 PRO A CD    1 
ATOM   1336 N N     . ARG A 1 191 ? -14.543 15.814  11.167  1.00   70.11  ? 176 ARG A N     1 
ATOM   1337 C CA    . ARG A 1 191 ? -14.769 17.246  11.118  1.00   72.10  ? 176 ARG A CA    1 
ATOM   1338 C C     . ARG A 1 191 ? -14.540 17.807  9.721   1.00   75.26  ? 176 ARG A C     1 
ATOM   1339 O O     . ARG A 1 191 ? -13.414 17.838  9.213   1.00   72.96  ? 176 ARG A O     1 
ATOM   1340 C CB    . ARG A 1 191 ? -13.892 17.956  12.152  1.00   76.89  ? 176 ARG A CB    1 
ATOM   1341 C CG    . ARG A 1 191 ? -14.147 19.444  12.272  1.00   80.45  ? 176 ARG A CG    1 
ATOM   1342 C CD    . ARG A 1 191 ? -13.543 20.001  13.554  1.00   85.03  ? 176 ARG A CD    1 
ATOM   1343 N NE    . ARG A 1 191 ? -12.934 21.311  13.338  1.00   88.06  ? 176 ARG A NE    1 
ATOM   1344 C CZ    . ARG A 1 191 ? -13.621 22.432  13.135  1.00   93.67  ? 176 ARG A CZ    1 
ATOM   1345 N NH1   . ARG A 1 191 ? -12.976 23.578  12.947  1.00   89.94  ? 176 ARG A NH1   1 
ATOM   1346 N NH2   . ARG A 1 191 ? -14.951 22.409  13.112  1.00   92.04  ? 176 ARG A NH2   1 
ATOM   1347 N N     . GLU A 1 192 ? -15.639 18.249  9.119   1.00   79.60  ? 177 GLU A N     1 
ATOM   1348 C CA    . GLU A 1 192 ? -15.661 18.784  7.764   1.00   76.15  ? 177 GLU A CA    1 
ATOM   1349 C C     . GLU A 1 192 ? -14.444 19.608  7.380   1.00   76.01  ? 177 GLU A C     1 
ATOM   1350 O O     . GLU A 1 192 ? -13.826 19.342  6.349   1.00   77.88  ? 177 GLU A O     1 
ATOM   1351 C CB    . GLU A 1 192 ? -16.930 19.612  7.557   1.00   81.24  ? 177 GLU A CB    1 
ATOM   1352 C CG    . GLU A 1 192 ? -18.081 18.815  6.967   1.00   86.48  ? 177 GLU A CG    1 
ATOM   1353 C CD    . GLU A 1 192 ? -17.793 18.382  5.543   1.00   91.53  ? 177 GLU A CD    1 
ATOM   1354 O OE1   . GLU A 1 192 ? -16.867 18.959  4.928   1.00   90.45  ? 177 GLU A OE1   1 
ATOM   1355 O OE2   . GLU A 1 192 ? -18.484 17.468  5.041   1.00   92.42  ? 177 GLU A OE2   1 
ATOM   1356 N N     . GLU A 1 193 ? -14.108 20.610  8.195   1.00   76.11  ? 178 GLU A N     1 
ATOM   1357 C CA    . GLU A 1 193 ? -13.033 21.541  7.853   1.00   75.10  ? 178 GLU A CA    1 
ATOM   1358 C C     . GLU A 1 193 ? -11.752 20.793  7.530   1.00   72.59  ? 178 GLU A C     1 
ATOM   1359 O O     . GLU A 1 193 ? -10.943 21.258  6.731   1.00   73.96  ? 178 GLU A O     1 
ATOM   1360 C CB    . GLU A 1 193 ? -12.768 22.559  8.978   1.00   78.84  ? 178 GLU A CB    1 
ATOM   1361 C CG    . GLU A 1 193 ? -11.833 23.713  8.552   1.00   83.74  ? 178 GLU A CG    1 
ATOM   1362 C CD    . GLU A 1 193 ? -11.067 24.368  9.712   1.00   90.91  ? 178 GLU A CD    1 
ATOM   1363 O OE1   . GLU A 1 193 ? -11.018 23.779  10.819  1.00   91.20  ? 178 GLU A OE1   1 
ATOM   1364 O OE2   . GLU A 1 193 ? -10.502 25.473  9.511   1.00   85.64  ? 178 GLU A OE2   1 
ATOM   1365 N N     . LEU A 1 194 ? -11.581 19.628  8.149   1.00   70.20  ? 179 LEU A N     1 
ATOM   1366 C CA    . LEU A 1 194 ? -10.330 18.876  8.045   1.00   73.06  ? 179 LEU A CA    1 
ATOM   1367 C C     . LEU A 1 194 ? -10.174 18.072  6.751   1.00   69.34  ? 179 LEU A C     1 
ATOM   1368 O O     . LEU A 1 194 ? -9.054  17.752  6.351   1.00   68.50  ? 179 LEU A O     1 
ATOM   1369 C CB    . LEU A 1 194 ? -10.158 17.948  9.253   1.00   70.81  ? 179 LEU A CB    1 
ATOM   1370 C CG    . LEU A 1 194 ? -10.039 18.621  10.622  1.00   70.26  ? 179 LEU A CG    1 
ATOM   1371 C CD1   . LEU A 1 194 ? -9.995  17.574  11.721  1.00   71.95  ? 179 LEU A CD1   1 
ATOM   1372 C CD2   . LEU A 1 194 ? -8.816  19.523  10.683  1.00   68.74  ? 179 LEU A CD2   1 
ATOM   1373 N N     . PHE A 1 195 ? -11.285 17.750  6.098   1.00   66.99  ? 180 PHE A N     1 
ATOM   1374 C CA    . PHE A 1 195 ? -11.239 16.887  4.922   1.00   67.02  ? 180 PHE A CA    1 
ATOM   1375 C C     . PHE A 1 195 ? -10.439 17.489  3.768   1.00   66.89  ? 180 PHE A C     1 
ATOM   1376 O O     . PHE A 1 195 ? -9.911  16.766  2.927   1.00   67.33  ? 180 PHE A O     1 
ATOM   1377 C CB    . PHE A 1 195 ? -12.647 16.496  4.475   1.00   68.62  ? 180 PHE A CB    1 
ATOM   1378 C CG    . PHE A 1 195 ? -13.418 15.720  5.511   1.00   69.73  ? 180 PHE A CG    1 
ATOM   1379 C CD1   . PHE A 1 195 ? -14.797 15.636  5.452   1.00   76.65  ? 180 PHE A CD1   1 
ATOM   1380 C CD2   . PHE A 1 195 ? -12.765 15.073  6.543   1.00   72.09  ? 180 PHE A CD2   1 
ATOM   1381 C CE1   . PHE A 1 195 ? -15.511 14.921  6.406   1.00   73.89  ? 180 PHE A CE1   1 
ATOM   1382 C CE2   . PHE A 1 195 ? -13.476 14.358  7.501   1.00   71.34  ? 180 PHE A CE2   1 
ATOM   1383 C CZ    . PHE A 1 195 ? -14.847 14.283  7.429   1.00   70.43  ? 180 PHE A CZ    1 
ATOM   1384 N N     . GLN A 1 196 ? -10.329 18.809  3.731   1.00   69.39  ? 181 GLN A N     1 
ATOM   1385 C CA    . GLN A 1 196 ? -9.513  19.440  2.704   1.00   67.62  ? 181 GLN A CA    1 
ATOM   1386 C C     . GLN A 1 196 ? -8.066  18.962  2.793   1.00   67.50  ? 181 GLN A C     1 
ATOM   1387 O O     . GLN A 1 196 ? -7.310  19.056  1.821   1.00   65.69  ? 181 GLN A O     1 
ATOM   1388 C CB    . GLN A 1 196 ? -9.587  20.968  2.801   1.00   71.01  ? 181 GLN A CB    1 
ATOM   1389 C CG    . GLN A 1 196 ? -9.429  21.519  4.215   1.00   74.03  ? 181 GLN A CG    1 
ATOM   1390 C CD    . GLN A 1 196 ? -9.475  23.043  4.263   1.00   79.78  ? 181 GLN A CD    1 
ATOM   1391 O OE1   . GLN A 1 196 ? -8.739  23.722  3.542   1.00   79.90  ? 181 GLN A OE1   1 
ATOM   1392 N NE2   . GLN A 1 196 ? -10.347 23.586  5.116   1.00   78.72  ? 181 GLN A NE2   1 
ATOM   1393 N N     . LEU A 1 197 ? -7.685  18.442  3.959   1.00   66.51  ? 182 LEU A N     1 
ATOM   1394 C CA    . LEU A 1 197 ? -6.300  18.018  4.195   1.00   66.91  ? 182 LEU A CA    1 
ATOM   1395 C C     . LEU A 1 197 ? -5.922  16.704  3.497   1.00   64.60  ? 182 LEU A C     1 
ATOM   1396 O O     . LEU A 1 197 ? -4.744  16.477  3.201   1.00   61.35  ? 182 LEU A O     1 
ATOM   1397 C CB    . LEU A 1 197 ? -6.008  17.923  5.688   1.00   62.39  ? 182 LEU A CB    1 
ATOM   1398 C CG    . LEU A 1 197 ? -5.989  19.260  6.416   1.00   67.84  ? 182 LEU A CG    1 
ATOM   1399 C CD1   . LEU A 1 197 ? -6.901  19.205  7.627   1.00   72.60  ? 182 LEU A CD1   1 
ATOM   1400 C CD2   . LEU A 1 197 ? -4.564  19.631  6.819   1.00   69.64  ? 182 LEU A CD2   1 
ATOM   1401 N N     . PHE A 1 198 ? -6.914  15.850  3.244   1.00   61.19  ? 183 PHE A N     1 
ATOM   1402 C CA    . PHE A 1 198 ? -6.697  14.632  2.465   1.00   63.07  ? 183 PHE A CA    1 
ATOM   1403 C C     . PHE A 1 198 ? -5.853  14.941  1.235   1.00   64.83  ? 183 PHE A C     1 
ATOM   1404 O O     . PHE A 1 198 ? -4.990  14.149  0.831   1.00   64.19  ? 183 PHE A O     1 
ATOM   1405 C CB    . PHE A 1 198 ? -8.028  14.043  1.995   1.00   61.21  ? 183 PHE A CB    1 
ATOM   1406 C CG    . PHE A 1 198 ? -8.751  13.237  3.036   1.00   63.78  ? 183 PHE A CG    1 
ATOM   1407 C CD1   . PHE A 1 198 ? -9.734  13.814  3.821   1.00   64.53  ? 183 PHE A CD1   1 
ATOM   1408 C CD2   . PHE A 1 198 ? -8.472  11.891  3.208   1.00   66.95  ? 183 PHE A CD2   1 
ATOM   1409 C CE1   . PHE A 1 198 ? -10.419 13.070  4.772   1.00   63.61  ? 183 PHE A CE1   1 
ATOM   1410 C CE2   . PHE A 1 198 ? -9.156  11.139  4.160   1.00   64.54  ? 183 PHE A CE2   1 
ATOM   1411 C CZ    . PHE A 1 198 ? -10.129 11.734  4.944   1.00   61.30  ? 183 PHE A CZ    1 
ATOM   1412 N N     . GLY A 1 199 ? -6.101  16.103  0.642   1.00   63.29  ? 184 GLY A N     1 
ATOM   1413 C CA    . GLY A 1 199 ? -5.497  16.448  -0.635  1.00   63.09  ? 184 GLY A CA    1 
ATOM   1414 C C     . GLY A 1 199 ? -4.030  16.817  -0.599  1.00   63.99  ? 184 GLY A C     1 
ATOM   1415 O O     . GLY A 1 199 ? -3.458  17.173  -1.625  1.00   68.14  ? 184 GLY A O     1 
ATOM   1416 N N     . TYR A 1 200 ? -3.408  16.731  0.572   1.00   63.90  ? 185 TYR A N     1 
ATOM   1417 C CA    . TYR A 1 200 ? -2.006  17.114  0.700   1.00   61.74  ? 185 TYR A CA    1 
ATOM   1418 C C     . TYR A 1 200 ? -1.193  16.008  1.331   1.00   60.70  ? 185 TYR A C     1 
ATOM   1419 O O     . TYR A 1 200 ? -1.724  15.190  2.072   1.00   62.77  ? 185 TYR A O     1 
ATOM   1420 C CB    . TYR A 1 200 ? -1.886  18.387  1.531   1.00   66.86  ? 185 TYR A CB    1 
ATOM   1421 C CG    . TYR A 1 200 ? -2.665  19.521  0.928   1.00   68.62  ? 185 TYR A CG    1 
ATOM   1422 C CD1   . TYR A 1 200 ? -2.026  20.504  0.185   1.00   71.74  ? 185 TYR A CD1   1 
ATOM   1423 C CD2   . TYR A 1 200 ? -4.047  19.588  1.066   1.00   66.83  ? 185 TYR A CD2   1 
ATOM   1424 C CE1   . TYR A 1 200 ? -2.737  21.534  -0.387  1.00   74.68  ? 185 TYR A CE1   1 
ATOM   1425 C CE2   . TYR A 1 200 ? -4.768  20.608  0.492   1.00   69.26  ? 185 TYR A CE2   1 
ATOM   1426 C CZ    . TYR A 1 200 ? -4.108  21.582  -0.233  1.00   73.14  ? 185 TYR A CZ    1 
ATOM   1427 O OH    . TYR A 1 200 ? -4.814  22.610  -0.809  1.00   76.15  ? 185 TYR A OH    1 
ATOM   1428 N N     . GLY A 1 201 ? 0.098   15.985  1.030   1.00   61.41  ? 186 GLY A N     1 
ATOM   1429 C CA    . GLY A 1 201 ? 1.002   15.034  1.647   1.00   59.93  ? 186 GLY A CA    1 
ATOM   1430 C C     . GLY A 1 201 ? 1.200   13.743  0.879   1.00   56.00  ? 186 GLY A C     1 
ATOM   1431 O O     . GLY A 1 201 ? 0.291   13.254  0.214   1.00   56.16  ? 186 GLY A O     1 
ATOM   1432 N N     . ASP A 1 202 ? 2.408   13.202  0.979   1.00   55.24  ? 187 ASP A N     1 
ATOM   1433 C CA    . ASP A 1 202 ? 2.746   11.904  0.417   1.00   56.04  ? 187 ASP A CA    1 
ATOM   1434 C C     . ASP A 1 202 ? 2.013   10.769  1.137   1.00   55.17  ? 187 ASP A C     1 
ATOM   1435 O O     . ASP A 1 202 ? 1.581   9.802   0.512   1.00   53.77  ? 187 ASP A O     1 
ATOM   1436 C CB    . ASP A 1 202 ? 4.252   11.699  0.521   1.00   56.37  ? 187 ASP A CB    1 
ATOM   1437 C CG    . ASP A 1 202 ? 5.032   12.878  -0.037  1.00   63.88  ? 187 ASP A CG    1 
ATOM   1438 O OD1   . ASP A 1 202 ? 4.650   13.381  -1.112  1.00   69.77  ? 187 ASP A OD1   1 
ATOM   1439 O OD2   . ASP A 1 202 ? 6.016   13.317  0.596   1.00   68.49  ? 187 ASP A OD2   1 
ATOM   1440 N N     . VAL A 1 203 ? 1.879   10.903  2.455   1.00   54.54  ? 188 VAL A N     1 
ATOM   1441 C CA    . VAL A 1 203 ? 1.200   9.913   3.283   1.00   50.00  ? 188 VAL A CA    1 
ATOM   1442 C C     . VAL A 1 203 ? 0.081   10.571  4.072   1.00   46.85  ? 188 VAL A C     1 
ATOM   1443 O O     . VAL A 1 203 ? 0.284   11.599  4.715   1.00   50.13  ? 188 VAL A O     1 
ATOM   1444 C CB    . VAL A 1 203 ? 2.162   9.270   4.304   1.00   48.95  ? 188 VAL A CB    1 
ATOM   1445 C CG1   . VAL A 1 203 ? 1.442   8.167   5.095   1.00   46.36  ? 188 VAL A CG1   1 
ATOM   1446 C CG2   . VAL A 1 203 ? 3.393   8.732   3.617   1.00   46.19  ? 188 VAL A CG2   1 
ATOM   1447 N N     . VAL A 1 204 ? -1.098  9.971   4.034   1.00   43.18  ? 189 VAL A N     1 
ATOM   1448 C CA    . VAL A 1 204 ? -2.232  10.486  4.774   1.00   42.70  ? 189 VAL A CA    1 
ATOM   1449 C C     . VAL A 1 204 ? -2.765  9.434   5.741   1.00   46.61  ? 189 VAL A C     1 
ATOM   1450 O O     . VAL A 1 204 ? -3.163  8.339   5.327   1.00   45.73  ? 189 VAL A O     1 
ATOM   1451 C CB    . VAL A 1 204 ? -3.369  10.911  3.826   1.00   48.18  ? 189 VAL A CB    1 
ATOM   1452 C CG1   . VAL A 1 204 ? -4.605  11.318  4.613   1.00   46.27  ? 189 VAL A CG1   1 
ATOM   1453 C CG2   . VAL A 1 204 ? -2.906  12.047  2.919   1.00   51.26  ? 189 VAL A CG2   1 
ATOM   1454 N N     . PHE A 1 205 ? -2.778  9.780   7.026   1.00   42.17  ? 190 PHE A N     1 
ATOM   1455 C CA    . PHE A 1 205 ? -3.334  8.923   8.066   1.00   44.30  ? 190 PHE A CA    1 
ATOM   1456 C C     . PHE A 1 205 ? -4.766  9.345   8.355   1.00   46.23  ? 190 PHE A C     1 
ATOM   1457 O O     . PHE A 1 205 ? -5.025  10.510  8.659   1.00   47.46  ? 190 PHE A O     1 
ATOM   1458 C CB    . PHE A 1 205 ? -2.513  9.040   9.356   1.00   42.74  ? 190 PHE A CB    1 
ATOM   1459 C CG    . PHE A 1 205 ? -1.079  8.590   9.221   1.00   43.70  ? 190 PHE A CG    1 
ATOM   1460 C CD1   . PHE A 1 205 ? -0.743  7.251   9.345   1.00   37.22  ? 190 PHE A CD1   1 
ATOM   1461 C CD2   . PHE A 1 205 ? -0.068  9.509   8.982   1.00   42.86  ? 190 PHE A CD2   1 
ATOM   1462 C CE1   . PHE A 1 205 ? 0.556   6.838   9.222   1.00   37.82  ? 190 PHE A CE1   1 
ATOM   1463 C CE2   . PHE A 1 205 ? 1.250   9.098   8.864   1.00   43.59  ? 190 PHE A CE2   1 
ATOM   1464 C CZ    . PHE A 1 205 ? 1.563   7.764   8.990   1.00   39.62  ? 190 PHE A CZ    1 
ATOM   1465 N N     . VAL A 1 206 ? -5.694  8.400   8.265   1.00   44.06  ? 191 VAL A N     1 
ATOM   1466 C CA    . VAL A 1 206 ? -7.085  8.648   8.627   1.00   46.13  ? 191 VAL A CA    1 
ATOM   1467 C C     . VAL A 1 206 ? -7.532  7.660   9.704   1.00   46.49  ? 191 VAL A C     1 
ATOM   1468 O O     . VAL A 1 206 ? -7.216  6.472   9.646   1.00   47.87  ? 191 VAL A O     1 
ATOM   1469 C CB    . VAL A 1 206 ? -8.029  8.551   7.402   1.00   46.19  ? 191 VAL A CB    1 
ATOM   1470 C CG1   . VAL A 1 206 ? -7.884  7.197   6.728   1.00   48.04  ? 191 VAL A CG1   1 
ATOM   1471 C CG2   . VAL A 1 206 ? -9.470  8.776   7.821   1.00   46.46  ? 191 VAL A CG2   1 
ATOM   1472 N N     . SER A 1 207 ? -8.283  8.154   10.680  1.00   47.17  ? 192 SER A N     1 
ATOM   1473 C CA    . SER A 1 207 ? -8.675  7.346   11.827  1.00   47.10  ? 192 SER A CA    1 
ATOM   1474 C C     . SER A 1 207 ? -9.960  6.557   11.618  1.00   51.58  ? 192 SER A C     1 
ATOM   1475 O O     . SER A 1 207 ? -10.813 6.905   10.802  1.00   51.73  ? 192 SER A O     1 
ATOM   1476 C CB    . SER A 1 207 ? -8.813  8.222   13.077  1.00   53.72  ? 192 SER A CB    1 
ATOM   1477 O OG    . SER A 1 207 ? -9.947  9.065   12.977  1.00   58.36  ? 192 SER A OG    1 
ATOM   1478 N N     . LYS A 1 208 ? -10.067 5.478   12.377  1.00   49.01  ? 193 LYS A N     1 
ATOM   1479 C CA    . LYS A 1 208 ? -11.247 4.642   12.434  1.00   52.34  ? 193 LYS A CA    1 
ATOM   1480 C C     . LYS A 1 208 ? -12.487 5.479   12.773  1.00   55.95  ? 193 LYS A C     1 
ATOM   1481 O O     . LYS A 1 208 ? -13.578 5.219   12.274  1.00   57.82  ? 193 LYS A O     1 
ATOM   1482 C CB    . LYS A 1 208 ? -11.001 3.572   13.501  1.00   54.70  ? 193 LYS A CB    1 
ATOM   1483 C CG    . LYS A 1 208 ? -12.149 2.623   13.817  1.00   56.54  ? 193 LYS A CG    1 
ATOM   1484 C CD    . LYS A 1 208 ? -11.795 1.830   15.092  1.00   57.08  ? 193 LYS A CD    1 
ATOM   1485 C CE    . LYS A 1 208 ? -12.649 0.575   15.276  1.00   65.56  ? 193 LYS A CE    1 
ATOM   1486 N NZ    . LYS A 1 208 ? -14.098 0.874   15.478  1.00   70.98  ? 193 LYS A NZ    1 
ATOM   1487 N N     . ASP A 1 209 ? -12.318 6.489   13.621  1.00   55.53  ? 194 ASP A N     1 
ATOM   1488 C CA    . ASP A 1 209 ? -13.448 7.314   14.031  1.00   61.19  ? 194 ASP A CA    1 
ATOM   1489 C C     . ASP A 1 209 ? -13.976 8.115   12.843  1.00   63.63  ? 194 ASP A C     1 
ATOM   1490 O O     . ASP A 1 209 ? -15.184 8.183   12.613  1.00   64.03  ? 194 ASP A O     1 
ATOM   1491 C CB    . ASP A 1 209 ? -13.056 8.245   15.184  1.00   68.82  ? 194 ASP A CB    1 
ATOM   1492 C CG    . ASP A 1 209 ? -14.268 8.815   15.913  1.00   79.30  ? 194 ASP A CG    1 
ATOM   1493 O OD1   . ASP A 1 209 ? -15.196 8.034   16.233  1.00   82.30  ? 194 ASP A OD1   1 
ATOM   1494 O OD2   . ASP A 1 209 ? -14.296 10.043  16.162  1.00   78.19  ? 194 ASP A OD2   1 
ATOM   1495 N N     . VAL A 1 210 ? -13.061 8.713   12.086  1.00   61.76  ? 195 VAL A N     1 
ATOM   1496 C CA    . VAL A 1 210 ? -13.424 9.417   10.868  1.00   59.90  ? 195 VAL A CA    1 
ATOM   1497 C C     . VAL A 1 210 ? -14.106 8.472   9.894   1.00   62.60  ? 195 VAL A C     1 
ATOM   1498 O O     . VAL A 1 210 ? -15.206 8.738   9.412   1.00   66.02  ? 195 VAL A O     1 
ATOM   1499 C CB    . VAL A 1 210 ? -12.191 9.999   10.179  1.00   59.61  ? 195 VAL A CB    1 
ATOM   1500 C CG1   . VAL A 1 210 ? -12.553 10.521  8.794   1.00   58.55  ? 195 VAL A CG1   1 
ATOM   1501 C CG2   . VAL A 1 210 ? -11.581 11.090  11.029  1.00   59.95  ? 195 VAL A CG2   1 
ATOM   1502 N N     . ALA A 1 211 ? -13.441 7.360   9.609   1.00   62.21  ? 196 ALA A N     1 
ATOM   1503 C CA    . ALA A 1 211 ? -13.952 6.391   8.657   1.00   58.54  ? 196 ALA A CA    1 
ATOM   1504 C C     . ALA A 1 211 ? -15.359 5.992   9.036   1.00   60.12  ? 196 ALA A C     1 
ATOM   1505 O O     . ALA A 1 211 ? -16.255 5.993   8.200   1.00   63.24  ? 196 ALA A O     1 
ATOM   1506 C CB    . ALA A 1 211 ? -13.052 5.169   8.602   1.00   56.28  ? 196 ALA A CB    1 
ATOM   1507 N N     . LYS A 1 212 ? -15.551 5.637   10.298  1.00   60.69  ? 197 LYS A N     1 
ATOM   1508 C CA    . LYS A 1 212 ? -16.874 5.241   10.760  1.00   65.96  ? 197 LYS A CA    1 
ATOM   1509 C C     . LYS A 1 212 ? -17.891 6.363   10.564  1.00   70.01  ? 197 LYS A C     1 
ATOM   1510 O O     . LYS A 1 212 ? -19.024 6.116   10.147  1.00   69.96  ? 197 LYS A O     1 
ATOM   1511 C CB    . LYS A 1 212 ? -16.836 4.788   12.218  1.00   61.49  ? 197 LYS A CB    1 
ATOM   1512 C CG    . LYS A 1 212 ? -16.453 3.333   12.377  1.00   69.20  ? 197 LYS A CG    1 
ATOM   1513 C CD    . LYS A 1 212 ? -16.411 2.901   13.838  1.00   72.13  ? 197 LYS A CD    1 
ATOM   1514 C CE    . LYS A 1 212 ? -16.821 1.438   13.965  1.00   77.44  ? 197 LYS A CE    1 
ATOM   1515 N NZ    . LYS A 1 212 ? -16.767 0.929   15.364  1.00   82.34  ? 197 LYS A NZ    1 
ATOM   1516 N N     . HIS A 1 213 ? -17.477 7.595   10.845  1.00   70.56  ? 198 HIS A N     1 
ATOM   1517 C CA    . HIS A 1 213 ? -18.365 8.743   10.684  1.00   72.55  ? 198 HIS A CA    1 
ATOM   1518 C C     . HIS A 1 213 ? -18.762 8.983   9.230   1.00   72.16  ? 198 HIS A C     1 
ATOM   1519 O O     . HIS A 1 213 ? -19.726 9.702   8.952   1.00   73.54  ? 198 HIS A O     1 
ATOM   1520 C CB    . HIS A 1 213 ? -17.747 10.005  11.294  1.00   73.87  ? 198 HIS A CB    1 
ATOM   1521 C CG    . HIS A 1 213 ? -18.245 10.305  12.675  1.00   81.18  ? 198 HIS A CG    1 
ATOM   1522 N ND1   . HIS A 1 213 ? -17.794 9.633   13.793  1.00   82.00  ? 198 HIS A ND1   1 
ATOM   1523 C CD2   . HIS A 1 213 ? -19.173 11.189  13.116  1.00   81.92  ? 198 HIS A CD2   1 
ATOM   1524 C CE1   . HIS A 1 213 ? -18.415 10.098  14.863  1.00   84.33  ? 198 HIS A CE1   1 
ATOM   1525 N NE2   . HIS A 1 213 ? -19.258 11.042  14.481  1.00   82.17  ? 198 HIS A NE2   1 
ATOM   1526 N N     . LEU A 1 214 ? -18.019 8.379   8.306   1.00   67.66  ? 199 LEU A N     1 
ATOM   1527 C CA    . LEU A 1 214 ? -18.336 8.487   6.891   1.00   61.37  ? 199 LEU A CA    1 
ATOM   1528 C C     . LEU A 1 214 ? -19.032 7.233   6.373   1.00   64.83  ? 199 LEU A C     1 
ATOM   1529 O O     . LEU A 1 214 ? -19.215 7.077   5.167   1.00   67.93  ? 199 LEU A O     1 
ATOM   1530 C CB    . LEU A 1 214 ? -17.079 8.766   6.071   1.00   65.04  ? 199 LEU A CB    1 
ATOM   1531 C CG    . LEU A 1 214 ? -16.274 10.006  6.448   1.00   65.65  ? 199 LEU A CG    1 
ATOM   1532 C CD1   . LEU A 1 214 ? -15.179 10.257  5.425   1.00   65.31  ? 199 LEU A CD1   1 
ATOM   1533 C CD2   . LEU A 1 214 ? -17.186 11.204  6.545   1.00   70.15  ? 199 LEU A CD2   1 
ATOM   1534 N N     . GLY A 1 215 ? -19.413 6.337   7.280   1.00   64.96  ? 200 GLY A N     1 
ATOM   1535 C CA    . GLY A 1 215 ? -20.182 5.158   6.906   1.00   67.64  ? 200 GLY A CA    1 
ATOM   1536 C C     . GLY A 1 215 ? -19.427 3.860   6.632   1.00   72.45  ? 200 GLY A C     1 
ATOM   1537 O O     . GLY A 1 215 ? -20.043 2.858   6.248   1.00   72.89  ? 200 GLY A O     1 
ATOM   1538 N N     . PHE A 1 216 ? -18.108 3.863   6.836   1.00   68.59  ? 201 PHE A N     1 
ATOM   1539 C CA    . PHE A 1 216 ? -17.264 2.698   6.554   1.00   60.41  ? 201 PHE A CA    1 
ATOM   1540 C C     . PHE A 1 216 ? -17.027 1.816   7.789   1.00   63.59  ? 201 PHE A C     1 
ATOM   1541 O O     . PHE A 1 216 ? -16.841 2.318   8.897   1.00   65.04  ? 201 PHE A O     1 
ATOM   1542 C CB    . PHE A 1 216 ? -15.933 3.159   5.975   1.00   60.66  ? 201 PHE A CB    1 
ATOM   1543 C CG    . PHE A 1 216 ? -16.073 4.025   4.759   1.00   60.77  ? 201 PHE A CG    1 
ATOM   1544 C CD1   . PHE A 1 216 ? -16.565 3.506   3.578   1.00   59.54  ? 201 PHE A CD1   1 
ATOM   1545 C CD2   . PHE A 1 216 ? -15.698 5.356   4.793   1.00   62.65  ? 201 PHE A CD2   1 
ATOM   1546 C CE1   . PHE A 1 216 ? -16.685 4.301   2.457   1.00   61.41  ? 201 PHE A CE1   1 
ATOM   1547 C CE2   . PHE A 1 216 ? -15.818 6.159   3.670   1.00   59.46  ? 201 PHE A CE2   1 
ATOM   1548 C CZ    . PHE A 1 216 ? -16.311 5.632   2.506   1.00   61.13  ? 201 PHE A CZ    1 
ATOM   1549 N N     . GLN A 1 217 ? -17.025 0.501   7.600   1.00   60.99  ? 202 GLN A N     1 
ATOM   1550 C CA    . GLN A 1 217 ? -16.984 -0.415  8.736   1.00   59.67  ? 202 GLN A CA    1 
ATOM   1551 C C     . GLN A 1 217 ? -15.699 -1.242  8.820   1.00   58.36  ? 202 GLN A C     1 
ATOM   1552 O O     . GLN A 1 217 ? -15.587 -2.155  9.647   1.00   54.48  ? 202 GLN A O     1 
ATOM   1553 C CB    . GLN A 1 217 ? -18.197 -1.345  8.709   1.00   64.68  ? 202 GLN A CB    1 
ATOM   1554 C CG    . GLN A 1 217 ? -19.479 -0.674  8.236   1.00   73.18  ? 202 GLN A CG    1 
ATOM   1555 C CD    . GLN A 1 217 ? -19.820 0.578   9.028   1.00   76.69  ? 202 GLN A CD    1 
ATOM   1556 O OE1   . GLN A 1 217 ? -20.325 1.563   8.475   1.00   81.77  ? 202 GLN A OE1   1 
ATOM   1557 N NE2   . GLN A 1 217 ? -19.551 0.546   10.330  1.00   76.13  ? 202 GLN A NE2   1 
ATOM   1558 N N     . SER A 1 218 ? -14.735 -0.932  7.961   1.00   54.57  ? 203 SER A N     1 
ATOM   1559 C CA    . SER A 1 218 ? -13.426 -1.570  8.049   1.00   52.57  ? 203 SER A CA    1 
ATOM   1560 C C     . SER A 1 218 ? -12.384 -0.673  7.418   1.00   53.58  ? 203 SER A C     1 
ATOM   1561 O O     . SER A 1 218 ? -12.718 0.243   6.647   1.00   51.48  ? 203 SER A O     1 
ATOM   1562 C CB    . SER A 1 218 ? -13.425 -2.934  7.350   1.00   49.75  ? 203 SER A CB    1 
ATOM   1563 O OG    . SER A 1 218 ? -13.381 -2.777  5.938   1.00   54.83  ? 203 SER A OG    1 
ATOM   1564 N N     . ALA A 1 219 ? -11.123 -0.941  7.742   1.00   49.47  ? 204 ALA A N     1 
ATOM   1565 C CA    . ALA A 1 219 ? -10.018 -0.229  7.126   1.00   46.50  ? 204 ALA A CA    1 
ATOM   1566 C C     . ALA A 1 219 ? -10.030 -0.355  5.613   1.00   47.62  ? 204 ALA A C     1 
ATOM   1567 O O     . ALA A 1 219 ? -9.746  0.615   4.903   1.00   53.32  ? 204 ALA A O     1 
ATOM   1568 C CB    . ALA A 1 219 ? -8.687  -0.703  7.684   1.00   43.91  ? 204 ALA A CB    1 
ATOM   1569 N N     . GLU A 1 220 ? -10.350 -1.537  5.099   1.00   49.90  ? 205 GLU A N     1 
ATOM   1570 C CA    . GLU A 1 220 ? -10.275 -1.729  3.645   1.00   52.14  ? 205 GLU A CA    1 
ATOM   1571 C C     . GLU A 1 220 ? -11.374 -0.960  2.911   1.00   51.56  ? 205 GLU A C     1 
ATOM   1572 O O     . GLU A 1 220 ? -11.137 -0.365  1.860   1.00   54.06  ? 205 GLU A O     1 
ATOM   1573 C CB    . GLU A 1 220 ? -10.265 -3.214  3.261   1.00   47.78  ? 205 GLU A CB    1 
ATOM   1574 C CG    . GLU A 1 220 ? -11.502 -3.986  3.677   1.00   53.74  ? 205 GLU A CG    1 
ATOM   1575 C CD    . GLU A 1 220 ? -12.565 -4.037  2.585   1.00   61.85  ? 205 GLU A CD    1 
ATOM   1576 O OE1   . GLU A 1 220 ? -13.657 -4.604  2.845   1.00   60.05  ? 205 GLU A OE1   1 
ATOM   1577 O OE2   . GLU A 1 220 ? -12.313 -3.510  1.468   1.00   64.83  ? 205 GLU A OE2   1 
ATOM   1578 N N     . GLU A 1 221 ? -12.570 -0.952  3.479   1.00   52.91  ? 206 GLU A N     1 
ATOM   1579 C CA    . GLU A 1 221 ? -13.680 -0.217  2.879   1.00   54.96  ? 206 GLU A CA    1 
ATOM   1580 C C     . GLU A 1 221 ? -13.411 1.296   2.922   1.00   56.16  ? 206 GLU A C     1 
ATOM   1581 O O     . GLU A 1 221 ? -13.681 2.017   1.964   1.00   56.31  ? 206 GLU A O     1 
ATOM   1582 C CB    . GLU A 1 221 ? -14.979 -0.562  3.596   1.00   54.27  ? 206 GLU A CB    1 
ATOM   1583 C CG    . GLU A 1 221 ? -16.211 0.034   2.959   1.00   64.90  ? 206 GLU A CG    1 
ATOM   1584 C CD    . GLU A 1 221 ? -17.478 -0.283  3.736   1.00   67.43  ? 206 GLU A CD    1 
ATOM   1585 O OE1   . GLU A 1 221 ? -17.375 -0.894  4.825   1.00   67.00  ? 206 GLU A OE1   1 
ATOM   1586 O OE2   . GLU A 1 221 ? -18.573 0.086   3.255   1.00   70.21  ? 206 GLU A OE2   1 
ATOM   1587 N N     . ALA A 1 222 ? -12.846 1.765   4.027   1.00   53.67  ? 207 ALA A N     1 
ATOM   1588 C CA    . ALA A 1 222 ? -12.505 3.173   4.171   1.00   51.94  ? 207 ALA A CA    1 
ATOM   1589 C C     . ALA A 1 222 ? -11.485 3.602   3.140   1.00   54.55  ? 207 ALA A C     1 
ATOM   1590 O O     . ALA A 1 222 ? -11.593 4.689   2.569   1.00   56.72  ? 207 ALA A O     1 
ATOM   1591 C CB    . ALA A 1 222 ? -11.982 3.454   5.566   1.00   53.25  ? 207 ALA A CB    1 
ATOM   1592 N N     . LEU A 1 223 ? -10.482 2.757   2.913   1.00   51.78  ? 208 LEU A N     1 
ATOM   1593 C CA    . LEU A 1 223 ? -9.439  3.062   1.934   1.00   50.23  ? 208 LEU A CA    1 
ATOM   1594 C C     . LEU A 1 223 ? -9.990  3.178   0.511   1.00   53.61  ? 208 LEU A C     1 
ATOM   1595 O O     . LEU A 1 223 ? -9.641  4.107   -0.223  1.00   52.26  ? 208 LEU A O     1 
ATOM   1596 C CB    . LEU A 1 223 ? -8.327  2.014   1.984   1.00   45.54  ? 208 LEU A CB    1 
ATOM   1597 C CG    . LEU A 1 223 ? -7.504  2.064   3.264   1.00   45.10  ? 208 LEU A CG    1 
ATOM   1598 C CD1   . LEU A 1 223 ? -6.492  0.951   3.313   1.00   46.91  ? 208 LEU A CD1   1 
ATOM   1599 C CD2   . LEU A 1 223 ? -6.830  3.404   3.361   1.00   44.72  ? 208 LEU A CD2   1 
ATOM   1600 N N     . ARG A 1 224 ? -10.830 2.224   0.121   1.00   51.16  ? 209 ARG A N     1 
ATOM   1601 C CA    . ARG A 1 224 ? -11.473 2.270   -1.186  1.00   55.47  ? 209 ARG A CA    1 
ATOM   1602 C C     . ARG A 1 224 ? -12.357 3.509   -1.303  1.00   58.58  ? 209 ARG A C     1 
ATOM   1603 O O     . ARG A 1 224 ? -12.331 4.210   -2.316  1.00   56.68  ? 209 ARG A O     1 
ATOM   1604 C CB    . ARG A 1 224 ? -12.313 1.013   -1.420  1.00   52.77  ? 209 ARG A CB    1 
ATOM   1605 C CG    . ARG A 1 224 ? -11.485 -0.244  -1.568  1.00   60.53  ? 209 ARG A CG    1 
ATOM   1606 C CD    . ARG A 1 224 ? -10.490 -0.122  -2.722  1.00   63.60  ? 209 ARG A CD    1 
ATOM   1607 N NE    . ARG A 1 224 ? -9.582  -1.268  -2.764  1.00   66.66  ? 209 ARG A NE    1 
ATOM   1608 C CZ    . ARG A 1 224 ? -8.585  -1.410  -3.634  1.00   62.50  ? 209 ARG A CZ    1 
ATOM   1609 N NH1   . ARG A 1 224 ? -8.351  -0.476  -4.550  1.00   61.47  ? 209 ARG A NH1   1 
ATOM   1610 N NH2   . ARG A 1 224 ? -7.816  -2.487  -3.582  1.00   60.39  ? 209 ARG A NH2   1 
ATOM   1611 N N     . GLY A 1 225 ? -13.130 3.779   -0.255  1.00   58.20  ? 210 GLY A N     1 
ATOM   1612 C CA    . GLY A 1 225 ? -14.045 4.906   -0.249  1.00   55.49  ? 210 GLY A CA    1 
ATOM   1613 C C     . GLY A 1 225 ? -13.377 6.271   -0.274  1.00   59.59  ? 210 GLY A C     1 
ATOM   1614 O O     . GLY A 1 225 ? -13.976 7.234   -0.740  1.00   63.54  ? 210 GLY A O     1 
ATOM   1615 N N     . LEU A 1 226 ? -12.141 6.367   0.210   1.00   55.61  ? 211 LEU A N     1 
ATOM   1616 C CA    . LEU A 1 226 ? -11.525 7.674   0.422   1.00   51.80  ? 211 LEU A CA    1 
ATOM   1617 C C     . LEU A 1 226 ? -10.313 7.951   -0.451  1.00   54.05  ? 211 LEU A C     1 
ATOM   1618 O O     . LEU A 1 226 ? -9.811  9.073   -0.465  1.00   58.01  ? 211 LEU A O     1 
ATOM   1619 C CB    . LEU A 1 226 ? -11.120 7.853   1.890   1.00   53.18  ? 211 LEU A CB    1 
ATOM   1620 C CG    . LEU A 1 226 ? -12.215 7.826   2.957   1.00   57.93  ? 211 LEU A CG    1 
ATOM   1621 C CD1   . LEU A 1 226 ? -11.593 7.926   4.340   1.00   53.39  ? 211 LEU A CD1   1 
ATOM   1622 C CD2   . LEU A 1 226 ? -13.223 8.945   2.733   1.00   58.57  ? 211 LEU A CD2   1 
ATOM   1623 N N     . TYR A 1 227 ? -9.822  6.949   -1.169  1.00   52.97  ? 212 TYR A N     1 
ATOM   1624 C CA    . TYR A 1 227 ? -8.594  7.160   -1.924  1.00   53.26  ? 212 TYR A CA    1 
ATOM   1625 C C     . TYR A 1 227 ? -8.763  8.237   -2.977  1.00   57.89  ? 212 TYR A C     1 
ATOM   1626 O O     . TYR A 1 227 ? -7.796  8.881   -3.379  1.00   61.68  ? 212 TYR A O     1 
ATOM   1627 C CB    . TYR A 1 227 ? -8.067  5.881   -2.572  1.00   50.72  ? 212 TYR A CB    1 
ATOM   1628 C CG    . TYR A 1 227 ? -6.662  6.083   -3.070  1.00   52.37  ? 212 TYR A CG    1 
ATOM   1629 C CD1   . TYR A 1 227 ? -5.580  5.956   -2.204  1.00   48.62  ? 212 TYR A CD1   1 
ATOM   1630 C CD2   . TYR A 1 227 ? -6.409  6.446   -4.393  1.00   51.94  ? 212 TYR A CD2   1 
ATOM   1631 C CE1   . TYR A 1 227 ? -4.285  6.158   -2.638  1.00   48.54  ? 212 TYR A CE1   1 
ATOM   1632 C CE2   . TYR A 1 227 ? -5.108  6.657   -4.843  1.00   50.63  ? 212 TYR A CE2   1 
ATOM   1633 C CZ    . TYR A 1 227 ? -4.051  6.515   -3.954  1.00   54.84  ? 212 TYR A CZ    1 
ATOM   1634 O OH    . TYR A 1 227 ? -2.756  6.715   -4.371  1.00   56.83  ? 212 TYR A OH    1 
ATOM   1635 N N     . GLY A 1 228 ? -9.996  8.427   -3.428  1.00   63.68  ? 213 GLY A N     1 
ATOM   1636 C CA    . GLY A 1 228 ? -10.281 9.435   -4.430  1.00   64.37  ? 213 GLY A CA    1 
ATOM   1637 C C     . GLY A 1 228 ? -9.895  10.836  -3.993  1.00   64.63  ? 213 GLY A C     1 
ATOM   1638 O O     . GLY A 1 228 ? -9.610  11.694  -4.832  1.00   66.99  ? 213 GLY A O     1 
ATOM   1639 N N     . ARG A 1 229 ? -9.876  11.069  -2.682  1.00   61.31  ? 214 ARG A N     1 
ATOM   1640 C CA    . ARG A 1 229 ? -9.648  12.409  -2.146  1.00   61.18  ? 214 ARG A CA    1 
ATOM   1641 C C     . ARG A 1 229 ? -8.177  12.785  -2.000  1.00   62.36  ? 214 ARG A C     1 
ATOM   1642 O O     . ARG A 1 229 ? -7.854  13.955  -1.800  1.00   63.39  ? 214 ARG A O     1 
ATOM   1643 C CB    . ARG A 1 229 ? -10.322 12.568  -0.790  1.00   62.17  ? 214 ARG A CB    1 
ATOM   1644 C CG    . ARG A 1 229 ? -11.830 12.418  -0.767  1.00   62.45  ? 214 ARG A CG    1 
ATOM   1645 C CD    . ARG A 1 229 ? -12.276 12.437  0.690   1.00   67.44  ? 214 ARG A CD    1 
ATOM   1646 N NE    . ARG A 1 229 ? -13.714 12.290  0.885   1.00   70.92  ? 214 ARG A NE    1 
ATOM   1647 C CZ    . ARG A 1 229 ? -14.496 13.256  1.357   1.00   73.63  ? 214 ARG A CZ    1 
ATOM   1648 N NH1   . ARG A 1 229 ? -13.975 14.437  1.664   1.00   69.72  ? 214 ARG A NH1   1 
ATOM   1649 N NH2   . ARG A 1 229 ? -15.795 13.042  1.525   1.00   75.73  ? 214 ARG A NH2   1 
ATOM   1650 N N     . VAL A 1 230 ? -7.281  11.810  -2.081  1.00   60.97  ? 215 VAL A N     1 
ATOM   1651 C CA    . VAL A 1 230 ? -5.868  12.122  -1.917  1.00   63.41  ? 215 VAL A CA    1 
ATOM   1652 C C     . VAL A 1 230 ? -5.269  12.579  -3.235  1.00   63.14  ? 215 VAL A C     1 
ATOM   1653 O O     . VAL A 1 230 ? -5.879  12.415  -4.287  1.00   67.95  ? 215 VAL A O     1 
ATOM   1654 C CB    . VAL A 1 230 ? -5.072  10.934  -1.354  1.00   61.18  ? 215 VAL A CB    1 
ATOM   1655 C CG1   . VAL A 1 230 ? -5.629  10.538  0.004   1.00   60.49  ? 215 VAL A CG1   1 
ATOM   1656 C CG2   . VAL A 1 230 ? -5.117  9.756   -2.310  1.00   58.65  ? 215 VAL A CG2   1 
ATOM   1657 N N     . ARG A 1 231 ? -4.074  13.152  -3.177  1.00   60.36  ? 216 ARG A N     1 
ATOM   1658 C CA    . ARG A 1 231 ? -3.427  13.653  -4.380  1.00   66.14  ? 216 ARG A CA    1 
ATOM   1659 C C     . ARG A 1 231 ? -2.631  12.551  -5.061  1.00   69.41  ? 216 ARG A C     1 
ATOM   1660 O O     . ARG A 1 231 ? -2.104  11.654  -4.401  1.00   69.65  ? 216 ARG A O     1 
ATOM   1661 C CB    . ARG A 1 231 ? -2.510  14.832  -4.054  1.00   65.26  ? 216 ARG A CB    1 
ATOM   1662 C CG    . ARG A 1 231 ? -1.060  14.455  -3.821  1.00   65.58  ? 216 ARG A CG    1 
ATOM   1663 C CD    . ARG A 1 231 ? -0.248  15.693  -3.515  1.00   68.02  ? 216 ARG A CD    1 
ATOM   1664 N NE    . ARG A 1 231 ? 0.807   15.429  -2.540  1.00   70.39  ? 216 ARG A NE    1 
ATOM   1665 C CZ    . ARG A 1 231 ? 2.110   15.509  -2.806  1.00   75.57  ? 216 ARG A CZ    1 
ATOM   1666 N NH1   . ARG A 1 231 ? 2.527   15.854  -4.024  1.00   75.40  ? 216 ARG A NH1   1 
ATOM   1667 N NH2   . ARG A 1 231 ? 2.999   15.253  -1.852  1.00   67.24  ? 216 ARG A NH2   1 
ATOM   1668 N N     . LYS A 1 232 ? -2.542  12.627  -6.383  1.00   67.78  ? 217 LYS A N     1 
ATOM   1669 C CA    . LYS A 1 232 ? -1.817  11.631  -7.162  1.00   67.85  ? 217 LYS A CA    1 
ATOM   1670 C C     . LYS A 1 232 ? -0.501  11.229  -6.497  1.00   66.95  ? 217 LYS A C     1 
ATOM   1671 O O     . LYS A 1 232 ? 0.280   12.091  -6.076  1.00   66.21  ? 217 LYS A O     1 
ATOM   1672 C CB    . LYS A 1 232 ? -1.552  12.163  -8.570  1.00   71.90  ? 217 LYS A CB    1 
ATOM   1673 C CG    . LYS A 1 232 ? -0.952  11.139  -9.522  1.00   77.26  ? 217 LYS A CG    1 
ATOM   1674 C CD    . LYS A 1 232 ? -0.870  11.686  -10.941 1.00   84.71  ? 217 LYS A CD    1 
ATOM   1675 C CE    . LYS A 1 232 ? -0.696  10.568  -11.959 1.00   92.42  ? 217 LYS A CE    1 
ATOM   1676 N NZ    . LYS A 1 232 ? -1.892  9.674   -12.016 1.00   90.68  ? 217 LYS A NZ    1 
ATOM   1677 N N     . GLY A 1 233 ? -0.266  9.920   -6.397  1.00   66.54  ? 218 GLY A N     1 
ATOM   1678 C CA    . GLY A 1 233 ? 0.988   9.397   -5.864  1.00   64.93  ? 218 GLY A CA    1 
ATOM   1679 C C     . GLY A 1 233 ? 1.020   9.146   -4.357  1.00   61.87  ? 218 GLY A C     1 
ATOM   1680 O O     . GLY A 1 233 ? 1.978   8.569   -3.835  1.00   60.62  ? 218 GLY A O     1 
ATOM   1681 N N     . ALA A 1 234 ? -0.030  9.567   -3.661  1.00   54.83  ? 219 ALA A N     1 
ATOM   1682 C CA    . ALA A 1 234 ? -0.061  9.524   -2.203  1.00   58.18  ? 219 ALA A CA    1 
ATOM   1683 C C     . ALA A 1 234 ? -0.477  8.162   -1.659  1.00   54.69  ? 219 ALA A C     1 
ATOM   1684 O O     . ALA A 1 234 ? -1.279  7.458   -2.268  1.00   56.54  ? 219 ALA A O     1 
ATOM   1685 C CB    . ALA A 1 234 ? -0.993  10.602  -1.668  1.00   54.18  ? 219 ALA A CB    1 
ATOM   1686 N N     . VAL A 1 235 ? 0.074   7.797   -0.508  1.00   50.26  ? 220 VAL A N     1 
ATOM   1687 C CA    . VAL A 1 235 ? -0.340  6.586   0.180   1.00   47.49  ? 220 VAL A CA    1 
ATOM   1688 C C     . VAL A 1 235 ? -1.347  6.952   1.260   1.00   48.80  ? 220 VAL A C     1 
ATOM   1689 O O     . VAL A 1 235 ? -1.083  7.815   2.100   1.00   46.25  ? 220 VAL A O     1 
ATOM   1690 C CB    . VAL A 1 235 ? 0.853   5.868   0.829   1.00   50.34  ? 220 VAL A CB    1 
ATOM   1691 C CG1   . VAL A 1 235 ? 0.389   4.588   1.535   1.00   45.86  ? 220 VAL A CG1   1 
ATOM   1692 C CG2   . VAL A 1 235 ? 1.917   5.553   -0.221  1.00   44.72  ? 220 VAL A CG2   1 
ATOM   1693 N N     . LEU A 1 236 ? -2.505  6.304   1.221   1.00   45.17  ? 221 LEU A N     1 
ATOM   1694 C CA    . LEU A 1 236 ? -3.525  6.469   2.242   1.00   41.03  ? 221 LEU A CA    1 
ATOM   1695 C C     . LEU A 1 236 ? -3.411  5.341   3.276   1.00   44.91  ? 221 LEU A C     1 
ATOM   1696 O O     . LEU A 1 236 ? -3.290  4.161   2.916   1.00   42.58  ? 221 LEU A O     1 
ATOM   1697 C CB    . LEU A 1 236 ? -4.908  6.439   1.593   1.00   44.05  ? 221 LEU A CB    1 
ATOM   1698 C CG    . LEU A 1 236 ? -6.081  6.739   2.519   1.00   46.68  ? 221 LEU A CG    1 
ATOM   1699 C CD1   . LEU A 1 236 ? -5.923  8.112   3.152   1.00   43.97  ? 221 LEU A CD1   1 
ATOM   1700 C CD2   . LEU A 1 236 ? -7.379  6.658   1.743   1.00   50.07  ? 221 LEU A CD2   1 
ATOM   1701 N N     . VAL A 1 237 ? -3.449  5.707   4.556   1.00   46.18  ? 222 VAL A N     1 
ATOM   1702 C CA    . VAL A 1 237 ? -3.263  4.750   5.652   1.00   45.07  ? 222 VAL A CA    1 
ATOM   1703 C C     . VAL A 1 237 ? -4.391  4.838   6.675   1.00   43.03  ? 222 VAL A C     1 
ATOM   1704 O O     . VAL A 1 237 ? -4.761  5.925   7.097   1.00   41.18  ? 222 VAL A O     1 
ATOM   1705 C CB    . VAL A 1 237 ? -1.915  4.978   6.378   1.00   43.40  ? 222 VAL A CB    1 
ATOM   1706 C CG1   . VAL A 1 237 ? -1.780  4.028   7.573   1.00   36.93  ? 222 VAL A CG1   1 
ATOM   1707 C CG2   . VAL A 1 237 ? -0.747  4.812   5.408   1.00   36.97  ? 222 VAL A CG2   1 
ATOM   1708 N N     . CYS A 1 238 ? -4.954  3.692   7.042   1.00   45.99  ? 223 CYS A N     1 
ATOM   1709 C CA    . CYS A 1 238 ? -5.992  3.631   8.069   1.00   40.56  ? 223 CYS A CA    1 
ATOM   1710 C C     . CYS A 1 238 ? -5.729  2.521   9.101   1.00   38.09  ? 223 CYS A C     1 
ATOM   1711 O O     . CYS A 1 238 ? -5.835  1.328   8.804   1.00   41.85  ? 223 CYS A O     1 
ATOM   1712 C CB    . CYS A 1 238 ? -7.377  3.459   7.431   1.00   42.41  ? 223 CYS A CB    1 
ATOM   1713 S SG    . CYS A 1 238 ? -8.759  3.426   8.623   1.00   49.72  ? 223 CYS A SG    1 
ATOM   1714 N N     . ALA A 1 239 ? -5.383  2.915   10.316  1.00   38.07  ? 224 ALA A N     1 
ATOM   1715 C CA    . ALA A 1 239 ? -5.202  1.954   11.402  1.00   38.51  ? 224 ALA A CA    1 
ATOM   1716 C C     . ALA A 1 239 ? -6.548  1.643   12.050  1.00   42.90  ? 224 ALA A C     1 
ATOM   1717 O O     . ALA A 1 239 ? -7.448  2.480   12.057  1.00   46.01  ? 224 ALA A O     1 
ATOM   1718 C CB    . ALA A 1 239 ? -4.239  2.505   12.437  1.00   39.85  ? 224 ALA A CB    1 
ATOM   1719 N N     . TRP A 1 240 ? -6.684  0.448   12.611  1.00   40.52  ? 225 TRP A N     1 
ATOM   1720 C CA    . TRP A 1 240 ? -7.978  0.005   13.098  1.00   41.70  ? 225 TRP A CA    1 
ATOM   1721 C C     . TRP A 1 240 ? -7.802  -0.866  14.339  1.00   42.82  ? 225 TRP A C     1 
ATOM   1722 O O     . TRP A 1 240 ? -8.206  -2.031  14.369  1.00   42.91  ? 225 TRP A O     1 
ATOM   1723 C CB    . TRP A 1 240 ? -8.723  -0.742  11.982  1.00   45.33  ? 225 TRP A CB    1 
ATOM   1724 C CG    . TRP A 1 240 ? -10.229 -0.743  12.085  1.00   49.34  ? 225 TRP A CG    1 
ATOM   1725 C CD1   . TRP A 1 240 ? -10.999 -1.558  12.871  1.00   52.83  ? 225 TRP A CD1   1 
ATOM   1726 C CD2   . TRP A 1 240 ? -11.146 0.090   11.358  1.00   49.14  ? 225 TRP A CD2   1 
ATOM   1727 N NE1   . TRP A 1 240 ? -12.331 -1.273  12.689  1.00   52.63  ? 225 TRP A NE1   1 
ATOM   1728 C CE2   . TRP A 1 240 ? -12.450 -0.269  11.763  1.00   53.30  ? 225 TRP A CE2   1 
ATOM   1729 C CE3   . TRP A 1 240 ? -10.991 1.107   10.411  1.00   48.39  ? 225 TRP A CE3   1 
ATOM   1730 C CZ2   . TRP A 1 240 ? -13.592 0.352   11.253  1.00   53.05  ? 225 TRP A CZ2   1 
ATOM   1731 C CZ3   . TRP A 1 240 ? -12.129 1.721   9.905   1.00   52.67  ? 225 TRP A CZ3   1 
ATOM   1732 C CH2   . TRP A 1 240 ? -13.413 1.341   10.329  1.00   50.84  ? 225 TRP A CH2   1 
ATOM   1733 N N     . ALA A 1 241 ? -7.194  -0.286  15.368  1.00   39.56  ? 226 ALA A N     1 
ATOM   1734 C CA    . ALA A 1 241 ? -7.128  -0.929  16.671  1.00   42.12  ? 226 ALA A CA    1 
ATOM   1735 C C     . ALA A 1 241 ? -6.617  -2.372  16.561  1.00   41.28  ? 226 ALA A C     1 
ATOM   1736 O O     . ALA A 1 241 ? -5.594  -2.624  15.932  1.00   40.93  ? 226 ALA A O     1 
ATOM   1737 C CB    . ALA A 1 241 ? -8.506  -0.865  17.366  1.00   38.20  ? 226 ALA A CB    1 
ATOM   1738 N N     . GLU A 1 242 ? -7.333  -3.318  17.156  1.00   42.12  ? 227 GLU A N     1 
ATOM   1739 C CA    . GLU A 1 242 ? -6.855  -4.691  17.208  1.00   40.97  ? 227 GLU A CA    1 
ATOM   1740 C C     . GLU A 1 242 ? -6.987  -5.398  15.862  1.00   41.87  ? 227 GLU A C     1 
ATOM   1741 O O     . GLU A 1 242 ? -6.614  -6.554  15.729  1.00   43.88  ? 227 GLU A O     1 
ATOM   1742 C CB    . GLU A 1 242 ? -7.553  -5.481  18.325  1.00   46.07  ? 227 GLU A CB    1 
ATOM   1743 C CG    . GLU A 1 242 ? -9.038  -5.749  18.074  1.00   54.06  ? 227 GLU A CG    1 
ATOM   1744 C CD    . GLU A 1 242 ? -9.884  -4.476  18.075  1.00   57.65  ? 227 GLU A CD    1 
ATOM   1745 O OE1   . GLU A 1 242 ? -10.733 -4.317  17.163  1.00   59.56  ? 227 GLU A OE1   1 
ATOM   1746 O OE2   . GLU A 1 242 ? -9.706  -3.639  18.993  1.00   54.08  ? 227 GLU A OE2   1 
ATOM   1747 N N     . GLU A 1 243 ? -7.491  -4.702  14.852  1.00   40.89  ? 228 GLU A N     1 
ATOM   1748 C CA    . GLU A 1 243 ? -7.540  -5.273  13.509  1.00   41.76  ? 228 GLU A CA    1 
ATOM   1749 C C     . GLU A 1 243 ? -6.251  -4.974  12.759  1.00   44.31  ? 228 GLU A C     1 
ATOM   1750 O O     . GLU A 1 243 ? -6.081  -5.378  11.597  1.00   40.77  ? 228 GLU A O     1 
ATOM   1751 C CB    . GLU A 1 243 ? -8.693  -4.690  12.713  1.00   40.38  ? 228 GLU A CB    1 
ATOM   1752 C CG    . GLU A 1 243 ? -9.718  -5.706  12.280  1.00   60.20  ? 228 GLU A CG    1 
ATOM   1753 C CD    . GLU A 1 243 ? -10.743 -5.981  13.357  1.00   67.49  ? 228 GLU A CD    1 
ATOM   1754 O OE1   . GLU A 1 243 ? -11.951 -5.713  13.124  1.00   70.98  ? 228 GLU A OE1   1 
ATOM   1755 O OE2   . GLU A 1 243 ? -10.338 -6.464  14.437  1.00   65.41  ? 228 GLU A OE2   1 
ATOM   1756 N N     . GLY A 1 244 ? -5.350  -4.243  13.409  1.00   40.29  ? 229 GLY A N     1 
ATOM   1757 C CA    . GLY A 1 244 ? -4.124  -3.845  12.751  1.00   39.64  ? 229 GLY A CA    1 
ATOM   1758 C C     . GLY A 1 244 ? -4.315  -2.597  11.916  1.00   40.19  ? 229 GLY A C     1 
ATOM   1759 O O     . GLY A 1 244 ? -4.861  -1.600  12.386  1.00   42.30  ? 229 GLY A O     1 
ATOM   1760 N N     . ALA A 1 245 ? -3.885  -2.650  10.666  1.00   38.73  ? 230 ALA A N     1 
ATOM   1761 C CA    . ALA A 1 245 ? -3.879  -1.461  9.839   1.00   39.87  ? 230 ALA A CA    1 
ATOM   1762 C C     . ALA A 1 245 ? -3.787  -1.859  8.397   1.00   39.14  ? 230 ALA A C     1 
ATOM   1763 O O     . ALA A 1 245 ? -3.297  -2.939  8.083   1.00   38.23  ? 230 ALA A O     1 
ATOM   1764 C CB    . ALA A 1 245 ? -2.704  -0.554  10.205  1.00   35.38  ? 230 ALA A CB    1 
ATOM   1765 N N     . ASP A 1 246 ? -4.293  -0.984  7.529   1.00   40.86  ? 231 ASP A N     1 
ATOM   1766 C CA    . ASP A 1 246 ? -4.239  -1.172  6.091   1.00   41.14  ? 231 ASP A CA    1 
ATOM   1767 C C     . ASP A 1 246 ? -3.698  0.092   5.439   1.00   43.88  ? 231 ASP A C     1 
ATOM   1768 O O     . ASP A 1 246 ? -3.742  1.180   6.033   1.00   41.52  ? 231 ASP A O     1 
ATOM   1769 C CB    . ASP A 1 246 ? -5.620  -1.495  5.529   1.00   43.02  ? 231 ASP A CB    1 
ATOM   1770 C CG    . ASP A 1 246 ? -6.113  -2.884  5.929   1.00   49.31  ? 231 ASP A CG    1 
ATOM   1771 O OD1   . ASP A 1 246 ? -5.753  -3.367  7.018   1.00   49.09  ? 231 ASP A OD1   1 
ATOM   1772 O OD2   . ASP A 1 246 ? -6.869  -3.509  5.151   1.00   57.99  ? 231 ASP A OD2   1 
ATOM   1773 N N     . ALA A 1 247 ? -3.172  -0.060  4.229   1.00   37.23  ? 232 ALA A N     1 
ATOM   1774 C CA    . ALA A 1 247 ? -2.715  1.074   3.441   1.00   42.24  ? 232 ALA A CA    1 
ATOM   1775 C C     . ALA A 1 247 ? -3.074  0.864   1.964   1.00   44.15  ? 232 ALA A C     1 
ATOM   1776 O O     . ALA A 1 247 ? -3.323  -0.255  1.533   1.00   44.21  ? 232 ALA A O     1 
ATOM   1777 C CB    . ALA A 1 247 ? -1.207  1.267   3.615   1.00   39.45  ? 232 ALA A CB    1 
ATOM   1778 N N     . LEU A 1 248 ? -3.112  1.940   1.194   1.00   45.90  ? 233 LEU A N     1 
ATOM   1779 C CA    . LEU A 1 248 ? -3.457  1.851   -0.222  1.00   46.75  ? 233 LEU A CA    1 
ATOM   1780 C C     . LEU A 1 248 ? -2.701  2.926   -0.976  1.00   47.95  ? 233 LEU A C     1 
ATOM   1781 O O     . LEU A 1 248 ? -2.806  4.106   -0.647  1.00   50.60  ? 233 LEU A O     1 
ATOM   1782 C CB    . LEU A 1 248 ? -4.964  2.014   -0.434  1.00   43.86  ? 233 LEU A CB    1 
ATOM   1783 C CG    . LEU A 1 248 ? -5.459  1.987   -1.887  1.00   51.92  ? 233 LEU A CG    1 
ATOM   1784 C CD1   . LEU A 1 248 ? -5.224  0.627   -2.554  1.00   48.08  ? 233 LEU A CD1   1 
ATOM   1785 C CD2   . LEU A 1 248 ? -6.928  2.332   -1.941  1.00   48.60  ? 233 LEU A CD2   1 
ATOM   1786 N N     . GLY A 1 249 ? -1.906  2.511   -1.958  1.00   50.64  ? 234 GLY A N     1 
ATOM   1787 C CA    . GLY A 1 249 ? -1.130  3.439   -2.764  1.00   50.75  ? 234 GLY A CA    1 
ATOM   1788 C C     . GLY A 1 249 ? -1.644  3.622   -4.186  1.00   52.21  ? 234 GLY A C     1 
ATOM   1789 O O     . GLY A 1 249 ? -2.732  3.150   -4.540  1.00   49.06  ? 234 GLY A O     1 
ATOM   1790 N N     . PRO A 1 250 ? -0.845  4.306   -5.020  1.00   55.06  ? 235 PRO A N     1 
ATOM   1791 C CA    . PRO A 1 250 ? -1.163  4.629   -6.418  1.00   56.24  ? 235 PRO A CA    1 
ATOM   1792 C C     . PRO A 1 250 ? -1.457  3.381   -7.245  1.00   56.26  ? 235 PRO A C     1 
ATOM   1793 O O     . PRO A 1 250 ? -2.296  3.439   -8.141  1.00   55.79  ? 235 PRO A O     1 
ATOM   1794 C CB    . PRO A 1 250 ? 0.128   5.280   -6.929  1.00   56.37  ? 235 PRO A CB    1 
ATOM   1795 C CG    . PRO A 1 250 ? 0.831   5.755   -5.708  1.00   57.77  ? 235 PRO A CG    1 
ATOM   1796 C CD    . PRO A 1 250 ? 0.512   4.741   -4.652  1.00   56.75  ? 235 PRO A CD    1 
ATOM   1797 N N     . ASP A 1 251 ? -0.778  2.274   -6.945  1.00   54.74  ? 236 ASP A N     1 
ATOM   1798 C CA    . ASP A 1 251 ? -0.940  1.047   -7.719  1.00   49.13  ? 236 ASP A CA    1 
ATOM   1799 C C     . ASP A 1 251 ? -2.246  0.307   -7.445  1.00   49.16  ? 236 ASP A C     1 
ATOM   1800 O O     . ASP A 1 251 ? -2.554  -0.678  -8.112  1.00   53.73  ? 236 ASP A O     1 
ATOM   1801 C CB    . ASP A 1 251 ? 0.259   0.112   -7.531  1.00   52.50  ? 236 ASP A CB    1 
ATOM   1802 C CG    . ASP A 1 251 ? 0.290   -0.556  -6.152  1.00   57.20  ? 236 ASP A CG    1 
ATOM   1803 O OD1   . ASP A 1 251 ? -0.729  -0.534  -5.424  1.00   53.59  ? 236 ASP A OD1   1 
ATOM   1804 O OD2   . ASP A 1 251 ? 1.346   -1.128  -5.804  1.00   59.43  ? 236 ASP A OD2   1 
