data_3NJ4
# 
_entry.id   3NJ4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NJ4         
RCSB  RCSB059893   
WWPDB D_1000059893 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3NJ4 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jeong, L.S.' 1 
'Lee, K.M.'   2 
'Hwang, K.Y.' 3 
'Choi, S.'    4 
'Heo, Y.S.'   5 
# 
_citation.id                        primary 
_citation.title                     
;X-ray crystal structure and binding mode analysis of human S-adenosylhomocysteine hydrolase complexed with novel mechanism-based inhibitors, haloneplanocin A analogues.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            54 
_citation.page_first                930 
_citation.page_last                 938 
_citation.year                      2011 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21226494 
_citation.pdbx_database_id_DOI      10.1021/jm1010836 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, K.M.'   1  
primary 'Choi, W.J.'  2  
primary 'Lee, Y.'     3  
primary 'Lee, H.J.'   4  
primary 'Zhao, L.X.'  5  
primary 'Lee, H.W.'   6  
primary 'Park, J.G.'  7  
primary 'Kim, H.O.'   8  
primary 'Hwang, K.Y.' 9  
primary 'Heo, Y.S.'   10 
primary 'Choi, S.'    11 
primary 'Jeong, L.S.' 12 
# 
_cell.entry_id           3NJ4 
_cell.length_a           91.201 
_cell.length_b           81.939 
_cell.length_c           129.599 
_cell.angle_alpha        90.00 
_cell.angle_beta         107.01 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NJ4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Adenosylhomocysteinase                                                                       48055.227 4   
3.3.1.1 ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                                                            663.425   4   ? ? ? 
? 
3 non-polymer syn '(4S,5S)-4-(6-amino-9H-purin-9-yl)-3-fluoro-5-hydroxy-2-(hydroxymethyl)cyclopent-2-en-1-one' 279.227   4   ? ? ? 
? 
4 water       nat water                                                                                        18.015    258 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AdoHcyase, S-adenosyl-L-homocysteine hydrolase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWS
SCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEET
TTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGA
RVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVE
KVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEA
HLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWS
SCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEET
TTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGA
RVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVE
KVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEA
HLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   ASP n 
1 7   LYS n 
1 8   LEU n 
1 9   PRO n 
1 10  TYR n 
1 11  LYS n 
1 12  VAL n 
1 13  ALA n 
1 14  ASP n 
1 15  ILE n 
1 16  GLY n 
1 17  LEU n 
1 18  ALA n 
1 19  ALA n 
1 20  TRP n 
1 21  GLY n 
1 22  ARG n 
1 23  LYS n 
1 24  ALA n 
1 25  LEU n 
1 26  ASP n 
1 27  ILE n 
1 28  ALA n 
1 29  GLU n 
1 30  ASN n 
1 31  GLU n 
1 32  MET n 
1 33  PRO n 
1 34  GLY n 
1 35  LEU n 
1 36  MET n 
1 37  ARG n 
1 38  MET n 
1 39  ARG n 
1 40  GLU n 
1 41  ARG n 
1 42  TYR n 
1 43  SER n 
1 44  ALA n 
1 45  SER n 
1 46  LYS n 
1 47  PRO n 
1 48  LEU n 
1 49  LYS n 
1 50  GLY n 
1 51  ALA n 
1 52  ARG n 
1 53  ILE n 
1 54  ALA n 
1 55  GLY n 
1 56  CYS n 
1 57  LEU n 
1 58  HIS n 
1 59  MET n 
1 60  THR n 
1 61  VAL n 
1 62  GLU n 
1 63  THR n 
1 64  ALA n 
1 65  VAL n 
1 66  LEU n 
1 67  ILE n 
1 68  GLU n 
1 69  THR n 
1 70  LEU n 
1 71  VAL n 
1 72  THR n 
1 73  LEU n 
1 74  GLY n 
1 75  ALA n 
1 76  GLU n 
1 77  VAL n 
1 78  GLN n 
1 79  TRP n 
1 80  SER n 
1 81  SER n 
1 82  CYS n 
1 83  ASN n 
1 84  ILE n 
1 85  PHE n 
1 86  SER n 
1 87  THR n 
1 88  GLN n 
1 89  ASP n 
1 90  HIS n 
1 91  ALA n 
1 92  ALA n 
1 93  ALA n 
1 94  ALA n 
1 95  ILE n 
1 96  ALA n 
1 97  LYS n 
1 98  ALA n 
1 99  GLY n 
1 100 ILE n 
1 101 PRO n 
1 102 VAL n 
1 103 TYR n 
1 104 ALA n 
1 105 TRP n 
1 106 LYS n 
1 107 GLY n 
1 108 GLU n 
1 109 THR n 
1 110 ASP n 
1 111 GLU n 
1 112 GLU n 
1 113 TYR n 
1 114 LEU n 
1 115 TRP n 
1 116 CYS n 
1 117 ILE n 
1 118 GLU n 
1 119 GLN n 
1 120 THR n 
1 121 LEU n 
1 122 TYR n 
1 123 PHE n 
1 124 LYS n 
1 125 ASP n 
1 126 GLY n 
1 127 PRO n 
1 128 LEU n 
1 129 ASN n 
1 130 MET n 
1 131 ILE n 
1 132 LEU n 
1 133 ASP n 
1 134 ASP n 
1 135 GLY n 
1 136 GLY n 
1 137 ASP n 
1 138 LEU n 
1 139 THR n 
1 140 ASN n 
1 141 LEU n 
1 142 ILE n 
1 143 HIS n 
1 144 THR n 
1 145 LYS n 
1 146 TYR n 
1 147 PRO n 
1 148 GLN n 
1 149 LEU n 
1 150 LEU n 
1 151 PRO n 
1 152 GLY n 
1 153 ILE n 
1 154 ARG n 
1 155 GLY n 
1 156 ILE n 
1 157 SER n 
1 158 GLU n 
1 159 GLU n 
1 160 THR n 
1 161 THR n 
1 162 THR n 
1 163 GLY n 
1 164 VAL n 
1 165 HIS n 
1 166 ASN n 
1 167 LEU n 
1 168 TYR n 
1 169 LYS n 
1 170 MET n 
1 171 MET n 
1 172 ALA n 
1 173 ASN n 
1 174 GLY n 
1 175 ILE n 
1 176 LEU n 
1 177 LYS n 
1 178 VAL n 
1 179 PRO n 
1 180 ALA n 
1 181 ILE n 
1 182 ASN n 
1 183 VAL n 
1 184 ASN n 
1 185 ASP n 
1 186 SER n 
1 187 VAL n 
1 188 THR n 
1 189 LYS n 
1 190 SER n 
1 191 LYS n 
1 192 PHE n 
1 193 ASP n 
1 194 ASN n 
1 195 LEU n 
1 196 TYR n 
1 197 GLY n 
1 198 CYS n 
1 199 ARG n 
1 200 GLU n 
1 201 SER n 
1 202 LEU n 
1 203 ILE n 
1 204 ASP n 
1 205 GLY n 
1 206 ILE n 
1 207 LYS n 
1 208 ARG n 
1 209 ALA n 
1 210 THR n 
1 211 ASP n 
1 212 VAL n 
1 213 MET n 
1 214 ILE n 
1 215 ALA n 
1 216 GLY n 
1 217 LYS n 
1 218 VAL n 
1 219 ALA n 
1 220 VAL n 
1 221 VAL n 
1 222 ALA n 
1 223 GLY n 
1 224 TYR n 
1 225 GLY n 
1 226 ASP n 
1 227 VAL n 
1 228 GLY n 
1 229 LYS n 
1 230 GLY n 
1 231 CYS n 
1 232 ALA n 
1 233 GLN n 
1 234 ALA n 
1 235 LEU n 
1 236 ARG n 
1 237 GLY n 
1 238 PHE n 
1 239 GLY n 
1 240 ALA n 
1 241 ARG n 
1 242 VAL n 
1 243 ILE n 
1 244 ILE n 
1 245 THR n 
1 246 GLU n 
1 247 ILE n 
1 248 ASP n 
1 249 PRO n 
1 250 ILE n 
1 251 ASN n 
1 252 ALA n 
1 253 LEU n 
1 254 GLN n 
1 255 ALA n 
1 256 ALA n 
1 257 MET n 
1 258 GLU n 
1 259 GLY n 
1 260 TYR n 
1 261 GLU n 
1 262 VAL n 
1 263 THR n 
1 264 THR n 
1 265 MET n 
1 266 ASP n 
1 267 GLU n 
1 268 ALA n 
1 269 CYS n 
1 270 GLN n 
1 271 GLU n 
1 272 GLY n 
1 273 ASN n 
1 274 ILE n 
1 275 PHE n 
1 276 VAL n 
1 277 THR n 
1 278 THR n 
1 279 THR n 
1 280 GLY n 
1 281 CYS n 
1 282 ILE n 
1 283 ASP n 
1 284 ILE n 
1 285 ILE n 
1 286 LEU n 
1 287 GLY n 
1 288 ARG n 
1 289 HIS n 
1 290 PHE n 
1 291 GLU n 
1 292 GLN n 
1 293 MET n 
1 294 LYS n 
1 295 ASP n 
1 296 ASP n 
1 297 ALA n 
1 298 ILE n 
1 299 VAL n 
1 300 CYS n 
1 301 ASN n 
1 302 ILE n 
1 303 GLY n 
1 304 HIS n 
1 305 PHE n 
1 306 ASP n 
1 307 VAL n 
1 308 GLU n 
1 309 ILE n 
1 310 ASP n 
1 311 VAL n 
1 312 LYS n 
1 313 TRP n 
1 314 LEU n 
1 315 ASN n 
1 316 GLU n 
1 317 ASN n 
1 318 ALA n 
1 319 VAL n 
1 320 GLU n 
1 321 LYS n 
1 322 VAL n 
1 323 ASN n 
1 324 ILE n 
1 325 LYS n 
1 326 PRO n 
1 327 GLN n 
1 328 VAL n 
1 329 ASP n 
1 330 ARG n 
1 331 TYR n 
1 332 ARG n 
1 333 LEU n 
1 334 LYS n 
1 335 ASN n 
1 336 GLY n 
1 337 ARG n 
1 338 ARG n 
1 339 ILE n 
1 340 ILE n 
1 341 LEU n 
1 342 LEU n 
1 343 ALA n 
1 344 GLU n 
1 345 GLY n 
1 346 ARG n 
1 347 LEU n 
1 348 VAL n 
1 349 ASN n 
1 350 LEU n 
1 351 GLY n 
1 352 CYS n 
1 353 ALA n 
1 354 MET n 
1 355 GLY n 
1 356 HIS n 
1 357 PRO n 
1 358 SER n 
1 359 PHE n 
1 360 VAL n 
1 361 MET n 
1 362 SER n 
1 363 ASN n 
1 364 SER n 
1 365 PHE n 
1 366 THR n 
1 367 ASN n 
1 368 GLN n 
1 369 VAL n 
1 370 MET n 
1 371 ALA n 
1 372 GLN n 
1 373 ILE n 
1 374 GLU n 
1 375 LEU n 
1 376 TRP n 
1 377 THR n 
1 378 HIS n 
1 379 PRO n 
1 380 ASP n 
1 381 LYS n 
1 382 TYR n 
1 383 PRO n 
1 384 VAL n 
1 385 GLY n 
1 386 VAL n 
1 387 HIS n 
1 388 PHE n 
1 389 LEU n 
1 390 PRO n 
1 391 LYS n 
1 392 LYS n 
1 393 LEU n 
1 394 ASP n 
1 395 GLU n 
1 396 ALA n 
1 397 VAL n 
1 398 ALA n 
1 399 GLU n 
1 400 ALA n 
1 401 HIS n 
1 402 LEU n 
1 403 GLY n 
1 404 LYS n 
1 405 LEU n 
1 406 ASN n 
1 407 VAL n 
1 408 LYS n 
1 409 LEU n 
1 410 THR n 
1 411 LYS n 
1 412 LEU n 
1 413 THR n 
1 414 GLU n 
1 415 LYS n 
1 416 GLN n 
1 417 ALA n 
1 418 GLN n 
1 419 TYR n 
1 420 LEU n 
1 421 GLY n 
1 422 MET n 
1 423 SER n 
1 424 CYS n 
1 425 ASP n 
1 426 GLY n 
1 427 PRO n 
1 428 PHE n 
1 429 LYS n 
1 430 PRO n 
1 431 ASP n 
1 432 HIS n 
1 433 TYR n 
1 434 ARG n 
1 435 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AHCY, SAHH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAHH_HUMAN 
_struct_ref.pdbx_db_accession          P23526 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN
IFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTG
VHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NJ4 A 4 ? 435 ? P23526 1 ? 432 ? 1 432 
2 1 3NJ4 B 4 ? 435 ? P23526 1 ? 432 ? 1 432 
3 1 3NJ4 C 4 ? 435 ? P23526 1 ? 432 ? 1 432 
4 1 3NJ4 D 4 ? 435 ? P23526 1 ? 432 ? 1 432 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NJ4 GLY A 1 ? UNP P23526 ? ? 'EXPRESSION TAG' -2 1  
1 3NJ4 SER A 2 ? UNP P23526 ? ? 'EXPRESSION TAG' -1 2  
1 3NJ4 HIS A 3 ? UNP P23526 ? ? 'EXPRESSION TAG' 0  3  
2 3NJ4 GLY B 1 ? UNP P23526 ? ? 'EXPRESSION TAG' -2 4  
2 3NJ4 SER B 2 ? UNP P23526 ? ? 'EXPRESSION TAG' -1 5  
2 3NJ4 HIS B 3 ? UNP P23526 ? ? 'EXPRESSION TAG' 0  6  
3 3NJ4 GLY C 1 ? UNP P23526 ? ? 'EXPRESSION TAG' -2 7  
3 3NJ4 SER C 2 ? UNP P23526 ? ? 'EXPRESSION TAG' -1 8  
3 3NJ4 HIS C 3 ? UNP P23526 ? ? 'EXPRESSION TAG' 0  9  
4 3NJ4 GLY D 1 ? UNP P23526 ? ? 'EXPRESSION TAG' -2 10 
4 3NJ4 SER D 2 ? UNP P23526 ? ? 'EXPRESSION TAG' -1 11 
4 3NJ4 HIS D 3 ? UNP P23526 ? ? 'EXPRESSION TAG' 0  12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AFX non-polymer         . '(4S,5S)-4-(6-amino-9H-purin-9-yl)-3-fluoro-5-hydroxy-2-(hydroxymethyl)cyclopent-2-en-1-one' ? 
'C11 H10 F N5 O3'   279.227 
ALA 'L-peptide linking' y ALANINE                                                                                      ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                      ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                        ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                      ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE                                                            ? 
'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                      ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                       ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                    ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                     ? 
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                       ? 
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3NJ4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   48.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'0.1M HEPES pH 8.0, 22% PEG400, 100mM Lithium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double mirror' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PAL/PLS BEAMLINE 6B' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
_diffrn_source.pdbx_synchrotron_beamline   6B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3NJ4 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   55307 
_reflns.number_all                   63498 
_reflns.percent_possible_obs         87.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        29.7 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high                  2.5 
_reflns_shell.d_res_low                   2.62 
_reflns_shell.percent_possible_all        70.6 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_diffrn_id              ? 
_reflns_shell.pdbx_ordinal                1 
# 
_refine.entry_id                                 3NJ4 
_refine.ls_number_reflns_obs                     55307 
_refine.ls_number_reflns_all                     63498 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               766342.26 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.61 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    87.1 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          0.209 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.1 
_refine.ls_number_reflns_R_free                  3954 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               36.2 
_refine.aniso_B[1][1]                            -1.39 
_refine.aniso_B[2][2]                            -0.98 
_refine.aniso_B[3][3]                            2.37 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            5.99 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.369721 
_refine.solvent_model_param_bsol                 40.3108 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3NJ4 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.37 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13332 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         256 
_refine_hist.number_atoms_solvent             258 
_refine_hist.number_atoms_total               13846 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        43.61 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.80  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.20  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.94  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.72  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.50  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             7461 
_refine_ls_shell.R_factor_R_work                  0.301 
_refine_ls_shell.percent_reflns_obs               77.0 
_refine_ls_shell.R_factor_R_free                  0.355 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            7.4 
_refine_ls_shell.number_reflns_R_free             592 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param protein.top 
'X-RAY DIFFRACTION' 2 water_rep.param   water.top   
'X-RAY DIFFRACTION' 3 adc.param         adc.top     
'X-RAY DIFFRACTION' 4 nah.param         nah.top     
# 
_struct.entry_id                  3NJ4 
_struct.title                     'Fluoro-neplanocin A in Human S-Adenosylhomocysteine Hydrolase' 
_struct.pdbx_descriptor           'Adenosylhomocysteinase (E.C.3.3.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NJ4 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'S-adenosylhomocystein, Hydrolase, NAD' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 14  ? GLY A 16  ? ASP A 11  GLY A 13  5 ? 3  
HELX_P HELX_P2  2  LEU A 17  ? ASN A 30  ? LEU A 14  ASN A 27  1 ? 14 
HELX_P HELX_P3  3  MET A 32  ? SER A 43  ? MET A 29  SER A 40  1 ? 12 
HELX_P HELX_P4  4  THR A 60  ? LEU A 73  ? THR A 57  LEU A 70  1 ? 14 
HELX_P HELX_P5  5  GLN A 88  ? ALA A 98  ? GLN A 85  ALA A 95  1 ? 11 
HELX_P HELX_P6  6  THR A 109 ? GLN A 119 ? THR A 106 GLN A 116 1 ? 11 
HELX_P HELX_P7  7  GLY A 136 ? TYR A 146 ? GLY A 133 TYR A 143 1 ? 11 
HELX_P HELX_P8  8  LEU A 149 ? ILE A 153 ? LEU A 146 ILE A 150 5 ? 5  
HELX_P HELX_P9  9  THR A 160 ? ASN A 173 ? THR A 157 ASN A 170 1 ? 14 
HELX_P HELX_P10 10 SER A 186 ? LYS A 191 ? SER A 183 LYS A 188 1 ? 6  
HELX_P HELX_P11 11 ASN A 194 ? ASP A 211 ? ASN A 191 ASP A 208 1 ? 18 
HELX_P HELX_P12 12 GLY A 225 ? PHE A 238 ? GLY A 222 PHE A 235 1 ? 14 
HELX_P HELX_P13 13 ASP A 248 ? GLU A 258 ? ASP A 245 GLU A 255 1 ? 11 
HELX_P HELX_P14 14 THR A 264 ? GLY A 272 ? THR A 261 GLY A 269 1 ? 9  
HELX_P HELX_P15 15 LEU A 286 ? GLU A 291 ? LEU A 283 GLU A 288 1 ? 6  
HELX_P HELX_P16 16 ASP A 310 ? GLU A 316 ? ASP A 307 GLU A 313 1 ? 7  
HELX_P HELX_P17 17 GLU A 344 ? ARG A 346 ? GLU A 341 ARG A 343 5 ? 3  
HELX_P HELX_P18 18 LEU A 347 ? CYS A 352 ? LEU A 344 CYS A 349 1 ? 6  
HELX_P HELX_P19 19 PRO A 357 ? HIS A 378 ? PRO A 354 HIS A 375 1 ? 22 
HELX_P HELX_P20 20 PRO A 379 ? TYR A 382 ? PRO A 376 TYR A 379 5 ? 4  
HELX_P HELX_P21 21 PRO A 390 ? ALA A 400 ? PRO A 387 ALA A 397 1 ? 11 
HELX_P HELX_P22 22 HIS A 401 ? ASN A 406 ? HIS A 398 ASN A 403 1 ? 6  
HELX_P HELX_P23 23 THR A 413 ? GLY A 421 ? THR A 410 GLY A 418 1 ? 9  
HELX_P HELX_P24 24 ASP B 14  ? GLY B 16  ? ASP B 11  GLY B 13  5 ? 3  
HELX_P HELX_P25 25 LEU B 17  ? ASN B 30  ? LEU B 14  ASN B 27  1 ? 14 
HELX_P HELX_P26 26 MET B 32  ? SER B 43  ? MET B 29  SER B 40  1 ? 12 
HELX_P HELX_P27 27 THR B 60  ? LEU B 73  ? THR B 57  LEU B 70  1 ? 14 
HELX_P HELX_P28 28 GLN B 88  ? ALA B 98  ? GLN B 85  ALA B 95  1 ? 11 
HELX_P HELX_P29 29 THR B 109 ? GLN B 119 ? THR B 106 GLN B 116 1 ? 11 
HELX_P HELX_P30 30 GLY B 136 ? TYR B 146 ? GLY B 133 TYR B 143 1 ? 11 
HELX_P HELX_P31 31 PRO B 147 ? ILE B 153 ? PRO B 144 ILE B 150 5 ? 7  
HELX_P HELX_P32 32 THR B 160 ? ASN B 173 ? THR B 157 ASN B 170 1 ? 14 
HELX_P HELX_P33 33 SER B 186 ? LYS B 191 ? SER B 183 LYS B 188 1 ? 6  
HELX_P HELX_P34 34 PHE B 192 ? ASP B 211 ? PHE B 189 ASP B 208 1 ? 20 
HELX_P HELX_P35 35 GLY B 225 ? PHE B 238 ? GLY B 222 PHE B 235 1 ? 14 
HELX_P HELX_P36 36 ASP B 248 ? GLU B 258 ? ASP B 245 GLU B 255 1 ? 11 
HELX_P HELX_P37 37 THR B 264 ? CYS B 269 ? THR B 261 CYS B 266 1 ? 6  
HELX_P HELX_P38 38 LEU B 286 ? GLU B 291 ? LEU B 283 GLU B 288 1 ? 6  
HELX_P HELX_P39 39 ASP B 310 ? GLU B 316 ? ASP B 307 GLU B 313 1 ? 7  
HELX_P HELX_P40 40 GLU B 344 ? ARG B 346 ? GLU B 341 ARG B 343 5 ? 3  
HELX_P HELX_P41 41 LEU B 347 ? CYS B 352 ? LEU B 344 CYS B 349 1 ? 6  
HELX_P HELX_P42 42 PRO B 357 ? HIS B 378 ? PRO B 354 HIS B 375 1 ? 22 
HELX_P HELX_P43 43 PRO B 390 ? HIS B 401 ? PRO B 387 HIS B 398 1 ? 12 
HELX_P HELX_P44 44 HIS B 401 ? ASN B 406 ? HIS B 398 ASN B 403 1 ? 6  
HELX_P HELX_P45 45 THR B 413 ? GLY B 421 ? THR B 410 GLY B 418 1 ? 9  
HELX_P HELX_P46 46 ASP C 14  ? GLY C 16  ? ASP C 11  GLY C 13  5 ? 3  
HELX_P HELX_P47 47 LEU C 17  ? ASN C 30  ? LEU C 14  ASN C 27  1 ? 14 
HELX_P HELX_P48 48 MET C 32  ? SER C 43  ? MET C 29  SER C 40  1 ? 12 
HELX_P HELX_P49 49 THR C 60  ? LEU C 73  ? THR C 57  LEU C 70  1 ? 14 
HELX_P HELX_P50 50 GLN C 88  ? ALA C 98  ? GLN C 85  ALA C 95  1 ? 11 
HELX_P HELX_P51 51 THR C 109 ? GLN C 119 ? THR C 106 GLN C 116 1 ? 11 
HELX_P HELX_P52 52 GLY C 136 ? TYR C 146 ? GLY C 133 TYR C 143 1 ? 11 
HELX_P HELX_P53 53 PRO C 147 ? ILE C 153 ? PRO C 144 ILE C 150 5 ? 7  
HELX_P HELX_P54 54 THR C 160 ? ASN C 173 ? THR C 157 ASN C 170 1 ? 14 
HELX_P HELX_P55 55 SER C 186 ? LYS C 191 ? SER C 183 LYS C 188 1 ? 6  
HELX_P HELX_P56 56 GLY C 197 ? ASP C 211 ? GLY C 194 ASP C 208 1 ? 15 
HELX_P HELX_P57 57 GLY C 225 ? PHE C 238 ? GLY C 222 PHE C 235 1 ? 14 
HELX_P HELX_P58 58 ASP C 248 ? GLU C 258 ? ASP C 245 GLU C 255 1 ? 11 
HELX_P HELX_P59 59 THR C 264 ? CYS C 269 ? THR C 261 CYS C 266 1 ? 6  
HELX_P HELX_P60 60 LEU C 286 ? MET C 293 ? LEU C 283 MET C 290 1 ? 8  
HELX_P HELX_P61 61 ASP C 310 ? GLU C 316 ? ASP C 307 GLU C 313 1 ? 7  
HELX_P HELX_P62 62 GLU C 344 ? ARG C 346 ? GLU C 341 ARG C 343 5 ? 3  
HELX_P HELX_P63 63 LEU C 347 ? ALA C 353 ? LEU C 344 ALA C 350 1 ? 7  
HELX_P HELX_P64 64 PRO C 357 ? HIS C 378 ? PRO C 354 HIS C 375 1 ? 22 
HELX_P HELX_P65 65 PRO C 390 ? GLY C 403 ? PRO C 387 GLY C 400 1 ? 14 
HELX_P HELX_P66 66 THR C 413 ? LEU C 420 ? THR C 410 LEU C 417 1 ? 8  
HELX_P HELX_P67 67 ASP D 14  ? GLY D 16  ? ASP D 11  GLY D 13  5 ? 3  
HELX_P HELX_P68 68 LEU D 17  ? MET D 32  ? LEU D 14  MET D 29  1 ? 16 
HELX_P HELX_P69 69 MET D 32  ? SER D 43  ? MET D 29  SER D 40  1 ? 12 
HELX_P HELX_P70 70 THR D 60  ? LEU D 73  ? THR D 57  LEU D 70  1 ? 14 
HELX_P HELX_P71 71 GLN D 88  ? ALA D 98  ? GLN D 85  ALA D 95  1 ? 11 
HELX_P HELX_P72 72 THR D 109 ? GLN D 119 ? THR D 106 GLN D 116 1 ? 11 
HELX_P HELX_P73 73 GLY D 136 ? TYR D 146 ? GLY D 133 TYR D 143 1 ? 11 
HELX_P HELX_P74 74 PRO D 147 ? ILE D 153 ? PRO D 144 ILE D 150 5 ? 7  
HELX_P HELX_P75 75 THR D 160 ? ASN D 173 ? THR D 157 ASN D 170 1 ? 14 
HELX_P HELX_P76 76 SER D 186 ? LYS D 191 ? SER D 183 LYS D 188 1 ? 6  
HELX_P HELX_P77 77 PHE D 192 ? ASP D 211 ? PHE D 189 ASP D 208 1 ? 20 
HELX_P HELX_P78 78 GLY D 225 ? PHE D 238 ? GLY D 222 PHE D 235 1 ? 14 
HELX_P HELX_P79 79 ASP D 248 ? GLU D 258 ? ASP D 245 GLU D 255 1 ? 11 
HELX_P HELX_P80 80 THR D 264 ? CYS D 269 ? THR D 261 CYS D 266 1 ? 6  
HELX_P HELX_P81 81 LEU D 286 ? GLU D 291 ? LEU D 283 GLU D 288 1 ? 6  
HELX_P HELX_P82 82 ASP D 310 ? ALA D 318 ? ASP D 307 ALA D 315 1 ? 9  
HELX_P HELX_P83 83 GLU D 344 ? ARG D 346 ? GLU D 341 ARG D 343 5 ? 3  
HELX_P HELX_P84 84 LEU D 347 ? CYS D 352 ? LEU D 344 CYS D 349 1 ? 6  
HELX_P HELX_P85 85 PRO D 357 ? HIS D 378 ? PRO D 354 HIS D 375 1 ? 22 
HELX_P HELX_P86 86 PRO D 379 ? TYR D 382 ? PRO D 376 TYR D 379 5 ? 4  
HELX_P HELX_P87 87 PRO D 390 ? GLY D 403 ? PRO D 387 GLY D 400 1 ? 14 
HELX_P HELX_P88 88 LYS D 404 ? ASN D 406 ? LYS D 401 ASN D 403 5 ? 3  
HELX_P HELX_P89 89 THR D 413 ? GLY D 421 ? THR D 410 GLY D 418 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 3 ? 
D ? 8 ? 
E ? 7 ? 
F ? 2 ? 
G ? 8 ? 
H ? 7 ? 
I ? 2 ? 
J ? 8 ? 
K ? 7 ? 
L ? 2 ? 
M ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? anti-parallel 
G 7 8 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? anti-parallel 
J 7 8 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
M 6 7 ? anti-parallel 
M 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 102 ? TYR A 103 ? VAL A 99  TYR A 100 
A 2 GLU A 76  ? SER A 80  ? GLU A 73  SER A 77  
A 3 ARG A 52  ? CYS A 56  ? ARG A 49  CYS A 53  
A 4 MET A 130 ? LEU A 132 ? MET A 127 LEU A 129 
B 1 TYR A 122 ? PHE A 123 ? TYR A 119 PHE A 120 
B 2 GLY A 126 ? PRO A 127 ? GLY A 123 PRO A 124 
C 1 ILE A 156 ? GLU A 158 ? ILE A 153 GLU A 155 
C 2 ALA A 180 ? ASN A 182 ? ALA A 177 ASN A 179 
C 3 VAL A 386 ? HIS A 387 ? VAL A 383 HIS A 384 
D 1 GLU A 261 ? VAL A 262 ? GLU A 258 VAL A 259 
D 2 ARG A 241 ? THR A 245 ? ARG A 238 THR A 242 
D 3 VAL A 218 ? ALA A 222 ? VAL A 215 ALA A 219 
D 4 ILE A 274 ? THR A 277 ? ILE A 271 THR A 274 
D 5 ALA A 297 ? ASN A 301 ? ALA A 294 ASN A 298 
D 6 ARG A 338 ? LEU A 342 ? ARG A 335 LEU A 339 
D 7 VAL A 328 ? ARG A 332 ? VAL A 325 ARG A 329 
D 8 GLU A 320 ? LYS A 325 ? GLU A 317 LYS A 322 
E 1 VAL B 102 ? TYR B 103 ? VAL B 99  TYR B 100 
E 2 GLU B 76  ? SER B 80  ? GLU B 73  SER B 77  
E 3 ARG B 52  ? CYS B 56  ? ARG B 49  CYS B 53  
E 4 MET B 130 ? ASP B 133 ? MET B 127 ASP B 130 
E 5 GLY B 155 ? SER B 157 ? GLY B 152 SER B 154 
E 6 ALA B 180 ? ILE B 181 ? ALA B 177 ILE B 178 
E 7 VAL B 386 ? HIS B 387 ? VAL B 383 HIS B 384 
F 1 TYR B 122 ? PHE B 123 ? TYR B 119 PHE B 120 
F 2 GLY B 126 ? PRO B 127 ? GLY B 123 PRO B 124 
G 1 GLU B 261 ? VAL B 262 ? GLU B 258 VAL B 259 
G 2 ARG B 241 ? THR B 245 ? ARG B 238 THR B 242 
G 3 VAL B 218 ? ALA B 222 ? VAL B 215 ALA B 219 
G 4 ILE B 274 ? THR B 277 ? ILE B 271 THR B 274 
G 5 ALA B 297 ? ASN B 301 ? ALA B 294 ASN B 298 
G 6 ARG B 338 ? LEU B 342 ? ARG B 335 LEU B 339 
G 7 VAL B 328 ? ARG B 332 ? VAL B 325 ARG B 329 
G 8 GLU B 320 ? LYS B 325 ? GLU B 317 LYS B 322 
H 1 VAL C 102 ? TYR C 103 ? VAL C 99  TYR C 100 
H 2 GLU C 76  ? SER C 80  ? GLU C 73  SER C 77  
H 3 ARG C 52  ? CYS C 56  ? ARG C 49  CYS C 53  
H 4 MET C 130 ? ASP C 133 ? MET C 127 ASP C 130 
H 5 GLY C 155 ? GLU C 158 ? GLY C 152 GLU C 155 
H 6 ALA C 180 ? ASN C 182 ? ALA C 177 ASN C 179 
H 7 VAL C 386 ? HIS C 387 ? VAL C 383 HIS C 384 
I 1 TYR C 122 ? PHE C 123 ? TYR C 119 PHE C 120 
I 2 GLY C 126 ? PRO C 127 ? GLY C 123 PRO C 124 
J 1 GLU C 261 ? VAL C 262 ? GLU C 258 VAL C 259 
J 2 ARG C 241 ? THR C 245 ? ARG C 238 THR C 242 
J 3 VAL C 218 ? ALA C 222 ? VAL C 215 ALA C 219 
J 4 ILE C 274 ? THR C 277 ? ILE C 271 THR C 274 
J 5 ALA C 297 ? ASN C 301 ? ALA C 294 ASN C 298 
J 6 ARG C 338 ? LEU C 342 ? ARG C 335 LEU C 339 
J 7 VAL C 328 ? ARG C 332 ? VAL C 325 ARG C 329 
J 8 GLU C 320 ? LYS C 325 ? GLU C 317 LYS C 322 
K 1 VAL D 102 ? TYR D 103 ? VAL D 99  TYR D 100 
K 2 GLU D 76  ? SER D 80  ? GLU D 73  SER D 77  
K 3 ARG D 52  ? CYS D 56  ? ARG D 49  CYS D 53  
K 4 MET D 130 ? ASP D 133 ? MET D 127 ASP D 130 
K 5 GLY D 155 ? GLU D 158 ? GLY D 152 GLU D 155 
K 6 ALA D 180 ? ASN D 182 ? ALA D 177 ASN D 179 
K 7 VAL D 386 ? HIS D 387 ? VAL D 383 HIS D 384 
L 1 TYR D 122 ? PHE D 123 ? TYR D 119 PHE D 120 
L 2 GLY D 126 ? PRO D 127 ? GLY D 123 PRO D 124 
M 1 GLU D 261 ? VAL D 262 ? GLU D 258 VAL D 259 
M 2 ARG D 241 ? THR D 245 ? ARG D 238 THR D 242 
M 3 VAL D 218 ? ALA D 222 ? VAL D 215 ALA D 219 
M 4 ILE D 274 ? THR D 277 ? ILE D 271 THR D 274 
M 5 ALA D 297 ? ASN D 301 ? ALA D 294 ASN D 298 
M 6 ARG D 338 ? LEU D 342 ? ARG D 335 LEU D 339 
M 7 VAL D 328 ? ARG D 332 ? VAL D 325 ARG D 329 
M 8 GLU D 320 ? LYS D 325 ? GLU D 317 LYS D 322 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 103 ? O TYR A 100 N TRP A 79  ? N TRP A 76  
A 2 3 O SER A 80  ? O SER A 77  N GLY A 55  ? N GLY A 52  
A 3 4 N CYS A 56  ? N CYS A 53  O LEU A 132 ? O LEU A 129 
B 1 2 N PHE A 123 ? N PHE A 120 O GLY A 126 ? O GLY A 123 
C 1 2 N ILE A 156 ? N ILE A 153 O ILE A 181 ? O ILE A 178 
C 2 3 N ASN A 182 ? N ASN A 179 O HIS A 387 ? O HIS A 384 
D 1 2 O GLU A 261 ? O GLU A 258 N ILE A 244 ? N ILE A 241 
D 2 3 O ILE A 243 ? O ILE A 240 N ALA A 219 ? N ALA A 216 
D 3 4 N VAL A 220 ? N VAL A 217 O ILE A 274 ? O ILE A 271 
D 4 5 N PHE A 275 ? N PHE A 272 O ILE A 298 ? O ILE A 295 
D 5 6 N VAL A 299 ? N VAL A 296 O ILE A 340 ? O ILE A 337 
D 6 7 O ILE A 339 ? O ILE A 336 N TYR A 331 ? N TYR A 328 
D 7 8 O ARG A 330 ? O ARG A 327 N VAL A 322 ? N VAL A 319 
E 1 2 O TYR B 103 ? O TYR B 100 N TRP B 79  ? N TRP B 76  
E 2 3 O GLN B 78  ? O GLN B 75  N GLY B 55  ? N GLY B 52  
E 3 4 N CYS B 56  ? N CYS B 53  O LEU B 132 ? O LEU B 129 
E 4 5 N ILE B 131 ? N ILE B 128 O SER B 157 ? O SER B 154 
E 5 6 N ILE B 156 ? N ILE B 153 O ILE B 181 ? O ILE B 178 
E 6 7 N ALA B 180 ? N ALA B 177 O HIS B 387 ? O HIS B 384 
F 1 2 N PHE B 123 ? N PHE B 120 O GLY B 126 ? O GLY B 123 
G 1 2 O GLU B 261 ? O GLU B 258 N ILE B 244 ? N ILE B 241 
G 2 3 O ARG B 241 ? O ARG B 238 N ALA B 219 ? N ALA B 216 
G 3 4 N VAL B 220 ? N VAL B 217 O ILE B 274 ? O ILE B 271 
G 4 5 N PHE B 275 ? N PHE B 272 O ILE B 298 ? O ILE B 295 
G 5 6 N VAL B 299 ? N VAL B 296 O ILE B 340 ? O ILE B 337 
G 6 7 O ILE B 339 ? O ILE B 336 N TYR B 331 ? N TYR B 328 
G 7 8 O ARG B 330 ? O ARG B 327 N VAL B 322 ? N VAL B 319 
H 1 2 O TYR C 103 ? O TYR C 100 N TRP C 79  ? N TRP C 76  
H 2 3 O GLU C 76  ? O GLU C 73  N ILE C 53  ? N ILE C 50  
H 3 4 N CYS C 56  ? N CYS C 53  O LEU C 132 ? O LEU C 129 
H 4 5 N ILE C 131 ? N ILE C 128 O SER C 157 ? O SER C 154 
H 5 6 N ILE C 156 ? N ILE C 153 O ILE C 181 ? O ILE C 178 
H 6 7 N ASN C 182 ? N ASN C 179 O HIS C 387 ? O HIS C 384 
I 1 2 N PHE C 123 ? N PHE C 120 O GLY C 126 ? O GLY C 123 
J 1 2 O GLU C 261 ? O GLU C 258 N ILE C 244 ? N ILE C 241 
J 2 3 O ILE C 243 ? O ILE C 240 N ALA C 219 ? N ALA C 216 
J 3 4 N VAL C 220 ? N VAL C 217 O ILE C 274 ? O ILE C 271 
J 4 5 N PHE C 275 ? N PHE C 272 O ILE C 298 ? O ILE C 295 
J 5 6 N VAL C 299 ? N VAL C 296 O ILE C 340 ? O ILE C 337 
J 6 7 O ILE C 339 ? O ILE C 336 N TYR C 331 ? N TYR C 328 
J 7 8 O ARG C 330 ? O ARG C 327 N VAL C 322 ? N VAL C 319 
K 1 2 O TYR D 103 ? O TYR D 100 N TRP D 79  ? N TRP D 76  
K 2 3 O GLU D 76  ? O GLU D 73  N ILE D 53  ? N ILE D 50  
K 3 4 N CYS D 56  ? N CYS D 53  O LEU D 132 ? O LEU D 129 
K 4 5 N ILE D 131 ? N ILE D 128 O GLY D 155 ? O GLY D 152 
K 5 6 N ILE D 156 ? N ILE D 153 O ILE D 181 ? O ILE D 178 
K 6 7 N ASN D 182 ? N ASN D 179 O HIS D 387 ? O HIS D 384 
L 1 2 N PHE D 123 ? N PHE D 120 O GLY D 126 ? O GLY D 123 
M 1 2 O GLU D 261 ? O GLU D 258 N ILE D 244 ? N ILE D 241 
M 2 3 O ILE D 243 ? O ILE D 240 N VAL D 221 ? N VAL D 218 
M 3 4 N ALA D 222 ? N ALA D 219 O VAL D 276 ? O VAL D 273 
M 4 5 N PHE D 275 ? N PHE D 272 O ILE D 298 ? O ILE D 295 
M 5 6 N VAL D 299 ? N VAL D 296 O ILE D 340 ? O ILE D 337 
M 6 7 O ILE D 339 ? O ILE D 336 N TYR D 331 ? N TYR D 328 
M 7 8 O ARG D 330 ? O ARG D 327 N VAL D 322 ? N VAL D 319 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 33 'BINDING SITE FOR RESIDUE NAD A 501' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE AFX A 601' 
AC3 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAD B 502' 
AC4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE AFX B 602' 
AC5 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD C 503' 
AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE AFX C 603' 
AC7 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAD D 504' 
AC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE AFX D 604' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 33 THR A 160 ? THR A 157 . ? 1_555 ? 