ATOM   1805 N N     . GLY A 1 252 ? -3.016  0.763   -6.468  1.00   48.62  ? 237 GLY A N     1 
ATOM   1806 C CA    . GLY A 1 252 ? -4.333  0.176   -6.239  1.00   49.57  ? 237 GLY A CA    1 
ATOM   1807 C C     . GLY A 1 252 ? -4.314  -1.147  -5.485  1.00   48.68  ? 237 GLY A C     1 
ATOM   1808 O O     . GLY A 1 252 ? -5.353  -1.787  -5.297  1.00   46.89  ? 237 GLY A O     1 
ATOM   1809 N N     . LYS A 1 253 ? -3.132  -1.564  -5.045  1.00   47.47  ? 238 LYS A N     1 
ATOM   1810 C CA    . LYS A 1 253 ? -3.024  -2.782  -4.245  1.00   48.45  ? 238 LYS A CA    1 
ATOM   1811 C C     . LYS A 1 253 ? -3.243  -2.472  -2.766  1.00   45.99  ? 238 LYS A C     1 
ATOM   1812 O O     . LYS A 1 253 ? -2.535  -1.668  -2.161  1.00   43.36  ? 238 LYS A O     1 
ATOM   1813 C CB    . LYS A 1 253 ? -1.671  -3.476  -4.450  1.00   48.71  ? 238 LYS A CB    1 
ATOM   1814 C CG    . LYS A 1 253 ? -1.504  -4.803  -3.680  1.00   44.63  ? 238 LYS A CG    1 
ATOM   1815 C CD    . LYS A 1 253 ? -2.542  -5.844  -4.119  1.00   46.51  ? 238 LYS A CD    1 
ATOM   1816 C CE    . LYS A 1 253 ? -2.260  -7.200  -3.487  1.00   45.85  ? 238 LYS A CE    1 
ATOM   1817 N NZ    . LYS A 1 253 ? -3.201  -8.265  -3.922  1.00   39.08  ? 238 LYS A NZ    1 
ATOM   1818 N N     . LEU A 1 254 ? -4.246  -3.113  -2.196  1.00   45.99  ? 239 LEU A N     1 
ATOM   1819 C CA    . LEU A 1 254 ? -4.509  -2.987  -0.786  1.00   46.36  ? 239 LEU A CA    1 
ATOM   1820 C C     . LEU A 1 254 ? -3.409  -3.698  -0.006  1.00   45.61  ? 239 LEU A C     1 
ATOM   1821 O O     . LEU A 1 254 ? -3.041  -4.820  -0.341  1.00   44.67  ? 239 LEU A O     1 
ATOM   1822 C CB    . LEU A 1 254 ? -5.836  -3.648  -0.484  1.00   44.34  ? 239 LEU A CB    1 
ATOM   1823 C CG    . LEU A 1 254 ? -6.325  -3.425  0.929   1.00   48.79  ? 239 LEU A CG    1 
ATOM   1824 C CD1   . LEU A 1 254 ? -6.704  -1.954  1.086   1.00   48.38  ? 239 LEU A CD1   1 
ATOM   1825 C CD2   . LEU A 1 254 ? -7.504  -4.351  1.187   1.00   53.30  ? 239 LEU A CD2   1 
ATOM   1826 N N     . LEU A 1 255 ? -2.890  -3.054  1.035   1.00   44.04  ? 240 LEU A N     1 
ATOM   1827 C CA    . LEU A 1 255 ? -1.902  -3.689  1.902   1.00   42.32  ? 240 LEU A CA    1 
ATOM   1828 C C     . LEU A 1 255 ? -2.459  -3.764  3.326   1.00   42.35  ? 240 LEU A C     1 
ATOM   1829 O O     . LEU A 1 255 ? -3.170  -2.855  3.761   1.00   44.18  ? 240 LEU A O     1 
ATOM   1830 C CB    . LEU A 1 255 ? -0.580  -2.922  1.868   1.00   35.65  ? 240 LEU A CB    1 
ATOM   1831 C CG    . LEU A 1 255 ? 0.032   -2.718  0.481   1.00   43.12  ? 240 LEU A CG    1 
ATOM   1832 C CD1   . LEU A 1 255 ? 1.189   -1.754  0.570   1.00   45.23  ? 240 LEU A CD1   1 
ATOM   1833 C CD2   . LEU A 1 255 ? 0.496   -4.031  -0.144  1.00   38.98  ? 240 LEU A CD2   1 
ATOM   1834 N N     . HIS A 1 256 ? -2.151  -4.854  4.032   1.00   38.31  ? 241 HIS A N     1 
ATOM   1835 C CA    . HIS A 1 256 ? -2.643  -5.087  5.394   1.00   36.75  ? 241 HIS A CA    1 
ATOM   1836 C C     . HIS A 1 256 ? -1.535  -5.567  6.341   1.00   34.96  ? 241 HIS A C     1 
ATOM   1837 O O     . HIS A 1 256 ? -0.602  -6.236  5.924   1.00   33.90  ? 241 HIS A O     1 
ATOM   1838 C CB    . HIS A 1 256 ? -3.764  -6.125  5.367   1.00   36.52  ? 241 HIS A CB    1 
ATOM   1839 C CG    . HIS A 1 256 ? -4.190  -6.605  6.725   1.00   37.52  ? 241 HIS A CG    1 
ATOM   1840 N ND1   . HIS A 1 256 ? -4.969  -5.848  7.573   1.00   37.98  ? 241 HIS A ND1   1 
ATOM   1841 C CD2   . HIS A 1 256 ? -3.944  -7.772  7.374   1.00   37.41  ? 241 HIS A CD2   1 
ATOM   1842 C CE1   . HIS A 1 256 ? -5.177  -6.523  8.695   1.00   38.33  ? 241 HIS A CE1   1 
ATOM   1843 N NE2   . HIS A 1 256 ? -4.572  -7.692  8.597   1.00   38.79  ? 241 HIS A NE2   1 
ATOM   1844 N N     . SER A 1 257 ? -1.652  -5.223  7.617   1.00   32.88  ? 242 SER A N     1 
ATOM   1845 C CA    . SER A 1 257 ? -0.812  -5.792  8.655   1.00   34.37  ? 242 SER A CA    1 
ATOM   1846 C C     . SER A 1 257 ? -1.697  -6.227  9.825   1.00   36.80  ? 242 SER A C     1 
ATOM   1847 O O     . SER A 1 257 ? -2.533  -5.449  10.298  1.00   36.49  ? 242 SER A O     1 
ATOM   1848 C CB    . SER A 1 257 ? 0.242   -4.767  9.125   1.00   35.03  ? 242 SER A CB    1 
ATOM   1849 O OG    . SER A 1 257 ? 0.962   -5.226  10.264  1.00   34.65  ? 242 SER A OG    1 
ATOM   1850 N N     . ASP A 1 258 ? -1.540  -7.466  10.285  1.00   31.08  ? 243 ASP A N     1 
ATOM   1851 C CA    . ASP A 1 258 ? -2.186  -7.838  11.530  1.00   33.98  ? 243 ASP A CA    1 
ATOM   1852 C C     . ASP A 1 258 ? -1.538  -7.000  12.625  1.00   40.23  ? 243 ASP A C     1 
ATOM   1853 O O     . ASP A 1 258 ? -0.380  -6.544  12.491  1.00   35.12  ? 243 ASP A O     1 
ATOM   1854 C CB    . ASP A 1 258 ? -1.979  -9.311  11.861  1.00   30.49  ? 243 ASP A CB    1 
ATOM   1855 C CG    . ASP A 1 258 ? -2.968  -10.209 11.163  1.00   43.61  ? 243 ASP A CG    1 
ATOM   1856 O OD1   . ASP A 1 258 ? -3.690  -9.727  10.256  1.00   43.41  ? 243 ASP A OD1   1 
ATOM   1857 O OD2   . ASP A 1 258 ? -3.028  -11.404 11.529  1.00   46.73  ? 243 ASP A OD2   1 
ATOM   1858 N N     . ALA A 1 259 ? -2.297  -6.808  13.692  1.00   33.39  ? 244 ALA A N     1 
ATOM   1859 C CA    . ALA A 1 259 ? -1.830  -6.211  14.919  1.00   34.61  ? 244 ALA A CA    1 
ATOM   1860 C C     . ALA A 1 259 ? -0.822  -7.146  15.593  1.00   35.23  ? 244 ALA A C     1 
ATOM   1861 O O     . ALA A 1 259 ? -0.721  -8.338  15.243  1.00   29.88  ? 244 ALA A O     1 
ATOM   1862 C CB    . ALA A 1 259 ? -3.040  -5.974  15.859  1.00   31.61  ? 244 ALA A CB    1 
ATOM   1863 N N     . PHE A 1 260 ? -0.084  -6.595  16.558  1.00   32.72  ? 245 PHE A N     1 
ATOM   1864 C CA    . PHE A 1 260 ? 0.751   -7.373  17.460  1.00   28.82  ? 245 PHE A CA    1 
ATOM   1865 C C     . PHE A 1 260 ? 0.236   -7.187  18.894  1.00   31.76  ? 245 PHE A C     1 
ATOM   1866 O O     . PHE A 1 260 ? 0.929   -6.606  19.725  1.00   32.78  ? 245 PHE A O     1 
ATOM   1867 C CB    . PHE A 1 260 ? 2.216   -6.897  17.415  1.00   29.99  ? 245 PHE A CB    1 
ATOM   1868 C CG    . PHE A 1 260 ? 2.909   -7.072  16.075  1.00   29.20  ? 245 PHE A CG    1 
ATOM   1869 C CD1   . PHE A 1 260 ? 4.098   -7.801  15.983  1.00   28.98  ? 245 PHE A CD1   1 
ATOM   1870 C CD2   . PHE A 1 260 ? 2.407   -6.471  14.925  1.00   30.39  ? 245 PHE A CD2   1 
ATOM   1871 C CE1   . PHE A 1 260 ? 4.764   -7.953  14.751  1.00   29.06  ? 245 PHE A CE1   1 
ATOM   1872 C CE2   . PHE A 1 260 ? 3.077   -6.607  13.687  1.00   30.95  ? 245 PHE A CE2   1 
ATOM   1873 C CZ    . PHE A 1 260 ? 4.241   -7.345  13.600  1.00   28.64  ? 245 PHE A CZ    1 
ATOM   1874 N N     . PRO A 1 261 ? -0.969  -7.702  19.201  1.00   30.49  ? 246 PRO A N     1 
ATOM   1875 C CA    . PRO A 1 261 ? -1.479  -7.453  20.551  1.00   32.84  ? 246 PRO A CA    1 
ATOM   1876 C C     . PRO A 1 261 ? -0.635  -8.152  21.613  1.00   33.75  ? 246 PRO A C     1 
ATOM   1877 O O     . PRO A 1 261 ? -0.279  -9.317  21.466  1.00   33.80  ? 246 PRO A O     1 
ATOM   1878 C CB    . PRO A 1 261 ? -2.903  -8.052  20.513  1.00   31.96  ? 246 PRO A CB    1 
ATOM   1879 C CG    . PRO A 1 261 ? -2.824  -9.125  19.452  1.00   35.66  ? 246 PRO A CG    1 
ATOM   1880 C CD    . PRO A 1 261 ? -1.856  -8.585  18.417  1.00   29.00  ? 246 PRO A CD    1 
ATOM   1881 N N     . PRO A 1 262 ? -0.329  -7.441  22.699  1.00   34.50  ? 247 PRO A N     1 
ATOM   1882 C CA    . PRO A 1 262 ? 0.355   -8.053  23.843  1.00   35.02  ? 247 PRO A CA    1 
ATOM   1883 C C     . PRO A 1 262 ? -0.666  -8.959  24.553  1.00   35.71  ? 247 PRO A C     1 
ATOM   1884 O O     . PRO A 1 262 ? -1.868  -8.753  24.405  1.00   33.52  ? 247 PRO A O     1 
ATOM   1885 C CB    . PRO A 1 262 ? 0.693   -6.842  24.715  1.00   36.05  ? 247 PRO A CB    1 
ATOM   1886 C CG    . PRO A 1 262 ? -0.510  -5.912  24.481  1.00   38.39  ? 247 PRO A CG    1 
ATOM   1887 C CD    . PRO A 1 262 ? -0.841  -6.091  22.999  1.00   32.51  ? 247 PRO A CD    1 
ATOM   1888 N N     . PRO A 1 263 ? -0.201  -9.972  25.277  1.00   32.98  ? 248 PRO A N     1 
ATOM   1889 C CA    . PRO A 1 263 ? -1.132  -10.879 25.960  1.00   37.15  ? 248 PRO A CA    1 
ATOM   1890 C C     . PRO A 1 263 ? -2.063  -10.123 26.906  1.00   40.74  ? 248 PRO A C     1 
ATOM   1891 O O     . PRO A 1 263 ? -3.245  -10.470 26.996  1.00   40.99  ? 248 PRO A O     1 
ATOM   1892 C CB    . PRO A 1 263 ? -0.199  -11.809 26.748  1.00   35.97  ? 248 PRO A CB    1 
ATOM   1893 C CG    . PRO A 1 263 ? 1.056   -11.843 25.937  1.00   38.14  ? 248 PRO A CG    1 
ATOM   1894 C CD    . PRO A 1 263 ? 1.187   -10.465 25.300  1.00   33.68  ? 248 PRO A CD    1 
ATOM   1895 N N     . ARG A 1 264 ? -1.534  -9.104  27.584  1.00   39.31  ? 249 ARG A N     1 
ATOM   1896 C CA    . ARG A 1 264 ? -2.330  -8.186  28.412  1.00   38.07  ? 249 ARG A CA    1 
ATOM   1897 C C     . ARG A 1 264 ? -2.319  -6.765  27.866  1.00   35.10  ? 249 ARG A C     1 
ATOM   1898 O O     . ARG A 1 264 ? -1.324  -6.065  27.987  1.00   37.50  ? 249 ARG A O     1 
ATOM   1899 C CB    . ARG A 1 264 ? -1.776  -8.122  29.839  1.00   44.86  ? 249 ARG A CB    1 
ATOM   1900 C CG    . ARG A 1 264 ? -1.955  -9.380  30.659  1.00   49.36  ? 249 ARG A CG    1 
ATOM   1901 C CD    . ARG A 1 264 ? -3.414  -9.687  30.870  1.00   58.10  ? 249 ARG A CD    1 
ATOM   1902 N NE    . ARG A 1 264 ? -3.594  -10.875 31.702  1.00   70.99  ? 249 ARG A NE    1 
ATOM   1903 C CZ    . ARG A 1 264 ? -4.761  -11.485 31.898  1.00   73.78  ? 249 ARG A CZ    1 
ATOM   1904 N NH1   . ARG A 1 264 ? -5.861  -11.023 31.306  1.00   74.70  ? 249 ARG A NH1   1 
ATOM   1905 N NH2   . ARG A 1 264 ? -4.825  -12.562 32.680  1.00   67.97  ? 249 ARG A NH2   1 
ATOM   1906 N N     . VAL A 1 265 ? -3.416  -6.324  27.270  1.00   32.75  ? 250 VAL A N     1 
ATOM   1907 C CA    . VAL A 1 265 ? -3.538  -4.922  26.892  1.00   33.88  ? 250 VAL A CA    1 
ATOM   1908 C C     . VAL A 1 265 ? -3.876  -4.072  28.124  1.00   39.01  ? 250 VAL A C     1 
ATOM   1909 O O     . VAL A 1 265 ? -4.959  -4.214  28.700  1.00   39.84  ? 250 VAL A O     1 
ATOM   1910 C CB    . VAL A 1 265 ? -4.629  -4.736  25.846  1.00   38.02  ? 250 VAL A CB    1 
ATOM   1911 C CG1   . VAL A 1 265 ? -4.644  -3.295  25.343  1.00   41.13  ? 250 VAL A CG1   1 
ATOM   1912 C CG2   . VAL A 1 265 ? -4.431  -5.719  24.690  1.00   35.37  ? 250 VAL A CG2   1 
ATOM   1913 N N     . VAL A 1 266 ? -2.945  -3.214  28.533  1.00   35.13  ? 251 VAL A N     1 
ATOM   1914 C CA    . VAL A 1 266 ? -3.111  -2.387  29.731  1.00   39.73  ? 251 VAL A CA    1 
ATOM   1915 C C     . VAL A 1 266 ? -3.188  -0.857  29.499  1.00   41.58  ? 251 VAL A C     1 
ATOM   1916 O O     . VAL A 1 266 ? -3.549  -0.114  30.419  1.00   42.94  ? 251 VAL A O     1 
ATOM   1917 C CB    . VAL A 1 266 ? -1.999  -2.674  30.771  1.00   39.90  ? 251 VAL A CB    1 
ATOM   1918 C CG1   . VAL A 1 266 ? -1.978  -4.162  31.146  1.00   38.31  ? 251 VAL A CG1   1 
ATOM   1919 C CG2   . VAL A 1 266 ? -0.632  -2.217  30.239  1.00   33.33  ? 251 VAL A CG2   1 
ATOM   1920 N N     . ASP A 1 267 ? -2.849  -0.378  28.301  1.00   37.95  ? 252 ASP A N     1 
ATOM   1921 C CA    . ASP A 1 267 ? -2.814  1.073   28.055  1.00   39.37  ? 252 ASP A CA    1 
ATOM   1922 C C     . ASP A 1 267 ? -2.708  1.441   26.583  1.00   39.87  ? 252 ASP A C     1 
ATOM   1923 O O     . ASP A 1 267 ? -1.626  1.418   25.994  1.00   39.31  ? 252 ASP A O     1 
ATOM   1924 C CB    . ASP A 1 267 ? -1.664  1.742   28.830  1.00   41.43  ? 252 ASP A CB    1 
ATOM   1925 C CG    . ASP A 1 267 ? -1.554  3.241   28.538  1.00   46.88  ? 252 ASP A CG    1 
ATOM   1926 O OD1   . ASP A 1 267 ? -2.564  3.820   28.088  1.00   47.78  ? 252 ASP A OD1   1 
ATOM   1927 O OD2   . ASP A 1 267 ? -0.466  3.847   28.756  1.00   48.74  ? 252 ASP A OD2   1 
ATOM   1928 N N     . THR A 1 268 ? -3.831  1.824   25.997  1.00   39.36  ? 253 THR A N     1 
ATOM   1929 C CA    . THR A 1 268 ? -3.849  2.166   24.589  1.00   39.69  ? 253 THR A CA    1 
ATOM   1930 C C     . THR A 1 268 ? -3.777  3.668   24.324  1.00   38.65  ? 253 THR A C     1 
ATOM   1931 O O     . THR A 1 268 ? -3.858  4.099   23.185  1.00   36.75  ? 253 THR A O     1 
ATOM   1932 C CB    . THR A 1 268 ? -5.074  1.564   23.912  1.00   42.15  ? 253 THR A CB    1 
ATOM   1933 O OG1   . THR A 1 268 ? -6.264  2.105   24.506  1.00   40.84  ? 253 THR A OG1   1 
ATOM   1934 C CG2   . THR A 1 268 ? -5.054  0.042   24.088  1.00   34.71  ? 253 THR A CG2   1 
ATOM   1935 N N     . LEU A 1 269 ? -3.611  4.462   25.371  1.00   37.21  ? 254 LEU A N     1 
ATOM   1936 C CA    . LEU A 1 269 ? -3.477  5.899   25.199  1.00   38.54  ? 254 LEU A CA    1 
ATOM   1937 C C     . LEU A 1 269 ? -2.208  6.217   24.397  1.00   36.07  ? 254 LEU A C     1 
ATOM   1938 O O     . LEU A 1 269 ? -1.119  5.841   24.787  1.00   35.25  ? 254 LEU A O     1 
ATOM   1939 C CB    . LEU A 1 269 ? -3.421  6.572   26.568  1.00   41.18  ? 254 LEU A CB    1 
ATOM   1940 C CG    . LEU A 1 269 ? -3.157  8.073   26.519  1.00   47.00  ? 254 LEU A CG    1 
ATOM   1941 C CD1   . LEU A 1 269 ? -4.333  8.770   25.850  1.00   43.30  ? 254 LEU A CD1   1 
ATOM   1942 C CD2   . LEU A 1 269 ? -2.896  8.628   27.914  1.00   45.48  ? 254 LEU A CD2   1 
ATOM   1943 N N     . GLY A 1 270 ? -2.352  6.893   23.265  1.00   38.21  ? 255 GLY A N     1 
ATOM   1944 C CA    . GLY A 1 270 ? -1.214  7.177   22.402  1.00   37.85  ? 255 GLY A CA    1 
ATOM   1945 C C     . GLY A 1 270 ? -0.771  6.049   21.469  1.00   39.29  ? 255 GLY A C     1 
ATOM   1946 O O     . GLY A 1 270 ? 0.283   6.139   20.835  1.00   39.95  ? 255 GLY A O     1 
ATOM   1947 N N     . ALA A 1 271 ? -1.558  4.980   21.375  1.00   36.92  ? 256 ALA A N     1 
ATOM   1948 C CA    . ALA A 1 271 ? -1.231  3.895   20.443  1.00   38.18  ? 256 ALA A CA    1 
ATOM   1949 C C     . ALA A 1 271 ? -1.244  4.393   18.992  1.00   37.09  ? 256 ALA A C     1 
ATOM   1950 O O     . ALA A 1 271 ? -0.309  4.152   18.231  1.00   38.12  ? 256 ALA A O     1 
ATOM   1951 C CB    . ALA A 1 271 ? -2.185  2.718   20.625  1.00   38.46  ? 256 ALA A CB    1 
ATOM   1952 N N     . GLY A 1 272 ? -2.301  5.102   18.615  1.00   36.12  ? 257 GLY A N     1 
ATOM   1953 C CA    . GLY A 1 272 ? -2.365  5.750   17.315  1.00   35.90  ? 257 GLY A CA    1 
ATOM   1954 C C     . GLY A 1 272 ? -1.141  6.599   16.979  1.00   41.71  ? 257 GLY A C     1 
ATOM   1955 O O     . GLY A 1 272 ? -0.631  6.557   15.848  1.00   39.87  ? 257 GLY A O     1 
ATOM   1956 N N     . ASP A 1 273 ? -0.662  7.374   17.953  1.00   39.92  ? 258 ASP A N     1 
ATOM   1957 C CA    . ASP A 1 273 ? 0.496   8.223   17.727  1.00   42.09  ? 258 ASP A CA    1 
ATOM   1958 C C     . ASP A 1 273 ? 1.769   7.390   17.635  1.00   40.96  ? 258 ASP A C     1 
ATOM   1959 O O     . ASP A 1 273 ? 2.690   7.749   16.923  1.00   40.87  ? 258 ASP A O     1 
ATOM   1960 C CB    . ASP A 1 273 ? 0.641   9.262   18.838  1.00   44.17  ? 258 ASP A CB    1 
ATOM   1961 C CG    . ASP A 1 273 ? -0.628  10.060  19.061  1.00   48.93  ? 258 ASP A CG    1 
ATOM   1962 O OD1   . ASP A 1 273 ? -1.416  10.200  18.102  1.00   53.88  ? 258 ASP A OD1   1 
ATOM   1963 O OD2   . ASP A 1 273 ? -0.834  10.548  20.197  1.00   51.37  ? 258 ASP A OD2   1 
ATOM   1964 N N     . THR A 1 274 ? 1.817   6.288   18.375  1.00   37.29  ? 259 THR A N     1 
ATOM   1965 C CA    . THR A 1 274 ? 2.948   5.380   18.319  1.00   37.25  ? 259 THR A CA    1 
ATOM   1966 C C     . THR A 1 274 ? 3.013   4.738   16.940  1.00   39.88  ? 259 THR A C     1 
ATOM   1967 O O     . THR A 1 274 ? 4.092   4.634   16.337  1.00   42.74  ? 259 THR A O     1 
ATOM   1968 C CB    . THR A 1 274 ? 2.849   4.312   19.427  1.00   38.58  ? 259 THR A CB    1 
ATOM   1969 O OG1   . THR A 1 274 ? 2.795   4.967   20.699  1.00   36.86  ? 259 THR A OG1   1 
ATOM   1970 C CG2   . THR A 1 274 ? 4.049   3.360   19.404  1.00   35.50  ? 259 THR A CG2   1 
ATOM   1971 N N     . PHE A 1 275 ? 1.852   4.328   16.436  1.00   36.34  ? 260 PHE A N     1 
ATOM   1972 C CA    . PHE A 1 275 ? 1.742   3.789   15.090  1.00   35.45  ? 260 PHE A CA    1 
ATOM   1973 C C     . PHE A 1 275 ? 2.191   4.807   14.018  1.00   37.90  ? 260 PHE A C     1 
ATOM   1974 O O     . PHE A 1 275 ? 3.036   4.487   13.185  1.00   37.03  ? 260 PHE A O     1 
ATOM   1975 C CB    . PHE A 1 275 ? 0.310   3.291   14.837  1.00   36.56  ? 260 PHE A CB    1 
ATOM   1976 C CG    . PHE A 1 275 ? 0.046   2.872   13.415  1.00   35.16  ? 260 PHE A CG    1 
ATOM   1977 C CD1   . PHE A 1 275 ? 0.411   1.610   12.966  1.00   35.53  ? 260 PHE A CD1   1 
ATOM   1978 C CD2   . PHE A 1 275 ? -0.576  3.735   12.530  1.00   36.68  ? 260 PHE A CD2   1 
ATOM   1979 C CE1   . PHE A 1 275 ? 0.176   1.219   11.651  1.00   34.89  ? 260 PHE A CE1   1 
ATOM   1980 C CE2   . PHE A 1 275 ? -0.832  3.350   11.215  1.00   37.61  ? 260 PHE A CE2   1 
ATOM   1981 C CZ    . PHE A 1 275 ? -0.443  2.086   10.773  1.00   35.58  ? 260 PHE A CZ    1 
ATOM   1982 N N     . ASN A 1 276 ? 1.636   6.019   14.033  1.00   37.44  ? 261 ASN A N     1 
ATOM   1983 C CA    . ASN A 1 276 ? 2.004   7.027   13.035  1.00   37.39  ? 261 ASN A CA    1 
ATOM   1984 C C     . ASN A 1 276 ? 3.506   7.299   13.029  1.00   41.62  ? 261 ASN A C     1 
ATOM   1985 O O     . ASN A 1 276 ? 4.162   7.287   11.978  1.00   39.37  ? 261 ASN A O     1 
ATOM   1986 C CB    . ASN A 1 276 ? 1.263   8.342   13.278  1.00   40.22  ? 261 ASN A CB    1 
ATOM   1987 C CG    . ASN A 1 276 ? -0.228  8.215   13.086  1.00   40.03  ? 261 ASN A CG    1 
ATOM   1988 O OD1   . ASN A 1 276 ? -0.709  7.234   12.515  1.00   44.32  ? 261 ASN A OD1   1 
ATOM   1989 N ND2   . ASN A 1 276 ? -0.975  9.201   13.566  1.00   41.04  ? 261 ASN A ND2   1 
ATOM   1990 N N     . ALA A 1 277 ? 4.047   7.539   14.217  1.00   39.11  ? 262 ALA A N     1 
ATOM   1991 C CA    . ALA A 1 277 ? 5.458   7.828   14.348  1.00   41.66  ? 262 ALA A CA    1 
ATOM   1992 C C     . ALA A 1 277 ? 6.279   6.697   13.752  1.00   40.16  ? 262 ALA A C     1 
ATOM   1993 O O     . ALA A 1 277 ? 7.274   6.936   13.066  1.00   41.40  ? 262 ALA A O     1 
ATOM   1994 C CB    . ALA A 1 277 ? 5.820   8.047   15.810  1.00   42.98  ? 262 ALA A CB    1 
ATOM   1995 N N     . SER A 1 278 ? 5.860   5.466   14.014  1.00   41.70  ? 263 SER A N     1 
ATOM   1996 C CA    . SER A 1 278 ? 6.599   4.293   13.533  1.00   42.87  ? 263 SER A CA    1 
ATOM   1997 C C     . SER A 1 278 ? 6.523   4.119   12.017  1.00   37.87  ? 263 SER A C     1 
ATOM   1998 O O     . SER A 1 278 ? 7.504   3.743   11.380  1.00   38.92  ? 263 SER A O     1 
ATOM   1999 C CB    . SER A 1 278 ? 6.132   3.020   14.250  1.00   36.18  ? 263 SER A CB    1 
ATOM   2000 O OG    . SER A 1 278 ? 6.462   3.111   15.621  1.00   39.97  ? 263 SER A OG    1 
ATOM   2001 N N     . VAL A 1 279 ? 5.364   4.394   11.442  1.00   36.81  ? 264 VAL A N     1 
ATOM   2002 C CA    . VAL A 1 279 ? 5.233   4.354   9.989   1.00   38.29  ? 264 VAL A CA    1 
ATOM   2003 C C     . VAL A 1 279 ? 6.138   5.406   9.346   1.00   40.77  ? 264 VAL A C     1 
ATOM   2004 O O     . VAL A 1 279 ? 6.885   5.112   8.412   1.00   42.25  ? 264 VAL A O     1 
ATOM   2005 C CB    . VAL A 1 279 ? 3.783   4.578   9.539   1.00   38.95  ? 264 VAL A CB    1 
ATOM   2006 C CG1   . VAL A 1 279 ? 3.715   4.698   8.041   1.00   32.85  ? 264 VAL A CG1   1 
ATOM   2007 C CG2   . VAL A 1 279 ? 2.879   3.442   10.045  1.00   35.01  ? 264 VAL A CG2   1 
ATOM   2008 N N     . ILE A 1 280 ? 6.078   6.629   9.864   1.00   45.27  ? 265 ILE A N     1 
ATOM   2009 C CA    . ILE A 1 280 ? 6.894   7.728   9.359   1.00   39.84  ? 265 ILE A CA    1 
ATOM   2010 C C     . ILE A 1 280 ? 8.359   7.356   9.436   1.00   44.47  ? 265 ILE A C     1 
ATOM   2011 O O     . ILE A 1 280 ? 9.104   7.502   8.463   1.00   46.50  ? 265 ILE A O     1 
ATOM   2012 C CB    . ILE A 1 280 ? 6.676   8.993   10.190  1.00   43.76  ? 265 ILE A CB    1 
ATOM   2013 C CG1   . ILE A 1 280 ? 5.319   9.620   9.859   1.00   43.05  ? 265 ILE A CG1   1 
ATOM   2014 C CG2   . ILE A 1 280 ? 7.834   9.978   9.988   1.00   45.81  ? 265 ILE A CG2   1 
ATOM   2015 C CD1   . ILE A 1 280 ? 4.849   10.660  10.874  1.00   42.06  ? 265 ILE A CD1   1 
ATOM   2016 N N     . PHE A 1 281 ? 8.771   6.858   10.597  1.00   43.10  ? 266 PHE A N     1 
ATOM   2017 C CA    . PHE A 1 281 ? 10.159  6.481   10.793  1.00   42.45  ? 266 PHE A CA    1 
ATOM   2018 C C     . PHE A 1 281 ? 10.599  5.448   9.776   1.00   47.11  ? 266 PHE A C     1 
ATOM   2019 O O     . PHE A 1 281 ? 11.687  5.549   9.188   1.00   47.20  ? 266 PHE A O     1 
ATOM   2020 C CB    . PHE A 1 281 ? 10.376  5.914   12.184  1.00   41.16  ? 266 PHE A CB    1 
ATOM   2021 C CG    . PHE A 1 281 ? 11.786  5.468   12.435  1.00   45.31  ? 266 PHE A CG    1 
ATOM   2022 C CD1   . PHE A 1 281 ? 12.820  6.390   12.477  1.00   51.41  ? 266 PHE A CD1   1 
ATOM   2023 C CD2   . PHE A 1 281 ? 12.084  4.130   12.624  1.00   44.71  ? 266 PHE A CD2   1 
ATOM   2024 C CE1   . PHE A 1 281 ? 14.130  5.979   12.708  1.00   54.23  ? 266 PHE A CE1   1 
ATOM   2025 C CE2   . PHE A 1 281 ? 13.389  3.713   12.859  1.00   46.36  ? 266 PHE A CE2   1 
ATOM   2026 C CZ    . PHE A 1 281 ? 14.408  4.632   12.904  1.00   46.90  ? 266 PHE A CZ    1 
ATOM   2027 N N     . SER A 1 282 ? 9.753   4.442   9.591   1.00   42.95  ? 267 SER A N     1 
ATOM   2028 C CA    . SER A 1 282 ? 10.098  3.322   8.746   1.00   45.24  ? 267 SER A CA    1 
ATOM   2029 C C     . SER A 1 282 ? 10.193  3.806   7.302   1.00   46.64  ? 267 SER A C     1 
ATOM   2030 O O     . SER A 1 282 ? 11.152  3.508   6.595   1.00   47.75  ? 267 SER A O     1 
ATOM   2031 C CB    . SER A 1 282 ? 9.064   2.206   8.897   1.00   43.24  ? 267 SER A CB    1 
ATOM   2032 O OG    . SER A 1 282 ? 9.556   0.988   8.367   1.00   45.85  ? 267 SER A OG    1 
ATOM   2033 N N     . LEU A 1 283 ? 9.205   4.583   6.881   1.00   43.74  ? 268 LEU A N     1 
ATOM   2034 C CA    . LEU A 1 283 ? 9.213   5.145   5.545   1.00   45.54  ? 268 LEU A CA    1 
ATOM   2035 C C     . LEU A 1 283 ? 10.425  6.062   5.320   1.00   50.02  ? 268 LEU A C     1 
ATOM   2036 O O     . LEU A 1 283 ? 11.135  5.938   4.319   1.00   51.42  ? 268 LEU A O     1 
ATOM   2037 C CB    . LEU A 1 283 ? 7.907   5.893   5.285   1.00   44.94  ? 268 LEU A CB    1 
ATOM   2038 C CG    . LEU A 1 283 ? 6.682   4.997   5.106   1.00   47.68  ? 268 LEU A CG    1 
ATOM   2039 C CD1   . LEU A 1 283 ? 5.446   5.842   4.870   1.00   40.23  ? 268 LEU A CD1   1 
ATOM   2040 C CD2   . LEU A 1 283 ? 6.902   4.016   3.957   1.00   38.24  ? 268 LEU A CD2   1 
ATOM   2041 N N     . SER A 1 284 ? 10.662  6.979   6.253   1.00   49.87  ? 269 SER A N     1 
ATOM   2042 C CA    . SER A 1 284 ? 11.823  7.860   6.181   1.00   48.75  ? 269 SER A CA    1 
ATOM   2043 C C     . SER A 1 284 ? 13.136  7.074   6.090   1.00   50.25  ? 269 SER A C     1 
ATOM   2044 O O     . SER A 1 284 ? 14.148  7.613   5.652   1.00   54.18  ? 269 SER A O     1 
ATOM   2045 C CB    . SER A 1 284 ? 11.874  8.800   7.395   1.00   47.10  ? 269 SER A CB    1 
ATOM   2046 O OG    . SER A 1 284 ? 12.684  8.253   8.426   1.00   48.11  ? 269 SER A OG    1 
ATOM   2047 N N     . GLN A 1 285 ? 13.129  5.813   6.515   1.00   49.79  ? 270 GLN A N     1 
ATOM   2048 C CA    . GLN A 1 285 ? 14.352  4.999   6.487   1.00   50.82  ? 270 GLN A CA    1 
ATOM   2049 C C     . GLN A 1 285 ? 14.468  4.192   5.206   1.00   52.30  ? 270 GLN A C     1 
ATOM   2050 O O     . GLN A 1 285 ? 15.387  3.383   5.059   1.00   53.18  ? 270 GLN A O     1 
ATOM   2051 C CB    . GLN A 1 285 ? 14.413  4.041   7.676   1.00   49.58  ? 270 GLN A CB    1 
ATOM   2052 C CG    . GLN A 1 285 ? 14.634  4.721   9.002   1.00   53.49  ? 270 GLN A CG    1 
ATOM   2053 C CD    . GLN A 1 285 ? 16.093  5.029   9.244   1.00   58.99  ? 270 GLN A CD    1 
ATOM   2054 O OE1   . GLN A 1 285 ? 16.471  6.184   9.452   1.00   60.78  ? 270 GLN A OE1   1 
ATOM   2055 N NE2   . GLN A 1 285 ? 16.926  3.990   9.224   1.00   61.20  ? 270 GLN A NE2   1 
ATOM   2056 N N     . GLY A 1 286 ? 13.515  4.389   4.299   1.00   50.04  ? 271 GLY A N     1 
ATOM   2057 C CA    . GLY A 1 286 ? 13.551  3.742   3.002   1.00   48.34  ? 271 GLY A CA    1 
ATOM   2058 C C     . GLY A 1 286 ? 12.758  2.454   2.857   1.00   52.15  ? 271 GLY A C     1 
ATOM   2059 O O     . GLY A 1 286 ? 12.801  1.832   1.799   1.00   50.42  ? 271 GLY A O     1 
ATOM   2060 N N     . ARG A 1 287 ? 12.030  2.032   3.889   1.00   52.92  ? 272 ARG A N     1 
ATOM   2061 C CA    . ARG A 1 287 ? 11.355  0.736   3.799   1.00   48.82  ? 272 ARG A CA    1 
ATOM   2062 C C     . ARG A 1 287 ? 10.117  0.824   2.928   1.00   43.11  ? 272 ARG A C     1 
ATOM   2063 O O     . ARG A 1 287 ? 9.598   1.913   2.690   1.00   46.67  ? 272 ARG A O     1 
ATOM   2064 C CB    . ARG A 1 287 ? 10.996  0.189   5.180   1.00   43.88  ? 272 ARG A CB    1 
ATOM   2065 C CG    . ARG A 1 287 ? 12.119  0.232   6.173   1.00   48.86  ? 272 ARG A CG    1 
ATOM   2066 C CD    . ARG A 1 287 ? 13.033  -0.970  6.081   1.00   55.61  ? 272 ARG A CD    1 
ATOM   2067 N NE    . ARG A 1 287 ? 14.300  -0.690  6.766   1.00   71.76  ? 272 ARG A NE    1 
ATOM   2068 C CZ    . ARG A 1 287 ? 15.444  -0.367  6.154   1.00   75.10  ? 272 ARG A CZ    1 
ATOM   2069 N NH1   . ARG A 1 287 ? 16.529  -0.115  6.881   1.00   73.35  ? 272 ARG A NH1   1 
ATOM   2070 N NH2   . ARG A 1 287 ? 15.515  -0.306  4.820   1.00   71.96  ? 272 ARG A NH2   1 
ATOM   2071 N N     . SER A 1 288 ? 9.647   -0.319  2.436   1.00   39.87  ? 273 SER A N     1 
ATOM   2072 C CA    . SER A 1 288 ? 8.384   -0.335  1.704   1.00   38.22  ? 273 SER A CA    1 
ATOM   2073 C C     . SER A 1 288 ? 7.218   0.009   2.619   1.00   36.67  ? 273 SER A C     1 
ATOM   2074 O O     . SER A 1 288 ? 7.335   -0.044  3.851   1.00   38.93  ? 273 SER A O     1 
ATOM   2075 C CB    . SER A 1 288 ? 8.133   -1.708  1.082   1.00   42.71  ? 273 SER A CB    1 
ATOM   2076 O OG    . SER A 1 288 ? 8.013   -2.706  2.084   1.00   45.76  ? 273 SER A OG    1 
ATOM   2077 N N     . VAL A 1 289 ? 6.091   0.348   2.007   1.00   36.90  ? 274 VAL A N     1 
ATOM   2078 C CA    . VAL A 1 289 ? 4.841   0.577   2.714   1.00   36.19  ? 274 VAL A CA    1 
ATOM   2079 C C     . VAL A 1 289 ? 4.398   -0.667  3.486   1.00   34.82  ? 274 VAL A C     1 
ATOM   2080 O O     . VAL A 1 289 ? 4.003   -0.575  4.632   1.00   39.26  ? 274 VAL A O     1 
ATOM   2081 C CB    . VAL A 1 289 ? 3.727   0.978   1.738   1.00   37.77  ? 274 VAL A CB    1 
ATOM   2082 C CG1   . VAL A 1 289 ? 2.422   1.215   2.487   1.00   37.67  ? 274 VAL A CG1   1 
ATOM   2083 C CG2   . VAL A 1 289 ? 4.131   2.224   0.973   1.00   40.27  ? 274 VAL A CG2   1 
ATOM   2084 N N     . GLN A 1 290 ? 4.449   -1.830  2.857   1.00   36.38  ? 275 GLN A N     1 
ATOM   2085 C CA    . GLN A 1 290 ? 4.149   -3.064  3.574   1.00   36.59  ? 275 GLN A CA    1 
ATOM   2086 C C     . GLN A 1 290 ? 4.980   -3.177  4.850   1.00   33.97  ? 275 GLN A C     1 
ATOM   2087 O O     . GLN A 1 290 ? 4.439   -3.418  5.924   1.00   33.32  ? 275 GLN A O     1 
ATOM   2088 C CB    . GLN A 1 290 ? 4.360   -4.305  2.694   1.00   33.33  ? 275 GLN A CB    1 
ATOM   2089 C CG    . GLN A 1 290 ? 4.026   -5.634  3.400   1.00   34.77  ? 275 GLN A CG    1 
ATOM   2090 C CD    . GLN A 1 290 ? 2.543   -5.771  3.771   1.00   39.73  ? 275 GLN A CD    1 
ATOM   2091 O OE1   . GLN A 1 290 ? 1.728   -6.248  2.974   1.00   36.38  ? 275 GLN A OE1   1 
ATOM   2092 N NE2   . GLN A 1 290 ? 2.192   -5.351  4.986   1.00   33.51  ? 275 GLN A NE2   1 
ATOM   2093 N N     . GLU A 1 291 ? 6.294   -3.006  4.736   1.00   35.26  ? 276 GLU A N     1 
ATOM   2094 C CA    . GLU A 1 291 ? 7.166   -3.114  5.902   1.00   34.67  ? 276 GLU A CA    1 
ATOM   2095 C C     . GLU A 1 291 ? 6.859   -2.057  6.964   1.00   35.41  ? 276 GLU A C     1 
ATOM   2096 O O     . GLU A 1 291 ? 6.896   -2.347  8.167   1.00   37.43  ? 276 GLU A O     1 
ATOM   2097 C CB    . GLU A 1 291 ? 8.651   -3.041  5.509   1.00   32.84  ? 276 GLU A CB    1 
ATOM   2098 C CG    . GLU A 1 291 ? 9.185   -4.293  4.836   1.00   36.71  ? 276 GLU A CG    1 
ATOM   2099 C CD    . GLU A 1 291 ? 10.435  -4.015  3.982   1.00   42.86  ? 276 GLU A CD    1 
ATOM   2100 O OE1   . GLU A 1 291 ? 11.204  -4.966  3.756   1.00   44.62  ? 276 GLU A OE1   1 
ATOM   2101 O OE2   . GLU A 1 291 ? 10.653  -2.852  3.549   1.00   43.33  ? 276 GLU A OE2   1 
ATOM   2102 N N     . ALA A 1 292 ? 6.576   -0.835  6.521   1.00   33.87  ? 277 ALA A N     1 
ATOM   2103 C CA    . ALA A 1 292 ? 6.260   0.259   7.437   1.00   36.45  ? 277 ALA A CA    1 
ATOM   2104 C C     . ALA A 1 292 ? 4.938   0.032   8.190   1.00   37.17  ? 277 ALA A C     1 
ATOM   2105 O O     . ALA A 1 292 ? 4.858   0.297   9.388   1.00   37.26  ? 277 ALA A O     1 
ATOM   2106 C CB    . ALA A 1 292 ? 6.252   1.601   6.704   1.00   35.05  ? 277 ALA A CB    1 
ATOM   2107 N N     . LEU A 1 293 ? 3.913   -0.450  7.491   1.00   35.78  ? 278 LEU A N     1 
ATOM   2108 C CA    . LEU A 1 293 ? 2.642   -0.808  8.129   1.00   36.79  ? 278 LEU A CA    1 
ATOM   2109 C C     . LEU A 1 293 ? 2.880   -1.735  9.303   1.00   33.35  ? 278 LEU A C     1 
ATOM   2110 O O     . LEU A 1 293 ? 2.370   -1.561  10.402  1.00   38.60  ? 278 LEU A O     1 
ATOM   2111 C CB    . LEU A 1 293 ? 1.781   -1.588  7.142   1.00   38.09  ? 278 LEU A CB    1 
ATOM   2112 C CG    . LEU A 1 293 ? 0.614   -0.887  6.479   1.00   45.97  ? 278 LEU A CG    1 
ATOM   2113 C CD1   . LEU A 1 293 ? -0.244  -1.918  5.742   1.00   40.61  ? 278 LEU A CD1   1 
ATOM   2114 C CD2   . LEU A 1 293 ? -0.178  -0.152  7.523   1.00   37.53  ? 278 LEU A CD2   1 
ATOM   2115 N N     . ARG A 1 294 ? 3.651   -2.759  9.022   1.00   31.94  ? 279 ARG A N     1 
ATOM   2116 C CA    . ARG A 1 294 ? 3.958   -3.822  9.954   1.00   30.63  ? 279 ARG A CA    1 
ATOM   2117 C C     . ARG A 1 294 ? 4.772   -3.326  11.162  1.00   35.72  ? 279 ARG A C     1 
ATOM   2118 O O     . ARG A 1 294 ? 4.517   -3.709  12.319  1.00   35.17  ? 279 ARG A O     1 
ATOM   2119 C CB    . ARG A 1 294 ? 4.786   -4.799  9.159   1.00   34.72  ? 279 ARG A CB    1 
ATOM   2120 C CG    . ARG A 1 294 ? 4.571   -6.187  9.465   1.00   42.81  ? 279 ARG A CG    1 
ATOM   2121 C CD    . ARG A 1 294 ? 3.371   -6.778  8.799   1.00   34.79  ? 279 ARG A CD    1 
ATOM   2122 N NE    . ARG A 1 294 ? 3.435   -8.175  9.167   1.00   37.22  ? 279 ARG A NE    1 
ATOM   2123 C CZ    . ARG A 1 294 ? 2.851   -8.735  10.216  1.00   34.54  ? 279 ARG A CZ    1 
ATOM   2124 N NH1   . ARG A 1 294 ? 3.060   -10.024 10.443  1.00   36.81  ? 279 ARG A NH1   1 
ATOM   2125 N NH2   . ARG A 1 294 ? 2.040   -8.056  11.003  1.00   35.71  ? 279 ARG A NH2   1 
ATOM   2126 N N     . PHE A 1 295 ? 5.771   -2.487  10.900  1.00   32.91  ? 280 PHE A N     1 
ATOM   2127 C CA    . PHE A 1 295 ? 6.573   -1.932  11.977  1.00   33.52  ? 280 PHE A CA    1 
ATOM   2128 C C     . PHE A 1 295 ? 5.690   -1.031  12.831  1.00   32.78  ? 280 PHE A C     1 
ATOM   2129 O O     . PHE A 1 295 ? 5.798   -1.012  14.048  1.00   32.53  ? 280 PHE A O     1 
ATOM   2130 C CB    . PHE A 1 295 ? 7.770   -1.145  11.428  1.00   35.14  ? 280 PHE A CB    1 
ATOM   2131 C CG    . PHE A 1 295 ? 8.740   -0.719  12.482  1.00   32.42  ? 280 PHE A CG    1 
ATOM   2132 C CD1   . PHE A 1 295 ? 9.470   -1.662  13.186  1.00   31.54  ? 280 PHE A CD1   1 
ATOM   2133 C CD2   . PHE A 1 295 ? 8.922   0.621   12.773  1.00   30.16  ? 280 PHE A CD2   1 
ATOM   2134 C CE1   . PHE A 1 295 ? 10.378  -1.269  14.163  1.00   32.93  ? 280 PHE A CE1   1 
ATOM   2135 C CE2   . PHE A 1 295 ? 9.822   1.017   13.733  1.00   32.38  ? 280 PHE A CE2   1 
ATOM   2136 C CZ    . PHE A 1 295 ? 10.552  0.067   14.436  1.00   32.89  ? 280 PHE A CZ    1 
ATOM   2137 N N     . GLY A 1 296 ? 4.800   -0.291  12.188  1.00   34.98  ? 281 GLY A N     1 
ATOM   2138 C CA    . GLY A 1 296 ? 3.861   0.530   12.924  1.00   34.51  ? 281 GLY A CA    1 
ATOM   2139 C C     . GLY A 1 296 ? 3.056   -0.289  13.916  1.00   34.67  ? 281 GLY A C     1 
ATOM   2140 O O     . GLY A 1 296 ? 2.946   0.080   15.074  1.00   36.14  ? 281 GLY A O     1 
ATOM   2141 N N     . CYS A 1 297 ? 2.486   -1.399  13.460  1.00   32.94  ? 282 CYS A N     1 
ATOM   2142 C CA    . CYS A 1 297 ? 1.699   -2.256  14.331  1.00   32.81  ? 282 CYS A CA    1 
ATOM   2143 C C     . CYS A 1 297 ? 2.567   -2.929  15.386  1.00   33.52  ? 282 CYS A C     1 
ATOM   2144 O O     . CYS A 1 297 ? 2.148   -3.136  16.526  1.00   35.15  ? 282 CYS A O     1 
ATOM   2145 C CB    . CYS A 1 297 ? 0.976   -3.317  13.509  1.00   31.79  ? 282 CYS A CB    1 
ATOM   2146 S SG    . CYS A 1 297 ? -0.369  -2.656  12.540  1.00   36.55  ? 282 CYS A SG    1 
ATOM   2147 N N     . GLN A 1 298 ? 3.777   -3.293  14.999  1.00   33.42  ? 283 GLN A N     1 
ATOM   2148 C CA    . GLN A 1 298 ? 4.664   -3.972  15.917  1.00   30.48  ? 283 GLN A CA    1 
ATOM   2149 C C     . GLN A 1 298 ? 4.942   -3.088  17.130  1.00   34.38  ? 283 GLN A C     1 
ATOM   2150 O O     . GLN A 1 298 ? 4.911   -3.560  18.274  1.00   33.44  ? 283 GLN A O     1 
ATOM   2151 C CB    . GLN A 1 298 ? 5.986   -4.339  15.229  1.00   31.68  ? 283 GLN A CB    1 
ATOM   2152 C CG    . GLN A 1 298 ? 6.973   -4.989  16.185  1.00   32.44  ? 283 GLN A CG    1 
ATOM   2153 C CD    . GLN A 1 298 ? 8.363   -5.087  15.606  1.00   40.79  ? 283 GLN A CD    1 
ATOM   2154 O OE1   . GLN A 1 298 ? 8.544   -5.164  14.386  1.00   34.55  ? 283 GLN A OE1   1 
ATOM   2155 N NE2   . GLN A 1 298 ? 9.362   -5.078  16.481  1.00   33.02  ? 283 GLN A NE2   1 
ATOM   2156 N N     . VAL A 1 299 ? 5.240   -1.814  16.876  1.00   34.39  ? 284 VAL A N     1 
ATOM   2157 C CA    . VAL A 1 299 ? 5.603   -0.874  17.950  1.00   36.21  ? 284 VAL A CA    1 
ATOM   2158 C C     . VAL A 1 299 ? 4.384   -0.408  18.757  1.00   30.45  ? 284 VAL A C     1 
ATOM   2159 O O     . VAL A 1 299 ? 4.443   -0.301  19.975  1.00   33.38  ? 284 VAL A O     1 
ATOM   2160 C CB    . VAL A 1 299 ? 6.391   0.364   17.413  1.00   38.02  ? 284 VAL A CB    1 
ATOM   2161 C CG1   . VAL A 1 299 ? 6.854   1.269   18.584  1.00   32.82  ? 284 VAL A CG1   1 
ATOM   2162 C CG2   . VAL A 1 299 ? 7.593   -0.085  16.572  1.00   32.43  ? 284 VAL A CG2   1 
ATOM   2163 N N     . ALA A 1 300 ? 3.284   -0.149  18.066  1.00   33.66  ? 285 ALA A N     1 
ATOM   2164 C CA    . ALA A 1 300 ? 2.040   0.249   18.711  1.00   32.70  ? 285 ALA A CA    1 
ATOM   2165 C C     . ALA A 1 300 ? 1.486   -0.887  19.590  1.00   37.42  ? 285 ALA A C     1 
ATOM   2166 O O     . ALA A 1 300 ? 1.047   -0.655  20.722  1.00   36.80  ? 285 ALA A O     1 
ATOM   2167 C CB    . ALA A 1 300 ? 1.025   0.683   17.664  1.00   29.73  ? 285 ALA A CB    1 
ATOM   2168 N N     . GLY A 1 301 ? 1.530   -2.117  19.082  1.00   33.72  ? 286 GLY A N     1 
ATOM   2169 C CA    . GLY A 1 301 ? 1.093   -3.266  19.858  1.00   33.36  ? 286 GLY A CA    1 
ATOM   2170 C C     . GLY A 1 301 ? 1.928   -3.413  21.110  1.00   35.92  ? 286 GLY A C     1 
ATOM   2171 O O     . GLY A 1 301 ? 1.410   -3.590  22.217  1.00   32.70  ? 286 GLY A O     1 
ATOM   2172 N N     . LYS A 1 302 ? 3.241   -3.320  20.943  1.00   33.32  ? 287 LYS A N     1 
ATOM   2173 C CA    . LYS A 1 302 ? 4.133   -3.340  22.095  1.00   37.16  ? 287 LYS A CA    1 
ATOM   2174 C C     . LYS A 1 302 ? 3.808   -2.251  23.147  1.00   34.65  ? 287 LYS A C     1 
ATOM   2175 O O     . LYS A 1 302 ? 3.817   -2.519  24.339  1.00   34.37  ? 287 LYS A O     1 
ATOM   2176 C CB    . LYS A 1 302 ? 5.593   -3.213  21.645  1.00   39.15  ? 287 LYS A CB    1 
ATOM   2177 C CG    . LYS A 1 302 ? 6.541   -2.956  22.790  1.00   41.09  ? 287 LYS A CG    1 
ATOM   2178 C CD    . LYS A 1 302 ? 7.602   -4.019  22.908  1.00   47.94  ? 287 LYS A CD    1 
ATOM   2179 C CE    . LYS A 1 302 ? 8.272   -3.943  24.284  1.00   51.65  ? 287 LYS A CE    1 
ATOM   2180 N NZ    . LYS A 1 302 ? 9.531   -4.723  24.342  1.00   56.86  ? 287 LYS A NZ    1 
ATOM   2181 N N     . LYS A 1 303 ? 3.540   -1.031  22.701  1.00   32.43  ? 288 LYS A N     1 
ATOM   2182 C CA    . LYS A 1 303 ? 3.194   0.051   23.612  1.00   35.61  ? 288 LYS A CA    1 
ATOM   2183 C C     . LYS A 1 303 ? 1.899   -0.246  24.393  1.00   38.16  ? 288 LYS A C     1 
ATOM   2184 O O     . LYS A 1 303 ? 1.760   0.165   25.535  1.00   33.87  ? 288 LYS A O     1 
ATOM   2185 C CB    . LYS A 1 303 ? 3.070   1.372   22.843  1.00   34.14  ? 288 LYS A CB    1 
ATOM   2186 C CG    . LYS A 1 303 ? 2.778   2.584   23.735  1.00   37.99  ? 288 LYS A CG    1 
ATOM   2187 C CD    . LYS A 1 303 ? 1.258   2.822   23.910  1.00   41.67  ? 288 LYS A CD    1 
ATOM   2188 C CE    . LYS A 1 303 ? 0.951   3.675   25.160  1.00   42.15  ? 288 LYS A CE    1 
ATOM   2189 N NZ    . LYS A 1 303 ? 1.238   2.955   26.451  1.00   36.81  ? 288 LYS A NZ    1 
ATOM   2190 N N     . CYS A 1 304 ? 0.963   -0.960  23.762  1.00   35.84  ? 289 CYS A N     1 
ATOM   2191 C CA    . CYS A 1 304 ? -0.316  -1.285  24.373  1.00   36.18  ? 289 CYS A CA    1 
ATOM   2192 C C     . CYS A 1 304 ? -0.124  -2.215  25.562  1.00   39.12  ? 289 CYS A C     1 
ATOM   2193 O O     . CYS A 1 304 ? -1.024  -2.390  26.396  1.00   32.64  ? 289 CYS A O     1 
ATOM   2194 C CB    . CYS A 1 304 ? -1.243  -1.939  23.349  1.00   32.13  ? 289 CYS A CB    1 
ATOM   2195 S SG    . CYS A 1 304 ? -1.873  -0.783  22.135  1.00   37.29  ? 289 CYS A SG    1 
ATOM   2196 N N     . GLY A 1 305 ? 1.053   -2.820  25.634  1.00   34.68  ? 290 GLY A N     1 
ATOM   2197 C CA    . GLY A 1 305 ? 1.349   -3.712  26.737  1.00   35.11  ? 290 GLY A CA    1 
ATOM   2198 C C     . GLY A 1 305 ? 2.040   -3.004  27.880  1.00   34.25  ? 290 GLY A C     1 
ATOM   2199 O O     . GLY A 1 305 ? 2.389   -3.628  28.867  1.00   37.29  ? 290 GLY A O     1 
ATOM   2200 N N     . LEU A 1 306 ? 2.234   -1.695  27.755  1.00   36.13  ? 291 LEU A N     1 
ATOM   2201 C CA    . LEU A 1 306 ? 3.009   -0.937  28.746  1.00   38.58  ? 291 LEU A CA    1 
ATOM   2202 C C     . LEU A 1 306 ? 2.278   0.331   29.165  1.00   38.83  ? 291 LEU A C     1 
ATOM   2203 O O     . LEU A 1 306 ? 1.557   0.922   28.356  1.00   39.33  ? 291 LEU A O     1 
ATOM   2204 C CB    . LEU A 1 306 ? 4.352   -0.512  28.137  1.00   37.86  ? 291 LEU A CB    1 
ATOM   2205 C CG    . LEU A 1 306 ? 5.332   -1.593  27.695  1.00   46.76  ? 291 LEU A CG    1 
ATOM   2206 C CD1   . LEU A 1 306 ? 6.466   -0.967  26.875  1.00   41.28  ? 291 LEU A CD1   1 
ATOM   2207 C CD2   . LEU A 1 306 ? 5.878   -2.352  28.918  1.00   40.75  ? 291 LEU A CD2   1 
ATOM   2208 N N     . GLN A 1 307 ? 2.488   0.773   30.403  1.00   35.60  ? 292 GLN A N     1 
ATOM   2209 C CA    . GLN A 1 307 ? 2.019   2.094   30.815  1.00   39.36  ? 292 GLN A CA    1 
ATOM   2210 C C     . GLN A 1 307 ? 3.008   3.115   30.279  1.00   40.43  ? 292 GLN A C     1 
ATOM   2211 O O     . GLN A 1 307 ? 4.189   3.056   30.603  1.00   45.02  ? 292 GLN A O     1 
ATOM   2212 C CB    . GLN A 1 307 ? 1.925   2.211   32.349  1.00   33.08  ? 292 GLN A CB    1 
ATOM   2213 C CG    . GLN A 1 307 ? 0.904   1.281   33.010  1.00   33.12  ? 292 GLN A CG    1 
ATOM   2214 C CD    . GLN A 1 307 ? -0.502  1.525   32.501  1.00   40.73  ? 292 GLN A CD    1 
ATOM   2215 O OE1   . GLN A 1 307 ? -0.864  2.660   32.198  1.00   41.91  ? 292 GLN A OE1   1 
ATOM   2216 N NE2   . GLN A 1 307 ? -1.301  0.459   32.390  1.00   36.33  ? 292 GLN A NE2   1 
ATOM   2217 N N     . GLY A 1 308 ? 2.540   4.050   29.461  1.00   41.88  ? 293 GLY A N     1 
ATOM   2218 C CA    . GLY A 1 308 ? 3.428   5.059   28.899  1.00   45.21  ? 293 GLY A CA    1 
ATOM   2219 C C     . GLY A 1 308 ? 4.270   4.585   27.715  1.00   47.36  ? 293 GLY A C     1 
ATOM   2220 O O     . GLY A 1 308 ? 3.900   3.649   27.013  1.00   45.83  ? 293 GLY A O     1 
ATOM   2221 N N     . PHE A 1 309 ? 5.417   5.219   27.497  1.00   47.82  ? 294 PHE A N     1 
ATOM   2222 C CA    . PHE A 1 309 ? 6.194   4.971   26.283  1.00   49.11  ? 294 PHE A CA    1 
ATOM   2223 C C     . PHE A 1 309 ? 7.547   4.316   26.539  1.00   51.02  ? 294 PHE A C     1 
ATOM   2224 O O     . PHE A 1 309 ? 8.077   3.631   25.672  1.00   52.83  ? 294 PHE A O     1 
ATOM   2225 C CB    . PHE A 1 309 ? 6.373   6.266   25.496  1.00   46.64  ? 294 PHE A CB    1 
ATOM   2226 C CG    . PHE A 1 309 ? 5.079   6.889   25.057  1.00   42.57  ? 294 PHE A CG    1 
ATOM   2227 C CD1   . PHE A 1 309 ? 4.480   6.506   23.869  1.00   42.49  ? 294 PHE A CD1   1 
ATOM   2228 C CD2   . PHE A 1 309 ? 4.448   7.841   25.843  1.00   44.91  ? 294 PHE A CD2   1 
ATOM   2229 C CE1   . PHE A 1 309 ? 3.285   7.067   23.459  1.00   41.92  ? 294 PHE A CE1   1 
ATOM   2230 C CE2   . PHE A 1 309 ? 3.243   8.422   25.438  1.00   42.78  ? 294 PHE A CE2   1 
ATOM   2231 C CZ    . PHE A 1 309 ? 2.660   8.031   24.249  1.00   46.46  ? 294 PHE A CZ    1 
ATOM   2232 N N     . ASP A 1 310 ? 8.096   4.506   27.728  1.00   50.07  ? 295 ASP A N     1 
ATOM   2233 C CA    . ASP A 1 310 ? 9.340   3.839   28.086  1.00   57.37  ? 295 ASP A CA    1 
ATOM   2234 C C     . ASP A 1 310 ? 9.287   2.338   27.834  1.00   57.36  ? 295 ASP A C     1 
ATOM   2235 O O     . ASP A 1 310 ? 8.378   1.648   28.298  1.00   56.72  ? 295 ASP A O     1 
ATOM   2236 C CB    . ASP A 1 310 ? 9.671   4.079   29.559  1.00   56.02  ? 295 ASP A CB    1 
ATOM   2237 C CG    . ASP A 1 310 ? 9.918   5.532   29.863  1.00   64.90  ? 295 ASP A CG    1 
ATOM   2238 O OD1   . ASP A 1 310 ? 10.274  6.278   28.922  1.00   65.44  ? 295 ASP A OD1   1 
ATOM   2239 O OD2   . ASP A 1 310 ? 9.757   5.926   31.039  1.00   73.18  ? 295 ASP A OD2   1 
ATOM   2240 N N     . GLY A 1 311 ? 10.272  1.820   27.117  1.00   54.59  ? 296 GLY A N     1 
ATOM   2241 C CA    . GLY A 1 311 ? 10.383  0.380   27.011  1.00   58.26  ? 296 GLY A CA    1 
ATOM   2242 C C     . GLY A 1 311 ? 9.738   -0.246  25.793  1.00   53.67  ? 296 GLY A C     1 
ATOM   2243 O O     . GLY A 1 311 ? 9.687   -1.466  25.692  1.00   52.61  ? 296 GLY A O     1 
ATOM   2244 N N     . ILE A 1 312 ? 9.233   0.577   24.879  1.00   51.84  ? 297 ILE A N     1 
ATOM   2245 C CA    . ILE A 1 312 ? 8.829   0.080   23.574  1.00   56.22  ? 297 ILE A CA    1 
ATOM   2246 C C     . ILE A 1 312 ? 10.101  -0.167  22.768  1.00   62.15  ? 297 ILE A C     1 
ATOM   2247 O O     . ILE A 1 312 ? 10.061  -0.628  21.630  1.00   61.33  ? 297 ILE A O     1 
ATOM   2248 C CB    . ILE A 1 312 ? 7.933   1.077   22.818  1.00   51.65  ? 297 ILE A CB    1 
ATOM   2249 C CG1   . ILE A 1 312 ? 8.759   2.226   22.247  1.00   59.64  ? 297 ILE A CG1   1 
ATOM   2250 C CG2   . ILE A 1 312 ? 6.835   1.622   23.718  1.00   54.08  ? 297 ILE A CG2   1 
ATOM   2251 C CD1   . ILE A 1 312 ? 7.899   3.281   21.571  1.00   53.60  ? 297 ILE A CD1   1 
ATOM   2252 N N     . VAL A 1 313 ? 11.237  0.145   23.381  1.00   65.79  ? 298 VAL A N     1 
ATOM   2253 C CA    . VAL A 1 313 ? 12.533  -0.021  22.736  1.00   69.39  ? 298 VAL A CA    1 
ATOM   2254 C C     . VAL A 1 313 ? 13.559  -0.623  23.693  1.00   74.72  ? 298 VAL A C     1 
ATOM   2255 O O     . VAL A 1 313 ? 14.311  -1.523  23.301  1.00   80.59  ? 298 VAL A O     1 
ATOM   2256 C CB    . VAL A 1 313 ? 13.067  1.323   22.215  1.00   71.79  ? 298 VAL A CB    1 
ATOM   2257 C CG1   . VAL A 1 313 ? 12.210  1.807   21.030  1.00   60.15  ? 298 VAL A CG1   1 
ATOM   2258 C CG2   . VAL A 1 313 ? 13.125  2.361   23.368  1.00   63.05  ? 298 VAL A CG2   1 
ATOM   2259 O OXT   . VAL A 1 313 ? 13.656  -0.229  24.866  1.00   72.57  ? 298 VAL A OXT   1 
ATOM   2260 N N     . GLY B 1 13  B 10.422  31.919  59.263  1.00   44.60  ? -2  GLY B N     1 
ATOM   2261 C CA    . GLY B 1 13  B 10.290  33.096  60.108  1.00   37.26  ? -2  GLY B CA    1 
ATOM   2262 C C     . GLY B 1 13  B 9.939   32.719  61.543  1.00   37.31  ? -2  GLY B C     1 
ATOM   2263 O O     . GLY B 1 13  B 9.572   31.586  61.821  1.00   38.14  ? -2  GLY B O     1 
ATOM   2264 N N     . LEU B 1 14  A 10.070  33.683  62.447  1.00   41.00  ? -1  LEU B N     1 
ATOM   2265 C CA    . LEU B 1 14  A 9.704   33.528  63.851  1.00   42.46  ? -1  LEU B CA    1 
ATOM   2266 C C     . LEU B 1 14  A 8.179   33.464  64.036  1.00   45.75  ? -1  LEU B C     1 
ATOM   2267 O O     . LEU B 1 14  A 7.446   34.344  63.559  1.00   42.08  ? -1  LEU B O     1 
ATOM   2268 C CB    . LEU B 1 14  A 10.307  34.675  64.676  1.00   36.64  ? -1  LEU B CB    1 
ATOM   2269 C CG    . LEU B 1 14  A 10.077  34.657  66.194  1.00   45.77  ? -1  LEU B CG    1 
ATOM   2270 C CD1   . LEU B 1 14  A 11.139  35.446  66.937  1.00   38.84  ? -1  LEU B CD1   1 
ATOM   2271 C CD2   . LEU B 1 14  A 8.689   35.179  66.547  1.00   43.80  ? -1  LEU B CD2   1 
ATOM   2272 N N     . VAL B 1 15  ? 7.713   32.412  64.711  1.00   39.34  ? 0   VAL B N     1 
ATOM   2273 C CA    . VAL B 1 15  ? 6.305   32.248  65.020  1.00   33.91  ? 0   VAL B CA    1 