2   AC1 33 THR A 161 ? THR A 158 . ? 1_555 ? 
3   AC1 33 THR A 162 ? THR A 159 . ? 1_555 ? 
4   AC1 33 ASP A 193 ? ASP A 190 . ? 1_555 ? 
5   AC1 33 ASN A 194 ? ASN A 191 . ? 1_555 ? 
6   AC1 33 GLY A 223 ? GLY A 220 . ? 1_555 ? 
7   AC1 33 GLY A 225 ? GLY A 222 . ? 1_555 ? 
8   AC1 33 ASP A 226 ? ASP A 223 . ? 1_555 ? 
9   AC1 33 VAL A 227 ? VAL A 224 . ? 1_555 ? 
10  AC1 33 THR A 245 ? THR A 242 . ? 1_555 ? 
11  AC1 33 GLU A 246 ? GLU A 243 . ? 1_555 ? 
12  AC1 33 ILE A 247 ? ILE A 244 . ? 1_555 ? 
13  AC1 33 ASP A 248 ? ASP A 245 . ? 1_555 ? 
14  AC1 33 ASN A 251 ? ASN A 248 . ? 1_555 ? 
15  AC1 33 THR A 278 ? THR A 275 . ? 1_555 ? 
16  AC1 33 THR A 279 ? THR A 276 . ? 1_555 ? 
17  AC1 33 CYS A 281 ? CYS A 278 . ? 1_555 ? 
18  AC1 33 ILE A 284 ? ILE A 281 . ? 1_555 ? 
19  AC1 33 ILE A 302 ? ILE A 299 . ? 1_555 ? 
20  AC1 33 GLY A 303 ? GLY A 300 . ? 1_555 ? 
21  AC1 33 HIS A 304 ? HIS A 301 . ? 1_555 ? 
22  AC1 33 LEU A 347 ? LEU A 344 . ? 1_555 ? 
23  AC1 33 ASN A 349 ? ASN A 346 . ? 1_555 ? 
24  AC1 33 HIS A 356 ? HIS A 353 . ? 1_555 ? 
25  AC1 33 HOH M .   ? HOH A 451 . ? 1_555 ? 
26  AC1 33 HOH M .   ? HOH A 478 . ? 1_555 ? 
27  AC1 33 HOH M .   ? HOH A 486 . ? 1_555 ? 
28  AC1 33 AFX F .   ? AFX A 601 . ? 1_555 ? 
29  AC1 33 LEU B 412 ? LEU B 409 . ? 1_555 ? 
30  AC1 33 GLN B 416 ? GLN B 413 . ? 1_555 ? 
31  AC1 33 LYS B 429 ? LYS B 426 . ? 1_555 ? 
32  AC1 33 TYR B 433 ? TYR B 430 . ? 1_555 ? 
33  AC1 33 HOH N .   ? HOH B 457 . ? 1_555 ? 
34  AC2 17 HIS A 58  ? HIS A 55  . ? 1_555 ? 
35  AC2 17 THR A 60  ? THR A 57  . ? 1_555 ? 
36  AC2 17 GLU A 62  ? GLU A 59  . ? 1_555 ? 
37  AC2 17 THR A 63  ? THR A 60  . ? 1_555 ? 
38  AC2 17 ASP A 134 ? ASP A 131 . ? 1_555 ? 
39  AC2 17 GLU A 159 ? GLU A 156 . ? 1_555 ? 
40  AC2 17 THR A 160 ? THR A 157 . ? 1_555 ? 
41  AC2 17 LYS A 189 ? LYS A 186 . ? 1_555 ? 
42  AC2 17 ASP A 193 ? ASP A 190 . ? 1_555 ? 
43  AC2 17 HIS A 304 ? HIS A 301 . ? 1_555 ? 
44  AC2 17 LEU A 347 ? LEU A 344 . ? 1_555 ? 
45  AC2 17 LEU A 350 ? LEU A 347 . ? 1_555 ? 
46  AC2 17 MET A 354 ? MET A 351 . ? 1_555 ? 
47  AC2 17 GLY A 355 ? GLY A 352 . ? 1_555 ? 
48  AC2 17 HIS A 356 ? HIS A 353 . ? 1_555 ? 
49  AC2 17 MET A 361 ? MET A 358 . ? 1_555 ? 
50  AC2 17 NAD E .   ? NAD A 501 . ? 1_555 ? 
51  AC3 28 GLN A 416 ? GLN A 413 . ? 1_555 ? 
52  AC3 28 LYS A 429 ? LYS A 426 . ? 1_555 ? 
53  AC3 28 TYR A 433 ? TYR A 430 . ? 1_555 ? 
54  AC3 28 THR B 160 ? THR B 157 . ? 1_555 ? 
55  AC3 28 THR B 161 ? THR B 158 . ? 1_555 ? 
56  AC3 28 THR B 162 ? THR B 159 . ? 1_555 ? 
57  AC3 28 ASP B 193 ? ASP B 190 . ? 1_555 ? 
58  AC3 28 ASN B 194 ? ASN B 191 . ? 1_555 ? 
59  AC3 28 GLY B 223 ? GLY B 220 . ? 1_555 ? 
60  AC3 28 GLY B 225 ? GLY B 222 . ? 1_555 ? 
61  AC3 28 ASP B 226 ? ASP B 223 . ? 1_555 ? 
62  AC3 28 VAL B 227 ? VAL B 224 . ? 1_555 ? 
63  AC3 28 THR B 245 ? THR B 242 . ? 1_555 ? 
64  AC3 28 GLU B 246 ? GLU B 243 . ? 1_555 ? 
65  AC3 28 ILE B 247 ? ILE B 244 . ? 1_555 ? 
66  AC3 28 ASP B 248 ? ASP B 245 . ? 1_555 ? 
67  AC3 28 ASN B 251 ? ASN B 248 . ? 1_555 ? 
68  AC3 28 THR B 278 ? THR B 275 . ? 1_555 ? 
69  AC3 28 THR B 279 ? THR B 276 . ? 1_555 ? 
70  AC3 28 ILE B 284 ? ILE B 281 . ? 1_555 ? 
71  AC3 28 ILE B 302 ? ILE B 299 . ? 1_555 ? 
72  AC3 28 GLY B 303 ? GLY B 300 . ? 1_555 ? 
73  AC3 28 HIS B 304 ? HIS B 301 . ? 1_555 ? 
74  AC3 28 LEU B 347 ? LEU B 344 . ? 1_555 ? 
75  AC3 28 ASN B 349 ? ASN B 346 . ? 1_555 ? 
76  AC3 28 HIS B 356 ? HIS B 353 . ? 1_555 ? 
77  AC3 28 HOH N .   ? HOH B 512 . ? 1_555 ? 
78  AC3 28 AFX H .   ? AFX B 602 . ? 1_555 ? 
79  AC4 17 LEU B 57  ? LEU B 54  . ? 1_555 ? 
80  AC4 17 HIS B 58  ? HIS B 55  . ? 1_555 ? 
81  AC4 17 THR B 60  ? THR B 57  . ? 1_555 ? 
82  AC4 17 GLU B 62  ? GLU B 59  . ? 1_555 ? 
83  AC4 17 THR B 63  ? THR B 60  . ? 1_555 ? 
84  AC4 17 ASP B 134 ? ASP B 131 . ? 1_555 ? 
85  AC4 17 GLU B 159 ? GLU B 156 . ? 1_555 ? 
86  AC4 17 THR B 160 ? THR B 157 . ? 1_555 ? 
87  AC4 17 LYS B 189 ? LYS B 186 . ? 1_555 ? 
88  AC4 17 ASP B 193 ? ASP B 190 . ? 1_555 ? 
89  AC4 17 HIS B 304 ? HIS B 301 . ? 1_555 ? 
90  AC4 17 LEU B 350 ? LEU B 347 . ? 1_555 ? 
91  AC4 17 MET B 354 ? MET B 351 . ? 1_555 ? 
92  AC4 17 GLY B 355 ? GLY B 352 . ? 1_555 ? 
93  AC4 17 HIS B 356 ? HIS B 353 . ? 1_555 ? 
94  AC4 17 MET B 361 ? MET B 358 . ? 1_555 ? 
95  AC4 17 NAD G .   ? NAD B 502 . ? 1_555 ? 
96  AC5 27 THR C 160 ? THR C 157 . ? 1_555 ? 
97  AC5 27 THR C 161 ? THR C 158 . ? 1_555 ? 
98  AC5 27 THR C 162 ? THR C 159 . ? 1_555 ? 
99  AC5 27 ASP C 193 ? ASP C 190 . ? 1_555 ? 
100 AC5 27 ASN C 194 ? ASN C 191 . ? 1_555 ? 
101 AC5 27 GLY C 223 ? GLY C 220 . ? 1_555 ? 
102 AC5 27 GLY C 225 ? GLY C 222 . ? 1_555 ? 
103 AC5 27 ASP C 226 ? ASP C 223 . ? 1_555 ? 
104 AC5 27 VAL C 227 ? VAL C 224 . ? 1_555 ? 
105 AC5 27 THR C 245 ? THR C 242 . ? 1_555 ? 
106 AC5 27 GLU C 246 ? GLU C 243 . ? 1_555 ? 
107 AC5 27 ILE C 247 ? ILE C 244 . ? 1_555 ? 
108 AC5 27 ASP C 248 ? ASP C 245 . ? 1_555 ? 
109 AC5 27 ASN C 251 ? ASN C 248 . ? 1_555 ? 
110 AC5 27 THR C 278 ? THR C 275 . ? 1_555 ? 
111 AC5 27 THR C 279 ? THR C 276 . ? 1_555 ? 
112 AC5 27 ILE C 284 ? ILE C 281 . ? 1_555 ? 
113 AC5 27 ILE C 302 ? ILE C 299 . ? 1_555 ? 
114 AC5 27 GLY C 303 ? GLY C 300 . ? 1_555 ? 
115 AC5 27 HIS C 304 ? HIS C 301 . ? 1_555 ? 
116 AC5 27 LEU C 347 ? LEU C 344 . ? 1_555 ? 
117 AC5 27 ASN C 349 ? ASN C 346 . ? 1_555 ? 
118 AC5 27 HIS C 356 ? HIS C 353 . ? 1_555 ? 
119 AC5 27 AFX J .   ? AFX C 603 . ? 1_555 ? 
120 AC5 27 LEU D 412 ? LEU D 409 . ? 1_555 ? 
121 AC5 27 LYS D 429 ? LYS D 426 . ? 1_555 ? 
122 AC5 27 TYR D 433 ? TYR D 430 . ? 1_555 ? 
123 AC6 15 HIS C 58  ? HIS C 55  . ? 1_555 ? 
124 AC6 15 THR C 60  ? THR C 57  . ? 1_555 ? 
125 AC6 15 GLU C 62  ? GLU C 59  . ? 1_555 ? 
126 AC6 15 ASP C 134 ? ASP C 131 . ? 1_555 ? 
127 AC6 15 GLU C 159 ? GLU C 156 . ? 1_555 ? 
128 AC6 15 THR C 160 ? THR C 157 . ? 1_555 ? 
129 AC6 15 LYS C 189 ? LYS C 186 . ? 1_555 ? 
130 AC6 15 ASP C 193 ? ASP C 190 . ? 1_555 ? 
131 AC6 15 HIS C 304 ? HIS C 301 . ? 1_555 ? 
132 AC6 15 LEU C 350 ? LEU C 347 . ? 1_555 ? 
133 AC6 15 MET C 354 ? MET C 351 . ? 1_555 ? 
134 AC6 15 GLY C 355 ? GLY C 352 . ? 1_555 ? 
135 AC6 15 HIS C 356 ? HIS C 353 . ? 1_555 ? 
136 AC6 15 MET C 361 ? MET C 358 . ? 1_555 ? 
137 AC6 15 NAD I .   ? NAD C 503 . ? 1_555 ? 
138 AC7 28 GLN C 416 ? GLN C 413 . ? 1_555 ? 
139 AC7 28 LYS C 429 ? LYS C 426 . ? 1_555 ? 
140 AC7 28 TYR C 433 ? TYR C 430 . ? 1_555 ? 
141 AC7 28 THR D 160 ? THR D 157 . ? 1_555 ? 
142 AC7 28 THR D 161 ? THR D 158 . ? 1_555 ? 
143 AC7 28 THR D 162 ? THR D 159 . ? 1_555 ? 
144 AC7 28 ASP D 193 ? ASP D 190 . ? 1_555 ? 
145 AC7 28 ASN D 194 ? ASN D 191 . ? 1_555 ? 
146 AC7 28 GLY D 223 ? GLY D 220 . ? 1_555 ? 
147 AC7 28 GLY D 225 ? GLY D 222 . ? 1_555 ? 
148 AC7 28 ASP D 226 ? ASP D 223 . ? 1_555 ? 
149 AC7 28 VAL D 227 ? VAL D 224 . ? 1_555 ? 
150 AC7 28 THR D 245 ? THR D 242 . ? 1_555 ? 
151 AC7 28 GLU D 246 ? GLU D 243 . ? 1_555 ? 
152 AC7 28 ILE D 247 ? ILE D 244 . ? 1_555 ? 
153 AC7 28 ASP D 248 ? ASP D 245 . ? 1_555 ? 
154 AC7 28 ASN D 251 ? ASN D 248 . ? 1_555 ? 
155 AC7 28 THR D 278 ? THR D 275 . ? 1_555 ? 
156 AC7 28 THR D 279 ? THR D 276 . ? 1_555 ? 
157 AC7 28 ILE D 284 ? ILE D 281 . ? 1_555 ? 
158 AC7 28 ILE D 302 ? ILE D 299 . ? 1_555 ? 
159 AC7 28 HIS D 304 ? HIS D 301 . ? 1_555 ? 
160 AC7 28 LEU D 347 ? LEU D 344 . ? 1_555 ? 
161 AC7 28 ASN D 349 ? ASN D 346 . ? 1_555 ? 
162 AC7 28 HIS D 356 ? HIS D 353 . ? 1_555 ? 
163 AC7 28 HOH P .   ? HOH D 442 . ? 1_555 ? 
164 AC7 28 HOH P .   ? HOH D 454 . ? 1_555 ? 
165 AC7 28 AFX L .   ? AFX D 604 . ? 1_555 ? 
166 AC8 16 HIS D 58  ? HIS D 55  . ? 1_555 ? 
167 AC8 16 THR D 60  ? THR D 57  . ? 1_555 ? 
168 AC8 16 GLU D 62  ? GLU D 59  . ? 1_555 ? 
169 AC8 16 THR D 63  ? THR D 60  . ? 1_555 ? 
170 AC8 16 ASP D 134 ? ASP D 131 . ? 1_555 ? 
171 AC8 16 GLU D 159 ? GLU D 156 . ? 1_555 ? 
172 AC8 16 THR D 160 ? THR D 157 . ? 1_555 ? 
173 AC8 16 LYS D 189 ? LYS D 186 . ? 1_555 ? 
174 AC8 16 ASP D 193 ? ASP D 190 . ? 1_555 ? 
175 AC8 16 HIS D 304 ? HIS D 301 . ? 1_555 ? 
176 AC8 16 LEU D 350 ? LEU D 347 . ? 1_555 ? 
177 AC8 16 MET D 354 ? MET D 351 . ? 1_555 ? 
178 AC8 16 GLY D 355 ? GLY D 352 . ? 1_555 ? 
179 AC8 16 HIS D 356 ? HIS D 353 . ? 1_555 ? 
180 AC8 16 MET D 361 ? MET D 358 . ? 1_555 ? 
181 AC8 16 NAD K .   ? NAD D 504 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3NJ4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3NJ4 
_atom_sites.fract_transf_matrix[1][1]   0.010965 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003354 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012204 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008069 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . SER A 1 5   ? 36.309  49.057  131.434 1.00 83.76 ? 2   SER A N     1 
ATOM   2     C CA    . SER A 1 5   ? 35.796  48.039  130.469 1.00 83.74 ? 2   SER A CA    1 
ATOM   3     C C     . SER A 1 5   ? 34.316  48.233  130.157 1.00 83.39 ? 2   SER A C     1 
ATOM   4     O O     . SER A 1 5   ? 33.484  48.362  131.060 1.00 83.96 ? 2   SER A O     1 
ATOM   5     C CB    . SER A 1 5   ? 36.007  46.629  131.025 1.00 84.01 ? 2   SER A CB    1 
ATOM   6     O OG    . SER A 1 5   ? 35.457  45.653  130.153 1.00 84.30 ? 2   SER A OG    1 
ATOM   7     N N     . ASP A 1 6   ? 33.990  48.249  128.871 1.00 82.15 ? 3   ASP A N     1 
ATOM   8     C CA    . ASP A 1 6   ? 32.610  48.412  128.444 1.00 80.83 ? 3   ASP A CA    1 
ATOM   9     C C     . ASP A 1 6   ? 32.183  47.218  127.594 1.00 78.77 ? 3   ASP A C     1 
ATOM   10    O O     . ASP A 1 6   ? 31.045  47.159  127.125 1.00 79.02 ? 3   ASP A O     1 
ATOM   11    C CB    . ASP A 1 6   ? 32.450  49.711  127.643 1.00 82.31 ? 3   ASP A CB    1 
ATOM   12    C CG    . ASP A 1 6   ? 32.523  50.954  128.517 1.00 82.44 ? 3   ASP A CG    1 
ATOM   13    O OD1   . ASP A 1 6   ? 31.686  51.088  129.436 1.00 82.22 ? 3   ASP A OD1   1 
ATOM   14    O OD2   . ASP A 1 6   ? 33.413  51.797  128.281 1.00 82.94 ? 3   ASP A OD2   1 
ATOM   15    N N     . LYS A 1 7   ? 33.095  46.266  127.408 1.00 75.35 ? 4   LYS A N     1 
ATOM   16    C CA    . LYS A 1 7   ? 32.809  45.081  126.607 1.00 71.12 ? 4   LYS A CA    1 
ATOM   17    C C     . LYS A 1 7   ? 31.513  44.408  127.039 1.00 68.99 ? 4   LYS A C     1 
ATOM   18    O O     . LYS A 1 7   ? 31.448  43.773  128.094 1.00 68.97 ? 4   LYS A O     1 
ATOM   19    C CB    . LYS A 1 7   ? 33.965  44.086  126.699 1.00 70.86 ? 4   LYS A CB    1 
ATOM   20    C CG    . LYS A 1 7   ? 33.852  42.904  125.737 1.00 70.57 ? 4   LYS A CG    1 
ATOM   21    C CD    . LYS A 1 7   ? 35.186  42.182  125.602 1.00 69.30 ? 4   LYS A CD    1 
ATOM   22    C CE    . LYS A 1 7   ? 35.129  41.074  124.570 1.00 69.01 ? 4   LYS A CE    1 
ATOM   23    N NZ    . LYS A 1 7   ? 36.462  40.422  124.385 1.00 69.17 ? 4   LYS A NZ    1 
ATOM   24    N N     . LEU A 1 8   ? 30.480  44.561  126.215 1.00 65.76 ? 5   LEU A N     1 
ATOM   25    C CA    . LEU A 1 8   ? 29.174  43.972  126.481 1.00 62.99 ? 5   LEU A CA    1 
ATOM   26    C C     . LEU A 1 8   ? 29.307  42.458  126.621 1.00 61.30 ? 5   LEU A C     1 
ATOM   27    O O     . LEU A 1 8   ? 30.070  41.827  125.897 1.00 61.54 ? 5   LEU A O     1 
ATOM   28    C CB    . LEU A 1 8   ? 28.207  44.297  125.337 1.00 62.74 ? 5   LEU A CB    1 
ATOM   29    C CG    . LEU A 1 8   ? 27.772  45.748  125.100 1.00 62.50 ? 5   LEU A CG    1 
ATOM   30    C CD1   . LEU A 1 8   ? 27.002  45.845  123.789 1.00 61.22 ? 5   LEU A CD1   1 
ATOM   31    C CD2   . LEU A 1 8   ? 26.909  46.227  126.267 1.00 63.09 ? 5   LEU A CD2   1 
ATOM   32    N N     . PRO A 1 9   ? 28.557  41.855  127.558 1.00 60.04 ? 6   PRO A N     1 
ATOM   33    C CA    . PRO A 1 9   ? 28.601  40.406  127.783 1.00 58.34 ? 6   PRO A CA    1 
ATOM   34    C C     . PRO A 1 9   ? 27.977  39.612  126.640 1.00 57.48 ? 6   PRO A C     1 
ATOM   35    O O     . PRO A 1 9   ? 28.070  38.381  126.594 1.00 58.61 ? 6   PRO A O     1 
ATOM   36    C CB    . PRO A 1 9   ? 27.823  40.244  129.081 1.00 57.88 ? 6   PRO A CB    1 
ATOM   37    C CG    . PRO A 1 9   ? 26.790  41.325  128.979 1.00 58.01 ? 6   PRO A CG    1 
ATOM   38    C CD    . PRO A 1 9   ? 27.598  42.499  128.476 1.00 59.13 ? 6   PRO A CD    1 
ATOM   39    N N     . TYR A 1 10  ? 27.339  40.328  125.722 1.00 55.25 ? 7   TYR A N     1 
ATOM   40    C CA    . TYR A 1 10  ? 26.673  39.712  124.587 1.00 52.30 ? 7   TYR A CA    1 
ATOM   41    C C     . TYR A 1 10  ? 26.005  40.796  123.755 1.00 51.49 ? 7   TYR A C     1 
ATOM   42    O O     . TYR A 1 10  ? 25.873  41.938  124.193 1.00 51.37 ? 7   TYR A O     1 
ATOM   43    C CB    . TYR A 1 10  ? 25.628  38.698  125.074 1.00 51.02 ? 7   TYR A CB    1 
ATOM   44    C CG    . TYR A 1 10  ? 24.419  39.301  125.768 1.00 50.46 ? 7   TYR A CG    1 
ATOM   45    C CD1   . TYR A 1 10  ? 23.388  39.893  125.033 1.00 50.34 ? 7   TYR A CD1   1 
ATOM   46    C CD2   . TYR A 1 10  ? 24.297  39.269  127.160 1.00 50.48 ? 7   TYR A CD2   1 
ATOM   47    C CE1   . TYR A 1 10  ? 22.265  40.437  125.662 1.00 50.02 ? 7   TYR A CE1   1 
ATOM   48    C CE2   . TYR A 1 10  ? 23.174  39.813  127.805 1.00 50.63 ? 7   TYR A CE2   1 
ATOM   49    C CZ    . TYR A 1 10  ? 22.162  40.395  127.047 1.00 51.01 ? 7   TYR A CZ    1 
ATOM   50    O OH    . TYR A 1 10  ? 21.057  40.941  127.668 1.00 50.78 ? 7   TYR A OH    1 
ATOM   51    N N     . LYS A 1 11  ? 25.568  40.425  122.559 1.00 49.99 ? 8   LYS A N     1 
ATOM   52    C CA    . LYS A 1 11  ? 24.930  41.371  121.656 1.00 48.76 ? 8   LYS A CA    1 
ATOM   53    C C     . LYS A 1 11  ? 24.015  40.612  120.695 1.00 47.82 ? 8   LYS A C     1 
ATOM   54    O O     . LYS A 1 11  ? 24.476  39.951  119.760 1.00 47.29 ? 8   LYS A O     1 
ATOM   55    C CB    . LYS A 1 11  ? 26.008  42.129  120.876 1.00 48.31 ? 8   LYS A CB    1 
ATOM   56    C CG    . LYS A 1 11  ? 25.750  43.613  120.687 1.00 48.59 ? 8   LYS A CG    1 
ATOM   57    C CD    . LYS A 1 11  ? 24.522  43.884  119.852 1.00 48.59 ? 8   LYS A CD    1 
ATOM   58    C CE    . LYS A 1 11  ? 24.197  45.379  119.797 1.00 49.57 ? 8   LYS A CE    1 
ATOM   59    N NZ    . LYS A 1 11  ? 25.292  46.211  119.212 1.00 50.83 ? 8   LYS A NZ    1 
ATOM   60    N N     . VAL A 1 12  ? 22.714  40.702  120.927 1.00 46.72 ? 9   VAL A N     1 
ATOM   61    C CA    . VAL A 1 12  ? 21.764  40.015  120.074 1.00 46.42 ? 9   VAL A CA    1 
ATOM   62    C C     . VAL A 1 12  ? 20.651  40.935  119.616 1.00 46.39 ? 9   VAL A C     1 
ATOM   63    O O     . VAL A 1 12  ? 20.514  42.053  120.104 1.00 46.49 ? 9   VAL A O     1 
ATOM   64    C CB    . VAL A 1 12  ? 21.150  38.818  120.796 1.00 46.49 ? 9   VAL A CB    1 
ATOM   65    C CG1   . VAL A 1 12  ? 22.222  37.754  121.024 1.00 45.98 ? 9   VAL A CG1   1 
ATOM   66    C CG2   . VAL A 1 12  ? 20.543  39.274  122.115 1.00 46.49 ? 9   VAL A CG2   1 
ATOM   67    N N     . ALA A 1 13  ? 19.858  40.452  118.669 1.00 46.02 ? 10  ALA A N     1 
ATOM   68    C CA    . ALA A 1 13  ? 18.754  41.229  118.128 1.00 45.35 ? 10  ALA A CA    1 
ATOM   69    C C     . ALA A 1 13  ? 17.694  41.524  119.179 1.00 44.64 ? 10  ALA A C     1 
ATOM   70    O O     . ALA A 1 13  ? 17.201  42.643  119.272 1.00 43.70 ? 10  ALA A O     1 
ATOM   71    C CB    . ALA A 1 13  ? 18.129  40.485  116.959 1.00 44.29 ? 10  ALA A CB    1 
ATOM   72    N N     . ASP A 1 14  ? 17.345  40.502  119.956 1.00 45.23 ? 11  ASP A N     1 
ATOM   73    C CA    . ASP A 1 14  ? 16.329  40.612  121.001 1.00 44.74 ? 11  ASP A CA    1 
ATOM   74    C C     . ASP A 1 14  ? 16.367  39.417  121.961 1.00 44.09 ? 11  ASP A C     1 
ATOM   75    O O     . ASP A 1 14  ? 15.800  38.356  121.680 1.00 42.52 ? 11  ASP A O     1 
ATOM   76    C CB    . ASP A 1 14  ? 14.933  40.721  120.370 1.00 44.82 ? 11  ASP A CB    1 
ATOM   77    C CG    . ASP A 1 14  ? 13.825  40.784  121.411 1.00 45.59 ? 11  ASP A CG    1 
ATOM   78    O OD1   . ASP A 1 14  ? 14.075  41.321  122.509 1.00 47.20 ? 11  ASP A OD1   1 
ATOM   79    O OD2   . ASP A 1 14  ? 12.704  40.308  121.133 1.00 44.82 ? 11  ASP A OD2   1 
ATOM   80    N N     . ILE A 1 15  ? 17.042  39.611  123.093 1.00 43.72 ? 12  ILE A N     1 
ATOM   81    C CA    . ILE A 1 15  ? 17.173  38.591  124.126 1.00 43.01 ? 12  ILE A CA    1 
ATOM   82    C C     . ILE A 1 15  ? 15.793  38.156  124.604 1.00 42.18 ? 12  ILE A C     1 
ATOM   83    O O     . ILE A 1 15  ? 15.651  37.145  125.279 1.00 41.11 ? 12  ILE A O     1 
ATOM   84    C CB    . ILE A 1 15  ? 17.968  39.128  125.342 1.00 45.16 ? 12  ILE A CB    1 
ATOM   85    C CG1   . ILE A 1 15  ? 18.113  38.043  126.406 1.00 46.34 ? 12  ILE A CG1   1 
ATOM   86    C CG2   . ILE A 1 15  ? 17.238  40.302  125.969 1.00 46.82 ? 12  ILE A CG2   1 
ATOM   87    C CD1   . ILE A 1 15  ? 18.838  36.819  125.926 1.00 46.06 ? 12  ILE A CD1   1 
ATOM   88    N N     . GLY A 1 16  ? 14.775  38.931  124.252 1.00 42.09 ? 13  GLY A N     1 
ATOM   89    C CA    . GLY A 1 16  ? 13.426  38.592  124.657 1.00 42.57 ? 13  GLY A CA    1 
ATOM   90    C C     . GLY A 1 16  ? 12.896  37.454  123.816 1.00 43.82 ? 13  GLY A C     1 
ATOM   91    O O     . GLY A 1 16  ? 11.768  36.995  123.992 1.00 44.96 ? 13  GLY A O     1 
ATOM   92    N N     . LEU A 1 17  ? 13.727  36.998  122.888 1.00 44.49 ? 14  LEU A N     1 
ATOM   93    C CA    . LEU A 1 17  ? 13.371  35.910  121.994 1.00 44.41 ? 14  LEU A CA    1 
ATOM   94    C C     . LEU A 1 17  ? 13.833  34.583  122.582 1.00 45.32 ? 14  LEU A C     1 
ATOM   95    O O     . LEU A 1 17  ? 13.478  33.517  122.092 1.00 47.25 ? 14  LEU A O     1 
ATOM   96    C CB    . LEU A 1 17  ? 14.027  36.141  120.633 1.00 42.98 ? 14  LEU A CB    1 
ATOM   97    C CG    . LEU A 1 17  ? 13.155  36.529  119.436 1.00 41.29 ? 14  LEU A CG    1 
ATOM   98    C CD1   . LEU A 1 17  ? 12.155  37.602  119.796 1.00 41.46 ? 14  LEU A CD1   1 
ATOM   99    C CD2   . LEU A 1 17  ? 14.063  37.007  118.328 1.00 40.11 ? 14  LEU A CD2   1 
ATOM   100   N N     . ALA A 1 18  ? 14.623  34.658  123.644 1.00 46.80 ? 15  ALA A N     1 
ATOM   101   C CA    . ALA A 1 18  ? 15.153  33.478  124.310 1.00 47.48 ? 15  ALA A CA    1 
ATOM   102   C C     . ALA A 1 18  ? 14.083  32.451  124.657 1.00 48.52 ? 15  ALA A C     1 
ATOM   103   O O     . ALA A 1 18  ? 14.318  31.251  124.546 1.00 48.84 ? 15  ALA A O     1 
ATOM   104   C CB    . ALA A 1 18  ? 15.902  33.891  125.572 1.00 46.99 ? 15  ALA A CB    1 
ATOM   105   N N     . ALA A 1 19  ? 12.911  32.910  125.079 1.00 49.30 ? 16  ALA A N     1 
ATOM   106   C CA    . ALA A 1 19  ? 11.851  31.977  125.440 1.00 50.11 ? 16  ALA A CA    1 
ATOM   107   C C     . ALA A 1 19  ? 11.525  31.021  124.292 1.00 50.26 ? 16  ALA A C     1 
ATOM   108   O O     . ALA A 1 19  ? 11.392  29.812  124.496 1.00 50.24 ? 16  ALA A O     1 
ATOM   109   C CB    . ALA A 1 19  ? 10.605  32.737  125.856 1.00 51.10 ? 16  ALA A CB    1 
ATOM   110   N N     . TRP A 1 20  ? 11.400  31.573  123.087 1.00 50.49 ? 17  TRP A N     1 
ATOM   111   C CA    . TRP A 1 20  ? 11.088  30.792  121.891 1.00 49.71 ? 17  TRP A CA    1 
ATOM   112   C C     . TRP A 1 20  ? 12.299  29.997  121.422 1.00 48.31 ? 17  TRP A C     1 
ATOM   113   O O     . TRP A 1 20  ? 12.169  28.862  120.968 1.00 47.65 ? 17  TRP A O     1 
ATOM   114   C CB    . TRP A 1 20  ? 10.600  31.726  120.786 1.00 51.03 ? 17  TRP A CB    1 
ATOM   115   C CG    . TRP A 1 20  ? 10.406  31.083  119.443 1.00 53.21 ? 17  TRP A CG    1 
ATOM   116   C CD1   . TRP A 1 20  ? 9.951   29.819  119.187 1.00 53.52 ? 17  TRP A CD1   1 
ATOM   117   C CD2   . TRP A 1 20  ? 10.559  31.721  118.164 1.00 53.95 ? 17  TRP A CD2   1 
ATOM   118   N NE1   . TRP A 1 20  ? 9.806   29.634  117.833 1.00 53.79 ? 17  TRP A NE1   1 
ATOM   119   C CE2   . TRP A 1 20  ? 10.171  30.785  117.183 1.00 53.72 ? 17  TRP A CE2   1 
ATOM   120   C CE3   . TRP A 1 20  ? 10.981  32.998  117.755 1.00 53.10 ? 17  TRP A CE3   1 
ATOM   121   C CZ2   . TRP A 1 20  ? 10.191  31.084  115.820 1.00 53.22 ? 17  TRP A CZ2   1 
ATOM   122   C CZ3   . TRP A 1 20  ? 11.001  33.294  116.399 1.00 51.39 ? 17  TRP A CZ3   1 
ATOM   123   C CH2   . TRP A 1 20  ? 10.609  32.344  115.451 1.00 52.87 ? 17  TRP A CH2   1 
ATOM   124   N N     . GLY A 1 21  ? 13.476  30.599  121.528 1.00 46.50 ? 18  GLY A N     1 
ATOM   125   C CA    . GLY A 1 21  ? 14.675  29.899  121.129 1.00 44.44 ? 18  GLY A CA    1 
ATOM   126   C C     . GLY A 1 21  ? 14.844  28.638  121.962 1.00 43.80 ? 18  GLY A C     1 
ATOM   127   O O     . GLY A 1 21  ? 15.158  27.576  121.418 1.00 44.13 ? 18  GLY A O     1 
ATOM   128   N N     . ARG A 1 22  ? 14.622  28.742  123.277 1.00 41.57 ? 19  ARG A N     1 
ATOM   129   C CA    . ARG A 1 22  ? 14.769  27.591  124.168 1.00 37.90 ? 19  ARG A CA    1 
ATOM   130   C C     . ARG A 1 22  ? 13.842  26.456  123.751 1.00 38.06 ? 19  ARG A C     1 
ATOM   131   O O     . ARG A 1 22  ? 14.221  25.283  123.828 1.00 35.82 ? 19  ARG A O     1 
ATOM   132   C CB    . ARG A 1 22  ? 14.508  27.980  125.629 1.00 34.94 ? 19  ARG A CB    1 
ATOM   133   C CG    . ARG A 1 22  ? 14.615  26.818  126.656 1.00 31.25 ? 19  ARG A CG    1 
ATOM   134   C CD    . ARG A 1 22  ? 15.953  26.068  126.601 1.00 28.72 ? 19  ARG A CD    1 
ATOM   135   N NE    . ARG A 1 22  ? 17.095  26.975  126.666 1.00 28.24 ? 19  ARG A NE    1 
ATOM   136   C CZ    . ARG A 1 22  ? 18.376  26.605  126.604 1.00 30.20 ? 19  ARG A CZ    1 
ATOM   137   N NH1   . ARG A 1 22  ? 18.707  25.324  126.477 1.00 27.05 ? 19  ARG A NH1   1 
ATOM   138   N NH2   . ARG A 1 22  ? 19.334  27.533  126.656 1.00 27.46 ? 19  ARG A NH2   1 
ATOM   139   N N     . LYS A 1 23  ? 12.627  26.797  123.319 1.00 37.96 ? 20  LYS A N     1 
ATOM   140   C CA    . LYS A 1 23  ? 11.687  25.769  122.871 1.00 37.94 ? 20  LYS A CA    1 
ATOM   141   C C     . LYS A 1 23  ? 12.308  25.073  121.666 1.00 38.33 ? 20  LYS A C     1 
ATOM   142   O O     . LYS A 1 23  ? 12.392  23.845  121.618 1.00 38.48 ? 20  LYS A O     1 
ATOM   143   C CB    . LYS A 1 23  ? 10.344  26.364  122.447 1.00 37.39 ? 20  LYS A CB    1 
ATOM   144   C CG    . LYS A 1 23  ? 9.550   27.048  123.540 1.00 38.53 ? 20  LYS A CG    1 
ATOM   145   C CD    . LYS A 1 23  ? 8.068   27.091  123.162 1.00 37.51 ? 20  LYS A CD    1 
ATOM   146   C CE    . LYS A 1 23  ? 7.288   28.046  124.048 1.00 37.94 ? 20  LYS A CE    1 
ATOM   147   N NZ    . LYS A 1 23  ? 7.704   29.455  123.810 1.00 35.78 ? 20  LYS A NZ    1 
ATOM   148   N N     . ALA A 1 24  ? 12.747  25.870  120.698 1.00 37.19 ? 21  ALA A N     1 
ATOM   149   C CA    . ALA A 1 24  ? 13.358  25.335  119.496 1.00 38.49 ? 21  ALA A CA    1 
ATOM   150   C C     . ALA A 1 24  ? 14.499  24.390  119.850 1.00 39.57 ? 21  ALA A C     1 
ATOM   151   O O     . ALA A 1 24  ? 14.649  23.330  119.228 1.00 40.19 ? 21  ALA A O     1 
ATOM   152   C CB    . ALA A 1 24  ? 13.869  26.468  118.614 1.00 38.25 ? 21  ALA A CB    1 
ATOM   153   N N     . LEU A 1 25  ? 15.294  24.772  120.850 1.00 39.88 ? 22  LEU A N     1 
ATOM   154   C CA    . LEU A 1 25  ? 16.416  23.948  121.289 1.00 40.21 ? 22  LEU A CA    1 
ATOM   155   C C     . LEU A 1 25  ? 15.932  22.655  121.913 1.00 40.05 ? 22  LEU A C     1 
ATOM   156   O O     . LEU A 1 25  ? 16.591  21.623  121.810 1.00 40.41 ? 22  LEU A O     1 
ATOM   157   C CB    . LEU A 1 25  ? 17.273  24.679  122.313 1.00 41.62 ? 22  LEU A CB    1 
ATOM   158   C CG    . LEU A 1 25  ? 17.932  25.969  121.856 1.00 42.87 ? 22  LEU A CG    1 
ATOM   159   C CD1   . LEU A 1 25  ? 18.882  26.468  122.948 1.00 43.08 ? 22  LEU A CD1   1 
ATOM   160   C CD2   . LEU A 1 25  ? 18.681  25.724  120.572 1.00 43.88 ? 22  LEU A CD2   1 
ATOM   161   N N     . ASP A 1 26  ? 14.790  22.712  122.587 1.00 40.31 ? 23  ASP A N     1 
ATOM   162   C CA    . ASP A 1 26  ? 14.255  21.504  123.197 1.00 40.55 ? 23  ASP A CA    1 
ATOM   163   C C     . ASP A 1 26  ? 14.103  20.462  122.089 1.00 39.66 ? 23  ASP A C     1 
ATOM   164   O O     . ASP A 1 26  ? 14.726  19.398  122.137 1.00 37.90 ? 23  ASP A O     1 
ATOM   165   C CB    . ASP A 1 26  ? 12.896  21.775  123.858 1.00 40.20 ? 23  ASP A CB    1 
ATOM   166   C CG    . ASP A 1 26  ? 13.002  22.698  125.067 1.00 41.48 ? 23  ASP A CG    1 
ATOM   167   O OD1   . ASP A 1 26  ? 13.966  22.541  125.846 1.00 43.66 ? 23  ASP A OD1   1 
ATOM   168   O OD2   . ASP A 1 26  ? 12.117  23.569  125.246 1.00 39.25 ? 23  ASP A OD2   1 
ATOM   169   N N     . ILE A 1 27  ? 13.304  20.812  121.081 1.00 39.39 ? 24  ILE A N     1 
ATOM   170   C CA    . ILE A 1 27  ? 13.024  19.944  119.939 1.00 39.45 ? 24  ILE A CA    1 
ATOM   171   C C     . ILE A 1 27  ? 14.285  19.518  119.192 1.00 38.96 ? 24  ILE A C     1 
ATOM   172   O O     . ILE A 1 27  ? 14.394  18.378  118.725 1.00 38.05 ? 24  ILE A O     1 
ATOM   173   C CB    . ILE A 1 27  ? 12.079  20.646  118.939 1.00 38.25 ? 24  ILE A CB    1 
ATOM   174   C CG1   . ILE A 1 27  ? 10.856  21.193  119.680 1.00 38.60 ? 24  ILE A CG1   1 
ATOM   175   C CG2   . ILE A 1 27  ? 11.620  19.662  117.878 1.00 37.91 ? 24  ILE A CG2   1 
ATOM   176   C CD1   . ILE A 1 27  ? 9.989   22.130  118.854 1.00 35.76 ? 24  ILE A CD1   1 
ATOM   177   N N     . ALA A 1 28  ? 15.225  20.450  119.081 1.00 37.65 ? 25  ALA A N     1 
ATOM   178   C CA    . ALA A 1 28  ? 16.477  20.199  118.398 1.00 37.61 ? 25  ALA A CA    1 
ATOM   179   C C     . ALA A 1 28  ? 17.303  19.126  119.111 1.00 38.49 ? 25  ALA A C     1 
ATOM   180   O O     . ALA A 1 28  ? 17.790  18.185  118.479 1.00 39.19 ? 25  ALA A O     1 
ATOM   181   C CB    . ALA A 1 28  ? 17.264  21.483  118.296 1.00 35.51 ? 25  ALA A CB    1 
ATOM   182   N N     . GLU A 1 29  ? 17.461  19.266  120.423 1.00 38.87 ? 26  GLU A N     1 
ATOM   183   C CA    . GLU A 1 29  ? 18.234  18.298  121.190 1.00 39.47 ? 26  GLU A CA    1 
ATOM   184   C C     . GLU A 1 29  ? 17.686  16.881  121.022 1.00 38.21 ? 26  GLU A C     1 
ATOM   185   O O     . GLU A 1 29  ? 18.441  15.906  121.067 1.00 38.06 ? 26  GLU A O     1 
ATOM   186   C CB    . GLU A 1 29  ? 18.264  18.692  122.677 1.00 40.11 ? 26  GLU A CB    1 
ATOM   187   C CG    . GLU A 1 29  ? 18.942  20.040  122.929 1.00 43.32 ? 26  GLU A CG    1 
ATOM   188   C CD    . GLU A 1 29  ? 18.890  20.478  124.387 1.00 43.93 ? 26  GLU A CD    1 
ATOM   189   O OE1   . GLU A 1 29  ? 17.804  20.393  124.999 1.00 42.55 ? 26  GLU A OE1   1 
ATOM   190   O OE2   . GLU A 1 29  ? 19.940  20.918  124.911 1.00 44.47 ? 26  GLU A OE2   1 
ATOM   191   N N     . ASN A 1 30  ? 16.379  16.772  120.802 1.00 35.62 ? 27  ASN A N     1 
ATOM   192   C CA    . ASN A 1 30  ? 15.745  15.467  120.635 1.00 34.78 ? 27  ASN A CA    1 
ATOM   193   C C     . ASN A 1 30  ? 15.914  14.912  119.210 1.00 35.62 ? 27  ASN A C     1 
ATOM   194   O O     . ASN A 1 30  ? 15.444  13.810  118.894 1.00 34.99 ? 27  ASN A O     1 
ATOM   195   C CB    . ASN A 1 30  ? 14.259  15.570  120.970 1.00 31.77 ? 27  ASN A CB    1 
ATOM   196   C CG    . ASN A 1 30  ? 13.666  14.245  121.384 1.00 32.45 ? 27  ASN A CG    1 
ATOM   197   O OD1   . ASN A 1 30  ? 12.474  14.002  121.196 1.00 33.38 ? 27  ASN A OD1   1 
ATOM   198   N ND2   . ASN A 1 30  ? 14.490  13.381  121.967 1.00 32.54 ? 27  ASN A ND2   1 
ATOM   199   N N     . GLU A 1 31  ? 16.584  15.690  118.360 1.00 35.44 ? 28  GLU A N     1 
ATOM   200   C CA    . GLU A 1 31  ? 16.825  15.324  116.966 1.00 34.61 ? 28  GLU A CA    1 
ATOM   201   C C     . GLU A 1 31  ? 18.313  15.208  116.659 1.00 35.73 ? 28  GLU A C     1 
ATOM   202   O O     . GLU A 1 31  ? 18.702  14.951  115.511 1.00 34.25 ? 28  GLU A O     1 
ATOM   203   C CB    . GLU A 1 31  ? 16.193  16.372  116.042 1.00 33.96 ? 28  GLU A CB    1 
ATOM   204   C CG    . GLU A 1 31  ? 14.713  16.158  115.815 1.00 30.56 ? 28  GLU A CG    1 
ATOM   205   C CD    . GLU A 1 31  ? 14.469  15.033  114.846 1.00 28.72 ? 28  GLU A CD    1 
ATOM   206   O OE1   . GLU A 1 31  ? 14.689  15.244  113.641 1.00 30.62 ? 28  GLU A OE1   1 
ATOM   207   O OE2   . GLU A 1 31  ? 14.073  13.935  115.285 1.00 27.19 ? 28  GLU A OE2   1 
ATOM   208   N N     . MET A 1 32  ? 19.133  15.412  117.690 1.00 35.61 ? 29  MET A N     1 
ATOM   209   C CA    . MET A 1 32  ? 20.585  15.339  117.570 1.00 37.46 ? 29  MET A CA    1 
ATOM   210   C C     . MET A 1 32  ? 21.184  14.336  118.568 1.00 38.92 ? 29  MET A C     1 
ATOM   211   O O     . MET A 1 32  ? 21.872  14.718  119.515 1.00 40.01 ? 29  MET A O     1 
ATOM   212   C CB    . MET A 1 32  ? 21.188  16.733  117.787 1.00 37.19 ? 29  MET A CB    1 
ATOM   213   C CG    . MET A 1 32  ? 20.823  17.728  116.694 1.00 36.13 ? 29  MET A CG    1 
ATOM   214   S SD    . MET A 1 32  ? 21.643  19.326  116.847 1.00 34.77 ? 29  MET A SD    1 
ATOM   215   C CE    . MET A 1 32  ? 20.353  20.203  117.593 1.00 32.48 ? 29  MET A CE    1 
ATOM   216   N N     . PRO A 1 33  ? 20.934  13.034  118.360 1.00 38.74 ? 30  PRO A N     1 
ATOM   217   C CA    . PRO A 1 33  ? 21.447  11.988  119.246 1.00 38.78 ? 30  PRO A CA    1 
ATOM   218   C C     . PRO A 1 33  ? 22.949  12.067  119.472 1.00 39.29 ? 30  PRO A C     1 
ATOM   219   O O     . PRO A 1 33  ? 23.422  11.947  120.599 1.00 38.94 ? 30  PRO A O     1 
ATOM   220   C CB    . PRO A 1 33  ? 21.046  10.704  118.525 1.00 39.04 ? 30  PRO A CB    1 
ATOM   221   C CG    . PRO A 1 33  ? 19.785  11.084  117.835 1.00 39.56 ? 30  PRO A CG    1 
ATOM   222   C CD    . PRO A 1 33  ? 20.140  12.439  117.272 1.00 39.17 ? 30  PRO A CD    1 
ATOM   223   N N     . GLY A 1 34  ? 23.693  12.267  118.389 1.00 39.24 ? 31  GLY A N     1 
ATOM   224   C CA    . GLY A 1 34  ? 25.141  12.331  118.478 1.00 39.18 ? 31  GLY A CA    1 
ATOM   225   C C     . GLY A 1 34  ? 25.663  13.373  119.443 1.00 39.50 ? 31  GLY A C     1 
ATOM   226   O O     . GLY A 1 34  ? 26.513  13.097  120.281 1.00 40.22 ? 31  GLY A O     1 
ATOM   227   N N     . LEU A 1 35  ? 25.147  14.584  119.320 1.00 40.09 ? 32  LEU A N     1 
ATOM   228   C CA    . LEU A 1 35  ? 25.559  15.682  120.169 1.00 40.33 ? 32  LEU A CA    1 
ATOM   229   C C     . LEU A 1 35  ? 25.134  15.418  121.615 1.00 40.96 ? 32  LEU A C     1 
ATOM   230   O O     . LEU A 1 35  ? 25.872  15.729  122.548 1.00 41.68 ? 32  LEU A O     1 
ATOM   231   C CB    . LEU A 1 35  ? 24.940  16.980  119.645 1.00 39.59 ? 32  LEU A CB    1 
ATOM   232   C CG    . LEU A 1 35  ? 25.753  18.264  119.783 1.00 40.33 ? 32  LEU A CG    1 
ATOM   233   C CD1   . LEU A 1 35  ? 27.153  18.088  119.199 1.00 39.73 ? 32  LEU A CD1   1 
ATOM   234   C CD2   . LEU A 1 35  ? 25.012  19.380  119.071 1.00 40.31 ? 32  LEU A CD2   1 
ATOM   235   N N     . MET A 1 36  ? 23.960  14.827  121.809 1.00 40.89 ? 33  MET A N     1 
ATOM   236   C CA    . MET A 1 36  ? 23.494  14.535  123.160 1.00 41.67 ? 33  MET A CA    1 
ATOM   237   C C     . MET A 1 36  ? 24.215  13.328  123.738 1.00 43.12 ? 33  MET A C     1 
ATOM   238   O O     . MET A 1 36  ? 24.312  13.176  124.953 1.00 44.08 ? 33  MET A O     1 
ATOM   239   C CB    . MET A 1 36  ? 21.987  14.272  123.181 1.00 40.09 ? 33  MET A CB    1 
ATOM   240   C CG    . MET A 1 36  ? 21.149  15.477  122.804 1.00 41.62 ? 33  MET A CG    1 
ATOM   241   S SD    . MET A 1 36  ? 21.534  16.953  123.788 1.00 41.85 ? 33  MET A SD    1 
ATOM   242   C CE    . MET A 1 36  ? 20.261  16.852  125.047 1.00 42.50 ? 33  MET A CE    1 
ATOM   243   N N     . ARG A 1 37  ? 24.711  12.458  122.871 1.00 44.83 ? 34  ARG A N     1 
ATOM   244   C CA    . ARG A 1 37  ? 25.421  11.287  123.345 1.00 45.47 ? 34  ARG A CA    1 
ATOM   245   C C     . ARG A 1 37  ? 26.789  11.747  123.823 1.00 44.97 ? 34  ARG A C     1 
ATOM   246   O O     . ARG A 1 37  ? 27.344  11.190  124.761 1.00 43.91 ? 34  ARG A O     1 
ATOM   247   C CB    . ARG A 1 37  ? 25.562  10.247  122.232 1.00 47.96 ? 34  ARG A CB    1 
ATOM   248   C CG    . ARG A 1 37  ? 26.260  8.961   122.668 1.00 52.17 ? 34  ARG A CG    1 
ATOM   249   C CD    . ARG A 1 37  ? 25.425  8.143   123.660 1.00 55.71 ? 34  ARG A CD    1 
ATOM   250   N NE    . ARG A 1 37  ? 26.198  7.054   124.265 1.00 58.91 ? 34  ARG A NE    1 
ATOM   251   C CZ    . ARG A 1 37  ? 27.014  7.193   125.310 1.00 59.24 ? 34  ARG A CZ    1 
ATOM   252   N NH1   . ARG A 1 37  ? 27.165  8.380   125.884 1.00 59.64 ? 34  ARG A NH1   1 
ATOM   253   N NH2   . ARG A 1 37  ? 27.684  6.146   125.780 1.00 57.93 ? 34  ARG A NH2   1 
ATOM   254   N N     . MET A 1 38  ? 27.322  12.783  123.184 1.00 45.76 ? 35  MET A N     1 
ATOM   255   C CA    . MET A 1 38  ? 28.622  13.318  123.564 1.00 47.40 ? 35  MET A CA    1 
ATOM   256   C C     . MET A 1 38  ? 28.602  13.817  124.997 1.00 49.60 ? 35  MET A C     1 
ATOM   257   O O     . MET A 1 38  ? 29.443  13.440  125.807 1.00 50.01 ? 35  MET A O     1 
ATOM   258   C CB    . MET A 1 38  ? 29.028  14.466  122.647 1.00 46.12 ? 35  MET A CB    1 
ATOM   259   C CG    . MET A 1 38  ? 29.525  14.022  121.295 1.00 44.47 ? 35  MET A CG    1 
ATOM   260   S SD    . MET A 1 38  ? 31.002  13.012  121.423 1.00 43.49 ? 35  MET A SD    1 
ATOM   261   C CE    . MET A 1 38  ? 32.226  14.279  121.733 1.00 41.89 ? 35  MET A CE    1 
ATOM   262   N N     . ARG A 1 39  ? 27.644  14.679  125.305 1.00 51.39 ? 36  ARG A N     1 
ATOM   263   C CA    . ARG A 1 39  ? 27.538  15.213  126.648 1.00 52.99 ? 36  ARG A CA    1 
ATOM   264   C C     . ARG A 1 39  ? 27.119  14.103  127.608 1.00 54.78 ? 36  ARG A C     1 
ATOM   265   O O     . ARG A 1 39  ? 27.627  14.015  128.725 1.00 55.00 ? 36  ARG A O     1 
ATOM   266   C CB    . ARG A 1 39  ? 26.531  16.375  126.680 1.00 52.34 ? 36  ARG A CB    1 
ATOM   267   C CG    . ARG A 1 39  ? 25.237  16.101  125.928 1.00 50.49 ? 36  ARG A CG    1 
ATOM   268   C CD    . ARG A 1 39  ? 24.225  17.239  126.040 1.00 48.97 ? 36  ARG A CD    1 
ATOM   269   N NE    . ARG A 1 39  ? 24.644  18.472  125.371 1.00 47.49 ? 36  ARG A NE    1 
ATOM   270   C CZ    . ARG A 1 39  ? 23.859  19.537  125.195 1.00 47.18 ? 36  ARG A CZ    1 
ATOM   271   N NH1   . ARG A 1 39  ? 22.606  19.530  125.634 1.00 45.44 ? 36  ARG A NH1   1 
ATOM   272   N NH2   . ARG A 1 39  ? 24.325  20.619  124.581 1.00 47.17 ? 36  ARG A NH2   1 
ATOM   273   N N     . GLU A 1 40  ? 26.208  13.244  127.162 1.00 56.11 ? 37  GLU A N     1 
ATOM   274   C CA    . GLU A 1 40  ? 25.726  12.146  127.993 1.00 57.12 ? 37  GLU A CA    1 
ATOM   275   C C     . GLU A 1 40  ? 26.863  11.213  128.382 1.00 57.35 ? 37  GLU A C     1 
ATOM   276   O O     . GLU A 1 40  ? 26.666  10.275  129.157 1.00 58.02 ? 37  GLU A O     1 
ATOM   277   C CB    . GLU A 1 40  ? 24.662  11.339  127.251 1.00 59.26 ? 37  GLU A CB    1 
ATOM   278   C CG    . GLU A 1 40  ? 23.976  10.302  128.115 1.00 62.03 ? 37  GLU A CG    1 
ATOM   279   C CD    . GLU A 1 40  ? 23.554  9.072   127.331 1.00 64.52 ? 37  GLU A CD    1 
ATOM   280   O OE1   . GLU A 1 40  ? 24.447  8.364   126.815 1.00 65.21 ? 37  GLU A OE1   1 
ATOM   281   O OE2   . GLU A 1 40  ? 22.334  8.813   127.229 1.00 65.91 ? 37  GLU A OE2   1 
ATOM   282   N N     . ARG A 1 41  ? 28.052  11.470  127.850 1.00 56.55 ? 38  ARG A N     1 
ATOM   283   C CA    . ARG A 1 41  ? 29.205  10.628  128.130 1.00 56.04 ? 38  ARG A CA    1 
ATOM   284   C C     . ARG A 1 41  ? 30.373  11.402  128.704 1.00 55.17 ? 38  ARG A C     1 
ATOM   285   O O     . ARG A 1 41  ? 31.235  10.832  129.370 1.00 55.58 ? 38  ARG A O     1 
ATOM   286   C CB    . ARG A 1 41  ? 29.663  9.920   126.846 1.00 57.08 ? 38  ARG A CB    1 
ATOM   287   C CG    . ARG A 1 41  ? 30.913  9.065   126.994 1.00 58.36 ? 38  ARG A CG    1 
ATOM   288   C CD    . ARG A 1 41  ? 31.339  8.454   125.664 1.00 61.29 ? 38  ARG A CD    1 
ATOM   289   N NE    . ARG A 1 41  ? 32.469  7.531   125.805 1.00 64.48 ? 38  ARG A NE    1 
ATOM   290   C CZ    . ARG A 1 41  ? 33.067  6.902   124.792 1.00 65.88 ? 38  ARG A CZ    1 
ATOM   291   N NH1   . ARG A 1 41  ? 32.651  7.090   123.543 1.00 66.98 ? 38  ARG A NH1   1 
ATOM   292   N NH2   . ARG A 1 41  ? 34.084  6.080   125.028 1.00 66.52 ? 38  ARG A NH2   1 
ATOM   293   N N     . TYR A 1 42  ? 30.411  12.701  128.448 1.00 53.42 ? 39  TYR A N     1 
ATOM   294   C CA    . TYR A 1 42  ? 31.517  13.501  128.933 1.00 53.17 ? 39  TYR A CA    1 
ATOM   295   C C     . TYR A 1 42  ? 31.062  14.617  129.858 1.00 53.40 ? 39  TYR A C     1 
ATOM   296   O O     . TYR A 1 42  ? 31.857  15.460  130.270 1.00 52.80 ? 39  TYR A O     1 
ATOM   297   C CB    . TYR A 1 42  ? 32.294  14.077  127.741 1.00 53.10 ? 39  TYR A CB    1 
ATOM   298   C CG    . TYR A 1 42  ? 32.890  13.026  126.822 1.00 53.35 ? 39  TYR A CG    1 
ATOM   299   C CD1   . TYR A 1 42  ? 33.852  12.125  127.286 1.00 53.63 ? 39  TYR A CD1   1 
ATOM   300   C CD2   . TYR A 1 42  ? 32.492  12.929  125.487 1.00 53.71 ? 39  TYR A CD2   1 
ATOM   301   C CE1   . TYR A 1 42  ? 34.407  11.150  126.439 1.00 52.61 ? 39  TYR A CE1   1 
ATOM   302   C CE2   . TYR A 1 42  ? 33.037  11.960  124.634 1.00 52.56 ? 39  TYR A CE2   1 
ATOM   303   C CZ    . TYR A 1 42  ? 33.992  11.075  125.115 1.00 52.56 ? 39  TYR A CZ    1 
ATOM   304   O OH    . TYR A 1 42  ? 34.523  10.124  124.272 1.00 49.79 ? 39  TYR A OH    1 
ATOM   305   N N     . SER A 1 43  ? 29.780  14.615  130.193 1.00 54.27 ? 40  SER A N     1 
ATOM   306   C CA    . SER A 1 43  ? 29.241  15.638  131.073 1.00 55.73 ? 40  SER A CA    1 
ATOM   307   C C     . SER A 1 43  ? 29.983  15.621  132.397 1.00 56.84 ? 40  SER A C     1 
ATOM   308   O O     . SER A 1 43  ? 30.286  16.671  132.968 1.00 57.34 ? 40  SER A O     1 
ATOM   309   C CB    . SER A 1 43  ? 27.755  15.395  131.323 1.00 55.48 ? 40  SER A CB    1 
ATOM   310   O OG    . SER A 1 43  ? 27.230  16.391  132.179 1.00 56.76 ? 40  SER A OG    1 
ATOM   311   N N     . ALA A 1 44  ? 30.281  14.419  132.875 1.00 57.31 ? 41  ALA A N     1 
ATOM   312   C CA    . ALA A 1 44  ? 30.980  14.252  134.139 1.00 57.46 ? 41  ALA A CA    1 
ATOM   313   C C     . ALA A 1 44  ? 32.482  14.415  133.972 1.00 57.40 ? 41  ALA A C     1 
ATOM   314   O O     . ALA A 1 44  ? 33.118  15.152  134.722 1.00 58.63 ? 41  ALA A O     1 
ATOM   315   C CB    . ALA A 1 44  ? 30.668  12.889  134.726 1.00 57.45 ? 41  ALA A CB    1 
ATOM   316   N N     . SER A 1 45  ? 33.051  13.732  132.986 1.00 57.11 ? 42  SER A N     1 
ATOM   317   C CA    . SER A 1 45  ? 34.491  13.808  132.750 1.00 57.08 ? 42  SER A CA    1 
ATOM   318   C C     . SER A 1 45  ? 35.010  15.218  132.447 1.00 55.82 ? 42  SER A C     1 