ATOM   2274 C C     . VAL B 1 15  ? 6.112   32.431  66.515  1.00   38.40  ? 0   VAL B C     1 
ATOM   2275 O O     . VAL B 1 15  ? 6.649   31.658  67.303  1.00   41.84  ? 0   VAL B O     1 
ATOM   2276 C CB    . VAL B 1 15  ? 5.820   30.831  64.657  1.00   37.85  ? 0   VAL B CB    1 
ATOM   2277 C CG1   . VAL B 1 15  ? 4.338   30.683  64.982  1.00   35.77  ? 0   VAL B CG1   1 
ATOM   2278 C CG2   . VAL B 1 15  ? 6.077   30.522  63.188  1.00   35.68  ? 0   VAL B CG2   1 
ATOM   2279 N N     . PRO B 1 16  ? 5.329   33.433  66.929  1.00   34.75  ? 1   PRO B N     1 
ATOM   2280 C CA    . PRO B 1 16  ? 5.201   33.619  68.374  1.00   37.29  ? 1   PRO B CA    1 
ATOM   2281 C C     . PRO B 1 16  ? 4.613   32.400  69.078  1.00   37.78  ? 1   PRO B C     1 
ATOM   2282 O O     . PRO B 1 16  ? 3.743   31.710  68.538  1.00   37.94  ? 1   PRO B O     1 
ATOM   2283 C CB    . PRO B 1 16  ? 4.248   34.804  68.478  1.00   36.27  ? 1   PRO B CB    1 
ATOM   2284 C CG    . PRO B 1 16  ? 4.501   35.564  67.245  1.00   38.56  ? 1   PRO B CG    1 
ATOM   2285 C CD    . PRO B 1 16  ? 4.662   34.509  66.189  1.00   34.99  ? 1   PRO B CD    1 
ATOM   2286 N N     . ARG B 1 17  ? 5.104   32.145  70.283  1.00   37.15  ? 2   ARG B N     1 
ATOM   2287 C CA    . ARG B 1 17  ? 4.606   31.069  71.130  1.00   37.54  ? 2   ARG B CA    1 
ATOM   2288 C C     . ARG B 1 17  ? 3.076   31.118  71.249  1.00   34.83  ? 2   ARG B C     1 
ATOM   2289 O O     . ARG B 1 17  ? 2.510   32.180  71.472  1.00   32.85  ? 2   ARG B O     1 
ATOM   2290 C CB    . ARG B 1 17  ? 5.227   31.202  72.530  1.00   36.39  ? 2   ARG B CB    1 
ATOM   2291 C CG    . ARG B 1 17  ? 4.917   30.045  73.487  1.00   40.84  ? 2   ARG B CG    1 
ATOM   2292 C CD    . ARG B 1 17  ? 5.482   30.247  74.900  1.00   40.28  ? 2   ARG B CD    1 
ATOM   2293 N NE    . ARG B 1 17  ? 5.055   31.501  75.527  1.00   55.79  ? 2   ARG B NE    1 
ATOM   2294 C CZ    . ARG B 1 17  ? 5.352   31.864  76.784  1.00   67.83  ? 2   ARG B CZ    1 
ATOM   2295 N NH1   . ARG B 1 17  ? 6.074   31.069  77.578  1.00   56.29  ? 2   ARG B NH1   1 
ATOM   2296 N NH2   . ARG B 1 17  ? 4.924   33.029  77.261  1.00   65.89  ? 2   ARG B NH2   1 
ATOM   2297 N N     . GLY B 1 18  ? 2.423   29.968  71.111  1.00   33.33  ? 3   GLY B N     1 
ATOM   2298 C CA    . GLY B 1 18  ? 0.991   29.851  71.356  1.00   33.41  ? 3   GLY B CA    1 
ATOM   2299 C C     . GLY B 1 18  ? 0.106   30.712  70.468  1.00   37.86  ? 3   GLY B C     1 
ATOM   2300 O O     . GLY B 1 18  ? -0.918  31.217  70.924  1.00   38.82  ? 3   GLY B O     1 
ATOM   2301 N N     . SER B 1 19  ? 0.485   30.868  69.197  1.00   34.62  ? 4   SER B N     1 
ATOM   2302 C CA    . SER B 1 19  ? -0.215  31.798  68.317  1.00   34.21  ? 4   SER B CA    1 
ATOM   2303 C C     . SER B 1 19  ? -0.996  31.115  67.201  1.00   31.64  ? 4   SER B C     1 
ATOM   2304 O O     . SER B 1 19  ? -1.941  31.690  66.683  1.00   34.49  ? 4   SER B O     1 
ATOM   2305 C CB    . SER B 1 19  ? 0.758   32.815  67.707  1.00   32.67  ? 4   SER B CB    1 
ATOM   2306 O OG    . SER B 1 19  ? 1.599   32.188  66.760  1.00   31.15  ? 4   SER B OG    1 
ATOM   2307 N N     . GLN B 1 20  ? -0.600  29.901  66.828  1.00   31.63  ? 5   GLN B N     1 
ATOM   2308 C CA    . GLN B 1 20  ? -1.146  29.262  65.631  1.00   32.05  ? 5   GLN B CA    1 
ATOM   2309 C C     . GLN B 1 20  ? -2.144  28.148  65.915  1.00   31.08  ? 5   GLN B C     1 
ATOM   2310 O O     . GLN B 1 20  ? -2.089  27.487  66.939  1.00   34.21  ? 5   GLN B O     1 
ATOM   2311 C CB    . GLN B 1 20  ? -0.031  28.659  64.764  1.00   28.95  ? 5   GLN B CB    1 
ATOM   2312 C CG    . GLN B 1 20  ? 0.711   29.661  63.929  1.00   33.83  ? 5   GLN B CG    1 
ATOM   2313 C CD    . GLN B 1 20  ? 1.770   29.031  63.018  1.00   35.97  ? 5   GLN B CD    1 
ATOM   2314 O OE1   . GLN B 1 20  ? 2.045   29.550  61.935  1.00   36.78  ? 5   GLN B OE1   1 
ATOM   2315 N NE2   . GLN B 1 20  ? 2.362   27.930  63.454  1.00   29.88  ? 5   GLN B NE2   1 
ATOM   2316 N N     . ILE B 1 21  ? -3.016  27.916  64.952  1.00   28.98  ? 6   ILE B N     1 
ATOM   2317 C CA    . ILE B 1 21  ? -3.896  26.768  64.970  1.00   30.03  ? 6   ILE B CA    1 
ATOM   2318 C C     . ILE B 1 21  ? -3.414  25.793  63.913  1.00   28.71  ? 6   ILE B C     1 
ATOM   2319 O O     . ILE B 1 21  ? -3.279  26.141  62.739  1.00   32.19  ? 6   ILE B O     1 
ATOM   2320 C CB    . ILE B 1 21  ? -5.359  27.178  64.676  1.00   29.07  ? 6   ILE B CB    1 
ATOM   2321 C CG1   . ILE B 1 21  ? -5.887  28.087  65.790  1.00   31.50  ? 6   ILE B CG1   1 
ATOM   2322 C CG2   . ILE B 1 21  ? -6.229  25.953  64.554  1.00   29.64  ? 6   ILE B CG2   1 
ATOM   2323 C CD1   . ILE B 1 21  ? -7.182  28.823  65.426  1.00   30.14  ? 6   ILE B CD1   1 
ATOM   2324 N N     . LEU B 1 22  ? -3.165  24.564  64.330  1.00   30.65  ? 7   LEU B N     1 
ATOM   2325 C CA    . LEU B 1 22  ? -2.644  23.536  63.441  1.00   29.73  ? 7   LEU B CA    1 
ATOM   2326 C C     . LEU B 1 22  ? -3.751  22.581  62.999  1.00   29.25  ? 7   LEU B C     1 
ATOM   2327 O O     . LEU B 1 22  ? -4.506  22.069  63.827  1.00   29.43  ? 7   LEU B O     1 
ATOM   2328 C CB    . LEU B 1 22  ? -1.542  22.745  64.168  1.00   27.97  ? 7   LEU B CB    1 
ATOM   2329 C CG    . LEU B 1 22  ? -0.922  21.554  63.426  1.00   33.24  ? 7   LEU B CG    1 
ATOM   2330 C CD1   . LEU B 1 22  ? -0.276  22.027  62.116  1.00   31.67  ? 7   LEU B CD1   1 
ATOM   2331 C CD2   . LEU B 1 22  ? 0.097   20.775  64.310  1.00   25.91  ? 7   LEU B CD2   1 
ATOM   2332 N N     . CYS B 1 23  ? -3.822  22.306  61.700  1.00   29.07  ? 8   CYS B N     1 
ATOM   2333 C CA    . CYS B 1 23  ? -4.722  21.289  61.206  1.00   29.43  ? 8   CYS B CA    1 
ATOM   2334 C C     . CYS B 1 23  ? -3.923  20.169  60.569  1.00   33.41  ? 8   CYS B C     1 
ATOM   2335 O O     . CYS B 1 23  ? -3.139  20.397  59.651  1.00   32.65  ? 8   CYS B O     1 
ATOM   2336 C CB    . CYS B 1 23  ? -5.746  21.863  60.210  1.00   34.26  ? 8   CYS B CB    1 
ATOM   2337 S SG    . CYS B 1 23  ? -6.790  23.185  60.859  1.00   36.97  ? 8   CYS B SG    1 
ATOM   2338 N N     . VAL B 1 24  ? -4.141  18.956  61.069  1.00   32.30  ? 9   VAL B N     1 
ATOM   2339 C CA    . VAL B 1 24  ? -3.456  17.768  60.600  1.00   31.55  ? 9   VAL B CA    1 
ATOM   2340 C C     . VAL B 1 24  ? -4.429  16.942  59.803  1.00   31.50  ? 9   VAL B C     1 
ATOM   2341 O O     . VAL B 1 24  ? -5.480  16.565  60.314  1.00   30.89  ? 9   VAL B O     1 
ATOM   2342 C CB    . VAL B 1 24  ? -2.963  16.915  61.798  1.00   30.60  ? 9   VAL B CB    1 
ATOM   2343 C CG1   . VAL B 1 24  ? -2.200  15.693  61.311  1.00   31.91  ? 9   VAL B CG1   1 
ATOM   2344 C CG2   . VAL B 1 24  ? -2.119  17.762  62.725  1.00   30.07  ? 9   VAL B CG2   1 
ATOM   2345 N N     . GLY B 1 25  ? -4.085  16.647  58.557  1.00   34.10  ? 10  GLY B N     1 
ATOM   2346 C CA    . GLY B 1 25  ? -4.936  15.829  57.719  1.00   30.69  ? 10  GLY B CA    1 
ATOM   2347 C C     . GLY B 1 25  ? -4.490  15.716  56.273  1.00   36.13  ? 10  GLY B C     1 
ATOM   2348 O O     . GLY B 1 25  ? -3.314  15.832  55.959  1.00   38.80  ? 10  GLY B O     1 
ATOM   2349 N N     . LEU B 1 26  ? -5.457  15.475  55.398  1.00   37.16  ? 11  LEU B N     1 
ATOM   2350 C CA    . LEU B 1 26  ? -5.239  15.262  53.981  1.00   39.52  ? 11  LEU B CA    1 
ATOM   2351 C C     . LEU B 1 26  ? -5.202  16.572  53.188  1.00   38.74  ? 11  LEU B C     1 
ATOM   2352 O O     . LEU B 1 26  ? -5.983  17.502  53.446  1.00   35.27  ? 11  LEU B O     1 
ATOM   2353 C CB    . LEU B 1 26  ? -6.373  14.381  53.429  1.00   41.38  ? 11  LEU B CB    1 
ATOM   2354 C CG    . LEU B 1 26  ? -6.340  14.013  51.936  1.00   44.59  ? 11  LEU B CG    1 
ATOM   2355 C CD1   . LEU B 1 26  ? -5.242  12.998  51.659  1.00   41.29  ? 11  LEU B CD1   1 
ATOM   2356 C CD2   . LEU B 1 26  ? -7.677  13.457  51.443  1.00   46.05  ? 11  LEU B CD2   1 
ATOM   2357 N N     . VAL B 1 27  ? -4.293  16.639  52.221  1.00   32.59  ? 12  VAL B N     1 
ATOM   2358 C CA    . VAL B 1 27  ? -4.379  17.637  51.171  1.00   31.08  ? 12  VAL B CA    1 
ATOM   2359 C C     . VAL B 1 27  ? -4.340  16.874  49.847  1.00   37.97  ? 12  VAL B C     1 
ATOM   2360 O O     . VAL B 1 27  ? -3.595  15.906  49.699  1.00   37.43  ? 12  VAL B O     1 
ATOM   2361 C CB    . VAL B 1 27  ? -3.252  18.694  51.264  1.00   38.89  ? 12  VAL B CB    1 
ATOM   2362 C CG1   . VAL B 1 27  ? -1.863  18.069  51.051  1.00   31.67  ? 12  VAL B CG1   1 
ATOM   2363 C CG2   . VAL B 1 27  ? -3.504  19.817  50.271  1.00   35.71  ? 12  VAL B CG2   1 
ATOM   2364 N N     . VAL B 1 28  ? -5.189  17.271  48.909  1.00   36.07  ? 13  VAL B N     1 
ATOM   2365 C CA    . VAL B 1 28  ? -5.317  16.561  47.645  1.00   35.78  ? 13  VAL B CA    1 
ATOM   2366 C C     . VAL B 1 28  ? -5.512  17.577  46.532  1.00   37.59  ? 13  VAL B C     1 
ATOM   2367 O O     . VAL B 1 28  ? -6.091  18.644  46.758  1.00   36.82  ? 13  VAL B O     1 
ATOM   2368 C CB    . VAL B 1 28  ? -6.494  15.514  47.657  1.00   39.50  ? 13  VAL B CB    1 
ATOM   2369 C CG1   . VAL B 1 28  ? -7.816  16.149  48.073  1.00   35.25  ? 13  VAL B CG1   1 
ATOM   2370 C CG2   . VAL B 1 28  ? -6.653  14.852  46.295  1.00   37.25  ? 13  VAL B CG2   1 
ATOM   2371 N N     . LEU B 1 29  ? -4.996  17.266  45.344  1.00   36.63  ? 14  LEU B N     1 
ATOM   2372 C CA    . LEU B 1 29  ? -5.291  18.066  44.162  1.00   37.43  ? 14  LEU B CA    1 
ATOM   2373 C C     . LEU B 1 29  ? -6.541  17.504  43.498  1.00   38.40  ? 14  LEU B C     1 
ATOM   2374 O O     . LEU B 1 29  ? -6.558  16.361  43.067  1.00   39.94  ? 14  LEU B O     1 
ATOM   2375 C CB    . LEU B 1 29  ? -4.100  18.093  43.186  1.00   32.74  ? 14  LEU B CB    1 
ATOM   2376 C CG    . LEU B 1 29  ? -4.304  18.595  41.747  1.00   42.91  ? 14  LEU B CG    1 
ATOM   2377 C CD1   . LEU B 1 29  ? -4.967  19.957  41.690  1.00   43.88  ? 14  LEU B CD1   1 
ATOM   2378 C CD2   . LEU B 1 29  ? -2.996  18.642  40.954  1.00   46.39  ? 14  LEU B CD2   1 
ATOM   2379 N N     . ASP B 1 30  ? -7.593  18.309  43.427  1.00   38.68  ? 15  ASP B N     1 
ATOM   2380 C CA    . ASP B 1 30  ? -8.820  17.895  42.744  1.00   40.77  ? 15  ASP B CA    1 
ATOM   2381 C C     . ASP B 1 30  ? -8.879  18.507  41.358  1.00   41.02  ? 15  ASP B C     1 
ATOM   2382 O O     . ASP B 1 30  ? -8.784  19.726  41.209  1.00   39.48  ? 15  ASP B O     1 
ATOM   2383 C CB    . ASP B 1 30  ? -10.068 18.304  43.531  1.00   38.49  ? 15  ASP B CB    1 
ATOM   2384 C CG    . ASP B 1 30  ? -10.211 17.554  44.838  1.00   41.93  ? 15  ASP B CG    1 
ATOM   2385 O OD1   . ASP B 1 30  ? -9.950  16.332  44.861  1.00   43.44  ? 15  ASP B OD1   1 
ATOM   2386 O OD2   . ASP B 1 30  ? -10.593 18.189  45.848  1.00   46.19  ? 15  ASP B OD2   1 
ATOM   2387 N N     . VAL B 1 31  ? -9.008  17.658  40.344  1.00   40.35  ? 16  VAL B N     1 
ATOM   2388 C CA    . VAL B 1 31  ? -9.188  18.135  38.989  1.00   41.07  ? 16  VAL B CA    1 
ATOM   2389 C C     . VAL B 1 31  ? -10.662 17.960  38.675  1.00   43.20  ? 16  VAL B C     1 
ATOM   2390 O O     . VAL B 1 31  ? -11.206 16.872  38.802  1.00   43.33  ? 16  VAL B O     1 
ATOM   2391 C CB    . VAL B 1 31  ? -8.315  17.380  37.971  1.00   46.68  ? 16  VAL B CB    1 
ATOM   2392 C CG1   . VAL B 1 31  ? -8.442  18.023  36.599  1.00   45.70  ? 16  VAL B CG1   1 
ATOM   2393 C CG2   . VAL B 1 31  ? -6.864  17.388  38.401  1.00   41.51  ? 16  VAL B CG2   1 
ATOM   2394 N N     . ILE B 1 32  ? -11.315 19.056  38.314  1.00   45.12  ? 17  ILE B N     1 
ATOM   2395 C CA    . ILE B 1 32  ? -12.758 19.057  38.157  1.00   43.99  ? 17  ILE B CA    1 
ATOM   2396 C C     . ILE B 1 32  ? -13.142 19.467  36.751  1.00   44.30  ? 17  ILE B C     1 
ATOM   2397 O O     . ILE B 1 32  ? -12.795 20.556  36.295  1.00   47.72  ? 17  ILE B O     1 
ATOM   2398 C CB    . ILE B 1 32  ? -13.428 19.982  39.184  1.00   47.69  ? 17  ILE B CB    1 
ATOM   2399 C CG1   . ILE B 1 32  ? -13.044 19.539  40.598  1.00   46.42  ? 17  ILE B CG1   1 
ATOM   2400 C CG2   . ILE B 1 32  ? -14.950 19.967  39.008  1.00   43.89  ? 17  ILE B CG2   1 
ATOM   2401 C CD1   . ILE B 1 32  ? -13.456 20.490  41.657  1.00   51.73  ? 17  ILE B CD1   1 
ATOM   2402 N N     . SER B 1 33  ? -13.859 18.576  36.076  1.00   43.57  ? 18  SER B N     1 
ATOM   2403 C CA    . SER B 1 33  ? -14.273 18.776  34.694  1.00   47.35  ? 18  SER B CA    1 
ATOM   2404 C C     . SER B 1 33  ? -15.792 18.810  34.578  1.00   51.53  ? 18  SER B C     1 
ATOM   2405 O O     . SER B 1 33  ? -16.493 17.907  35.049  1.00   47.35  ? 18  SER B O     1 
ATOM   2406 C CB    . SER B 1 33  ? -13.748 17.640  33.816  1.00   47.01  ? 18  SER B CB    1 
ATOM   2407 O OG    . SER B 1 33  ? -12.341 17.670  33.720  1.00   51.20  ? 18  SER B OG    1 
ATOM   2408 N N     . LEU B 1 34  ? -16.301 19.845  33.928  1.00   54.29  ? 19  LEU B N     1 
ATOM   2409 C CA    . LEU B 1 34  ? -17.729 19.931  33.672  1.00   55.43  ? 19  LEU B CA    1 
ATOM   2410 C C     . LEU B 1 34  ? -17.990 19.480  32.237  1.00   51.18  ? 19  LEU B C     1 
ATOM   2411 O O     . LEU B 1 34  ? -17.327 19.945  31.306  1.00   51.15  ? 19  LEU B O     1 
ATOM   2412 C CB    . LEU B 1 34  ? -18.207 21.364  33.896  1.00   54.49  ? 19  LEU B CB    1 
ATOM   2413 C CG    . LEU B 1 34  ? -19.704 21.599  33.722  1.00   60.62  ? 19  LEU B CG    1 
ATOM   2414 C CD1   . LEU B 1 34  ? -20.467 20.892  34.828  1.00   58.84  ? 19  LEU B CD1   1 
ATOM   2415 C CD2   . LEU B 1 34  ? -20.000 23.092  33.710  1.00   60.03  ? 19  LEU B CD2   1 
ATOM   2416 N N     . VAL B 1 35  ? -18.939 18.568  32.054  1.00   51.51  ? 20  VAL B N     1 
ATOM   2417 C CA    . VAL B 1 35  ? -19.192 18.014  30.717  1.00   58.28  ? 20  VAL B CA    1 
ATOM   2418 C C     . VAL B 1 35  ? -20.678 18.003  30.343  1.00   60.75  ? 20  VAL B C     1 
ATOM   2419 O O     . VAL B 1 35  ? -21.541 17.986  31.218  1.00   59.46  ? 20  VAL B O     1 
ATOM   2420 C CB    . VAL B 1 35  ? -18.618 16.574  30.568  1.00   54.14  ? 20  VAL B CB    1 
ATOM   2421 C CG1   . VAL B 1 35  ? -17.103 16.582  30.662  1.00   52.69  ? 20  VAL B CG1   1 
ATOM   2422 C CG2   . VAL B 1 35  ? -19.210 15.647  31.622  1.00   55.28  ? 20  VAL B CG2   1 
ATOM   2423 N N     . ASP B 1 36  ? -20.963 18.016  29.040  1.00   63.12  ? 21  ASP B N     1 
ATOM   2424 C CA    . ASP B 1 36  ? -22.334 17.899  28.548  1.00   62.64  ? 21  ASP B CA    1 
ATOM   2425 C C     . ASP B 1 36  ? -22.928 16.592  29.026  1.00   64.40  ? 21  ASP B C     1 
ATOM   2426 O O     . ASP B 1 36  ? -24.018 16.554  29.590  1.00   68.99  ? 21  ASP B O     1 
ATOM   2427 C CB    . ASP B 1 36  ? -22.377 17.919  27.019  1.00   67.01  ? 21  ASP B CB    1 
ATOM   2428 C CG    . ASP B 1 36  ? -21.948 19.251  26.437  1.00   79.37  ? 21  ASP B CG    1 
ATOM   2429 O OD1   . ASP B 1 36  ? -21.991 20.260  27.175  1.00   83.43  ? 21  ASP B OD1   1 
ATOM   2430 O OD2   . ASP B 1 36  ? -21.574 19.296  25.240  1.00   82.54  ? 21  ASP B OD2   1 
ATOM   2431 N N     . LYS B 1 37  ? -22.202 15.509  28.793  1.00   61.84  ? 22  LYS B N     1 
ATOM   2432 C CA    . LYS B 1 37  ? -22.689 14.198  29.168  1.00   62.95  ? 22  LYS B CA    1 
ATOM   2433 C C     . LYS B 1 37  ? -21.546 13.308  29.619  1.00   59.01  ? 22  LYS B C     1 
ATOM   2434 O O     . LYS B 1 37  ? -20.412 13.465  29.181  1.00   57.96  ? 22  LYS B O     1 
ATOM   2435 C CB    . LYS B 1 37  ? -23.441 13.553  28.000  1.00   70.39  ? 22  LYS B CB    1 
ATOM   2436 C CG    . LYS B 1 37  ? -22.627 13.482  26.712  1.00   71.59  ? 22  LYS B CG    1 
ATOM   2437 C CD    . LYS B 1 37  ? -23.362 12.688  25.638  1.00   79.71  ? 22  LYS B CD    1 
ATOM   2438 C CE    . LYS B 1 37  ? -22.504 12.534  24.386  1.00   85.90  ? 22  LYS B CE    1 
ATOM   2439 N NZ    . LYS B 1 37  ? -21.176 11.920  24.698  1.00   78.74  ? 22  LYS B NZ    1 
ATOM   2440 N N     . TYR B 1 38  ? -21.861 12.378  30.508  1.00   59.12  ? 23  TYR B N     1 
ATOM   2441 C CA    . TYR B 1 38  ? -20.888 11.426  30.996  1.00   57.86  ? 23  TYR B CA    1 
ATOM   2442 C C     . TYR B 1 38  ? -20.233 10.714  29.824  1.00   58.86  ? 23  TYR B C     1 
ATOM   2443 O O     . TYR B 1 38  ? -20.927 10.197  28.952  1.00   61.91  ? 23  TYR B O     1 
ATOM   2444 C CB    . TYR B 1 38  ? -21.568 10.409  31.900  1.00   59.36  ? 23  TYR B CB    1 
ATOM   2445 C CG    . TYR B 1 38  ? -20.591 9.569   32.668  1.00   61.70  ? 23  TYR B CG    1 
ATOM   2446 C CD1   . TYR B 1 38  ? -19.737 10.150  33.589  1.00   57.04  ? 23  TYR B CD1   1 
ATOM   2447 C CD2   . TYR B 1 38  ? -20.512 8.197   32.470  1.00   61.33  ? 23  TYR B CD2   1 
ATOM   2448 C CE1   . TYR B 1 38  ? -18.838 9.398   34.297  1.00   59.85  ? 23  TYR B CE1   1 
ATOM   2449 C CE2   . TYR B 1 38  ? -19.609 7.428   33.182  1.00   56.49  ? 23  TYR B CE2   1 
ATOM   2450 C CZ    . TYR B 1 38  ? -18.776 8.040   34.094  1.00   59.00  ? 23  TYR B CZ    1 
ATOM   2451 O OH    . TYR B 1 38  ? -17.867 7.300   34.813  1.00   63.09  ? 23  TYR B OH    1 
ATOM   2452 N N     . PRO B 1 39  ? -18.891 10.694  29.791  1.00   58.88  ? 24  PRO B N     1 
ATOM   2453 C CA    . PRO B 1 39  ? -18.180 10.069  28.671  1.00   56.66  ? 24  PRO B CA    1 
ATOM   2454 C C     . PRO B 1 39  ? -18.346 8.559   28.711  1.00   57.71  ? 24  PRO B C     1 
ATOM   2455 O O     . PRO B 1 39  ? -18.246 7.957   29.785  1.00   55.07  ? 24  PRO B O     1 
ATOM   2456 C CB    . PRO B 1 39  ? -16.712 10.431  28.931  1.00   54.10  ? 24  PRO B CB    1 
ATOM   2457 C CG    . PRO B 1 39  ? -16.737 11.508  29.977  1.00   55.31  ? 24  PRO B CG    1 
ATOM   2458 C CD    . PRO B 1 39  ? -17.966 11.267  30.781  1.00   54.67  ? 24  PRO B CD    1 
ATOM   2459 N N     . LYS B 1 40  ? -18.617 7.961   27.556  1.00   57.76  ? 25  LYS B N     1 
ATOM   2460 C CA    . LYS B 1 40  ? -18.604 6.512   27.434  1.00   55.15  ? 25  LYS B CA    1 
ATOM   2461 C C     . LYS B 1 40  ? -17.161 6.021   27.497  1.00   53.42  ? 25  LYS B C     1 
ATOM   2462 O O     . LYS B 1 40  ? -16.247 6.679   27.000  1.00   50.84  ? 25  LYS B O     1 
ATOM   2463 C CB    . LYS B 1 40  ? -19.238 6.084   26.113  1.00   56.91  ? 25  LYS B CB    1 
ATOM   2464 C CG    . LYS B 1 40  ? -20.681 6.529   25.966  1.00   70.96  ? 25  LYS B CG    1 
ATOM   2465 C CD    . LYS B 1 40  ? -21.353 5.897   24.759  1.00   79.33  ? 25  LYS B CD    1 
ATOM   2466 C CE    . LYS B 1 40  ? -22.874 6.016   24.856  1.00   80.05  ? 25  LYS B CE    1 
ATOM   2467 N NZ    . LYS B 1 40  ? -23.397 5.405   26.115  1.00   74.58  ? 25  LYS B NZ    1 
ATOM   2468 N N     . GLU B 1 41  ? -16.959 4.860   28.102  1.00   48.60  ? 26  GLU B N     1 
ATOM   2469 C CA    . GLU B 1 41  ? -15.635 4.285   28.174  1.00   49.89  ? 26  GLU B CA    1 
ATOM   2470 C C     . GLU B 1 41  ? -14.964 4.244   26.801  1.00   52.77  ? 26  GLU B C     1 
ATOM   2471 O O     . GLU B 1 41  ? -15.577 3.877   25.802  1.00   51.14  ? 26  GLU B O     1 
ATOM   2472 C CB    . GLU B 1 41  ? -15.683 2.891   28.783  1.00   51.43  ? 26  GLU B CB    1 
ATOM   2473 C CG    . GLU B 1 41  ? -14.319 2.387   29.210  1.00   55.90  ? 26  GLU B CG    1 
ATOM   2474 C CD    . GLU B 1 41  ? -14.356 0.943   29.642  1.00   57.91  ? 26  GLU B CD    1 
ATOM   2475 O OE1   . GLU B 1 41  ? -15.462 0.365   29.639  1.00   58.68  ? 26  GLU B OE1   1 
ATOM   2476 O OE2   . GLU B 1 41  ? -13.286 0.391   29.987  1.00   59.89  ? 26  GLU B OE2   1 
ATOM   2477 N N     . ASP B 1 42  ? -13.695 4.637   26.775  1.00   54.27  ? 27  ASP B N     1 
ATOM   2478 C CA    . ASP B 1 42  ? -12.872 4.632   25.565  1.00   53.99  ? 27  ASP B CA    1 
ATOM   2479 C C     . ASP B 1 42  ? -13.238 5.724   24.572  1.00   52.36  ? 27  ASP B C     1 
ATOM   2480 O O     . ASP B 1 42  ? -12.918 5.619   23.393  1.00   53.75  ? 27  ASP B O     1 
ATOM   2481 C CB    . ASP B 1 42  ? -12.875 3.262   24.868  1.00   50.17  ? 27  ASP B CB    1 
ATOM   2482 C CG    . ASP B 1 42  ? -11.593 3.005   24.088  1.00   54.06  ? 27  ASP B CG    1 
ATOM   2483 O OD1   . ASP B 1 42  ? -11.681 2.532   22.934  1.00   61.53  ? 27  ASP B OD1   1 
ATOM   2484 O OD2   . ASP B 1 42  ? -10.494 3.272   24.628  1.00   49.46  ? 27  ASP B OD2   1 
ATOM   2485 N N     . SER B 1 43  ? -13.902 6.772   25.043  1.00   53.18  ? 28  SER B N     1 
ATOM   2486 C CA    . SER B 1 43  ? -14.149 7.934   24.189  1.00   55.21  ? 28  SER B CA    1 
ATOM   2487 C C     . SER B 1 43  ? -13.265 9.129   24.566  1.00   48.38  ? 28  SER B C     1 
ATOM   2488 O O     . SER B 1 43  ? -12.620 9.144   25.616  1.00   50.00  ? 28  SER B O     1 
ATOM   2489 C CB    . SER B 1 43  ? -15.629 8.332   24.209  1.00   52.66  ? 28  SER B CB    1 
ATOM   2490 O OG    . SER B 1 43  ? -15.997 8.874   25.464  1.00   58.66  ? 28  SER B OG    1 
ATOM   2491 N N     . GLU B 1 44  ? -13.230 10.117  23.686  1.00   47.02  ? 29  GLU B N     1 
ATOM   2492 C CA    . GLU B 1 44  ? -12.519 11.355  23.947  1.00   53.66  ? 29  GLU B CA    1 
ATOM   2493 C C     . GLU B 1 44  ? -13.537 12.480  23.835  1.00   55.01  ? 29  GLU B C     1 
ATOM   2494 O O     . GLU B 1 44  ? -14.251 12.563  22.838  1.00   55.94  ? 29  GLU B O     1 
ATOM   2495 C CB    . GLU B 1 44  ? -11.377 11.548  22.941  1.00   50.80  ? 29  GLU B CB    1 
ATOM   2496 C CG    . GLU B 1 44  ? -10.655 12.902  23.042  1.00   53.50  ? 29  GLU B CG    1 
ATOM   2497 C CD    . GLU B 1 44  ? -9.429  13.002  22.130  1.00   65.59  ? 29  GLU B CD    1 
ATOM   2498 O OE1   . GLU B 1 44  ? -9.111  12.013  21.416  1.00   67.38  ? 29  GLU B OE1   1 
ATOM   2499 O OE2   . GLU B 1 44  ? -8.775  14.074  22.132  1.00   65.05  ? 29  GLU B OE2   1 
ATOM   2500 N N     . ILE B 1 45  ? -13.638 13.326  24.859  1.00   50.69  ? 30  ILE B N     1 
ATOM   2501 C CA    . ILE B 1 45  ? -14.587 14.443  24.805  1.00   51.59  ? 30  ILE B CA    1 
ATOM   2502 C C     . ILE B 1 45  ? -13.958 15.760  25.232  1.00   54.09  ? 30  ILE B C     1 
ATOM   2503 O O     . ILE B 1 45  ? -12.944 15.784  25.925  1.00   50.16  ? 30  ILE B O     1 
ATOM   2504 C CB    . ILE B 1 45  ? -15.828 14.209  25.680  1.00   52.14  ? 30  ILE B CB    1 
ATOM   2505 C CG1   . ILE B 1 45  ? -15.428 14.174  27.154  1.00   52.65  ? 30  ILE B CG1   1 
ATOM   2506 C CG2   . ILE B 1 45  ? -16.539 12.927  25.274  1.00   57.24  ? 30  ILE B CG2   1 
ATOM   2507 C CD1   . ILE B 1 45  ? -16.586 14.294  28.113  1.00   49.57  ? 30  ILE B CD1   1 
ATOM   2508 N N     . ARG B 1 46  ? -14.573 16.853  24.793  1.00   56.43  ? 31  ARG B N     1 
ATOM   2509 C CA    . ARG B 1 46  ? -14.217 18.186  25.234  1.00   55.48  ? 31  ARG B CA    1 
ATOM   2510 C C     . ARG B 1 46  ? -15.087 18.529  26.429  1.00   56.70  ? 31  ARG B C     1 
ATOM   2511 O O     . ARG B 1 46  ? -16.300 18.308  26.405  1.00   55.52  ? 31  ARG B O     1 
ATOM   2512 C CB    . ARG B 1 46  ? -14.481 19.202  24.123  1.00   60.37  ? 31  ARG B CB    1 
ATOM   2513 C CG    . ARG B 1 46  ? -13.351 19.385  23.134  1.00   70.86  ? 31  ARG B CG    1 
ATOM   2514 C CD    . ARG B 1 46  ? -13.730 20.421  22.073  1.00   78.81  ? 31  ARG B CD    1 
ATOM   2515 N NE    . ARG B 1 46  ? -12.721 20.526  21.023  1.00   82.90  ? 31  ARG B NE    1 
ATOM   2516 C CZ    . ARG B 1 46  ? -11.866 21.537  20.909  1.00   83.93  ? 31  ARG B CZ    1 
ATOM   2517 N NH1   . ARG B 1 46  ? -11.910 22.538  21.778  1.00   83.54  ? 31  ARG B NH1   1 
ATOM   2518 N NH2   . ARG B 1 46  ? -10.971 21.551  19.925  1.00   80.25  ? 31  ARG B NH2   1 
ATOM   2519 N N     . CYS B 1 47  ? -14.477 19.062  27.478  1.00   51.05  ? 32  CYS B N     1 
ATOM   2520 C CA    . CYS B 1 47  ? -15.256 19.505  28.620  1.00   54.70  ? 32  CYS B CA    1 
ATOM   2521 C C     . CYS B 1 47  ? -15.672 20.953  28.400  1.00   56.73  ? 32  CYS B C     1 
ATOM   2522 O O     . CYS B 1 47  ? -15.091 21.648  27.565  1.00   54.74  ? 32  CYS B O     1 
ATOM   2523 C CB    . CYS B 1 47  ? -14.455 19.368  29.916  1.00   50.47  ? 32  CYS B CB    1 
ATOM   2524 S SG    . CYS B 1 47  ? -12.937 20.331  29.959  1.00   56.25  ? 32  CYS B SG    1 
ATOM   2525 N N     . LEU B 1 48  ? -16.675 21.400  29.150  1.00   53.41  ? 33  LEU B N     1 
ATOM   2526 C CA    . LEU B 1 48  ? -17.101 22.792  29.100  1.00   52.79  ? 33  LEU B CA    1 
ATOM   2527 C C     . LEU B 1 48  ? -16.124 23.659  29.882  1.00   56.97  ? 33  LEU B C     1 
ATOM   2528 O O     . LEU B 1 48  ? -15.802 24.778  29.466  1.00   54.38  ? 33  LEU B O     1 
ATOM   2529 C CB    . LEU B 1 48  ? -18.520 22.934  29.642  1.00   51.91  ? 33  LEU B CB    1 
ATOM   2530 C CG    . LEU B 1 48  ? -19.532 22.152  28.803  1.00   59.96  ? 33  LEU B CG    1 
ATOM   2531 C CD1   . LEU B 1 48  ? -20.915 22.168  29.423  1.00   62.15  ? 33  LEU B CD1   1 
ATOM   2532 C CD2   . LEU B 1 48  ? -19.565 22.684  27.367  1.00   57.75  ? 33  LEU B CD2   1 
ATOM   2533 N N     . SER B 1 49  ? -15.643 23.123  31.004  1.00   54.74  ? 34  SER B N     1 
ATOM   2534 C CA    . SER B 1 49  ? -14.592 23.762  31.796  1.00   51.70  ? 34  SER B CA    1 
ATOM   2535 C C     . SER B 1 49  ? -13.862 22.745  32.671  1.00   48.83  ? 34  SER B C     1 
ATOM   2536 O O     . SER B 1 49  ? -14.386 21.675  32.977  1.00   50.59  ? 34  SER B O     1 
ATOM   2537 C CB    . SER B 1 49  ? -15.178 24.861  32.687  1.00   54.51  ? 34  SER B CB    1 
ATOM   2538 O OG    . SER B 1 49  ? -16.145 24.331  33.586  1.00   55.90  ? 34  SER B OG    1 
ATOM   2539 N N     . GLN B 1 50  ? -12.656 23.096  33.091  1.00   47.28  ? 35  GLN B N     1 
ATOM   2540 C CA    . GLN B 1 50  ? -11.862 22.217  33.930  1.00   52.13  ? 35  GLN B CA    1 
ATOM   2541 C C     . GLN B 1 50  ? -11.094 23.067  34.918  1.00   52.17  ? 35  GLN B C     1 
ATOM   2542 O O     . GLN B 1 50  ? -10.590 24.123  34.550  1.00   54.46  ? 35  GLN B O     1 
ATOM   2543 C CB    . GLN B 1 50  ? -10.895 21.393  33.084  1.00   51.03  ? 35  GLN B CB    1 
ATOM   2544 C CG    . GLN B 1 50  ? -10.224 20.261  33.837  1.00   50.44  ? 35  GLN B CG    1 
ATOM   2545 C CD    . GLN B 1 50  ? -9.324  19.428  32.946  1.00   57.23  ? 35  GLN B CD    1 
ATOM   2546 O OE1   . GLN B 1 50  ? -9.778  18.485  32.268  1.00   52.07  ? 35  GLN B OE1   1 
ATOM   2547 N NE2   . GLN B 1 50  ? -8.043  19.778  32.927  1.00   56.51  ? 35  GLN B NE2   1 
ATOM   2548 N N     . ARG B 1 51  ? -11.003 22.599  36.162  1.00   47.10  ? 36  ARG B N     1 
ATOM   2549 C CA    . ARG B 1 51  ? -10.427 23.384  37.252  1.00   49.87  ? 36  ARG B CA    1 
ATOM   2550 C C     . ARG B 1 51  ? -9.506  22.543  38.115  1.00   44.48  ? 36  ARG B C     1 
ATOM   2551 O O     . ARG B 1 51  ? -9.839  21.418  38.452  1.00   45.84  ? 36  ARG B O     1 
ATOM   2552 C CB    . ARG B 1 51  ? -11.543 23.913  38.164  1.00   51.84  ? 36  ARG B CB    1 
ATOM   2553 C CG    . ARG B 1 51  ? -12.018 25.312  37.855  1.00   61.41  ? 36  ARG B CG    1 
ATOM   2554 C CD    . ARG B 1 51  ? -13.080 25.756  38.877  1.00   74.59  ? 36  ARG B CD    1 
ATOM   2555 N NE    . ARG B 1 51  ? -13.531 27.131  38.639  1.00   92.25  ? 36  ARG B NE    1 
ATOM   2556 C CZ    . ARG B 1 51  ? -14.550 27.717  39.268  1.00   91.86  ? 36  ARG B CZ    1 
ATOM   2557 N NH1   . ARG B 1 51  ? -15.249 27.050  40.180  1.00   86.84  ? 36  ARG B NH1   1 
ATOM   2558 N NH2   . ARG B 1 51  ? -14.878 28.972  38.978  1.00   91.27  ? 36  ARG B NH2   1 
ATOM   2559 N N     . TRP B 1 52  ? -8.365  23.097  38.500  1.00   41.65  ? 37  TRP B N     1 
ATOM   2560 C CA    . TRP B 1 52  ? -7.526  22.459  39.496  1.00   42.35  ? 37  TRP B CA    1 
ATOM   2561 C C     . TRP B 1 52  ? -7.776  23.163  40.815  1.00   43.58  ? 37  TRP B C     1 
ATOM   2562 O O     . TRP B 1 52  ? -7.688  24.384  40.880  1.00   43.53  ? 37  TRP B O     1 
ATOM   2563 C CB    . TRP B 1 52  ? -6.047  22.580  39.143  1.00   41.46  ? 37  TRP B CB    1 
ATOM   2564 C CG    . TRP B 1 52  ? -5.625  21.809  37.941  1.00   45.21  ? 37  TRP B CG    1 
ATOM   2565 C CD1   . TRP B 1 52  ? -6.424  21.339  36.934  1.00   46.66  ? 37  TRP B CD1   1 
ATOM   2566 C CD2   . TRP B 1 52  ? -4.288  21.413  37.611  1.00   39.40  ? 37  TRP B CD2   1 
ATOM   2567 N NE1   . TRP B 1 52  ? -5.661  20.675  36.000  1.00   51.04  ? 37  TRP B NE1   1 
ATOM   2568 C CE2   . TRP B 1 52  ? -4.349  20.703  36.397  1.00   43.91  ? 37  TRP B CE2   1 
ATOM   2569 C CE3   . TRP B 1 52  ? -3.051  21.579  38.233  1.00   42.06  ? 37  TRP B CE3   1 
ATOM   2570 C CZ2   . TRP B 1 52  ? -3.221  20.174  35.786  1.00   43.18  ? 37  TRP B CZ2   1 
ATOM   2571 C CZ3   . TRP B 1 52  ? -1.930  21.059  37.623  1.00   46.71  ? 37  TRP B CZ3   1 
ATOM   2572 C CH2   . TRP B 1 52  ? -2.022  20.364  36.412  1.00   47.79  ? 37  TRP B CH2   1 
ATOM   2573 N N     . GLN B 1 53  ? -8.087  22.393  41.854  1.00   42.06  ? 38  GLN B N     1 
ATOM   2574 C CA    . GLN B 1 53  ? -8.399  22.935  43.176  1.00   39.51  ? 38  GLN B CA    1 
ATOM   2575 C C     . GLN B 1 53  ? -7.645  22.191  44.250  1.00   37.38  ? 38  GLN B C     1 
ATOM   2576 O O     . GLN B 1 53  ? -7.391  20.999  44.117  1.00   39.53  ? 38  GLN B O     1 
ATOM   2577 C CB    . GLN B 1 53  ? -9.892  22.782  43.473  1.00   40.70  ? 38  GLN B CB    1 
ATOM   2578 C CG    . GLN B 1 53  ? -10.763 23.803  42.783  1.00   54.67  ? 38  GLN B CG    1 
ATOM   2579 C CD    . GLN B 1 53  ? -12.247 23.631  43.084  1.00   57.08  ? 38  GLN B CD    1 
ATOM   2580 O OE1   . GLN B 1 53  ? -12.634 22.973  44.064  1.00   51.17  ? 38  GLN B OE1   1 
ATOM   2581 N NE2   . GLN B 1 53  ? -13.089 24.224  42.235  1.00   55.47  ? 38  GLN B NE2   1 
ATOM   2582 N N     . ARG B 1 54  ? -7.303  22.894  45.321  1.00   34.56  ? 39  ARG B N     1 
ATOM   2583 C CA    . ARG B 1 54  ? -6.780  22.256  46.513  1.00   33.57  ? 39  ARG B CA    1 
ATOM   2584 C C     . ARG B 1 54  ? -7.951  21.790  47.368  1.00   35.54  ? 39  ARG B C     1 
ATOM   2585 O O     . ARG B 1 54  ? -8.819  22.577  47.689  1.00   34.16  ? 39  ARG B O     1 
ATOM   2586 C CB    . ARG B 1 54  ? -5.924  23.232  47.317  1.00   29.16  ? 39  ARG B CB    1 
ATOM   2587 C CG    . ARG B 1 54  ? -5.397  22.621  48.594  1.00   32.34  ? 39  ARG B CG    1 
ATOM   2588 C CD    . ARG B 1 54  ? -4.353  23.472  49.286  1.00   31.65  ? 39  ARG B CD    1 
ATOM   2589 N NE    . ARG B 1 54  ? -4.694  24.889  49.368  1.00   33.84  ? 39  ARG B NE    1 
ATOM   2590 C CZ    . ARG B 1 54  ? -5.341  25.473  50.377  1.00   34.81  ? 39  ARG B CZ    1 
ATOM   2591 N NH1   . ARG B 1 54  ? -5.769  24.769  51.423  1.00   31.74  ? 39  ARG B NH1   1 
ATOM   2592 N NH2   . ARG B 1 54  ? -5.552  26.781  50.343  1.00   31.96  ? 39  ARG B NH2   1 
ATOM   2593 N N     . GLY B 1 55  ? -7.962  20.512  47.736  1.00   38.48  ? 40  GLY B N     1 
ATOM   2594 C CA    . GLY B 1 55  ? -9.039  19.926  48.505  1.00   32.08  ? 40  GLY B CA    1 
ATOM   2595 C C     . GLY B 1 55  ? -8.508  19.196  49.720  1.00   34.76  ? 40  GLY B C     1 
ATOM   2596 O O     . GLY B 1 55  ? -7.318  19.284  50.026  1.00   32.92  ? 40  GLY B O     1 
ATOM   2597 N N     . GLY B 1 56  ? -9.391  18.476  50.413  1.00   32.14  ? 41  GLY B N     1 
ATOM   2598 C CA    . GLY B 1 56  ? -9.054  17.785  51.648  1.00   30.07  ? 41  GLY B CA    1 
ATOM   2599 C C     . GLY B 1 56  ? -9.590  18.528  52.859  1.00   32.27  ? 41  GLY B C     1 
ATOM   2600 O O     . GLY B 1 56  ? -9.600  19.762  52.867  1.00   32.38  ? 41  GLY B O     1 
ATOM   2601 N N     . ASN B 1 57  ? -10.018 17.793  53.889  1.00   35.74  ? 42  ASN B N     1 
ATOM   2602 C CA    . ASN B 1 57  ? -10.689 18.408  55.044  1.00   34.15  ? 42  ASN B CA    1 
ATOM   2603 C C     . ASN B 1 57  ? -9.819  19.351  55.844  1.00   35.97  ? 42  ASN B C     1 
ATOM   2604 O O     . ASN B 1 57  ? -10.199 20.500  56.063  1.00   34.94  ? 42  ASN B O     1 
ATOM   2605 C CB    . ASN B 1 57  ? -11.310 17.354  55.963  1.00   39.34  ? 42  ASN B CB    1 
ATOM   2606 C CG    . ASN B 1 57  ? -12.519 16.682  55.326  1.00   47.85  ? 42  ASN B CG    1 
ATOM   2607 O OD1   . ASN B 1 57  ? -13.216 17.291  54.511  1.00   46.86  ? 42  ASN B OD1   1 
ATOM   2608 N ND2   . ASN B 1 57  ? -12.767 15.425  55.682  1.00   49.42  ? 42  ASN B ND2   1 
ATOM   2609 N N     . ALA B 1 58  ? -8.645  18.881  56.266  1.00   35.87  ? 43  ALA B N     1 
ATOM   2610 C CA    . ALA B 1 58  ? -7.747  19.728  57.049  1.00   32.22  ? 43  ALA B CA    1 
ATOM   2611 C C     . ALA B 1 58  ? -7.322  20.918  56.214  1.00   29.34  ? 43  ALA B C     1 
ATOM   2612 O O     . ALA B 1 58  ? -7.242  22.030  56.707  1.00   31.06  ? 43  ALA B O     1 
ATOM   2613 C CB    . ALA B 1 58  ? -6.529  18.947  57.532  1.00   31.78  ? 43  ALA B CB    1 
ATOM   2614 N N     . SER B 1 59  ? -7.092  20.670  54.926  1.00   32.27  ? 44  SER B N     1 
ATOM   2615 C CA    . SER B 1 59  ? -6.664  21.702  53.994  1.00   29.72  ? 44  SER B CA    1 
ATOM   2616 C C     . SER B 1 59  ? -7.729  22.793  53.883  1.00   30.30  ? 44  SER B C     1 
ATOM   2617 O O     . SER B 1 59  ? -7.429  23.973  54.032  1.00   28.94  ? 44  SER B O     1 
ATOM   2618 C CB    . SER B 1 59  ? -6.339  21.077  52.612  1.00   32.34  ? 44  SER B CB    1 
ATOM   2619 O OG    . SER B 1 59  ? -6.297  22.051  51.571  1.00   30.84  ? 44  SER B OG    1 
ATOM   2620 N N     . ASN B 1 60  ? -8.970  22.389  53.610  1.00   31.99  ? 45  ASN B N     1 
ATOM   2621 C CA    . ASN B 1 60  ? -10.095 23.318  53.531  1.00   29.65  ? 45  ASN B CA    1 
ATOM   2622 C C     . ASN B 1 60  ? -10.202 24.150  54.799  1.00   30.71  ? 45  ASN B C     1 
ATOM   2623 O O     . ASN B 1 60  ? -10.357 25.371  54.755  1.00   27.95  ? 45  ASN B O     1 
ATOM   2624 C CB    . ASN B 1 60  ? -11.407 22.555  53.329  1.00   32.76  ? 45  ASN B CB    1 
ATOM   2625 C CG    . ASN B 1 60  ? -11.583 22.046  51.904  1.00   37.13  ? 45  ASN B CG    1 
ATOM   2626 O OD1   . ASN B 1 60  ? -10.921 22.510  50.974  1.00   36.90  ? 45  ASN B OD1   1 
ATOM   2627 N ND2   . ASN B 1 60  ? -12.489 21.094  51.729  1.00   33.54  ? 45  ASN B ND2   1 
ATOM   2628 N N     . SER B 1 61  ? -10.109 23.477  55.936  1.00   28.50  ? 46  SER B N     1 
ATOM   2629 C CA    . SER B 1 61  ? -10.190 24.172  57.210  1.00   35.09  ? 46  SER B CA    1 
ATOM   2630 C C     . SER B 1 61  ? -9.128  25.240  57.383  1.00   32.31  ? 46  SER B C     1 
ATOM   2631 O O     . SER B 1 61  ? -9.440  26.324  57.869  1.00   30.92  ? 46  SER B O     1 
ATOM   2632 C CB    . SER B 1 61  ? -10.172 23.191  58.382  1.00   32.71  ? 46  SER B CB    1 
ATOM   2633 O OG    . SER B 1 61  ? -11.418 22.525  58.428  1.00   35.06  ? 46  SER B OG    1 
ATOM   2634 N N     . CYS B 1 62  ? -7.878  24.935  57.008  1.00   32.02  ? 47  CYS B N     1 
ATOM   2635 C CA    . CYS B 1 62  ? -6.806  25.941  57.046  1.00   28.88  ? 47  CYS B CA    1 
ATOM   2636 C C     . CYS B 1 62  ? -7.134  27.192  56.237  1.00   27.05  ? 47  CYS B C     1 
ATOM   2637 O O     . CYS B 1 62  ? -6.926  28.301  56.705  1.00   26.71  ? 47  CYS B O     1 
ATOM   2638 C CB    . CYS B 1 62  ? -5.478  25.361  56.535  1.00   34.63  ? 47  CYS B CB    1 
ATOM   2639 S SG    . CYS B 1 62  ? -4.676  24.344  57.733  1.00   39.10  ? 47  CYS B SG    1 
ATOM   2640 N N     . THR B 1 63  ? -7.611  27.015  55.011  1.00   27.53  ? 48  THR B N     1 
ATOM   2641 C CA    . THR B 1 63  ? -8.067  28.167  54.222  1.00   28.99  ? 48  THR B CA    1 
ATOM   2642 C C     . THR B 1 63  ? -9.072  29.047  54.994  1.00   31.12  ? 48  THR B C     1 
ATOM   2643 O O     . THR B 1 63  ? -8.939  30.268  55.036  1.00   30.56  ? 48  THR B O     1 
ATOM   2644 C CB    . THR B 1 63  ? -8.708  27.721  52.902  1.00   29.52  ? 48  THR B CB    1 
ATOM   2645 O OG1   . THR B 1 63  ? -7.764  26.948  52.155  1.00   31.03  ? 48  THR B OG1   1 
ATOM   2646 C CG2   . THR B 1 63  ? -9.190  28.940  52.042  1.00   28.71  ? 48  THR B CG2   1 
ATOM   2647 N N     . VAL B 1 64  ? -10.064 28.425  55.624  1.00   31.44  ? 49  VAL B N     1 
ATOM   2648 C CA    . VAL B 1 64  ? -11.111 29.183  56.310  1.00   28.74  ? 49  VAL B CA    1 
ATOM   2649 C C     . VAL B 1 64  ? -10.544 29.919  57.520  1.00   27.82  ? 49  VAL B C     1 
ATOM   2650 O O     . VAL B 1 64  ? -10.824 31.094  57.732  1.00   30.34  ? 49  VAL B O     1 
ATOM   2651 C CB    . VAL B 1 64  ? -12.299 28.273  56.699  1.00   31.48  ? 49  VAL B CB    1 
ATOM   2652 C CG1   . VAL B 1 64  ? -13.319 29.017  57.611  1.00   28.29  ? 49  VAL B CG1   1 
ATOM   2653 C CG2   . VAL B 1 64  ? -12.972 27.734  55.451  1.00   28.81  ? 49  VAL B CG2   1 
ATOM   2654 N N     . LEU B 1 65  ? -9.712  29.237  58.293  1.00   27.07  ? 50  LEU B N     1 
ATOM   2655 C CA    . LEU B 1 65  ? -9.007  29.876  59.407  1.00   28.15  ? 50  LEU B CA    1 
ATOM   2656 C C     . LEU B 1 65  ? -8.198  31.114  59.022  1.00   27.93  ? 50  LEU B C     1 
ATOM   2657 O O     . LEU B 1 65  ? -8.235  32.129  59.717  1.00   30.42  ? 50  LEU B O     1 
ATOM   2658 C CB    . LEU B 1 65  ? -8.120  28.868  60.119  1.00   29.31  ? 50  LEU B CB    1 
ATOM   2659 C CG    . LEU B 1 65  ? -8.830  27.797  60.945  1.00   32.42  ? 50  LEU B CG    1 
ATOM   2660 C CD1   . LEU B 1 65  ? -7.835  26.719  61.298  1.00   28.80  ? 50  LEU B CD1   1 
ATOM   2661 C CD2   . LEU B 1 65  ? -9.513  28.391  62.212  1.00   23.79  ? 50  LEU B CD2   1 
ATOM   2662 N N     . SER B 1 66  ? -7.461  31.033  57.923  1.00   28.80  ? 51  SER B N     1 
ATOM   2663 C CA    . SER B 1 66  ? -6.745  32.201  57.409  1.00   32.78  ? 51  SER B CA    1 
ATOM   2664 C C     . SER B 1 66  ? -7.658  33.362  57.048  1.00   29.56  ? 51  SER B C     1 
ATOM   2665 O O     . SER B 1 66  ? -7.365  34.502  57.386  1.00   31.08  ? 51  SER B O     1 
ATOM   2666 C CB    . SER B 1 66  ? -5.907  31.843  56.178  1.00   30.56  ? 51  SER B CB    1 
ATOM   2667 O OG    . SER B 1 66  ? -4.670  31.298  56.566  1.00   33.90  ? 51  SER B OG    1 
ATOM   2668 N N     . LEU B 1 67  ? -8.742  33.073  56.332  1.00   29.79  ? 52  LEU B N     1 
ATOM   2669 C CA    . LEU B 1 67  ? -9.714  34.105  55.963  1.00   31.70  ? 52  LEU B CA    1 
ATOM   2670 C C     . LEU B 1 67  ? -10.392 34.710  57.191  1.00   31.73  ? 52  LEU B C     1 
ATOM   2671 O O     . LEU B 1 67  ? -10.771 35.880  57.183  1.00   33.81  ? 52  LEU B O     1 
ATOM   2672 C CB    . LEU B 1 67  ? -10.754 33.547  54.983  1.00   28.48  ? 52  LEU B CB    1 
ATOM   2673 C CG    . LEU B 1 67  ? -10.114 33.080  53.673  1.00   34.18  ? 52  LEU B CG    1 
ATOM   2674 C CD1   . LEU B 1 67  ? -11.104 32.371  52.785  1.00   40.11  ? 52  LEU B CD1   1 
ATOM   2675 C CD2   . LEU B 1 67  ? -9.457  34.245  52.937  1.00   33.95  ? 52  LEU B CD2   1 
ATOM   2676 N N     . LEU B 1 68  ? -10.538 33.908  58.243  1.00   29.80  ? 53  LEU B N     1 
ATOM   2677 C CA    . LEU B 1 68  ? -11.087 34.388  59.514  1.00   30.56  ? 53  LEU B CA    1 
ATOM   2678 C C     . LEU B 1 68  ? -10.136 35.303  60.286  1.00   32.79  ? 53  LEU B C     1 
ATOM   2679 O O     . LEU B 1 68  ? -10.565 36.019  61.190  1.00   33.32  ? 53  LEU B O     1 
ATOM   2680 C CB    . LEU B 1 68  ? -11.480 33.209  60.397  1.00   29.20  ? 53  LEU B CB    1 
ATOM   2681 C CG    . LEU B 1 68  ? -12.755 32.521  59.911  1.00   35.98  ? 53  LEU B CG    1 
ATOM   2682 C CD1   . LEU B 1 68  ? -13.101 31.317  60.790  1.00   32.60  ? 53  LEU B CD1   1 
ATOM   2683 C CD2   . LEU B 1 68  ? -13.901 33.522  59.888  1.00   38.36  ? 53  LEU B CD2   1 
ATOM   2684 N N     . GLY B 1 69  ? -8.847  35.264  59.949  1.00   30.23  ? 54  GLY B N     1 
ATOM   2685 C CA    . GLY B 1 69  ? -7.866  36.106  60.606  1.00   28.43  ? 54  GLY B CA    1 
ATOM   2686 C C     . GLY B 1 69  ? -7.013  35.382  61.632  1.00   32.10  ? 54  GLY B C     1 
ATOM   2687 O O     . GLY B 1 69  ? -6.383  36.026  62.468  1.00   31.41  ? 54  GLY B O     1 
ATOM   2688 N N     . ALA B 1 70  ? -7.016  34.052  61.598  1.00   30.21  ? 55  ALA B N     1 
ATOM   2689 C CA    . ALA B 1 70  ? -6.142  33.266  62.465  1.00   30.64  ? 55  ALA B CA    1 
ATOM   2690 C C     . ALA B 1 70  ? -4.845  32.856  61.751  1.00   33.30  ? 55  ALA B C     1 
ATOM   2691 O O     . ALA B 1 70  ? -4.881  32.471  60.588  1.00   33.15  ? 55  ALA B O     1 
ATOM   2692 C CB    . ALA B 1 70  ? -6.865  32.015  62.957  1.00   29.09  ? 55  ALA B CB    1 
ATOM   2693 N N     . PRO B 1 71  ? -3.695  32.937  62.450  1.00   35.04  ? 56  PRO B N     1 
ATOM   2694 C CA    . PRO B 1 71  ? -2.462  32.306  61.945  1.00   37.06  ? 56  PRO B CA    1 
ATOM   2695 C C     . PRO B 1 71  ? -2.689  30.810  61.964  1.00   33.76  ? 56  PRO B C     1 
ATOM   2696 O O     . PRO B 1 71  ? -3.185  30.294  62.955  1.00   31.01  ? 56  PRO B O     1 
ATOM   2697 C CB    . PRO B 1 71  ? -1.408  32.665  63.000  1.00   32.08  ? 56  PRO B CB    1 
ATOM   2698 C CG    . PRO B 1 71  ? -1.952  33.858  63.712  1.00   36.17  ? 56  PRO B CG    1 
ATOM   2699 C CD    . PRO B 1 71  ? -3.464  33.714  63.676  1.00   35.40  ? 56  PRO B CD    1 
ATOM   2700 N N     . CYS B 1 72  ? -2.378  30.113  60.885  1.00   34.30  ? 57  CYS B N     1 
ATOM   2701 C CA    . CYS B 1 72  ? -2.621  28.687  60.889  1.00   33.87  ? 57  CYS B CA    1 
ATOM   2702 C C     . CYS B 1 72  ? -1.645  27.952  60.019  1.00   32.96  ? 57  CYS B C     1 
ATOM   2703 O O     . CYS B 1 72  ? -1.096  28.504  59.060  1.00   29.83  ? 57  CYS B O     1 
ATOM   2704 C CB    . CYS B 1 72  ? -4.036  28.367  60.420  1.00   38.56  ? 57  CYS B CB    1 
ATOM   2705 S SG    . CYS B 1 72  ? -4.228  28.651  58.715  1.00   43.87  ? 57  CYS B SG    1 
ATOM   2706 N N     . ALA B 1 73  ? -1.473  26.682  60.360  1.00   29.31  ? 58  ALA B N     1 
ATOM   2707 C CA    . ALA B 1 73  ? -0.448  25.866  59.773  1.00   30.52  ? 58  ALA B CA    1 
ATOM   2708 C C     . ALA B 1 73  ? -1.094  24.571  59.362  1.00   32.63  ? 58  ALA B C     1 
ATOM   2709 O O     . ALA B 1 73  ? -2.063  24.098  59.978  1.00   32.65  ? 58  ALA B O     1 
ATOM   2710 C CB    . ALA B 1 73  ? 0.657   25.605  60.804  1.00   25.72  ? 58  ALA B CB    1 
ATOM   2711 N N     . PHE B 1 74  ? -0.565  23.987  58.309  1.00   31.79  ? 59  PHE B N     1 
ATOM   2712 C CA    . PHE B 1 74  ? -1.068  22.713  57.866  1.00   32.51  ? 59  PHE B CA    1 
ATOM   2713 C C     . PHE B 1 74  ? 0.004   21.647  58.059  1.00   33.18  ? 59  PHE B C     1 
ATOM   2714 O O     . PHE B 1 74  ? 1.183   21.841  57.721  1.00   36.36  ? 59  PHE B O     1 
ATOM   2715 C CB    . PHE B 1 74  ? -1.488  22.794  56.399  1.00   28.07  ? 59  PHE B CB    1 
ATOM   2716 C CG    . PHE B 1 74  ? -1.720  21.458  55.776  1.00   33.87  ? 59  PHE B CG    1 
ATOM   2717 C CD1   . PHE B 1 74  ? -2.935  20.808  55.932  1.00   34.86  ? 59  PHE B CD1   1 
ATOM   2718 C CD2   . PHE B 1 74  ? -0.720  20.833  55.055  1.00   30.65  ? 59  PHE B CD2   1 
ATOM   2719 C CE1   . PHE B 1 74  ? -3.150  19.565  55.370  1.00   30.65  ? 59  PHE B CE1   1 
ATOM   2720 C CE2   . PHE B 1 74  ? -0.932  19.589  54.494  1.00   30.01  ? 59  PHE B CE2   1 
ATOM   2721 C CZ    . PHE B 1 74  ? -2.152  18.960  54.651  1.00   32.28  ? 59  PHE B CZ    1 
ATOM   2722 N N     . MET B 1 75  ? -0.401  20.512  58.600  1.00   34.92  ? 60  MET B N     1 
ATOM   2723 C CA    . MET B 1 75  ? 0.477   19.353  58.589  1.00   35.46  ? 60  MET B CA    1 
ATOM   2724 C C     . MET B 1 75  ? -0.165  18.163  57.884  1.00   32.79  ? 60  MET B C     1 
ATOM   2725 O O     . MET B 1 75  ? -1.214  17.685  58.283  1.00   37.20  ? 60  MET B O     1 
ATOM   2726 C CB    . MET B 1 75  ? 0.876   18.973  60.005  1.00   33.12  ? 60  MET B CB    1 
ATOM   2727 C CG    . MET B 1 75  ? 1.903   17.863  60.030  1.00   36.88  ? 60  MET B CG    1 
ATOM   2728 S SD    . MET B 1 75  ? 2.212   17.260  61.693  1.00   40.77  ? 60  MET B SD    1 
ATOM   2729 C CE    . MET B 1 75  ? 2.839   18.721  62.503  1.00   38.58  ? 60  MET B CE    1 
ATOM   2730 N N     . GLY B 1 76  ? 0.472   17.685  56.831  1.00   32.34  ? 61  GLY B N     1 
ATOM   2731 C CA    . GLY B 1 76  ? -0.006  16.526  56.107  1.00   35.73  ? 61  GLY B CA    1 
ATOM   2732 C C     . GLY B 1 76  ? 1.133   16.036  55.232  1.00   39.88  ? 61  GLY B C     1 
ATOM   2733 O O     . GLY B 1 76  ? 2.182   16.671  55.188  1.00   38.27  ? 61  GLY B O     1 
ATOM   2734 N N     . SER B 1 77  ? 0.925   14.936  54.518  1.00   39.37  ? 62  SER B N     1 
ATOM   2735 C CA    . SER B 1 77  ? 1.974   14.359  53.688  1.00   40.29  ? 62  SER B CA    1 
ATOM   2736 C C     . SER B 1 77  ? 1.959   14.883  52.264  1.00   47.71  ? 62  SER B C     1 
ATOM   2737 O O     . SER B 1 77  ? 0.900   15.033  51.652  1.00   46.33  ? 62  SER B O     1 
ATOM   2738 C CB    . SER B 1 77  ? 1.828   12.841  53.642  1.00   39.67  ? 62  SER B CB    1 
ATOM   2739 O OG    . SER B 1 77  ? 2.086   12.264  54.902  1.00   43.58  ? 62  SER B OG    1 
ATOM   2740 N N     . MET B 1 78  ? 3.141   15.137  51.717  1.00   45.51  ? 63  MET B N     1 
ATOM   2741 C CA    . MET B 1 78  ? 3.258   15.360  50.284  1.00   43.29  ? 63  MET B CA    1 
ATOM   2742 C C     . MET B 1 78  ? 4.548   14.733  49.772  1.00   46.32  ? 63  MET B C     1 