ATOM   319   O O     . SER A 1 45  ? 36.167  15.520  132.716 1.00 55.68 ? 42  SER A O     1 
ATOM   320   C CB    . SER A 1 45  ? 34.885  12.859  131.612 1.00 58.06 ? 42  SER A CB    1 
ATOM   321   O OG    . SER A 1 45  ? 34.095  13.086  130.460 1.00 59.23 ? 42  SER A OG    1 
ATOM   322   N N     . LYS A 1 46  ? 34.155  16.073  131.890 1.00 55.17 ? 43  LYS A N     1 
ATOM   323   C CA    . LYS A 1 46  ? 34.540  17.440  131.549 1.00 53.89 ? 43  LYS A CA    1 
ATOM   324   C C     . LYS A 1 46  ? 35.928  17.470  130.898 1.00 54.03 ? 43  LYS A C     1 
ATOM   325   O O     . LYS A 1 46  ? 36.864  18.059  131.433 1.00 53.94 ? 43  LYS A O     1 
ATOM   326   C CB    . LYS A 1 46  ? 34.526  18.315  132.806 1.00 52.72 ? 43  LYS A CB    1 
ATOM   327   C CG    . LYS A 1 46  ? 33.164  18.428  133.482 1.00 51.65 ? 43  LYS A CG    1 
ATOM   328   C CD    . LYS A 1 46  ? 32.280  19.434  132.770 1.00 53.69 ? 43  LYS A CD    1 
ATOM   329   C CE    . LYS A 1 46  ? 30.861  19.493  133.340 1.00 54.10 ? 43  LYS A CE    1 
ATOM   330   N NZ    . LYS A 1 46  ? 30.805  19.822  134.791 1.00 54.91 ? 43  LYS A NZ    1 
ATOM   331   N N     . PRO A 1 47  ? 36.070  16.834  129.722 1.00 54.20 ? 44  PRO A N     1 
ATOM   332   C CA    . PRO A 1 47  ? 37.351  16.791  129.006 1.00 54.24 ? 44  PRO A CA    1 
ATOM   333   C C     . PRO A 1 47  ? 37.806  18.124  128.419 1.00 54.38 ? 44  PRO A C     1 
ATOM   334   O O     . PRO A 1 47  ? 38.978  18.297  128.082 1.00 53.07 ? 44  PRO A O     1 
ATOM   335   C CB    . PRO A 1 47  ? 37.093  15.756  127.919 1.00 54.76 ? 44  PRO A CB    1 
ATOM   336   C CG    . PRO A 1 47  ? 35.641  15.994  127.595 1.00 53.87 ? 44  PRO A CG    1 
ATOM   337   C CD    . PRO A 1 47  ? 35.032  16.097  128.976 1.00 53.84 ? 44  PRO A CD    1 
ATOM   338   N N     . LEU A 1 48  ? 36.877  19.063  128.290 1.00 55.00 ? 45  LEU A N     1 
ATOM   339   C CA    . LEU A 1 48  ? 37.205  20.360  127.718 1.00 55.70 ? 45  LEU A CA    1 
ATOM   340   C C     . LEU A 1 48  ? 37.513  21.425  128.769 1.00 55.74 ? 45  LEU A C     1 
ATOM   341   O O     . LEU A 1 48  ? 37.612  22.614  128.454 1.00 55.47 ? 45  LEU A O     1 
ATOM   342   C CB    . LEU A 1 48  ? 36.065  20.819  126.800 1.00 56.39 ? 45  LEU A CB    1 
ATOM   343   C CG    . LEU A 1 48  ? 35.964  20.151  125.419 1.00 56.88 ? 45  LEU A CG    1 
ATOM   344   C CD1   . LEU A 1 48  ? 34.676  20.570  124.716 1.00 55.89 ? 45  LEU A CD1   1 
ATOM   345   C CD2   . LEU A 1 48  ? 37.174  20.543  124.579 1.00 56.44 ? 45  LEU A CD2   1 
ATOM   346   N N     . LYS A 1 49  ? 37.673  20.994  130.018 1.00 55.92 ? 46  LYS A N     1 
ATOM   347   C CA    . LYS A 1 49  ? 37.986  21.919  131.104 1.00 54.52 ? 46  LYS A CA    1 
ATOM   348   C C     . LYS A 1 49  ? 39.292  22.640  130.794 1.00 53.31 ? 46  LYS A C     1 
ATOM   349   O O     . LYS A 1 49  ? 40.298  22.006  130.467 1.00 53.40 ? 46  LYS A O     1 
ATOM   350   C CB    . LYS A 1 49  ? 38.131  21.170  132.432 1.00 54.83 ? 46  LYS A CB    1 
ATOM   351   C CG    . LYS A 1 49  ? 38.460  22.079  133.603 1.00 55.80 ? 46  LYS A CG    1 
ATOM   352   C CD    . LYS A 1 49  ? 38.767  21.307  134.879 1.00 56.71 ? 46  LYS A CD    1 
ATOM   353   C CE    . LYS A 1 49  ? 39.047  22.277  136.037 1.00 57.02 ? 46  LYS A CE    1 
ATOM   354   N NZ    . LYS A 1 49  ? 39.412  21.606  137.314 1.00 54.71 ? 46  LYS A NZ    1 
ATOM   355   N N     . GLY A 1 50  ? 39.270  23.967  130.889 1.00 52.42 ? 47  GLY A N     1 
ATOM   356   C CA    . GLY A 1 50  ? 40.468  24.750  130.631 1.00 50.35 ? 47  GLY A CA    1 
ATOM   357   C C     . GLY A 1 50  ? 40.565  25.268  129.211 1.00 48.54 ? 47  GLY A C     1 
ATOM   358   O O     . GLY A 1 50  ? 41.471  26.031  128.868 1.00 46.94 ? 47  GLY A O     1 
ATOM   359   N N     . ALA A 1 51  ? 39.619  24.860  128.377 1.00 47.87 ? 48  ALA A N     1 
ATOM   360   C CA    . ALA A 1 51  ? 39.614  25.295  126.993 1.00 46.71 ? 48  ALA A CA    1 
ATOM   361   C C     . ALA A 1 51  ? 38.793  26.569  126.846 1.00 46.02 ? 48  ALA A C     1 
ATOM   362   O O     . ALA A 1 51  ? 37.673  26.663  127.358 1.00 45.73 ? 48  ALA A O     1 
ATOM   363   C CB    . ALA A 1 51  ? 39.042  24.201  126.110 1.00 46.66 ? 48  ALA A CB    1 
ATOM   364   N N     . ARG A 1 52  ? 39.375  27.561  126.176 1.00 44.74 ? 49  ARG A N     1 
ATOM   365   C CA    . ARG A 1 52  ? 38.693  28.827  125.920 1.00 44.30 ? 49  ARG A CA    1 
ATOM   366   C C     . ARG A 1 52  ? 38.401  28.838  124.411 1.00 44.38 ? 49  ARG A C     1 
ATOM   367   O O     . ARG A 1 52  ? 39.153  29.415  123.614 1.00 43.87 ? 49  ARG A O     1 
ATOM   368   C CB    . ARG A 1 52  ? 39.575  30.023  126.323 1.00 43.67 ? 49  ARG A CB    1 
ATOM   369   C CG    . ARG A 1 52  ? 39.573  30.353  127.833 1.00 43.02 ? 49  ARG A CG    1 
ATOM   370   C CD    . ARG A 1 52  ? 40.326  31.661  128.139 1.00 41.16 ? 49  ARG A CD    1 
ATOM   371   N NE    . ARG A 1 52  ? 41.759  31.502  127.928 1.00 37.55 ? 49  ARG A NE    1 
ATOM   372   C CZ    . ARG A 1 52  ? 42.536  30.761  128.710 1.00 37.69 ? 49  ARG A CZ    1 
ATOM   373   N NH1   . ARG A 1 52  ? 42.007  30.133  129.752 1.00 35.13 ? 49  ARG A NH1   1 
ATOM   374   N NH2   . ARG A 1 52  ? 43.826  30.608  128.428 1.00 36.17 ? 49  ARG A NH2   1 
ATOM   375   N N     . ILE A 1 53  ? 37.309  28.169  124.040 1.00 42.98 ? 50  ILE A N     1 
ATOM   376   C CA    . ILE A 1 53  ? 36.904  28.042  122.649 1.00 41.54 ? 50  ILE A CA    1 
ATOM   377   C C     . ILE A 1 53  ? 36.155  29.257  122.103 1.00 40.56 ? 50  ILE A C     1 
ATOM   378   O O     . ILE A 1 53  ? 35.180  29.738  122.690 1.00 39.51 ? 50  ILE A O     1 
ATOM   379   C CB    . ILE A 1 53  ? 36.037  26.771  122.440 1.00 41.62 ? 50  ILE A CB    1 
ATOM   380   C CG1   . ILE A 1 53  ? 36.785  25.545  122.989 1.00 40.60 ? 50  ILE A CG1   1 
ATOM   381   C CG2   . ILE A 1 53  ? 35.720  26.583  120.952 1.00 41.20 ? 50  ILE A CG2   1 
ATOM   382   C CD1   . ILE A 1 53  ? 35.971  24.259  123.016 1.00 36.65 ? 50  ILE A CD1   1 
ATOM   383   N N     . ALA A 1 54  ? 36.648  29.750  120.973 1.00 39.43 ? 51  ALA A N     1 
ATOM   384   C CA    . ALA A 1 54  ? 36.068  30.884  120.286 1.00 39.67 ? 51  ALA A CA    1 
ATOM   385   C C     . ALA A 1 54  ? 35.531  30.335  118.969 1.00 40.03 ? 51  ALA A C     1 
ATOM   386   O O     . ALA A 1 54  ? 36.300  30.012  118.058 1.00 39.34 ? 51  ALA A O     1 
ATOM   387   C CB    . ALA A 1 54  ? 37.128  31.937  120.025 1.00 38.87 ? 51  ALA A CB    1 
ATOM   388   N N     . GLY A 1 55  ? 34.210  30.221  118.882 1.00 40.52 ? 52  GLY A N     1 
ATOM   389   C CA    . GLY A 1 55  ? 33.598  29.689  117.681 1.00 41.52 ? 52  GLY A CA    1 
ATOM   390   C C     . GLY A 1 55  ? 32.971  30.707  116.749 1.00 41.90 ? 52  GLY A C     1 
ATOM   391   O O     . GLY A 1 55  ? 32.175  31.555  117.164 1.00 42.29 ? 52  GLY A O     1 
ATOM   392   N N     . CYS A 1 56  ? 33.343  30.616  115.475 1.00 41.92 ? 53  CYS A N     1 
ATOM   393   C CA    . CYS A 1 56  ? 32.813  31.489  114.433 1.00 40.97 ? 53  CYS A CA    1 
ATOM   394   C C     . CYS A 1 56  ? 32.003  30.625  113.458 1.00 41.21 ? 53  CYS A C     1 
ATOM   395   O O     . CYS A 1 56  ? 32.530  30.123  112.466 1.00 41.21 ? 53  CYS A O     1 
ATOM   396   C CB    . CYS A 1 56  ? 33.941  32.173  113.685 1.00 39.37 ? 53  CYS A CB    1 
ATOM   397   S SG    . CYS A 1 56  ? 33.331  33.444  112.576 1.00 44.33 ? 53  CYS A SG    1 
ATOM   398   N N     . LEU A 1 57  ? 30.717  30.454  113.748 1.00 40.54 ? 54  LEU A N     1 
ATOM   399   C CA    . LEU A 1 57  ? 29.862  29.623  112.916 1.00 40.27 ? 54  LEU A CA    1 
ATOM   400   C C     . LEU A 1 57  ? 28.391  30.042  113.031 1.00 40.22 ? 54  LEU A C     1 
ATOM   401   O O     . LEU A 1 57  ? 27.908  30.360  114.120 1.00 40.05 ? 54  LEU A O     1 
ATOM   402   C CB    . LEU A 1 57  ? 30.039  28.160  113.341 1.00 40.35 ? 54  LEU A CB    1 
ATOM   403   C CG    . LEU A 1 57  ? 29.545  26.999  112.475 1.00 42.29 ? 54  LEU A CG    1 
ATOM   404   C CD1   . LEU A 1 57  ? 30.196  25.706  112.958 1.00 43.59 ? 54  LEU A CD1   1 
ATOM   405   C CD2   . LEU A 1 57  ? 28.031  26.894  112.528 1.00 43.37 ? 54  LEU A CD2   1 
ATOM   406   N N     . HIS A 1 58  ? 27.700  30.033  111.892 1.00 39.57 ? 55  HIS A N     1 
ATOM   407   C CA    . HIS A 1 58  ? 26.283  30.394  111.770 1.00 39.01 ? 55  HIS A CA    1 
ATOM   408   C C     . HIS A 1 58  ? 25.524  30.185  113.058 1.00 37.76 ? 55  HIS A C     1 
ATOM   409   O O     . HIS A 1 58  ? 25.172  29.058  113.404 1.00 37.57 ? 55  HIS A O     1 
ATOM   410   C CB    . HIS A 1 58  ? 25.638  29.555  110.653 1.00 39.01 ? 55  HIS A CB    1 
ATOM   411   C CG    . HIS A 1 58  ? 26.435  29.544  109.388 1.00 40.53 ? 55  HIS A CG    1 
ATOM   412   N ND1   . HIS A 1 58  ? 26.224  30.439  108.360 1.00 40.08 ? 55  HIS A ND1   1 
ATOM   413   C CD2   . HIS A 1 58  ? 27.512  28.810  109.029 1.00 40.18 ? 55  HIS A CD2   1 
ATOM   414   C CE1   . HIS A 1 58  ? 27.137  30.258  107.424 1.00 39.28 ? 55  HIS A CE1   1 
ATOM   415   N NE2   . HIS A 1 58  ? 27.932  29.275  107.806 1.00 40.83 ? 55  HIS A NE2   1 
ATOM   416   N N     . MET A 1 59  ? 25.272  31.274  113.771 1.00 36.55 ? 56  MET A N     1 
ATOM   417   C CA    . MET A 1 59  ? 24.568  31.181  115.040 1.00 34.90 ? 56  MET A CA    1 
ATOM   418   C C     . MET A 1 59  ? 23.112  30.794  114.814 1.00 33.64 ? 56  MET A C     1 
ATOM   419   O O     . MET A 1 59  ? 22.235  31.645  114.642 1.00 35.00 ? 56  MET A O     1 
ATOM   420   C CB    . MET A 1 59  ? 24.668  32.505  115.797 1.00 34.05 ? 56  MET A CB    1 
ATOM   421   C CG    . MET A 1 59  ? 24.055  32.471  117.184 1.00 35.15 ? 56  MET A CG    1 
ATOM   422   S SD    . MET A 1 59  ? 24.678  31.119  118.223 1.00 36.79 ? 56  MET A SD    1 
ATOM   423   C CE    . MET A 1 59  ? 23.206  30.111  118.375 1.00 30.88 ? 56  MET A CE    1 
ATOM   424   N N     . THR A 1 60  ? 22.864  29.491  114.845 1.00 31.62 ? 57  THR A N     1 
ATOM   425   C CA    . THR A 1 60  ? 21.535  28.958  114.620 1.00 29.02 ? 57  THR A CA    1 
ATOM   426   C C     . THR A 1 60  ? 21.110  28.037  115.750 1.00 28.54 ? 57  THR A C     1 
ATOM   427   O O     . THR A 1 60  ? 21.878  27.773  116.676 1.00 28.05 ? 57  THR A O     1 
ATOM   428   C CB    . THR A 1 60  ? 21.515  28.151  113.328 1.00 28.26 ? 57  THR A CB    1 
ATOM   429   O OG1   . THR A 1 60  ? 22.445  27.062  113.448 1.00 27.59 ? 57  THR A OG1   1 
ATOM   430   C CG2   . THR A 1 60  ? 21.923  29.025  112.159 1.00 27.66 ? 57  THR A CG2   1 
ATOM   431   N N     . VAL A 1 61  ? 19.882  27.539  115.661 1.00 28.04 ? 58  VAL A N     1 
ATOM   432   C CA    . VAL A 1 61  ? 19.366  26.622  116.658 1.00 28.10 ? 58  VAL A CA    1 
ATOM   433   C C     . VAL A 1 61  ? 20.321  25.443  116.790 1.00 31.16 ? 58  VAL A C     1 
ATOM   434   O O     . VAL A 1 61  ? 20.714  25.089  117.906 1.00 32.96 ? 58  VAL A O     1 
ATOM   435   C CB    . VAL A 1 61  ? 17.977  26.082  116.265 1.00 28.16 ? 58  VAL A CB    1 
ATOM   436   C CG1   . VAL A 1 61  ? 17.539  25.014  117.252 1.00 27.32 ? 58  VAL A CG1   1 
ATOM   437   C CG2   . VAL A 1 61  ? 16.957  27.220  116.222 1.00 28.63 ? 58  VAL A CG2   1 
ATOM   438   N N     . GLU A 1 62  ? 20.691  24.838  115.658 1.00 30.79 ? 59  GLU A N     1 
ATOM   439   C CA    . GLU A 1 62  ? 21.602  23.693  115.668 1.00 31.77 ? 59  GLU A CA    1 
ATOM   440   C C     . GLU A 1 62  ? 22.915  24.067  116.360 1.00 32.48 ? 59  GLU A C     1 
ATOM   441   O O     . GLU A 1 62  ? 23.408  23.336  117.224 1.00 32.22 ? 59  GLU A O     1 
ATOM   442   C CB    . GLU A 1 62  ? 21.909  23.212  114.239 1.00 31.05 ? 59  GLU A CB    1 
ATOM   443   C CG    . GLU A 1 62  ? 20.727  22.623  113.474 1.00 31.06 ? 59  GLU A CG    1 
ATOM   444   C CD    . GLU A 1 62  ? 19.550  23.565  113.379 1.00 30.46 ? 59  GLU A CD    1 
ATOM   445   O OE1   . GLU A 1 62  ? 19.774  24.767  113.113 1.00 31.66 ? 59  GLU A OE1   1 
ATOM   446   O OE2   . GLU A 1 62  ? 18.403  23.108  113.566 1.00 30.15 ? 59  GLU A OE2   1 
ATOM   447   N N     . THR A 1 63  ? 23.478  25.207  115.965 1.00 32.21 ? 60  THR A N     1 
ATOM   448   C CA    . THR A 1 63  ? 24.724  25.681  116.550 1.00 32.53 ? 60  THR A CA    1 
ATOM   449   C C     . THR A 1 63  ? 24.566  25.945  118.048 1.00 33.75 ? 60  THR A C     1 
ATOM   450   O O     . THR A 1 63  ? 25.523  25.799  118.813 1.00 33.07 ? 60  THR A O     1 
ATOM   451   C CB    . THR A 1 63  ? 25.205  26.974  115.874 1.00 31.61 ? 60  THR A CB    1 
ATOM   452   O OG1   . THR A 1 63  ? 25.479  26.716  114.491 1.00 31.30 ? 60  THR A OG1   1 
ATOM   453   C CG2   . THR A 1 63  ? 26.467  27.498  116.553 1.00 29.85 ? 60  THR A CG2   1 
ATOM   454   N N     . ALA A 1 64  ? 23.361  26.329  118.467 1.00 33.89 ? 61  ALA A N     1 
ATOM   455   C CA    . ALA A 1 64  ? 23.125  26.600  119.884 1.00 35.97 ? 61  ALA A CA    1 
ATOM   456   C C     . ALA A 1 64  ? 23.382  25.319  120.673 1.00 36.89 ? 61  ALA A C     1 
ATOM   457   O O     . ALA A 1 64  ? 24.114  25.324  121.675 1.00 36.29 ? 61  ALA A O     1 
ATOM   458   C CB    . ALA A 1 64  ? 21.695  27.077  120.107 1.00 33.42 ? 61  ALA A CB    1 
ATOM   459   N N     . VAL A 1 65  ? 22.782  24.224  120.202 1.00 36.89 ? 62  VAL A N     1 
ATOM   460   C CA    . VAL A 1 65  ? 22.935  22.913  120.840 1.00 36.45 ? 62  VAL A CA    1 
ATOM   461   C C     . VAL A 1 65  ? 24.404  22.510  120.852 1.00 36.67 ? 62  VAL A C     1 
ATOM   462   O O     . VAL A 1 65  ? 24.863  21.839  121.769 1.00 36.54 ? 62  VAL A O     1 
ATOM   463   C CB    . VAL A 1 65  ? 22.115  21.816  120.098 1.00 34.98 ? 62  VAL A CB    1 
ATOM   464   C CG1   . VAL A 1 65  ? 22.325  20.476  120.757 1.00 34.14 ? 62  VAL A CG1   1 
ATOM   465   C CG2   . VAL A 1 65  ? 20.632  22.176  120.103 1.00 32.68 ? 62  VAL A CG2   1 
ATOM   466   N N     . LEU A 1 66  ? 25.132  22.921  119.819 1.00 37.74 ? 63  LEU A N     1 
ATOM   467   C CA    . LEU A 1 66  ? 26.557  22.625  119.718 1.00 38.97 ? 63  LEU A CA    1 
ATOM   468   C C     . LEU A 1 66  ? 27.299  23.336  120.849 1.00 39.25 ? 63  LEU A C     1 
ATOM   469   O O     . LEU A 1 66  ? 28.130  22.745  121.538 1.00 38.84 ? 63  LEU A O     1 
ATOM   470   C CB    . LEU A 1 66  ? 27.096  23.099  118.368 1.00 38.74 ? 63  LEU A CB    1 
ATOM   471   C CG    . LEU A 1 66  ? 28.622  23.178  118.237 1.00 39.64 ? 63  LEU A CG    1 
ATOM   472   C CD1   . LEU A 1 66  ? 29.198  21.797  118.453 1.00 38.86 ? 63  LEU A CD1   1 
ATOM   473   C CD2   . LEU A 1 66  ? 29.028  23.720  116.861 1.00 38.23 ? 63  LEU A CD2   1 
ATOM   474   N N     . ILE A 1 67  ? 26.981  24.614  121.025 1.00 39.84 ? 64  ILE A N     1 
ATOM   475   C CA    . ILE A 1 67  ? 27.591  25.452  122.051 1.00 39.58 ? 64  ILE A CA    1 
ATOM   476   C C     . ILE A 1 67  ? 27.293  24.894  123.445 1.00 40.51 ? 64  ILE A C     1 
ATOM   477   O O     . ILE A 1 67  ? 28.204  24.680  124.253 1.00 39.26 ? 64  ILE A O     1 
ATOM   478   C CB    . ILE A 1 67  ? 27.066  26.901  121.940 1.00 38.27 ? 64  ILE A CB    1 
ATOM   479   C CG1   . ILE A 1 67  ? 27.433  27.477  120.566 1.00 38.02 ? 64  ILE A CG1   1 
ATOM   480   C CG2   . ILE A 1 67  ? 27.655  27.765  123.039 1.00 40.49 ? 64  ILE A CG2   1 
ATOM   481   C CD1   . ILE A 1 67  ? 26.817  28.834  120.264 1.00 33.53 ? 64  ILE A CD1   1 
ATOM   482   N N     . GLU A 1 68  ? 26.018  24.653  123.724 1.00 41.29 ? 65  GLU A N     1 
ATOM   483   C CA    . GLU A 1 68  ? 25.636  24.108  125.013 1.00 42.44 ? 65  GLU A CA    1 
ATOM   484   C C     . GLU A 1 68  ? 26.315  22.757  125.271 1.00 44.05 ? 65  GLU A C     1 
ATOM   485   O O     . GLU A 1 68  ? 26.564  22.395  126.421 1.00 44.94 ? 65  GLU A O     1 
ATOM   486   C CB    . GLU A 1 68  ? 24.113  23.973  125.109 1.00 42.88 ? 65  GLU A CB    1 
ATOM   487   C CG    . GLU A 1 68  ? 23.390  25.273  125.476 1.00 44.27 ? 65  GLU A CG    1 
ATOM   488   C CD    . GLU A 1 68  ? 21.950  25.035  125.929 1.00 47.14 ? 65  GLU A CD    1 
ATOM   489   O OE1   . GLU A 1 68  ? 21.279  26.010  126.340 1.00 45.86 ? 65  GLU A OE1   1 
ATOM   490   O OE2   . GLU A 1 68  ? 21.492  23.866  125.876 1.00 49.29 ? 65  GLU A OE2   1 
ATOM   491   N N     . THR A 1 69  ? 26.631  22.020  124.208 1.00 44.32 ? 66  THR A N     1 
ATOM   492   C CA    . THR A 1 69  ? 27.294  20.722  124.351 1.00 44.47 ? 66  THR A CA    1 
ATOM   493   C C     . THR A 1 69  ? 28.725  20.910  124.856 1.00 43.84 ? 66  THR A C     1 
ATOM   494   O O     . THR A 1 69  ? 29.161  20.235  125.789 1.00 43.74 ? 66  THR A O     1 
ATOM   495   C CB    . THR A 1 69  ? 27.330  19.950  123.000 1.00 44.13 ? 66  THR A CB    1 
ATOM   496   O OG1   . THR A 1 69  ? 25.993  19.652  122.587 1.00 43.82 ? 66  THR A OG1   1 
ATOM   497   C CG2   . THR A 1 69  ? 28.110  18.648  123.141 1.00 43.11 ? 66  THR A CG2   1 
ATOM   498   N N     . LEU A 1 70  ? 29.446  21.831  124.226 1.00 43.34 ? 67  LEU A N     1 
ATOM   499   C CA    . LEU A 1 70  ? 30.815  22.131  124.605 1.00 42.46 ? 67  LEU A CA    1 
ATOM   500   C C     . LEU A 1 70  ? 30.828  22.625  126.049 1.00 44.24 ? 67  LEU A C     1 
ATOM   501   O O     . LEU A 1 70  ? 31.657  22.198  126.855 1.00 45.12 ? 67  LEU A O     1 
ATOM   502   C CB    . LEU A 1 70  ? 31.399  23.207  123.683 1.00 39.68 ? 67  LEU A CB    1 
ATOM   503   C CG    . LEU A 1 70  ? 31.647  22.835  122.217 1.00 37.60 ? 67  LEU A CG    1 
ATOM   504   C CD1   . LEU A 1 70  ? 32.000  24.077  121.411 1.00 37.64 ? 67  LEU A CD1   1 
ATOM   505   C CD2   . LEU A 1 70  ? 32.773  21.834  122.136 1.00 35.34 ? 67  LEU A CD2   1 
ATOM   506   N N     . VAL A 1 71  ? 29.901  23.523  126.369 1.00 44.54 ? 68  VAL A N     1 
ATOM   507   C CA    . VAL A 1 71  ? 29.821  24.076  127.713 1.00 44.72 ? 68  VAL A CA    1 
ATOM   508   C C     . VAL A 1 71  ? 29.645  22.955  128.733 1.00 44.63 ? 68  VAL A C     1 
ATOM   509   O O     . VAL A 1 71  ? 30.256  22.982  129.804 1.00 44.41 ? 68  VAL A O     1 
ATOM   510   C CB    . VAL A 1 71  ? 28.663  25.111  127.826 1.00 44.50 ? 68  VAL A CB    1 
ATOM   511   C CG1   . VAL A 1 71  ? 28.565  25.649  129.236 1.00 43.79 ? 68  VAL A CG1   1 
ATOM   512   C CG2   . VAL A 1 71  ? 28.917  26.266  126.872 1.00 44.36 ? 68  VAL A CG2   1 
ATOM   513   N N     . THR A 1 72  ? 28.829  21.962  128.387 1.00 44.60 ? 69  THR A N     1 
ATOM   514   C CA    . THR A 1 72  ? 28.582  20.820  129.258 1.00 44.93 ? 69  THR A CA    1 
ATOM   515   C C     . THR A 1 72  ? 29.846  19.975  129.453 1.00 46.34 ? 69  THR A C     1 
ATOM   516   O O     . THR A 1 72  ? 29.956  19.224  130.422 1.00 48.31 ? 69  THR A O     1 
ATOM   517   C CB    . THR A 1 72  ? 27.461  19.931  128.684 1.00 45.02 ? 69  THR A CB    1 
ATOM   518   O OG1   . THR A 1 72  ? 26.238  20.676  128.662 1.00 47.14 ? 69  THR A OG1   1 
ATOM   519   C CG2   . THR A 1 72  ? 27.267  18.677  129.526 1.00 44.20 ? 69  THR A CG2   1 
ATOM   520   N N     . LEU A 1 73  ? 30.798  20.094  128.532 1.00 46.64 ? 70  LEU A N     1 
ATOM   521   C CA    . LEU A 1 73  ? 32.050  19.344  128.627 1.00 46.67 ? 70  LEU A CA    1 
ATOM   522   C C     . LEU A 1 73  ? 33.151  20.128  129.333 1.00 47.07 ? 70  LEU A C     1 
ATOM   523   O O     . LEU A 1 73  ? 34.327  19.759  129.259 1.00 46.65 ? 70  LEU A O     1 
ATOM   524   C CB    . LEU A 1 73  ? 32.544  18.920  127.235 1.00 45.72 ? 70  LEU A CB    1 
ATOM   525   C CG    . LEU A 1 73  ? 32.018  17.599  126.664 1.00 45.68 ? 70  LEU A CG    1 
ATOM   526   C CD1   . LEU A 1 73  ? 30.509  17.653  126.517 1.00 45.01 ? 70  LEU A CD1   1 
ATOM   527   C CD2   . LEU A 1 73  ? 32.681  17.328  125.325 1.00 44.60 ? 70  LEU A CD2   1 
ATOM   528   N N     . GLY A 1 74  ? 32.770  21.219  129.997 1.00 47.63 ? 71  GLY A N     1 
ATOM   529   C CA    . GLY A 1 74  ? 33.734  22.022  130.738 1.00 48.27 ? 71  GLY A CA    1 
ATOM   530   C C     . GLY A 1 74  ? 34.514  23.083  129.981 1.00 48.72 ? 71  GLY A C     1 
ATOM   531   O O     . GLY A 1 74  ? 35.465  23.652  130.515 1.00 47.55 ? 71  GLY A O     1 
ATOM   532   N N     . ALA A 1 75  ? 34.118  23.363  128.743 1.00 50.18 ? 72  ALA A N     1 
ATOM   533   C CA    . ALA A 1 75  ? 34.806  24.373  127.942 1.00 50.18 ? 72  ALA A CA    1 
ATOM   534   C C     . ALA A 1 75  ? 34.192  25.743  128.172 1.00 50.72 ? 72  ALA A C     1 
ATOM   535   O O     . ALA A 1 75  ? 33.065  25.864  128.654 1.00 50.17 ? 72  ALA A O     1 
ATOM   536   C CB    . ALA A 1 75  ? 34.736  24.013  126.467 1.00 50.11 ? 72  ALA A CB    1 
ATOM   537   N N     . GLU A 1 76  ? 34.943  26.777  127.829 1.00 51.26 ? 73  GLU A N     1 
ATOM   538   C CA    . GLU A 1 76  ? 34.475  28.142  127.992 1.00 52.31 ? 73  GLU A CA    1 
ATOM   539   C C     . GLU A 1 76  ? 34.395  28.668  126.572 1.00 52.39 ? 73  GLU A C     1 
ATOM   540   O O     . GLU A 1 76  ? 35.386  28.615  125.839 1.00 52.27 ? 73  GLU A O     1 
ATOM   541   C CB    . GLU A 1 76  ? 35.499  28.927  128.809 1.00 54.47 ? 73  GLU A CB    1 
ATOM   542   C CG    . GLU A 1 76  ? 34.916  29.973  129.739 1.00 56.60 ? 73  GLU A CG    1 
ATOM   543   C CD    . GLU A 1 76  ? 35.970  30.544  130.681 1.00 58.90 ? 73  GLU A CD    1 
ATOM   544   O OE1   . GLU A 1 76  ? 36.970  31.120  130.185 1.00 59.46 ? 73  GLU A OE1   1 
ATOM   545   O OE2   . GLU A 1 76  ? 35.806  30.406  131.914 1.00 58.28 ? 73  GLU A OE2   1 
ATOM   546   N N     . VAL A 1 77  ? 33.225  29.157  126.167 1.00 52.89 ? 74  VAL A N     1 
ATOM   547   C CA    . VAL A 1 77  ? 33.071  29.647  124.797 1.00 51.83 ? 74  VAL A CA    1 
ATOM   548   C C     . VAL A 1 77  ? 32.424  31.006  124.579 1.00 51.40 ? 74  VAL A C     1 
ATOM   549   O O     . VAL A 1 77  ? 31.475  31.393  125.265 1.00 51.08 ? 74  VAL A O     1 
ATOM   550   C CB    . VAL A 1 77  ? 32.286  28.632  123.915 1.00 51.30 ? 74  VAL A CB    1 
ATOM   551   C CG1   . VAL A 1 77  ? 32.983  27.287  123.922 1.00 50.52 ? 74  VAL A CG1   1 
ATOM   552   C CG2   . VAL A 1 77  ? 30.853  28.499  124.404 1.00 49.96 ? 74  VAL A CG2   1 
ATOM   553   N N     . GLN A 1 78  ? 32.962  31.718  123.597 1.00 50.72 ? 75  GLN A N     1 
ATOM   554   C CA    . GLN A 1 78  ? 32.456  33.017  123.186 1.00 51.21 ? 75  GLN A CA    1 
ATOM   555   C C     . GLN A 1 78  ? 32.146  32.790  121.707 1.00 51.23 ? 75  GLN A C     1 
ATOM   556   O O     . GLN A 1 78  ? 33.012  32.334  120.962 1.00 51.76 ? 75  GLN A O     1 
ATOM   557   C CB    . GLN A 1 78  ? 33.532  34.082  123.374 1.00 50.99 ? 75  GLN A CB    1 
ATOM   558   C CG    . GLN A 1 78  ? 33.694  34.534  124.819 1.00 50.58 ? 75  GLN A CG    1 
ATOM   559   C CD    . GLN A 1 78  ? 34.855  35.486  124.991 1.00 51.62 ? 75  GLN A CD    1 
ATOM   560   O OE1   . GLN A 1 78  ? 34.924  36.229  125.971 1.00 53.98 ? 75  GLN A OE1   1 
ATOM   561   N NE2   . GLN A 1 78  ? 35.785  35.463  124.041 1.00 51.30 ? 75  GLN A NE2   1 
ATOM   562   N N     . TRP A 1 79  ? 30.924  33.097  121.279 1.00 50.06 ? 76  TRP A N     1 
ATOM   563   C CA    . TRP A 1 79  ? 30.540  32.832  119.890 1.00 49.09 ? 76  TRP A CA    1 
ATOM   564   C C     . TRP A 1 79  ? 30.155  34.012  118.988 1.00 48.35 ? 76  TRP A C     1 
ATOM   565   O O     . TRP A 1 79  ? 29.761  35.079  119.457 1.00 48.32 ? 76  TRP A O     1 
ATOM   566   C CB    . TRP A 1 79  ? 29.402  31.804  119.885 1.00 48.10 ? 76  TRP A CB    1 
ATOM   567   C CG    . TRP A 1 79  ? 29.469  30.840  118.751 1.00 48.20 ? 76  TRP A CG    1 
ATOM   568   C CD1   . TRP A 1 79  ? 29.016  31.027  117.475 1.00 47.04 ? 76  TRP A CD1   1 
ATOM   569   C CD2   . TRP A 1 79  ? 30.054  29.538  118.784 1.00 48.05 ? 76  TRP A CD2   1 
ATOM   570   N NE1   . TRP A 1 79  ? 29.283  29.916  116.711 1.00 46.71 ? 76  TRP A NE1   1 
ATOM   571   C CE2   . TRP A 1 79  ? 29.920  28.986  117.489 1.00 48.25 ? 76  TRP A CE2   1 
ATOM   572   C CE3   . TRP A 1 79  ? 30.681  28.780  119.783 1.00 47.77 ? 76  TRP A CE3   1 
ATOM   573   C CZ2   . TRP A 1 79  ? 30.390  27.707  117.166 1.00 48.38 ? 76  TRP A CZ2   1 
ATOM   574   C CZ3   . TRP A 1 79  ? 31.147  27.506  119.462 1.00 48.77 ? 76  TRP A CZ3   1 
ATOM   575   C CH2   . TRP A 1 79  ? 30.998  26.984  118.163 1.00 48.10 ? 76  TRP A CH2   1 
ATOM   576   N N     . SER A 1 80  ? 30.273  33.787  117.681 1.00 47.16 ? 77  SER A N     1 
ATOM   577   C CA    . SER A 1 80  ? 29.929  34.777  116.663 1.00 45.73 ? 77  SER A CA    1 
ATOM   578   C C     . SER A 1 80  ? 29.603  34.012  115.396 1.00 44.25 ? 77  SER A C     1 
ATOM   579   O O     . SER A 1 80  ? 30.098  32.905  115.199 1.00 45.46 ? 77  SER A O     1 
ATOM   580   C CB    . SER A 1 80  ? 31.103  35.716  116.393 1.00 46.14 ? 77  SER A CB    1 
ATOM   581   O OG    . SER A 1 80  ? 32.239  34.996  115.948 1.00 46.38 ? 77  SER A OG    1 
ATOM   582   N N     . SER A 1 81  ? 28.763  34.597  114.548 1.00 42.46 ? 78  SER A N     1 
ATOM   583   C CA    . SER A 1 81  ? 28.370  33.977  113.285 1.00 40.69 ? 78  SER A CA    1 
ATOM   584   C C     . SER A 1 81  ? 29.389  34.258  112.193 1.00 38.52 ? 78  SER A C     1 
ATOM   585   O O     . SER A 1 81  ? 30.094  35.264  112.236 1.00 36.56 ? 78  SER A O     1 
ATOM   586   C CB    . SER A 1 81  ? 27.006  34.505  112.837 1.00 42.50 ? 78  SER A CB    1 
ATOM   587   O OG    . SER A 1 81  ? 26.668  34.035  111.542 1.00 42.73 ? 78  SER A OG    1 
ATOM   588   N N     . CYS A 1 82  ? 29.462  33.358  111.218 1.00 37.38 ? 79  CYS A N     1 
ATOM   589   C CA    . CYS A 1 82  ? 30.382  33.509  110.104 1.00 37.74 ? 79  CYS A CA    1 
ATOM   590   C C     . CYS A 1 82  ? 29.671  34.063  108.864 1.00 38.20 ? 79  CYS A C     1 
ATOM   591   O O     . CYS A 1 82  ? 30.194  33.997  107.752 1.00 38.40 ? 79  CYS A O     1 
ATOM   592   C CB    . CYS A 1 82  ? 31.041  32.166  109.779 1.00 38.59 ? 79  CYS A CB    1 
ATOM   593   S SG    . CYS A 1 82  ? 29.900  30.871  109.250 1.00 37.86 ? 79  CYS A SG    1 
ATOM   594   N N     . ASN A 1 83  ? 28.477  34.616  109.066 1.00 38.91 ? 80  ASN A N     1 
ATOM   595   C CA    . ASN A 1 83  ? 27.698  35.206  107.974 1.00 38.78 ? 80  ASN A CA    1 
ATOM   596   C C     . ASN A 1 83  ? 26.691  36.216  108.527 1.00 38.19 ? 80  ASN A C     1 
ATOM   597   O O     . ASN A 1 83  ? 26.080  36.002  109.572 1.00 39.03 ? 80  ASN A O     1 
ATOM   598   C CB    . ASN A 1 83  ? 26.974  34.118  107.168 1.00 37.21 ? 80  ASN A CB    1 
ATOM   599   C CG    . ASN A 1 83  ? 26.515  34.608  105.802 1.00 36.39 ? 80  ASN A CG    1 
ATOM   600   O OD1   . ASN A 1 83  ? 25.484  35.258  105.677 1.00 36.44 ? 80  ASN A OD1   1 
ATOM   601   N ND2   . ASN A 1 83  ? 27.294  34.299  104.771 1.00 36.42 ? 80  ASN A ND2   1 
ATOM   602   N N     . ILE A 1 84  ? 26.522  37.313  107.801 1.00 37.72 ? 81  ILE A N     1 
ATOM   603   C CA    . ILE A 1 84  ? 25.626  38.389  108.193 1.00 36.95 ? 81  ILE A CA    1 
ATOM   604   C C     . ILE A 1 84  ? 24.129  38.108  108.089 1.00 36.83 ? 81  ILE A C     1 
ATOM   605   O O     . ILE A 1 84  ? 23.314  38.953  108.471 1.00 39.13 ? 81  ILE A O     1 
ATOM   606   C CB    . ILE A 1 84  ? 25.945  39.652  107.377 1.00 37.54 ? 81  ILE A CB    1 
ATOM   607   C CG1   . ILE A 1 84  ? 25.804  39.349  105.880 1.00 37.46 ? 81  ILE A CG1   1 
ATOM   608   C CG2   . ILE A 1 84  ? 27.368  40.103  107.680 1.00 36.50 ? 81  ILE A CG2   1 
ATOM   609   C CD1   . ILE A 1 84  ? 25.883  40.568  104.987 1.00 36.78 ? 81  ILE A CD1   1 
ATOM   610   N N     . PHE A 1 85  ? 23.755  36.938  107.581 1.00 34.86 ? 82  PHE A N     1 
ATOM   611   C CA    . PHE A 1 85  ? 22.339  36.604  107.457 1.00 34.22 ? 82  PHE A CA    1 
ATOM   612   C C     . PHE A 1 85  ? 21.970  35.216  107.978 1.00 34.15 ? 82  PHE A C     1 
ATOM   613   O O     . PHE A 1 85  ? 20.795  34.885  108.077 1.00 34.69 ? 82  PHE A O     1 
ATOM   614   C CB    . PHE A 1 85  ? 21.888  36.687  106.003 1.00 33.11 ? 82  PHE A CB    1 
ATOM   615   C CG    . PHE A 1 85  ? 22.033  38.043  105.397 1.00 33.96 ? 82  PHE A CG    1 
ATOM   616   C CD1   . PHE A 1 85  ? 21.603  39.178  106.083 1.00 32.06 ? 82  PHE A CD1   1 
ATOM   617   C CD2   . PHE A 1 85  ? 22.560  38.188  104.115 1.00 32.08 ? 82  PHE A CD2   1 
ATOM   618   C CE1   . PHE A 1 85  ? 21.692  40.435  105.501 1.00 29.90 ? 82  PHE A CE1   1 
ATOM   619   C CE2   . PHE A 1 85  ? 22.653  39.443  103.525 1.00 32.33 ? 82  PHE A CE2   1 
ATOM   620   C CZ    . PHE A 1 85  ? 22.217  40.566  104.219 1.00 30.91 ? 82  PHE A CZ    1 
ATOM   621   N N     . SER A 1 86  ? 22.965  34.402  108.306 1.00 33.83 ? 83  SER A N     1 
ATOM   622   C CA    . SER A 1 86  ? 22.700  33.047  108.773 1.00 32.85 ? 83  SER A CA    1 
ATOM   623   C C     . SER A 1 86  ? 22.248  32.953  110.217 1.00 31.97 ? 83  SER A C     1 
ATOM   624   O O     . SER A 1 86  ? 21.761  31.914  110.654 1.00 31.33 ? 83  SER A O     1 
ATOM   625   C CB    . SER A 1 86  ? 23.940  32.179  108.591 1.00 31.42 ? 83  SER A CB    1 
ATOM   626   O OG    . SER A 1 86  ? 24.999  32.641  109.410 1.00 30.91 ? 83  SER A OG    1 
ATOM   627   N N     . THR A 1 87  ? 22.409  34.035  110.961 1.00 32.78 ? 84  THR A N     1 
ATOM   628   C CA    . THR A 1 87  ? 22.014  34.021  112.357 1.00 33.21 ? 84  THR A CA    1 
ATOM   629   C C     . THR A 1 87  ? 20.502  33.971  112.530 1.00 33.46 ? 84  THR A C     1 
ATOM   630   O O     . THR A 1 87  ? 19.763  34.636  111.809 1.00 32.07 ? 84  THR A O     1 
ATOM   631   C CB    . THR A 1 87  ? 22.564  35.253  113.098 1.00 32.73 ? 84  THR A CB    1 
ATOM   632   O OG1   . THR A 1 87  ? 23.996  35.224  113.074 1.00 33.85 ? 84  THR A OG1   1 
ATOM   633   C CG2   . THR A 1 87  ? 22.087  35.264  114.540 1.00 32.09 ? 84  THR A CG2   1 
ATOM   634   N N     . GLN A 1 88  ? 20.064  33.156  113.487 1.00 35.12 ? 85  GLN A N     1 
ATOM   635   C CA    . GLN A 1 88  ? 18.651  33.005  113.827 1.00 37.89 ? 85  GLN A CA    1 
ATOM   636   C C     . GLN A 1 88  ? 18.495  33.615  115.224 1.00 39.94 ? 85  GLN A C     1 
ATOM   637   O O     . GLN A 1 88  ? 18.814  32.984  116.231 1.00 41.43 ? 85  GLN A O     1 
ATOM   638   C CB    . GLN A 1 88  ? 18.262  31.526  113.837 1.00 36.72 ? 85  GLN A CB    1 
ATOM   639   C CG    . GLN A 1 88  ? 18.550  30.834  112.514 1.00 37.49 ? 85  GLN A CG    1 
ATOM   640   C CD    . GLN A 1 88  ? 18.356  29.324  112.545 1.00 38.11 ? 85  GLN A CD    1 
ATOM   641   O OE1   . GLN A 1 88  ? 18.493  28.660  111.517 1.00 37.21 ? 85  GLN A OE1   1 
ATOM   642   N NE2   . GLN A 1 88  ? 18.041  28.775  113.719 1.00 36.38 ? 85  GLN A NE2   1 
ATOM   643   N N     . ASP A 1 89  ? 18.011  34.854  115.260 1.00 40.47 ? 86  ASP A N     1 
ATOM   644   C CA    . ASP A 1 89  ? 17.827  35.616  116.489 1.00 40.81 ? 86  ASP A CA    1 
ATOM   645   C C     . ASP A 1 89  ? 17.310  34.896  117.732 1.00 41.61 ? 86  ASP A C     1 
ATOM   646   O O     . ASP A 1 89  ? 17.878  35.046  118.812 1.00 42.28 ? 86  ASP A O     1 
ATOM   647   C CB    . ASP A 1 89  ? 16.938  36.826  116.202 1.00 40.05 ? 86  ASP A CB    1 
ATOM   648   C CG    . ASP A 1 89  ? 17.503  37.712  115.113 1.00 38.78 ? 86  ASP A CG    1 
ATOM   649   O OD1   . ASP A 1 89  ? 18.716  37.920  115.039 1.00 38.05 ? 86  ASP A OD1   1 
ATOM   650   O OD2   . ASP A 1 89  ? 16.630  38.247  114.266 1.00 39.17 ? 86  ASP A OD2   1 
ATOM   651   N N     . HIS A 1 90  ? 16.232  34.134  117.605 1.00 42.95 ? 87  HIS A N     1 
ATOM   652   C CA    . HIS A 1 90  ? 15.694  33.441  118.766 1.00 44.64 ? 87  HIS A CA    1 
ATOM   653   C C     . HIS A 1 90  ? 16.702  32.438  119.323 1.00 46.07 ? 87  HIS A C     1 
ATOM   654   O O     . HIS A 1 90  ? 16.727  32.177  120.528 1.00 46.77 ? 87  HIS A O     1 
ATOM   655   C CB    . HIS A 1 90  ? 14.373  32.745  118.415 1.00 45.22 ? 87  HIS A CB    1 
ATOM   656   C CG    . HIS A 1 90  ? 14.513  31.607  117.454 1.00 45.90 ? 87  HIS A CG    1 
ATOM   657   N ND1   . HIS A 1 90  ? 15.099  31.745  116.215 1.00 47.30 ? 87  HIS A ND1   1 
ATOM   658   C CD2   . HIS A 1 90  ? 14.113  30.316  117.538 1.00 45.92 ? 87  HIS A CD2   1 
ATOM   659   C CE1   . HIS A 1 90  ? 15.055  30.590  115.575 1.00 46.28 ? 87  HIS A CE1   1 
ATOM   660   N NE2   . HIS A 1 90  ? 14.461  29.707  116.357 1.00 45.87 ? 87  HIS A NE2   1 
ATOM   661   N N     . ALA A 1 91  ? 17.537  31.882  118.449 1.00 45.42 ? 88  ALA A N     1 
ATOM   662   C CA    . ALA A 1 91  ? 18.546  30.924  118.877 1.00 45.32 ? 88  ALA A CA    1 
ATOM   663   C C     . ALA A 1 91  ? 19.689  31.669  119.583 1.00 44.95 ? 88  ALA A C     1 
ATOM   664   O O     . ALA A 1 91  ? 20.148  31.260  120.657 1.00 44.34 ? 88  ALA A O     1 
ATOM   665   C CB    . ALA A 1 91  ? 19.077  30.143  117.671 1.00 44.58 ? 88  ALA A CB    1 
ATOM   666   N N     . ALA A 1 92  ? 20.135  32.765  118.971 1.00 43.50 ? 89  ALA A N     1 
ATOM   667   C CA    . ALA A 1 92  ? 21.202  33.592  119.522 1.00 42.60 ? 89  ALA A CA    1 
ATOM   668   C C     . ALA A 1 92  ? 20.774  34.159  120.880 1.00 43.41 ? 89  ALA A C     1 
ATOM   669   O O     . ALA A 1 92  ? 21.611  34.433  121.746 1.00 43.26 ? 89  ALA A O     1 
ATOM   670   C CB    . ALA A 1 92  ? 21.532  34.727  118.556 1.00 40.71 ? 89  ALA A CB    1 
ATOM   671   N N     . ALA A 1 93  ? 19.467  34.330  121.053 1.00 43.70 ? 90  ALA A N     1 
ATOM   672   C CA    . ALA A 1 93  ? 18.916  34.846  122.296 1.00 45.72 ? 90  ALA A CA    1 
ATOM   673   C C     . ALA A 1 93  ? 19.051  33.809  123.413 1.00 46.74 ? 90  ALA A C     1 
ATOM   674   O O     . ALA A 1 93  ? 19.558  34.109  124.496 1.00 47.09 ? 90  ALA A O     1 
ATOM   675   C CB    . ALA A 1 93  ? 17.447  35.217  122.104 1.00 45.53 ? 90  ALA A CB    1 
ATOM   676   N N     . ALA A 1 94  ? 18.606  32.587  123.145 1.00 45.79 ? 91  ALA A N     1 
ATOM   677   C CA    . ALA A 1 94  ? 18.686  31.535  124.140 1.00 45.68 ? 91  ALA A CA    1 
ATOM   678   C C     . ALA A 1 94  ? 20.097  31.435  124.718 1.00 45.53 ? 91  ALA A C     1 
ATOM   679   O O     . ALA A 1 94  ? 20.281  31.431  125.938 1.00 45.16 ? 91  ALA A O     1 
ATOM   680   C CB    . ALA A 1 94  ? 18.267  30.204  123.530 1.00 46.54 ? 91  ALA A CB    1 
ATOM   681   N N     . ILE A 1 95  ? 21.095  31.360  123.847 1.00 44.43 ? 92  ILE A N     1 
ATOM   682   C CA    . ILE A 1 95  ? 22.467  31.269  124.316 1.00 44.66 ? 92  ILE A CA    1 
ATOM   683   C C     . ILE A 1 95  ? 22.819  32.485  125.165 1.00 44.93 ? 92  ILE A C     1 
ATOM   684   O O     . ILE A 1 95  ? 23.500  32.363  126.187 1.00 45.17 ? 92  ILE A O     1 
ATOM   685   C CB    . ILE A 1 95  ? 23.461  31.181  123.145 1.00 44.41 ? 92  ILE A CB    1 
ATOM   686   C CG1   . ILE A 1 95  ? 23.194  29.914  122.330 1.00 45.45 ? 92  ILE A CG1   1 
ATOM   687   C CG2   . ILE A 1 95  ? 24.875  31.151  123.672 1.00 43.64 ? 92  ILE A CG2   1 
ATOM   688   C CD1   . ILE A 1 95  ? 23.391  28.629  123.116 1.00 44.00 ? 92  ILE A CD1   1 
ATOM   689   N N     . ALA A 1 96  ? 22.350  33.656  124.743 1.00 44.71 ? 93  ALA A N     1 
ATOM   690   C CA    . ALA A 1 96  ? 22.623  34.896  125.464 1.00 44.11 ? 93  ALA A CA    1 
ATOM   691   C C     . ALA A 1 96  ? 22.036  34.821  126.869 1.00 43.74 ? 93  ALA A C     1 
ATOM   692   O O     . ALA A 1 96  ? 22.719  35.095  127.855 1.00 42.54 ? 93  ALA A O     1 
ATOM   693   C CB    . ALA A 1 96  ? 22.042  36.079  124.713 1.00 43.36 ? 93  ALA A CB    1 
ATOM   694   N N     . LYS A 1 97  ? 20.766  34.440  126.949 1.00 43.49 ? 94  LYS A N     1 
ATOM   695   C CA    . LYS A 1 97  ? 20.077  34.305  128.226 1.00 43.90 ? 94  LYS A CA    1 
ATOM   696   C C     . LYS A 1 97  ? 20.787  33.286  129.108 1.00 43.25 ? 94  LYS A C     1 
ATOM   697   O O     . LYS A 1 97  ? 20.815  33.427  130.323 1.00 44.56 ? 94  LYS A O     1 
ATOM   698   C CB    . LYS A 1 97  ? 18.631  33.853  128.002 1.00 45.15 ? 94  LYS A CB    1 
ATOM   699   C CG    . LYS A 1 97  ? 17.857  33.580  129.283 1.00 45.35 ? 94  LYS A CG    1 
ATOM   700   C CD    . LYS A 1 97  ? 17.586  34.863  130.064 1.00 48.17 ? 94  LYS A CD    1 
ATOM   701   C CE    . LYS A 1 97  ? 16.609  35.775  129.335 1.00 48.22 ? 94  LYS A CE    1 
ATOM   702   N NZ    . LYS A 1 97  ? 15.262  35.156  129.215 1.00 49.70 ? 94  LYS A NZ    1 
ATOM   703   N N     . ALA A 1 98  ? 21.356  32.260  128.484 1.00 42.73 ? 95  ALA A N     1 
ATOM   704   C CA    . ALA A 1 98  ? 22.066  31.216  129.215 1.00 42.16 ? 95  ALA A CA    1 
ATOM   705   C C     . ALA A 1 98  ? 23.421  31.689  129.740 1.00 40.80 ? 95  ALA A C     1 
ATOM   706   O O     . ALA A 1 98  ? 24.170  30.912  130.326 1.00 38.49 ? 95  ALA A O     1 
ATOM   707   C CB    . ALA A 1 98  ? 22.245  29.973  128.325 1.00 43.18 ? 95  ALA A CB    1 
ATOM   708   N N     . GLY A 1 99  ? 23.735  32.959  129.516 1.00 40.81 ? 96  GLY A N     1 
ATOM   709   C CA    . GLY A 1 99  ? 24.988  33.498  130.010 1.00 42.18 ? 96  GLY A CA    1 
ATOM   710   C C     . GLY A 1 99  ? 26.239  33.126  129.239 1.00 42.38 ? 96  GLY A C     1 
ATOM   711   O O     . GLY A 1 99  ? 27.275  32.788  129.829 1.00 42.81 ? 96  GLY A O     1 
ATOM   712   N N     . ILE A 1 100 ? 26.156  33.210  127.917 1.00 41.61 ? 97  ILE A N     1 
ATOM   713   C CA    . ILE A 1 100 ? 27.289  32.884  127.070 1.00 40.74 ? 97  ILE A CA    1 
ATOM   714   C C     . ILE A 1 100 ? 27.507  34.025  126.085 1.00 39.89 ? 97  ILE A C     1 
ATOM   715   O O     . ILE A 1 100 ? 26.595  34.391  125.348 1.00 39.83 ? 97  ILE A O     1 
ATOM   716   C CB    . ILE A 1 100 ? 27.024  31.573  126.303 1.00 40.41 ? 97  ILE A CB    1 
ATOM   717   C CG1   . ILE A 1 100 ? 26.618  30.470  127.288 1.00 39.93 ? 97  ILE A CG1   1 
ATOM   718   C CG2   . ILE A 1 100 ? 28.262  31.181  125.521 1.00 40.77 ? 97  ILE A CG2   1 
ATOM   719   C CD1   . ILE A 1 100 ? 26.204  29.161  126.641 1.00 37.96 ? 97  ILE A CD1   1 
ATOM   720   N N     . PRO A 1 101 ? 28.714  34.617  126.075 1.00 40.61 ? 98  PRO A N     1 
ATOM   721   C CA    . PRO A 1 101 ? 29.081  35.730  125.185 1.00 41.25 ? 98  PRO A CA    1 
ATOM   722   C C     . PRO A 1 101 ? 28.849  35.409  123.709 1.00 42.19 ? 98  PRO A C     1 
ATOM   723   O O     . PRO A 1 101 ? 29.640  34.687  123.090 1.00 41.95 ? 98  PRO A O     1 
ATOM   724   C CB    . PRO A 1 101 ? 30.565  35.940  125.483 1.00 40.37 ? 98  PRO A CB    1 
ATOM   725   C CG    . PRO A 1 101 ? 30.676  35.556  126.909 1.00 41.74 ? 98  PRO A CG    1 
ATOM   726   C CD    . PRO A 1 101 ? 29.825  34.296  126.985 1.00 41.37 ? 98  PRO A CD    1 
ATOM   727   N N     . VAL A 1 102 ? 27.764  35.939  123.152 1.00 42.22 ? 99  VAL A N     1 
ATOM   728   C CA    . VAL A 1 102 ? 27.435  35.717  121.747 1.00 43.14 ? 99  VAL A CA    1 
ATOM   729   C C     . VAL A 1 102 ? 27.222  37.041  121.037 1.00 43.49 ? 99  VAL A C     1 