ATOM   2743 O O     . MET B 1 78  ? 5.436   14.401  50.558  1.00   43.45  ? 63  MET B O     1 
ATOM   2744 C CB    . MET B 1 78  ? 3.240   16.852  49.957  1.00   43.39  ? 63  MET B CB    1 
ATOM   2745 C CG    . MET B 1 78  ? 2.014   17.615  50.475  1.00   46.22  ? 63  MET B CG    1 
ATOM   2746 S SD    . MET B 1 78  ? 1.973   19.279  49.763  1.00   51.55  ? 63  MET B SD    1 
ATOM   2747 C CE    . MET B 1 78  ? 1.928   20.270  51.223  1.00   45.28  ? 63  MET B CE    1 
ATOM   2748 N N     . ALA B 1 79  ? 4.647   14.577  48.455  1.00   44.10  ? 64  ALA B N     1 
ATOM   2749 C CA    . ALA B 1 79  ? 5.896   14.153  47.822  1.00   43.04  ? 64  ALA B CA    1 
ATOM   2750 C C     . ALA B 1 79  ? 6.354   15.246  46.867  1.00   45.58  ? 64  ALA B C     1 
ATOM   2751 O O     . ALA B 1 79  ? 5.524   15.878  46.201  1.00   41.81  ? 64  ALA B O     1 
ATOM   2752 C CB    . ALA B 1 79  ? 5.699   12.842  47.063  1.00   43.27  ? 64  ALA B CB    1 
ATOM   2753 N N     . PRO B 1 80  ? 7.676   15.485  46.803  1.00   42.61  ? 65  PRO B N     1 
ATOM   2754 C CA    . PRO B 1 80  ? 8.228   16.505  45.897  1.00   39.90  ? 65  PRO B CA    1 
ATOM   2755 C C     . PRO B 1 80  ? 7.732   16.282  44.480  1.00   41.73  ? 65  PRO B C     1 
ATOM   2756 O O     . PRO B 1 80  ? 7.559   15.142  44.068  1.00   44.08  ? 65  PRO B O     1 
ATOM   2757 C CB    . PRO B 1 80  ? 9.738   16.276  45.997  1.00   42.64  ? 65  PRO B CB    1 
ATOM   2758 C CG    . PRO B 1 80  ? 9.912   15.805  47.454  1.00   44.60  ? 65  PRO B CG    1 
ATOM   2759 C CD    . PRO B 1 80  ? 8.691   14.939  47.727  1.00   41.77  ? 65  PRO B CD    1 
ATOM   2760 N N     . GLY B 1 81  ? 7.472   17.357  43.750  1.00   43.72  ? 66  GLY B N     1 
ATOM   2761 C CA    . GLY B 1 81  ? 6.843   17.226  42.451  1.00   40.03  ? 66  GLY B CA    1 
ATOM   2762 C C     . GLY B 1 81  ? 5.963   18.409  42.112  1.00   41.24  ? 66  GLY B C     1 
ATOM   2763 O O     . GLY B 1 81  ? 5.785   19.333  42.912  1.00   41.55  ? 66  GLY B O     1 
ATOM   2764 N N     . HIS B 1 82  ? 5.413   18.374  40.911  1.00   41.25  ? 67  HIS B N     1 
ATOM   2765 C CA    . HIS B 1 82  ? 4.597   19.465  40.407  1.00   50.66  ? 67  HIS B CA    1 
ATOM   2766 C C     . HIS B 1 82  ? 3.201   19.527  41.036  1.00   44.93  ? 67  HIS B C     1 
ATOM   2767 O O     . HIS B 1 82  ? 2.606   20.599  41.098  1.00   45.44  ? 67  HIS B O     1 
ATOM   2768 C CB    . HIS B 1 82  ? 4.476   19.395  38.879  1.00   48.75  ? 67  HIS B CB    1 
ATOM   2769 C CG    . HIS B 1 82  ? 5.668   19.941  38.157  1.00   58.63  ? 67  HIS B CG    1 
ATOM   2770 N ND1   . HIS B 1 82  ? 6.805   19.196  37.922  1.00   57.88  ? 67  HIS B ND1   1 
ATOM   2771 C CD2   . HIS B 1 82  ? 5.899   21.163  37.615  1.00   61.88  ? 67  HIS B CD2   1 
ATOM   2772 C CE1   . HIS B 1 82  ? 7.687   19.936  37.273  1.00   60.84  ? 67  HIS B CE1   1 
ATOM   2773 N NE2   . HIS B 1 82  ? 7.161   21.133  37.073  1.00   63.08  ? 67  HIS B NE2   1 
ATOM   2774 N N     . VAL B 1 83  ? 2.667   18.387  41.458  1.00   40.00  ? 68  VAL B N     1 
ATOM   2775 C CA    . VAL B 1 83  ? 1.397   18.390  42.178  1.00   41.06  ? 68  VAL B CA    1 
ATOM   2776 C C     . VAL B 1 83  ? 1.578   19.131  43.500  1.00   39.67  ? 68  VAL B C     1 
ATOM   2777 O O     . VAL B 1 83  ? 0.840   20.063  43.801  1.00   38.84  ? 68  VAL B O     1 
ATOM   2778 C CB    . VAL B 1 83  ? 0.869   16.980  42.424  1.00   39.43  ? 68  VAL B CB    1 
ATOM   2779 C CG1   . VAL B 1 83  ? -0.371  17.009  43.331  1.00   36.39  ? 68  VAL B CG1   1 
ATOM   2780 C CG2   . VAL B 1 83  ? 0.544   16.316  41.082  1.00   39.10  ? 68  VAL B CG2   1 
ATOM   2781 N N     . ALA B 1 84  ? 2.592   18.746  44.264  1.00   38.66  ? 69  ALA B N     1 
ATOM   2782 C CA    . ALA B 1 84  ? 2.838   19.388  45.537  1.00   37.00  ? 69  ALA B CA    1 
ATOM   2783 C C     . ALA B 1 84  ? 3.130   20.885  45.352  1.00   44.68  ? 69  ALA B C     1 
ATOM   2784 O O     . ALA B 1 84  ? 2.759   21.697  46.205  1.00   39.66  ? 69  ALA B O     1 
ATOM   2785 C CB    . ALA B 1 84  ? 3.964   18.695  46.281  1.00   35.84  ? 69  ALA B CB    1 
ATOM   2786 N N     . ASP B 1 85  ? 3.778   21.247  44.239  1.00   40.89  ? 70  ASP B N     1 
ATOM   2787 C CA    . ASP B 1 85  ? 4.125   22.642  43.984  1.00   39.00  ? 70  ASP B CA    1 
ATOM   2788 C C     . ASP B 1 85  ? 2.855   23.470  43.821  1.00   37.78  ? 70  ASP B C     1 
ATOM   2789 O O     . ASP B 1 85  ? 2.748   24.575  44.361  1.00   37.56  ? 70  ASP B O     1 
ATOM   2790 C CB    . ASP B 1 85  ? 5.004   22.787  42.727  1.00   39.33  ? 70  ASP B CB    1 
ATOM   2791 C CG    . ASP B 1 85  ? 6.437   22.256  42.929  1.00   49.17  ? 70  ASP B CG    1 
ATOM   2792 O OD1   . ASP B 1 85  ? 6.859   22.036  44.087  1.00   49.24  ? 70  ASP B OD1   1 
ATOM   2793 O OD2   . ASP B 1 85  ? 7.153   22.071  41.915  1.00   55.34  ? 70  ASP B OD2   1 
ATOM   2794 N N     . PHE B 1 86  ? 1.911   22.944  43.047  1.00   33.16  ? 71  PHE B N     1 
ATOM   2795 C CA    . PHE B 1 86  ? 0.644   23.608  42.860  1.00   35.95  ? 71  PHE B CA    1 
ATOM   2796 C C     . PHE B 1 86  ? -0.066  23.749  44.206  1.00   36.59  ? 71  PHE B C     1 
ATOM   2797 O O     . PHE B 1 86  ? -0.525  24.833  44.565  1.00   36.99  ? 71  PHE B O     1 
ATOM   2798 C CB    . PHE B 1 86  ? -0.257  22.846  41.892  1.00   38.00  ? 71  PHE B CB    1 
ATOM   2799 C CG    . PHE B 1 86  ? -1.666  23.361  41.881  1.00   36.68  ? 71  PHE B CG    1 
ATOM   2800 C CD1   . PHE B 1 86  ? -2.022  24.412  41.062  1.00   38.66  ? 71  PHE B CD1   1 
ATOM   2801 C CD2   . PHE B 1 86  ? -2.621  22.826  42.737  1.00   38.91  ? 71  PHE B CD2   1 
ATOM   2802 C CE1   . PHE B 1 86  ? -3.318  24.914  41.074  1.00   43.47  ? 71  PHE B CE1   1 
ATOM   2803 C CE2   . PHE B 1 86  ? -3.921  23.322  42.757  1.00   36.75  ? 71  PHE B CE2   1 
ATOM   2804 C CZ    . PHE B 1 86  ? -4.271  24.363  41.930  1.00   37.97  ? 71  PHE B CZ    1 
ATOM   2805 N N     . LEU B 1 87  ? -0.128  22.652  44.954  1.00   34.21  ? 72  LEU B N     1 
ATOM   2806 C CA    . LEU B 1 87  ? -0.768  22.646  46.262  1.00   31.31  ? 72  LEU B CA    1 
ATOM   2807 C C     . LEU B 1 87  ? -0.118  23.620  47.265  1.00   35.99  ? 72  LEU B C     1 
ATOM   2808 O O     . LEU B 1 87  ? -0.827  24.336  47.992  1.00   31.74  ? 72  LEU B O     1 
ATOM   2809 C CB    . LEU B 1 87  ? -0.835  21.215  46.812  1.00   32.24  ? 72  LEU B CB    1 
ATOM   2810 C CG    . LEU B 1 87  ? -1.721  20.215  46.042  1.00   34.87  ? 72  LEU B CG    1 
ATOM   2811 C CD1   . LEU B 1 87  ? -1.673  18.848  46.703  1.00   31.12  ? 72  LEU B CD1   1 
ATOM   2812 C CD2   . LEU B 1 87  ? -3.184  20.709  45.926  1.00   29.88  ? 72  LEU B CD2   1 
ATOM   2813 N N     . VAL B 1 88  ? 1.220   23.638  47.310  1.00   34.56  ? 73  VAL B N     1 
ATOM   2814 C CA    . VAL B 1 88  ? 1.965   24.549  48.184  1.00   34.27  ? 73  VAL B CA    1 
ATOM   2815 C C     . VAL B 1 88  ? 1.708   26.000  47.782  1.00   35.28  ? 73  VAL B C     1 
ATOM   2816 O O     . VAL B 1 88  ? 1.454   26.854  48.618  1.00   34.56  ? 73  VAL B O     1 
ATOM   2817 C CB    . VAL B 1 88  ? 3.495   24.283  48.124  1.00   36.82  ? 73  VAL B CB    1 
ATOM   2818 C CG1   . VAL B 1 88  ? 4.261   25.425  48.748  1.00   34.15  ? 73  VAL B CG1   1 
ATOM   2819 C CG2   . VAL B 1 88  ? 3.834   22.979  48.811  1.00   36.32  ? 73  VAL B CG2   1 
ATOM   2820 N N     . ALA B 1 89  ? 1.772   26.286  46.492  1.00   32.14  ? 74  ALA B N     1 
ATOM   2821 C CA    . ALA B 1 89  ? 1.482   27.642  46.046  1.00   36.18  ? 74  ALA B CA    1 
ATOM   2822 C C     . ALA B 1 89  ? 0.026   28.039  46.378  1.00   34.93  ? 74  ALA B C     1 
ATOM   2823 O O     . ALA B 1 89  ? -0.258  29.202  46.639  1.00   34.12  ? 74  ALA B O     1 
ATOM   2824 C CB    . ALA B 1 89  ? 1.759   27.785  44.539  1.00   31.37  ? 74  ALA B CB    1 
ATOM   2825 N N     . ASP B 1 90  ? -0.897  27.082  46.365  1.00   32.68  ? 75  ASP B N     1 
ATOM   2826 C CA    . ASP B 1 90  ? -2.300  27.403  46.663  1.00   33.77  ? 75  ASP B CA    1 
ATOM   2827 C C     . ASP B 1 90  ? -2.526  27.634  48.171  1.00   31.33  ? 75  ASP B C     1 
ATOM   2828 O O     . ASP B 1 90  ? -3.205  28.581  48.573  1.00   30.49  ? 75  ASP B O     1 
ATOM   2829 C CB    . ASP B 1 90  ? -3.274  26.355  46.104  1.00   33.00  ? 75  ASP B CB    1 
ATOM   2830 C CG    . ASP B 1 90  ? -4.738  26.777  46.271  1.00   38.75  ? 75  ASP B CG    1 
ATOM   2831 O OD1   . ASP B 1 90  ? -5.273  27.484  45.386  1.00   38.88  ? 75  ASP B OD1   1 
ATOM   2832 O OD2   . ASP B 1 90  ? -5.347  26.425  47.307  1.00   41.10  ? 75  ASP B OD2   1 
ATOM   2833 N N     . PHE B 1 91  ? -1.935  26.779  48.994  1.00   30.43  ? 76  PHE B N     1 
ATOM   2834 C CA    . PHE B 1 91  ? -1.820  27.046  50.429  1.00   33.10  ? 76  PHE B CA    1 
ATOM   2835 C C     . PHE B 1 91  ? -1.357  28.483  50.726  1.00   32.44  ? 76  PHE B C     1 
ATOM   2836 O O     . PHE B 1 91  ? -2.000  29.222  51.489  1.00   31.15  ? 76  PHE B O     1 
ATOM   2837 C CB    . PHE B 1 91  ? -0.819  26.073  51.074  1.00   32.81  ? 76  PHE B CB    1 
ATOM   2838 C CG    . PHE B 1 91  ? -1.435  24.788  51.584  1.00   33.00  ? 76  PHE B CG    1 
ATOM   2839 C CD1   . PHE B 1 91  ? -0.974  23.556  51.138  1.00   31.36  ? 76  PHE B CD1   1 
ATOM   2840 C CD2   . PHE B 1 91  ? -2.438  24.816  52.531  1.00   31.37  ? 76  PHE B CD2   1 
ATOM   2841 C CE1   . PHE B 1 91  ? -1.525  22.376  51.614  1.00   33.12  ? 76  PHE B CE1   1 
ATOM   2842 C CE2   . PHE B 1 91  ? -2.991  23.639  53.026  1.00   34.19  ? 76  PHE B CE2   1 
ATOM   2843 C CZ    . PHE B 1 91  ? -2.540  22.416  52.555  1.00   34.88  ? 76  PHE B CZ    1 
ATOM   2844 N N     . ARG B 1 92  ? -0.224  28.862  50.135  1.00   31.76  ? 77  ARG B N     1 
ATOM   2845 C CA    . ARG B 1 92  ? 0.392   30.169  50.382  1.00   30.74  ? 77  ARG B CA    1 
ATOM   2846 C C     . ARG B 1 92  ? -0.461  31.317  49.840  1.00   27.14  ? 77  ARG B C     1 
ATOM   2847 O O     . ARG B 1 92  ? -0.503  32.391  50.425  1.00   29.10  ? 77  ARG B O     1 
ATOM   2848 C CB    . ARG B 1 92  ? 1.826   30.211  49.806  1.00   33.04  ? 77  ARG B CB    1 
ATOM   2849 C CG    . ARG B 1 92  ? 2.880   29.564  50.720  1.00   37.42  ? 77  ARG B CG    1 
ATOM   2850 C CD    . ARG B 1 92  ? 4.147   29.273  49.929  1.00   50.46  ? 77  ARG B CD    1 
ATOM   2851 N NE    . ARG B 1 92  ? 5.153   28.563  50.717  1.00   59.65  ? 77  ARG B NE    1 
ATOM   2852 C CZ    . ARG B 1 92  ? 6.272   28.044  50.215  1.00   60.10  ? 77  ARG B CZ    1 
ATOM   2853 N NH1   . ARG B 1 92  ? 6.533   28.148  48.912  1.00   51.93  ? 77  ARG B NH1   1 
ATOM   2854 N NH2   . ARG B 1 92  ? 7.123   27.409  51.019  1.00   59.47  ? 77  ARG B NH2   1 
ATOM   2855 N N     . ARG B 1 93  ? -1.124  31.082  48.717  1.00   25.48  ? 78  ARG B N     1 
ATOM   2856 C CA    . ARG B 1 93  ? -2.085  32.030  48.172  1.00   30.05  ? 78  ARG B CA    1 
ATOM   2857 C C     . ARG B 1 93  ? -3.163  32.348  49.218  1.00   32.68  ? 78  ARG B C     1 
ATOM   2858 O O     . ARG B 1 93  ? -3.695  33.466  49.253  1.00   30.18  ? 78  ARG B O     1 
ATOM   2859 C CB    . ARG B 1 93  ? -2.735  31.459  46.903  1.00   29.81  ? 78  ARG B CB    1 
ATOM   2860 C CG    . ARG B 1 93  ? -3.813  32.356  46.272  1.00   34.62  ? 78  ARG B CG    1 
ATOM   2861 C CD    . ARG B 1 93  ? -4.347  31.813  44.937  1.00   34.92  ? 78  ARG B CD    1 
ATOM   2862 N NE    . ARG B 1 93  ? -5.166  30.608  45.092  1.00   42.97  ? 78  ARG B NE    1 
ATOM   2863 C CZ    . ARG B 1 93  ? -6.485  30.620  45.310  1.00   47.08  ? 78  ARG B CZ    1 
ATOM   2864 N NH1   . ARG B 1 93  ? -7.132  31.777  45.416  1.00   45.48  ? 78  ARG B NH1   1 
ATOM   2865 N NH2   . ARG B 1 93  ? -7.164  29.481  45.421  1.00   39.83  ? 78  ARG B NH2   1 
ATOM   2866 N N     . ARG B 1 94  ? -3.480  31.355  50.056  1.00   30.83  ? 79  ARG B N     1 
ATOM   2867 C CA    . ARG B 1 94  ? -4.442  31.524  51.158  1.00   31.74  ? 79  ARG B CA    1 
ATOM   2868 C C     . ARG B 1 94  ? -3.793  31.847  52.515  1.00   32.50  ? 79  ARG B C     1 
ATOM   2869 O O     . ARG B 1 94  ? -4.463  31.793  53.537  1.00   34.45  ? 79  ARG B O     1 
ATOM   2870 C CB    . ARG B 1 94  ? -5.317  30.275  51.310  1.00   28.86  ? 79  ARG B CB    1 
ATOM   2871 C CG    . ARG B 1 94  ? -6.211  29.975  50.110  1.00   31.48  ? 79  ARG B CG    1 
ATOM   2872 C CD    . ARG B 1 94  ? -6.859  31.253  49.597  1.00   37.60  ? 79  ARG B CD    1 
ATOM   2873 N NE    . ARG B 1 94  ? -8.211  31.049  49.098  1.00   40.70  ? 79  ARG B NE    1 
ATOM   2874 C CZ    . ARG B 1 94  ? -9.028  32.029  48.719  1.00   46.79  ? 79  ARG B CZ    1 
ATOM   2875 N NH1   . ARG B 1 94  ? -8.629  33.295  48.768  1.00   45.89  ? 79  ARG B NH1   1 
ATOM   2876 N NH2   . ARG B 1 94  ? -10.257 31.743  48.297  1.00   47.83  ? 79  ARG B NH2   1 
ATOM   2877 N N     . GLY B 1 95  ? -2.494  32.152  52.544  1.00   28.89  ? 80  GLY B N     1 
ATOM   2878 C CA    . GLY B 1 95  ? -1.841  32.555  53.787  1.00   25.34  ? 80  GLY B CA    1 
ATOM   2879 C C     . GLY B 1 95  ? -1.611  31.414  54.782  1.00   29.16  ? 80  GLY B C     1 
ATOM   2880 O O     . GLY B 1 95  ? -1.461  31.640  55.990  1.00   29.92  ? 80  GLY B O     1 
ATOM   2881 N N     . VAL B 1 96  ? -1.591  30.179  54.288  1.00   26.29  ? 81  VAL B N     1 
ATOM   2882 C CA    . VAL B 1 96  ? -1.380  29.035  55.162  1.00   27.94  ? 81  VAL B CA    1 
ATOM   2883 C C     . VAL B 1 96  ? 0.100   28.695  55.278  1.00   30.77  ? 81  VAL B C     1 
ATOM   2884 O O     . VAL B 1 96  ? 0.803   28.605  54.278  1.00   34.87  ? 81  VAL B O     1 
ATOM   2885 C CB    . VAL B 1 96  ? -2.143  27.769  54.691  1.00   30.35  ? 81  VAL B CB    1 
ATOM   2886 C CG1   . VAL B 1 96  ? -1.877  26.633  55.667  1.00   27.60  ? 81  VAL B CG1   1 
ATOM   2887 C CG2   . VAL B 1 96  ? -3.662  28.036  54.553  1.00   29.44  ? 81  VAL B CG2   1 
ATOM   2888 N N     . ASP B 1 97  ? 0.565   28.516  56.506  1.00   33.76  ? 82  ASP B N     1 
ATOM   2889 C CA    . ASP B 1 97  ? 1.948   28.143  56.808  1.00   32.48  ? 82  ASP B CA    1 
ATOM   2890 C C     . ASP B 1 97  ? 2.130   26.637  56.532  1.00   34.64  ? 82  ASP B C     1 
ATOM   2891 O O     . ASP B 1 97  ? 1.442   25.794  57.126  1.00   31.77  ? 82  ASP B O     1 
ATOM   2892 C CB    . ASP B 1 97  ? 2.206   28.529  58.272  1.00   33.21  ? 82  ASP B CB    1 
ATOM   2893 C CG    . ASP B 1 97  ? 3.525   27.999  58.845  1.00   41.39  ? 82  ASP B CG    1 
ATOM   2894 O OD1   . ASP B 1 97  ? 4.050   26.961  58.387  1.00   47.27  ? 82  ASP B OD1   1 
ATOM   2895 O OD2   . ASP B 1 97  ? 4.015   28.622  59.820  1.00   40.27  ? 82  ASP B OD2   1 
ATOM   2896 N N     . VAL B 1 98  ? 3.029   26.303  55.603  1.00   33.55  ? 83  VAL B N     1 
ATOM   2897 C CA    . VAL B 1 98  ? 3.252   24.912  55.195  1.00   33.22  ? 83  VAL B CA    1 
ATOM   2898 C C     . VAL B 1 98  ? 4.551   24.279  55.744  1.00   37.72  ? 83  VAL B C     1 
ATOM   2899 O O     . VAL B 1 98  ? 4.922   23.171  55.376  1.00   36.66  ? 83  VAL B O     1 
ATOM   2900 C CB    . VAL B 1 98  ? 3.268   24.781  53.661  1.00   42.74  ? 83  VAL B CB    1 
ATOM   2901 C CG1   . VAL B 1 98  ? 1.954   25.259  53.074  1.00   38.32  ? 83  VAL B CG1   1 
ATOM   2902 C CG2   . VAL B 1 98  ? 4.435   25.566  53.069  1.00   40.50  ? 83  VAL B CG2   1 
ATOM   2903 N N     . SER B 1 99  ? 5.228   24.966  56.649  1.00   35.92  ? 84  SER B N     1 
ATOM   2904 C CA    . SER B 1 99  ? 6.517   24.484  57.134  1.00   38.07  ? 84  SER B CA    1 
ATOM   2905 C C     . SER B 1 99  ? 6.475   23.139  57.876  1.00   43.51  ? 84  SER B C     1 
ATOM   2906 O O     . SER B 1 99  ? 7.528   22.574  58.162  1.00   37.96  ? 84  SER B O     1 
ATOM   2907 C CB    . SER B 1 99  ? 7.159   25.537  58.039  1.00   37.32  ? 84  SER B CB    1 
ATOM   2908 O OG    . SER B 1 99  ? 6.434   25.650  59.241  1.00   45.13  ? 84  SER B OG    1 
ATOM   2909 N N     . GLN B 1 100 ? 5.286   22.629  58.212  1.00   38.58  ? 85  GLN B N     1 
ATOM   2910 C CA    . GLN B 1 100 ? 5.209   21.357  58.942  1.00   34.82  ? 85  GLN B CA    1 
ATOM   2911 C C     . GLN B 1 100 ? 4.831   20.228  58.019  1.00   38.38  ? 85  GLN B C     1 
ATOM   2912 O O     . GLN B 1 100 ? 4.582   19.125  58.479  1.00   44.07  ? 85  GLN B O     1 
ATOM   2913 C CB    . GLN B 1 100 ? 4.173   21.383  60.072  1.00   40.15  ? 85  GLN B CB    1 
ATOM   2914 C CG    . GLN B 1 100 ? 4.250   22.569  60.979  1.00   42.92  ? 85  GLN B CG    1 
ATOM   2915 C CD    . GLN B 1 100 ? 5.510   22.559  61.819  1.00   45.42  ? 85  GLN B CD    1 
ATOM   2916 O OE1   . GLN B 1 100 ? 5.971   23.605  62.263  1.00   45.18  ? 85  GLN B OE1   1 
ATOM   2917 N NE2   . GLN B 1 100 ? 6.068   21.371  62.048  1.00   46.59  ? 85  GLN B NE2   1 
ATOM   2918 N N     . VAL B 1 101 ? 4.754   20.489  56.722  1.00   36.48  ? 86  VAL B N     1 
ATOM   2919 C CA    . VAL B 1 101 ? 4.464   19.395  55.813  1.00   38.60  ? 86  VAL B CA    1 
ATOM   2920 C C     . VAL B 1 101 ? 5.442   18.248  56.065  1.00   43.28  ? 86  VAL B C     1 
ATOM   2921 O O     . VAL B 1 101 ? 6.615   18.476  56.374  1.00   43.80  ? 86  VAL B O     1 
ATOM   2922 C CB    . VAL B 1 101 ? 4.544   19.832  54.359  1.00   41.71  ? 86  VAL B CB    1 
ATOM   2923 C CG1   . VAL B 1 101 ? 4.498   18.603  53.439  1.00   41.78  ? 86  VAL B CG1   1 
ATOM   2924 C CG2   . VAL B 1 101 ? 3.404   20.801  54.051  1.00   41.59  ? 86  VAL B CG2   1 
ATOM   2925 N N     . ALA B 1 102 ? 4.949   17.021  55.975  1.00   40.22  ? 87  ALA B N     1 
ATOM   2926 C CA    . ALA B 1 102 ? 5.789   15.853  56.129  1.00   38.58  ? 87  ALA B CA    1 
ATOM   2927 C C     . ALA B 1 102 ? 6.140   15.358  54.738  1.00   44.80  ? 87  ALA B C     1 
ATOM   2928 O O     . ALA B 1 102 ? 5.360   14.625  54.120  1.00   44.71  ? 87  ALA B O     1 
ATOM   2929 C CB    . ALA B 1 102 ? 5.060   14.782  56.895  1.00   42.67  ? 87  ALA B CB    1 
ATOM   2930 N N     . TRP B 1 103 ? 7.307   15.766  54.239  1.00   40.65  ? 88  TRP B N     1 
ATOM   2931 C CA    . TRP B 1 103 ? 7.717   15.389  52.890  1.00   45.38  ? 88  TRP B CA    1 
ATOM   2932 C C     . TRP B 1 103 ? 8.145   13.925  52.803  1.00   43.89  ? 88  TRP B C     1 
ATOM   2933 O O     . TRP B 1 103 ? 8.753   13.390  53.716  1.00   52.32  ? 88  TRP B O     1 
ATOM   2934 C CB    . TRP B 1 103 ? 8.805   16.318  52.382  1.00   39.70  ? 88  TRP B CB    1 
ATOM   2935 C CG    . TRP B 1 103 ? 8.332   17.714  52.256  1.00   43.60  ? 88  TRP B CG    1 
ATOM   2936 C CD1   . TRP B 1 103 ? 8.478   18.716  53.176  1.00   39.26  ? 88  TRP B CD1   1 
ATOM   2937 C CD2   . TRP B 1 103 ? 7.609   18.284  51.149  1.00   44.13  ? 88  TRP B CD2   1 
ATOM   2938 N NE1   . TRP B 1 103 ? 7.910   19.874  52.698  1.00   40.41  ? 88  TRP B NE1   1 
ATOM   2939 C CE2   . TRP B 1 103 ? 7.373   19.636  51.461  1.00   41.32  ? 88  TRP B CE2   1 
ATOM   2940 C CE3   . TRP B 1 103 ? 7.152   17.782  49.925  1.00   40.71  ? 88  TRP B CE3   1 
ATOM   2941 C CZ2   . TRP B 1 103 ? 6.691   20.489  50.594  1.00   41.79  ? 88  TRP B CZ2   1 
ATOM   2942 C CZ3   . TRP B 1 103 ? 6.494   18.633  49.066  1.00   39.89  ? 88  TRP B CZ3   1 
ATOM   2943 C CH2   . TRP B 1 103 ? 6.265   19.971  49.404  1.00   39.99  ? 88  TRP B CH2   1 
ATOM   2944 N N     . GLN B 1 104 ? 7.790   13.278  51.708  1.00   46.04  ? 89  GLN B N     1 
ATOM   2945 C CA    . GLN B 1 104 ? 7.925   11.835  51.593  1.00   52.67  ? 89  GLN B CA    1 
ATOM   2946 C C     . GLN B 1 104 ? 8.781   11.480  50.397  1.00   57.20  ? 89  GLN B C     1 
ATOM   2947 O O     . GLN B 1 104 ? 8.701   12.125  49.349  1.00   61.10  ? 89  GLN B O     1 
ATOM   2948 C CB    . GLN B 1 104 ? 6.548   11.193  51.435  1.00   48.88  ? 89  GLN B CB    1 
ATOM   2949 C CG    . GLN B 1 104 ? 5.567   11.624  52.512  1.00   53.05  ? 89  GLN B CG    1 
ATOM   2950 C CD    . GLN B 1 104 ? 5.706   10.815  53.774  1.00   53.28  ? 89  GLN B CD    1 
ATOM   2951 O OE1   . GLN B 1 104 ? 6.060   9.639   53.721  1.00   58.10  ? 89  GLN B OE1   1 
ATOM   2952 N NE2   . GLN B 1 104 ? 5.423   11.433  54.920  1.00   49.18  ? 89  GLN B NE2   1 
ATOM   2953 N N     . SER B 1 105 ? 9.595   10.441  50.547  1.00   62.46  ? 90  SER B N     1 
ATOM   2954 C CA    . SER B 1 105 ? 10.422  9.970   49.439  1.00   63.67  ? 90  SER B CA    1 
ATOM   2955 C C     . SER B 1 105 ? 9.714   8.854   48.673  1.00   61.19  ? 90  SER B C     1 
ATOM   2956 O O     . SER B 1 105 ? 10.114  8.496   47.569  1.00   64.36  ? 90  SER B O     1 
ATOM   2957 C CB    . SER B 1 105 ? 11.794  9.517   49.945  1.00   58.62  ? 90  SER B CB    1 
ATOM   2958 O OG    . SER B 1 105 ? 11.692  8.958   51.243  1.00   57.67  ? 90  SER B OG    1 
ATOM   2959 N N     . LYS B 1 106 ? 8.641   8.330   49.252  1.00   61.12  ? 91  LYS B N     1 
ATOM   2960 C CA    . LYS B 1 106 ? 7.875   7.264   48.613  1.00   62.58  ? 91  LYS B CA    1 
ATOM   2961 C C     . LYS B 1 106 ? 6.417   7.674   48.414  1.00   58.94  ? 91  LYS B C     1 
ATOM   2962 O O     . LYS B 1 106 ? 5.788   8.190   49.330  1.00   56.00  ? 91  LYS B O     1 
ATOM   2963 C CB    . LYS B 1 106 ? 7.924   6.007   49.483  1.00   67.45  ? 91  LYS B CB    1 
ATOM   2964 C CG    . LYS B 1 106 ? 7.275   4.786   48.861  1.00   75.02  ? 91  LYS B CG    1 
ATOM   2965 C CD    . LYS B 1 106 ? 8.261   4.040   47.964  1.00   83.81  ? 91  LYS B CD    1 
ATOM   2966 C CE    . LYS B 1 106 ? 7.761   2.634   47.635  1.00   90.26  ? 91  LYS B CE    1 
ATOM   2967 N NZ    . LYS B 1 106 ? 8.848   1.762   47.094  1.00   92.15  ? 91  LYS B NZ    1 
ATOM   2968 N N     . GLY B 1 107 ? 5.882   7.437   47.220  1.00   58.34  ? 92  GLY B N     1 
ATOM   2969 C CA    . GLY B 1 107 ? 4.465   7.637   46.962  1.00   53.37  ? 92  GLY B CA    1 
ATOM   2970 C C     . GLY B 1 107 ? 4.107   8.847   46.113  1.00   50.50  ? 92  GLY B C     1 
ATOM   2971 O O     . GLY B 1 107 ? 4.965   9.649   45.761  1.00   53.79  ? 92  GLY B O     1 
ATOM   2972 N N     . ASP B 1 108 ? 2.825   8.963   45.783  1.00   48.06  ? 93  ASP B N     1 
ATOM   2973 C CA    . ASP B 1 108 ? 2.298   10.071  44.980  1.00   53.42  ? 93  ASP B CA    1 
ATOM   2974 C C     . ASP B 1 108 ? 1.521   11.076  45.835  1.00   47.22  ? 93  ASP B C     1 
ATOM   2975 O O     . ASP B 1 108 ? 0.730   10.694  46.692  1.00   45.52  ? 93  ASP B O     1 
ATOM   2976 C CB    . ASP B 1 108 ? 1.356   9.531   43.897  1.00   53.69  ? 93  ASP B CB    1 
ATOM   2977 C CG    . ASP B 1 108 ? 2.085   8.738   42.837  1.00   63.76  ? 93  ASP B CG    1 
ATOM   2978 O OD1   . ASP B 1 108 ? 3.283   9.038   42.602  1.00   70.09  ? 93  ASP B OD1   1 
ATOM   2979 O OD2   . ASP B 1 108 ? 1.468   7.816   42.245  1.00   65.60  ? 93  ASP B OD2   1 
ATOM   2980 N N     . THR B 1 109 ? 1.750   12.359  45.607  1.00   46.45  ? 94  THR B N     1 
ATOM   2981 C CA    . THR B 1 109 ? 0.910   13.373  46.209  1.00   43.54  ? 94  THR B CA    1 
ATOM   2982 C C     . THR B 1 109 ? -0.506  13.148  45.662  1.00   40.61  ? 94  THR B C     1 
ATOM   2983 O O     . THR B 1 109 ? -0.697  13.076  44.458  1.00   37.20  ? 94  THR B O     1 
ATOM   2984 C CB    . THR B 1 109 ? 1.432   14.781  45.883  1.00   42.63  ? 94  THR B CB    1 
ATOM   2985 O OG1   . THR B 1 109 ? 2.790   14.894  46.321  1.00   44.62  ? 94  THR B OG1   1 
ATOM   2986 C CG2   . THR B 1 109 ? 0.613   15.850  46.596  1.00   42.73  ? 94  THR B CG2   1 
ATOM   2987 N N     . PRO B 1 110 ? -1.495  13.012  46.557  1.00   40.09  ? 95  PRO B N     1 
ATOM   2988 C CA    . PRO B 1 110 ? -2.878  12.697  46.181  1.00   39.95  ? 95  PRO B CA    1 
ATOM   2989 C C     . PRO B 1 110 ? -3.469  13.674  45.165  1.00   39.72  ? 95  PRO B C     1 
ATOM   2990 O O     . PRO B 1 110 ? -3.335  14.892  45.273  1.00   37.63  ? 95  PRO B O     1 
ATOM   2991 C CB    . PRO B 1 110 ? -3.649  12.803  47.510  1.00   40.69  ? 95  PRO B CB    1 
ATOM   2992 C CG    . PRO B 1 110 ? -2.637  12.677  48.573  1.00   43.20  ? 95  PRO B CG    1 
ATOM   2993 C CD    . PRO B 1 110 ? -1.354  13.254  48.003  1.00   43.36  ? 95  PRO B CD    1 
ATOM   2994 N N     . SER B 1 111 ? -4.137  13.114  44.174  1.00   37.93  ? 96  SER B N     1 
ATOM   2995 C CA    . SER B 1 111 ? -4.836  13.885  43.176  1.00   40.92  ? 96  SER B CA    1 
ATOM   2996 C C     . SER B 1 111 ? -6.080  13.087  42.828  1.00   43.64  ? 96  SER B C     1 
ATOM   2997 O O     . SER B 1 111 ? -6.043  11.864  42.817  1.00   47.35  ? 96  SER B O     1 
ATOM   2998 C CB    . SER B 1 111 ? -3.954  14.082  41.947  1.00   44.24  ? 96  SER B CB    1 
ATOM   2999 O OG    . SER B 1 111 ? -4.727  14.530  40.844  1.00   53.05  ? 96  SER B OG    1 
ATOM   3000 N N     . SER B 1 112 ? -7.189  13.769  42.585  1.00   42.53  ? 97  SER B N     1 
ATOM   3001 C CA    . SER B 1 112 ? -8.449  13.097  42.300  1.00   41.26  ? 97  SER B CA    1 
ATOM   3002 C C     . SER B 1 112 ? -9.056  13.693  41.068  1.00   37.95  ? 97  SER B C     1 
ATOM   3003 O O     . SER B 1 112 ? -8.866  14.860  40.784  1.00   41.30  ? 97  SER B O     1 
ATOM   3004 C CB    . SER B 1 112 ? -9.433  13.229  43.467  1.00   43.38  ? 97  SER B CB    1 
ATOM   3005 O OG    . SER B 1 112 ? -8.979  12.486  44.594  1.00   47.86  ? 97  SER B OG    1 
ATOM   3006 N N     . CYS B 1 113 ? -9.783  12.876  40.327  1.00   41.84  ? 98  CYS B N     1 
ATOM   3007 C CA    . CYS B 1 113 ? -10.438 13.333  39.118  1.00   45.39  ? 98  CYS B CA    1 
ATOM   3008 C C     . CYS B 1 113 ? -11.938 13.338  39.375  1.00   46.71  ? 98  CYS B C     1 
ATOM   3009 O O     . CYS B 1 113 ? -12.501 12.345  39.849  1.00   48.42  ? 98  CYS B O     1 
ATOM   3010 C CB    . CYS B 1 113 ? -10.084 12.407  37.950  1.00   45.64  ? 98  CYS B CB    1 
ATOM   3011 S SG    . CYS B 1 113 ? -10.954 12.780  36.409  1.00   69.08  ? 98  CYS B SG    1 
ATOM   3012 N N     . CYS B 1 114 ? -12.584 14.465  39.100  1.00   43.68  ? 99  CYS B N     1 
ATOM   3013 C CA    . CYS B 1 114 ? -14.024 14.560  39.308  1.00   47.63  ? 99  CYS B CA    1 
ATOM   3014 C C     . CYS B 1 114 ? -14.708 15.028  38.031  1.00   51.40  ? 99  CYS B C     1 
ATOM   3015 O O     . CYS B 1 114 ? -14.311 16.016  37.416  1.00   49.39  ? 99  CYS B O     1 
ATOM   3016 C CB    . CYS B 1 114 ? -14.363 15.502  40.463  1.00   50.28  ? 99  CYS B CB    1 
ATOM   3017 S SG    . CYS B 1 114 ? -16.158 15.751  40.670  1.00   67.22  ? 99  CYS B SG    1 
ATOM   3018 N N     . ILE B 1 115 ? -15.733 14.302  37.625  1.00   49.25  ? 100 ILE B N     1 
ATOM   3019 C CA    . ILE B 1 115 ? -16.413 14.630  36.398  1.00   49.49  ? 100 ILE B CA    1 
ATOM   3020 C C     . ILE B 1 115 ? -17.830 14.993  36.757  1.00   52.00  ? 100 ILE B C     1 
ATOM   3021 O O     . ILE B 1 115 ? -18.549 14.200  37.367  1.00   51.48  ? 100 ILE B O     1 
ATOM   3022 C CB    . ILE B 1 115 ? -16.368 13.462  35.402  1.00   54.43  ? 100 ILE B CB    1 
ATOM   3023 C CG1   . ILE B 1 115 ? -14.914 13.168  35.021  1.00   47.53  ? 100 ILE B CG1   1 
ATOM   3024 C CG2   . ILE B 1 115 ? -17.205 13.773  34.145  1.00   46.46  ? 100 ILE B CG2   1 
ATOM   3025 C CD1   . ILE B 1 115 ? -14.767 11.938  34.192  1.00   51.00  ? 100 ILE B CD1   1 
ATOM   3026 N N     . ILE B 1 116 ? -18.208 16.218  36.417  1.00   53.49  ? 101 ILE B N     1 
ATOM   3027 C CA    . ILE B 1 116 ? -19.520 16.736  36.776  1.00   56.82  ? 101 ILE B CA    1 
ATOM   3028 C C     . ILE B 1 116 ? -20.388 16.821  35.543  1.00   52.61  ? 101 ILE B C     1 
ATOM   3029 O O     . ILE B 1 116 ? -20.016 17.470  34.565  1.00   55.26  ? 101 ILE B O     1 
ATOM   3030 C CB    . ILE B 1 116 ? -19.419 18.133  37.413  1.00   55.86  ? 101 ILE B CB    1 
ATOM   3031 C CG1   . ILE B 1 116 ? -18.631 18.063  38.721  1.00   56.67  ? 101 ILE B CG1   1 
ATOM   3032 C CG2   . ILE B 1 116 ? -20.815 18.713  37.650  1.00   59.46  ? 101 ILE B CG2   1 
ATOM   3033 C CD1   . ILE B 1 116 ? -18.334 19.404  39.327  1.00   56.37  ? 101 ILE B CD1   1 
ATOM   3034 N N     . ASN B 1 117 ? -21.536 16.156  35.586  1.00   55.82  ? 102 ASN B N     1 
ATOM   3035 C CA    . ASN B 1 117 ? -22.473 16.191  34.469  1.00   64.52  ? 102 ASN B CA    1 
ATOM   3036 C C     . ASN B 1 117 ? -23.287 17.471  34.512  1.00   65.63  ? 102 ASN B C     1 
ATOM   3037 O O     . ASN B 1 117 ? -23.968 17.737  35.491  1.00   68.26  ? 102 ASN B O     1 
ATOM   3038 C CB    . ASN B 1 117 ? -23.398 14.974  34.502  1.00   68.70  ? 102 ASN B CB    1 
ATOM   3039 C CG    . ASN B 1 117 ? -24.121 14.752  33.180  1.00   73.03  ? 102 ASN B CG    1 
ATOM   3040 O OD1   . ASN B 1 117 ? -24.328 15.691  32.406  1.00   73.34  ? 102 ASN B OD1   1 
ATOM   3041 N ND2   . ASN B 1 117 ? -24.502 13.504  32.912  1.00   66.51  ? 102 ASN B ND2   1 
ATOM   3042 N N     . ASN B 1 118 ? -23.209 18.268  33.453  1.00   68.31  ? 103 ASN B N     1 
ATOM   3043 C CA    . ASN B 1 118 ? -23.870 19.570  33.438  1.00   69.89  ? 103 ASN B CA    1 
ATOM   3044 C C     . ASN B 1 118 ? -25.388 19.470  33.262  1.00   72.36  ? 103 ASN B C     1 
ATOM   3045 O O     . ASN B 1 118 ? -26.138 20.329  33.725  1.00   71.42  ? 103 ASN B O     1 
ATOM   3046 C CB    . ASN B 1 118 ? -23.259 20.468  32.361  1.00   67.51  ? 103 ASN B CB    1 
ATOM   3047 C CG    . ASN B 1 118 ? -23.661 21.924  32.515  1.00   69.78  ? 103 ASN B CG    1 
ATOM   3048 O OD1   . ASN B 1 118 ? -24.221 22.525  31.600  1.00   71.56  ? 103 ASN B OD1   1 
ATOM   3049 N ND2   . ASN B 1 118 ? -23.377 22.497  33.680  1.00   70.64  ? 103 ASN B ND2   1 
ATOM   3050 N N     . SER B 1 119 ? -25.840 18.405  32.613  1.00   72.38  ? 104 SER B N     1 
ATOM   3051 C CA    . SER B 1 119 ? -27.264 18.243  32.345  1.00   72.99  ? 104 SER B CA    1 
ATOM   3052 C C     . SER B 1 119 ? -27.966 17.289  33.309  1.00   76.67  ? 104 SER B C     1 
ATOM   3053 O O     . SER B 1 119 ? -28.886 16.577  32.909  1.00   81.94  ? 104 SER B O     1 
ATOM   3054 C CB    . SER B 1 119 ? -27.480 17.773  30.906  1.00   75.27  ? 104 SER B CB    1 
ATOM   3055 O OG    . SER B 1 119 ? -26.830 16.536  30.674  1.00   74.32  ? 104 SER B OG    1 
ATOM   3056 N N     . ASN B 1 120 ? -27.535 17.275  34.568  1.00   75.65  ? 105 ASN B N     1 
ATOM   3057 C CA    . ASN B 1 120 ? -28.200 16.490  35.610  1.00   73.36  ? 105 ASN B CA    1 
ATOM   3058 C C     . ASN B 1 120 ? -27.450 16.562  36.930  1.00   72.28  ? 105 ASN B C     1 
ATOM   3059 O O     . ASN B 1 120 ? -27.844 15.938  37.915  1.00   71.67  ? 105 ASN B O     1 
ATOM   3060 C CB    . ASN B 1 120 ? -28.413 15.031  35.179  1.00   73.40  ? 105 ASN B CB    1 
ATOM   3061 C CG    . ASN B 1 120 ? -27.182 14.166  35.385  1.00   77.93  ? 105 ASN B CG    1 
ATOM   3062 O OD1   . ASN B 1 120 ? -26.074 14.670  35.591  1.00   75.66  ? 105 ASN B OD1   1 
ATOM   3063 N ND2   . ASN B 1 120 ? -27.371 12.848  35.321  1.00   75.93  ? 105 ASN B ND2   1 
ATOM   3064 N N     . GLY B 1 121 ? -26.351 17.313  36.923  1.00   72.89  ? 106 GLY B N     1 
ATOM   3065 C CA    . GLY B 1 121 ? -25.598 17.627  38.124  1.00   67.88  ? 106 GLY B CA    1 
ATOM   3066 C C     . GLY B 1 121 ? -24.767 16.523  38.757  1.00   66.89  ? 106 GLY B C     1 
ATOM   3067 O O     . GLY B 1 121 ? -24.052 16.776  39.728  1.00   64.05  ? 106 GLY B O     1 
ATOM   3068 N N     . ASN B 1 122 ? -24.848 15.306  38.230  1.00   68.02  ? 107 ASN B N     1 
ATOM   3069 C CA    . ASN B 1 122 ? -24.132 14.184  38.847  1.00   71.94  ? 107 ASN B CA    1 
ATOM   3070 C C     . ASN B 1 122 ? -22.606 14.313  38.861  1.00   64.27  ? 107 ASN B C     1 
ATOM   3071 O O     . ASN B 1 122 ? -22.007 14.941  37.988  1.00   60.77  ? 107 ASN B O     1 
ATOM   3072 C CB    . ASN B 1 122 ? -24.546 12.849  38.231  1.00   71.24  ? 107 ASN B CB    1 
ATOM   3073 C CG    . ASN B 1 122 ? -25.986 12.512  38.521  1.00   74.13  ? 107 ASN B CG    1 
ATOM   3074 O OD1   . ASN B 1 122 ? -26.636 11.797  37.759  1.00   78.17  ? 107 ASN B OD1   1 
ATOM   3075 N ND2   . ASN B 1 122 ? -26.505 13.048  39.621  1.00   71.28  ? 107 ASN B ND2   1 
ATOM   3076 N N     . ARG B 1 123 ? -21.993 13.713  39.873  1.00   60.69  ? 108 ARG B N     1 
ATOM   3077 C CA    . ARG B 1 123 ? -20.557 13.788  40.048  1.00   61.85  ? 108 ARG B CA    1 
ATOM   3078 C C     . ARG B 1 123 ? -20.000 12.383  40.063  1.00   61.18  ? 108 ARG B C     1 
ATOM   3079 O O     . ARG B 1 123 ? -20.372 11.579  40.921  1.00   60.04  ? 108 ARG B O     1 
ATOM   3080 C CB    . ARG B 1 123 ? -20.216 14.485  41.367  1.00   61.59  ? 108 ARG B CB    1 
ATOM   3081 C CG    . ARG B 1 123 ? -21.210 15.552  41.763  1.00   67.02  ? 108 ARG B CG    1 
ATOM   3082 C CD    . ARG B 1 123 ? -20.537 16.866  42.112  1.00   67.62  ? 108 ARG B CD    1 
ATOM   3083 N NE    . ARG B 1 123 ? -19.196 16.689  42.661  1.00   69.23  ? 108 ARG B NE    1 
ATOM   3084 C CZ    . ARG B 1 123 ? -18.928 16.436  43.940  1.00   76.39  ? 108 ARG B CZ    1 
ATOM   3085 N NH1   . ARG B 1 123 ? -19.921 16.311  44.818  1.00   74.26  ? 108 ARG B NH1   1 
ATOM   3086 N NH2   . ARG B 1 123 ? -17.661 16.302  44.339  1.00   68.83  ? 108 ARG B NH2   1 
ATOM   3087 N N     . THR B 1 124 ? -19.119 12.089  39.111  1.00   55.88  ? 109 THR B N     1 
ATOM   3088 C CA    . THR B 1 124 ? -18.429 10.806  39.067  1.00   54.77  ? 109 THR B CA    1 
ATOM   3089 C C     . THR B 1 124 ? -16.990 11.030  39.504  1.00   51.33  ? 109 THR B C     1 
ATOM   3090 O O     . THR B 1 124 ? -16.310 11.910  38.983  1.00   52.04  ? 109 THR B O     1 
ATOM   3091 C CB    . THR B 1 124 ? -18.453 10.204  37.658  1.00   59.52  ? 109 THR B CB    1 
ATOM   3092 O OG1   . THR B 1 124 ? -19.810 10.114  37.202  1.00   63.90  ? 109 THR B OG1   1 
ATOM   3093 C CG2   . THR B 1 124 ? -17.820 8.812   37.656  1.00   57.88  ? 109 THR B CG2   1 
ATOM   3094 N N     . ILE B 1 125 ? -16.525 10.243  40.466  1.00   49.56  ? 110 ILE B N     1 
ATOM   3095 C CA    . ILE B 1 125 ? -15.245 10.524  41.095  1.00   49.15  ? 110 ILE B CA    1 
ATOM   3096 C C     . ILE B 1 125 ? -14.239 9.385   41.024  1.00   49.88  ? 110 ILE B C     1 
ATOM   3097 O O     . ILE B 1 125 ? -14.560 8.242   41.356  1.00   49.65  ? 110 ILE B O     1 
ATOM   3098 C CB    . ILE B 1 125 ? -15.417 10.896  42.578  1.00   54.10  ? 110 ILE B CB    1 
ATOM   3099 C CG1   . ILE B 1 125 ? -16.354 12.094  42.720  1.00   54.44  ? 110 ILE B CG1   1 
ATOM   3100 C CG2   . ILE B 1 125 ? -14.056 11.199  43.211  1.00   47.68  ? 110 ILE B CG2   1 
ATOM   3101 C CD1   . ILE B 1 125 ? -16.411 12.627  44.128  1.00   58.23  ? 110 ILE B CD1   1 
ATOM   3102 N N     . VAL B 1 126 ? -13.019 9.713   40.600  1.00   45.87  ? 111 VAL B N     1 
ATOM   3103 C CA    . VAL B 1 126 ? -11.902 8.786   40.689  1.00   42.86  ? 111 VAL B CA    1 
ATOM   3104 C C     . VAL B 1 126 ? -10.968 9.285   41.782  1.00   44.51  ? 111 VAL B C     1 
ATOM   3105 O O     . VAL B 1 126 ? -10.258 10.282  41.598  1.00   46.72  ? 111 VAL B O     1 
ATOM   3106 C CB    . VAL B 1 126 ? -11.140 8.660   39.351  1.00   42.05  ? 111 VAL B CB    1 
ATOM   3107 C CG1   . VAL B 1 126 ? -9.981  7.669   39.486  1.00   41.41  ? 111 VAL B CG1   1 
ATOM   3108 C CG2   . VAL B 1 126 ? -12.077 8.234   38.243  1.00   43.31  ? 111 VAL B CG2   1 
ATOM   3109 N N     . LEU B 1 127 ? -10.976 8.595   42.920  1.00   44.21  ? 112 LEU B N     1 
ATOM   3110 C CA    . LEU B 1 127 ? -10.208 9.010   44.086  1.00   41.68  ? 112 LEU B CA    1 
ATOM   3111 C C     . LEU B 1 127 ? -8.728  8.753   43.932  1.00   45.05  ? 112 LEU B C     1 
ATOM   3112 O O     . LEU B 1 127 ? -8.305  7.849   43.207  1.00   43.44  ? 112 LEU B O     1 
ATOM   3113 C CB    . LEU B 1 127 ? -10.665 8.275   45.339  1.00   46.88  ? 112 LEU B CB    1 
ATOM   3114 C CG    . LEU B 1 127 ? -11.832 8.866   46.119  1.00   59.70  ? 112 LEU B CG    1 
ATOM   3115 C CD1   . LEU B 1 127 ? -11.592 10.359  46.409  1.00   55.01  ? 112 LEU B CD1   1 
ATOM   3116 C CD2   . LEU B 1 127 ? -13.086 8.666   45.320  1.00   57.94  ? 112 LEU B CD2   1 
ATOM   3117 N N     . HIS B 1 128 ? -7.957  9.546   44.661  1.00   43.91  ? 113 HIS B N     1 
ATOM   3118 C CA    . HIS B 1 128 ? -6.515  9.428   44.713  1.00   44.58  ? 113 HIS B CA    1 
ATOM   3119 C C     . HIS B 1 128 ? -6.071  8.032   45.142  1.00   45.78  ? 113 HIS B C     1 
ATOM   3120 O O     . HIS B 1 128 ? -6.771  7.322   45.877  1.00   46.23  ? 113 HIS B O     1 
ATOM   3121 C CB    . HIS B 1 128 ? -5.952  10.475  45.679  1.00   42.41  ? 113 HIS B CB    1 
ATOM   3122 C CG    . HIS B 1 128 ? -6.317  10.228  47.107  1.00   44.04  ? 113 HIS B CG    1 
ATOM   3123 N ND1   . HIS B 1 128 ? -5.609  9.368   47.921  1.00   44.83  ? 113 HIS B ND1   1 
ATOM   3124 C CD2   . HIS B 1 128 ? -7.318  10.729  47.871  1.00   46.15  ? 113 HIS B CD2   1 
ATOM   3125 C CE1   . HIS B 1 128 ? -6.159  9.350   49.122  1.00   50.22  ? 113 HIS B CE1   1 
ATOM   3126 N NE2   . HIS B 1 128 ? -7.201  10.164  49.118  1.00   46.93  ? 113 HIS B NE2   1 
ATOM   3127 N N     . ASP B 1 129 ? -4.883  7.646   44.701  1.00   44.87  ? 114 ASP B N     1 
ATOM   3128 C CA    . ASP B 1 129 ? -4.367  6.336   45.060  1.00   48.26  ? 114 ASP B CA    1 
ATOM   3129 C C     . ASP B 1 129 ? -3.844  6.322   46.500  1.00   47.51  ? 114 ASP B C     1 
ATOM   3130 O O     . ASP B 1 129 ? -3.784  7.357   47.168  1.00   44.05  ? 114 ASP B O     1 
ATOM   3131 C CB    . ASP B 1 129 ? -3.314  5.850   44.041  1.00   47.44  ? 114 ASP B CB    1 
ATOM   3132 C CG    . ASP B 1 129 ? -1.986  6.570   44.174  1.00   50.20  ? 114 ASP B CG    1 
ATOM   3133 O OD1   . ASP B 1 129 ? -1.506  6.734   45.314  1.00   51.01  ? 114 ASP B OD1   1 
ATOM   3134 O OD2   . ASP B 1 129 ? -1.413  6.971   43.134  1.00   52.24  ? 114 ASP B OD2   1 
ATOM   3135 N N     . THR B 1 130 ? -3.458  5.138   46.959  1.00   49.43  ? 115 THR B N     1 
ATOM   3136 C CA    . THR B 1 130 ? -3.100  4.897   48.351  1.00   50.52  ? 115 THR B CA    1 
ATOM   3137 C C     . THR B 1 130 ? -1.584  4.948   48.631  1.00   50.71  ? 115 THR B C     1 
ATOM   3138 O O     . THR B 1 130 ? -1.137  4.718   49.751  1.00   53.56  ? 115 THR B O     1 
ATOM   3139 C CB    . THR B 1 130 ? -3.702  3.540   48.796  1.00   52.95  ? 115 THR B CB    1 
ATOM   3140 O OG1   . THR B 1 130 ? -4.853  3.772   49.616  1.00   56.14  ? 115 THR B OG1   1 
ATOM   3141 C CG2   . THR B 1 130 ? -2.683  2.669   49.538  1.00   53.45  ? 115 THR B CG2   1 
ATOM   3142 N N     . SER B 1 131 ? -0.800  5.307   47.627  1.00   48.56  ? 116 SER B N     1 
ATOM   3143 C CA    . SER B 1 131 ? 0.657   5.145   47.708  1.00   53.70  ? 116 SER B CA    1 
ATOM   3144 C C     . SER B 1 131 ? 1.390   5.970   48.775  1.00   54.18  ? 116 SER B C     1 
ATOM   3145 O O     . SER B 1 131 ? 2.423   5.542   49.280  1.00   58.76  ? 116 SER B O     1 
ATOM   3146 C CB    . SER B 1 131 ? 1.289   5.398   46.337  1.00   50.87  ? 116 SER B CB    1 
ATOM   3147 O OG    . SER B 1 131 ? 1.088   6.739   45.927  1.00   54.25  ? 116 SER B OG    1 
ATOM   3148 N N     . LEU B 1 132 ? 0.873   7.144   49.121  1.00   53.90  ? 117 LEU B N     1 
ATOM   3149 C CA    . LEU B 1 132 ? 1.581   8.032   50.040  1.00   47.43  ? 117 LEU B CA    1 
ATOM   3150 C C     . LEU B 1 132 ? 1.332   7.667   51.502  1.00   48.69  ? 117 LEU B C     1 
ATOM   3151 O O     . LEU B 1 132 ? 0.201   7.414   51.900  1.00   51.22  ? 117 LEU B O     1 
ATOM   3152 C CB    . LEU B 1 132 ? 1.174   9.479   49.787  1.00   45.93  ? 117 LEU B CB    1 
ATOM   3153 C CG    . LEU B 1 132 ? 2.134   10.560  50.274  1.00   45.96  ? 117 LEU B CG    1 
ATOM   3154 C CD1   . LEU B 1 132 ? 3.339   10.630  49.359  1.00   50.18  ? 117 LEU B CD1   1 
ATOM   3155 C CD2   . LEU B 1 132 ? 1.430   11.908  50.314  1.00   49.44  ? 117 LEU B CD2   1 
ATOM   3156 N N     . PRO B 1 133 ? 2.400   7.620   52.310  1.00   48.53  ? 118 PRO B N     1 
ATOM   3157 C CA    . PRO B 1 133 ? 2.236   7.350   53.743  1.00   50.94  ? 118 PRO B CA    1 
ATOM   3158 C C     . PRO B 1 133 ? 1.621   8.536   54.494  1.00   49.99  ? 118 PRO B C     1 
ATOM   3159 O O     . PRO B 1 133 ? 1.991   9.687   54.243  1.00   44.81  ? 118 PRO B O     1 
ATOM   3160 C CB    . PRO B 1 133 ? 3.678   7.117   54.228  1.00   49.79  ? 118 PRO B CB    1 
ATOM   3161 C CG    . PRO B 1 133 ? 4.484   6.859   52.993  1.00   50.50  ? 118 PRO B CG    1 
ATOM   3162 C CD    . PRO B 1 133 ? 3.816   7.640   51.906  1.00   51.35  ? 118 PRO B CD    1 
ATOM   3163 N N     . ASP B 1 134 ? 0.703   8.240   55.412  1.00   46.01  ? 119 ASP B N     1 
ATOM   3164 C CA    . ASP B 1 134 ? 0.104   9.242   56.282  1.00   47.30  ? 119 ASP B CA    1 
ATOM   3165 C C     . ASP B 1 134 ? 1.129   9.787   57.254  1.00   49.00  ? 119 ASP B C     1 
ATOM   3166 O O     . ASP B 1 134 ? 2.159   9.163   57.488  1.00   46.64  ? 119 ASP B O     1 
ATOM   3167 C CB    . ASP B 1 134 ? -1.034  8.616   57.081  1.00   51.84  ? 119 ASP B CB    1 
ATOM   3168 C CG    . ASP B 1 134 ? -2.383  8.732   56.379  1.00   61.21  ? 119 ASP B CG    1 
ATOM   3169 O OD1   . ASP B 1 134 ? -2.999  7.672   56.115  1.00   59.71  ? 119 ASP B OD1   1 
ATOM   3170 O OD2   . ASP B 1 134 ? -2.832  9.881   56.111  1.00   60.12  ? 119 ASP B OD2   1 
ATOM   3171 N N     . VAL B 1 135 ? 0.849   10.946  57.838  1.00   51.84  ? 120 VAL B N     1 
ATOM   3172 C CA    . VAL B 1 135 ? 1.713   11.448  58.900  1.00   44.69  ? 120 VAL B CA    1 
ATOM   3173 C C     . VAL B 1 135 ? 1.767   10.435  60.037  1.00   49.14  ? 120 VAL B C     1 
ATOM   3174 O O     . VAL B 1 135 ? 0.723   9.981   60.523  1.00   47.80  ? 120 VAL B O     1 
ATOM   3175 C CB    . VAL B 1 135 ? 1.221   12.790  59.451  1.00   45.93  ? 120 VAL B CB    1 
ATOM   3176 C CG1   . VAL B 1 135 ? 2.187   13.299  60.536  1.00   45.84  ? 120 VAL B CG1   1 
ATOM   3177 C CG2   . VAL B 1 135 ? 1.120   13.810  58.318  1.00   43.49  ? 120 VAL B CG2   1 
ATOM   3178 N N     . SER B 1 136 ? 2.978   10.087  60.471  1.00   44.22  ? 121 SER B N     1 
ATOM   3179 C CA    . SER B 1 136 ? 3.154   9.080   61.515  1.00   46.01  ? 121 SER B CA    1 
ATOM   3180 C C     . SER B 1 136 ? 3.371   9.724   62.875  1.00   42.75  ? 121 SER B C     1 
ATOM   3181 O O     . SER B 1 136 ? 3.711   10.907  62.969  1.00   41.03  ? 121 SER B O     1 
ATOM   3182 C CB    . SER B 1 136 ? 4.344   8.175   61.184  1.00   47.43  ? 121 SER B CB    1 
ATOM   3183 O OG    . SER B 1 136 ? 5.559   8.914   61.201  1.00   49.87  ? 121 SER B OG    1 
ATOM   3184 N N     . ALA B 1 137 ? 3.185   8.941   63.930  1.00   39.86  ? 122 ALA B N     1 
ATOM   3185 C CA    . ALA B 1 137 ? 3.458   9.424   65.278  1.00   42.34  ? 122 ALA B CA    1 
ATOM   3186 C C     . ALA B 1 137 ? 4.927   9.840   65.460  1.00   41.97  ? 122 ALA B C     1 
ATOM   3187 O O     . ALA B 1 137 ? 5.226   10.800  66.183  1.00   40.37  ? 122 ALA B O     1 
ATOM   3188 C CB    . ALA B 1 137 ? 3.060   8.392   66.307  1.00   38.70  ? 122 ALA B CB    1 
ATOM   3189 N N     . THR B 1 138 ? 5.844   9.116   64.825  1.00   40.37  ? 123 THR B N     1 
ATOM   3190 C CA    . THR B 1 138 ? 7.249   9.516   64.867  1.00   43.47  ? 123 THR B CA    1 
ATOM   3191 C C     . THR B 1 138 ? 7.483   10.827  64.091  1.00   42.02  ? 123 THR B C     1 
ATOM   3192 O O     . THR B 1 138 ? 8.233   11.690  64.543  1.00   47.49  ? 123 THR B O     1 
ATOM   3193 C CB    . THR B 1 138 ? 8.201   8.397   64.385  1.00   44.03  ? 123 THR B CB    1 
ATOM   3194 O OG1   . THR B 1 138 ? 7.900   8.059   63.032  1.00   54.37  ? 123 THR B OG1   1 
ATOM   3195 C CG2   . THR B 1 138 ? 8.036   7.159   65.241  1.00   43.71  ? 123 THR B CG2   1 
ATOM   3196 N N     . ASP B 1 139 ? 6.825   10.986  62.947  1.00   40.13  ? 124 ASP B N     1 
ATOM   3197 C CA    . ASP B 1 139 ? 6.789   12.285  62.264  1.00   42.28  ? 124 ASP B CA    1 
ATOM   3198 C C     . ASP B 1 139 ? 6.352   13.403  63.216  1.00   44.19  ? 124 ASP B C     1 
ATOM   3199 O O     . ASP B 1 139 ? 6.921   14.485  63.212  1.00   43.93  ? 124 ASP B O     1 
ATOM   3200 C CB    . ASP B 1 139 ? 5.811   12.272  61.084  1.00   46.92  ? 124 ASP B CB    1 
ATOM   3201 C CG    . ASP B 1 139 ? 6.306   11.461  59.895  1.00   52.73  ? 124 ASP B CG    1 
ATOM   3202 O OD1   . ASP B 1 139 ? 7.539   11.249  59.784  1.00   54.91  ? 124 ASP B OD1   1 
ATOM   3203 O OD2   . ASP B 1 139 ? 5.450   11.060  59.055  1.00   45.98  ? 124 ASP B OD2   1 
ATOM   3204 N N     . PHE B 1 140 ? 5.331   13.142  64.028  1.00   41.66  ? 125 PHE B N     1 
ATOM   3205 C CA    . PHE B 1 140 ? 4.749   14.179  64.878  1.00   36.12  ? 125 PHE B CA    1 
ATOM   3206 C C     . PHE B 1 140 ? 5.623   14.482  66.107  1.00   42.76  ? 125 PHE B C     1 
ATOM   3207 O O     . PHE B 1 140 ? 5.628   15.616  66.622  1.00   39.10  ? 125 PHE B O     1 
ATOM   3208 C CB    . PHE B 1 140 ? 3.329   13.760  65.286  1.00   38.70  ? 125 PHE B CB    1 
ATOM   3209 C CG    . PHE B 1 140 ? 2.580   14.810  66.041  1.00   42.34  ? 125 PHE B CG    1 
ATOM   3210 C CD1   . PHE B 1 140 ? 2.019   15.899  65.376  1.00   43.29  ? 125 PHE B CD1   1 
ATOM   3211 C CD2   . PHE B 1 140 ? 2.425   14.712  67.410  1.00   35.93  ? 125 PHE B CD2   1 