ATOM   730   O O     . VAL A 1 102 ? 26.421  37.864  121.469 1.00 44.12 ? 99  VAL A O     1 
ATOM   731   C CB    . VAL A 1 102 ? 26.157  34.862  121.575 1.00 43.11 ? 99  VAL A CB    1 
ATOM   732   C CG1   . VAL A 1 102 ? 26.452  33.414  121.897 1.00 44.19 ? 99  VAL A CG1   1 
ATOM   733   C CG2   . VAL A 1 102 ? 25.049  35.384  122.485 1.00 43.87 ? 99  VAL A CG2   1 
ATOM   734   N N     . TYR A 1 103 ? 27.944  37.253  119.948 1.00 43.56 ? 100 TYR A N     1 
ATOM   735   C CA    . TYR A 1 103 ? 27.799  38.487  119.201 1.00 44.41 ? 100 TYR A CA    1 
ATOM   736   C C     . TYR A 1 103 ? 27.397  38.157  117.780 1.00 43.78 ? 100 TYR A C     1 
ATOM   737   O O     . TYR A 1 103 ? 28.243  37.907  116.922 1.00 43.18 ? 100 TYR A O     1 
ATOM   738   C CB    . TYR A 1 103 ? 29.109  39.279  119.222 1.00 45.78 ? 100 TYR A CB    1 
ATOM   739   C CG    . TYR A 1 103 ? 29.680  39.407  120.610 1.00 49.40 ? 100 TYR A CG    1 
ATOM   740   C CD1   . TYR A 1 103 ? 30.521  38.422  121.130 1.00 50.71 ? 100 TYR A CD1   1 
ATOM   741   C CD2   . TYR A 1 103 ? 29.337  40.481  121.432 1.00 51.12 ? 100 TYR A CD2   1 
ATOM   742   C CE1   . TYR A 1 103 ? 31.004  38.504  122.433 1.00 52.58 ? 100 TYR A CE1   1 
ATOM   743   C CE2   . TYR A 1 103 ? 29.813  40.572  122.739 1.00 52.25 ? 100 TYR A CE2   1 
ATOM   744   C CZ    . TYR A 1 103 ? 30.646  39.580  123.231 1.00 53.00 ? 100 TYR A CZ    1 
ATOM   745   O OH    . TYR A 1 103 ? 31.118  39.658  124.518 1.00 53.85 ? 100 TYR A OH    1 
ATOM   746   N N     . ALA A 1 104 ? 26.090  38.147  117.545 1.00 43.63 ? 101 ALA A N     1 
ATOM   747   C CA    . ALA A 1 104 ? 25.552  37.842  116.228 1.00 44.17 ? 101 ALA A CA    1 
ATOM   748   C C     . ALA A 1 104 ? 24.054  38.087  116.154 1.00 44.02 ? 101 ALA A C     1 
ATOM   749   O O     . ALA A 1 104 ? 23.327  37.900  117.135 1.00 43.54 ? 101 ALA A O     1 
ATOM   750   C CB    . ALA A 1 104 ? 25.847  36.397  115.866 1.00 45.16 ? 101 ALA A CB    1 
ATOM   751   N N     . TRP A 1 105 ? 23.608  38.507  114.976 1.00 43.34 ? 102 TRP A N     1 
ATOM   752   C CA    . TRP A 1 105 ? 22.204  38.772  114.730 1.00 43.35 ? 102 TRP A CA    1 
ATOM   753   C C     . TRP A 1 105 ? 21.989  38.768  113.230 1.00 43.26 ? 102 TRP A C     1 
ATOM   754   O O     . TRP A 1 105 ? 22.946  38.906  112.463 1.00 43.08 ? 102 TRP A O     1 
ATOM   755   C CB    . TRP A 1 105 ? 21.805  40.119  115.340 1.00 43.75 ? 102 TRP A CB    1 
ATOM   756   C CG    . TRP A 1 105 ? 22.598  41.294  114.839 1.00 44.15 ? 102 TRP A CG    1 
ATOM   757   C CD1   . TRP A 1 105 ? 22.335  42.054  113.734 1.00 44.80 ? 102 TRP A CD1   1 
ATOM   758   C CD2   . TRP A 1 105 ? 23.779  41.849  115.434 1.00 44.37 ? 102 TRP A CD2   1 
ATOM   759   N NE1   . TRP A 1 105 ? 23.275  43.049  113.606 1.00 44.24 ? 102 TRP A NE1   1 
ATOM   760   C CE2   . TRP A 1 105 ? 24.173  42.946  114.636 1.00 45.29 ? 102 TRP A CE2   1 
ATOM   761   C CE3   . TRP A 1 105 ? 24.542  41.525  116.564 1.00 43.69 ? 102 TRP A CE3   1 
ATOM   762   C CZ2   . TRP A 1 105 ? 25.297  43.723  114.932 1.00 45.12 ? 102 TRP A CZ2   1 
ATOM   763   C CZ3   . TRP A 1 105 ? 25.661  42.299  116.859 1.00 44.43 ? 102 TRP A CZ3   1 
ATOM   764   C CH2   . TRP A 1 105 ? 26.027  43.386  116.044 1.00 44.44 ? 102 TRP A CH2   1 
ATOM   765   N N     . LYS A 1 106 ? 20.740  38.588  112.817 1.00 43.47 ? 103 LYS A N     1 
ATOM   766   C CA    . LYS A 1 106 ? 20.388  38.555  111.405 1.00 44.07 ? 103 LYS A CA    1 
ATOM   767   C C     . LYS A 1 106 ? 20.300  39.971  110.847 1.00 44.71 ? 103 LYS A C     1 
ATOM   768   O O     . LYS A 1 106 ? 19.540  40.794  111.360 1.00 45.55 ? 103 LYS A O     1 
ATOM   769   C CB    . LYS A 1 106 ? 19.040  37.844  111.227 1.00 43.66 ? 103 LYS A CB    1 
ATOM   770   C CG    . LYS A 1 106 ? 18.688  37.485  109.797 1.00 40.69 ? 103 LYS A CG    1 
ATOM   771   C CD    . LYS A 1 106 ? 17.449  36.609  109.761 1.00 40.96 ? 103 LYS A CD    1 
ATOM   772   C CE    . LYS A 1 106 ? 17.100  36.156  108.341 1.00 42.21 ? 103 LYS A CE    1 
ATOM   773   N NZ    . LYS A 1 106 ? 18.084  35.204  107.739 1.00 41.51 ? 103 LYS A NZ    1 
ATOM   774   N N     . GLY A 1 107 ? 21.079  40.247  109.800 1.00 45.53 ? 104 GLY A N     1 
ATOM   775   C CA    . GLY A 1 107 ? 21.072  41.563  109.176 1.00 45.32 ? 104 GLY A CA    1 
ATOM   776   C C     . GLY A 1 107 ? 22.319  42.387  109.446 1.00 44.88 ? 104 GLY A C     1 
ATOM   777   O O     . GLY A 1 107 ? 22.354  43.591  109.173 1.00 45.09 ? 104 GLY A O     1 
ATOM   778   N N     . GLU A 1 108 ? 23.346  41.741  109.983 1.00 43.52 ? 105 GLU A N     1 
ATOM   779   C CA    . GLU A 1 108 ? 24.597  42.419  110.298 1.00 42.02 ? 105 GLU A CA    1 
ATOM   780   C C     . GLU A 1 108 ? 25.190  43.180  109.113 1.00 42.02 ? 105 GLU A C     1 
ATOM   781   O O     . GLU A 1 108 ? 24.767  43.012  107.970 1.00 41.74 ? 105 GLU A O     1 
ATOM   782   C CB    . GLU A 1 108 ? 25.625  41.404  110.814 1.00 40.87 ? 105 GLU A CB    1 
ATOM   783   C CG    . GLU A 1 108 ? 25.332  40.863  112.206 1.00 40.11 ? 105 GLU A CG    1 
ATOM   784   C CD    . GLU A 1 108 ? 26.358  39.839  112.662 1.00 39.58 ? 105 GLU A CD    1 
ATOM   785   O OE1   . GLU A 1 108 ? 27.553  40.015  112.349 1.00 39.92 ? 105 GLU A OE1   1 
ATOM   786   O OE2   . GLU A 1 108 ? 25.976  38.867  113.345 1.00 37.72 ? 105 GLU A OE2   1 
ATOM   787   N N     . THR A 1 109 ? 26.158  44.041  109.411 1.00 42.85 ? 106 THR A N     1 
ATOM   788   C CA    . THR A 1 109 ? 26.856  44.818  108.395 1.00 42.49 ? 106 THR A CA    1 
ATOM   789   C C     . THR A 1 109 ? 28.310  44.392  108.512 1.00 43.73 ? 106 THR A C     1 
ATOM   790   O O     . THR A 1 109 ? 28.759  43.986  109.583 1.00 43.94 ? 106 THR A O     1 
ATOM   791   C CB    . THR A 1 109 ? 26.769  46.340  108.638 1.00 41.46 ? 106 THR A CB    1 
ATOM   792   O OG1   . THR A 1 109 ? 27.536  46.693  109.793 1.00 41.76 ? 106 THR A OG1   1 
ATOM   793   C CG2   . THR A 1 109 ? 25.335  46.762  108.840 1.00 41.73 ? 106 THR A CG2   1 
ATOM   794   N N     . ASP A 1 110 ? 29.039  44.479  107.408 1.00 45.20 ? 107 ASP A N     1 
ATOM   795   C CA    . ASP A 1 110 ? 30.440  44.085  107.373 1.00 46.40 ? 107 ASP A CA    1 
ATOM   796   C C     . ASP A 1 110 ? 31.192  44.571  108.604 1.00 46.36 ? 107 ASP A C     1 
ATOM   797   O O     . ASP A 1 110 ? 31.910  43.813  109.250 1.00 46.28 ? 107 ASP A O     1 
ATOM   798   C CB    . ASP A 1 110 ? 31.085  44.636  106.103 1.00 48.95 ? 107 ASP A CB    1 
ATOM   799   C CG    . ASP A 1 110 ? 30.282  44.301  104.853 1.00 51.64 ? 107 ASP A CG    1 
ATOM   800   O OD1   . ASP A 1 110 ? 30.210  43.110  104.484 1.00 51.24 ? 107 ASP A OD1   1 
ATOM   801   O OD2   . ASP A 1 110 ? 29.710  45.234  104.243 1.00 56.00 ? 107 ASP A OD2   1 
ATOM   802   N N     . GLU A 1 111 ? 31.021  45.842  108.936 1.00 47.03 ? 108 GLU A N     1 
ATOM   803   C CA    . GLU A 1 111 ? 31.697  46.412  110.088 1.00 47.12 ? 108 GLU A CA    1 
ATOM   804   C C     . GLU A 1 111 ? 31.335  45.650  111.355 1.00 46.34 ? 108 GLU A C     1 
ATOM   805   O O     . GLU A 1 111 ? 32.212  45.297  112.149 1.00 46.26 ? 108 GLU A O     1 
ATOM   806   C CB    . GLU A 1 111 ? 31.314  47.886  110.263 1.00 49.85 ? 108 GLU A CB    1 
ATOM   807   C CG    . GLU A 1 111 ? 31.567  48.788  109.051 1.00 53.96 ? 108 GLU A CG    1 
ATOM   808   C CD    . GLU A 1 111 ? 30.474  48.691  107.984 1.00 55.78 ? 108 GLU A CD    1 
ATOM   809   O OE1   . GLU A 1 111 ? 30.515  47.751  107.155 1.00 56.01 ? 108 GLU A OE1   1 
ATOM   810   O OE2   . GLU A 1 111 ? 29.569  49.556  107.982 1.00 56.15 ? 108 GLU A OE2   1 
ATOM   811   N N     . GLU A 1 112 ? 30.041  45.395  111.537 1.00 43.53 ? 109 GLU A N     1 
ATOM   812   C CA    . GLU A 1 112 ? 29.559  44.687  112.722 1.00 41.25 ? 109 GLU A CA    1 
ATOM   813   C C     . GLU A 1 112 ? 29.976  43.225  112.711 1.00 40.09 ? 109 GLU A C     1 
ATOM   814   O O     . GLU A 1 112 ? 30.095  42.600  113.770 1.00 39.35 ? 109 GLU A O     1 
ATOM   815   C CB    . GLU A 1 112 ? 28.038  44.784  112.816 1.00 41.53 ? 109 GLU A CB    1 
ATOM   816   C CG    . GLU A 1 112 ? 27.502  46.198  112.766 1.00 41.77 ? 109 GLU A CG    1 
ATOM   817   C CD    . GLU A 1 112 ? 25.989  46.246  112.738 1.00 43.59 ? 109 GLU A CD    1 
ATOM   818   O OE1   . GLU A 1 112 ? 25.389  45.577  111.873 1.00 41.97 ? 109 GLU A OE1   1 
ATOM   819   O OE2   . GLU A 1 112 ? 25.396  46.959  113.580 1.00 45.56 ? 109 GLU A OE2   1 
ATOM   820   N N     . TYR A 1 113 ? 30.184  42.681  111.513 1.00 39.05 ? 110 TYR A N     1 
ATOM   821   C CA    . TYR A 1 113 ? 30.599  41.291  111.361 1.00 39.30 ? 110 TYR A CA    1 
ATOM   822   C C     . TYR A 1 113 ? 32.001  41.141  111.947 1.00 38.04 ? 110 TYR A C     1 
ATOM   823   O O     . TYR A 1 113 ? 32.235  40.288  112.804 1.00 35.86 ? 110 TYR A O     1 
ATOM   824   C CB    . TYR A 1 113 ? 30.603  40.881  109.875 1.00 42.10 ? 110 TYR A CB    1 
ATOM   825   C CG    . TYR A 1 113 ? 31.121  39.472  109.628 1.00 43.80 ? 110 TYR A CG    1 
ATOM   826   C CD1   . TYR A 1 113 ? 30.366  38.348  109.990 1.00 44.67 ? 110 TYR A CD1   1 
ATOM   827   C CD2   . TYR A 1 113 ? 32.392  39.263  109.092 1.00 44.14 ? 110 TYR A CD2   1 
ATOM   828   C CE1   . TYR A 1 113 ? 30.875  37.050  109.826 1.00 44.17 ? 110 TYR A CE1   1 
ATOM   829   C CE2   . TYR A 1 113 ? 32.909  37.968  108.928 1.00 44.73 ? 110 TYR A CE2   1 
ATOM   830   C CZ    . TYR A 1 113 ? 32.147  36.873  109.299 1.00 44.19 ? 110 TYR A CZ    1 
ATOM   831   O OH    . TYR A 1 113 ? 32.673  35.613  109.156 1.00 44.86 ? 110 TYR A OH    1 
ATOM   832   N N     . LEU A 1 114 ? 32.922  41.978  111.474 1.00 36.34 ? 111 LEU A N     1 
ATOM   833   C CA    . LEU A 1 114 ? 34.297  41.979  111.958 1.00 37.23 ? 111 LEU A CA    1 
ATOM   834   C C     . LEU A 1 114 ? 34.293  42.168  113.473 1.00 38.57 ? 111 LEU A C     1 
ATOM   835   O O     . LEU A 1 114 ? 34.938  41.417  114.214 1.00 38.42 ? 111 LEU A O     1 
ATOM   836   C CB    . LEU A 1 114 ? 35.067  43.118  111.297 1.00 36.66 ? 111 LEU A CB    1 
ATOM   837   C CG    . LEU A 1 114 ? 36.452  43.450  111.850 1.00 38.18 ? 111 LEU A CG    1 
ATOM   838   C CD1   . LEU A 1 114 ? 37.378  42.271  111.641 1.00 37.21 ? 111 LEU A CD1   1 
ATOM   839   C CD2   . LEU A 1 114 ? 37.000  44.697  111.166 1.00 37.01 ? 111 LEU A CD2   1 
ATOM   840   N N     . TRP A 1 115 ? 33.551  43.180  113.911 1.00 39.48 ? 112 TRP A N     1 
ATOM   841   C CA    . TRP A 1 115 ? 33.414  43.513  115.318 1.00 40.81 ? 112 TRP A CA    1 
ATOM   842   C C     . TRP A 1 115 ? 32.944  42.304  116.127 1.00 41.12 ? 112 TRP A C     1 
ATOM   843   O O     . TRP A 1 115 ? 33.595  41.906  117.092 1.00 42.07 ? 112 TRP A O     1 
ATOM   844   C CB    . TRP A 1 115 ? 32.410  44.664  115.485 1.00 41.52 ? 112 TRP A CB    1 
ATOM   845   C CG    . TRP A 1 115 ? 32.211  45.105  116.909 1.00 41.61 ? 112 TRP A CG    1 
ATOM   846   C CD1   . TRP A 1 115 ? 33.006  45.950  117.626 1.00 41.45 ? 112 TRP A CD1   1 
ATOM   847   C CD2   . TRP A 1 115 ? 31.181  44.669  117.805 1.00 42.30 ? 112 TRP A CD2   1 
ATOM   848   N NE1   . TRP A 1 115 ? 32.539  46.065  118.913 1.00 41.38 ? 112 TRP A NE1   1 
ATOM   849   C CE2   . TRP A 1 115 ? 31.421  45.290  119.051 1.00 40.97 ? 112 TRP A CE2   1 
ATOM   850   C CE3   . TRP A 1 115 ? 30.080  43.812  117.679 1.00 42.52 ? 112 TRP A CE3   1 
ATOM   851   C CZ2   . TRP A 1 115 ? 30.601  45.081  120.165 1.00 39.47 ? 112 TRP A CZ2   1 
ATOM   852   C CZ3   . TRP A 1 115 ? 29.263  43.606  118.789 1.00 42.72 ? 112 TRP A CZ3   1 
ATOM   853   C CH2   . TRP A 1 115 ? 29.529  44.238  120.014 1.00 40.12 ? 112 TRP A CH2   1 
ATOM   854   N N     . CYS A 1 116 ? 31.812  41.722  115.734 1.00 41.35 ? 113 CYS A N     1 
ATOM   855   C CA    . CYS A 1 116 ? 31.264  40.562  116.437 1.00 40.46 ? 113 CYS A CA    1 
ATOM   856   C C     . CYS A 1 116 ? 32.279  39.459  116.705 1.00 41.97 ? 113 CYS A C     1 
ATOM   857   O O     . CYS A 1 116 ? 32.236  38.818  117.753 1.00 42.78 ? 113 CYS A O     1 
ATOM   858   C CB    . CYS A 1 116 ? 30.082  39.969  115.668 1.00 38.52 ? 113 CYS A CB    1 
ATOM   859   S SG    . CYS A 1 116 ? 28.482  40.740  115.999 1.00 32.40 ? 113 CYS A SG    1 
ATOM   860   N N     . ILE A 1 117 ? 33.182  39.230  115.759 1.00 44.23 ? 114 ILE A N     1 
ATOM   861   C CA    . ILE A 1 117 ? 34.192  38.186  115.907 1.00 45.92 ? 114 ILE A CA    1 
ATOM   862   C C     . ILE A 1 117 ? 35.275  38.599  116.911 1.00 47.30 ? 114 ILE A C     1 
ATOM   863   O O     . ILE A 1 117 ? 35.650  37.826  117.802 1.00 47.19 ? 114 ILE A O     1 
ATOM   864   C CB    . ILE A 1 117 ? 34.855  37.864  114.539 1.00 45.88 ? 114 ILE A CB    1 
ATOM   865   C CG1   . ILE A 1 117 ? 33.784  37.432  113.526 1.00 46.26 ? 114 ILE A CG1   1 
ATOM   866   C CG2   . ILE A 1 117 ? 35.914  36.771  114.714 1.00 45.46 ? 114 ILE A CG2   1 
ATOM   867   C CD1   . ILE A 1 117 ? 34.317  37.121  112.122 1.00 43.36 ? 114 ILE A CD1   1 
ATOM   868   N N     . GLU A 1 118 ? 35.766  39.825  116.763 1.00 48.21 ? 115 GLU A N     1 
ATOM   869   C CA    . GLU A 1 118 ? 36.801  40.349  117.640 1.00 48.84 ? 115 GLU A CA    1 
ATOM   870   C C     . GLU A 1 118 ? 36.353  40.369  119.096 1.00 48.55 ? 115 GLU A C     1 
ATOM   871   O O     . GLU A 1 118 ? 37.177  40.324  120.011 1.00 49.31 ? 115 GLU A O     1 
ATOM   872   C CB    . GLU A 1 118 ? 37.196  41.755  117.190 1.00 49.60 ? 115 GLU A CB    1 
ATOM   873   C CG    . GLU A 1 118 ? 37.816  41.786  115.801 1.00 52.35 ? 115 GLU A CG    1 
ATOM   874   C CD    . GLU A 1 118 ? 38.317  43.165  115.419 1.00 54.39 ? 115 GLU A CD    1 
ATOM   875   O OE1   . GLU A 1 118 ? 37.500  44.112  115.410 1.00 55.19 ? 115 GLU A OE1   1 
ATOM   876   O OE2   . GLU A 1 118 ? 39.528  43.304  115.129 1.00 56.04 ? 115 GLU A OE2   1 
ATOM   877   N N     . GLN A 1 119 ? 35.045  40.423  119.314 1.00 47.20 ? 116 GLN A N     1 
ATOM   878   C CA    . GLN A 1 119 ? 34.527  40.436  120.672 1.00 46.72 ? 116 GLN A CA    1 
ATOM   879   C C     . GLN A 1 119 ? 34.611  39.052  121.306 1.00 46.82 ? 116 GLN A C     1 
ATOM   880   O O     . GLN A 1 119 ? 34.290  38.886  122.481 1.00 48.47 ? 116 GLN A O     1 
ATOM   881   C CB    . GLN A 1 119 ? 33.075  40.915  120.687 1.00 45.61 ? 116 GLN A CB    1 
ATOM   882   C CG    . GLN A 1 119 ? 32.862  42.278  120.041 1.00 46.04 ? 116 GLN A CG    1 
ATOM   883   C CD    . GLN A 1 119 ? 33.644  43.384  120.724 1.00 45.28 ? 116 GLN A CD    1 
ATOM   884   O OE1   . GLN A 1 119 ? 33.483  43.627  121.918 1.00 46.38 ? 116 GLN A OE1   1 
ATOM   885   N NE2   . GLN A 1 119 ? 34.495  44.059  119.970 1.00 44.11 ? 116 GLN A NE2   1 
ATOM   886   N N     . THR A 1 120 ? 35.052  38.062  120.537 1.00 46.16 ? 117 THR A N     1 
ATOM   887   C CA    . THR A 1 120 ? 35.150  36.697  121.047 1.00 45.96 ? 117 THR A CA    1 
ATOM   888   C C     . THR A 1 120 ? 36.596  36.224  121.237 1.00 45.57 ? 117 THR A C     1 
ATOM   889   O O     . THR A 1 120 ? 36.840  35.069  121.573 1.00 45.18 ? 117 THR A O     1 
ATOM   890   C CB    . THR A 1 120 ? 34.435  35.704  120.103 1.00 45.49 ? 117 THR A CB    1 
ATOM   891   O OG1   . THR A 1 120 ? 35.186  35.562  118.889 1.00 44.09 ? 117 THR A OG1   1 
ATOM   892   C CG2   . THR A 1 120 ? 33.047  36.210  119.762 1.00 44.18 ? 117 THR A CG2   1 
ATOM   893   N N     . LEU A 1 121 ? 37.553  37.119  121.023 1.00 45.39 ? 118 LEU A N     1 
ATOM   894   C CA    . LEU A 1 121 ? 38.957  36.762  121.151 1.00 46.00 ? 118 LEU A CA    1 
ATOM   895   C C     . LEU A 1 121 ? 39.433  36.636  122.590 1.00 47.96 ? 118 LEU A C     1 
ATOM   896   O O     . LEU A 1 121 ? 40.053  35.639  122.960 1.00 48.57 ? 118 LEU A O     1 
ATOM   897   C CB    . LEU A 1 121 ? 39.826  37.779  120.410 1.00 44.21 ? 118 LEU A CB    1 
ATOM   898   C CG    . LEU A 1 121 ? 39.563  37.865  118.902 1.00 43.87 ? 118 LEU A CG    1 
ATOM   899   C CD1   . LEU A 1 121 ? 40.522  38.847  118.246 1.00 41.32 ? 118 LEU A CD1   1 
ATOM   900   C CD2   . LEU A 1 121 ? 39.710  36.478  118.296 1.00 42.46 ? 118 LEU A CD2   1 
ATOM   901   N N     . TYR A 1 122 ? 39.144  37.636  123.411 1.00 49.89 ? 119 TYR A N     1 
ATOM   902   C CA    . TYR A 1 122 ? 39.594  37.582  124.791 1.00 51.58 ? 119 TYR A CA    1 
ATOM   903   C C     . TYR A 1 122 ? 38.501  37.207  125.787 1.00 52.39 ? 119 TYR A C     1 
ATOM   904   O O     . TYR A 1 122 ? 37.435  37.828  125.833 1.00 51.52 ? 119 TYR A O     1 
ATOM   905   C CB    . TYR A 1 122 ? 40.233  38.914  125.185 1.00 50.56 ? 119 TYR A CB    1 
ATOM   906   C CG    . TYR A 1 122 ? 41.399  39.307  124.307 1.00 50.56 ? 119 TYR A CG    1 
ATOM   907   C CD1   . TYR A 1 122 ? 41.195  39.957  123.091 1.00 50.17 ? 119 TYR A CD1   1 
ATOM   908   C CD2   . TYR A 1 122 ? 42.711  39.026  124.692 1.00 52.03 ? 119 TYR A CD2   1 
ATOM   909   C CE1   . TYR A 1 122 ? 42.270  40.323  122.276 1.00 51.11 ? 119 TYR A CE1   1 
ATOM   910   C CE2   . TYR A 1 122 ? 43.798  39.386  123.884 1.00 52.51 ? 119 TYR A CE2   1 
ATOM   911   C CZ    . TYR A 1 122 ? 43.567  40.036  122.679 1.00 53.03 ? 119 TYR A CZ    1 
ATOM   912   O OH    . TYR A 1 122 ? 44.629  40.411  121.882 1.00 53.12 ? 119 TYR A OH    1 
ATOM   913   N N     . PHE A 1 123 ? 38.774  36.172  126.577 1.00 53.68 ? 120 PHE A N     1 
ATOM   914   C CA    . PHE A 1 123 ? 37.825  35.714  127.585 1.00 55.18 ? 120 PHE A CA    1 
ATOM   915   C C     . PHE A 1 123 ? 38.168  36.354  128.922 1.00 55.86 ? 120 PHE A C     1 
ATOM   916   O O     . PHE A 1 123 ? 39.121  37.127  129.022 1.00 56.30 ? 120 PHE A O     1 
ATOM   917   C CB    . PHE A 1 123 ? 37.872  34.190  127.719 1.00 53.42 ? 120 PHE A CB    1 
ATOM   918   C CG    . PHE A 1 123 ? 37.524  33.464  126.461 1.00 53.38 ? 120 PHE A CG    1 
ATOM   919   C CD1   . PHE A 1 123 ? 38.381  33.501  125.365 1.00 53.87 ? 120 PHE A CD1   1 
ATOM   920   C CD2   . PHE A 1 123 ? 36.338  32.748  126.360 1.00 52.96 ? 120 PHE A CD2   1 
ATOM   921   C CE1   . PHE A 1 123 ? 38.063  32.834  124.189 1.00 53.10 ? 120 PHE A CE1   1 
ATOM   922   C CE2   . PHE A 1 123 ? 36.009  32.077  125.189 1.00 52.44 ? 120 PHE A CE2   1 
ATOM   923   C CZ    . PHE A 1 123 ? 36.873  32.121  124.102 1.00 53.59 ? 120 PHE A CZ    1 
ATOM   924   N N     . LYS A 1 124 ? 37.388  36.032  129.948 1.00 57.01 ? 121 LYS A N     1 
ATOM   925   C CA    . LYS A 1 124 ? 37.639  36.581  131.272 1.00 57.59 ? 121 LYS A CA    1 
ATOM   926   C C     . LYS A 1 124 ? 39.000  36.122  131.772 1.00 57.13 ? 121 LYS A C     1 
ATOM   927   O O     . LYS A 1 124 ? 39.735  36.893  132.390 1.00 57.86 ? 121 LYS A O     1 
ATOM   928   C CB    . LYS A 1 124 ? 36.561  36.128  132.262 1.00 58.53 ? 121 LYS A CB    1 
ATOM   929   C CG    . LYS A 1 124 ? 35.152  36.618  131.943 1.00 60.12 ? 121 LYS A CG    1 
ATOM   930   C CD    . LYS A 1 124 ? 34.254  36.504  133.177 1.00 61.30 ? 121 LYS A CD    1 
ATOM   931   C CE    . LYS A 1 124 ? 34.288  35.099  133.763 1.00 61.59 ? 121 LYS A CE    1 
ATOM   932   N NZ    . LYS A 1 124 ? 33.684  35.046  135.119 1.00 62.09 ? 121 LYS A NZ    1 
ATOM   933   N N     . ASP A 1 125 ? 39.333  34.867  131.489 1.00 55.78 ? 122 ASP A N     1 
ATOM   934   C CA    . ASP A 1 125 ? 40.595  34.291  131.925 1.00 54.91 ? 122 ASP A CA    1 