ATOM   3212 C CE1   . PHE B 1 140 ? 1.327   16.869  66.064  1.00   33.34  ? 125 PHE B CE1   1 
ATOM   3213 C CE2   . PHE B 1 140 ? 1.720   15.679  68.108  1.00   42.42  ? 125 PHE B CE2   1 
ATOM   3214 C CZ    . PHE B 1 140 ? 1.172   16.765  67.426  1.00   41.38  ? 125 PHE B CZ    1 
ATOM   3215 N N     . GLU B 1 141 ? 6.355   13.467  66.579  1.00   42.63  ? 126 GLU B N     1 
ATOM   3216 C CA    . GLU B 1 141 ? 7.301   13.623  67.695  1.00   42.85  ? 126 GLU B CA    1 
ATOM   3217 C C     . GLU B 1 141 ? 8.258   14.772  67.446  1.00   40.11  ? 126 GLU B C     1 
ATOM   3218 O O     . GLU B 1 141 ? 8.646   15.473  68.367  1.00   43.75  ? 126 GLU B O     1 
ATOM   3219 C CB    . GLU B 1 141 ? 8.156   12.370  67.863  1.00   47.00  ? 126 GLU B CB    1 
ATOM   3220 C CG    . GLU B 1 141 ? 7.561   11.252  68.677  1.00   50.20  ? 126 GLU B CG    1 
ATOM   3221 C CD    . GLU B 1 141 ? 8.515   10.049  68.781  1.00   62.97  ? 126 GLU B CD    1 
ATOM   3222 O OE1   . GLU B 1 141 ? 8.076   8.986   69.287  1.00   67.35  ? 126 GLU B OE1   1 
ATOM   3223 O OE2   . GLU B 1 141 ? 9.702   10.171  68.365  1.00   59.13  ? 126 GLU B OE2   1 
ATOM   3224 N N     . LYS B 1 142 ? 8.649   14.946  66.192  1.00   44.30  ? 127 LYS B N     1 
ATOM   3225 C CA    . LYS B 1 142 ? 9.676   15.915  65.819  1.00   44.56  ? 127 LYS B CA    1 
ATOM   3226 C C     . LYS B 1 142 ? 9.179   17.355  65.811  1.00   41.61  ? 127 LYS B C     1 
ATOM   3227 O O     . LYS B 1 142 ? 9.949   18.278  65.579  1.00   44.11  ? 127 LYS B O     1 
ATOM   3228 C CB    . LYS B 1 142 ? 10.241  15.563  64.438  1.00   49.99  ? 127 LYS B CB    1 
ATOM   3229 C CG    . LYS B 1 142 ? 11.026  14.244  64.385  1.00   50.90  ? 127 LYS B CG    1 
ATOM   3230 C CD    . LYS B 1 142 ? 11.084  13.682  62.954  1.00   54.64  ? 127 LYS B CD    1 
ATOM   3231 C CE    . LYS B 1 142 ? 11.768  12.310  62.907  1.00   58.66  ? 127 LYS B CE    1 
ATOM   3232 N NZ    . LYS B 1 142 ? 11.346  11.426  64.053  1.00   61.31  ? 127 LYS B NZ    1 
ATOM   3233 N N     . VAL B 1 143 ? 7.891   17.552  66.054  1.00   42.89  ? 128 VAL B N     1 
ATOM   3234 C CA    . VAL B 1 143 ? 7.315   18.885  65.984  1.00   37.59  ? 128 VAL B CA    1 
ATOM   3235 C C     . VAL B 1 143 ? 7.279   19.555  67.353  1.00   37.40  ? 128 VAL B C     1 
ATOM   3236 O O     . VAL B 1 143 ? 6.720   19.011  68.301  1.00   39.12  ? 128 VAL B O     1 
ATOM   3237 C CB    . VAL B 1 143 ? 5.876   18.837  65.412  1.00   43.82  ? 128 VAL B CB    1 
ATOM   3238 C CG1   . VAL B 1 143 ? 5.258   20.236  65.379  1.00   38.12  ? 128 VAL B CG1   1 
ATOM   3239 C CG2   . VAL B 1 143 ? 5.865   18.186  64.022  1.00   42.37  ? 128 VAL B CG2   1 
ATOM   3240 N N     . ASP B 1 144 ? 7.886   20.733  67.446  1.00   35.31  ? 129 ASP B N     1 
ATOM   3241 C CA    . ASP B 1 144 ? 7.811   21.561  68.633  1.00   38.54  ? 129 ASP B CA    1 
ATOM   3242 C C     . ASP B 1 144 ? 6.412   22.178  68.662  1.00   38.62  ? 129 ASP B C     1 
ATOM   3243 O O     . ASP B 1 144 ? 6.008   22.838  67.715  1.00   40.43  ? 129 ASP B O     1 
ATOM   3244 C CB    . ASP B 1 144 ? 8.889   22.652  68.570  1.00   37.63  ? 129 ASP B CB    1 
ATOM   3245 C CG    . ASP B 1 144 ? 8.833   23.611  69.752  1.00   41.63  ? 129 ASP B CG    1 
ATOM   3246 O OD1   . ASP B 1 144 ? 7.753   23.729  70.379  1.00   42.60  ? 129 ASP B OD1   1 
ATOM   3247 O OD2   . ASP B 1 144 ? 9.857   24.278  70.044  1.00   38.98  ? 129 ASP B OD2   1 
ATOM   3248 N N     . LEU B 1 145 ? 5.685   21.956  69.750  1.00   36.17  ? 130 LEU B N     1 
ATOM   3249 C CA    . LEU B 1 145 ? 4.282   22.342  69.858  1.00   37.34  ? 130 LEU B CA    1 
ATOM   3250 C C     . LEU B 1 145 ? 4.053   23.735  70.433  1.00   37.24  ? 130 LEU B C     1 
ATOM   3251 O O     . LEU B 1 145 ? 2.929   24.221  70.414  1.00   36.10  ? 130 LEU B O     1 
ATOM   3252 C CB    . LEU B 1 145 ? 3.536   21.340  70.749  1.00   37.09  ? 130 LEU B CB    1 
ATOM   3253 C CG    . LEU B 1 145 ? 3.684   19.855  70.432  1.00   38.08  ? 130 LEU B CG    1 
ATOM   3254 C CD1   . LEU B 1 145 ? 3.164   18.986  71.575  1.00   33.19  ? 130 LEU B CD1   1 
ATOM   3255 C CD2   . LEU B 1 145 ? 3.013   19.496  69.122  1.00   31.24  ? 130 LEU B CD2   1 
ATOM   3256 N N     . THR B 1 146 ? 5.085   24.371  70.972  1.00   33.91  ? 131 THR B N     1 
ATOM   3257 C CA    . THR B 1 146 ? 4.874   25.589  71.759  1.00   32.25  ? 131 THR B CA    1 
ATOM   3258 C C     . THR B 1 146 ? 4.266   26.676  70.892  1.00   32.94  ? 131 THR B C     1 
ATOM   3259 O O     . THR B 1 146 ? 3.675   27.646  71.375  1.00   37.03  ? 131 THR B O     1 
ATOM   3260 C CB    . THR B 1 146 ? 6.204   26.122  72.374  1.00   39.84  ? 131 THR B CB    1 
ATOM   3261 O OG1   . THR B 1 146 ? 7.163   26.293  71.332  1.00   36.70  ? 131 THR B OG1   1 
ATOM   3262 C CG2   . THR B 1 146 ? 6.777   25.156  73.416  1.00   33.09  ? 131 THR B CG2   1 
ATOM   3263 N N     . GLN B 1 147 ? 4.454   26.509  69.600  1.00   29.98  ? 132 GLN B N     1 
ATOM   3264 C CA    . GLN B 1 147 ? 3.923   27.385  68.566  1.00   39.12  ? 132 GLN B CA    1 
ATOM   3265 C C     . GLN B 1 147 ? 2.390   27.426  68.513  1.00   34.96  ? 132 GLN B C     1 
ATOM   3266 O O     . GLN B 1 147 ? 1.789   28.385  68.033  1.00   34.20  ? 132 GLN B O     1 
ATOM   3267 C CB    . GLN B 1 147 ? 4.352   26.748  67.259  1.00   38.51  ? 132 GLN B CB    1 
ATOM   3268 C CG    . GLN B 1 147 ? 4.476   27.618  66.109  1.00   39.88  ? 132 GLN B CG    1 
ATOM   3269 C CD    . GLN B 1 147 ? 5.388   26.976  65.094  1.00   43.32  ? 132 GLN B CD    1 
ATOM   3270 O OE1   . GLN B 1 147 ? 6.505   26.549  65.424  1.00   44.97  ? 132 GLN B OE1   1 
ATOM   3271 N NE2   . GLN B 1 147 ? 4.914   26.867  63.869  1.00   34.74  ? 132 GLN B NE2   1 
ATOM   3272 N N     . PHE B 1 148 ? 1.765   26.340  68.932  1.00   30.85  ? 133 PHE B N     1 
ATOM   3273 C CA    . PHE B 1 148 ? 0.340   26.172  68.663  1.00   36.63  ? 133 PHE B CA    1 
ATOM   3274 C C     . PHE B 1 148 ? -0.517  26.386  69.885  1.00   34.87  ? 133 PHE B C     1 
ATOM   3275 O O     . PHE B 1 148 ? -0.164  25.957  70.967  1.00   34.10  ? 133 PHE B O     1 
ATOM   3276 C CB    . PHE B 1 148 ? 0.089   24.789  68.084  1.00   32.80  ? 133 PHE B CB    1 
ATOM   3277 C CG    . PHE B 1 148 ? 0.980   24.467  66.932  1.00   28.79  ? 133 PHE B CG    1 
ATOM   3278 C CD1   . PHE B 1 148 ? 0.834   25.137  65.719  1.00   28.30  ? 133 PHE B CD1   1 
ATOM   3279 C CD2   . PHE B 1 148 ? 1.973   23.499  67.056  1.00   33.55  ? 133 PHE B CD2   1 
ATOM   3280 C CE1   . PHE B 1 148 ? 1.662   24.853  64.637  1.00   24.87  ? 133 PHE B CE1   1 
ATOM   3281 C CE2   . PHE B 1 148 ? 2.806   23.191  65.978  1.00   31.13  ? 133 PHE B CE2   1 
ATOM   3282 C CZ    . PHE B 1 148 ? 2.645   23.872  64.762  1.00   31.75  ? 133 PHE B CZ    1 
ATOM   3283 N N     . LYS B 1 149 ? -1.653  27.056  69.706  1.00   37.29  ? 134 LYS B N     1 
ATOM   3284 C CA    . LYS B 1 149 ? -2.610  27.217  70.796  1.00   33.41  ? 134 LYS B CA    1 
ATOM   3285 C C     . LYS B 1 149 ? -3.751  26.215  70.628  1.00   35.59  ? 134 LYS B C     1 
ATOM   3286 O O     . LYS B 1 149 ? -4.511  25.982  71.559  1.00   34.98  ? 134 LYS B O     1 
ATOM   3287 C CB    . LYS B 1 149 ? -3.189  28.629  70.787  1.00   33.55  ? 134 LYS B CB    1 
ATOM   3288 C CG    . LYS B 1 149 ? -3.789  28.969  69.430  1.00   37.99  ? 134 LYS B CG    1 
ATOM   3289 C CD    . LYS B 1 149 ? -4.918  29.969  69.517  1.00   40.48  ? 134 LYS B CD    1 
ATOM   3290 C CE    . LYS B 1 149 ? -4.518  31.208  70.276  1.00   42.35  ? 134 LYS B CE    1 
ATOM   3291 N NZ    . LYS B 1 149 ? -5.341  32.361  69.807  1.00   47.05  ? 134 LYS B NZ    1 
ATOM   3292 N N     . TRP B 1 150 ? -3.886  25.641  69.432  1.00   36.25  ? 135 TRP B N     1 
ATOM   3293 C CA    . TRP B 1 150 ? -4.984  24.720  69.154  1.00   27.33  ? 135 TRP B CA    1 
ATOM   3294 C C     . TRP B 1 150 ? -4.528  23.733  68.123  1.00   28.11  ? 135 TRP B C     1 
ATOM   3295 O O     . TRP B 1 150 ? -3.967  24.112  67.109  1.00   29.77  ? 135 TRP B O     1 
ATOM   3296 C CB    . TRP B 1 150 ? -6.201  25.469  68.582  1.00   31.02  ? 135 TRP B CB    1 
ATOM   3297 C CG    . TRP B 1 150 ? -7.430  24.626  68.516  1.00   27.76  ? 135 TRP B CG    1 
ATOM   3298 C CD1   . TRP B 1 150 ? -7.638  23.531  67.726  1.00   26.75  ? 135 TRP B CD1   1 
ATOM   3299 C CD2   . TRP B 1 150 ? -8.623  24.800  69.289  1.00   27.57  ? 135 TRP B CD2   1 
ATOM   3300 N NE1   . TRP B 1 150 ? -8.893  23.009  67.963  1.00   26.09  ? 135 TRP B NE1   1 
ATOM   3301 C CE2   . TRP B 1 150 ? -9.517  23.775  68.916  1.00   30.67  ? 135 TRP B CE2   1 
ATOM   3302 C CE3   . TRP B 1 150 ? -9.032  25.742  70.244  1.00   31.75  ? 135 TRP B CE3   1 
ATOM   3303 C CZ2   . TRP B 1 150 ? -10.801 23.653  69.488  1.00   30.14  ? 135 TRP B CZ2   1 
ATOM   3304 C CZ3   . TRP B 1 150 ? -10.297 25.622  70.810  1.00   28.85  ? 135 TRP B CZ3   1 
ATOM   3305 C CH2   . TRP B 1 150 ? -11.165 24.580  70.426  1.00   31.50  ? 135 TRP B CH2   1 
ATOM   3306 N N     . ILE B 1 151 ? -4.796  22.458  68.339  1.00   27.91  ? 136 ILE B N     1 
ATOM   3307 C CA    . ILE B 1 151 ? -4.445  21.492  67.318  1.00   28.72  ? 136 ILE B CA    1 
ATOM   3308 C C     . ILE B 1 151 ? -5.672  20.689  66.931  1.00   30.09  ? 136 ILE B C     1 
ATOM   3309 O O     . ILE B 1 151 ? -6.331  20.122  67.788  1.00   30.87  ? 136 ILE B O     1 
ATOM   3310 C CB    . ILE B 1 151 ? -3.301  20.552  67.774  1.00   27.84  ? 136 ILE B CB    1 
ATOM   3311 C CG1   . ILE B 1 151 ? -2.033  21.366  68.102  1.00   27.45  ? 136 ILE B CG1   1 
ATOM   3312 C CG2   . ILE B 1 151 ? -3.008  19.523  66.702  1.00   27.13  ? 136 ILE B CG2   1 
ATOM   3313 C CD1   . ILE B 1 151 ? -0.831  20.502  68.592  1.00   29.41  ? 136 ILE B CD1   1 
ATOM   3314 N N     . HIS B 1 152 ? -5.960  20.643  65.633  1.00   29.62  ? 137 HIS B N     1 
ATOM   3315 C CA    . HIS B 1 152 ? -7.126  19.946  65.123  1.00   30.61  ? 137 HIS B CA    1 
ATOM   3316 C C     . HIS B 1 152 ? -6.722  18.748  64.265  1.00   32.28  ? 137 HIS B C     1 
ATOM   3317 O O     . HIS B 1 152 ? -5.945  18.882  63.319  1.00   31.24  ? 137 HIS B O     1 
ATOM   3318 C CB    . HIS B 1 152 ? -7.986  20.895  64.277  1.00   29.02  ? 137 HIS B CB    1 
ATOM   3319 C CG    . HIS B 1 152 ? -9.166  20.220  63.657  1.00   37.10  ? 137 HIS B CG    1 
ATOM   3320 N ND1   . HIS B 1 152 ? -10.254 19.793  64.397  1.00   37.25  ? 137 HIS B ND1   1 
ATOM   3321 C CD2   . HIS B 1 152 ? -9.415  19.851  62.377  1.00   37.59  ? 137 HIS B CD2   1 
ATOM   3322 C CE1   . HIS B 1 152 ? -11.129 19.216  63.594  1.00   36.44  ? 137 HIS B CE1   1 
ATOM   3323 N NE2   . HIS B 1 152 ? -10.642 19.237  62.362  1.00   40.26  ? 137 HIS B NE2   1 
ATOM   3324 N N     . ILE B 1 153 ? -7.269  17.580  64.573  1.00   32.67  ? 138 ILE B N     1 
ATOM   3325 C CA    . ILE B 1 153 ? -6.891  16.391  63.837  1.00   32.37  ? 138 ILE B CA    1 
ATOM   3326 C C     . ILE B 1 153 ? -8.023  15.748  63.050  1.00   32.52  ? 138 ILE B C     1 
ATOM   3327 O O     . ILE B 1 153 ? -9.040  15.365  63.600  1.00   33.15  ? 138 ILE B O     1 
ATOM   3328 C CB    . ILE B 1 153 ? -6.193  15.358  64.753  1.00   32.59  ? 138 ILE B CB    1 
ATOM   3329 C CG1   . ILE B 1 153 ? -4.926  16.003  65.329  1.00   39.41  ? 138 ILE B CG1   1 
ATOM   3330 C CG2   . ILE B 1 153 ? -5.824  14.115  63.953  1.00   33.82  ? 138 ILE B CG2   1 
ATOM   3331 C CD1   . ILE B 1 153 ? -4.195  15.176  66.351  1.00   42.00  ? 138 ILE B CD1   1 
ATOM   3332 N N     . GLU B 1 154 ? -7.825  15.639  61.743  1.00   34.35  ? 139 GLU B N     1 
ATOM   3333 C CA    . GLU B 1 154 ? -8.736  14.902  60.884  1.00   36.09  ? 139 GLU B CA    1 
ATOM   3334 C C     . GLU B 1 154 ? -8.430  13.404  60.995  1.00   37.36  ? 139 GLU B C     1 
ATOM   3335 O O     . GLU B 1 154 ? -7.371  12.942  60.567  1.00   34.98  ? 139 GLU B O     1 
ATOM   3336 C CB    . GLU B 1 154 ? -8.606  15.400  59.438  1.00   36.66  ? 139 GLU B CB    1 
ATOM   3337 C CG    . GLU B 1 154 ? -9.420  14.634  58.394  1.00   37.37  ? 139 GLU B CG    1 
ATOM   3338 C CD    . GLU B 1 154 ? -8.896  14.831  56.946  1.00   45.30  ? 139 GLU B CD    1 
ATOM   3339 O OE1   . GLU B 1 154 ? -8.237  15.864  56.631  1.00   38.62  ? 139 GLU B OE1   1 
ATOM   3340 O OE2   . GLU B 1 154 ? -9.153  13.934  56.112  1.00   46.50  ? 139 GLU B OE2   1 
ATOM   3341 N N     . GLY B 1 155 ? -9.356  12.656  61.585  1.00   34.89  ? 140 GLY B N     1 
ATOM   3342 C CA    . GLY B 1 155 ? -9.209  11.217  61.743  1.00   35.04  ? 140 GLY B CA    1 
ATOM   3343 C C     . GLY B 1 155 ? -8.922  10.464  60.453  1.00   38.71  ? 140 GLY B C     1 
ATOM   3344 O O     . GLY B 1 155 ? -9.708  10.494  59.515  1.00   38.20  ? 140 GLY B O     1 
ATOM   3345 N N     . ARG B 1 156 ? -7.781  9.786   60.396  1.00   39.36  ? 141 ARG B N     1 
ATOM   3346 C CA    . ARG B 1 156 ? -7.393  9.052   59.192  1.00   43.01  ? 141 ARG B CA    1 
ATOM   3347 C C     . ARG B 1 156 ? -6.739  7.734   59.598  1.00   48.23  ? 141 ARG B C     1 
ATOM   3348 O O     . ARG B 1 156 ? -7.395  6.701   59.622  1.00   51.89  ? 141 ARG B O     1 
ATOM   3349 C CB    . ARG B 1 156 ? -6.429  9.869   58.323  1.00   39.53  ? 141 ARG B CB    1 
ATOM   3350 C CG    . ARG B 1 156 ? -6.996  11.174  57.782  1.00   43.03  ? 141 ARG B CG    1 
ATOM   3351 C CD    . ARG B 1 156 ? -6.095  11.800  56.698  1.00   44.59  ? 141 ARG B CD    1 
ATOM   3352 N NE    . ARG B 1 156 ? -6.001  10.943  55.513  1.00   47.57  ? 141 ARG B NE    1 
ATOM   3353 C CZ    . ARG B 1 156 ? -6.998  10.777  54.647  1.00   56.50  ? 141 ARG B CZ    1 
ATOM   3354 N NH1   . ARG B 1 156 ? -8.150  11.418  54.843  1.00   54.38  ? 141 ARG B NH1   1 
ATOM   3355 N NH2   . ARG B 1 156 ? -6.858  9.973   53.593  1.00   48.85  ? 141 ARG B NH2   1 
ATOM   3356 N N     . ASN B 1 157 ? -5.442  7.785   59.908  1.00   47.41  ? 142 ASN B N     1 
ATOM   3357 C CA    . ASN B 1 157 ? -4.710  6.635   60.440  1.00   42.56  ? 142 ASN B CA    1 
ATOM   3358 C C     . ASN B 1 157 ? -4.769  6.616   61.963  1.00   41.56  ? 142 ASN B C     1 
ATOM   3359 O O     . ASN B 1 157 ? -3.836  7.060   62.634  1.00   47.65  ? 142 ASN B O     1 
ATOM   3360 C CB    . ASN B 1 157 ? -3.255  6.662   59.955  1.00   43.41  ? 142 ASN B CB    1 
ATOM   3361 C CG    . ASN B 1 157 ? -2.544  7.977   60.279  1.00   48.77  ? 142 ASN B CG    1 
ATOM   3362 O OD1   . ASN B 1 157 ? -3.163  9.039   60.349  1.00   47.24  ? 142 ASN B OD1   1 
ATOM   3363 N ND2   . ASN B 1 157 ? -1.230  7.904   60.474  1.00   51.21  ? 142 ASN B ND2   1 
ATOM   3364 N N     . ALA B 1 158 ? -5.859  6.087   62.511  1.00   39.94  ? 143 ALA B N     1 
ATOM   3365 C CA    . ALA B 1 158 ? -6.196  6.299   63.933  1.00   44.59  ? 143 ALA B CA    1 
ATOM   3366 C C     . ALA B 1 158 ? -5.189  5.808   64.974  1.00   41.00  ? 143 ALA B C     1 
ATOM   3367 O O     . ALA B 1 158 ? -4.917  6.505   65.944  1.00   42.25  ? 143 ALA B O     1 
ATOM   3368 C CB    . ALA B 1 158 ? -7.595  5.763   64.247  1.00   46.36  ? 143 ALA B CB    1 
ATOM   3369 N N     . SER B 1 159 ? -4.645  4.613   64.791  1.00   43.81  ? 144 SER B N     1 
ATOM   3370 C CA    . SER B 1 159 ? -3.671  4.091   65.755  1.00   44.11  ? 144 SER B CA    1 
ATOM   3371 C C     . SER B 1 159 ? -2.456  5.022   65.913  1.00   41.20  ? 144 SER B C     1 
ATOM   3372 O O     . SER B 1 159 ? -2.007  5.270   67.018  1.00   43.21  ? 144 SER B O     1 
ATOM   3373 C CB    . SER B 1 159 ? -3.245  2.663   65.390  1.00   41.94  ? 144 SER B CB    1 
ATOM   3374 O OG    . SER B 1 159 ? -2.767  2.601   64.054  1.00   52.07  ? 144 SER B OG    1 
ATOM   3375 N N     . GLU B 1 160 ? -1.952  5.564   64.810  1.00   42.22  ? 145 GLU B N     1 
ATOM   3376 C CA    . GLU B 1 160 ? -0.884  6.559   64.873  1.00   37.39  ? 145 GLU B CA    1 
ATOM   3377 C C     . GLU B 1 160 ? -1.349  7.872   65.487  1.00   40.91  ? 145 GLU B C     1 
ATOM   3378 O O     . GLU B 1 160 ? -0.639  8.481   66.296  1.00   41.40  ? 145 GLU B O     1 
ATOM   3379 C CB    . GLU B 1 160 ? -0.341  6.816   63.475  1.00   41.41  ? 145 GLU B CB    1 
ATOM   3380 C CG    . GLU B 1 160 ? 0.411   5.633   62.930  1.00   51.47  ? 145 GLU B CG    1 
ATOM   3381 C CD    . GLU B 1 160 ? 1.688   5.378   63.719  1.00   54.02  ? 145 GLU B CD    1 
ATOM   3382 O OE1   . GLU B 1 160 ? 2.560   6.275   63.712  1.00   51.23  ? 145 GLU B OE1   1 
ATOM   3383 O OE2   . GLU B 1 160 ? 1.795   4.309   64.368  1.00   57.32  ? 145 GLU B OE2   1 
ATOM   3384 N N     . GLN B 1 161 ? -2.547  8.315   65.111  1.00   41.31  ? 146 GLN B N     1 
ATOM   3385 C CA    . GLN B 1 161 ? -3.059  9.599   65.604  1.00   37.59  ? 146 GLN B CA    1 
ATOM   3386 C C     . GLN B 1 161 ? -3.326  9.568   67.098  1.00   36.09  ? 146 GLN B C     1 
ATOM   3387 O O     . GLN B 1 161 ? -3.178  10.583  67.795  1.00   37.79  ? 146 GLN B O     1 
ATOM   3388 C CB    . GLN B 1 161 ? -4.291  10.033  64.808  1.00   38.22  ? 146 GLN B CB    1 
ATOM   3389 C CG    . GLN B 1 161 ? -3.929  10.472  63.390  1.00   37.50  ? 146 GLN B CG    1 
ATOM   3390 C CD    . GLN B 1 161 ? -5.135  10.652  62.485  1.00   38.37  ? 146 GLN B CD    1 
ATOM   3391 O OE1   . GLN B 1 161 ? -6.181  10.034  62.686  1.00   38.38  ? 146 GLN B OE1   1 
ATOM   3392 N NE2   . GLN B 1 161 ? -4.992  11.508  61.481  1.00   34.18  ? 146 GLN B NE2   1 
ATOM   3393 N N     . VAL B 1 162 ? -3.708  8.402   67.606  1.00   36.22  ? 147 VAL B N     1 
ATOM   3394 C CA    . VAL B 1 162 ? -3.864  8.244   69.050  1.00   38.03  ? 147 VAL B CA    1 
ATOM   3395 C C     . VAL B 1 162 ? -2.555  8.567   69.774  1.00   36.53  ? 147 VAL B C     1 
ATOM   3396 O O     . VAL B 1 162 ? -2.551  9.251   70.802  1.00   39.07  ? 147 VAL B O     1 
ATOM   3397 C CB    . VAL B 1 162 ? -4.354  6.832   69.413  1.00   43.89  ? 147 VAL B CB    1 
ATOM   3398 C CG1   . VAL B 1 162 ? -4.062  6.516   70.869  1.00   41.30  ? 147 VAL B CG1   1 
ATOM   3399 C CG2   . VAL B 1 162 ? -5.850  6.718   69.122  1.00   39.81  ? 147 VAL B CG2   1 
ATOM   3400 N N     . LYS B 1 163 ? -1.435  8.117   69.221  1.00   40.27  ? 148 LYS B N     1 
ATOM   3401 C CA    . LYS B 1 163 ? -0.130  8.463   69.808  1.00   42.21  ? 148 LYS B CA    1 
ATOM   3402 C C     . LYS B 1 163 ? 0.130   9.964   69.787  1.00   36.24  ? 148 LYS B C     1 
ATOM   3403 O O     . LYS B 1 163 ? 0.616   10.512  70.775  1.00   37.42  ? 148 LYS B O     1 
ATOM   3404 C CB    . LYS B 1 163 ? 1.012   7.711   69.125  1.00   44.67  ? 148 LYS B CB    1 
ATOM   3405 C CG    . LYS B 1 163 ? 0.950   6.197   69.311  1.00   47.99  ? 148 LYS B CG    1 
ATOM   3406 C CD    . LYS B 1 163 ? 1.933   5.513   68.365  1.00   52.25  ? 148 LYS B CD    1 
ATOM   3407 C CE    . LYS B 1 163 ? 1.781   4.000   68.383  1.00   57.82  ? 148 LYS B CE    1 
ATOM   3408 N NZ    . LYS B 1 163 ? 2.772   3.336   67.472  1.00   62.60  ? 148 LYS B NZ    1 
ATOM   3409 N N     . MET B 1 164 ? -0.223  10.637  68.688  1.00   36.61  ? 149 MET B N     1 
ATOM   3410 C CA    . MET B 1 164 ? -0.035  12.094  68.603  1.00   33.59  ? 149 MET B CA    1 
ATOM   3411 C C     . MET B 1 164 ? -0.820  12.783  69.694  1.00   35.24  ? 149 MET B C     1 
ATOM   3412 O O     . MET B 1 164 ? -0.319  13.688  70.371  1.00   37.42  ? 149 MET B O     1 
ATOM   3413 C CB    . MET B 1 164 ? -0.499  12.638  67.254  1.00   35.88  ? 149 MET B CB    1 
ATOM   3414 C CG    . MET B 1 164 ? 0.022   11.895  66.067  1.00   37.13  ? 149 MET B CG    1 
ATOM   3415 S SD    . MET B 1 164 ? -0.488  12.596  64.463  1.00   43.38  ? 149 MET B SD    1 
ATOM   3416 C CE    . MET B 1 164 ? -0.022  11.214  63.412  1.00   35.74  ? 149 MET B CE    1 
ATOM   3417 N N     . LEU B 1 165 ? -2.071  12.351  69.850  1.00   39.05  ? 150 LEU B N     1 
ATOM   3418 C CA    . LEU B 1 165 ? -2.950  12.871  70.892  1.00   36.40  ? 150 LEU B CA    1 
ATOM   3419 C C     . LEU B 1 165 ? -2.365  12.623  72.290  1.00   35.54  ? 150 LEU B C     1 
ATOM   3420 O O     . LEU B 1 165 ? -2.334  13.527  73.135  1.00   37.26  ? 150 LEU B O     1 
ATOM   3421 C CB    . LEU B 1 165 ? -4.371  12.278  70.731  1.00   35.66  ? 150 LEU B CB    1 
ATOM   3422 C CG    . LEU B 1 165 ? -5.083  12.732  69.439  1.00   34.82  ? 150 LEU B CG    1 
ATOM   3423 C CD1   . LEU B 1 165 ? -6.118  11.757  68.907  1.00   34.02  ? 150 LEU B CD1   1 
ATOM   3424 C CD2   . LEU B 1 165 ? -5.677  14.099  69.602  1.00   29.78  ? 150 LEU B CD2   1 
ATOM   3425 N N     . GLN B 1 166 ? -1.888  11.408  72.547  1.00   37.73  ? 151 GLN B N     1 
ATOM   3426 C CA    . GLN B 1 166 ? -1.245  11.143  73.842  1.00   40.38  ? 151 GLN B CA    1 
ATOM   3427 C C     . GLN B 1 166 ? -0.044  12.064  74.030  1.00   36.28  ? 151 GLN B C     1 
ATOM   3428 O O     . GLN B 1 166 ? 0.213   12.544  75.132  1.00   40.04  ? 151 GLN B O     1 
ATOM   3429 C CB    . GLN B 1 166 ? -0.832  9.675   73.982  1.00   41.37  ? 151 GLN B CB    1 
ATOM   3430 C CG    . GLN B 1 166 ? -2.012  8.756   74.242  1.00   39.28  ? 151 GLN B CG    1 
ATOM   3431 C CD    . GLN B 1 166 ? -1.752  7.313   73.838  1.00   45.33  ? 151 GLN B CD    1 
ATOM   3432 O OE1   . GLN B 1 166 ? -0.871  7.020   73.029  1.00   47.01  ? 151 GLN B OE1   1 
ATOM   3433 N NE2   . GLN B 1 166 ? -2.529  6.402   74.401  1.00   53.38  ? 151 GLN B NE2   1 
ATOM   3434 N N     . ARG B 1 167 ? 0.673   12.356  72.950  1.00   36.27  ? 152 ARG B N     1 
ATOM   3435 C CA    . ARG B 1 167 ? 1.819   13.254  73.085  1.00   37.28  ? 152 ARG B CA    1 
ATOM   3436 C C     . ARG B 1 167 ? 1.358   14.660  73.500  1.00   37.07  ? 152 ARG B C     1 
ATOM   3437 O O     . ARG B 1 167 ? 1.962   15.290  74.375  1.00   39.28  ? 152 ARG B O     1 
ATOM   3438 C CB    . ARG B 1 167 ? 2.691   13.269  71.820  1.00   32.02  ? 152 ARG B CB    1 
ATOM   3439 C CG    . ARG B 1 167 ? 3.801   14.279  71.916  1.00   36.01  ? 152 ARG B CG    1 
ATOM   3440 C CD    . ARG B 1 167 ? 4.797   14.339  70.712  1.00   37.17  ? 152 ARG B CD    1 
ATOM   3441 N NE    . ARG B 1 167 ? 5.708   15.439  71.026  1.00   36.34  ? 152 ARG B NE    1 
ATOM   3442 C CZ    . ARG B 1 167 ? 5.903   16.520  70.293  1.00   36.85  ? 152 ARG B CZ    1 
ATOM   3443 N NH1   . ARG B 1 167 ? 5.323   16.650  69.102  1.00   38.96  ? 152 ARG B NH1   1 
ATOM   3444 N NH2   . ARG B 1 167 ? 6.698   17.470  70.760  1.00   36.73  ? 152 ARG B NH2   1 
ATOM   3445 N N     . ILE B 1 168 ? 0.268   15.140  72.898  1.00   37.92  ? 153 ILE B N     1 
ATOM   3446 C CA    . ILE B 1 168 ? -0.290  16.452  73.252  1.00   38.19  ? 153 ILE B CA    1 
ATOM   3447 C C     . ILE B 1 168 ? -0.787  16.458  74.697  1.00   35.07  ? 153 ILE B C     1 
ATOM   3448 O O     . ILE B 1 168 ? -0.600  17.430  75.437  1.00   36.92  ? 153 ILE B O     1 
ATOM   3449 C CB    . ILE B 1 168 ? -1.443  16.895  72.277  1.00   38.41  ? 153 ILE B CB    1 
ATOM   3450 C CG1   . ILE B 1 168 ? -0.915  16.975  70.840  1.00   35.96  ? 153 ILE B CG1   1 
ATOM   3451 C CG2   . ILE B 1 168 ? -2.029  18.254  72.717  1.00   30.89  ? 153 ILE B CG2   1 
ATOM   3452 C CD1   . ILE B 1 168 ? -1.972  16.863  69.751  1.00   36.73  ? 153 ILE B CD1   1 
ATOM   3453 N N     . ASP B 1 169 ? -1.418  15.367  75.104  1.00   37.72  ? 154 ASP B N     1 
ATOM   3454 C CA    . ASP B 1 169 ? -1.823  15.231  76.509  1.00   42.56  ? 154 ASP B CA    1 
ATOM   3455 C C     . ASP B 1 169 ? -0.633  15.335  77.471  1.00   42.16  ? 154 ASP B C     1 
ATOM   3456 O O     . ASP B 1 169 ? -0.718  16.018  78.500  1.00   46.47  ? 154 ASP B O     1 
ATOM   3457 C CB    . ASP B 1 169 ? -2.587  13.920  76.746  1.00   46.32  ? 154 ASP B CB    1 
ATOM   3458 C CG    . ASP B 1 169 ? -4.011  13.962  76.186  1.00   53.45  ? 154 ASP B CG    1 
ATOM   3459 O OD1   . ASP B 1 169 ? -4.532  15.092  75.996  1.00   53.47  ? 154 ASP B OD1   1 
ATOM   3460 O OD2   . ASP B 1 169 ? -4.604  12.876  75.940  1.00   50.31  ? 154 ASP B OD2   1 
ATOM   3461 N N     . ALA B 1 170 ? 0.469   14.662  77.144  1.00   36.33  ? 155 ALA B N     1 
ATOM   3462 C CA    . ALA B 1 170 ? 1.676   14.736  77.981  1.00   43.03  ? 155 ALA B CA    1 
ATOM   3463 C C     . ALA B 1 170 ? 2.217   16.158  78.066  1.00   42.77  ? 155 ALA B C     1 
ATOM   3464 O O     . ALA B 1 170 ? 2.558   16.625  79.142  1.00   44.66  ? 155 ALA B O     1 
ATOM   3465 C CB    . ALA B 1 170 ? 2.750   13.782  77.479  1.00   40.41  ? 155 ALA B CB    1 
ATOM   3466 N N     . HIS B 1 171 ? 2.267   16.854  76.930  1.00   45.18  ? 156 HIS B N     1 
ATOM   3467 C CA    . HIS B 1 171 ? 2.692   18.254  76.911  1.00   40.07  ? 156 HIS B CA    1 
ATOM   3468 C C     . HIS B 1 171 ? 1.854   19.128  77.850  1.00   43.24  ? 156 HIS B C     1 
ATOM   3469 O O     . HIS B 1 171 ? 2.385   19.958  78.590  1.00   44.63  ? 156 HIS B O     1 
ATOM   3470 C CB    . HIS B 1 171 ? 2.596   18.806  75.488  1.00   39.74  ? 156 HIS B CB    1 
ATOM   3471 C CG    . HIS B 1 171 ? 2.905   20.265  75.387  1.00   41.35  ? 156 HIS B CG    1 
ATOM   3472 N ND1   . HIS B 1 171 ? 4.170   20.741  75.107  1.00   42.36  ? 156 HIS B ND1   1 
ATOM   3473 C CD2   . HIS B 1 171 ? 2.117   21.357  75.544  1.00   38.77  ? 156 HIS B CD2   1 
ATOM   3474 C CE1   . HIS B 1 171 ? 4.146   22.062  75.095  1.00   46.20  ? 156 HIS B CE1   1 
ATOM   3475 N NE2   . HIS B 1 171 ? 2.910   22.461  75.354  1.00   45.55  ? 156 HIS B NE2   1 
ATOM   3476 N N     . ASN B 1 172 ? 0.539   18.951  77.794  1.00   43.99  ? 157 ASN B N     1 
ATOM   3477 C CA    . ASN B 1 172 ? -0.393  19.787  78.543  1.00   42.83  ? 157 ASN B CA    1 
ATOM   3478 C C     . ASN B 1 172 ? -0.323  19.573  80.050  1.00   46.06  ? 157 ASN B C     1 
ATOM   3479 O O     . ASN B 1 172 ? -0.418  20.526  80.831  1.00   44.92  ? 157 ASN B O     1 
ATOM   3480 C CB    . ASN B 1 172 ? -1.830  19.569  78.056  1.00   40.92  ? 157 ASN B CB    1 
ATOM   3481 C CG    . ASN B 1 172 ? -2.113  20.274  76.742  1.00   44.61  ? 157 ASN B CG    1 
ATOM   3482 O OD1   . ASN B 1 172 ? -2.972  19.846  75.961  1.00   41.59  ? 157 ASN B OD1   1 
ATOM   3483 N ND2   . ASN B 1 172 ? -1.385  21.357  76.485  1.00   38.33  ? 157 ASN B ND2   1 
ATOM   3484 N N     . THR B 1 173 ? -0.173  18.319  80.455  1.00   47.18  ? 158 THR B N     1 
ATOM   3485 C CA    . THR B 1 173 ? -0.019  17.999  81.873  1.00   52.08  ? 158 THR B CA    1 
ATOM   3486 C C     . THR B 1 173 ? 0.966   18.934  82.579  1.00   53.07  ? 158 THR B C     1 
ATOM   3487 O O     . THR B 1 173 ? 0.744   19.330  83.723  1.00   56.05  ? 158 THR B O     1 
ATOM   3488 C CB    . THR B 1 173 ? 0.470   16.561  82.078  1.00   52.34  ? 158 THR B CB    1 
ATOM   3489 O OG1   . THR B 1 173 ? -0.573  15.646  81.718  1.00   54.87  ? 158 THR B OG1   1 
ATOM   3490 C CG2   . THR B 1 173 ? 0.823   16.353  83.524  1.00   59.15  ? 158 THR B CG2   1 
ATOM   3491 N N     . ARG B 1 174 ? 2.045   19.290  81.891  1.00   50.99  ? 159 ARG B N     1 
ATOM   3492 C CA    . ARG B 1 174 ? 3.080   20.138  82.474  1.00   51.86  ? 159 ARG B CA    1 
ATOM   3493 C C     . ARG B 1 174 ? 2.827   21.643  82.336  1.00   52.55  ? 159 ARG B C     1 
ATOM   3494 O O     . ARG B 1 174 ? 3.604   22.439  82.851  1.00   57.25  ? 159 ARG B O     1 
ATOM   3495 C CB    . ARG B 1 174 ? 4.451   19.825  81.849  1.00   53.01  ? 159 ARG B CB    1 
ATOM   3496 C CG    . ARG B 1 174 ? 4.639   18.389  81.370  1.00   56.38  ? 159 ARG B CG    1 
ATOM   3497 C CD    . ARG B 1 174 ? 6.041   18.191  80.771  1.00   61.60  ? 159 ARG B CD    1 
ATOM   3498 N NE    . ARG B 1 174 ? 6.372   19.209  79.771  1.00   52.40  ? 159 ARG B NE    1 
ATOM   3499 C CZ    . ARG B 1 174 ? 6.417   18.983  78.461  1.00   55.57  ? 159 ARG B CZ    1 
ATOM   3500 N NH1   . ARG B 1 174 ? 6.171   17.763  77.974  1.00   56.54  ? 159 ARG B NH1   1 
ATOM   3501 N NH2   . ARG B 1 174 ? 6.718   19.979  77.632  1.00   53.33  ? 159 ARG B NH2   1 
ATOM   3502 N N     . GLN B 1 175 ? 1.771   22.055  81.639  1.00   53.72  ? 160 GLN B N     1 
ATOM   3503 C CA    . GLN B 1 175 ? 1.575   23.493  81.400  1.00   52.69  ? 160 GLN B CA    1 
ATOM   3504 C C     . GLN B 1 175 ? 0.605   24.161  82.367  1.00   49.26  ? 160 GLN B C     1 
ATOM   3505 O O     . GLN B 1 175 ? -0.381  23.566  82.780  1.00   46.94  ? 160 GLN B O     1 
ATOM   3506 C CB    . GLN B 1 175 ? 1.066   23.764  79.975  1.00   49.81  ? 160 GLN B CB    1 
ATOM   3507 C CG    . GLN B 1 175 ? 1.806   23.062  78.852  1.00   49.48  ? 160 GLN B CG    1 
ATOM   3508 C CD    . GLN B 1 175 ? 3.236   23.548  78.673  1.00   51.61  ? 160 GLN B CD    1 
ATOM   3509 O OE1   . GLN B 1 175 ? 3.509   24.753  78.656  1.00   52.48  ? 160 GLN B OE1   1 
ATOM   3510 N NE2   . GLN B 1 175 ? 4.154   22.605  78.520  1.00   51.09  ? 160 GLN B NE2   1 
ATOM   3511 N N     . PRO B 1 176 ? 0.870   25.431  82.685  1.00   51.18  ? 161 PRO B N     1 
ATOM   3512 C CA    . PRO B 1 176 ? -0.131  26.312  83.293  1.00   57.05  ? 161 PRO B CA    1 
ATOM   3513 C C     . PRO B 1 176 ? -1.352  26.351  82.375  1.00   60.51  ? 161 PRO B C     1 
ATOM   3514 O O     . PRO B 1 176 ? -1.186  26.253  81.165  1.00   58.33  ? 161 PRO B O     1 
ATOM   3515 C CB    . PRO B 1 176 ? 0.542   27.688  83.263  1.00   59.18  ? 161 PRO B CB    1 
ATOM   3516 C CG    . PRO B 1 176 ? 1.998   27.430  82.970  1.00   61.00  ? 161 PRO B CG    1 
ATOM   3517 C CD    . PRO B 1 176 ? 2.065   26.154  82.220  1.00   55.78  ? 161 PRO B CD    1 
ATOM   3518 N N     . PRO B 1 177 ? -2.559  26.506  82.939  1.00   65.49  ? 162 PRO B N     1 
ATOM   3519 C CA    . PRO B 1 177 ? -3.808  26.519  82.159  1.00   59.65  ? 162 PRO B CA    1 
ATOM   3520 C C     . PRO B 1 177 ? -3.745  27.438  80.933  1.00   62.21  ? 162 PRO B C     1 
ATOM   3521 O O     . PRO B 1 177 ? -4.349  27.132  79.903  1.00   62.13  ? 162 PRO B O     1 
ATOM   3522 C CB    . PRO B 1 177 ? -4.835  27.052  83.160  1.00   63.81  ? 162 PRO B CB    1 
ATOM   3523 C CG    . PRO B 1 177 ? -4.291  26.652  84.505  1.00   61.17  ? 162 PRO B CG    1 
ATOM   3524 C CD    . PRO B 1 177 ? -2.793  26.691  84.384  1.00   60.98  ? 162 PRO B CD    1 
ATOM   3525 N N     . GLU B 1 178 ? -3.011  28.541  81.044  1.00   63.98  ? 163 GLU B N     1 
ATOM   3526 C CA    . GLU B 1 178 ? -2.961  29.549  79.989  1.00   65.69  ? 163 GLU B CA    1 
ATOM   3527 C C     . GLU B 1 178 ? -1.970  29.205  78.884  1.00   65.71  ? 163 GLU B C     1 
ATOM   3528 O O     . GLU B 1 178 ? -1.748  30.000  77.974  1.00   67.85  ? 163 GLU B O     1 
ATOM   3529 C CB    . GLU B 1 178 ? -2.621  30.925  80.574  1.00   77.65  ? 163 GLU B CB    1 
ATOM   3530 C CG    . GLU B 1 178 ? -3.695  31.993  80.329  1.00   85.93  ? 163 GLU B CG    1 
ATOM   3531 C CD    . GLU B 1 178 ? -3.315  33.362  80.898  1.00   94.18  ? 163 GLU B CD    1 
ATOM   3532 O OE1   . GLU B 1 178 ? -2.243  33.473  81.538  1.00   91.57  ? 163 GLU B OE1   1 
ATOM   3533 O OE2   . GLU B 1 178 ? -4.091  34.326  80.703  1.00   93.99  ? 163 GLU B OE2   1 
ATOM   3534 N N     . GLN B 1 179 ? -1.363  28.030  78.966  1.00   59.94  ? 164 GLN B N     1 
ATOM   3535 C CA    . GLN B 1 179 ? -0.506  27.561  77.888  1.00   54.40  ? 164 GLN B CA    1 
ATOM   3536 C C     . GLN B 1 179 ? -0.836  26.131  77.503  1.00   49.07  ? 164 GLN B C     1 
ATOM   3537 O O     . GLN B 1 179 ? -0.065  25.472  76.812  1.00   46.50  ? 164 GLN B O     1 
ATOM   3538 C CB    . GLN B 1 179 ? 0.970   27.685  78.256  1.00   60.42  ? 164 GLN B CB    1 
ATOM   3539 C CG    . GLN B 1 179 ? 1.548   29.054  77.967  1.00   62.20  ? 164 GLN B CG    1 
ATOM   3540 C CD    . GLN B 1 179 ? 2.726   29.362  78.847  1.00   65.90  ? 164 GLN B CD    1 
ATOM   3541 O OE1   . GLN B 1 179 ? 3.822   28.846  78.632  1.00   65.22  ? 164 GLN B OE1   1 
ATOM   3542 N NE2   . GLN B 1 179 ? 2.507   30.191  79.867  1.00   71.31  ? 164 GLN B NE2   1 
ATOM   3543 N N     . LYS B 1 180 ? -1.985  25.649  77.949  1.00   48.61  ? 165 LYS B N     1 
ATOM   3544 C CA    . LYS B 1 180 ? -2.436  24.340  77.512  1.00   47.06  ? 165 LYS B CA    1 
ATOM   3545 C C     . LYS B 1 180 ? -2.914  24.436  76.072  1.00   44.74  ? 165 LYS B C     1 
ATOM   3546 O O     . LYS B 1 180 ? -3.579  25.393  75.693  1.00   45.33  ? 165 LYS B O     1 
ATOM   3547 C CB    . LYS B 1 180 ? -3.534  23.804  78.428  1.00   46.07  ? 165 LYS B CB    1 
ATOM   3548 C CG    . LYS B 1 180 ? -2.982  23.027  79.645  1.00   49.61  ? 165 LYS B CG    1 
ATOM   3549 C CD    . LYS B 1 180 ? -3.722  23.386  80.917  1.00   59.11  ? 165 LYS B CD    1 
ATOM   3550 C CE    . LYS B 1 180 ? -3.880  22.187  81.861  1.00   58.61  ? 165 LYS B CE    1 
ATOM   3551 N NZ    . LYS B 1 180 ? -2.600  21.700  82.445  1.00   50.57  ? 165 LYS B NZ    1 
ATOM   3552 N N     . ILE B 1 181 ? -2.536  23.458  75.265  1.00   36.73  ? 166 ILE B N     1 
ATOM   3553 C CA    . ILE B 1 181 ? -2.959  23.412  73.892  1.00   36.03  ? 166 ILE B CA    1 
ATOM   3554 C C     . ILE B 1 181 ? -4.336  22.752  73.810  1.00   38.49  ? 166 ILE B C     1 
ATOM   3555 O O     . ILE B 1 181 ? -4.511  21.632  74.288  1.00   34.95  ? 166 ILE B O     1 
ATOM   3556 C CB    . ILE B 1 181 ? -1.944  22.639  73.044  1.00   32.86  ? 166 ILE B CB    1 
ATOM   3557 C CG1   . ILE B 1 181 ? -0.547  23.257  73.212  1.00   36.21  ? 166 ILE B CG1   1 
ATOM   3558 C CG2   . ILE B 1 181 ? -2.360  22.623  71.573  1.00   30.72  ? 166 ILE B CG2   1 
ATOM   3559 C CD1   . ILE B 1 181 ? 0.515   22.645  72.289  1.00   34.25  ? 166 ILE B CD1   1 
ATOM   3560 N N     . ARG B 1 182 ? -5.303  23.451  73.211  1.00   33.38  ? 167 ARG B N     1 
ATOM   3561 C CA    . ARG B 1 182 ? -6.649  22.900  73.029  1.00   33.79  ? 167 ARG B CA    1 
ATOM   3562 C C     . ARG B 1 182 ? -6.616  21.930  71.880  1.00   34.01  ? 167 ARG B C     1 
ATOM   3563 O O     . ARG B 1 182 ? -5.886  22.149  70.892  1.00   38.13  ? 167 ARG B O     1 
ATOM   3564 C CB    . ARG B 1 182 ? -7.667  24.007  72.755  1.00   34.81  ? 167 ARG B CB    1 
ATOM   3565 C CG    . ARG B 1 182 ? -8.016  24.854  73.977  1.00   45.43  ? 167 ARG B CG    1 
ATOM   3566 C CD    . ARG B 1 182 ? -9.067  24.151  74.825  1.00   56.34  ? 167 ARG B CD    1 
ATOM   3567 N NE    . ARG B 1 182 ? -9.436  24.919  76.016  1.00   72.53  ? 167 ARG B NE    1 
ATOM   3568 C CZ    . ARG B 1 182 ? -10.028 24.400  77.094  1.00   74.11  ? 167 ARG B CZ    1 
ATOM   3569 N NH1   . ARG B 1 182 ? -10.329 25.179  78.131  1.00   75.13  ? 167 ARG B NH1   1 
ATOM   3570 N NH2   . ARG B 1 182 ? -10.322 23.103  77.137  1.00   67.03  ? 167 ARG B NH2   1 
ATOM   3571 N N     . VAL B 1 183 ? -7.388  20.852  71.989  1.00   30.13  ? 168 VAL B N     1 
ATOM   3572 C CA    . VAL B 1 183 ? -7.362  19.821  70.954  1.00   30.96  ? 168 VAL B CA    1 
ATOM   3573 C C     . VAL B 1 183 ? -8.746  19.495  70.402  1.00   33.94  ? 168 VAL B C     1 
ATOM   3574 O O     . VAL B 1 183 ? -9.711  19.340  71.161  1.00   31.01  ? 168 VAL B O     1 
ATOM   3575 C CB    . VAL B 1 183 ? -6.716  18.518  71.463  1.00   31.87  ? 168 VAL B CB    1 
ATOM   3576 C CG1   . VAL B 1 183 ? -6.644  17.489  70.334  1.00   30.58  ? 168 VAL B CG1   1 
ATOM   3577 C CG2   . VAL B 1 183 ? -5.315  18.809  72.018  1.00   33.75  ? 168 VAL B CG2   1 
ATOM   3578 N N     . SER B 1 184 ? -8.837  19.370  69.076  1.00   28.00  ? 169 SER B N     1 
ATOM   3579 C CA    . SER B 1 184 ? -10.071 18.915  68.459  1.00   27.81  ? 169 SER B CA    1 
ATOM   3580 C C     . SER B 1 184 ? -9.794  17.799  67.498  1.00   31.71  ? 169 SER B C     1 
ATOM   3581 O O     . SER B 1 184 ? -8.679  17.663  66.979  1.00   30.12  ? 169 SER B O     1 
ATOM   3582 C CB    . SER B 1 184 ? -10.849 20.062  67.784  1.00   28.03  ? 169 SER B CB    1 
ATOM   3583 O OG    . SER B 1 184 ? -10.121 20.707  66.739  1.00   32.46  ? 169 SER B OG    1 
ATOM   3584 N N     . VAL B 1 185 ? -10.832 17.008  67.261  1.00   31.87  ? 170 VAL B N     1 
ATOM   3585 C CA    . VAL B 1 185 ? -10.757 15.829  66.420  1.00   30.99  ? 170 VAL B CA    1 
ATOM   3586 C C     . VAL B 1 185 ? -11.990 15.794  65.522  1.00   33.09  ? 170 VAL B C     1 
ATOM   3587 O O     . VAL B 1 185 ? -13.087 16.204  65.934  1.00   33.55  ? 170 VAL B O     1 
ATOM   3588 C CB    . VAL B 1 185 ? -10.715 14.533  67.300  1.00   35.30  ? 170 VAL B CB    1 
ATOM   3589 C CG1   . VAL B 1 185 ? -10.869 13.294  66.440  1.00   37.05  ? 170 VAL B CG1   1 
ATOM   3590 C CG2   . VAL B 1 185 ? -9.402  14.457  68.107  1.00   35.84  ? 170 VAL B CG2   1 
ATOM   3591 N N     . GLU B 1 186 ? -11.827 15.298  64.302  1.00   30.71  ? 171 GLU B N     1 
ATOM   3592 C CA    . GLU B 1 186 ? -12.968 15.100  63.425  1.00   34.41  ? 171 GLU B CA    1 
ATOM   3593 C C     . GLU B 1 186 ? -13.046 13.639  62.976  1.00   39.94  ? 171 GLU B C     1 
ATOM   3594 O O     . GLU B 1 186 ? -12.044 13.045  62.569  1.00   37.96  ? 171 GLU B O     1 
ATOM   3595 C CB    . GLU B 1 186 ? -12.907 16.010  62.193  1.00   34.51  ? 171 GLU B CB    1 
ATOM   3596 C CG    . GLU B 1 186 ? -14.107 15.772  61.259  1.00   44.37  ? 171 GLU B CG    1 
ATOM   3597 C CD    . GLU B 1 186 ? -13.963 16.407  59.877  1.00   56.73  ? 171 GLU B CD    1 
ATOM   3598 O OE1   . GLU B 1 186 ? -12.848 16.370  59.308  1.00   55.74  ? 171 GLU B OE1   1 
ATOM   3599 O OE2   . GLU B 1 186 ? -14.976 16.943  59.358  1.00   62.69  ? 171 GLU B OE2   1 
ATOM   3600 N N     . VAL B 1 187 ? -14.235 13.060  63.074  1.00   37.51  ? 172 VAL B N     1 
ATOM   3601 C CA    . VAL B 1 187 ? -14.480 11.710  62.594  1.00   35.96  ? 172 VAL B CA    1 
ATOM   3602 C C     . VAL B 1 187 ? -15.499 11.840  61.487  1.00   40.72  ? 172 VAL B C     1 
ATOM   3603 O O     . VAL B 1 187 ? -16.677 12.124  61.736  1.00   35.84  ? 172 VAL B O     1 
ATOM   3604 C CB    . VAL B 1 187 ? -15.053 10.813  63.703  1.00   40.54  ? 172 VAL B CB    1 
ATOM   3605 C CG1   . VAL B 1 187 ? -15.400 9.447   63.149  1.00   43.48  ? 172 VAL B CG1   1 
ATOM   3606 C CG2   . VAL B 1 187 ? -14.069 10.689  64.836  1.00   39.93  ? 172 VAL B CG2   1 
ATOM   3607 N N     . GLU B 1 188 ? -15.050 11.639  60.257  1.00   42.28  ? 173 GLU B N     1 
ATOM   3608 C CA    . GLU B 1 188 ? -15.832 12.044  59.116  1.00   44.27  ? 173 GLU B CA    1 
ATOM   3609 C C     . GLU B 1 188 ? -16.227 10.868  58.240  1.00   47.63  ? 173 GLU B C     1 
ATOM   3610 O O     . GLU B 1 188 ? -17.203 10.941  57.495  1.00   46.47  ? 173 GLU B O     1 
ATOM   3611 C CB    . GLU B 1 188 ? -15.078 13.111  58.326  1.00   49.48  ? 173 GLU B CB    1 
ATOM   3612 C CG    . GLU B 1 188 ? -15.989 14.115  57.638  1.00   54.18  ? 173 GLU B CG    1 
ATOM   3613 C CD    . GLU B 1 188 ? -16.260 13.746  56.190  1.00   67.68  ? 173 GLU B CD    1 
ATOM   3614 O OE1   . GLU B 1 188 ? -15.291 13.351  55.491  1.00   67.18  ? 173 GLU B OE1   1 
ATOM   3615 O OE2   . GLU B 1 188 ? -17.437 13.847  55.754  1.00   72.47  ? 173 GLU B OE2   1 
ATOM   3616 N N     . LYS B 1 189 ? -15.480 9.780   58.359  1.00   46.89  ? 174 LYS B N     1 
ATOM   3617 C CA    . LYS B 1 189 ? -15.750 8.568   57.598  1.00   49.23  ? 174 LYS B CA    1 
ATOM   3618 C C     . LYS B 1 189 ? -16.236 7.498   58.548  1.00   49.17  ? 174 LYS B C     1 
ATOM   3619 O O     . LYS B 1 189 ? -15.739 7.382   59.660  1.00   47.15  ? 174 LYS B O     1 
ATOM   3620 C CB    . LYS B 1 189 ? -14.479 8.069   56.907  1.00   55.86  ? 174 LYS B CB    1 
ATOM   3621 C CG    . LYS B 1 189 ? -14.011 8.899   55.734  1.00   59.80  ? 174 LYS B CG    1 
ATOM   3622 C CD    . LYS B 1 189 ? -12.846 8.216   55.010  1.00   70.30  ? 174 LYS B CD    1 
ATOM   3623 C CE    . LYS B 1 189 ? -13.193 6.781   54.599  1.00   76.19  ? 174 LYS B CE    1 
ATOM   3624 N NZ    . LYS B 1 189 ? -12.219 6.215   53.611  1.00   76.79  ? 174 LYS B NZ    1 
ATOM   3625 N N     . PRO B 1 190 ? -17.221 6.711   58.116  1.00   53.91  ? 175 PRO B N     1 
ATOM   3626 C CA    . PRO B 1 190 ? -17.743 5.627   58.947  1.00   53.96  ? 175 PRO B CA    1 
ATOM   3627 C C     . PRO B 1 190 ? -16.851 4.400   58.842  1.00   56.22  ? 175 PRO B C     1 
ATOM   3628 O O     . PRO B 1 190 ? -17.124 3.495   58.056  1.00   60.99  ? 175 PRO B O     1 
ATOM   3629 C CB    . PRO B 1 190 ? -19.110 5.350   58.322  1.00   54.48  ? 175 PRO B CB    1 
ATOM   3630 C CG    . PRO B 1 190 ? -18.916 5.669   56.876  1.00   56.82  ? 175 PRO B CG    1 
ATOM   3631 C CD    . PRO B 1 190 ? -17.932 6.817   56.829  1.00   58.47  ? 175 PRO B CD    1 
ATOM   3632 N N     . ARG B 1 191 ? -15.771 4.391   59.610  1.00   59.86  ? 176 ARG B N     1 
ATOM   3633 C CA    . ARG B 1 191 ? -14.866 3.249   59.655  1.00   59.87  ? 176 ARG B CA    1 
ATOM   3634 C C     . ARG B 1 191 ? -14.599 2.968   61.113  1.00   59.10  ? 176 ARG B C     1 
ATOM   3635 O O     . ARG B 1 191 ? -14.246 3.883   61.858  1.00   57.79  ? 176 ARG B O     1 
ATOM   3636 C CB    . ARG B 1 191 ? -13.542 3.557   58.950  1.00   61.15  ? 176 ARG B CB    1 
ATOM   3637 C CG    . ARG B 1 191 ? -13.670 4.213   57.590  1.00   64.36  ? 176 ARG B CG    1 
ATOM   3638 C CD    . ARG B 1 191 ? -12.412 3.993   56.748  1.00   75.02  ? 176 ARG B CD    1 
ATOM   3639 N NE    . ARG B 1 191 ? -11.256 3.594   57.557  1.00   76.20  ? 176 ARG B NE    1 
ATOM   3640 C CZ    . ARG B 1 191 ? -10.197 4.369   57.800  1.00   76.15  ? 176 ARG B CZ    1 
ATOM   3641 N NH1   . ARG B 1 191 ? -9.198  3.914   58.553  1.00   70.50  ? 176 ARG B NH1   1 
ATOM   3642 N NH2   . ARG B 1 191 ? -10.132 5.599   57.294  1.00   70.64  ? 176 ARG B NH2   1 
ATOM   3643 N N     . GLU B 1 192 ? -14.764 1.715   61.522  1.00   58.74  ? 177 GLU B N     1 
ATOM   3644 C CA    . GLU B 1 192 ? -14.635 1.350   62.933  1.00   64.51  ? 177 GLU B CA    1 
ATOM   3645 C C     . GLU B 1 192 ? -13.320 1.794   63.579  1.00   60.08  ? 177 GLU B C     1 
ATOM   3646 O O     . GLU B 1 192 ? -13.291 2.161   64.749  1.00   64.52  ? 177 GLU B O     1 
ATOM   3647 C CB    . GLU B 1 192 ? -14.833 -0.156  63.123  1.00   72.39  ? 177 GLU B CB    1 
ATOM   3648 C CG    . GLU B 1 192 ? -16.236 -0.540  63.586  1.00   79.73  ? 177 GLU B CG    1 
ATOM   3649 C CD    . GLU B 1 192 ? -16.318 -0.752  65.093  1.00   87.11  ? 177 GLU B CD    1 
ATOM   3650 O OE1   . GLU B 1 192 ? -17.359 -0.399  65.702  1.00   88.17  ? 177 GLU B OE1   1 
ATOM   3651 O OE2   . GLU B 1 192 ? -15.338 -1.284  65.664  1.00   89.98  ? 177 GLU B OE2   1 
ATOM   3652 N N     . GLU B 1 193 ? -12.231 1.763   62.824  1.00   59.11  ? 178 GLU B N     1 
ATOM   3653 C CA    . GLU B 1 193 ? -10.944 2.135   63.390  1.00   61.47  ? 178 GLU B CA    1 
ATOM   3654 C C     . GLU B 1 193 ? -10.969 3.570   63.914  1.00   55.89  ? 178 GLU B C     1 
ATOM   3655 O O     . GLU B 1 193 ? -10.420 3.861   64.975  1.00   53.81  ? 178 GLU B O     1 
ATOM   3656 C CB    . GLU B 1 193 ? -9.805  1.911   62.389  1.00   55.55  ? 178 GLU B CB    1 
ATOM   3657 C CG    . GLU B 1 193 ? -10.148 2.228   60.934  1.00   68.65  ? 178 GLU B CG    1 
ATOM   3658 C CD    . GLU B 1 193 ? -10.859 1.074   60.189  1.00   77.27  ? 178 GLU B CD    1 
ATOM   3659 O OE1   . GLU B 1 193 ? -11.643 0.327   60.821  1.00   70.47  ? 178 GLU B OE1   1 
ATOM   3660 O OE2   . GLU B 1 193 ? -10.630 0.917   58.962  1.00   78.13  ? 178 GLU B OE2   1 
ATOM   3661 N N     . LEU B 1 194 ? -11.646 4.455   63.193  1.00   53.38  ? 179 LEU B N     1 
ATOM   3662 C CA    . LEU B 1 194 ? -11.673 5.864   63.569  1.00   48.62  ? 179 LEU B CA    1 
ATOM   3663 C C     . LEU B 1 194 ? -12.356 6.131   64.902  1.00   48.51  ? 179 LEU B C     1 
ATOM   3664 O O     . LEU B 1 194 ? -12.118 7.164   65.529  1.00   49.43  ? 179 LEU B O     1 
ATOM   3665 C CB    . LEU B 1 194 ? -12.343 6.704   62.480  1.00   47.02  ? 179 LEU B CB    1 
ATOM   3666 C CG    . LEU B 1 194 ? -11.644 6.744   61.126  1.00   54.69  ? 179 LEU B CG    1 
ATOM   3667 C CD1   . LEU B 1 194 ? -12.343 7.735   60.193  1.00   51.03  ? 179 LEU B CD1   1 
ATOM   3668 C CD2   . LEU B 1 194 ? -10.168 7.097   61.304  1.00   47.23  ? 179 LEU B CD2   1 
ATOM   3669 N N     . PHE B 1 195 ? -13.202 5.209   65.341  1.00   48.31  ? 180 PHE B N     1 
ATOM   3670 C CA    . PHE B 1 195 ? -14.056 5.483   66.485  1.00   47.91  ? 180 PHE B CA    1 
ATOM   3671 C C     . PHE B 1 195 ? -13.302 5.664   67.790  1.00   48.97  ? 180 PHE B C     1 
ATOM   3672 O O     . PHE B 1 195 ? -13.770 6.374   68.684  1.00   51.87  ? 180 PHE B O     1 
ATOM   3673 C CB    . PHE B 1 195 ? -15.181 4.447   66.596  1.00   57.36  ? 180 PHE B CB    1 
ATOM   3674 C CG    . PHE B 1 195 ? -16.091 4.422   65.388  1.00   57.74  ? 180 PHE B CG    1 
ATOM   3675 C CD1   . PHE B 1 195 ? -16.189 5.539   64.559  1.00   56.30  ? 180 PHE B CD1   1 
ATOM   3676 C CD2   . PHE B 1 195 ? -16.828 3.293   65.070  1.00   59.43  ? 180 PHE B CD2   1 
ATOM   3677 C CE1   . PHE B 1 195 ? -17.019 5.530   63.430  1.00   56.46  ? 180 PHE B CE1   1 
ATOM   3678 C CE2   . PHE B 1 195 ? -17.655 3.274   63.943  1.00   63.78  ? 180 PHE B CE2   1 
ATOM   3679 C CZ    . PHE B 1 195 ? -17.749 4.394   63.123  1.00   58.04  ? 180 PHE B CZ    1 
ATOM   3680 N N     . GLN B 1 196 ? -12.122 5.064   67.900  1.00   45.04  ? 181 GLN B N     1 
ATOM   3681 C CA    . GLN B 1 196 ? -11.321 5.250   69.099  1.00   43.79  ? 181 GLN B CA    1 
ATOM   3682 C C     . GLN B 1 196 ? -10.903 6.709   69.250  1.00   44.78  ? 181 GLN B C     1 
ATOM   3683 O O     . GLN B 1 196 ? -10.478 7.137   70.321  1.00   47.09  ? 181 GLN B O     1 
ATOM   3684 C CB    . GLN B 1 196 ? -10.091 4.345   69.068  1.00   48.87  ? 181 GLN B CB    1 
ATOM   3685 C CG    . GLN B 1 196 ? -9.407  4.330   67.703  1.00   54.59  ? 181 GLN B CG    1 
ATOM   3686 C CD    . GLN B 1 196 ? -8.125  3.521   67.695  1.00   55.24  ? 181 GLN B CD    1 
ATOM   3687 O OE1   . GLN B 1 196 ? -7.424  3.427   68.709  1.00   50.71  ? 181 GLN B OE1   1 
ATOM   3688 N NE2   . GLN B 1 196 ? -7.810  2.927   66.545  1.00   52.21  ? 181 GLN B NE2   1 
ATOM   3689 N N     . LEU B 1 197 ? -11.018 7.483   68.181  1.00   44.25  ? 182 LEU B N     1 
ATOM   3690 C CA    . LEU B 1 197 ? -10.673 8.899   68.275  1.00   42.05  ? 182 LEU B CA    1 
ATOM   3691 C C     . LEU B 1 197 ? -11.673 9.702   69.098  1.00   42.50  ? 182 LEU B C     1 
ATOM   3692 O O     . LEU B 1 197 ? -11.327 10.762  69.616  1.00   43.65  ? 182 LEU B O     1 
ATOM   3693 C CB    . LEU B 1 197 ? -10.495 9.504   66.891  1.00   45.02  ? 182 LEU B CB    1 
ATOM   3694 C CG    . LEU B 1 197 ? -9.300  8.872   66.184  1.00   45.22  ? 182 LEU B CG    1 
ATOM   3695 C CD1   . LEU B 1 197 ? -9.233  9.327   64.736  1.00   46.46  ? 182 LEU B CD1   1 
ATOM   3696 C CD2   . LEU B 1 197 ? -8.013  9.207   66.945  1.00   40.53  ? 182 LEU B CD2   1 
ATOM   3697 N N     . PHE B 1 198 ? -12.906 9.201   69.224  1.00   42.08  ? 183 PHE B N     1 
ATOM   3698 C CA    . PHE B 1 198 ? -13.917 9.870   70.043  1.00   42.45  ? 183 PHE B CA    1 
ATOM   3699 C C     . PHE B 1 198 ? -13.380 10.166  71.439  1.00   43.53  ? 183 PHE B C     1 
ATOM   3700 O O     . PHE B 1 198 ? -13.783 11.153  72.070  1.00   42.16  ? 183 PHE B O     1 
ATOM   3701 C CB    . PHE B 1 198 ? -15.193 9.027   70.160  1.00   45.20  ? 183 PHE B CB    1 
ATOM   3702 C CG    . PHE B 1 198 ? -16.121 9.121   68.961  1.00   46.36  ? 183 PHE B CG    1 
ATOM   3703 C CD1   . PHE B 1 198 ? -16.112 8.145   67.976  1.00   49.42  ? 183 PHE B CD1   1 
ATOM   3704 C CD2   . PHE B 1 198 ? -17.041 10.158  68.849  1.00   52.76  ? 183 PHE B CD2   1 
ATOM   3705 C CE1   . PHE B 1 198 ? -16.979 8.214   66.879  1.00   46.92  ? 183 PHE B CE1   1 
ATOM   3706 C CE2   . PHE B 1 198 ? -17.914 10.234  67.753  1.00   45.94  ? 183 PHE B CE2   1 
ATOM   3707 C CZ    . PHE B 1 198 ? -17.871 9.261   66.767  1.00   43.07  ? 183 PHE B CZ    1 
ATOM   3708 N N     . GLY B 1 199 ? -12.453 9.322   71.903  1.00   44.16  ? 184 GLY B N     1 
ATOM   3709 C CA    . GLY B 1 199 ? -11.931 9.392   73.259  1.00   40.09  ? 184 GLY B CA    1 
ATOM   3710 C C     . GLY B 1 199 ? -10.878 10.457  73.517  1.00   45.35  ? 184 GLY B C     1 
ATOM   3711 O O     . GLY B 1 199 ? -10.393 10.602  74.644  1.00   42.41  ? 184 GLY B O     1 
ATOM   3712 N N     . TYR B 1 200 ? -10.536 11.217  72.481  1.00   41.91  ? 185 TYR B N     1 
ATOM   3713 C CA    . TYR B 1 200 ? -9.523  12.249  72.598  1.00   40.17  ? 185 TYR B CA    1 
ATOM   3714 C C     . TYR B 1 200 ? -10.068 13.601  72.174  1.00   41.14  ? 185 TYR B C     1 
ATOM   3715 O O     . TYR B 1 200 ? -10.995 13.685  71.384  1.00   43.65  ? 185 TYR B O     1 
ATOM   3716 C CB    . TYR B 1 200 ? -8.297  11.858  71.759  1.00   43.25  ? 185 TYR B CB    1 
ATOM   3717 C CG    . TYR B 1 200 ? -7.743  10.521  72.192  1.00   41.34  ? 185 TYR B CG    1 
ATOM   3718 C CD1   . TYR B 1 200 ? -6.739  10.445  73.148  1.00   39.79  ? 185 TYR B CD1   1 
ATOM   3719 C CD2   . TYR B 1 200 ? -8.265  9.334   71.686  1.00   44.68  ? 185 TYR B CD2   1 
ATOM   3720 C CE1   . TYR B 1 200 ? -6.245  9.220   73.578  1.00   45.93  ? 185 TYR B CE1   1 
ATOM   3721 C CE2   . TYR B 1 200 ? -7.780  8.098   72.109  1.00   46.87  ? 185 TYR B CE2   1 
ATOM   3722 C CZ    . TYR B 1 200 ? -6.770  8.052   73.056  1.00   46.14  ? 185 TYR B CZ    1 
ATOM   3723 O OH    . TYR B 1 200 ? -6.286  6.836   73.484  1.00   53.34  ? 185 TYR B OH    1 
ATOM   3724 N N     . GLY B 1 201 ? -9.495  14.668  72.701  1.00   44.45  ? 186 GLY B N     1 
ATOM   3725 C CA    . GLY B 1 201 ? -9.910  15.995  72.300  1.00   41.63  ? 186 GLY B CA    1 
ATOM   3726 C C     . GLY B 1 201 ? -10.884 16.648  73.257  1.00   41.22  ? 186 GLY B C     1 
ATOM   3727 O O     . GLY B 1 201 ? -11.738 15.996  73.845  1.00   43.73  ? 186 GLY B O     1 
ATOM   3728 N N     . ASP B 1 202 ? -10.724 17.951  73.418  1.00   35.32  ? 187 ASP B N     1 
ATOM   3729 C CA    . ASP B 1 202 ? -11.689 18.781  74.104  1.00   35.47  ? 187 ASP B CA    1 
ATOM   3730 C C     . ASP B 1 202 ? -12.952 18.935  73.249  1.00   38.03  ? 187 ASP B C     1 
ATOM   3731 O O     . ASP B 1 202 ? -14.044 19.146  73.773  1.00   32.39  ? 187 ASP B O     1 
ATOM   3732 C CB    . ASP B 1 202 ? -11.050 20.138  74.363  1.00   35.35  ? 187 ASP B CB    1 
ATOM   3733 C CG    . ASP B 1 202 ? -9.669  19.997  75.004  1.00   47.12  ? 187 ASP B CG    1 
ATOM   3734 O OD1   . ASP B 1 202 ? -9.577  19.293  76.031  1.00   52.37  ? 187 ASP B OD1   1 
ATOM   3735 O OD2   . ASP B 1 202 ? -8.674  20.531  74.473  1.00   43.48  ? 187 ASP B OD2   1 
ATOM   3736 N N     . VAL B 1 203 ? -12.788 18.843  71.932  1.00   33.92  ? 188 VAL B N     1 
ATOM   3737 C CA    . VAL B 1 203 ? -13.903 18.996  71.013  1.00   30.39  ? 188 VAL B CA    1 
ATOM   3738 C C     . VAL B 1 203 ? -13.859 17.899  69.954  1.00   33.19  ? 188 VAL B C     1 
ATOM   3739 O O     . VAL B 1 203 ? -12.820 17.649  69.333  1.00   32.43  ? 188 VAL B O     1 
ATOM   3740 C CB    . VAL B 1 203 ? -13.904 20.383  70.362  1.00   33.38  ? 188 VAL B CB    1 
ATOM   3741 C CG1   . VAL B 1 203 ? -15.092 20.533  69.408  1.00   28.86  ? 188 VAL B CG1   1 
ATOM   3742 C CG2   . VAL B 1 203 ? -13.909 21.472  71.445  1.00   27.99  ? 188 VAL B CG2   1 
ATOM   3743 N N     . VAL B 1 204 ? -14.981 17.211  69.782  1.00   30.40  ? 189 VAL B N     1 
ATOM   3744 C CA    . VAL B 1 204 ? -15.075 16.140  68.797  1.00   29.23  ? 189 VAL B CA    1 
ATOM   3745 C C     . VAL B 1 204 ? -16.203 16.462  67.819  1.00   31.23  ? 189 VAL B C     1 
ATOM   3746 O O     . VAL B 1 204 ? -17.360 16.600  68.207  1.00   34.28  ? 189 VAL B O     1 
ATOM   3747 C CB    . VAL B 1 204 ? -15.337 14.764  69.482  1.00   31.53  ? 189 VAL B CB    1 
ATOM   3748 C CG1   . VAL B 1 204 ? -15.360 13.645  68.478  1.00   31.79  ? 189 VAL B CG1   1 
ATOM   3749 C CG2   . VAL B 1 204 ? -14.298 14.480  70.575  1.00   30.81  ? 189 VAL B CG2   1 
ATOM   3750 N N     . PHE B 1 205 ? -15.852 16.598  66.551  1.00   32.49  ? 190 PHE B N     1 
ATOM   3751 C CA    . PHE B 1 205 ? -16.816 16.788  65.487  1.00   30.13  ? 190 PHE B CA    1 
ATOM   3752 C C     . PHE B 1 205 ? -17.104 15.413  64.909  1.00   33.35  ? 190 PHE B C     1 
ATOM   3753 O O     . PHE B 1 205 ? -16.186 14.662  64.582  1.00   34.93  ? 190 PHE B O     1 
ATOM   3754 C CB    . PHE B 1 205 ? -16.234 17.693  64.374  1.00   25.52  ? 190 PHE B CB    1 
ATOM   3755 C CG    . PHE B 1 205 ? -15.870 19.092  64.834  1.00   27.99  ? 190 PHE B CG    1 
ATOM   3756 C CD1   . PHE B 1 205 ? -16.828 20.104  64.871  1.00   23.02  ? 190 PHE B CD1   1 
ATOM   3757 C CD2   . PHE B 1 205 ? -14.556 19.408  65.183  1.00   28.39  ? 190 PHE B CD2   1 
ATOM   3758 C CE1   . PHE B 1 205 ? -16.499 21.393  65.277  1.00   24.17  ? 190 PHE B CE1   1 
ATOM   3759 C CE2   . PHE B 1 205 ? -14.208 20.714  65.583  1.00   27.96  ? 190 PHE B CE2   1 
ATOM   3760 C CZ    . PHE B 1 205 ? -15.182 21.700  65.646  1.00   25.86  ? 190 PHE B CZ    1 
ATOM   3761 N N     . VAL B 1 206 ? -18.374 15.067  64.778  1.00   32.83  ? 191 VAL B N     1 
ATOM   3762 C CA    . VAL B 1 206 ? -18.720 13.861  64.049  1.00   33.11  ? 191 VAL B CA    1 
ATOM   3763 C C     . VAL B 1 206 ? -19.665 14.254  62.917  1.00   34.32  ? 191 VAL B C     1 
ATOM   3764 O O     . VAL B 1 206 ? -20.570 15.063  63.109  1.00   35.39  ? 191 VAL B O     1 
ATOM   3765 C CB    . VAL B 1 206 ? -19.343 12.783  64.974  1.00   35.64  ? 191 VAL B CB    1 
ATOM   3766 C CG1   . VAL B 1 206 ? -20.600 13.305  65.644  1.00   33.34  ? 191 VAL B CG1   1 
ATOM   3767 C CG2   . VAL B 1 206 ? -19.652 11.524  64.180  1.00   37.50  ? 191 VAL B CG2   1 
ATOM   3768 N N     . SER B 1 207 ? -19.448 13.710  61.728  1.00   33.42  ? 192 SER B N     1 
ATOM   3769 C CA    . SER B 1 207 ? -20.244 14.140  60.586  1.00   36.47  ? 192 SER B CA    1 
ATOM   3770 C C     . SER B 1 207 ? -21.599 13.442  60.552  1.00   36.55  ? 192 SER B C     1 
ATOM   3771 O O     . SER B 1 207 ? -21.798 12.372  61.159  1.00   33.47  ? 192 SER B O     1 
ATOM   3772 C CB    . SER B 1 207 ? -19.496 13.907  59.274  1.00   40.14  ? 192 SER B CB    1 
ATOM   3773 O OG    . SER B 1 207 ? -19.448 12.528  58.964  1.00   41.53  ? 192 SER B OG    1 
ATOM   3774 N N     . LYS B 1 208 ? -22.535 14.047  59.837  1.00   33.81  ? 193 LYS B N     1 
ATOM   3775 C CA    . LYS B 1 208 ? -23.861 13.475  59.776  1.00   35.92  ? 193 LYS B CA    1 
ATOM   3776 C C     . LYS B 1 208 ? -23.788 12.135  59.064  1.00   40.31  ? 193 LYS B C     1 
ATOM   3777 O O     . LYS B 1 208 ? -24.520 11.201  59.387  1.00   42.37  ? 193 LYS B O     1 
ATOM   3778 C CB    . LYS B 1 208 ? -24.835 14.433  59.095  1.00   37.42  ? 193 LYS B CB    1 
ATOM   3779 C CG    . LYS B 1 208 ? -24.707 14.539  57.614  1.00   40.92  ? 193 LYS B CG    1 
ATOM   3780 C CD    . LYS B 1 208 ? -25.665 15.608  57.081  1.00   47.42  ? 193 LYS B CD    1 
ATOM   3781 C CE    . LYS B 1 208 ? -25.424 15.878  55.595  1.00   48.40  ? 193 LYS B CE    1 
ATOM   3782 N NZ    . LYS B 1 208 ? -24.043 16.384  55.340  1.00   48.08  ? 193 LYS B NZ    1 
ATOM   3783 N N     . ASP B 1 209 ? -22.858 12.025  58.126  1.00   38.83  ? 194 ASP B N     1 
ATOM   3784 C CA    . ASP B 1 209 ? -22.699 10.791  57.373  1.00   45.69  ? 194 ASP B CA    1 
ATOM   3785 C C     . ASP B 1 209 ? -22.270 9.620   58.249  1.00   44.57  ? 194 ASP B C     1 
ATOM   3786 O O     . ASP B 1 209 ? -22.702 8.500   58.031  1.00   46.46  ? 194 ASP B O     1 
ATOM   3787 C CB    . ASP B 1 209 ? -21.723 10.975  56.204  1.00   50.51  ? 194 ASP B CB    1 
ATOM   3788 C CG    . ASP B 1 209 ? -21.582 9.721   55.374  1.00   59.07  ? 194 ASP B CG    1 
ATOM   3789 O OD1   . ASP B 1 209 ? -22.391 9.530   54.441  1.00   64.13  ? 194 ASP B OD1   1 
ATOM   3790 O OD2   . ASP B 1 209 ? -20.674 8.913   55.668  1.00   62.83  ? 194 ASP B OD2   1 
ATOM   3791 N N     . VAL B 1 210 ? -21.415 9.875   59.233  1.00   41.97  ? 195 VAL B N     1 
ATOM   3792 C CA    . VAL B 1 210 ? -21.039 8.840   60.180  1.00   40.28  ? 195 VAL B CA    1 
ATOM   3793 C C     . VAL B 1 210 ? -22.231 8.515   61.075  1.00   44.06  ? 195 VAL B C     1 
ATOM   3794 O O     . VAL B 1 210 ? -22.557 7.351   61.290  1.00   44.64  ? 195 VAL B O     1 
ATOM   3795 C CB    . VAL B 1 210 ? -19.862 9.279   61.070  1.00   44.53  ? 195 VAL B CB    1 
ATOM   3796 C CG1   . VAL B 1 210 ? -19.736 8.361   62.298  1.00   41.66  ? 195 VAL B CG1   1 
ATOM   3797 C CG2   . VAL B 1 210 ? -18.578 9.317   60.273  1.00   42.30  ? 195 VAL B CG2   1 
ATOM   3798 N N     . ALA B 1 211 ? -22.877 9.555   61.593  1.00   42.62  ? 196 ALA B N     1 
ATOM   3799 C CA    . ALA B 1 211 ? -24.101 9.390   62.378  1.00   43.22  ? 196 ALA B CA    1 
ATOM   3800 C C     . ALA B 1 211 ? -25.130 8.509   61.661  1.00   41.50  ? 196 ALA B C     1 
ATOM   3801 O O     . ALA B 1 211 ? -25.680 7.581   62.243  1.00   40.32  ? 196 ALA B O     1 
ATOM   3802 C CB    . ALA B 1 211 ? -24.704 10.744  62.720  1.00   35.36  ? 196 ALA B CB    1 
ATOM   3803 N N     . LYS B 1 212 ? -25.378 8.793   60.394  1.00   42.89  ? 197 LYS B N     1 
ATOM   3804 C CA    . LYS B 1 212 ? -26.375 8.030   59.650  1.00   45.92  ? 197 LYS B CA    1 
ATOM   3805 C C     . LYS B 1 212 ? -25.990 6.569   59.533  1.00   49.84  ? 197 LYS B C     1 
ATOM   3806 O O     . LYS B 1 212 ? -26.827 5.690   59.734  1.00   51.78  ? 197 LYS B O     1 
ATOM   3807 C CB    . LYS B 1 212 ? -26.605 8.619   58.261  1.00   46.49  ? 197 LYS B CB    1 
ATOM   3808 C CG    . LYS B 1 212 ? -27.571 9.782   58.237  1.00   44.88  ? 197 LYS B CG    1 
ATOM   3809 C CD    . LYS B 1 212 ? -27.394 10.587  56.973  1.00   48.67  ? 197 LYS B CD    1 
ATOM   3810 C CE    . LYS B 1 212 ? -28.352 11.770  56.945  1.00   56.12  ? 197 LYS B CE    1 
ATOM   3811 N NZ    . LYS B 1 212 ? -28.082 12.723  55.813  1.00   59.47  ? 197 LYS B NZ    1 
ATOM   3812 N N     . HIS B 1 213 ? -24.723 6.307   59.219  1.00   47.66  ? 198 HIS B N     1 
ATOM   3813 C CA    . HIS B 1 213 ? -24.252 4.932   59.088  1.00   47.09  ? 198 HIS B CA    1 
ATOM   3814 C C     . HIS B 1 213 ? -24.382 4.150   60.388  1.00   48.67  ? 198 HIS B C     1 
ATOM   3815 O O     . HIS B 1 213 ? -24.560 2.937   60.365  1.00   51.94  ? 198 HIS B O     1 
ATOM   3816 C CB    . HIS B 1 213 ? -22.819 4.876   58.539  1.00   53.85  ? 198 HIS B CB    1 
ATOM   3817 C CG    . HIS B 1 213 ? -22.737 5.107   57.058  1.00   61.00  ? 198 HIS B CG    1 
ATOM   3818 N ND1   . HIS B 1 213 ? -23.025 6.326   56.476  1.00   60.04  ? 198 HIS B ND1   1 
ATOM   3819 C CD2   . HIS B 1 213 ? -22.432 4.268   56.038  1.00   61.73  ? 198 HIS B CD2   1 
ATOM   3820 C CE1   . HIS B 1 213 ? -22.877 6.233   55.166  1.00   62.37  ? 198 HIS B CE1   1 
ATOM   3821 N NE2   . HIS B 1 213 ? -22.522 4.994   54.873  1.00   62.36  ? 198 HIS B NE2   1 
ATOM   3822 N N     . LEU B 1 214 ? -24.302 4.841   61.520  1.00   47.30  ? 199 LEU B N     1 
ATOM   3823 C CA    . LEU B 1 214 ? -24.513 4.194   62.807  1.00   45.83  ? 199 LEU B CA    1 
ATOM   3824 C C     . LEU B 1 214 ? -26.003 4.058   63.123  1.00   51.70  ? 199 LEU B C     1 
ATOM   3825 O O     . LEU B 1 214 ? -26.370 3.548   64.170  1.00   52.74  ? 199 LEU B O     1 
ATOM   3826 C CB    . LEU B 1 214 ? -23.847 4.988   63.917  1.00   47.38  ? 199 LEU B CB    1 
ATOM   3827 C CG    . LEU B 1 214 ? -22.336 5.137   63.848  1.00   50.20  ? 199 LEU B CG    1 
ATOM   3828 C CD1   . LEU B 1 214 ? -21.855 5.915   65.058  1.00   50.07  ? 199 LEU B CD1   1 
ATOM   3829 C CD2   . LEU B 1 214 ? -21.685 3.769   63.798  1.00   52.44  ? 199 LEU B CD2   1 
ATOM   3830 N N     . GLY B 1 215 ? -26.861 4.543   62.232  1.00   51.44  ? 200 GLY B N     1 
ATOM   3831 C CA    . GLY B 1 215 ? -28.295 4.419   62.433  1.00   50.83  ? 200 GLY B CA    1 
ATOM   3832 C C     . GLY B 1 215 ? -29.017 5.558   63.144  1.00   53.65  ? 200 GLY B C     1 
ATOM   3833 O O     . GLY B 1 215 ? -30.182 5.405   63.517  1.00   51.88  ? 200 GLY B O     1 
ATOM   3834 N N     . PHE B 1 216 ? -28.346 6.691   63.338  1.00   46.53  ? 201 PHE B N     1 
ATOM   3835 C CA    . PHE B 1 216 ? -28.995 7.852   63.936  1.00   43.20  ? 201 PHE B CA    1 
ATOM   3836 C C     . PHE B 1 216 ? -29.628 8.719   62.853  1.00   45.54  ? 201 PHE B C     1 
ATOM   3837 O O     . PHE B 1 216 ? -29.027 8.954   61.803  1.00   43.75  ? 201 PHE B O     1 
ATOM   3838 C CB    . PHE B 1 216 ? -28.008 8.676   64.757  1.00   41.79  ? 201 PHE B CB    1 
ATOM   3839 C CG    . PHE B 1 216 ? -27.313 7.893   65.821  1.00   44.50  ? 201 PHE B CG    1 
ATOM   3840 C CD1   . PHE B 1 216 ? -28.035 7.277   66.834  1.00   44.66  ? 201 PHE B CD1   1 
ATOM   3841 C CD2   . PHE B 1 216 ? -25.933 7.763   65.814  1.00   45.48  ? 201 PHE B CD2   1 
ATOM   3842 C CE1   . PHE B 1 216 ? -27.395 6.542   67.823  1.00   45.44  ? 201 PHE B CE1   1 
ATOM   3843 C CE2   . PHE B 1 216 ? -25.283 7.033   66.804  1.00   45.03  ? 201 PHE B CE2   1 
ATOM   3844 C CZ    . PHE B 1 216 ? -26.013 6.421   67.809  1.00   45.90  ? 201 PHE B CZ    1 
ATOM   3845 N N     . GLN B 1 217 ? -30.835 9.208   63.120  1.00   40.23  ? 202 GLN B N     1 
ATOM   3846 C CA    . GLN B 1 217 ? -31.592 9.942   62.118  1.00   41.72  ? 202 GLN B CA    1 
ATOM   3847 C C     . GLN B 1 217 ? -31.612 11.449  62.319  1.00   39.17  ? 202 GLN B C     1 
ATOM   3848 O O     . GLN B 1 217 ? -32.229 12.169  61.550  1.00   44.15  ? 202 GLN B O     1 
ATOM   3849 C CB    . GLN B 1 217 ? -33.022 9.427   62.070  1.00   51.47  ? 202 GLN B CB    1 
ATOM   3850 C CG    . GLN B 1 217 ? -33.163 8.034   61.502  1.00   54.11  ? 202 GLN B CG    1 
ATOM   3851 C CD    . GLN B 1 217 ? -34.593 7.763   61.063  1.00   66.18  ? 202 GLN B CD    1 
ATOM   3852 O OE1   . GLN B 1 217 ? -34.826 7.093   60.056  1.00   71.52  ? 202 GLN B OE1   1 
ATOM   3853 N NE2   . GLN B 1 217 ? -35.562 8.306   61.807  1.00   54.39  ? 202 GLN B NE2   1 
ATOM   3854 N N     . SER B 1 218 ? -30.955 11.933  63.361  1.00   39.17  ? 203 SER B N     1 
ATOM   3855 C CA    . SER B 1 218 ? -30.858 13.369  63.575  1.00   34.16  ? 203 SER B CA    1 
ATOM   3856 C C     . SER B 1 218 ? -29.610 13.656  64.402  1.00   36.26  ? 203 SER B C     1 
ATOM   3857 O O     . SER B 1 218 ? -29.012 12.745  64.954  1.00   37.81  ? 203 SER B O     1 
ATOM   3858 C CB    . SER B 1 218 ? -32.087 13.878  64.330  1.00   35.77  ? 203 SER B CB    1 
ATOM   3859 O OG    . SER B 1 218 ? -32.070 13.419  65.679  1.00   37.38  ? 203 SER B OG    1 
ATOM   3860 N N     . ALA B 1 219 ? -29.247 14.927  64.498  1.00   32.51  ? 204 ALA B N     1 
ATOM   3861 C CA    . ALA B 1 219 ? -28.110 15.359  65.281  1.00   37.14  ? 204 ALA B CA    1 
ATOM   3862 C C     . ALA B 1 219 ? -28.326 15.092  66.770  1.00   37.12  ? 204 ALA B C     1 
ATOM   3863 O O     . ALA B 1 219 ? -27.417 14.634  67.467  1.00   38.21  ? 204 ALA B O     1 
ATOM   3864 C CB    . ALA B 1 219 ? -27.836 16.848  65.023  1.00   32.42  ? 204 ALA B CB    1 
ATOM   3865 N N     . GLU B 1 220 ? -29.536 15.376  67.246  1.00   40.88  ? 205 GLU B N     1 
ATOM   3866 C CA    . GLU B 1 220 ? -29.934 15.105  68.634  1.00   35.48  ? 205 GLU B CA    1 
ATOM   3867 C C     . GLU B 1 220 ? -29.746 13.622  68.988  1.00   35.56  ? 205 GLU B C     1 
ATOM   3868 O O     . GLU B 1 220 ? -29.124 13.292  69.983  1.00   35.02  ? 205 GLU B O     1 
ATOM   3869 C CB    . GLU B 1 220 ? -31.383 15.556  68.868  1.00   34.62  ? 205 GLU B CB    1 
ATOM   3870 C CG    . GLU B 1 220 ? -31.940 15.208  70.266  1.00   34.40  ? 205 GLU B CG    1 
ATOM   3871 C CD    . GLU B 1 220 ? -32.533 13.805  70.315  1.00   37.29  ? 205 GLU B CD    1 
ATOM   3872 O OE1   . GLU B 1 220 ? -32.134 13.028  71.201  1.00   36.35  ? 205 GLU B OE1   1 
ATOM   3873 O OE2   . GLU B 1 220 ? -33.412 13.484  69.471  1.00   38.68  ? 205 GLU B OE2   1 
ATOM   3874 N N     . GLU B 1 221 ? -30.256 12.732  68.146  1.00   34.25  ? 206 GLU B N     1 
ATOM   3875 C CA    . GLU B 1 221 ? -30.008 11.303  68.292  1.00   37.61  ? 206 GLU B CA    1 
ATOM   3876 C C     . GLU B 1 221 ? -28.506 10.941  68.329  1.00   40.86  ? 206 GLU B C     1 
ATOM   3877 O O     . GLU B 1 221 ? -28.069 10.125  69.144  1.00   39.28  ? 206 GLU B O     1 
ATOM   3878 C CB    . GLU B 1 221 ? -30.696 10.524  67.153  1.00   39.79  ? 206 GLU B CB    1 
ATOM   3879 C CG    . GLU B 1 221 ? -32.235 10.513  67.176  1.00   35.04  ? 206 GLU B CG    1 
ATOM   3880 C CD    . GLU B 1 221 ? -32.822 9.393   66.296  1.00   44.33  ? 206 GLU B CD    1 
ATOM   3881 O OE1   . GLU B 1 221 ? -34.071 9.327   66.126  1.00   45.50  ? 206 GLU B OE1   1 
ATOM   3882 O OE2   . GLU B 1 221 ? -32.038 8.566   65.772  1.00   43.60  ? 206 GLU B OE2   1 
ATOM   3883 N N     . ALA B 1 222 ? -27.725 11.528  67.427  1.00   37.21  ? 207 ALA B N     1 
ATOM   3884 C CA    . ALA B 1 222 ? -26.301 11.220  67.333  1.00   40.57  ? 207 ALA B CA    1 
ATOM   3885 C C     . ALA B 1 222 ? -25.542 11.644  68.584  1.00   36.63  ? 207 ALA B C     1 
ATOM   3886 O O     . ALA B 1 222 ? -24.766 10.861  69.151  1.00   38.99  ? 207 ALA B O     1 
ATOM   3887 C CB    . ALA B 1 222 ? -25.681 11.859  66.062  1.00   36.07  ? 207 ALA B CB    1 
ATOM   3888 N N     . LEU B 1 223 ? -25.764 12.877  69.025  1.00   33.70  ? 208 LEU B N     1 
ATOM   3889 C CA    . LEU B 1 223 ? -25.091 13.342  70.222  1.00   34.71  ? 208 LEU B CA    1 
ATOM   3890 C C     . LEU B 1 223 ? -25.448 12.537  71.472  1.00   39.76  ? 208 LEU B C     1 
ATOM   3891 O O     . LEU B 1 223 ? -24.556 12.129  72.213  1.00   41.67  ? 208 LEU B O     1 
ATOM   3892 C CB    . LEU B 1 223 ? -25.328 14.832  70.458  1.00   34.50  ? 208 LEU B CB    1 
ATOM   3893 C CG    . LEU B 1 223 ? -24.783 15.714  69.338  1.00   36.22  ? 208 LEU B CG    1 
ATOM   3894 C CD1   . LEU B 1 223 ? -24.886 17.165  69.725  1.00   39.03  ? 208 LEU B CD1   1 
ATOM   3895 C CD2   . LEU B 1 223 ? -23.333 15.363  69.002  1.00   35.87  ? 208 LEU B CD2   1 
ATOM   3896 N N     . ARG B 1 224 ? -26.735 12.319  71.727  1.00   39.13  ? 209 ARG B N     1 
ATOM   3897 C CA    . ARG B 1 224 ? -27.133 11.533  72.904  1.00   40.08  ? 209 ARG B CA    1 
ATOM   3898 C C     . ARG B 1 224 ? -26.595 10.108  72.781  1.00   41.85  ? 209 ARG B C     1 
ATOM   3899 O O     . ARG B 1 224 ? -26.206 9.498   73.767  1.00   44.22  ? 209 ARG B O     1 
ATOM   3900 C CB    . ARG B 1 224 ? -28.658 11.474  73.072  1.00   39.18  ? 209 ARG B CB    1 
ATOM   3901 C CG    . ARG B 1 224 ? -29.332 12.792  73.381  1.00   40.08  ? 209 ARG B CG    1 
ATOM   3902 C CD    . ARG B 1 224 ? -28.949 13.312  74.750  1.00   41.46  ? 209 ARG B CD    1 
ATOM   3903 N NE    . ARG B 1 224 ? -29.599 14.587  75.045  1.00   39.27  ? 209 ARG B NE    1 
ATOM   3904 C CZ    . ARG B 1 224 ? -29.220 15.412  76.017  1.00   39.69  ? 209 ARG B CZ    1 
ATOM   3905 N NH1   . ARG B 1 224 ? -28.188 15.105  76.796  1.00   37.17  ? 209 ARG B NH1   1 
ATOM   3906 N NH2   . ARG B 1 224 ? -29.869 16.552  76.203  1.00   42.08  ? 209 ARG B NH2   1 
ATOM   3907 N N     . GLY B 1 225 ? -26.581 9.570   71.568  1.00   39.85  ? 210 GLY B N     1 
ATOM   3908 C CA    . GLY B 1 225 ? -26.150 8.196   71.384  1.00   41.51  ? 210 GLY B CA    1 
ATOM   3909 C C     . GLY B 1 225 ? -24.642 7.973   71.395  1.00   45.08  ? 210 GLY B C     1 
ATOM   3910 O O     . GLY B 1 225 ? -24.193 6.838   71.530  1.00   46.49  ? 210 GLY B O     1 
ATOM   3911 N N     . LEU B 1 226 ? -23.857 9.036   71.234  1.00   39.38  ? 211 LEU B N     1 
ATOM   3912 C CA    . LEU B 1 226 ? -22.417 8.879   71.090  1.00   40.54  ? 211 LEU B CA    1 
ATOM   3913 C C     . LEU B 1 226 ? -21.660 9.555   72.192  1.00   37.53  ? 211 LEU B C     1 
ATOM   3914 O O     . LEU B 1 226 ? -20.476 9.300   72.365  1.00   42.61  ? 211 LEU B O     1 
ATOM   3915 C CB    . LEU B 1 226 ? -21.933 9.444   69.751  1.00   42.14  ? 211 LEU B CB    1 
ATOM   3916 C CG    . LEU B 1 226 ? -22.350 8.651   68.525  1.00   40.32  ? 211 LEU B CG    1 
ATOM   3917 C CD1   . LEU B 1 226 ? -22.067 9.447   67.246  1.00   38.11  ? 211 LEU B CD1   1 
ATOM   3918 C CD2   . LEU B 1 226 ? -21.653 7.300   68.533  1.00   36.20  ? 211 LEU B CD2   1 
ATOM   3919 N N     . TYR B 1 227 ? -22.334 10.422  72.939  1.00   38.43  ? 212 TYR B N     1 
ATOM   3920 C CA    . TYR B 1 227 ? -21.646 11.184  73.969  1.00   38.07  ? 212 TYR B CA    1 
ATOM   3921 C C     . TYR B 1 227 ? -20.849 10.283  74.918  1.00   44.84  ? 212 TYR B C     1 
ATOM   3922 O O     . TYR B 1 227 ? -19.733 10.618  75.326  1.00   45.69  ? 212 TYR B O     1 
ATOM   3923 C CB    . TYR B 1 227 ? -22.588 12.073  74.763  1.00   32.96  ? 212 TYR B CB    1 
ATOM   3924 C CG    . TYR B 1 227 ? -21.784 13.027  75.602  1.00   39.69  ? 212 TYR B CG    1 
ATOM   3925 C CD1   . TYR B 1 227 ? -21.287 14.199  75.045  1.00   33.25  ? 212 TYR B CD1   1 
ATOM   3926 C CD2   . TYR B 1 227 ? -21.452 12.728  76.929  1.00   39.14  ? 212 TYR B CD2   1 
ATOM   3927 C CE1   . TYR B 1 227 ? -20.528 15.073  75.775  1.00   32.95  ? 212 TYR B CE1   1 
ATOM   3928 C CE2   . TYR B 1 227 ? -20.679 13.608  77.684  1.00   39.65  ? 212 TYR B CE2   1 
ATOM   3929 C CZ    . TYR B 1 227 ? -20.208 14.783  77.084  1.00   43.68  ? 212 TYR B CZ    1 
ATOM   3930 O OH    . TYR B 1 227 ? -19.426 15.693  77.774  1.00   40.04  ? 212 TYR B OH    1 
ATOM   3931 N N     . GLY B 1 228 ? -21.419 9.132   75.255  1.00   45.58  ? 213 GLY B N     1 
ATOM   3932 C CA    . GLY B 1 228 ? -20.732 8.169   76.095  1.00   47.26  ? 213 GLY B CA    1 
ATOM   3933 C C     . GLY B 1 228 ? -19.288 7.921   75.670  1.00   47.33  ? 213 GLY B C     1 
ATOM   3934 O O     . GLY B 1 228 ? -18.453 7.586   76.497  1.00   46.59  ? 213 GLY B O     1 
ATOM   3935 N N     . ARG B 1 229 ? -18.982 8.107   74.391  1.00   42.01  ? 214 ARG B N     1 
ATOM   3936 C CA    . ARG B 1 229 ? -17.676 7.703   73.868  1.00   44.51  ? 214 ARG B CA    1 
ATOM   3937 C C     . ARG B 1 229 ? -16.567 8.745   74.060  1.00   43.25  ? 214 ARG B C     1 
ATOM   3938 O O     . ARG B 1 229 ? -15.397 8.455   73.834  1.00   44.91  ? 214 ARG B O     1 
ATOM   3939 C CB    . ARG B 1 229 ? -17.778 7.350   72.386  1.00   45.33  ? 214 ARG B CB    1 
ATOM   3940 C CG    . ARG B 1 229 ? -18.753 6.231   72.047  1.00   46.22  ? 214 ARG B CG    1 
ATOM   3941 C CD    . ARG B 1 229 ? -18.087 5.280   71.073  1.00   55.43  ? 214 ARG B CD    1 
ATOM   3942 N NE    . ARG B 1 229 ? -18.995 4.663   70.116  1.00   53.25  ? 214 ARG B NE    1 
ATOM   3943 C CZ    . ARG B 1 229 ? -18.628 3.695   69.275  1.00   60.22  ? 214 ARG B CZ    1 
ATOM   3944 N NH1   . ARG B 1 229 ? -17.376 3.247   69.296  1.00   59.67  ? 214 ARG B NH1   1 
ATOM   3945 N NH2   . ARG B 1 229 ? -19.501 3.174   68.415  1.00   56.48  ? 214 ARG B NH2   1 
ATOM   3946 N N     . VAL B 1 230 ? -16.932 9.956   74.459  1.00   39.89  ? 215 VAL B N     1 
ATOM   3947 C CA    . VAL B 1 230 ? -15.961 11.020  74.559  1.00   39.59  ? 215 VAL B CA    1 
ATOM   3948 C C     . VAL B 1 230 ? -15.356 11.063  75.950  1.00   43.53  ? 215 VAL B C     1 
ATOM   3949 O O     . VAL B 1 230 ? -15.924 10.518  76.892  1.00   44.05  ? 215 VAL B O     1 
ATOM   3950 C CB    . VAL B 1 230 ? -16.569 12.383  74.184  1.00   40.66  ? 215 VAL B CB    1 
ATOM   3951 C CG1   . VAL B 1 230 ? -17.325 12.278  72.843  1.00   36.49  ? 215 VAL B CG1   1 
ATOM   3952 C CG2   . VAL B 1 230 ? -17.464 12.894  75.286  1.00   38.63  ? 215 VAL B CG2   1 
ATOM   3953 N N     . ARG B 1 231 ? -14.201 11.710  76.084  1.00   42.87  ? 216 ARG B N     1 
ATOM   3954 C CA    . ARG B 1 231 ? -13.566 11.783  77.385  1.00   42.84  ? 216 ARG B CA    1 
ATOM   3955 C C     . ARG B 1 231 ? -14.221 12.843  78.234  1.00   46.87  ? 216 ARG B C     1 
ATOM   3956 O O     . ARG B 1 231 ? -14.866 13.758  77.724  1.00   47.54  ? 216 ARG B O     1 
ATOM   3957 C CB    . ARG B 1 231 ? -12.044 11.976  77.295  1.00   49.70  ? 216 ARG B CB    1 
ATOM   3958 C CG    . ARG B 1 231 ? -11.565 13.380  76.982  1.00   53.76  ? 216 ARG B CG    1 
ATOM   3959 C CD    . ARG B 1 231 ? -10.041 13.435  77.095  1.00   54.06  ? 216 ARG B CD    1 
ATOM   3960 N NE    . ARG B 1 231 ? -9.428  14.465  76.256  1.00   58.16  ? 216 ARG B NE    1 
ATOM   3961 C CZ    . ARG B 1 231 ? -8.159  14.428  75.840  1.00   62.56  ? 216 ARG B CZ    1 
ATOM   3962 N NH1   . ARG B 1 231 ? -7.379  13.404  76.181  1.00   56.16  ? 216 ARG B NH1   1 
ATOM   3963 N NH2   . ARG B 1 231 ? -7.674  15.402  75.068  1.00   59.87  ? 216 ARG B NH2   1 
ATOM   3964 N N     . LYS B 1 232 ? -14.080 12.688  79.544  1.00   49.34  ? 217 LYS B N     1 
ATOM   3965 C CA    . LYS B 1 232 ? -14.768 13.536  80.492  1.00   47.08  ? 217 LYS B CA    1 
ATOM   3966 C C     . LYS B 1 232 ? -14.457 15.002  80.232  1.00   48.03  ? 217 LYS B C     1 
ATOM   3967 O O     . LYS B 1 232 ? -13.305 15.372  79.989  1.00   47.11  ? 217 LYS B O     1 
ATOM   3968 C CB    . LYS B 1 232 ? -14.389 13.141  81.923  1.00   57.98  ? 217 LYS B CB    1 
ATOM   3969 C CG    . LYS B 1 232 ? -14.951 14.074  82.996  1.00   63.84  ? 217 LYS B CG    1 
ATOM   3970 C CD    . LYS B 1 232 ? -14.535 13.641  84.400  1.00   67.48  ? 217 LYS B CD    1 
ATOM   3971 C CE    . LYS B 1 232 ? -15.080 14.605  85.454  1.00   80.90  ? 217 LYS B CE    1 
ATOM   3972 N NZ    . LYS B 1 232 ? -14.772 14.164  86.852  1.00   88.27  ? 217 LYS B NZ    1 
ATOM   3973 N N     . GLY B 1 233 ? -15.491 15.835  80.271  1.00   44.45  ? 218 GLY B N     1 
ATOM   3974 C CA    . GLY B 1 233 ? -15.327 17.255  80.036  1.00   39.36  ? 218 GLY B CA    1 
ATOM   3975 C C     . GLY B 1 233 ? -15.393 17.672  78.573  1.00   39.66  ? 218 GLY B C     1 
ATOM   3976 O O     . GLY B 1 233 ? -15.413 18.868  78.283  1.00   37.38  ? 218 GLY B O     1 
ATOM   3977 N N     . ALA B 1 234 ? -15.430 16.707  77.654  1.00   38.07  ? 219 ALA B N     1 
ATOM   3978 C CA    . ALA B 1 234 ? -15.369 17.033  76.219  1.00   41.49  ? 219 ALA B CA    1 
ATOM   3979 C C     . ALA B 1 234 ? -16.702 17.496  75.615  1.00   40.40  ? 219 ALA B C     1 
ATOM   3980 O O     . ALA B 1 234 ? -17.778 17.148  76.110  1.00   39.68  ? 219 ALA B O     1 
ATOM   3981 C CB    . ALA B 1 234 ? -14.796 15.858  75.417  1.00   34.46  ? 219 ALA B CB    1 
ATOM   3982 N N     . VAL B 1 235 ? -16.612 18.277  74.537  1.00   37.93  ? 220 VAL B N     1 
ATOM   3983 C CA    . VAL B 1 235 ? -17.777 18.716  73.782  1.00   35.26  ? 220 VAL B CA    1 
ATOM   3984 C C     . VAL B 1 235 ? -17.897 17.951  72.464  1.00   36.04  ? 220 VAL B C     1 
ATOM   3985 O O     . VAL B 1 235 ? -16.939 17.871  71.696  1.00   34.69  ? 220 VAL B O     1 
ATOM   3986 C CB    . VAL B 1 235 ? -17.720 20.227  73.486  1.00   39.98  ? 220 VAL B CB    1 
ATOM   3987 C CG1   . VAL B 1 235 ? -18.920 20.647  72.636  1.00   31.02  ? 220 VAL B CG1   1 
ATOM   3988 C CG2   . VAL B 1 235 ? -17.673 21.022  74.802  1.00   34.75  ? 220 VAL B CG2   1 
ATOM   3989 N N     . LEU B 1 236 ? -19.078 17.387  72.219  1.00   32.92  ? 221 LEU B N     1 
ATOM   3990 C CA    . LEU B 1 236 ? -19.355 16.624  71.010  1.00   31.07  ? 221 LEU B CA    1 
ATOM   3991 C C     . LEU B 1 236 ? -20.267 17.436  70.102  1.00   32.67  ? 221 LEU B C     1 
ATOM   3992 O O     . LEU B 1 236 ? -21.271 17.982  70.548  1.00   31.79  ? 221 LEU B O     1 
ATOM   3993 C CB    . LEU B 1 236 ? -19.976 15.273  71.342  1.00   27.71  ? 221 LEU B CB    1 
ATOM   3994 C CG    . LEU B 1 236 ? -20.277 14.318  70.186  1.00   31.26  ? 221 LEU B CG    1 
ATOM   3995 C CD1   . LEU B 1 236 ? -19.014 13.870  69.431  1.00   34.12  ? 221 LEU B CD1   1 
ATOM   3996 C CD2   . LEU B 1 236 ? -21.052 13.106  70.714  1.00   35.00  ? 221 LEU B CD2   1 
ATOM   3997 N N     . VAL B 1 237 ? -19.900 17.529  68.827  1.00   31.40  ? 222 VAL B N     1 
ATOM   3998 C CA    . VAL B 1 237 ? -20.546 18.468  67.916  1.00   31.28  ? 222 VAL B CA    1 
ATOM   3999 C C     . VAL B 1 237 ? -20.960 17.742  66.653  1.00   32.76  ? 222 VAL B C     1 
ATOM   4000 O O     . VAL B 1 237 ? -20.206 16.905  66.156  1.00   34.53  ? 222 VAL B O     1 
ATOM   4001 C CB    . VAL B 1 237 ? -19.596 19.642  67.551  1.00   36.76  ? 222 VAL B CB    1 
ATOM   4002 C CG1   . VAL B 1 237 ? -20.261 20.600  66.572  1.00   28.77  ? 222 VAL B CG1   1 
ATOM   4003 C CG2   . VAL B 1 237 ? -19.134 20.384  68.813  1.00   30.78  ? 222 VAL B CG2   1 
ATOM   4004 N N     . CYS B 1 238 ? -22.162 18.042  66.147  1.00   33.05  ? 223 CYS B N     1 
ATOM   4005 C CA    . CYS B 1 238 ? -22.677 17.403  64.931  1.00   30.99  ? 223 CYS B CA    1 
ATOM   4006 C C     . CYS B 1 238 ? -23.520 18.372  64.090  1.00   37.44  ? 223 CYS B C     1 
ATOM   4007 O O     . CYS B 1 238 ? -24.605 18.812  64.525  1.00   38.45  ? 223 CYS B O     1 
ATOM   4008 C CB    . CYS B 1 238 ? -23.523 16.180  65.297  1.00   31.92  ? 223 CYS B CB    1 
ATOM   4009 S SG    . CYS B 1 238 ? -24.019 15.143  63.890  1.00   38.14  ? 223 CYS B SG    1 
ATOM   4010 N N     . ALA B 1 239 ? -23.016 18.700  62.899  1.00   37.27  ? 224 ALA B N     1 
ATOM   4011 C CA    . ALA B 1 239 ? -23.705 19.566  61.939  1.00   34.01  ? 224 ALA B CA    1 
ATOM   4012 C C     . ALA B 1 239 ? -24.597 18.717  61.049  1.00   37.09  ? 224 ALA B C     1 
ATOM   4013 O O     . ALA B 1 239 ? -24.238 17.590  60.702  1.00   39.33  ? 224 ALA B O     1 
ATOM   4014 C CB    . ALA B 1 239 ? -22.702 20.321  61.091  1.00   33.30  ? 224 ALA B CB    1 
ATOM   4015 N N     . TRP B 1 240 ? -25.755 19.245  60.657  1.00   34.71  ? 225 TRP B N     1 
ATOM   4016 C CA    . TRP B 1 240 ? -26.686 18.434  59.880  1.00   37.03  ? 225 TRP B CA    1 
ATOM   4017 C C     . TRP B 1 240 ? -27.275 19.237  58.739  1.00   39.29  ? 225 TRP B C     1 
ATOM   4018 O O     . TRP B 1 240 ? -28.493 19.437  58.664  1.00   37.70  ? 225 TRP B O     1 
ATOM   4019 C CB    . TRP B 1 240 ? -27.789 17.870  60.787  1.00   35.82  ? 225 TRP B CB    1 
ATOM   4020 C CG    . TRP B 1 240 ? -28.406 16.573  60.326  1.00   36.14  ? 225 TRP B CG    1 
ATOM   4021 C CD1   . TRP B 1 240 ? -29.365 16.414  59.354  1.00   34.41  ? 225 TRP B CD1   1 
ATOM   4022 C CD2   . TRP B 1 240 ? -28.131 15.257  60.837  1.00   32.44  ? 225 TRP B CD2   1 
ATOM   4023 N NE1   . TRP B 1 240 ? -29.687 15.080  59.228  1.00   34.85  ? 225 TRP B NE1   1 
ATOM   4024 C CE2   . TRP B 1 240 ? -28.956 14.353  60.134  1.00   35.91  ? 225 TRP B CE2   1 
ATOM   4025 C CE3   . TRP B 1 240 ? -27.266 14.757  61.818  1.00   34.68  ? 225 TRP B CE3   1 
ATOM   4026 C CZ2   . TRP B 1 240 ? -28.941 12.983  60.378  1.00   35.70  ? 225 TRP B CZ2   1 
ATOM   4027 C CZ3   . TRP B 1 240 ? -27.249 13.396  62.056  1.00   33.74  ? 225 TRP B CZ3   1 
ATOM   4028 C CH2   . TRP B 1 240 ? -28.074 12.524  61.335  1.00   36.16  ? 225 TRP B CH2   1 
ATOM   4029 N N     . ALA B 1 241 ? -26.386 19.704  57.862  1.00   40.12  ? 226 ALA B N     1 
ATOM   4030 C CA    . ALA B 1 241 ? -26.767 20.410  56.646  1.00   36.42  ? 226 ALA B CA    1 
ATOM   4031 C C     . ALA B 1 241 ? -27.762 21.531  56.911  1.00   36.97  ? 226 ALA B C     1 
ATOM   4032 O O     . ALA B 1 241 ? -27.488 22.430  57.706  1.00   37.49  ? 226 ALA B O     1 
ATOM   4033 C CB    . ALA B 1 241 ? -27.314 19.425  55.624  1.00   41.48  ? 226 ALA B CB    1 
ATOM   4034 N N     . GLU B 1 242 ? -28.920 21.474  56.256  1.00   39.43  ? 227 GLU B N     1 
ATOM   4035 C CA    . GLU B 1 242 ? -29.940 22.523  56.392  1.00   41.58  ? 227 GLU B CA    1 
ATOM   4036 C C     . GLU B 1 242 ? -30.638 22.568  57.752  1.00   41.75  ? 227 GLU B C     1 
ATOM   4037 O O     . GLU B 1 242 ? -31.384 23.504  58.042  1.00   40.85  ? 227 GLU B O     1 
ATOM   4038 C CB    . GLU B 1 242 ? -30.983 22.447  55.261  1.00   48.87  ? 227 GLU B CB    1 
ATOM   4039 C CG    . GLU B 1 242 ? -31.763 21.133  55.195  1.00   52.60  ? 227 GLU B CG    1 
ATOM   4040 C CD    . GLU B 1 242 ? -30.884 19.914  54.881  1.00   55.38  ? 227 GLU B CD    1 
ATOM   4041 O OE1   . GLU B 1 242 ? -30.133 19.949  53.879  1.00   59.50  ? 227 GLU B OE1   1 
ATOM   4042 O OE2   . GLU B 1 242 ? -30.944 18.917  55.644  1.00   59.07  ? 227 GLU B OE2   1 
ATOM   4043 N N     . GLU B 1 243 ? -30.400 21.575  58.602  1.00   41.10  ? 228 GLU B N     1 
ATOM   4044 C CA    . GLU B 1 243 ? -30.950 21.644  59.951  1.00   38.04  ? 228 GLU B CA    1 
ATOM   4045 C C     . GLU B 1 243 ? -30.024 22.355  60.937  1.00   38.33  ? 228 GLU B C     1 
ATOM   4046 O O     . GLU B 1 243 ? -30.279 22.330  62.120  1.00   40.47  ? 228 GLU B O     1 
ATOM   4047 C CB    . GLU B 1 243 ? -31.282 20.247  60.473  1.00   41.50  ? 228 GLU B CB    1 
ATOM   4048 C CG    . GLU B 1 243 ? -32.250 19.488  59.585  1.00   45.02  ? 228 GLU B CG    1 
ATOM   4049 C CD    . GLU B 1 243 ? -33.600 20.200  59.450  1.00   54.06  ? 228 GLU B CD    1 
ATOM   4050 O OE1   . GLU B 1 243 ? -34.129 20.679  60.489  1.00   53.48  ? 228 GLU B OE1   1 
ATOM   4051 O OE2   . GLU B 1 243 ? -34.126 20.292  58.307  1.00   58.24  ? 228 GLU B OE2   1 
ATOM   4052 N N     . GLY B 1 244 ? -28.938 22.964  60.463  1.00   35.89  ? 229 GLY B N     1 
ATOM   4053 C CA    . GLY B 1 244 ? -27.985 23.594  61.364  1.00   38.42  ? 229 GLY B CA    1 
ATOM   4054 C C     . GLY B 1 244 ? -27.088 22.595  62.078  1.00   35.26  ? 229 GLY B C     1 
ATOM   4055 O O     . GLY B 1 244 ? -26.613 21.638  61.471  1.00   35.34  ? 229 GLY B O     1 
ATOM   4056 N N     . ALA B 1 245 ? -26.875 22.797  63.372  1.00   31.02  ? 230 ALA B N     1 
ATOM   4057 C CA    . ALA B 1 245 ? -25.928 21.982  64.120  1.00   35.11  ? 230 ALA B CA    1 
ATOM   4058 C C     . ALA B 1 245 ? -26.238 21.941  65.615  1.00   34.49  ? 230 ALA B C     1 
ATOM   4059 O O     . ALA B 1 245 ? -26.775 22.894  66.170  1.00   35.12  ? 230 ALA B O     1 
ATOM   4060 C CB    . ALA B 1 245 ? -24.486 22.523  63.893  1.00   32.21  ? 230 ALA B CB    1 
ATOM   4061 N N     . ASP B 1 246 ? -25.881 20.838  66.266  1.00   36.03  ? 231 ASP B N     1 
ATOM   4062 C CA    . ASP B 1 246 ? -25.994 20.736  67.726  1.00   35.80  ? 231 ASP B CA    1 
ATOM   4063 C C     . ASP B 1 246 ? -24.639 20.503  68.393  1.00   35.77  ? 231 ASP B C     1 
ATOM   4064 O O     . ASP B 1 246 ? -23.656 20.109  67.738  1.00   34.88  ? 231 ASP B O     1 
ATOM   4065 C CB    . ASP B 1 246 ? -26.914 19.577  68.132  1.00   38.57  ? 231 ASP B CB    1 
ATOM   4066 C CG    . ASP B 1 246 ? -28.345 19.718  67.593  1.00   39.25  ? 231 ASP B CG    1 
ATOM   4067 O OD1   . ASP B 1 246 ? -28.744 20.807  67.134  1.00   40.12  ? 231 ASP B OD1   1 
ATOM   4068 O OD2   . ASP B 1 246 ? -29.086 18.725  67.663  1.00   39.60  ? 231 ASP B OD2   1 
ATOM   4069 N N     . ALA B 1 247 ? -24.606 20.731  69.703  1.00   36.13  ? 232 ALA B N     1 
ATOM   4070 C CA    . ALA B 1 247 ? -23.474 20.358  70.548  1.00   36.39  ? 232 ALA B CA    1 
ATOM   4071 C C     . ALA B 1 247 ? -23.947 19.899  71.918  1.00   38.03  ? 232 ALA B C     1 
ATOM   4072 O O     . ALA B 1 247 ? -24.963 20.364  72.435  1.00   41.32  ? 232 ALA B O     1 
ATOM   4073 C CB    . ALA B 1 247 ? -22.503 21.505  70.699  1.00   32.84  ? 232 ALA B CB    1 
ATOM   4074 N N     . LEU B 1 248 ? -23.188 18.992  72.509  1.00   35.92  ? 233 LEU B N     1 
ATOM   4075 C CA    . LEU B 1 248 ? -23.490 18.495  73.826  1.00   36.12  ? 233 LEU B CA    1 
ATOM   4076 C C     . LEU B 1 248 ? -22.207 18.465  74.657  1.00   38.03  ? 233 LEU B C     1 
ATOM   4077 O O     . LEU B 1 248 ? -21.217 17.850  74.270  1.00   34.81  ? 233 LEU B O     1 
ATOM   4078 C CB    . LEU B 1 248 ? -24.117 17.106  73.713  1.00   36.70  ? 233 LEU B CB    1 
ATOM   4079 C CG    . LEU B 1 248 ? -24.456 16.366  75.004  1.00   39.51  ? 233 LEU B CG    1 
ATOM   4080 C CD1   . LEU B 1 248 ? -25.489 17.153  75.825  1.00   39.44  ? 233 LEU B CD1   1 
ATOM   4081 C CD2   . LEU B 1 248 ? -24.942 14.979  74.656  1.00   32.11  ? 233 LEU B CD2   1 
ATOM   4082 N N     . GLY B 1 249 ? -22.223 19.158  75.786  1.00   40.07  ? 234 GLY B N     1 
ATOM   4083 C CA    . GLY B 1 249 ? -21.096 19.145  76.704  1.00   42.84  ? 234 GLY B CA    1 
ATOM   4084 C C     . GLY B 1 249 ? -21.343 18.339  77.978  1.00   46.28  ? 234 GLY B C     1 
ATOM   4085 O O     . GLY B 1 249 ? -22.338 17.613  78.091  1.00   44.65  ? 234 GLY B O     1 
ATOM   4086 N N     . PRO B 1 250 ? -20.420 18.448  78.942  1.00   42.33  ? 235 PRO B N     1 
ATOM   4087 C CA    . PRO B 1 250 ? -20.493 17.693  80.200  1.00   45.52  ? 235 PRO B CA    1 
ATOM   4088 C C     . PRO B 1 250 ? -21.736 18.001  81.044  1.00   45.96  ? 235 PRO B C     1 
ATOM   4089 O O     . PRO B 1 250 ? -22.191 17.118  81.773  1.00   47.68  ? 235 PRO B O     1 
ATOM   4090 C CB    . PRO B 1 250 ? -19.201 18.096  80.950  1.00   41.04  ? 235 PRO B CB    1 
ATOM   4091 C CG    . PRO B 1 250 ? -18.629 19.278  80.198  1.00   40.41  ? 235 PRO B CG    1 
ATOM   4092 C CD    . PRO B 1 250 ? -19.133 19.148  78.778  1.00   42.54  ? 235 PRO B CD    1 
ATOM   4093 N N     . ASP B 1 251 ? -22.279 19.210  80.949  1.00   42.39  ? 236 ASP B N     1 
ATOM   4094 C CA    . ASP B 1 251 ? -23.496 19.539  81.694  1.00   42.10  ? 236 ASP B CA    1 
ATOM   4095 C C     . ASP B 1 251 ? -24.775 18.932  81.096  1.00   46.76  ? 236 ASP B C     1 
ATOM   4096 O O     . ASP B 1 251 ? -25.873 19.207  81.576  1.00   49.06  ? 236 ASP B O     1 
ATOM   4097 C CB    . ASP B 1 251 ? -23.665 21.054  81.819  1.00   40.12  ? 236 ASP B CB    1 
ATOM   4098 C CG    . ASP B 1 251 ? -24.003 21.708  80.500  1.00   48.86  ? 236 ASP B CG    1 
ATOM   4099 O OD1   . ASP B 1 251 ? -24.281 20.964  79.530  1.00   52.02  ? 236 ASP B OD1   1 
ATOM   4100 O OD2   . ASP B 1 251 ? -24.016 22.961  80.429  1.00   52.77  ? 236 ASP B OD2   1 
ATOM   4101 N N     . GLY B 1 252 ? -24.646 18.149  80.029  1.00   43.64  ? 237 GLY B N     1 
ATOM   4102 C CA    . GLY B 1 252 ? -25.779 17.403  79.507  1.00   41.95  ? 237 GLY B CA    1 
ATOM   4103 C C     . GLY B 1 252 ? -26.825 18.182  78.723  1.00   43.23  ? 237 GLY B C     1 
ATOM   4104 O O     . GLY B 1 252 ? -27.807 17.610  78.246  1.00   39.38  ? 237 GLY B O     1 
ATOM   4105 N N     . LYS B 1 253 ? -26.595 19.477  78.555  1.00   45.16  ? 238 LYS B N     1 
ATOM   4106 C CA    . LYS B 1 253 ? -27.539 20.355  77.877  1.00   41.03  ? 238 LYS B CA    1 
ATOM   4107 C C     . LYS B 1 253 ? -27.312 20.433  76.359  1.00   48.54  ? 238 LYS B C     1 
ATOM   4108 O O     . LYS B 1 253 ? -26.322 21.014  75.886  1.00   51.30  ? 238 LYS B O     1 
ATOM   4109 C CB    . LYS B 1 253 ? -27.413 21.748  78.495  1.00   52.06  ? 238 LYS B CB    1 
ATOM   4110 C CG    . LYS B 1 253 ? -28.358 22.795  77.945  1.00   57.17  ? 238 LYS B CG    1 
ATOM   4111 C CD    . LYS B 1 253 ? -28.024 24.149  78.565  1.00   66.02  ? 238 LYS B CD    1 
ATOM   4112 C CE    . LYS B 1 253 ? -28.739 25.295  77.859  1.00   70.38  ? 238 LYS B CE    1 
ATOM   4113 N NZ    . LYS B 1 253 ? -28.174 26.620  78.266  1.00   72.58  ? 238 LYS B NZ    1 
ATOM   4114 N N     . LEU B 1 254 ? -28.233 19.857  75.596  1.00   41.53  ? 239 LEU B N     1 
ATOM   4115 C CA    . LEU B 1 254 ? -28.174 19.899  74.146  1.00   42.22  ? 239 LEU B CA    1 
ATOM   4116 C C     . LEU B 1 254 ? -28.303 21.308  73.576  1.00   46.63  ? 239 LEU B C     1 
ATOM   4117 O O     . LEU B 1 254 ? -29.344 21.932  73.702  1.00   48.84  ? 239 LEU B O     1 
ATOM   4118 C CB    . LEU B 1 254 ? -29.243 19.017  73.524  1.00   39.51  ? 239 LEU B CB    1 
ATOM   4119 C CG    . LEU B 1 254 ? -29.024 18.938  72.004  1.00   44.35  ? 239 LEU B CG    1 
ATOM   4120 C CD1   . LEU B 1 254 ? -27.861 18.001  71.665  1.00   36.49  ? 239 LEU B CD1   1 
ATOM   4121 C CD2   . LEU B 1 254 ? -30.273 18.491  71.309  1.00   41.54  ? 239 LEU B CD2   1 
ATOM   4122 N N     . LEU B 1 255 ? -27.240 21.782  72.927  1.00   41.83  ? 240 LEU B N     1 
ATOM   4123 C CA    . LEU B 1 255 ? -27.199 23.119  72.354  1.00   40.20  ? 240 LEU B CA    1 
ATOM   4124 C C     . LEU B 1 255 ? -27.477 23.036  70.861  1.00   35.68  ? 240 LEU B C     1 
ATOM   4125 O O     . LEU B 1 255 ? -27.142 22.054  70.208  1.00   37.23  ? 240 LEU B O     1 
ATOM   4126 C CB    . LEU B 1 255 ? -25.836 23.769  72.613  1.00   42.46  ? 240 LEU B CB    1 
ATOM   4127 C CG    . LEU B 1 255 ? -25.420 23.892  74.081  1.00   46.80  ? 240 LEU B CG    1 
ATOM   4128 C CD1   . LEU B 1 255 ? -24.019 24.435  74.196  1.00   41.40  ? 240 LEU B CD1   1 
ATOM   4129 C CD2   . LEU B 1 255 ? -26.395 24.769  74.850  1.00   44.26  ? 240 LEU B CD2   1 
ATOM   4130 N N     . HIS B 1 256 ? -28.125 24.050  70.322  1.00   33.93  ? 241 HIS B N     1 
ATOM   4131 C CA    . HIS B 1 256 ? -28.519 23.991  68.930  1.00   33.21  ? 241 HIS B CA    1 
ATOM   4132 C C     . HIS B 1 256 ? -28.447 25.350  68.269  1.00   31.33  ? 241 HIS B C     1 
ATOM   4133 O O     . HIS B 1 256 ? -28.736 26.366  68.896  1.00   38.31  ? 241 HIS B O     1 
ATOM   4134 C CB    . HIS B 1 256 ? -29.940 23.416  68.809  1.00   37.29  ? 241 HIS B CB    1 
ATOM   4135 C CG    . HIS B 1 256 ? -30.534 23.555  67.438  1.00   33.37  ? 241 HIS B CG    1 
ATOM   4136 N ND1   . HIS B 1 256 ? -30.376 22.602  66.460  1.00   33.58  ? 241 HIS B ND1   1 
ATOM   4137 C CD2   . HIS B 1 256 ? -31.261 24.556  66.884  1.00   32.19  ? 241 HIS B CD2   1 
ATOM   4138 C CE1   . HIS B 1 256 ? -30.990 23.001  65.356  1.00   32.99  ? 241 HIS B CE1   1 
ATOM   4139 N NE2   . HIS B 1 256 ? -31.539 24.178  65.591  1.00   34.85  ? 241 HIS B NE2   1 
ATOM   4140 N N     . SER B 1 257 ? -28.056 25.368  66.999  1.00   31.09  ? 242 SER B N     1 
ATOM   4141 C CA    . SER B 1 257 ? -28.287 26.528  66.144  1.00   32.05  ? 242 SER B CA    1 
ATOM   4142 C C     . SER B 1 257 ? -28.934 26.126  64.813  1.00   35.77  ? 242 SER B C     1 
ATOM   4143 O O     . SER B 1 257 ? -28.545 25.139  64.183  1.00   35.83  ? 242 SER B O     1 
ATOM   4144 C CB    . SER B 1 257 ? -26.975 27.287  65.862  1.00   38.26  ? 242 SER B CB    1 
ATOM   4145 O OG    . SER B 1 257 ? -27.169 28.273  64.847  1.00   39.21  ? 242 SER B OG    1 
ATOM   4146 N N     . ASP B 1 258 ? -29.909 26.911  64.376  1.00   35.67  ? 243 ASP B N     1 
ATOM   4147 C CA    . ASP B 1 258 ? -30.445 26.759  63.039  1.00   31.50  ? 243 ASP B CA    1 
ATOM   4148 C C     . ASP B 1 258 ? -29.383 27.142  62.006  1.00   37.25  ? 243 ASP B C     1 
ATOM   4149 O O     . ASP B 1 258 ? -28.420 27.845  62.313  1.00   33.02  ? 243 ASP B O     1 
ATOM   4150 C CB    . ASP B 1 258 ? -31.670 27.645  62.849  1.00   39.82  ? 243 ASP B CB    1 
ATOM   4151 C CG    . ASP B 1 258 ? -32.863 27.208  63.728  1.00   47.32  ? 243 ASP B CG    1 
ATOM   4152 O OD1   . ASP B 1 258 ? -32.940 26.007  64.081  1.00   38.80  ? 243 ASP B OD1   1 
ATOM   4153 O OD2   . ASP B 1 258 ? -33.708 28.073  64.065  1.00   43.09  ? 243 ASP B OD2   1 
ATOM   4154 N N     . ALA B 1 259 ? -29.572 26.645  60.791  1.00   32.00  ? 244 ALA B N     1 
ATOM   4155 C CA    . ALA B 1 259 ? -28.817 27.076  59.647  1.00   35.01  ? 244 ALA B CA    1 
ATOM   4156 C C     . ALA B 1 259 ? -29.165 28.524  59.303  1.00   40.66  ? 244 ALA B C     1 
ATOM   4157 O O     . ALA B 1 259 ? -30.157 29.088  59.796  1.00   38.02  ? 244 ALA B O     1 
ATOM   4158 C CB    . ALA B 1 259 ? -29.100 26.167  58.479  1.00   35.33  ? 244 ALA B CB    1 
ATOM   4159 N N     . PHE B 1 260 ? -28.300 29.132  58.497  1.00   39.13  ? 245 PHE B N     1 
ATOM   4160 C CA    . PHE B 1 260 ? -28.528 30.452  57.942  1.00   36.78  ? 245 PHE B CA    1 
ATOM   4161 C C     . PHE B 1 260 ? -28.513 30.309  56.434  1.00   40.38  ? 245 PHE B C     1 
ATOM   4162 O O     . PHE B 1 260 ? -27.489 30.537  55.797  1.00   39.52  ? 245 PHE B O     1 
ATOM   4163 C CB    . PHE B 1 260 ? -27.458 31.425  58.399  1.00   35.37  ? 245 PHE B CB    1 
ATOM   4164 C CG    . PHE B 1 260 ? -27.489 31.683  59.856  1.00   36.74  ? 245 PHE B CG    1 
ATOM   4165 C CD1   . PHE B 1 260 ? -27.987 32.879  60.351  1.00   41.80  ? 245 PHE B CD1   1 
ATOM   4166 C CD2   . PHE B 1 260 ? -27.068 30.707  60.753  1.00   37.64  ? 245 PHE B CD2   1 
ATOM   4167 C CE1   . PHE B 1 260 ? -28.045 33.116  61.732  1.00   46.29  ? 245 PHE B CE1   1 
ATOM   4168 C CE2   . PHE B 1 260 ? -27.127 30.930  62.129  1.00   39.67  ? 245 PHE B CE2   1 
ATOM   4169 C CZ    . PHE B 1 260 ? -27.608 32.138  62.620  1.00   42.52  ? 245 PHE B CZ    1 
ATOM   4170 N N     . PRO B 1 261 ? -29.662 29.908  55.862  1.00   45.11  ? 246 PRO B N     1 
ATOM   4171 C CA    . PRO B 1 261 ? -29.778 29.661  54.420  1.00   43.36  ? 246 PRO B CA    1 
ATOM   4172 C C     . PRO B 1 261 ? -29.357 30.920  53.677  1.00   45.41  ? 246 PRO B C     1 
ATOM   4173 O O     . PRO B 1 261 ? -29.640 32.031  54.137  1.00   43.76  ? 246 PRO B O     1 
ATOM   4174 C CB    . PRO B 1 261 ? -31.277 29.393  54.217  1.00   49.94  ? 246 PRO B CB    1 
ATOM   4175 C CG    . PRO B 1 261 ? -31.816 29.057  55.595  1.00   46.47  ? 246 PRO B CG    1 
ATOM   4176 C CD    . PRO B 1 261 ? -30.959 29.822  56.561  1.00   43.18  ? 246 PRO B CD    1 
ATOM   4177 N N     . PRO B 1 262 ? -28.620 30.755  52.580  1.00   42.32  ? 247 PRO B N     1 
ATOM   4178 C CA    . PRO B 1 262 ? -28.223 31.893  51.750  1.00   46.17  ? 247 PRO B CA    1 
ATOM   4179 C C     . PRO B 1 262 ? -29.298 32.140  50.677  1.00   54.09  ? 247 PRO B C     1 
ATOM   4180 O O     . PRO B 1 262 ? -30.117 31.244  50.431  1.00   46.50  ? 247 PRO B O     1 
ATOM   4181 C CB    . PRO B 1 262 ? -26.929 31.397  51.110  1.00   41.57  ? 247 PRO B CB    1 
ATOM   4182 C CG    . PRO B 1 262 ? -27.126 29.922  50.986  1.00   38.10  ? 247 PRO B CG    1 
ATOM   4183 C CD    . PRO B 1 262 ? -28.020 29.489  52.121  1.00   37.29  ? 247 PRO B CD    1 
ATOM   4184 N N     . PRO B 1 263 ? -29.298 33.332  50.050  1.00   56.17  ? 248 PRO B N     1 
ATOM   4185 C CA    . PRO B 1 263 ? -30.308 33.678  49.037  1.00   54.63  ? 248 PRO B CA    1 
ATOM   4186 C C     . PRO B 1 263 ? -30.589 32.503  48.104  1.00   55.51  ? 248 PRO B C     1 
ATOM   4187 O O     . PRO B 1 263 ? -31.750 32.198  47.830  1.00   55.51  ? 248 PRO B O     1 
ATOM   4188 C CB    . PRO B 1 263 ? -29.651 34.829  48.286  1.00   59.58  ? 248 PRO B CB    1 
ATOM   4189 C CG    . PRO B 1 263 ? -28.850 35.529  49.352  1.00   56.76  ? 248 PRO B CG    1 
ATOM   4190 C CD    . PRO B 1 263 ? -28.309 34.412  50.229  1.00   51.76  ? 248 PRO B CD    1 
ATOM   4191 N N     . ARG B 1 264 ? -29.532 31.840  47.644  1.00   57.99  ? 249 ARG B N     1 
ATOM   4192 C CA    . ARG B 1 264 ? -29.676 30.545  46.989  1.00   55.43  ? 249 ARG B CA    1 
ATOM   4193 C C     . ARG B 1 264 ? -28.420 29.704  47.172  1.00   51.26  ? 249 ARG B C     1 
ATOM   4194 O O     . ARG B 1 264 ? -27.322 30.241  47.322  1.00   49.98  ? 249 ARG B O     1 
ATOM   4195 C CB    . ARG B 1 264 ? -30.004 30.707  45.506  1.00   62.18  ? 249 ARG B CB    1 
ATOM   4196 C CG    . ARG B 1 264 ? -28.958 31.454  44.712  1.00   65.06  ? 249 ARG B CG    1 
ATOM   4197 C CD    . ARG B 1 264 ? -29.332 31.483  43.235  1.00   72.33  ? 249 ARG B CD    1 
ATOM   4198 N NE    . ARG B 1 264 ? -29.644 30.141  42.748  1.00   78.69  ? 249 ARG B NE    1 
ATOM   4199 C CZ    . ARG B 1 264 ? -28.832 29.406  41.991  1.00   83.06  ? 249 ARG B CZ    1 
ATOM   4200 N NH1   . ARG B 1 264 ? -29.211 28.190  41.606  1.00   79.41  ? 249 ARG B NH1   1 
ATOM   4201 N NH2   . ARG B 1 264 ? -27.648 29.886  41.612  1.00   77.43  ? 249 ARG B NH2   1 
ATOM   4202 N N     . VAL B 1 265 ? -28.593 28.386  47.156  1.00   50.90  ? 250 VAL B N     1 
ATOM   4203 C CA    . VAL B 1 265 ? -27.501 27.450  47.388  1.00   50.90  ? 250 VAL B CA    1 
ATOM   4204 C C     . VAL B 1 265 ? -26.716 27.163  46.113  1.00   50.99  ? 250 VAL B C     1 
ATOM   4205 O O     . VAL B 1 265 ? -27.246 26.615  45.149  1.00   57.62  ? 250 VAL B O     1 
ATOM   4206 C CB    . VAL B 1 265 ? -28.010 26.132  48.012  1.00   48.51  ? 250 VAL B CB    1 
ATOM   4207 C CG1   . VAL B 1 265 ? -26.887 25.126  48.131  1.00   48.95  ? 250 VAL B CG1   1 
ATOM   4208 C CG2   . VAL B 1 265 ? -28.604 26.406  49.377  1.00   45.61  ? 250 VAL B CG2   1 
ATOM   4209 N N     . VAL B 1 266 ? -25.443 27.534  46.134  1.00   49.07  ? 251 VAL B N     1 
ATOM   4210 C CA    . VAL B 1 266 ? -24.563 27.447  44.969  1.00   49.01  ? 251 VAL B CA    1 
ATOM   4211 C C     . VAL B 1 266 ? -23.519 26.332  45.094  1.00   47.29  ? 251 VAL B C     1 
ATOM   4212 O O     . VAL B 1 266 ? -23.214 25.650  44.121  1.00   47.09  ? 251 VAL B O     1 
ATOM   4213 C CB    . VAL B 1 266 ? -23.814 28.778  44.769  1.00   47.07  ? 251 VAL B CB    1 
ATOM   4214 C CG1   . VAL B 1 266 ? -22.659 28.609  43.796  1.00   47.96  ? 251 VAL B CG1   1 
ATOM   4215 C CG2   . VAL B 1 266 ? -24.772 29.867  44.325  1.00   47.49  ? 251 VAL B CG2   1 
ATOM   4216 N N     . ASP B 1 267 ? -22.967 26.151  46.294  1.00   49.22  ? 252 ASP B N     1 
ATOM   4217 C CA    . ASP B 1 267 ? -21.862 25.211  46.488  1.00   44.52  ? 252 ASP B CA    1 
ATOM   4218 C C     . ASP B 1 267 ? -21.697 24.815  47.952  1.00   41.82  ? 252 ASP B C     1 
ATOM   4219 O O     . ASP B 1 267 ? -21.214 25.607  48.763  1.00   43.97  ? 252 ASP B O     1 
ATOM   4220 C CB    . ASP B 1 267 ? -20.556 25.829  45.945  1.00   46.12  ? 252 ASP B CB    1 
ATOM   4221 C CG    . ASP B 1 267 ? -19.326 24.969  46.232  1.00   50.78  ? 252 ASP B CG    1 
ATOM   4222 O OD1   . ASP B 1 267 ? -19.429 23.712  46.156  1.00   49.41  ? 252 ASP B OD1   1 
ATOM   4223 O OD2   . ASP B 1 267 ? -18.254 25.561  46.524  1.00   47.65  ? 252 ASP B OD2   1 
ATOM   4224 N N     . THR B 1 268 ? -22.077 23.585  48.286  1.00   41.55  ? 253 THR B N     1 
ATOM   4225 C CA    . THR B 1 268 ? -21.976 23.107  49.660  1.00   42.74  ? 253 THR B CA    1 
ATOM   4226 C C     . THR B 1 268 ? -20.747 22.246  49.906  1.00   43.04  ? 253 THR B C     1 
ATOM   4227 O O     . THR B 1 268 ? -20.548 21.753  51.017  1.00   41.24  ? 253 THR B O     1 
ATOM   4228 C CB    . THR B 1 268 ? -23.239 22.337  50.118  1.00   44.19  ? 253 THR B CB    1 
ATOM   4229 O OG1   . THR B 1 268 ? -23.452 21.209  49.268  1.00   42.49  ? 253 THR B OG1   1 
ATOM   4230 C CG2   . THR B 1 268 ? -24.461 23.237  50.064  1.00   47.35  ? 253 THR B CG2   1 
ATOM   4231 N N     . LEU B 1 269 ? -19.919 22.065  48.881  1.00   41.52  ? 254 LEU B N     1 
ATOM   4232 C CA    . LEU B 1 269 ? -18.662 21.356  49.074  1.00   43.45  ? 254 LEU B CA    1 
ATOM   4233 C C     . LEU B 1 269 ? -17.774 22.141  50.031  1.00   40.55  ? 254 LEU B C     1 
ATOM   4234 O O     . LEU B 1 269 ? -17.456 23.304  49.785  1.00   36.52  ? 254 LEU B O     1 
ATOM   4235 C CB    . LEU B 1 269 ? -17.928 21.123  47.743  1.00   47.60  ? 254 LEU B CB    1 
ATOM   4236 C CG    . LEU B 1 269 ? -18.296 19.860  46.953  1.00   58.46  ? 254 LEU B CG    1 
ATOM   4237 C CD1   . LEU B 1 269 ? -19.801 19.718  46.825  1.00   56.60  ? 254 LEU B CD1   1 
ATOM   4238 C CD2   . LEU B 1 269 ? -17.640 19.849  45.569  1.00   62.94  ? 254 LEU B CD2   1 
ATOM   4239 N N     . GLY B 1 270 ? -17.394 21.507  51.135  1.00   38.90  ? 255 GLY B N     1 
ATOM   4240 C CA    . GLY B 1 270 ? -16.528 22.146  52.111  1.00   35.21  ? 255 GLY B CA    1 
ATOM   4241 C C     . GLY B 1 270 ? -17.257 22.969  53.156  1.00   35.55  ? 255 GLY B C     1 
ATOM   4242 O O     . GLY B 1 270 ? -16.613 23.633  53.985  1.00   32.77  ? 255 GLY B O     1 
ATOM   4243 N N     . ALA B 1 271 ? -18.592 22.936  53.123  1.00   32.73  ? 256 ALA B N     1 
ATOM   4244 C CA    . ALA B 1 271 ? -19.382 23.593  54.164  1.00   35.09  ? 256 ALA B CA    1 
ATOM   4245 C C     . ALA B 1 271 ? -19.072 23.013  55.543  1.00   30.66  ? 256 ALA B C     1 
ATOM   4246 O O     . ALA B 1 271 ? -18.945 23.755  56.506  1.00   30.83  ? 256 ALA B O     1 
ATOM   4247 C CB    . ALA B 1 271 ? -20.879 23.500  53.877  1.00   32.46  ? 256 ALA B CB    1 
ATOM   4248 N N     . GLY B 1 272 ? -18.963 21.690  55.637  1.00   32.65  ? 257 GLY B N     1 
ATOM   4249 C CA    . GLY B 1 272 ? -18.620 21.048  56.896  1.00   31.14  ? 257 GLY B CA    1 
ATOM   4250 C C     . GLY B 1 272 ? -17.269 21.518  57.434  1.00   33.32  ? 257 GLY B C     1 
ATOM   4251 O O     . GLY B 1 272 ? -17.144 21.808  58.619  1.00   31.56  ? 257 GLY B O     1 
ATOM   4252 N N     . ASP B 1 273 ? -16.268 21.608  56.550  1.00   31.87  ? 258 ASP B N     1 
ATOM   4253 C CA    . ASP B 1 273 ? -14.935 22.125  56.894  1.00   32.96  ? 258 ASP B CA    1 
ATOM   4254 C C     . ASP B 1 273 ? -14.971 23.602  57.255  1.00   29.63  ? 258 ASP B C     1 
ATOM   4255 O O     . ASP B 1 273 ? -14.210 24.056  58.103  1.00   30.45  ? 258 ASP B O     1 
ATOM   4256 C CB    . ASP B 1 273 ? -13.932 21.901  55.736  1.00   29.98  ? 258 ASP B CB    1 
ATOM   4257 C CG    . ASP B 1 273 ? -13.826 20.426  55.316  1.00   36.84  ? 258 ASP B CG    1 
ATOM   4258 O OD1   . ASP B 1 273 ? -13.780 19.541  56.201  1.00   46.77  ? 258 ASP B OD1   1 
ATOM   4259 O OD2   . ASP B 1 273 ? -13.797 20.141  54.101  1.00   39.23  ? 258 ASP B OD2   1 
ATOM   4260 N N     . THR B 1 274 ? -15.851 24.362  56.617  1.00   29.89  ? 259 THR B N     1 
ATOM   4261 C CA    . THR B 1 274 ? -15.999 25.773  56.972  1.00   28.47  ? 259 THR B CA    1 
ATOM   4262 C C     . THR B 1 274 ? -16.624 25.908  58.366  1.00   27.60  ? 259 THR B C     1 
ATOM   4263 O O     . THR B 1 274 ? -16.239 26.768  59.185  1.00   26.34  ? 259 THR B O     1 
ATOM   4264 C CB    . THR B 1 274 ? -16.874 26.498  55.941  1.00   27.59  ? 259 THR B CB    1 
ATOM   4265 O OG1   . THR B 1 274 ? -16.288 26.351  54.647  1.00   29.41  ? 259 THR B OG1   1 
ATOM   4266 C CG2   . THR B 1 274 ? -16.979 27.966  56.265  1.00   27.77  ? 259 THR B CG2   1 
ATOM   4267 N N     . PHE B 1 275 ? -17.597 25.042  58.629  1.00   29.49  ? 260 PHE B N     1 
ATOM   4268 C CA    . PHE B 1 275 ? -18.234 25.003  59.919  1.00   28.59  ? 260 PHE B CA    1 
ATOM   4269 C C     . PHE B 1 275 ? -17.216 24.616  60.980  1.00   26.88  ? 260 PHE B C     1 
ATOM   4270 O O     . PHE B 1 275 ? -17.089 25.291  61.990  1.00   28.46  ? 260 PHE B O     1 
ATOM   4271 C CB    . PHE B 1 275 ? -19.376 23.995  59.907  1.00   31.11  ? 260 PHE B CB    1 
ATOM   4272 C CG    . PHE B 1 275 ? -19.977 23.757  61.253  1.00   30.81  ? 260 PHE B CG    1 
ATOM   4273 C CD1   . PHE B 1 275 ? -20.930 24.637  61.773  1.00   32.79  ? 260 PHE B CD1   1 
ATOM   4274 C CD2   . PHE B 1 275 ? -19.603 22.647  62.003  1.00   28.48  ? 260 PHE B CD2   1 
ATOM   4275 C CE1   . PHE B 1 275 ? -21.502 24.415  63.027  1.00   28.93  ? 260 PHE B CE1   1 
ATOM   4276 C CE2   . PHE B 1 275 ? -20.169 22.424  63.253  1.00   32.90  ? 260 PHE B CE2   1 
ATOM   4277 C CZ    . PHE B 1 275 ? -21.124 23.317  63.763  1.00   31.01  ? 260 PHE B CZ    1 
ATOM   4278 N N     . ASN B 1 276 ? -16.497 23.519  60.766  1.00   26.88  ? 261 ASN B N     1 
ATOM   4279 C CA    . ASN B 1 276 ? -15.473 23.100  61.741  1.00   30.33  ? 261 ASN B CA    1 
ATOM   4280 C C     . ASN B 1 276 ? -14.464 24.210  62.104  1.00   27.70  ? 261 ASN B C     1 
ATOM   4281 O O     . ASN B 1 276 ? -14.256 24.512  63.283  1.00   31.14  ? 261 ASN B O     1 
ATOM   4282 C CB    . ASN B 1 276 ? -14.730 21.845  61.248  1.00   28.15  ? 261 ASN B CB    1 
ATOM   4283 C CG    . ASN B 1 276 ? -15.625 20.633  61.189  1.00   29.28  ? 261 ASN B CG    1 
ATOM   4284 O OD1   . ASN B 1 276 ? -16.736 20.633  61.740  1.00   32.80  ? 261 ASN B OD1   1 
ATOM   4285 N ND2   . ASN B 1 276 ? -15.160 19.589  60.532  1.00   31.97  ? 261 ASN B ND2   1 
ATOM   4286 N N     . ALA B 1 277 ? -13.852 24.821  61.090  1.00   29.21  ? 262 ALA B N     1 
ATOM   4287 C CA    . ALA B 1 277 ? -12.841 25.876  61.298  1.00   27.75  ? 262 ALA B CA    1 
ATOM   4288 C C     . ALA B 1 277 ? -13.422 27.071  62.044  1.00   29.49  ? 262 ALA B C     1 
ATOM   4289 O O     . ALA B 1 277 ? -12.755 27.725  62.861  1.00   28.73  ? 262 ALA B O     1 
ATOM   4290 C CB    . ALA B 1 277 ? -12.304 26.341  59.956  1.00   27.40  ? 262 ALA B CB    1 
ATOM   4291 N N     . SER B 1 278 ? -14.677 27.371  61.741  1.00   27.71  ? 263 SER B N     1 
ATOM   4292 C CA    . SER B 1 278 ? -15.349 28.506  62.345  1.00   25.50  ? 263 SER B CA    1 
ATOM   4293 C C     . SER B 1 278 ? -15.669 28.249  63.805  1.00   27.57  ? 263 SER B C     1 
ATOM   4294 O O     . SER B 1 278 ? -15.519 29.146  64.639  1.00   29.57  ? 263 SER B O     1 
ATOM   4295 C CB    . SER B 1 278 ? -16.633 28.813  61.565  1.00   28.73  ? 263 SER B CB    1 
ATOM   4296 O OG    . SER B 1 278 ? -16.311 29.342  60.303  1.00   29.24  ? 263 SER B OG    1 
ATOM   4297 N N     . VAL B 1 279 ? -16.119 27.040  64.129  1.00   25.43  ? 264 VAL B N     1 
ATOM   4298 C CA    . VAL B 1 279 ? -16.303 26.708  65.543  1.00   28.27  ? 264 VAL B CA    1 
ATOM   4299 C C     . VAL B 1 279 ? -14.970 26.767  66.301  1.00   27.13  ? 264 VAL B C     1 
ATOM   4300 O O     . VAL B 1 279 ? -14.862 27.392  67.359  1.00   33.42  ? 264 VAL B O     1 
ATOM   4301 C CB    . VAL B 1 279 ? -16.984 25.334  65.731  1.00   26.45  ? 264 VAL B CB    1 
ATOM   4302 C CG1   . VAL B 1 279 ? -17.039 24.970  67.196  1.00   24.41  ? 264 VAL B CG1   1 
ATOM   4303 C CG2   . VAL B 1 279 ? -18.389 25.368  65.161  1.00   25.10  ? 264 VAL B CG2   1 
ATOM   4304 N N     . ILE B 1 280 ? -13.946 26.129  65.758  1.00   28.78  ? 265 ILE B N     1 
ATOM   4305 C CA    . ILE B 1 280 ? -12.616 26.188  66.362  1.00   28.36  ? 265 ILE B CA    1 
ATOM   4306 C C     . ILE B 1 280 ? -12.186 27.635  66.588  1.00   28.57  ? 265 ILE B C     1 
ATOM   4307 O O     . ILE B 1 280 ? -11.746 28.013  67.677  1.00   30.01  ? 265 ILE B O     1 
ATOM   4308 C CB    . ILE B 1 280 ? -11.582 25.478  65.461  1.00   33.28  ? 265 ILE B CB    1 
ATOM   4309 C CG1   . ILE B 1 280 ? -11.782 23.961  65.562  1.00   32.82  ? 265 ILE B CG1   1 
ATOM   4310 C CG2   . ILE B 1 280 ? -10.146 25.923  65.822  1.00   28.41  ? 265 ILE B CG2   1 
ATOM   4311 C CD1   . ILE B 1 280 ? -11.178 23.175  64.393  1.00   30.25  ? 265 ILE B CD1   1 
ATOM   4312 N N     . PHE B 1 281 ? -12.348 28.454  65.560  1.00   27.42  ? 266 PHE B N     1 
ATOM   4313 C CA    . PHE B 1 281 ? -11.918 29.838  65.654  1.00   31.64  ? 266 PHE B CA    1 
ATOM   4314 C C     . PHE B 1 281 ? -12.605 30.543  66.813  1.00   32.48  ? 266 PHE B C     1 
ATOM   4315 O O     . PHE B 1 281 ? -11.951 31.149  67.664  1.00   32.49  ? 266 PHE B O     1 
ATOM   4316 C CB    . PHE B 1 281 ? -12.182 30.607  64.344  1.00   29.72  ? 266 PHE B CB    1 
ATOM   4317 C CG    . PHE B 1 281 ? -11.673 32.014  64.386  1.00   33.87  ? 266 PHE B CG    1 
ATOM   4318 C CD1   . PHE B 1 281 ? -10.304 32.261  64.452  1.00   34.78  ? 266 PHE B CD1   1 
ATOM   4319 C CD2   . PHE B 1 281 ? -12.547 33.091  64.412  1.00   32.95  ? 266 PHE B CD2   1 
ATOM   4320 C CE1   . PHE B 1 281 ? -9.820  33.562  64.517  1.00   34.83  ? 266 PHE B CE1   1 
ATOM   4321 C CE2   . PHE B 1 281 ? -12.068 34.393  64.474  1.00   34.68  ? 266 PHE B CE2   1 
ATOM   4322 C CZ    . PHE B 1 281 ? -10.710 34.628  64.525  1.00   39.11  ? 266 PHE B CZ    1 
ATOM   4323 N N     . SER B 1 282 ? -13.935 30.455  66.832  1.00   34.19  ? 267 SER B N     1 
ATOM   4324 C CA    . SER B 1 282 ? -14.749 31.076  67.866  1.00   31.40  ? 267 SER B CA    1 
ATOM   4325 C C     . SER B 1 282 ? -14.345 30.612  69.261  1.00   32.61  ? 267 SER B C     1 
ATOM   4326 O O     . SER B 1 282 ? -14.131 31.429  70.155  1.00   33.76  ? 267 SER B O     1 
ATOM   4327 C CB    . SER B 1 282 ? -16.237 30.775  67.611  1.00   34.23  ? 267 SER B CB    1 
ATOM   4328 O OG    . SER B 1 282 ? -17.066 31.521  68.488  1.00   40.23  ? 267 SER B OG    1 
ATOM   4329 N N     . LEU B 1 283 ? -14.246 29.301  69.458  1.00   32.66  ? 268 LEU B N     1 
ATOM   4330 C CA    . LEU B 1 283 ? -13.809 28.792  70.760  1.00   32.76  ? 268 LEU B CA    1 
ATOM   4331 C C     . LEU B 1 283 ? -12.390 29.267  71.097  1.00   36.30  ? 268 LEU B C     1 
ATOM   4332 O O     . LEU B 1 283 ? -12.091 29.580  72.257  1.00   36.11  ? 268 LEU B O     1 
ATOM   4333 C CB    . LEU B 1 283 ? -13.868 27.260  70.810  1.00   31.04  ? 268 LEU B CB    1 
ATOM   4334 C CG    . LEU B 1 283 ? -15.268 26.647  70.719  1.00   36.51  ? 268 LEU B CG    1 
ATOM   4335 C CD1   . LEU B 1 283 ? -15.173 25.140  70.659  1.00   28.96  ? 268 LEU B CD1   1 
ATOM   4336 C CD2   . LEU B 1 283 ? -16.159 27.107  71.898  1.00   34.05  ? 268 LEU B CD2   1 
ATOM   4337 N N     . SER B 1 284 ? -11.513 29.324  70.093  1.00   34.54  ? 269 SER B N     1 
ATOM   4338 C CA    . SER B 1 284 ? -10.128 29.735  70.356  1.00   31.64  ? 269 SER B CA    1 
ATOM   4339 C C     . SER B 1 284 ? -10.114 31.186  70.810  1.00   35.25  ? 269 SER B C     1 
ATOM   4340 O O     . SER B 1 284 ? -9.199  31.617  71.500  1.00   41.89  ? 269 SER B O     1 
ATOM   4341 C CB    . SER B 1 284 ? -9.217  29.515  69.128  1.00   33.02  ? 269 SER B CB    1 
ATOM   4342 O OG    . SER B 1 284 ? -9.345  30.542  68.147  1.00   29.20  ? 269 SER B OG    1 
ATOM   4343 N N     . GLN B 1 285 ? -11.142 31.939  70.427  1.00   37.69  ? 270 GLN B N     1 
ATOM   4344 C CA    . GLN B 1 285 ? -11.242 33.333  70.818  1.00   36.31  ? 270 GLN B CA    1 
ATOM   4345 C C     . GLN B 1 285 ? -11.905 33.477  72.199  1.00   41.11  ? 270 GLN B C     1 
ATOM   4346 O O     . GLN B 1 285 ? -12.142 34.585  72.673  1.00   40.69  ? 270 GLN B O     1 
ATOM   4347 C CB    . GLN B 1 285 ? -12.024 34.122  69.768  1.00   34.91  ? 270 GLN B CB    1 
ATOM   4348 C CG    . GLN B 1 285 ? -11.371 34.177  68.372  1.00   35.44  ? 270 GLN B CG    1 
ATOM   4349 C CD    . GLN B 1 285 ? -10.170 35.118  68.319  1.00   42.94  ? 270 GLN B CD    1 
ATOM   4350 O OE1   . GLN B 1 285 ? -9.059  34.755  68.719  1.00   47.01  ? 270 GLN B OE1   1 
ATOM   4351 N NE2   . GLN B 1 285 ? -10.391 36.335  67.832  1.00   44.41  ? 270 GLN B NE2   1 
ATOM   4352 N N     . GLY B 1 286 ? -12.220 32.354  72.834  1.00   40.82  ? 271 GLY B N     1 
ATOM   4353 C CA    . GLY B 1 286 ? -12.865 32.388  74.135  1.00   39.62  ? 271 GLY B CA    1 
ATOM   4354 C C     . GLY B 1 286 ? -14.385 32.552  74.132  1.00   45.31  ? 271 GLY B C     1 
ATOM   4355 O O     . GLY B 1 286 ? -14.967 32.894  75.165  1.00   40.39  ? 271 GLY B O     1 
ATOM   4356 N N     . ARG B 1 287 ? -15.044 32.318  73.000  1.00   41.93  ? 272 ARG B N     1 
ATOM   4357 C CA    . ARG B 1 287 ? -16.506 32.392  72.986  1.00   40.46  ? 272 ARG B CA    1 
ATOM   4358 C C     . ARG B 1 287 ? -17.101 31.127  73.612  1.00   43.64  ? 272 ARG B C     1 
ATOM   4359 O O     . ARG B 1 287 ? -16.392 30.133  73.827  1.00   42.79  ? 272 ARG B O     1 
ATOM   4360 C CB    . ARG B 1 287 ? -17.057 32.580  71.573  1.00   38.14  ? 272 ARG B CB    1 
ATOM   4361 C CG    . ARG B 1 287 ? -16.470 33.725  70.776  1.00   41.91  ? 272 ARG B CG    1 
ATOM   4362 C CD    . ARG B 1 287 ? -16.482 35.042  71.524  1.00   46.04  ? 272 ARG B CD    1 
ATOM   4363 N NE    . ARG B 1 287 ? -17.819 35.454  71.951  1.00   61.27  ? 272 ARG B NE    1 
ATOM   4364 C CZ    . ARG B 1 287 ? -18.729 36.024  71.158  1.00   64.84  ? 272 ARG B CZ    1 
ATOM   4365 N NH1   . ARG B 1 287 ? -19.918 36.372  71.643  1.00   62.45  ? 272 ARG B NH1   1 
ATOM   4366 N NH2   . ARG B 1 287 ? -18.460 36.235  69.874  1.00   64.51  ? 272 ARG B NH2   1 
ATOM   4367 N N     . SER B 1 288 ? -18.397 31.167  73.918  1.00   39.83  ? 273 SER B N     1 
ATOM   4368 C CA    . SER B 1 288 ? -19.079 30.003  74.487  1.00   39.83  ? 273 SER B CA    1 
ATOM   4369 C C     . SER B 1 288 ? -19.378 28.992  73.379  1.00   36.93  ? 273 SER B C     1 
ATOM   4370 O O     . SER B 1 288 ? -19.430 29.336  72.201  1.00   34.48  ? 273 SER B O     1 
ATOM   4371 C CB    . SER B 1 288 ? -20.388 30.409  75.193  1.00   38.40  ? 273 SER B CB    1 
ATOM   4372 O OG    . SER B 1 288 ? -21.308 30.993  74.275  1.00   39.76  ? 273 SER B OG    1 
ATOM   4373 N N     . VAL B 1 289 ? -19.561 27.739  73.759  1.00   33.58  ? 274 VAL B N     1 
ATOM   4374 C CA    . VAL B 1 289 ? -19.964 26.737  72.799  1.00   36.96  ? 274 VAL B CA    1 
ATOM   4375 C C     . VAL B 1 289 ? -21.187 27.186  71.993  1.00   36.40  ? 274 VAL B C     1 
ATOM   4376 O O     . VAL B 1 289 ? -21.265 26.946  70.792  1.00   35.00  ? 274 VAL B O     1 
ATOM   4377 C CB    . VAL B 1 289 ? -20.277 25.415  73.507  1.00   39.51  ? 274 VAL B CB    1 
ATOM   4378 C CG1   . VAL B 1 289 ? -20.828 24.379  72.510  1.00   35.41  ? 274 VAL B CG1   1 
ATOM   4379 C CG2   . VAL B 1 289 ? -19.033 24.913  74.219  1.00   34.71  ? 274 VAL B CG2   1 
ATOM   4380 N N     . GLN B 1 290 ? -22.142 27.835  72.654  1.00   38.86  ? 275 GLN B N     1 
ATOM   4381 C CA    . GLN B 1 290 ? -23.381 28.249  71.996  1.00   37.99  ? 275 GLN B CA    1 
ATOM   4382 C C     . GLN B 1 290 ? -23.119 29.354  70.979  1.00   34.01  ? 275 GLN B C     1 
ATOM   4383 O O     . GLN B 1 290 ? -23.733 29.369  69.930  1.00   33.57  ? 275 GLN B O     1 
ATOM   4384 C CB    . GLN B 1 290 ? -24.430 28.711  73.030  1.00   38.17  ? 275 GLN B CB    1 
ATOM   4385 C CG    . GLN B 1 290 ? -25.662 29.400  72.405  1.00   43.00  ? 275 GLN B CG    1 
ATOM   4386 C CD    . GLN B 1 290 ? -26.565 28.436  71.632  1.00   50.11  ? 275 GLN B CD    1 
ATOM   4387 O OE1   . GLN B 1 290 ? -27.092 27.478  72.200  1.00   55.55  ? 275 GLN B OE1   1 
ATOM   4388 N NE2   . GLN B 1 290 ? -26.740 28.685  70.332  1.00   44.37  ? 275 GLN B NE2   1 
ATOM   4389 N N     . GLU B 1 291 ? -22.222 30.280  71.310  1.00   34.76  ? 276 GLU B N     1 
ATOM   4390 C CA    . GLU B 1 291 ? -21.832 31.358  70.399  1.00   37.99  ? 276 GLU B CA    1 
ATOM   4391 C C     . GLU B 1 291 ? -21.092 30.754  69.199  1.00   35.92  ? 276 GLU B C     1 
ATOM   4392 O O     . GLU B 1 291 ? -21.339 31.131  68.051  1.00   34.11  ? 276 GLU B O     1 
ATOM   4393 C CB    . GLU B 1 291 ? -20.964 32.419  71.118  1.00   41.06  ? 276 GLU B CB    1 
ATOM   4394 C CG    . GLU B 1 291 ? -21.728 33.219  72.202  1.00   46.07  ? 276 GLU B CG    1 
ATOM   4395 C CD    . GLU B 1 291 ? -20.853 33.978  73.248  1.00   56.26  ? 276 GLU B CD    1 
ATOM   4396 O OE1   . GLU B 1 291 ? -21.332 35.031  73.724  1.00   59.19  ? 276 GLU B OE1   1 
ATOM   4397 O OE2   . GLU B 1 291 ? -19.731 33.537  73.626  1.00   52.94  ? 276 GLU B OE2   1 
ATOM   4398 N N     . ALA B 1 292 ? -20.229 29.780  69.470  1.00   34.26  ? 277 ALA B N     1 
ATOM   4399 C CA    . ALA B 1 292 ? -19.423 29.137  68.426  1.00   32.90  ? 277 ALA B CA    1 
ATOM   4400 C C     . ALA B 1 292 ? -20.256 28.355  67.419  1.00   32.66  ? 277 ALA B C     1 
ATOM   4401 O O     . ALA B 1 292 ? -19.960 28.383  66.214  1.00   32.57  ? 277 ALA B O     1 
ATOM   4402 C CB    . ALA B 1 292 ? -18.366 28.233  69.044  1.00   31.09  ? 277 ALA B CB    1 
ATOM   4403 N N     . LEU B 1 293 ? -21.270 27.638  67.910  1.00   33.93  ? 278 LEU B N     1 
ATOM   4404 C CA    . LEU B 1 293 ? -22.225 26.929  67.041  1.00   36.33  ? 278 LEU B CA    1 
ATOM   4405 C C     . LEU B 1 293 ? -22.908 27.911  66.110  1.00   30.16  ? 278 LEU B C     1 
ATOM   4406 O O     . LEU B 1 293 ? -23.055 27.667  64.911  1.00   36.01  ? 278 LEU B O     1 
ATOM   4407 C CB    . LEU B 1 293 ? -23.329 26.257  67.858  1.00   35.10  ? 278 LEU B CB    1 
ATOM   4408 C CG    . LEU B 1 293 ? -23.332 24.786  68.235  1.00   38.50  ? 278 LEU B CG    1 
ATOM   4409 C CD1   . LEU B 1 293 ? -24.720 24.471  68.803  1.00   38.27  ? 278 LEU B CD1   1 
ATOM   4410 C CD2   . LEU B 1 293 ? -23.038 23.886  67.052  1.00   34.49  ? 278 LEU B CD2   1 
ATOM   4411 N N     . ARG B 1 294 ? -23.347 29.021  66.684  1.00   30.67  ? 279 ARG B N     1 
ATOM   4412 C CA    . ARG B 1 294 ? -24.043 30.032  65.916  1.00   35.39  ? 279 ARG B CA    1 
ATOM   4413 C C     . ARG B 1 294 ? -23.124 30.592  64.839  1.00   35.45  ? 279 ARG B C     1 
ATOM   4414 O O     . ARG B 1 294 ? -23.486 30.614  63.664  1.00   36.18  ? 279 ARG B O     1 
ATOM   4415 C CB    . ARG B 1 294 ? -24.541 31.162  66.823  1.00   34.20  ? 279 ARG B CB    1 
ATOM   4416 C CG    . ARG B 1 294 ? -25.443 32.148  66.084  1.00   37.08  ? 279 ARG B CG    1 
ATOM   4417 C CD    . ARG B 1 294 ? -25.852 33.294  66.986  1.00   46.99  ? 279 ARG B CD    1 
ATOM   4418 N NE    . ARG B 1 294 ? -26.548 34.313  66.220  1.00   56.89  ? 279 ARG B NE    1 
ATOM   4419 C CZ    . ARG B 1 294 ? -27.830 34.228  65.863  1.00   61.61  ? 279 ARG B CZ    1 
ATOM   4420 N NH1   . ARG B 1 294 ? -28.390 35.204  65.156  1.00   59.04  ? 279 ARG B NH1   1 
ATOM   4421 N NH2   . ARG B 1 294 ? -28.554 33.165  66.209  1.00   51.08  ? 279 ARG B NH2   1 
ATOM   4422 N N     . PHE B 1 295 ? -21.939 31.048  65.252  1.00   33.20  ? 280 PHE B N     1 
ATOM   4423 C CA    . PHE B 1 295 ? -20.948 31.574  64.320  1.00   31.59  ? 280 PHE B CA    1 
ATOM   4424 C C     . PHE B 1 295 ? -20.594 30.548  63.230  1.00   30.79  ? 280 PHE B C     1 
ATOM   4425 O O     . PHE B 1 295 ? -20.507 30.876  62.050  1.00   30.76  ? 280 PHE B O     1 
ATOM   4426 C CB    . PHE B 1 295 ? -19.693 32.021  65.085  1.00   32.05  ? 280 PHE B CB    1 
ATOM   4427 C CG    . PHE B 1 295 ? -18.687 32.744  64.226  1.00   32.69  ? 280 PHE B CG    1 
ATOM   4428 C CD1   . PHE B 1 295 ? -18.968 34.012  63.722  1.00   31.62  ? 280 PHE B CD1   1 
ATOM   4429 C CD2   . PHE B 1 295 ? -17.463 32.156  63.921  1.00   29.85  ? 280 PHE B CD2   1 
ATOM   4430 C CE1   . PHE B 1 295 ? -18.038 34.689  62.930  1.00   33.48  ? 280 PHE B CE1   1 
ATOM   4431 C CE2   . PHE B 1 295 ? -16.526 32.821  63.131  1.00   28.29  ? 280 PHE B CE2   1 
ATOM   4432 C CZ    . PHE B 1 295 ? -16.812 34.088  62.636  1.00   32.79  ? 280 PHE B CZ    1 
ATOM   4433 N N     . GLY B 1 296 ? -20.425 29.295  63.625  1.00   29.06  ? 281 GLY B N     1 
ATOM   4434 C CA    . GLY B 1 296 ? -20.147 28.255  62.654  1.00   28.62  ? 281 GLY B CA    1 
ATOM   4435 C C     . GLY B 1 296 ? -21.241 28.142  61.612  1.00   34.04  ? 281 GLY B C     1 
ATOM   4436 O O     . GLY B 1 296 ? -20.957 28.021  60.410  1.00   32.58  ? 281 GLY B O     1 
ATOM   4437 N N     . CYS B 1 297 ? -22.498 28.180  62.061  1.00   31.68  ? 282 CYS B N     1 
ATOM   4438 C CA    . CYS B 1 297 ? -23.625 28.107  61.130  1.00   29.92  ? 282 CYS B CA    1 
ATOM   4439 C C     . CYS B 1 297 ? -23.725 29.345  60.248  1.00   28.82  ? 282 CYS B C     1 
ATOM   4440 O O     . CYS B 1 297 ? -24.064 29.253  59.075  1.00   36.41  ? 282 CYS B O     1 
ATOM   4441 C CB    . CYS B 1 297 ? -24.941 27.824  61.875  1.00   31.74  ? 282 CYS B CB    1 
ATOM   4442 S SG    . CYS B 1 297 ? -25.071 26.095  62.402  1.00   35.47  ? 282 CYS B SG    1 
ATOM   4443 N N     . GLN B 1 298 ? -23.414 30.505  60.793  1.00   31.94  ? 283 GLN B N     1 
ATOM   4444 C CA    . GLN B 1 298 ? -23.425 31.715  59.976  1.00   34.91  ? 283 GLN B CA    1 
ATOM   4445 C C     . GLN B 1 298 ? -22.372 31.684  58.877  1.00   33.70  ? 283 GLN B C     1 
ATOM   4446 O O     . GLN B 1 298 ? -22.676 31.994  57.739  1.00   34.02  ? 283 GLN B O     1 
ATOM   4447 C CB    . GLN B 1 298 ? -23.234 32.956  60.848  1.00   34.34  ? 283 GLN B CB    1 
ATOM   4448 C CG    . GLN B 1 298 ? -24.323 33.105  61.908  1.00   42.26  ? 283 GLN B CG    1 
ATOM   4449 C CD    . GLN B 1 298 ? -24.066 34.277  62.846  1.00   47.38  ? 283 GLN B CD    1 
ATOM   4450 O OE1   . GLN B 1 298 ? -24.991 34.981  63.249  1.00   56.91  ? 283 GLN B OE1   1 
ATOM   4451 N NE2   . GLN B 1 298 ? -22.804 34.487  63.195  1.00   48.75  ? 283 GLN B NE2   1 
ATOM   4452 N N     . VAL B 1 299 ? -21.129 31.324  59.209  1.00   34.62  ? 284 VAL B N     1 
ATOM   4453 C CA    . VAL B 1 299 ? -20.079 31.343  58.192  1.00   31.61  ? 284 VAL B CA    1 
ATOM   4454 C C     . VAL B 1 299 ? -20.348 30.274  57.134  1.00   33.25  ? 284 VAL B C     1 
ATOM   4455 O O     . VAL B 1 299 ? -20.245 30.530  55.939  1.00   34.03  ? 284 VAL B O     1 
ATOM   4456 C CB    . VAL B 1 299 ? -18.639 31.205  58.800  1.00   28.90  ? 284 VAL B CB    1 
ATOM   4457 C CG1   . VAL B 1 299 ? -17.571 31.206  57.683  1.00   29.36  ? 284 VAL B CG1   1 
ATOM   4458 C CG2   . VAL B 1 299 ? -18.378 32.336  59.755  1.00   29.28  ? 284 VAL B CG2   1 
ATOM   4459 N N     . ALA B 1 300 ? -20.702 29.075  57.577  1.00   33.72  ? 285 ALA B N     1 
ATOM   4460 C CA    . ALA B 1 300 ? -20.916 27.969  56.650  1.00   33.80  ? 285 ALA B CA    1 
ATOM   4461 C C     . ALA B 1 300 ? -22.141 28.212  55.756  1.00   32.74  ? 285 ALA B C     1 
ATOM   4462 O O     . ALA B 1 300 ? -22.166 27.801  54.594  1.00   32.87  ? 285 ALA B O     1 
ATOM   4463 C CB    . ALA B 1 300 ? -21.039 26.633  57.413  1.00   30.45  ? 285 ALA B CB    1 
ATOM   4464 N N     . GLY B 1 301 ? -23.162 28.873  56.294  1.00   35.20  ? 286 GLY B N     1 
ATOM   4465 C CA    . GLY B 1 301 ? -24.350 29.174  55.494  1.00   35.55  ? 286 GLY B CA    1 
ATOM   4466 C C     . GLY B 1 301 ? -24.041 30.196  54.418  1.00   36.28  ? 286 GLY B C     1 
ATOM   4467 O O     . GLY B 1 301 ? -24.392 30.022  53.254  1.00   39.88  ? 286 GLY B O     1 
ATOM   4468 N N     . LYS B 1 302 ? -23.362 31.267  54.810  1.00   37.79  ? 287 LYS B N     1 
ATOM   4469 C CA    . LYS B 1 302 ? -22.796 32.201  53.843  1.00   39.33  ? 287 LYS B CA    1 
ATOM   4470 C C     . LYS B 1 302 ? -22.014 31.463  52.749  1.00   40.24  ? 287 LYS B C     1 
ATOM   4471 O O     . LYS B 1 302 ? -22.209 31.711  51.566  1.00   44.13  ? 287 LYS B O     1 
ATOM   4472 C CB    . LYS B 1 302 ? -21.900 33.224  54.555  1.00   39.83  ? 287 LYS B CB    1 
ATOM   4473 C CG    . LYS B 1 302 ? -21.249 34.243  53.638  1.00   45.56  ? 287 LYS B CG    1 
ATOM   4474 C CD    . LYS B 1 302 ? -22.063 35.526  53.555  1.00   55.76  ? 287 LYS B CD    1 
ATOM   4475 C CE    . LYS B 1 302 ? -21.280 36.650  52.849  1.00   62.45  ? 287 LYS B CE    1 
ATOM   4476 N NZ    . LYS B 1 302 ? -20.092 37.130  53.642  1.00   62.29  ? 287 LYS B NZ    1 
ATOM   4477 N N     . LYS B 1 303 ? -21.150 30.534  53.144  1.00   41.22  ? 288 LYS B N     1 
ATOM   4478 C CA    . LYS B 1 303 ? -20.309 29.804  52.192  1.00   40.84  ? 288 LYS B CA    1 
ATOM   4479 C C     . LYS B 1 303 ? -21.135 28.971  51.211  1.00   39.92  ? 288 LYS B C     1 
ATOM   4480 O O     . LYS B 1 303 ? -20.750 28.766  50.056  1.00   38.78  ? 288 LYS B O     1 
ATOM   4481 C CB    . LYS B 1 303 ? -19.275 28.918  52.922  1.00   35.28  ? 288 LYS B CB    1 
ATOM   4482 C CG    . LYS B 1 303 ? -18.321 28.170  51.973  1.00   32.71  ? 288 LYS B CG    1 
ATOM   4483 C CD    . LYS B 1 303 ? -18.890 26.821  51.567  1.00   34.76  ? 288 LYS B CD    1 
ATOM   4484 C CE    . LYS B 1 303 ? -18.216 26.256  50.300  1.00   38.73  ? 288 LYS B CE    1 
ATOM   4485 N NZ    . LYS B 1 303 ? -18.486 27.035  49.038  1.00   38.88  ? 288 LYS B NZ    1 
ATOM   4486 N N     . CYS B 1 304 ? -22.277 28.488  51.668  1.00   39.38  ? 289 CYS B N     1 
ATOM   4487 C CA    . CYS B 1 304 ? -23.119 27.666  50.808  1.00   39.40  ? 289 CYS B CA    1 
ATOM   4488 C C     . CYS B 1 304 ? -23.682 28.427  49.595  1.00   42.28  ? 289 CYS B C     1 
ATOM   4489 O O     . CYS B 1 304 ? -24.045 27.814  48.597  1.00   42.40  ? 289 CYS B O     1 
ATOM   4490 C CB    . CYS B 1 304 ? -24.229 27.014  51.624  1.00   39.31  ? 289 CYS B CB    1 
ATOM   4491 S SG    . CYS B 1 304 ? -23.639 25.599  52.577  1.00   42.65  ? 289 CYS B SG    1 
ATOM   4492 N N     . GLY B 1 305 ? -23.721 29.756  49.682  1.00   40.83  ? 290 GLY B N     1 
ATOM   4493 C CA    . GLY B 1 305 ? -24.149 30.593  48.575  1.00   41.04  ? 290 GLY B CA    1 
ATOM   4494 C C     . GLY B 1 305 ? -23.026 31.123  47.683  1.00   47.20  ? 290 GLY B C     1 
ATOM   4495 O O     . GLY B 1 305 ? -23.269 31.932  46.795  1.00   48.56  ? 290 GLY B O     1 
ATOM   4496 N N     . LEU B 1 306 ? -21.795 30.670  47.904  1.00   44.18  ? 291 LEU B N     1 
ATOM   4497 C CA    . LEU B 1 306 ? -20.657 31.147  47.118  1.00   41.79  ? 291 LEU B CA    1 
ATOM   4498 C C     . LEU B 1 306 ? -19.931 29.967  46.513  1.00   42.98  ? 291 LEU B C     1 
ATOM   4499 O O     . LEU B 1 306 ? -19.964 28.857  47.047  1.00   43.15  ? 291 LEU B O     1 
ATOM   4500 C CB    . LEU B 1 306 ? -19.679 31.941  47.988  1.00   42.56  ? 291 LEU B CB    1 
ATOM   4501 C CG    . LEU B 1 306 ? -20.292 33.096  48.782  1.00   48.94  ? 291 LEU B CG    1 
ATOM   4502 C CD1   . LEU B 1 306 ? -19.310 33.679  49.777  1.00   43.17  ? 291 LEU B CD1   1 
ATOM   4503 C CD2   . LEU B 1 306 ? -20.787 34.165  47.810  1.00   52.84  ? 291 LEU B CD2   1 
ATOM   4504 N N     . GLN B 1 307 ? -19.289 30.197  45.381  1.00   42.05  ? 292 GLN B N     1 
ATOM   4505 C CA    . GLN B 1 307 ? -18.434 29.179  44.829  1.00   42.61  ? 292 GLN B CA    1 
ATOM   4506 C C     . GLN B 1 307 ? -17.111 29.349  45.558  1.00   43.26  ? 292 GLN B C     1 
ATOM   4507 O O     . GLN B 1 307 ? -16.615 30.474  45.691  1.00   43.16  ? 292 GLN B O     1 
ATOM   4508 C CB    . GLN B 1 307 ? -18.263 29.359  43.321  1.00   46.18  ? 292 GLN B CB    1 
ATOM   4509 C CG    . GLN B 1 307 ? -17.430 28.255  42.678  1.00   50.95  ? 292 GLN B CG    1 
ATOM   4510 C CD    . GLN B 1 307 ? -18.104 26.897  42.774  1.00   54.77  ? 292 GLN B CD    1 
ATOM   4511 O OE1   . GLN B 1 307 ? -17.460 25.886  43.064  1.00   58.82  ? 292 GLN B OE1   1 
ATOM   4512 N NE2   . GLN B 1 307 ? -19.406 26.867  42.526  1.00   50.28  ? 292 GLN B NE2   1 
ATOM   4513 N N     . GLY B 1 308 ? -16.562 28.250  46.069  1.00   40.66  ? 293 GLY B N     1 
ATOM   4514 C CA    . GLY B 1 308 ? -15.302 28.320  46.795  1.00   39.78  ? 293 GLY B CA    1 
ATOM   4515 C C     . GLY B 1 308 ? -15.404 29.076  48.110  1.00   41.41  ? 293 GLY B C     1 
ATOM   4516 O O     . GLY B 1 308 ? -16.482 29.168  48.709  1.00   41.51  ? 293 GLY B O     1 
ATOM   4517 N N     . PHE B 1 309 ? -14.288 29.655  48.542  1.00   40.88  ? 294 PHE B N     1 
ATOM   4518 C CA    . PHE B 1 309 ? -14.206 30.272  49.864  1.00   41.40  ? 294 PHE B CA    1 
ATOM   4519 C C     . PHE B 1 309 ? -14.073 31.791  49.815  1.00   41.10  ? 294 PHE B C     1 
ATOM   4520 O O     . PHE B 1 309 ? -14.095 32.447  50.853  1.00   43.99  ? 294 PHE B O     1 
ATOM   4521 C CB    . PHE B 1 309 ? -13.049 29.668  50.674  1.00   36.94  ? 294 PHE B CB    1 
ATOM   4522 C CG    . PHE B 1 309 ? -13.204 28.202  50.955  1.00   37.66  ? 294 PHE B CG    1 
ATOM   4523 C CD1   . PHE B 1 309 ? -14.269 27.736  51.711  1.00   40.54  ? 294 PHE B CD1   1 
ATOM   4524 C CD2   . PHE B 1 309 ? -12.288 27.287  50.471  1.00   39.62  ? 294 PHE B CD2   1 
ATOM   4525 C CE1   . PHE B 1 309 ? -14.424 26.381  51.972  1.00   39.44  ? 294 PHE B CE1   1 
ATOM   4526 C CE2   . PHE B 1 309 ? -12.426 25.925  50.737  1.00   43.16  ? 294 PHE B CE2   1 
ATOM   4527 C CZ    . PHE B 1 309 ? -13.501 25.472  51.491  1.00   39.79  ? 294 PHE B CZ    1 
ATOM   4528 N N     . ASP B 1 310 ? -13.917 32.343  48.617  1.00   41.74  ? 295 ASP B N     1 
ATOM   4529 C CA    . ASP B 1 310 ? -13.845 33.793  48.452  1.00   44.26  ? 295 ASP B CA    1 
ATOM   4530 C C     . ASP B 1 310 ? -15.108 34.459  48.982  1.00   48.67  ? 295 ASP B C     1 
ATOM   4531 O O     . ASP B 1 310 ? -16.220 34.050  48.643  1.00   51.59  ? 295 ASP B O     1 
ATOM   4532 C CB    . ASP B 1 310 ? -13.701 34.157  46.970  1.00   47.11  ? 295 ASP B CB    1 
ATOM   4533 C CG    . ASP B 1 310 ? -12.249 34.273  46.522  1.00   55.93  ? 295 ASP B CG    1 
ATOM   4534 O OD1   . ASP B 1 310 ? -12.016 34.682  45.363  1.00   57.86  ? 295 ASP B OD1   1 
ATOM   4535 O OD2   . ASP B 1 310 ? -11.344 33.967  47.326  1.00   56.90  ? 295 ASP B OD2   1 
ATOM   4536 N N     . GLY B 1 311 ? -14.944 35.492  49.795  1.00   45.82  ? 296 GLY B N     1 
ATOM   4537 C CA    . GLY B 1 311 ? -16.079 36.282  50.232  1.00   45.48  ? 296 GLY B CA    1 
ATOM   4538 C C     . GLY B 1 311 ? -16.883 35.712  51.385  1.00   53.30  ? 296 GLY B C     1 
ATOM   4539 O O     . GLY B 1 311 ? -17.958 36.225  51.689  1.00   53.66  ? 296 GLY B O     1 
ATOM   4540 N N     . ILE B 1 312 ? -16.396 34.657  52.032  1.00   50.62  ? 297 ILE B N     1 
ATOM   4541 C CA    . ILE B 1 312 ? -17.065 34.213  53.250  1.00   56.20  ? 297 ILE B CA    1 
ATOM   4542 C C     . ILE B 1 312 ? -16.756 35.249  54.328  1.00   60.45  ? 297 ILE B C     1 
ATOM   4543 O O     . ILE B 1 312 ? -17.468 35.363  55.324  1.00   59.03  ? 297 ILE B O     1 
ATOM   4544 C CB    . ILE B 1 312 ? -16.662 32.783  53.695  1.00   48.92  ? 297 ILE B CB    1 
ATOM   4545 C CG1   . ILE B 1 312 ? -15.181 32.713  54.054  1.00   50.18  ? 297 ILE B CG1   1 
ATOM   4546 C CG2   . ILE B 1 312 ? -16.987 31.765  52.614  1.00   45.53  ? 297 ILE B CG2   1 
ATOM   4547 C CD1   . ILE B 1 312 ? -14.722 31.302  54.323  1.00   46.36  ? 297 ILE B CD1   1 
ATOM   4548 N N     . VAL B 1 313 ? -15.705 36.027  54.071  1.00   65.38  ? 298 VAL B N     1 
ATOM   4549 C CA    . VAL B 1 313 ? -15.197 37.058  54.983  1.00   68.72  ? 298 VAL B CA    1 
ATOM   4550 C C     . VAL B 1 313 ? -15.106 36.583  56.429  1.00   66.08  ? 298 VAL B C     1 
ATOM   4551 O O     . VAL B 1 313 ? -14.121 35.934  56.780  1.00   57.54  ? 298 VAL B O     1 
ATOM   4552 C CB    . VAL B 1 313 ? -15.969 38.412  54.887  1.00   71.03  ? 298 VAL B CB    1 
ATOM   4553 C CG1   . VAL B 1 313 ? -15.771 39.045  53.507  1.00   73.70  ? 298 VAL B CG1   1 
ATOM   4554 C CG2   . VAL B 1 313 ? -17.453 38.237  55.206  1.00   72.53  ? 298 VAL B CG2   1 
ATOM   4555 O OXT   . VAL B 1 313 ? -15.980 36.832  57.264  1.00   71.62  ? 298 VAL B OXT   1 
HETATM 4556 P PG    . ANP C 2 .   ? -5.198  7.236   20.974  0.0000 41.73  ? 299 ANP A PG    1 
HETATM 4557 O O1G   . ANP C 2 .   ? -4.050  7.819   21.762  0.0000 41.62  ? 299 ANP A O1G   1 
HETATM 4558 O O2G   . ANP C 2 .   ? -6.108  8.156   20.201  0.0000 45.10  ? 299 ANP A O2G   1 
HETATM 4559 O O3G   . ANP C 2 .   ? -6.097  6.362   21.995  0.0000 42.71  ? 299 ANP A O3G   1 
HETATM 4560 P PB    . ANP C 2 .   ? -5.855  4.863   19.702  1.00   41.74  ? 299 ANP A PB    1 
HETATM 4561 O O1B   . ANP C 2 .   ? -7.061  5.545   19.097  1.00   42.14  ? 299 ANP A O1B   1 
HETATM 4562 O O2B   . ANP C 2 .   ? -5.952  4.123   21.026  1.00   42.19  ? 299 ANP A O2B   1 
HETATM 4563 N N3B   . ANP C 2 .   ? -4.587  5.982   19.959  1.00   35.10  ? 299 ANP A N3B   1 
HETATM 4564 P PA    . ANP C 2 .   ? -6.023  3.104   17.387  1.00   44.82  ? 299 ANP A PA    1 
HETATM 4565 O O1A   . ANP C 2 .   ? -6.098  4.121   16.268  1.00   46.88  ? 299 ANP A O1A   1 
HETATM 4566 O O2A   . ANP C 2 .   ? -7.252  2.362   17.898  1.00   49.25  ? 299 ANP A O2A   1 
HETATM 4567 O O3A   . ANP C 2 .   ? -5.270  3.788   18.639  1.00   43.89  ? 299 ANP A O3A   1 
HETATM 4568 O "O5'" . ANP C 2 .   ? -4.905  1.980   16.991  1.00   45.16  ? 299 ANP A "O5'" 1 
HETATM 4569 C "C5'" . ANP C 2 .   ? -3.745  2.401   16.266  1.00   40.49  ? 299 ANP A "C5'" 1 
HETATM 4570 C "C4'" . ANP C 2 .   ? -2.816  1.198   16.167  1.00   37.53  ? 299 ANP A "C4'" 1 
HETATM 4571 O "O4'" . ANP C 2 .   ? -2.343  0.841   17.490  1.00   39.34  ? 299 ANP A "O4'" 1 
HETATM 4572 C "C3'" . ANP C 2 .   ? -3.505  -0.069  15.615  1.00   38.93  ? 299 ANP A "C3'" 1 
HETATM 4573 O "O3'" . ANP C 2 .   ? -3.481  -0.103  14.194  1.00   39.36  ? 299 ANP A "O3'" 1 
HETATM 4574 C "C2'" . ANP C 2 .   ? -2.582  -1.184  16.151  1.00   41.95  ? 299 ANP A "C2'" 1 
HETATM 4575 O "O2'" . ANP C 2 .   ? -1.429  -1.205  15.477  1.00   44.76  ? 299 ANP A "O2'" 1 
HETATM 4576 C "C1'" . ANP C 2 .   ? -2.372  -0.610  17.576  1.00   35.69  ? 299 ANP A "C1'" 1 
HETATM 4577 N N9    . ANP C 2 .   ? -3.355  -1.012  18.541  1.00   38.55  ? 299 ANP A N9    1 
HETATM 4578 C C8    . ANP C 2 .   ? -4.372  -0.233  19.052  1.00   41.16  ? 299 ANP A C8    1 
HETATM 4579 N N7    . ANP C 2 .   ? -5.143  -0.909  19.888  1.00   38.97  ? 299 ANP A N7    1 
HETATM 4580 C C5    . ANP C 2 .   ? -4.611  -2.184  19.885  1.00   41.42  ? 299 ANP A C5    1 
HETATM 4581 C C6    . ANP C 2 .   ? -4.973  -3.360  20.562  1.00   40.75  ? 299 ANP A C6    1 
HETATM 4582 N N6    . ANP C 2 .   ? -6.046  -3.427  21.422  1.00   42.44  ? 299 ANP A N6    1 
HETATM 4583 N N1    . ANP C 2 .   ? -4.222  -4.479  20.352  1.00   46.69  ? 299 ANP A N1    1 
HETATM 4584 C C2    . ANP C 2 .   ? -3.162  -4.431  19.506  1.00   37.38  ? 299 ANP A C2    1 
HETATM 4585 N N3    . ANP C 2 .   ? -2.735  -3.359  18.816  1.00   40.40  ? 299 ANP A N3    1 
HETATM 4586 C C4    . ANP C 2 .   ? -3.500  -2.270  19.050  1.00   40.05  ? 299 ANP A C4    1 
HETATM 4587 C C1    . FRU D 3 .   ? -3.973  10.668  22.563  1.00   47.79  ? 300 FRU A C1    1 
HETATM 4588 C C2    . FRU D 3 .   ? -3.859  12.185  22.854  1.00   49.77  ? 300 FRU A C2    1 
HETATM 4589 C C3    . FRU D 3 .   ? -3.661  12.457  24.376  1.00   49.44  ? 300 FRU A C3    1 
HETATM 4590 C C4    . FRU D 3 .   ? -4.259  13.885  24.397  1.00   51.09  ? 300 FRU A C4    1 
HETATM 4591 C C5    . FRU D 3 .   ? -5.427  13.800  23.369  1.00   53.43  ? 300 FRU A C5    1 
HETATM 4592 C C6    . FRU D 3 .   ? -5.746  15.155  22.725  1.00   55.49  ? 300 FRU A C6    1 
HETATM 4593 O O1    . FRU D 3 .   ? -3.597  10.557  21.223  1.00   52.04  ? 300 FRU A O1    1 
HETATM 4594 O O2    . FRU D 3 .   ? -2.822  12.805  22.181  1.00   45.88  ? 300 FRU A O2    1 
HETATM 4595 O O3    . FRU D 3 .   ? -2.319  12.473  24.724  1.00   43.26  ? 300 FRU A O3    1 
HETATM 4596 O O4    . FRU D 3 .   ? -4.769  14.186  25.653  1.00   50.31  ? 300 FRU A O4    1 
HETATM 4597 O O5    . FRU D 3 .   ? -5.062  12.824  22.419  1.00   47.11  ? 300 FRU A O5    1 
HETATM 4598 O O6    . FRU D 3 .   ? -6.406  14.931  21.513  1.00   56.63  ? 300 FRU A O6    1 
HETATM 4599 P PG    . ANP E 2 .   ? -23.574 18.885  52.390  1.00   67.76  ? 299 ANP B PG    1 
HETATM 4600 O O1G   . ANP E 2 .   ? -24.439 19.630  53.384  1.00   58.59  ? 299 ANP B O1G   1 
HETATM 4601 O O2G   . ANP E 2 .   ? -23.907 18.930  50.907  1.00   64.85  ? 299 ANP B O2G   1 
HETATM 4602 O O3G   . ANP E 2 .   ? -23.550 17.307  52.787  1.00   61.96  ? 299 ANP B O3G   1 
HETATM 4603 P PB    . ANP E 2 .   ? -21.153 19.043  54.120  1.00   53.09  ? 299 ANP B PB    1 
HETATM 4604 O O1B   . ANP E 2 .   ? -19.719 19.531  53.976  1.00   44.72  ? 299 ANP B O1B   1 
HETATM 4605 O O2B   . ANP E 2 .   ? -21.420 17.577  54.422  1.00   47.66  ? 299 ANP B O2B   1 
HETATM 4606 N N3B   . ANP E 2 .   ? -21.943 19.444  52.626  1.00   48.80  ? 299 ANP B N3B   1 
HETATM 4607 P PA    . ANP E 2 .   ? -22.535 19.527  56.671  1.00   45.68  ? 299 ANP B PA    1 
HETATM 4608 O O1A   . ANP E 2 .   ? -21.362 18.994  57.479  1.00   46.03  ? 299 ANP B O1A   1 
HETATM 4609 O O2A   . ANP E 2 .   ? -23.794 18.693  56.563  1.00   42.23  ? 299 ANP B O2A   1 
HETATM 4610 O O3A   . ANP E 2 .   ? -21.989 19.942  55.204  1.00   45.33  ? 299 ANP B O3A   1 
HETATM 4611 O "O5'" . ANP E 2 .   ? -23.028 20.967  57.225  1.00   44.25  ? 299 ANP B "O5'" 1 
HETATM 4612 C "C5'" . ANP E 2 .   ? -22.145 21.811  57.957  1.00   38.86  ? 299 ANP B "C5'" 1 
HETATM 4613 C "C4'" . ANP E 2 .   ? -22.860 23.149  58.124  1.00   34.81  ? 299 ANP B "C4'" 1 
HETATM 4614 O "O4'" . ANP E 2 .   ? -22.933 23.809  56.837  1.00   40.56  ? 299 ANP B "O4'" 1 
HETATM 4615 C "C3'" . ANP E 2 .   ? -24.329 23.029  58.587  1.00   36.22  ? 299 ANP B "C3'" 1 
HETATM 4616 O "O3'" . ANP E 2 .   ? -24.418 22.856  60.013  1.00   38.15  ? 299 ANP B "O3'" 1 
HETATM 4617 C "C2'" . ANP E 2 .   ? -24.910 24.398  58.147  1.00   34.61  ? 299 ANP B "C2'" 1 
HETATM 4618 O "O2'" . ANP E 2 .   ? -24.506 25.408  58.921  1.00   36.04  ? 299 ANP B "O2'" 1 
HETATM 4619 C "C1'" . ANP E 2 .   ? -24.210 24.496  56.760  1.00   34.52  ? 299 ANP B "C1'" 1 
HETATM 4620 N N9    . ANP E 2 .   ? -24.979 24.013  55.629  1.00   39.78  ? 299 ANP B N9    1 
HETATM 4621 C C8    . ANP E 2 .   ? -24.809 22.838  54.935  1.00   39.02  ? 299 ANP B C8    1 
HETATM 4622 N N7    . ANP E 2 .   ? -25.716 22.696  53.985  1.00   42.09  ? 299 ANP B N7    1 
HETATM 4623 C C5    . ANP E 2 .   ? -26.501 23.829  54.086  1.00   41.00  ? 299 ANP B C5    1 
HETATM 4624 C C6    . ANP E 2 .   ? -27.612 24.278  53.347  1.00   47.83  ? 299 ANP B C6    1 
HETATM 4625 N N6    . ANP E 2 .   ? -28.131 23.548  52.302  1.00   45.19  ? 299 ANP B N6    1 
HETATM 4626 N N1    . ANP E 2 .   ? -28.193 25.468  53.682  1.00   45.03  ? 299 ANP B N1    1 
HETATM 4627 C C2    . ANP E 2 .   ? -27.657 26.174  54.709  1.00   41.93  ? 299 ANP B C2    1 
HETATM 4628 N N3    . ANP E 2 .   ? -26.595 25.839  55.472  1.00   43.29  ? 299 ANP B N3    1 
HETATM 4629 C C4    . ANP E 2 .   ? -26.072 24.650  55.105  1.00   37.62  ? 299 ANP B C4    1 
HETATM 4630 S S     . SO4 F 4 .   ? -9.848  9.557   51.704  1.00   77.87  ? 300 SO4 B S     1 
HETATM 4631 O O1    . SO4 F 4 .   ? -8.441  9.852   51.448  1.00   61.34  ? 300 SO4 B O1    1 
HETATM 4632 O O2    . SO4 F 4 .   ? -10.690 9.943   50.567  1.00   66.76  ? 300 SO4 B O2    1 
HETATM 4633 O O3    . SO4 F 4 .   ? -10.011 8.120   51.953  1.00   74.30  ? 300 SO4 B O3    1 
HETATM 4634 O O4    . SO4 F 4 .   ? -10.249 10.325  52.886  1.00   70.69  ? 300 SO4 B O4    1 
HETATM 4635 O O     . HOH G 5 .   ? -0.570  -3.964  17.103  1.00   30.59  ? 301 HOH A O     1 
HETATM 4636 O O     . HOH G 5 .   ? -1.156  -11.663 22.439  1.00   30.79  ? 302 HOH A O     1 
HETATM 4637 O O     . HOH G 5 .   ? 3.255   -7.214  20.869  1.00   32.72  ? 303 HOH A O     1 
HETATM 4638 O O     . HOH G 5 .   ? -1.082  -6.941  -0.028  1.00   38.22  ? 304 HOH A O     1 
HETATM 4639 O O     . HOH G 5 .   ? -0.861  0.004   -2.508  1.00   45.63  ? 305 HOH A O     1 
HETATM 4640 O O     . HOH G 5 .   ? -0.240  23.737  18.739  1.00   58.37  ? 306 HOH A O     1 
HETATM 4641 O O     . HOH G 5 .   ? -0.812  -7.155  2.716   1.00   33.51  ? 307 HOH A O     1 
HETATM 4642 O O     . HOH G 5 .   ? -0.546  -1.787  34.078  1.00   42.11  ? 308 HOH A O     1 
HETATM 4643 O O     . HOH G 5 .   ? 0.363   6.012   27.557  1.00   44.68  ? 309 HOH A O     1 
HETATM 4644 O O     . HOH G 5 .   ? 11.064  -5.282  13.266  1.00   41.20  ? 310 HOH A O     1 
HETATM 4645 O O     . HOH G 5 .   ? 11.393  -0.224  9.782   1.00   46.73  ? 311 HOH A O     1 
HETATM 4646 O O     . HOH G 5 .   ? -4.833  -8.077  13.628  1.00   37.37  ? 312 HOH A O     1 
HETATM 4647 O O     . HOH G 5 .   ? 15.278  8.709   9.110   1.00   54.03  ? 313 HOH A O     1 
HETATM 4648 O O     . HOH G 5 .   ? -5.851  -7.757  -3.637  1.00   43.23  ? 314 HOH A O     1 
HETATM 4649 O O     . HOH G 5 .   ? -3.638  15.972  19.623  1.00   55.14  ? 315 HOH A O     1 
HETATM 4650 O O     . HOH G 5 .   ? 13.561  -0.199  10.960  1.00   55.85  ? 316 HOH A O     1 
HETATM 4651 O O     . HOH G 5 .   ? 2.771   -7.161  0.390   1.00   39.89  ? 317 HOH A O     1 
HETATM 4652 O O     . HOH G 5 .   ? 0.954   -4.003  33.636  1.00   49.43  ? 318 HOH A O     1 
HETATM 4653 O O     . HOH G 5 .   ? -0.049  -9.239  8.556   1.00   33.56  ? 319 HOH A O     1 
HETATM 4654 O O     . HOH G 5 .   ? 4.879   -2.244  0.086   1.00   45.28  ? 320 HOH A O     1 
HETATM 4655 O O     . HOH G 5 .   ? 4.687   11.659  24.905  1.00   47.22  ? 321 HOH A O     1 
HETATM 4656 O O     . HOH G 5 .   ? -6.162  -4.913  -3.690  1.00   44.07  ? 322 HOH A O     1 
HETATM 4657 O O     . HOH G 5 .   ? 7.613   -5.324  1.357   1.00   41.19  ? 323 HOH A O     1 
HETATM 4658 O O     . HOH G 5 .   ? -8.492  2.100   22.955  1.00   48.21  ? 324 HOH A O     1 
HETATM 4659 O O     . HOH G 5 .   ? 14.452  22.235  30.517  1.00   66.51  ? 325 HOH A O     1 
HETATM 4660 O O     . HOH G 5 .   ? 0.989   -7.111  -1.515  1.00   39.59  ? 326 HOH A O     1 
HETATM 4661 O O     . HOH G 5 .   ? -7.623  4.629   13.862  1.00   45.36  ? 327 HOH A O     1 
HETATM 4662 O O     . HOH G 5 .   ? -3.539  9.789   16.920  1.00   51.85  ? 328 HOH A O     1 
HETATM 4663 O O     . HOH G 5 .   ? -1.814  -10.396 6.634   1.00   38.19  ? 329 HOH A O     1 
HETATM 4664 O O     . HOH G 5 .   ? -8.705  -1.581  21.855  1.00   49.93  ? 330 HOH A O     1 
HETATM 4665 O O     . HOH G 5 .   ? -7.270  0.810   20.403  1.00   46.17  ? 331 HOH A O     1 
HETATM 4666 O O     . HOH G 5 .   ? -10.397 -3.689  -1.859  1.00   64.64  ? 332 HOH A O     1 
HETATM 4667 O O     . HOH G 5 .   ? -4.406  -6.545  32.604  1.00   53.69  ? 333 HOH A O     1 
HETATM 4668 O O     . HOH G 5 .   ? 5.704   10.759  27.822  1.00   53.28  ? 334 HOH A O     1 
HETATM 4669 O O     . HOH G 5 .   ? 0.826   -6.356  32.211  1.00   47.64  ? 335 HOH A O     1 
HETATM 4670 O O     . HOH G 5 .   ? -19.405 12.306  10.379  1.00   71.54  ? 336 HOH A O     1 
HETATM 4671 O O     . HOH G 5 .   ? -11.540 7.759   20.818  1.00   60.45  ? 337 HOH A O     1 
HETATM 4672 O O     . HOH G 5 .   ? 12.339  -0.871  0.448   1.00   57.51  ? 338 HOH A O     1 
HETATM 4673 O O     . HOH G 5 .   ? 6.191   8.196   28.887  1.00   55.14  ? 339 HOH A O     1 
HETATM 4674 O O     . HOH G 5 .   ? -4.423  -9.247  24.136  1.00   46.05  ? 340 HOH A O     1 
HETATM 4675 O O     . HOH G 5 .   ? 2.080   -8.761  32.701  1.00   58.11  ? 341 HOH A O     1 
HETATM 4676 O O     . HOH G 5 .   ? 15.657  10.829  11.338  1.00   54.71  ? 342 HOH A O     1 
HETATM 4677 O O     . HOH G 5 .   ? 4.085   -5.026  25.407  1.00   35.78  ? 343 HOH A O     1 
HETATM 4678 O O     . HOH G 5 .   ? 5.345   -5.909  19.426  1.00   30.59  ? 344 HOH A O     1 
HETATM 4679 O O     . HOH G 5 .   ? 4.143   -7.002  23.534  1.00   43.98  ? 345 HOH A O     1 
HETATM 4680 O O     . HOH H 5 .   ? -34.317 14.249  66.755  1.00   29.10  ? 301 HOH B O     1 
HETATM 4681 O O     . HOH H 5 .   ? 2.731   23.747  58.529  1.00   35.34  ? 302 HOH B O     1 
HETATM 4682 O O     . HOH H 5 .   ? 1.827   33.684  64.318  1.00   33.61  ? 303 HOH B O     1 
HETATM 4683 O O     . HOH H 5 .   ? -0.589  31.348  58.632  1.00   32.78  ? 304 HOH B O     1 
HETATM 4684 O O     . HOH H 5 .   ? 5.166   28.420  55.070  1.00   41.98  ? 305 HOH B O     1 
HETATM 4685 O O     . HOH H 5 .   ? 4.133   16.089  44.204  1.00   36.90  ? 306 HOH B O     1 
HETATM 4686 O O     . HOH H 5 .   ? -6.035  33.558  66.189  1.00   34.19  ? 307 HOH B O     1 
HETATM 4687 O O     . HOH H 5 .   ? -24.938 33.689  57.076  1.00   38.92  ? 308 HOH B O     1 
HETATM 4688 O O     . HOH H 5 .   ? -13.213 13.142  73.615  1.00   44.34  ? 309 HOH B O     1 
HETATM 4689 O O     . HOH H 5 .   ? -7.794  32.639  68.124  1.00   38.00  ? 310 HOH B O     1 
HETATM 4690 O O     . HOH H 5 .   ? -6.501  34.563  49.924  1.00   35.97  ? 311 HOH B O     1 
HETATM 4691 O O     . HOH H 5 .   ? 7.904   20.025  45.307  1.00   41.53  ? 312 HOH B O     1 
HETATM 4692 O O     . HOH H 5 .   ? -26.093 27.526  57.986  1.00   36.10  ? 313 HOH B O     1 
HETATM 4693 O O     . HOH H 5 .   ? -18.494 18.961  60.910  1.00   42.07  ? 314 HOH B O     1 
HETATM 4694 O O     . HOH H 5 .   ? -2.120  11.827  60.330  1.00   39.46  ? 315 HOH B O     1 
HETATM 4695 O O     . HOH H 5 .   ? -7.434  37.433  56.652  1.00   33.69  ? 316 HOH B O     1 
HETATM 4696 O O     . HOH H 5 .   ? -8.604  23.032  50.400  1.00   36.20  ? 317 HOH B O     1 
HETATM 4697 O O     . HOH H 5 .   ? -3.686  28.525  43.460  1.00   46.81  ? 318 HOH B O     1 
HETATM 4698 O O     . HOH H 5 .   ? -22.388 27.652  75.731  1.00   41.70  ? 319 HOH B O     1 
HETATM 4699 O O     . HOH H 5 .   ? -23.902 33.460  50.442  1.00   45.34  ? 320 HOH B O     1 
HETATM 4700 O O     . HOH H 5 .   ? -8.731  25.620  50.375  1.00   30.22  ? 321 HOH B O     1 
HETATM 4701 O O     . HOH H 5 .   ? -10.159 14.890  53.829  1.00   43.13  ? 322 HOH B O     1 
HETATM 4702 O O     . HOH H 5 .   ? -21.141 15.842  52.548  1.00   50.68  ? 323 HOH B O     1 
HETATM 4703 O O     . HOH H 5 .   ? 10.174  29.235  57.857  1.00   53.85  ? 324 HOH B O     1 
HETATM 4704 O O     . HOH H 5 .   ? -1.903  14.662  51.623  1.00   40.04  ? 325 HOH B O     1 
HETATM 4705 O O     . HOH H 5 .   ? -1.648  13.862  55.081  1.00   46.50  ? 326 HOH B O     1 
HETATM 4706 O O     . HOH H 5 .   ? -31.913 24.967  59.861  1.00   40.43  ? 327 HOH B O     1 
HETATM 4707 O O     . HOH H 5 .   ? -20.649 17.462  62.136  1.00   39.30  ? 328 HOH B O     1 
HETATM 4708 O O     . HOH H 5 .   ? -16.650 19.768  54.422  1.00   39.15  ? 329 HOH B O     1 
HETATM 4709 O O     . HOH H 5 .   ? -12.511 24.448  74.320  1.00   54.13  ? 330 HOH B O     1 
HETATM 4710 O O     . HOH H 5 .   ? -7.500  25.657  45.134  1.00   46.62  ? 331 HOH B O     1 
HETATM 4711 O O     . HOH H 5 .   ? -23.932 21.152  76.849  1.00   45.97  ? 332 HOH B O     1 
HETATM 4712 O O     . HOH H 5 .   ? -12.404 19.998  58.838  1.00   46.01  ? 333 HOH B O     1 
HETATM 4713 O O     . HOH H 5 .   ? -6.838  17.696  75.038  1.00   52.02  ? 334 HOH B O     1 
HETATM 4714 O O     . HOH H 5 .   ? -2.211  12.187  57.511  1.00   55.84  ? 335 HOH B O     1 
HETATM 4715 O O     . HOH H 5 .   ? -7.001  35.832  65.390  1.00   37.95  ? 336 HOH B O     1 
HETATM 4716 O O     . HOH H 5 .   ? -7.865  27.141  47.794  1.00   43.05  ? 337 HOH B O     1 
HETATM 4717 O O     . HOH H 5 .   ? 3.445   11.514  68.285  1.00   41.95  ? 338 HOH B O     1 
HETATM 4718 O O     . HOH H 5 .   ? -33.338 21.128  63.169  1.00   44.30  ? 339 HOH B O     1 
HETATM 4719 O O     . HOH H 5 .   ? 5.014   26.142  44.955  1.00   44.39  ? 340 HOH B O     1 
HETATM 4720 O O     . HOH H 5 .   ? -23.948 15.225  78.466  1.00   45.25  ? 341 HOH B O     1 
HETATM 4721 O O     . HOH H 5 .   ? 5.150   28.202  46.642  1.00   44.06  ? 342 HOH B O     1 
HETATM 4722 O O     . HOH H 5 .   ? -3.749  33.598  67.660  1.00   39.87  ? 343 HOH B O     1 
HETATM 4723 O O     . HOH H 5 .   ? -18.476 18.686  51.791  1.00   49.14  ? 344 HOH B O     1 
HETATM 4724 O O     . HOH H 5 .   ? -28.641 30.378  66.208  1.00   46.23  ? 345 HOH B O     1 
HETATM 4725 O O     . HOH H 5 .   ? 2.886   22.803  39.501  1.00   48.33  ? 346 HOH B O     1 
HETATM 4726 O O     . HOH H 5 .   ? -26.355 32.774  55.082  1.00   36.89  ? 347 HOH B O     1 
HETATM 4727 O O     . HOH H 5 .   ? -19.570 26.977  76.713  1.00   46.18  ? 348 HOH B O     1 
HETATM 4728 O O     . HOH H 5 .   ? 2.595   9.156   72.351  1.00   44.53  ? 349 HOH B O     1 
HETATM 4729 O O     . HOH H 5 .   ? -7.247  3.835   71.019  1.00   52.66  ? 350 HOH B O     1 
HETATM 4730 O O     . HOH H 5 .   ? -2.794  3.989   61.689  1.00   50.21  ? 351 HOH B O     1 
HETATM 4731 O O     . HOH H 5 .   ? -14.934 23.852  75.068  1.00   54.02  ? 352 HOH B O     1 
HETATM 4732 O O     . HOH H 5 .   ? -32.103 25.805  56.573  1.00   47.84  ? 353 HOH B O     1 
HETATM 4733 O O     . HOH H 5 .   ? 9.127   20.937  47.443  1.00   51.63  ? 354 HOH B O     1 
HETATM 4734 O O     . HOH H 5 .   ? 7.052   20.493  71.880  1.00   40.17  ? 355 HOH B O     1 
HETATM 4735 O O     . HOH H 5 .   ? -1.484  27.217  42.905  1.00   42.03  ? 356 HOH B O     1 
HETATM 4736 O O     . HOH H 5 .   ? -1.532  34.020  71.744  1.00   52.26  ? 357 HOH B O     1 
HETATM 4737 O O     . HOH H 5 .   ? -24.156 8.317   75.565  1.00   49.41  ? 358 HOH B O     1 
HETATM 4738 O O     . HOH H 5 .   ? -13.252 36.871  61.843  1.00   49.04  ? 359 HOH B O     1 
HETATM 4739 O O     . HOH H 5 .   ? 6.683   25.409  67.887  1.00   38.53  ? 360 HOH B O     1 
HETATM 4740 O O     . HOH H 5 .   ? -8.628  38.614  58.699  1.00   40.66  ? 361 HOH B O     1 
HETATM 4741 O O     . HOH H 5 .   ? -16.152 35.686  66.649  1.00   53.54  ? 362 HOH B O     1 
HETATM 4742 O O     . HOH H 5 .   ? -17.879 34.097  67.602  1.00   40.20  ? 363 HOH B O     1 
HETATM 4743 O O     . HOH H 5 .   ? -19.094 17.993  58.486  1.00   44.03  ? 364 HOH B O     1 
HETATM 4744 O O     . HOH H 5 .   ? 10.520  20.447  49.462  1.00   51.66  ? 365 HOH B O     1 
HETATM 4745 O O     . HOH H 5 .   ? -29.046 20.199  63.796  1.00   45.90  ? 366 HOH B O     1 
HETATM 4746 O O     . HOH H 5 .   ? -10.958 24.609  47.142  1.00   51.56  ? 367 HOH B O     1 
HETATM 4747 O O     . HOH H 5 .   ? -32.487 15.881  73.859  1.00   52.61  ? 368 HOH B O     1 
HETATM 4748 O O     . HOH H 5 .   ? -3.057  16.673  79.956  1.00   48.64  ? 369 HOH B O     1 
HETATM 4749 O O     . HOH H 5 .   ? -13.961 29.176  74.537  1.00   44.56  ? 370 HOH B O     1 
HETATM 4750 O O     . HOH H 5 .   ? 4.856   9.166   69.760  1.00   54.31  ? 371 HOH B O     1 
HETATM 4751 O O     . HOH H 5 .   ? -22.742 33.423  44.681  1.00   50.37  ? 372 HOH B O     1 
HETATM 4752 O O     . HOH H 5 .   ? -1.756  12.044  52.813  1.00   51.44  ? 373 HOH B O     1 
HETATM 4753 O O     . HOH H 5 .   ? -12.277 22.750  48.337  1.00   51.60  ? 374 HOH B O     1 
HETATM 4754 O O     . HOH H 5 .   ? -7.528  25.621  37.346  1.00   48.93  ? 375 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -14 ?   ?   ?   A . n 
A 1 2   GLY 2   -13 ?   ?   ?   A . n 
A 1 3   SER 3   -12 ?   ?   ?   A . n 
A 1 4   SER 4   -11 ?   ?   ?   A . n 
A 1 5   HIS 5   -10 ?   ?   ?   A . n 
A 1 6   HIS 6   -9  ?   ?   ?   A . n 
A 1 7   HIS 7   -8  ?   ?   ?   A . n 
A 1 8   HIS 8   -7  ?   ?   ?   A . n 
A 1 9   HIS 9   -6  ?   ?   ?   A . n 
A 1 10  HIS 10  -5  ?   ?   ?   A . n 
A 1 11  SER 11  -4  ?   ?   ?   A . n 
A 1 12  SER 12  -3  ?   ?   ?   A . n 
A 1 13  GLY 13  -2  ?   ?   ?   A . n 
A 1 14  LEU 14  -1  ?   ?   ?   A . n 
A 1 15  VAL 15  0   ?   ?   ?   A . n 
A 1 16  PRO 16  1   ?   ?   ?   A . n 
A 1 17  ARG 17  2   ?   ?   ?   A . n 
A 1 18  GLY 18  3   3   GLY GLY A . n 
A 1 19  SER 19  4   4   SER SER A . n 
A 1 20  GLN 20  5   5   GLN GLN A . n 
A 1 21  ILE 21  6   6   ILE ILE A . n 
A 1 22  LEU 22  7   7   LEU LEU A . n 
A 1 23  CYS 23  8   8   CYS CYS A . n 
A 1 24  VAL 24  9   9   VAL VAL A . n 
A 1 25  GLY 25  10  10  GLY GLY A . n 
A 1 26  LEU 26  11  11  LEU LEU A . n 
A 1 27  VAL 27  12  12  VAL VAL A . n 
A 1 28  VAL 28  13  13  VAL VAL A . n 
A 1 29  LEU 29  14  14  LEU LEU A . n 
A 1 30  ASP 30  15  15  ASP ASP A . n 
A 1 31  VAL 31  16  16  VAL VAL A . n 
A 1 32  ILE 32  17  17  ILE ILE A . n 
A 1 33  SER 33  18  18  SER SER A . n 
A 1 34  LEU 34  19  19  LEU LEU A . n 
A 1 35  VAL 35  20  20  VAL VAL A . n 
A 1 36  ASP 36  21  21  ASP ASP A . n 
A 1 37  LYS 37  22  22  LYS LYS A . n 
A 1 38  TYR 38  23  23  TYR TYR A . n 
A 1 39  PRO 39  24  24  PRO PRO A . n 
A 1 40  LYS 40  25  25  LYS LYS A . n 
A 1 41  GLU 41  26  26  GLU GLU A . n 
A 1 42  ASP 42  27  27  ASP ASP A . n 
A 1 43  SER 43  28  28  SER SER A . n 
A 1 44  GLU 44  29  29  GLU GLU A . n 
A 1 45  ILE 45  30  30  ILE ILE A . n 
A 1 46  ARG 46  31  31  ARG ARG A . n 
A 1 47  CYS 47  32  32  CYS CYS A . n 
A 1 48  LEU 48  33  33  LEU LEU A . n 
A 1 49  SER 49  34  34  SER SER A . n 
A 1 50  GLN 50  35  35  GLN GLN A . n 
A 1 51  ARG 51  36  36  ARG ARG A . n 
A 1 52  TRP 52  37  37  TRP TRP A . n 
A 1 53  GLN 53  38  38  GLN GLN A . n 
A 1 54  ARG 54  39  39  ARG ARG A . n 
A 1 55  GLY 55  40  40  GLY GLY A . n 
A 1 56  GLY 56  41  41  GLY GLY A . n 
A 1 57  ASN 57  42  42  ASN ASN A . n 
A 1 58  ALA 58  43  43  ALA ALA A . n 
A 1 59  SER 59  44  44  SER SER A . n 
A 1 60  ASN 60  45  45  ASN ASN A . n 
A 1 61  SER 61  46  46  SER SER A . n 
A 1 62  CYS 62  47  47  CYS CYS A . n 
A 1 63  THR 63  48  48  THR THR A . n 
A 1 64  VAL 64  49  49  VAL VAL A . n 
A 1 65  LEU 65  50  50  LEU LEU A . n 
A 1 66  SER 66  51  51  SER SER A . n 
A 1 67  LEU 67  52  52  LEU LEU A . n 
A 1 68  LEU 68  53  53  LEU LEU A . n 
A 1 69  GLY 69  54  54  GLY GLY A . n 
A 1 70  ALA 70  55  55  ALA ALA A . n 
A 1 71  PRO 71  56  56  PRO PRO A . n 
A 1 72  CYS 72  57  57  CYS CYS A . n 
A 1 73  ALA 73  58  58  ALA ALA A . n 
A 1 74  PHE 74  59  59  PHE PHE A . n 
A 1 75  MET 75  60  60  MET MET A . n 
A 1 76  GLY 76  61  61  GLY GLY A . n 
A 1 77  SER 77  62  62  SER SER A . n 
A 1 78  MET 78  63  63  MET MET A . n 
A 1 79  ALA 79  64  64  ALA ALA A . n 
A 1 80  PRO 80  65  65  PRO PRO A . n 
A 1 81  GLY 81  66  66  GLY GLY A . n 
A 1 82  HIS 82  67  67  HIS HIS A . n 
A 1 83  VAL 83  68  68  VAL VAL A . n 
A 1 84  ALA 84  69  69  ALA ALA A . n 
A 1 85  ASP 85  70  70  ASP ASP A . n 
A 1 86  PHE 86  71  71  PHE PHE A . n 
A 1 87  LEU 87  72  72  LEU LEU A . n 
A 1 88  VAL 88  73  73  VAL VAL A . n 
A 1 89  ALA 89  74  74  ALA ALA A . n 
A 1 90  ASP 90  75  75  ASP ASP A . n 
A 1 91  PHE 91  76  76  PHE PHE A . n 
A 1 92  ARG 92  77  77  ARG ARG A . n 
A 1 93  ARG 93  78  78  ARG ARG A . n 
A 1 94  ARG 94  79  79  ARG ARG A . n 
A 1 95  GLY 95  80  80  GLY GLY A . n 
A 1 96  VAL 96  81  81  VAL VAL A . n 
A 1 97  ASP 97  82  82  ASP ASP A . n 
A 1 98  VAL 98  83  83  VAL VAL A . n 
A 1 99  SER 99  84  84  SER SER A . n 
A 1 100 GLN 100 85  85  GLN GLN A . n 
A 1 101 VAL 101 86  86  VAL VAL A . n 
A 1 102 ALA 102 87  87  ALA ALA A . n 
A 1 103 TRP 103 88  88  TRP TRP A . n 
A 1 104 GLN 104 89  89  GLN GLN A . n 
A 1 105 SER 105 90  90  SER SER A . n 
A 1 106 LYS 106 91  91  LYS LYS A . n 
A 1 107 GLY 107 92  92  GLY GLY A . n 
A 1 108 ASP 108 93  93  ASP ASP A . n 
A 1 109 THR 109 94  94  THR THR A . n 
A 1 110 PRO 110 95  95  PRO PRO A . n 
A 1 111 SER 111 96  96  SER SER A . n 
A 1 112 SER 112 97  97  SER SER A . n 
A 1 113 CYS 113 98  98  CYS CYS A . n 
A 1 114 CYS 114 99  99  CYS CYS A . n 
A 1 115 ILE 115 100 100 ILE ILE A . n 
A 1 116 ILE 116 101 101 ILE ILE A . n 
A 1 117 ASN 117 102 102 ASN ASN A . n 
A 1 118 ASN 118 103 103 ASN ASN A . n 
A 1 119 SER 119 104 104 SER SER A . n 
A 1 120 ASN 120 105 105 ASN ASN A . n 
A 1 121 GLY 121 106 106 GLY GLY A . n 
A 1 122 ASN 122 107 107 ASN ASN A . n 
A 1 123 ARG 123 108 108 ARG ARG A . n 
A 1 124 THR 124 109 109 THR THR A . n 
A 1 125 ILE 125 110 110 ILE ILE A . n 
A 1 126 VAL 126 111 111 VAL VAL A . n 
A 1 127 LEU 127 112 112 LEU LEU A . n 
A 1 128 HIS 128 113 113 HIS HIS A . n 
A 1 129 ASP 129 114 114 ASP ASP A . n 
A 1 130 THR 130 115 115 THR THR A . n 
A 1 131 SER 131 116 116 SER SER A . n 
A 1 132 LEU 132 117 117 LEU LEU A . n 
A 1 133 PRO 133 118 118 PRO PRO A . n 
A 1 134 ASP 134 119 119 ASP ASP A . n 
A 1 135 VAL 135 120 120 VAL VAL A . n 
A 1 136 SER 136 121 121 SER SER A . n 
A 1 137 ALA 137 122 122 ALA ALA A . n 
A 1 138 THR 138 123 123 THR THR A . n 
A 1 139 ASP 139 124 124 ASP ASP A . n 
A 1 140 PHE 140 125 125 PHE PHE A . n 
A 1 141 GLU 141 126 126 GLU GLU A . n 
A 1 142 LYS 142 127 127 LYS LYS A . n 
A 1 143 VAL 143 128 128 VAL VAL A . n 
A 1 144 ASP 144 129 129 ASP ASP A . n 
A 1 145 LEU 145 130 130 LEU LEU A . n 
A 1 146 THR 146 131 131 THR THR A . n 
A 1 147 GLN 147 132 132 GLN GLN A . n 
A 1 148 PHE 148 133 133 PHE PHE A . n 
A 1 149 LYS 149 134 134 LYS LYS A . n 
A 1 150 TRP 150 135 135 TRP TRP A . n 
A 1 151 ILE 151 136 136 ILE ILE A . n 
A 1 152 HIS 152 137 137 HIS HIS A . n 
A 1 153 ILE 153 138 138 ILE ILE A . n 
A 1 154 GLU 154 139 139 GLU GLU A . n 
A 1 155 GLY 155 140 140 GLY GLY A . n 
A 1 156 ARG 156 141 141 ARG ARG A . n 
A 1 157 ASN 157 142 142 ASN ASN A . n 
A 1 158 ALA 158 143 143 ALA ALA A . n 
A 1 159 SER 159 144 144 SER SER A . n 
A 1 160 GLU 160 145 145 GLU GLU A . n 
A 1 161 GLN 161 146 146 GLN GLN A . n 
A 1 162 VAL 162 147 147 VAL VAL A . n 
A 1 163 LYS 163 148 148 LYS LYS A . n 
A 1 164 MET 164 149 149 MET MET A . n 
A 1 165 LEU 165 150 150 LEU LEU A . n 
A 1 166 GLN 166 151 151 GLN GLN A . n 
A 1 167 ARG 167 152 152 ARG ARG A . n 
A 1 168 ILE 168 153 153 ILE ILE A . n 
A 1 169 ASP 169 154 154 ASP ASP A . n 
A 1 170 ALA 170 155 155 ALA ALA A . n 
A 1 171 HIS 171 156 156 HIS HIS A . n 
A 1 172 ASN 172 157 157 ASN ASN A . n 
A 1 173 THR 173 158 158 THR THR A . n 
A 1 174 ARG 174 159 159 ARG ARG A . n 
A 1 175 GLN 175 160 160 GLN GLN A . n 
A 1 176 PRO 176 161 161 PRO PRO A . n 
A 1 177 PRO 177 162 162 PRO PRO A . n 
A 1 178 GLU 178 163 163 GLU GLU A . n 
A 1 179 GLN 179 164 164 GLN GLN A . n 
A 1 180 LYS 180 165 165 LYS LYS A . n 
A 1 181 ILE 181 166 166 ILE ILE A . n 
A 1 182 ARG 182 167 167 ARG ARG A . n 
A 1 183 VAL 183 168 168 VAL VAL A . n 
A 1 184 SER 184 169 169 SER SER A . n 
A 1 185 VAL 185 170 170 VAL VAL A . n 
A 1 186 GLU 186 171 171 GLU GLU A . n 
A 1 187 VAL 187 172 172 VAL VAL A . n 
A 1 188 GLU 188 173 173 GLU GLU A . n 
A 1 189 LYS 189 174 174 LYS LYS A . n 
A 1 190 PRO 190 175 175 PRO PRO A . n 
A 1 191 ARG 191 176 176 ARG ARG A . n 
A 1 192 GLU 192 177 177 GLU GLU A . n 
A 1 193 GLU 193 178 178 GLU GLU A . n 
A 1 194 LEU 194 179 179 LEU LEU A . n 
A 1 195 PHE 195 180 180 PHE PHE A . n 
A 1 196 GLN 196 181 181 GLN GLN A . n 
A 1 197 LEU 197 182 182 LEU LEU A . n 
A 1 198 PHE 198 183 183 PHE PHE A . n 
A 1 199 GLY 199 184 184 GLY GLY A . n 
A 1 200 TYR 200 185 185 TYR TYR A . n 
A 1 201 GLY 201 186 186 GLY GLY A . n 
A 1 202 ASP 202 187 187 ASP ASP A . n 
A 1 203 VAL 203 188 188 VAL VAL A . n 
A 1 204 VAL 204 189 189 VAL VAL A . n 
A 1 205 PHE 205 190 190 PHE PHE A . n 
A 1 206 VAL 206 191 191 VAL VAL A . n 
A 1 207 SER 207 192 192 SER SER A . n 
A 1 208 LYS 208 193 193 LYS LYS A . n 
A 1 209 ASP 209 194 194 ASP ASP A . n 
A 1 210 VAL 210 195 195 VAL VAL A . n 
A 1 211 ALA 211 196 196 ALA ALA A . n 
A 1 212 LYS 212 197 197 LYS LYS A . n 
A 1 213 HIS 213 198 198 HIS HIS A . n 
A 1 214 LEU 214 199 199 LEU LEU A . n 
A 1 215 GLY 215 200 200 GLY GLY A . n 
A 1 216 PHE 216 201 201 PHE PHE A . n 
A 1 217 GLN 217 202 202 GLN GLN A . n 
A 1 218 SER 218 203 203 SER SER A . n 
A 1 219 ALA 219 204 204 ALA ALA A . n 
A 1 220 GLU 220 205 205 GLU GLU A . n 
A 1 221 GLU 221 206 206 GLU GLU A . n 
A 1 222 ALA 222 207 207 ALA ALA A . n 
A 1 223 LEU 223 208 208 LEU LEU A . n 
A 1 224 ARG 224 209 209 ARG ARG A . n 
A 1 225 GLY 225 210 210 GLY GLY A . n 
A 1 226 LEU 226 211 211 LEU LEU A . n 
A 1 227 TYR 227 212 212 TYR TYR A . n 
A 1 228 GLY 228 213 213 GLY GLY A . n 
A 1 229 ARG 229 214 214 ARG ARG A . n 
A 1 230 VAL 230 215 215 VAL VAL A . n 
A 1 231 ARG 231 216 216 ARG ARG A . n 
A 1 232 LYS 232 217 217 LYS LYS A . n 
A 1 233 GLY 233 218 218 GLY GLY A . n 
A 1 234 ALA 234 219 219 ALA ALA A . n 
A 1 235 VAL 235 220 220 VAL VAL A . n 
A 1 236 LEU 236 221 221 LEU LEU A . n 
A 1 237 VAL 237 222 222 VAL VAL A . n 
A 1 238 CYS 238 223 223 CYS CYS A . n 
A 1 239 ALA 239 224 224 ALA ALA A . n 
A 1 240 TRP 240 225 225 TRP TRP A . n 
A 1 241 ALA 241 226 226 ALA ALA A . n 
A 1 242 GLU 242 227 227 GLU GLU A . n 
A 1 243 GLU 243 228 228 GLU GLU A . n 
A 1 244 GLY 244 229 229 GLY GLY A . n 
A 1 245 ALA 245 230 230 ALA ALA A . n 
A 1 246 ASP 246 231 231 ASP ASP A . n 
A 1 247 ALA 247 232 232 ALA ALA A . n 
A 1 248 LEU 248 233 233 LEU LEU A . n 
A 1 249 GLY 249 234 234 GLY GLY A . n 
A 1 250 PRO 250 235 235 PRO PRO A . n 
A 1 251 ASP 251 236 236 ASP ASP A . n 
A 1 252 GLY 252 237 237 GLY GLY A . n 
A 1 253 LYS 253 238 238 LYS LYS A . n 
A 1 254 LEU 254 239 239 LEU LEU A . n 
A 1 255 LEU 255 240 240 LEU LEU A . n 
A 1 256 HIS 256 241 241 HIS HIS A . n 
A 1 257 SER 257 242 242 SER SER A . n 
A 1 258 ASP 258 243 243 ASP ASP A . n 
A 1 259 ALA 259 244 244 ALA ALA A . n 
A 1 260 PHE 260 245 245 PHE PHE A . n 
A 1 261 PRO 261 246 246 PRO PRO A . n 
A 1 262 PRO 262 247 247 PRO PRO A . n 
A 1 263 PRO 263 248 248 PRO PRO A . n 
A 1 264 ARG 264 249 249 ARG ARG A . n 
A 1 265 VAL 265 250 250 VAL VAL A . n 
A 1 266 VAL 266 251 251 VAL VAL A . n 
A 1 267 ASP 267 252 252 ASP ASP A . n 
A 1 268 THR 268 253 253 THR THR A . n 
A 1 269 LEU 269 254 254 LEU LEU A . n 
A 1 270 GLY 270 255 255 GLY GLY A . n 
A 1 271 ALA 271 256 256 ALA ALA A . n 
A 1 272 GLY 272 257 257 GLY GLY A . n 
A 1 273 ASP 273 258 258 ASP ASP A . n 
A 1 274 THR 274 259 259 THR THR A . n 
A 1 275 PHE 275 260 260 PHE PHE A . n 
A 1 276 ASN 276 261 261 ASN ASN A . n 
A 1 277 ALA 277 262 262 ALA ALA A . n 
A 1 278 SER 278 263 263 SER SER A . n 
A 1 279 VAL 279 264 264 VAL VAL A . n 
A 1 280 ILE 280 265 265 ILE ILE A . n 
A 1 281 PHE 281 266 266 PHE PHE A . n 
A 1 282 SER 282 267 267 SER SER A . n 
A 1 283 LEU 283 268 268 LEU LEU A . n 
A 1 284 SER 284 269 269 SER SER A . n 
A 1 285 GLN 285 270 270 GLN GLN A . n 
A 1 286 GLY 286 271 271 GLY GLY A . n 
A 1 287 ARG 287 272 272 ARG ARG A . n 
A 1 288 SER 288 273 273 SER SER A . n 
A 1 289 VAL 289 274 274 VAL VAL A . n 
A 1 290 GLN 290 275 275 GLN GLN A . n 
A 1 291 GLU 291 276 276 GLU GLU A . n 
A 1 292 ALA 292 277 277 ALA ALA A . n 
A 1 293 LEU 293 278 278 LEU LEU A . n 
A 1 294 ARG 294 279 279 ARG ARG A . n 
A 1 295 PHE 295 280 280 PHE PHE A . n 
A 1 296 GLY 296 281 281 GLY GLY A . n 
A 1 297 CYS 297 282 282 CYS CYS A . n 
A 1 298 GLN 298 283 283 GLN GLN A . n 
A 1 299 VAL 299 284 284 VAL VAL A . n 
A 1 300 ALA 300 285 285 ALA ALA A . n 
A 1 301 GLY 301 286 286 GLY GLY A . n 
A 1 302 LYS 302 287 287 LYS LYS A . n 
A 1 303 LYS 303 288 288 LYS LYS A . n 
A 1 304 CYS 304 289 289 CYS CYS A . n 
A 1 305 GLY 305 290 290 GLY GLY A . n 
A 1 306 LEU 306 291 291 LEU LEU A . n 
A 1 307 GLN 307 292 292 GLN GLN A . n 
A 1 308 GLY 308 293 293 GLY GLY A . n 
A 1 309 PHE 309 294 294 PHE PHE A . n 
A 1 310 ASP 310 295 295 ASP ASP A . n 
A 1 311 GLY 311 296 296 GLY GLY A . n 
A 1 312 ILE 312 297 297 ILE ILE A . n 
A 1 313 VAL 313 298 298 VAL VAL A . n 
B 1 1   MET 1   -14 ?   ?   ?   B . n 
B 1 2   GLY 2   -13 ?   ?   ?   B . n 
B 1 3   SER 3   -12 ?   ?   ?   B . n 
B 1 4   SER 4   -11 ?   ?   ?   B . n 
B 1 5   HIS 5   -10 ?   ?   ?   B . n 
B 1 6   HIS 6   -9  ?   ?   ?   B . n 
B 1 7   HIS 7   -8  ?   ?   ?   B . n 
B 1 8   HIS 8   -7  ?   ?   ?   B . n 
B 1 9   HIS 9   -6  ?   ?   ?   B . n 
B 1 10  HIS 10  -5  ?   ?   ?   B . n 
B 1 11  SER 11  -4  ?   ?   ?   B . n 
B 1 12  SER 12  -3  ?   ?   ?   B . n 
B 1 13  GLY 13  -2  1   GLY GLY B B n 
B 1 14  LEU 14  -1  1   LEU LEU B A n 
B 1 15  VAL 15  0   0   VAL VAL B . n 
B 1 16  PRO 16  1   1   PRO PRO B . n 
B 1 17  ARG 17  2   2   ARG ARG B . n 
B 1 18  GLY 18  3   3   GLY GLY B . n 
B 1 19  SER 19  4   4   SER SER B . n 
B 1 20  GLN 20  5   5   GLN GLN B . n 
B 1 21  ILE 21  6   6   ILE ILE B . n 
B 1 22  LEU 22  7   7   LEU LEU B . n 
B 1 23  CYS 23  8   8   CYS CYS B . n 
B 1 24  VAL 24  9   9   VAL VAL B . n 
B 1 25  GLY 25  10  10  GLY GLY B . n 
B 1 26  LEU 26  11  11  LEU LEU B . n 
B 1 27  VAL 27  12  12  VAL VAL B . n 
B 1 28  VAL 28  13  13  VAL VAL B . n 
B 1 29  LEU 29  14  14  LEU LEU B . n 
B 1 30  ASP 30  15  15  ASP ASP B . n 
B 1 31  VAL 31  16  16  VAL VAL B . n 
B 1 32  ILE 32  17  17  ILE ILE B . n 
B 1 33  SER 33  18  18  SER SER B . n 
B 1 34  LEU 34  19  19  LEU LEU B . n 
B 1 35  VAL 35  20  20  VAL VAL B . n 
B 1 36  ASP 36  21  21  ASP ASP B . n 
B 1 37  LYS 37  22  22  LYS LYS B . n 
B 1 38  TYR 38  23  23  TYR TYR B . n 
B 1 39  PRO 39  24  24  PRO PRO B . n 
B 1 40  LYS 40  25  25  LYS LYS B . n 
B 1 41  GLU 41  26  26  GLU GLU B . n 
B 1 42  ASP 42  27  27  ASP ASP B . n 
B 1 43  SER 43  28  28  SER SER B . n 
B 1 44  GLU 44  29  29  GLU GLU B . n 
B 1 45  ILE 45  30  30  ILE ILE B . n 
B 1 46  ARG 46  31  31  ARG ARG B . n 
B 1 47  CYS 47  32  32  CYS CYS B . n 
B 1 48  LEU 48  33  33  LEU LEU B . n 
B 1 49  SER 49  34  34  SER SER B . n 
B 1 50  GLN 50  35  35  GLN GLN B . n 
B 1 51  ARG 51  36  36  ARG ARG B . n 
B 1 52  TRP 52  37  37  TRP TRP B . n 
B 1 53  GLN 53  38  38  GLN GLN B . n 
B 1 54  ARG 54  39  39  ARG ARG B . n 
B 1 55  GLY 55  40  40  GLY GLY B . n 
B 1 56  GLY 56  41  41  GLY GLY B . n 
B 1 57  ASN 57  42  42  ASN ASN B . n 
B 1 58  ALA 58  43  43  ALA ALA B . n 
B 1 59  SER 59  44  44  SER SER B . n 
B 1 60  ASN 60  45  45  ASN ASN B . n 
B 1 61  SER 61  46  46  SER SER B . n 
B 1 62  CYS 62  47  47  CYS CYS B . n 
B 1 63  THR 63  48  48  THR THR B . n 
B 1 64  VAL 64  49  49  VAL VAL B . n 
B 1 65  LEU 65  50  50  LEU LEU B . n 
B 1 66  SER 66  51  51  SER SER B . n 
B 1 67  LEU 67  52  52  LEU LEU B . n 
B 1 68  LEU 68  53  53  LEU LEU B . n 
B 1 69  GLY 69  54  54  GLY GLY B . n 
B 1 70  ALA 70  55  55  ALA ALA B . n 
B 1 71  PRO 71  56  56  PRO PRO B . n 
B 1 72  CYS 72  57  57  CYS CYS B . n 
B 1 73  ALA 73  58  58  ALA ALA B . n 
B 1 74  PHE 74  59  59  PHE PHE B . n 
B 1 75  MET 75  60  60  MET MET B . n 
B 1 76  GLY 76  61  61  GLY GLY B . n 
B 1 77  SER 77  62  62  SER SER B . n 
B 1 78  MET 78  63  63  MET MET B . n 
B 1 79  ALA 79  64  64  ALA ALA B . n 
B 1 80  PRO 80  65  65  PRO PRO B . n 
B 1 81  GLY 81  66  66  GLY GLY B . n 
B 1 82  HIS 82  67  67  HIS HIS B . n 
B 1 83  VAL 83  68  68  VAL VAL B . n 
B 1 84  ALA 84  69  69  ALA ALA B . n 
B 1 85  ASP 85  70  70  ASP ASP B . n 
B 1 86  PHE 86  71  71  PHE PHE B . n 
B 1 87  LEU 87  72  72  LEU LEU B . n 
B 1 88  VAL 88  73  73  VAL VAL B . n 
B 1 89  ALA 89  74  74  ALA ALA B . n 
B 1 90  ASP 90  75  75  ASP ASP B . n 
B 1 91  PHE 91  76  76  PHE PHE B . n 
B 1 92  ARG 92  77  77  ARG ARG B . n 
B 1 93  ARG 93  78  78  ARG ARG B . n 
B 1 94  ARG 94  79  79  ARG ARG B . n 
B 1 95  GLY 95  80  80  GLY GLY B . n 
B 1 96  VAL 96  81  81  VAL VAL B . n 
B 1 97  ASP 97  82  82  ASP ASP B . n 
B 1 98  VAL 98  83  83  VAL VAL B . n 
B 1 99  SER 99  84  84  SER SER B . n 
B 1 100 GLN 100 85  85  GLN GLN B . n 
B 1 101 VAL 101 86  86  VAL VAL B . n 
B 1 102 ALA 102 87  87  ALA ALA B . n 
B 1 103 TRP 103 88  88  TRP TRP B . n 
B 1 104 GLN 104 89  89  GLN GLN B . n 
B 1 105 SER 105 90  90  SER SER B . n 
B 1 106 LYS 106 91  91  LYS LYS B . n 
B 1 107 GLY 107 92  92  GLY GLY B . n 
B 1 108 ASP 108 93  93  ASP ASP B . n 
B 1 109 THR 109 94  94  THR THR B . n 
B 1 110 PRO 110 95  95  PRO PRO B . n 
B 1 111 SER 111 96  96  SER SER B . n 
B 1 112 SER 112 97  97  SER SER B . n 
B 1 113 CYS 113 98  98  CYS CYS B . n 
B 1 114 CYS 114 99  99  CYS CYS B . n 
B 1 115 ILE 115 100 100 ILE ILE B . n 
B 1 116 ILE 116 101 101 ILE ILE B . n 
B 1 117 ASN 117 102 102 ASN ASN B . n 
B 1 118 ASN 118 103 103 ASN ASN B . n 
B 1 119 SER 119 104 104 SER SER B . n 
B 1 120 ASN 120 105 105 ASN ASN B . n 
B 1 121 GLY 121 106 106 GLY GLY B . n 
B 1 122 ASN 122 107 107 ASN ASN B . n 
B 1 123 ARG 123 108 108 ARG ARG B . n 
B 1 124 THR 124 109 109 THR THR B . n 
B 1 125 ILE 125 110 110 ILE ILE B . n 
B 1 126 VAL 126 111 111 VAL VAL B . n 
B 1 127 LEU 127 112 112 LEU LEU B . n 
B 1 128 HIS 128 113 113 HIS HIS B . n 
B 1 129 ASP 129 114 114 ASP ASP B . n 
B 1 130 THR 130 115 115 THR THR B . n 
B 1 131 SER 131 116 116 SER SER B . n 
B 1 132 LEU 132 117 117 LEU LEU B . n 
B 1 133 PRO 133 118 118 PRO PRO B . n 
B 1 134 ASP 134 119 119 ASP ASP B . n 
B 1 135 VAL 135 120 120 VAL VAL B . n 
B 1 136 SER 136 121 121 SER SER B . n 
B 1 137 ALA 137 122 122 ALA ALA B . n 
B 1 138 THR 138 123 123 THR THR B . n 
B 1 139 ASP 139 124 124 ASP ASP B . n 
B 1 140 PHE 140 125 125 PHE PHE B . n 
B 1 141 GLU 141 126 126 GLU GLU B . n 
B 1 142 LYS 142 127 127 LYS LYS B . n 
B 1 143 VAL 143 128 128 VAL VAL B . n 
B 1 144 ASP 144 129 129 ASP ASP B . n 
B 1 145 LEU 145 130 130 LEU LEU B . n 
B 1 146 THR 146 131 131 THR THR B . n 
B 1 147 GLN 147 132 132 GLN GLN B . n 
B 1 148 PHE 148 133 133 PHE PHE B . n 
B 1 149 LYS 149 134 134 LYS LYS B . n 
B 1 150 TRP 150 135 135 TRP TRP B . n 
B 1 151 ILE 151 136 136 ILE ILE B . n 
B 1 152 HIS 152 137 137 HIS HIS B . n 
B 1 153 ILE 153 138 138 ILE ILE B . n 
B 1 154 GLU 154 139 139 GLU GLU B . n 
B 1 155 GLY 155 140 140 GLY GLY B . n 
B 1 156 ARG 156 141 141 ARG ARG B . n 
B 1 157 ASN 157 142 142 ASN ASN B . n 
B 1 158 ALA 158 143 143 ALA ALA B . n 
B 1 159 SER 159 144 144 SER SER B . n 
B 1 160 GLU 160 145 145 GLU GLU B . n 
B 1 161 GLN 161 146 146 GLN GLN B . n 
B 1 162 VAL 162 147 147 VAL VAL B . n 
B 1 163 LYS 163 148 148 LYS LYS B . n 
B 1 164 MET 164 149 149 MET MET B . n 
B 1 165 LEU 165 150 150 LEU LEU B . n 
B 1 166 GLN 166 151 151 GLN GLN B . n 
B 1 167 ARG 167 152 152 ARG ARG B . n 
B 1 168 ILE 168 153 153 ILE ILE B . n 
B 1 169 ASP 169 154 154 ASP ASP B . n 
B 1 170 ALA 170 155 155 ALA ALA B . n 
B 1 171 HIS 171 156 156 HIS HIS B . n 
B 1 172 ASN 172 157 157 ASN ASN B . n 
B 1 173 THR 173 158 158 THR THR B . n 
B 1 174 ARG 174 159 159 ARG ARG B . n 
B 1 175 GLN 175 160 160 GLN GLN B . n 
B 1 176 PRO 176 161 161 PRO PRO B . n 
B 1 177 PRO 177 162 162 PRO PRO B . n 
B 1 178 GLU 178 163 163 GLU GLU B . n 
B 1 179 GLN 179 164 164 GLN GLN B . n 
B 1 180 LYS 180 165 165 LYS LYS B . n 
B 1 181 ILE 181 166 166 ILE ILE B . n 
B 1 182 ARG 182 167 167 ARG ARG B . n 
B 1 183 VAL 183 168 168 VAL VAL B . n 
B 1 184 SER 184 169 169 SER SER B . n 
B 1 185 VAL 185 170 170 VAL VAL B . n 
B 1 186 GLU 186 171 171 GLU GLU B . n 
B 1 187 VAL 187 172 172 VAL VAL B . n 
B 1 188 GLU 188 173 173 GLU GLU B . n 
B 1 189 LYS 189 174 174 LYS LYS B . n 
B 1 190 PRO 190 175 175 PRO PRO B . n 
B 1 191 ARG 191 176 176 ARG ARG B . n 
B 1 192 GLU 192 177 177 GLU GLU B . n 
B 1 193 GLU 193 178 178 GLU GLU B . n 
B 1 194 LEU 194 179 179 LEU LEU B . n 
B 1 195 PHE 195 180 180 PHE PHE B . n 
B 1 196 GLN 196 181 181 GLN GLN B . n 
B 1 197 LEU 197 182 182 LEU LEU B . n 
B 1 198 PHE 198 183 183 PHE PHE B . n 
B 1 199 GLY 199 184 184 GLY GLY B . n 
B 1 200 TYR 200 185 185 TYR TYR B . n 
B 1 201 GLY 201 186 186 GLY GLY B . n 
B 1 202 ASP 202 187 187 ASP ASP B . n 
B 1 203 VAL 203 188 188 VAL VAL B . n 
B 1 204 VAL 204 189 189 VAL VAL B . n 
B 1 205 PHE 205 190 190 PHE PHE B . n 
B 1 206 VAL 206 191 191 VAL VAL B . n 
B 1 207 SER 207 192 192 SER SER B . n 
B 1 208 LYS 208 193 193 LYS LYS B . n 
B 1 209 ASP 209 194 194 ASP ASP B . n 
B 1 210 VAL 210 195 195 VAL VAL B . n 
B 1 211 ALA 211 196 196 ALA ALA B . n 
B 1 212 LYS 212 197 197 LYS LYS B . n 
B 1 213 HIS 213 198 198 HIS HIS B . n 
B 1 214 LEU 214 199 199 LEU LEU B . n 
B 1 215 GLY 215 200 200 GLY GLY B . n 
B 1 216 PHE 216 201 201 PHE PHE B . n 
B 1 217 GLN 217 202 202 GLN GLN B . n 
B 1 218 SER 218 203 203 SER SER B . n 
B 1 219 ALA 219 204 204 ALA ALA B . n 
B 1 220 GLU 220 205 205 GLU GLU B . n 
B 1 221 GLU 221 206 206 GLU GLU B . n 
B 1 222 ALA 222 207 207 ALA ALA B . n 
B 1 223 LEU 223 208 208 LEU LEU B . n 
B 1 224 ARG 224 209 209 ARG ARG B . n 
B 1 225 GLY 225 210 210 GLY GLY B . n 
B 1 226 LEU 226 211 211 LEU LEU B . n 
B 1 227 TYR 227 212 212 TYR TYR B . n 
B 1 228 GLY 228 213 213 GLY GLY B . n 
B 1 229 ARG 229 214 214 ARG ARG B . n 
B 1 230 VAL 230 215 215 VAL VAL B . n 
B 1 231 ARG 231 216 216 ARG ARG B . n 
B 1 232 LYS 232 217 217 LYS LYS B . n 
B 1 233 GLY 233 218 218 GLY GLY B . n 
B 1 234 ALA 234 219 219 ALA ALA B . n 
B 1 235 VAL 235 220 220 VAL VAL B . n 
B 1 236 LEU 236 221 221 LEU LEU B . n 
B 1 237 VAL 237 222 222 VAL VAL B . n 
B 1 238 CYS 238 223 223 CYS CYS B . n 
B 1 239 ALA 239 224 224 ALA ALA B . n 
B 1 240 TRP 240 225 225 TRP TRP B . n 
B 1 241 ALA 241 226 226 ALA ALA B . n 
B 1 242 GLU 242 227 227 GLU GLU B . n 
B 1 243 GLU 243 228 228 GLU GLU B . n 
B 1 244 GLY 244 229 229 GLY GLY B . n 
B 1 245 ALA 245 230 230 ALA ALA B . n 
B 1 246 ASP 246 231 231 ASP ASP B . n 
B 1 247 ALA 247 232 232 ALA ALA B . n 
B 1 248 LEU 248 233 233 LEU LEU B . n 
B 1 249 GLY 249 234 234 GLY GLY B . n 
B 1 250 PRO 250 235 235 PRO PRO B . n 
B 1 251 ASP 251 236 236 ASP ASP B . n 
B 1 252 GLY 252 237 237 GLY GLY B . n 
B 1 253 LYS 253 238 238 LYS LYS B . n 
B 1 254 LEU 254 239 239 LEU LEU B . n 
B 1 255 LEU 255 240 240 LEU LEU B . n 
B 1 256 HIS 256 241 241 HIS HIS B . n 
B 1 257 SER 257 242 242 SER SER B . n 
B 1 258 ASP 258 243 243 ASP ASP B . n 
B 1 259 ALA 259 244 244 ALA ALA B . n 
B 1 260 PHE 260 245 245 PHE PHE B . n 
B 1 261 PRO 261 246 246 PRO PRO B . n 
B 1 262 PRO 262 247 247 PRO PRO B . n 
B 1 263 PRO 263 248 248 PRO PRO B . n 
B 1 264 ARG 264 249 249 ARG ARG B . n 
B 1 265 VAL 265 250 250 VAL VAL B . n 
B 1 266 VAL 266 251 251 VAL VAL B . n 
B 1 267 ASP 267 252 252 ASP ASP B . n 
B 1 268 THR 268 253 253 THR THR B . n 
B 1 269 LEU 269 254 254 LEU LEU B . n 
B 1 270 GLY 270 255 255 GLY GLY B . n 
B 1 271 ALA 271 256 256 ALA ALA B . n 
B 1 272 GLY 272 257 257 GLY GLY B . n 
B 1 273 ASP 273 258 258 ASP ASP B . n 
B 1 274 THR 274 259 259 THR THR B . n 
B 1 275 PHE 275 260 260 PHE PHE B . n 
B 1 276 ASN 276 261 261 ASN ASN B . n 
B 1 277 ALA 277 262 262 ALA ALA B . n 
B 1 278 SER 278 263 263 SER SER B . n 
B 1 279 VAL 279 264 264 VAL VAL B . n 
B 1 280 ILE 280 265 265 ILE ILE B . n 
B 1 281 PHE 281 266 266 PHE PHE B . n 
B 1 282 SER 282 267 267 SER SER B . n 
B 1 283 LEU 283 268 268 LEU LEU B . n 
B 1 284 SER 284 269 269 SER SER B . n 
B 1 285 GLN 285 270 270 GLN GLN B . n 
B 1 286 GLY 286 271 271 GLY GLY B . n 
B 1 287 ARG 287 272 272 ARG ARG B . n 
B 1 288 SER 288 273 273 SER SER B . n 
B 1 289 VAL 289 274 274 VAL VAL B . n 
B 1 290 GLN 290 275 275 GLN GLN B . n 
B 1 291 GLU 291 276 276 GLU GLU B . n 
B 1 292 ALA 292 277 277 ALA ALA B . n 
B 1 293 LEU 293 278 278 LEU LEU B . n 
B 1 294 ARG 294 279 279 ARG ARG B . n 
B 1 295 PHE 295 280 280 PHE PHE B . n 
B 1 296 GLY 296 281 281 GLY GLY B . n 
B 1 297 CYS 297 282 282 CYS CYS B . n 
B 1 298 GLN 298 283 283 GLN GLN B . n 
B 1 299 VAL 299 284 284 VAL VAL B . n 
B 1 300 ALA 300 285 285 ALA ALA B . n 
B 1 301 GLY 301 286 286 GLY GLY B . n 
B 1 302 LYS 302 287 287 LYS LYS B . n 
B 1 303 LYS 303 288 288 LYS LYS B . n 
B 1 304 CYS 304 289 289 CYS CYS B . n 
B 1 305 GLY 305 290 290 GLY GLY B . n 
B 1 306 LEU 306 291 291 LEU LEU B . n 
B 1 307 GLN 307 292 292 GLN GLN B . n 
B 1 308 GLY 308 293 293 GLY GLY B . n 
B 1 309 PHE 309 294 294 PHE PHE B . n 
B 1 310 ASP 310 295 295 ASP ASP B . n 
B 1 311 GLY 311 296 296 GLY GLY B . n 
B 1 312 ILE 312 297 297 ILE ILE B . n 
B 1 313 VAL 313 298 298 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ANP 1  299 1   ANP ANP A . 
D 3 FRU 1  300 1   FRU FRU A . 
E 2 ANP 1  299 2   ANP ANP B . 
F 4 SO4 1  300 2   SO4 SO4 B . 
G 5 HOH 1  301 3   HOH HOH A . 
G 5 HOH 2  302 4   HOH HOH A . 
G 5 HOH 3  303 5   HOH HOH A . 
G 5 HOH 4  304 10  HOH HOH A . 
G 5 HOH 5  305 11  HOH HOH A . 
G 5 HOH 6  306 16  HOH HOH A . 
G 5 HOH 7  307 19  HOH HOH A . 
G 5 HOH 8  308 21  HOH HOH A . 
G 5 HOH 9  309 24  HOH HOH A . 
G 5 HOH 10 310 29  HOH HOH A . 
G 5 HOH 11 311 30  HOH HOH A . 
G 5 HOH 12 312 34  HOH HOH A . 
G 5 HOH 13 313 36  HOH HOH A . 
G 5 HOH 14 314 37  HOH HOH A . 
G 5 HOH 15 315 41  HOH HOH A . 
G 5 HOH 16 316 42  HOH HOH A . 
G 5 HOH 17 317 44  HOH HOH A . 
G 5 HOH 18 318 47  HOH HOH A . 
G 5 HOH 19 319 50  HOH HOH A . 
G 5 HOH 20 320 52  HOH HOH A . 
G 5 HOH 21 321 53  HOH HOH A . 
G 5 HOH 22 322 54  HOH HOH A . 
G 5 HOH 23 323 55  HOH HOH A . 
G 5 HOH 24 324 61  HOH HOH A . 
G 5 HOH 25 325 62  HOH HOH A . 
G 5 HOH 26 326 69  HOH HOH A . 
G 5 HOH 27 327 73  HOH HOH A . 
G 5 HOH 28 328 75  HOH HOH A . 
G 5 HOH 29 329 77  HOH HOH A . 
G 5 HOH 30 330 81  HOH HOH A . 
G 5 HOH 31 331 82  HOH HOH A . 
G 5 HOH 32 332 84  HOH HOH A . 
G 5 HOH 33 333 90  HOH HOH A . 
G 5 HOH 34 334 97  HOH HOH A . 
G 5 HOH 35 335 101 HOH HOH A . 
G 5 HOH 36 336 104 HOH HOH A . 
G 5 HOH 37 337 105 HOH HOH A . 
G 5 HOH 38 338 108 HOH HOH A . 
G 5 HOH 39 339 109 HOH HOH A . 
G 5 HOH 40 340 113 HOH HOH A . 
G 5 HOH 41 341 115 HOH HOH A . 
G 5 HOH 42 342 116 HOH HOH A . 
G 5 HOH 43 343 118 HOH HOH A . 
G 5 HOH 44 344 119 HOH HOH A . 
G 5 HOH 45 345 120 HOH HOH A . 
H 5 HOH 1  301 1   HOH HOH B . 
H 5 HOH 2  302 2   HOH HOH B . 
H 5 HOH 3  303 6   HOH HOH B . 
H 5 HOH 4  304 7   HOH HOH B . 
H 5 HOH 5  305 8   HOH HOH B . 
H 5 HOH 6  306 9   HOH HOH B . 
H 5 HOH 7  307 12  HOH HOH B . 
H 5 HOH 8  308 13  HOH HOH B . 
H 5 HOH 9  309 14  HOH HOH B . 
H 5 HOH 10 310 15  HOH HOH B . 
H 5 HOH 11 311 17  HOH HOH B . 
H 5 HOH 12 312 18  HOH HOH B . 
H 5 HOH 13 313 20  HOH HOH B . 
H 5 HOH 14 314 22  HOH HOH B . 
H 5 HOH 15 315 23  HOH HOH B . 
H 5 HOH 16 316 25  HOH HOH B . 
H 5 HOH 17 317 26  HOH HOH B . 
H 5 HOH 18 318 27  HOH HOH B . 
H 5 HOH 19 319 28  HOH HOH B . 
H 5 HOH 20 320 31  HOH HOH B . 
H 5 HOH 21 321 32  HOH HOH B . 
H 5 HOH 22 322 33  HOH HOH B . 
H 5 HOH 23 323 35  HOH HOH B . 
H 5 HOH 24 324 38  HOH HOH B . 
H 5 HOH 25 325 39  HOH HOH B . 
H 5 HOH 26 326 40  HOH HOH B . 
H 5 HOH 27 327 43  HOH HOH B . 
H 5 HOH 28 328 45  HOH HOH B . 
H 5 HOH 29 329 46  HOH HOH B . 
H 5 HOH 30 330 48  HOH HOH B . 
H 5 HOH 31 331 49  HOH HOH B . 
H 5 HOH 32 332 51  HOH HOH B . 
H 5 HOH 33 333 56  HOH HOH B . 
H 5 HOH 34 334 57  HOH HOH B . 
H 5 HOH 35 335 58  HOH HOH B . 
H 5 HOH 36 336 59  HOH HOH B . 
H 5 HOH 37 337 60  HOH HOH B . 
H 5 HOH 38 338 63  HOH HOH B . 
H 5 HOH 39 339 64  HOH HOH B . 
H 5 HOH 40 340 65  HOH HOH B . 
H 5 HOH 41 341 66  HOH HOH B . 
H 5 HOH 42 342 67  HOH HOH B . 
H 5 HOH 43 343 68  HOH HOH B . 
H 5 HOH 44 344 70  HOH HOH B . 
H 5 HOH 45 345 71  HOH HOH B . 
H 5 HOH 46 346 72  HOH HOH B . 
H 5 HOH 47 347 74  HOH HOH B . 
H 5 HOH 48 348 76  HOH HOH B . 
H 5 HOH 49 349 78  HOH HOH B . 
H 5 HOH 50 350 79  HOH HOH B . 
H 5 HOH 51 351 80  HOH HOH B . 
H 5 HOH 52 352 83  HOH HOH B . 
H 5 HOH 53 353 85  HOH HOH B . 
H 5 HOH 54 354 86  HOH HOH B . 
H 5 HOH 55 355 87  HOH HOH B . 
H 5 HOH 56 356 88  HOH HOH B . 
H 5 HOH 57 357 89  HOH HOH B . 
H 5 HOH 58 358 91  HOH HOH B . 
H 5 HOH 59 359 92  HOH HOH B . 
H 5 HOH 60 360 93  HOH HOH B . 
H 5 HOH 61 361 94  HOH HOH B . 
H 5 HOH 62 362 95  HOH HOH B . 
H 5 HOH 63 363 96  HOH HOH B . 
H 5 HOH 64 364 98  HOH HOH B . 
H 5 HOH 65 365 99  HOH HOH B . 
H 5 HOH 66 366 100 HOH HOH B . 
H 5 HOH 67 367 102 HOH HOH B . 
H 5 HOH 68 368 103 HOH HOH B . 
H 5 HOH 69 369 106 HOH HOH B . 
H 5 HOH 70 370 107 HOH HOH B . 
H 5 HOH 71 371 110 HOH HOH B . 
H 5 HOH 72 372 111 HOH HOH B . 
H 5 HOH 73 373 112 HOH HOH B . 
H 5 HOH 74 374 114 HOH HOH B . 
H 5 HOH 75 375 117 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5590  ? 
1 MORE         -30   ? 
1 'SSA (A^2)'  24780 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-02-22 
4 'Structure model' 1 3 2017-11-08 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Structure summary'         
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Derived calculations'      
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
2 4 'Structure model' software                     
3 5 'Structure model' chem_comp                    
4 5 'Structure model' entity                       
5 5 'Structure model' pdbx_chem_comp_identifier    
6 5 'Structure model' pdbx_entity_nonpoly          
7 5 'Structure model' struct_ref_seq_dif           
8 5 'Structure model' struct_site                  
9 5 'Structure model' struct_site_gen              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'              
2 5 'Structure model' '_chem_comp.name'             
3 5 'Structure model' '_chem_comp.type'             
4 5 'Structure model' '_entity.pdbx_description'    
5 5 'Structure model' '_pdbx_entity_nonpoly.name'   
6 5 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
JDirector 'data collection' .                            ? 1 
PHENIX    'model building'  .                            ? 2 
PHENIX    refinement        '(phenix.refine: 1.6.1_357)' ? 3 
HKL-2000  'data reduction'  .                            ? 4 
HKL-2000  'data scaling'    .                            ? 5 
PHENIX    phasing           .                            ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 90  ? ? -150.62 -7.56   
2  1 THR A 115 ? ? -79.14  24.14   
3  1 SER A 116 ? ? 69.33   -16.14  
4  1 LEU A 117 ? ? -35.62  119.32  
5  1 ARG A 141 ? ? -126.35 -75.03  
6  1 THR A 158 ? ? -47.26  -13.70  
7  1 PRO A 175 ? ? -67.85  80.36   
8  1 TRP A 225 ? ? -146.05 59.42   
9  1 ALA A 226 ? ? 50.51   -129.34 
10 1 PHE A 245 ? ? -117.36 67.66   
11 1 ASP A 252 ? ? -167.42 101.39  
12 1 ASN B 105 ? ? 175.60  0.49    
13 1 ARG B 141 ? ? -140.95 -83.30  
14 1 ALA B 226 ? ? 49.75   -122.63 
15 1 ASP B 252 ? ? -160.96 107.04  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -14 ? A MET 1  
2  1 Y 1 A GLY -13 ? A GLY 2  
3  1 Y 1 A SER -12 ? A SER 3  
4  1 Y 1 A SER -11 ? A SER 4  
5  1 Y 1 A HIS -10 ? A HIS 5  
6  1 Y 1 A HIS -9  ? A HIS 6  
7  1 Y 1 A HIS -8  ? A HIS 7  
8  1 Y 1 A HIS -7  ? A HIS 8  
9  1 Y 1 A HIS -6  ? A HIS 9  
10 1 Y 1 A HIS -5  ? A HIS 10 
11 1 Y 1 A SER -4  ? A SER 11 
12 1 Y 1 A SER -3  ? A SER 12 
13 1 Y 1 A GLY -2  ? A GLY 13 
14 1 Y 1 A LEU -1  ? A LEU 14 
15 1 Y 1 A VAL 0   ? A VAL 15 
16 1 Y 1 A PRO 1   ? A PRO 16 
17 1 Y 1 A ARG 2   ? A ARG 17 
18 1 Y 1 B MET -14 ? B MET 1  
19 1 Y 1 B GLY -13 ? B GLY 2  
20 1 Y 1 B SER -12 ? B SER 3  
21 1 Y 1 B SER -11 ? B SER 4  
22 1 Y 1 B HIS -10 ? B HIS 5  
23 1 Y 1 B HIS -9  ? B HIS 6  
24 1 Y 1 B HIS -8  ? B HIS 7  
25 1 Y 1 B HIS -7  ? B HIS 8  
26 1 Y 1 B HIS -6  ? B HIS 9  
27 1 Y 1 B HIS -5  ? B HIS 10 
28 1 Y 1 B SER -4  ? B SER 11 
29 1 Y 1 B SER -3  ? B SER 12 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
3 beta-D-fructofuranose                         FRU 
4 'SULFATE ION'                                 SO4 
5 water                                         HOH 
#