ATOM   935   C C     . ASP A 1 125 ? 41.728  34.499  130.938 1.00 54.14 ? 122 ASP A C     1 
ATOM   936   O O     . ASP A 1 125 ? 42.812  33.934  131.111 1.00 54.56 ? 122 ASP A O     1 
ATOM   937   C CB    . ASP A 1 125 ? 40.421  32.802  132.174 1.00 55.89 ? 122 ASP A CB    1 
ATOM   938   C CG    . ASP A 1 125 ? 39.085  32.479  132.789 1.00 57.78 ? 122 ASP A CG    1 
ATOM   939   O OD1   . ASP A 1 125 ? 38.730  33.114  133.805 1.00 57.75 ? 122 ASP A OD1   1 
ATOM   940   O OD2   . ASP A 1 125 ? 38.393  31.590  132.253 1.00 58.40 ? 122 ASP A OD2   1 
ATOM   941   N N     . GLY A 1 126 ? 41.479  35.293  129.900 1.00 52.50 ? 123 GLY A N     1 
ATOM   942   C CA    . GLY A 1 126 ? 42.516  35.549  128.918 1.00 51.20 ? 123 GLY A CA    1 
ATOM   943   C C     . GLY A 1 126 ? 42.197  35.168  127.483 1.00 50.45 ? 123 GLY A C     1 
ATOM   944   O O     . GLY A 1 126 ? 41.065  34.802  127.162 1.00 48.88 ? 123 GLY A O     1 
ATOM   945   N N     . PRO A 1 127 ? 43.196  35.250  126.588 1.00 50.56 ? 124 PRO A N     1 
ATOM   946   C CA    . PRO A 1 127 ? 43.049  34.920  125.168 1.00 50.50 ? 124 PRO A CA    1 
ATOM   947   C C     . PRO A 1 127 ? 42.444  33.545  124.911 1.00 50.28 ? 124 PRO A C     1 
ATOM   948   O O     . PRO A 1 127 ? 42.510  32.651  125.757 1.00 49.51 ? 124 PRO A O     1 
ATOM   949   C CB    . PRO A 1 127 ? 44.479  35.022  124.645 1.00 50.24 ? 124 PRO A CB    1 
ATOM   950   C CG    . PRO A 1 127 ? 45.060  36.098  125.493 1.00 50.89 ? 124 PRO A CG    1 
ATOM   951   C CD    . PRO A 1 127 ? 44.567  35.718  126.866 1.00 50.48 ? 124 PRO A CD    1 
ATOM   952   N N     . LEU A 1 128 ? 41.871  33.386  123.723 1.00 50.36 ? 125 LEU A N     1 
ATOM   953   C CA    . LEU A 1 128 ? 41.250  32.129  123.322 1.00 50.23 ? 125 LEU A CA    1 
ATOM   954   C C     . LEU A 1 128 ? 42.230  30.956  123.335 1.00 49.65 ? 125 LEU A C     1 
ATOM   955   O O     . LEU A 1 128 ? 43.426  31.130  123.101 1.00 47.90 ? 125 LEU A O     1 
ATOM   956   C CB    . LEU A 1 128 ? 40.657  32.261  121.916 1.00 49.12 ? 125 LEU A CB    1 
ATOM   957   C CG    . LEU A 1 128 ? 41.627  32.393  120.732 1.00 48.12 ? 125 LEU A CG    1 
ATOM   958   C CD1   . LEU A 1 128 ? 40.855  32.184  119.434 1.00 48.33 ? 125 LEU A CD1   1 
ATOM   959   C CD2   . LEU A 1 128 ? 42.312  33.749  120.739 1.00 46.31 ? 125 LEU A CD2   1 
ATOM   960   N N     . ASN A 1 129 ? 41.710  29.763  123.605 1.00 50.01 ? 126 ASN A N     1 
ATOM   961   C CA    . ASN A 1 129 ? 42.523  28.554  123.612 1.00 50.89 ? 126 ASN A CA    1 
ATOM   962   C C     . ASN A 1 129 ? 42.304  27.748  122.350 1.00 50.53 ? 126 ASN A C     1 
ATOM   963   O O     . ASN A 1 129 ? 43.256  27.262  121.744 1.00 51.14 ? 126 ASN A O     1 
ATOM   964   C CB    . ASN A 1 129 ? 42.173  27.662  124.795 1.00 53.25 ? 126 ASN A CB    1 
ATOM   965   C CG    . ASN A 1 129 ? 42.897  28.056  126.038 1.00 56.85 ? 126 ASN A CG    1 
ATOM   966   O OD1   . ASN A 1 129 ? 44.038  28.526  125.978 1.00 59.88 ? 126 ASN A OD1   1 
ATOM   967   N ND2   . ASN A 1 129 ? 42.254  27.863  127.184 1.00 57.58 ? 126 ASN A ND2   1 
ATOM   968   N N     . MET A 1 130 ? 41.037  27.610  121.965 1.00 49.14 ? 127 MET A N     1 
ATOM   969   C CA    . MET A 1 130 ? 40.668  26.840  120.784 1.00 47.01 ? 127 MET A CA    1 
ATOM   970   C C     . MET A 1 130 ? 39.894  27.627  119.730 1.00 46.21 ? 127 MET A C     1 
ATOM   971   O O     . MET A 1 130 ? 39.281  28.657  120.014 1.00 45.58 ? 127 MET A O     1 
ATOM   972   C CB    . MET A 1 130 ? 39.841  25.622  121.201 1.00 45.53 ? 127 MET A CB    1 
ATOM   973   C CG    . MET A 1 130 ? 40.595  24.639  122.061 1.00 44.91 ? 127 MET A CG    1 
ATOM   974   S SD    . MET A 1 130 ? 41.987  23.981  121.146 1.00 44.51 ? 127 MET A SD    1 
ATOM   975   C CE    . MET A 1 130 ? 41.152  22.695  120.207 1.00 43.33 ? 127 MET A CE    1 
ATOM   976   N N     . ILE A 1 131 ? 39.929  27.119  118.504 1.00 44.78 ? 128 ILE A N     1 
ATOM   977   C CA    . ILE A 1 131 ? 39.216  27.729  117.394 1.00 42.61 ? 128 ILE A CA    1 
ATOM   978   C C     . ILE A 1 131 ? 38.260  26.725  116.749 1.00 42.02 ? 128 ILE A C     1 
ATOM   979   O O     . ILE A 1 131 ? 38.614  25.570  116.491 1.00 39.19 ? 128 ILE A O     1 
ATOM   980   C CB    . ILE A 1 131 ? 40.186  28.253  116.301 1.00 41.18 ? 128 ILE A CB    1 
ATOM   981   C CG1   . ILE A 1 131 ? 40.982  29.443  116.836 1.00 40.55 ? 128 ILE A CG1   1 
ATOM   982   C CG2   . ILE A 1 131 ? 39.403  28.688  115.068 1.00 38.82 ? 128 ILE A CG2   1 
ATOM   983   C CD1   . ILE A 1 131 ? 41.871  30.090  115.802 1.00 40.15 ? 128 ILE A CD1   1 
ATOM   984   N N     . LEU A 1 132 ? 37.031  27.177  116.530 1.00 41.94 ? 129 LEU A N     1 
ATOM   985   C CA    . LEU A 1 132 ? 36.010  26.372  115.882 1.00 40.77 ? 129 LEU A CA    1 
ATOM   986   C C     . LEU A 1 132 ? 35.548  27.296  114.763 1.00 41.76 ? 129 LEU A C     1 
ATOM   987   O O     . LEU A 1 132 ? 34.702  28.169  114.964 1.00 42.32 ? 129 LEU A O     1 
ATOM   988   C CB    . LEU A 1 132 ? 34.872  26.045  116.853 1.00 39.98 ? 129 LEU A CB    1 
ATOM   989   C CG    . LEU A 1 132 ? 34.044  24.791  116.506 1.00 40.39 ? 129 LEU A CG    1 
ATOM   990   C CD1   . LEU A 1 132 ? 33.231  24.329  117.714 1.00 38.81 ? 129 LEU A CD1   1 
ATOM   991   C CD2   . LEU A 1 132 ? 33.147  25.082  115.317 1.00 38.53 ? 129 LEU A CD2   1 
ATOM   992   N N     . ASP A 1 133 ? 36.150  27.119  113.591 1.00 41.44 ? 130 ASP A N     1 
ATOM   993   C CA    . ASP A 1 133 ? 35.854  27.944  112.432 1.00 41.28 ? 130 ASP A CA    1 
ATOM   994   C C     . ASP A 1 133 ? 34.953  27.236  111.416 1.00 41.15 ? 130 ASP A C     1 
ATOM   995   O O     . ASP A 1 133 ? 34.759  26.015  111.472 1.00 38.68 ? 130 ASP A O     1 
ATOM   996   C CB    . ASP A 1 133 ? 37.166  28.348  111.738 1.00 41.72 ? 130 ASP A CB    1 
ATOM   997   C CG    . ASP A 1 133 ? 37.121  29.750  111.163 1.00 41.84 ? 130 ASP A CG    1 
ATOM   998   O OD1   . ASP A 1 133 ? 36.011  30.265  110.913 1.00 42.70 ? 130 ASP A OD1   1 
ATOM   999   O OD2   . ASP A 1 133 ? 38.203  30.338  110.954 1.00 42.78 ? 130 ASP A OD2   1 
ATOM   1000  N N     . ASP A 1 134 ? 34.419  28.037  110.494 1.00 40.01 ? 131 ASP A N     1 
ATOM   1001  C CA    . ASP A 1 134 ? 33.543  27.588  109.414 1.00 39.14 ? 131 ASP A CA    1 
ATOM   1002  C C     . ASP A 1 134 ? 33.719  28.630  108.327 1.00 38.12 ? 131 ASP A C     1 
ATOM   1003  O O     . ASP A 1 134 ? 33.006  29.625  108.323 1.00 39.45 ? 131 ASP A O     1 
ATOM   1004  C CB    . ASP A 1 134 ? 32.086  27.603  109.856 1.00 39.19 ? 131 ASP A CB    1 
ATOM   1005  C CG    . ASP A 1 134 ? 31.159  26.983  108.827 1.00 40.53 ? 131 ASP A CG    1 
ATOM   1006  O OD1   . ASP A 1 134 ? 31.377  27.191  107.614 1.00 39.65 ? 131 ASP A OD1   1 
ATOM   1007  O OD2   . ASP A 1 134 ? 30.203  26.289  109.243 1.00 41.25 ? 131 ASP A OD2   1 
ATOM   1008  N N     . GLY A 1 135 ? 34.669  28.422  107.425 1.00 36.45 ? 132 GLY A N     1 
ATOM   1009  C CA    . GLY A 1 135 ? 34.901  29.392  106.372 1.00 37.44 ? 132 GLY A CA    1 
ATOM   1010  C C     . GLY A 1 135 ? 36.301  29.959  106.479 1.00 39.16 ? 132 GLY A C     1 
ATOM   1011  O O     . GLY A 1 135 ? 36.864  30.471  105.505 1.00 40.14 ? 132 GLY A O     1 
ATOM   1012  N N     . GLY A 1 136 ? 36.855  29.879  107.686 1.00 39.75 ? 133 GLY A N     1 
ATOM   1013  C CA    . GLY A 1 136 ? 38.203  30.352  107.946 1.00 40.32 ? 133 GLY A CA    1 
ATOM   1014  C C     . GLY A 1 136 ? 38.390  31.809  108.337 1.00 40.36 ? 133 GLY A C     1 
ATOM   1015  O O     . GLY A 1 136 ? 39.523  32.231  108.569 1.00 40.50 ? 133 GLY A O     1 
ATOM   1016  N N     . ASP A 1 137 ? 37.315  32.586  108.429 1.00 39.42 ? 134 ASP A N     1 
ATOM   1017  C CA    . ASP A 1 137 ? 37.488  33.994  108.773 1.00 38.98 ? 134 ASP A CA    1 
ATOM   1018  C C     . ASP A 1 137 ? 38.170  34.235  110.120 1.00 38.52 ? 134 ASP A C     1 
ATOM   1019  O O     . ASP A 1 137 ? 39.018  35.120  110.236 1.00 36.75 ? 134 ASP A O     1 
ATOM   1020  C CB    . ASP A 1 137 ? 36.150  34.736  108.723 1.00 38.62 ? 134 ASP A CB    1 
ATOM   1021  C CG    . ASP A 1 137 ? 35.706  35.037  107.303 1.00 38.06 ? 134 ASP A CG    1 
ATOM   1022  O OD1   . ASP A 1 137 ? 36.577  35.301  106.446 1.00 38.32 ? 134 ASP A OD1   1 
ATOM   1023  O OD2   . ASP A 1 137 ? 34.489  35.027  107.043 1.00 39.12 ? 134 ASP A OD2   1 
ATOM   1024  N N     . LEU A 1 138 ? 37.809  33.441  111.125 1.00 38.81 ? 135 LEU A N     1 
ATOM   1025  C CA    . LEU A 1 138 ? 38.400  33.572  112.454 1.00 39.43 ? 135 LEU A CA    1 
ATOM   1026  C C     . LEU A 1 138 ? 39.884  33.227  112.367 1.00 40.58 ? 135 LEU A C     1 
ATOM   1027  O O     . LEU A 1 138 ? 40.743  34.029  112.721 1.00 41.82 ? 135 LEU A O     1 
ATOM   1028  C CB    . LEU A 1 138 ? 37.709  32.625  113.446 1.00 38.93 ? 135 LEU A CB    1 
ATOM   1029  C CG    . LEU A 1 138 ? 37.736  33.011  114.933 1.00 38.52 ? 135 LEU A CG    1 
ATOM   1030  C CD1   . LEU A 1 138 ? 37.157  31.893  115.787 1.00 36.54 ? 135 LEU A CD1   1 
ATOM   1031  C CD2   . LEU A 1 138 ? 39.149  33.299  115.366 1.00 38.42 ? 135 LEU A CD2   1 
ATOM   1032  N N     . THR A 1 139 ? 40.180  32.030  111.880 1.00 41.27 ? 136 THR A N     1 
ATOM   1033  C CA    . THR A 1 139 ? 41.558  31.595  111.755 1.00 41.96 ? 136 THR A CA    1 
ATOM   1034  C C     . THR A 1 139 ? 42.363  32.584  110.919 1.00 41.48 ? 136 THR A C     1 
ATOM   1035  O O     . THR A 1 139 ? 43.563  32.734  111.125 1.00 42.15 ? 136 THR A O     1 
ATOM   1036  C CB    . THR A 1 139 ? 41.643  30.180  111.134 1.00 43.76 ? 136 THR A CB    1 
ATOM   1037  O OG1   . THR A 1 139 ? 41.269  30.228  109.755 1.00 46.58 ? 136 THR A OG1   1 
ATOM   1038  C CG2   . THR A 1 139 ? 40.697  29.228  111.868 1.00 43.12 ? 136 THR A CG2   1 
ATOM   1039  N N     . ASN A 1 140 ? 41.710  33.264  109.982 1.00 40.59 ? 137 ASN A N     1 
ATOM   1040  C CA    . ASN A 1 140 ? 42.408  34.246  109.165 1.00 40.42 ? 137 ASN A CA    1 
ATOM   1041  C C     . ASN A 1 140 ? 42.596  35.561  109.906 1.00 40.98 ? 137 ASN A C     1 
ATOM   1042  O O     . ASN A 1 140 ? 43.548  36.298  109.621 1.00 40.45 ? 137 ASN A O     1 
ATOM   1043  C CB    . ASN A 1 140 ? 41.661  34.535  107.864 1.00 41.55 ? 137 ASN A CB    1 
ATOM   1044  C CG    . ASN A 1 140 ? 41.957  33.524  106.791 1.00 43.83 ? 137 ASN A CG    1 
ATOM   1045  O OD1   . ASN A 1 140 ? 43.114  33.166  106.559 1.00 44.20 ? 137 ASN A OD1   1 
ATOM   1046  N ND2   . ASN A 1 140 ? 40.910  33.060  106.114 1.00 44.86 ? 137 ASN A ND2   1 
ATOM   1047  N N     . LEU A 1 141 ? 41.686  35.864  110.835 1.00 39.27 ? 138 LEU A N     1 
ATOM   1048  C CA    . LEU A 1 141 ? 41.775  37.104  111.600 1.00 38.09 ? 138 LEU A CA    1 
ATOM   1049  C C     . LEU A 1 141 ? 42.955  37.016  112.573 1.00 38.50 ? 138 LEU A C     1 
ATOM   1050  O O     . LEU A 1 141 ? 43.796  37.921  112.634 1.00 38.04 ? 138 LEU A O     1 
ATOM   1051  C CB    . LEU A 1 141 ? 40.469  37.377  112.355 1.00 35.19 ? 138 LEU A CB    1 
ATOM   1052  C CG    . LEU A 1 141 ? 40.381  38.722  113.098 1.00 34.34 ? 138 LEU A CG    1 
ATOM   1053  C CD1   . LEU A 1 141 ? 40.458  39.858  112.104 1.00 29.37 ? 138 LEU A CD1   1 
ATOM   1054  C CD2   . LEU A 1 141 ? 39.078  38.811  113.902 1.00 33.92 ? 138 LEU A CD2   1 
ATOM   1055  N N     . ILE A 1 142 ? 43.018  35.914  113.316 1.00 37.90 ? 139 ILE A N     1 
ATOM   1056  C CA    . ILE A 1 142 ? 44.097  35.679  114.260 1.00 38.90 ? 139 ILE A CA    1 
ATOM   1057  C C     . ILE A 1 142 ? 45.446  35.724  113.523 1.00 40.68 ? 139 ILE A C     1 
ATOM   1058  O O     . ILE A 1 142 ? 46.287  36.581  113.801 1.00 41.23 ? 139 ILE A O     1 
ATOM   1059  C CB    . ILE A 1 142 ? 43.945  34.295  114.942 1.00 39.77 ? 139 ILE A CB    1 
ATOM   1060  C CG1   . ILE A 1 142 ? 42.524  34.141  115.486 1.00 39.30 ? 139 ILE A CG1   1 
ATOM   1061  C CG2   . ILE A 1 142 ? 44.908  34.157  116.102 1.00 39.69 ? 139 ILE A CG2   1 
ATOM   1062  C CD1   . ILE A 1 142 ? 42.148  35.194  116.492 1.00 41.14 ? 139 ILE A CD1   1 
ATOM   1063  N N     . HIS A 1 143 ? 45.638  34.815  112.569 1.00 40.89 ? 140 HIS A N     1 
ATOM   1064  C CA    . HIS A 1 143 ? 46.884  34.736  111.806 1.00 40.95 ? 140 HIS A CA    1 
ATOM   1065  C C     . HIS A 1 143 ? 47.393  36.031  111.191 1.00 43.74 ? 140 HIS A C     1 
ATOM   1066  O O     . HIS A 1 143 ? 48.601  36.217  111.058 1.00 43.04 ? 140 HIS A O     1 
ATOM   1067  C CB    . HIS A 1 143 ? 46.774  33.704  110.680 1.00 38.93 ? 140 HIS A CB    1 
ATOM   1068  C CG    . HIS A 1 143 ? 47.064  32.301  111.112 1.00 37.92 ? 140 HIS A CG    1 
ATOM   1069  N ND1   . HIS A 1 143 ? 46.153  31.532  111.804 1.00 36.93 ? 140 HIS A ND1   1 
ATOM   1070  C CD2   . HIS A 1 143 ? 48.179  31.540  110.979 1.00 36.70 ? 140 HIS A CD2   1 
ATOM   1071  C CE1   . HIS A 1 143 ? 46.695  30.359  112.081 1.00 37.24 ? 140 HIS A CE1   1 
ATOM   1072  N NE2   . HIS A 1 143 ? 47.924  30.338  111.592 1.00 36.38 ? 140 HIS A NE2   1 
ATOM   1073  N N     . THR A 1 144 ? 46.485  36.919  110.805 1.00 46.36 ? 141 THR A N     1 
ATOM   1074  C CA    . THR A 1 144 ? 46.887  38.165  110.171 1.00 49.81 ? 141 THR A CA    1 
ATOM   1075  C C     . THR A 1 144 ? 46.942  39.388  111.082 1.00 51.71 ? 141 THR A C     1 
ATOM   1076  O O     . THR A 1 144 ? 47.865  40.195  110.973 1.00 51.38 ? 141 THR A O     1 
ATOM   1077  C CB    . THR A 1 144 ? 45.969  38.498  108.973 1.00 51.33 ? 141 THR A CB    1 
ATOM   1078  O OG1   . THR A 1 144 ? 44.624  38.679  109.436 1.00 52.98 ? 141 THR A OG1   1 
ATOM   1079  C CG2   . THR A 1 144 ? 46.007  37.374  107.946 1.00 50.96 ? 141 THR A CG2   1 
ATOM   1080  N N     . LYS A 1 145 ? 45.966  39.530  111.974 1.00 52.78 ? 142 LYS A N     1 
ATOM   1081  C CA    . LYS A 1 145 ? 45.943  40.686  112.867 1.00 54.08 ? 142 LYS A CA    1 
ATOM   1082  C C     . LYS A 1 145 ? 46.454  40.429  114.276 1.00 53.26 ? 142 LYS A C     1 
ATOM   1083  O O     . LYS A 1 145 ? 46.972  41.338  114.918 1.00 54.02 ? 142 LYS A O     1 
ATOM   1084  C CB    . LYS A 1 145 ? 44.527  41.266  112.953 1.00 55.48 ? 142 LYS A CB    1 
ATOM   1085  C CG    . LYS A 1 145 ? 43.991  41.771  111.630 1.00 58.09 ? 142 LYS A CG    1 
ATOM   1086  C CD    . LYS A 1 145 ? 44.875  42.860  111.047 1.00 60.02 ? 142 LYS A CD    1 
ATOM   1087  C CE    . LYS A 1 145 ? 44.345  43.320  109.694 1.00 61.32 ? 142 LYS A CE    1 
ATOM   1088  N NZ    . LYS A 1 145 ? 44.297  42.205  108.706 1.00 61.80 ? 142 LYS A NZ    1 
ATOM   1089  N N     . TYR A 1 146 ? 46.305  39.200  114.760 1.00 52.17 ? 143 TYR A N     1 
ATOM   1090  C CA    . TYR A 1 146 ? 46.747  38.864  116.109 1.00 51.32 ? 143 TYR A CA    1 
ATOM   1091  C C     . TYR A 1 146 ? 47.742  37.702  116.138 1.00 50.84 ? 143 TYR A C     1 
ATOM   1092  O O     . TYR A 1 146 ? 47.551  36.729  116.870 1.00 51.07 ? 143 TYR A O     1 
ATOM   1093  C CB    . TYR A 1 146 ? 45.538  38.516  116.982 1.00 51.03 ? 143 TYR A CB    1 
ATOM   1094  C CG    . TYR A 1 146 ? 44.399  39.507  116.892 1.00 50.39 ? 143 TYR A CG    1 
ATOM   1095  C CD1   . TYR A 1 146 ? 43.555  39.526  115.784 1.00 50.00 ? 143 TYR A CD1   1 
ATOM   1096  C CD2   . TYR A 1 146 ? 44.154  40.417  117.919 1.00 49.86 ? 143 TYR A CD2   1 
ATOM   1097  C CE1   . TYR A 1 146 ? 42.496  40.417  115.699 1.00 48.26 ? 143 TYR A CE1   1 
ATOM   1098  C CE2   . TYR A 1 146 ? 43.092  41.318  117.841 1.00 48.14 ? 143 TYR A CE2   1 
ATOM   1099  C CZ    . TYR A 1 146 ? 42.268  41.308  116.728 1.00 47.31 ? 143 TYR A CZ    1 
ATOM   1100  O OH    . TYR A 1 146 ? 41.205  42.173  116.641 1.00 47.01 ? 143 TYR A OH    1 
ATOM   1101  N N     . PRO A 1 147 ? 48.828  37.797  115.354 1.00 50.11 ? 144 PRO A N     1 
ATOM   1102  C CA    . PRO A 1 147 ? 49.820  36.719  115.330 1.00 50.16 ? 144 PRO A CA    1 
ATOM   1103  C C     . PRO A 1 147 ? 50.451  36.416  116.688 1.00 50.43 ? 144 PRO A C     1 
ATOM   1104  O O     . PRO A 1 147 ? 51.087  35.374  116.864 1.00 50.39 ? 144 PRO A O     1 
ATOM   1105  C CB    . PRO A 1 147 ? 50.840  37.214  114.308 1.00 49.38 ? 144 PRO A CB    1 
ATOM   1106  C CG    . PRO A 1 147 ? 50.746  38.701  114.434 1.00 48.89 ? 144 PRO A CG    1 
ATOM   1107  C CD    . PRO A 1 147 ? 49.260  38.921  114.507 1.00 49.61 ? 144 PRO A CD    1 
ATOM   1108  N N     . GLN A 1 148 ? 50.267  37.319  117.648 1.00 50.11 ? 145 GLN A N     1 
ATOM   1109  C CA    . GLN A 1 148 ? 50.836  37.127  118.976 1.00 50.80 ? 145 GLN A CA    1 
ATOM   1110  C C     . GLN A 1 148 ? 49.974  36.203  119.827 1.00 50.99 ? 145 GLN A C     1 
ATOM   1111  O O     . GLN A 1 148 ? 50.365  35.803  120.928 1.00 51.32 ? 145 GLN A O     1 
ATOM   1112  C CB    . GLN A 1 148 ? 51.031  38.478  119.687 1.00 51.20 ? 145 GLN A CB    1 
ATOM   1113  C CG    . GLN A 1 148 ? 49.777  39.150  120.244 1.00 52.75 ? 145 GLN A CG    1 
ATOM   1114  C CD    . GLN A 1 148 ? 48.790  39.574  119.176 1.00 55.02 ? 145 GLN A CD    1 
ATOM   1115  O OE1   . GLN A 1 148 ? 49.173  40.062  118.113 1.00 56.25 ? 145 GLN A OE1   1 
ATOM   1116  N NE2   . GLN A 1 148 ? 47.505  39.403  119.463 1.00 57.16 ? 145 GLN A NE2   1 
ATOM   1117  N N     . LEU A 1 149 ? 48.802  35.859  119.307 1.00 50.33 ? 146 LEU A N     1 
ATOM   1118  C CA    . LEU A 1 149 ? 47.896  34.978  120.025 1.00 49.15 ? 146 LEU A CA    1 
ATOM   1119  C C     . LEU A 1 149 ? 48.055  33.545  119.527 1.00 48.42 ? 146 LEU A C     1 
ATOM   1120  O O     . LEU A 1 149 ? 47.604  32.603  120.180 1.00 46.88 ? 146 LEU A O     1 
ATOM   1121  C CB    . LEU A 1 149 ? 46.447  35.436  119.831 1.00 49.56 ? 146 LEU A CB    1 
ATOM   1122  C CG    . LEU A 1 149 ? 46.079  36.851  120.280 1.00 49.05 ? 146 LEU A CG    1 
ATOM   1123  C CD1   . LEU A 1 149 ? 44.625  37.119  119.935 1.00 48.43 ? 146 LEU A CD1   1 
ATOM   1124  C CD2   . LEU A 1 149 ? 46.311  37.006  121.775 1.00 48.44 ? 146 LEU A CD2   1 
ATOM   1125  N N     . LEU A 1 150 ? 48.702  33.392  118.372 1.00 48.16 ? 147 LEU A N     1 
ATOM   1126  C CA    . LEU A 1 150 ? 48.920  32.078  117.765 1.00 48.04 ? 147 LEU A CA    1 
ATOM   1127  C C     . LEU A 1 150 ? 49.578  31.073  118.704 1.00 48.17 ? 147 LEU A C     1 
ATOM   1128  O O     . LEU A 1 150 ? 49.096  29.953  118.859 1.00 48.42 ? 147 LEU A O     1 
ATOM   1129  C CB    . LEU A 1 150 ? 49.758  32.208  116.486 1.00 48.45 ? 147 LEU A CB    1 
ATOM   1130  C CG    . LEU A 1 150 ? 49.040  32.458  115.152 1.00 50.02 ? 147 LEU A CG    1 
ATOM   1131  C CD1   . LEU A 1 150 ? 48.136  33.675  115.256 1.00 51.17 ? 147 LEU A CD1   1 
ATOM   1132  C CD2   . LEU A 1 150 ? 50.076  32.656  114.048 1.00 50.84 ? 147 LEU A CD2   1 
ATOM   1133  N N     . PRO A 1 151 ? 50.696  31.456  119.343 1.00 48.77 ? 148 PRO A N     1 
ATOM   1134  C CA    . PRO A 1 151 ? 51.379  30.537  120.263 1.00 48.33 ? 148 PRO A CA    1 
ATOM   1135  C C     . PRO A 1 151 ? 50.505  30.124  121.444 1.00 48.08 ? 148 PRO A C     1 
ATOM   1136  O O     . PRO A 1 151 ? 50.846  29.204  122.179 1.00 47.59 ? 148 PRO A O     1 
ATOM   1137  C CB    . PRO A 1 151 ? 52.601  31.338  120.706 1.00 47.82 ? 148 PRO A CB    1 
ATOM   1138  C CG    . PRO A 1 151 ? 52.892  32.189  119.509 1.00 49.12 ? 148 PRO A CG    1 
ATOM   1139  C CD    . PRO A 1 151 ? 51.509  32.668  119.120 1.00 49.29 ? 148 PRO A CD    1 
ATOM   1140  N N     . GLY A 1 152 ? 49.374  30.805  121.613 1.00 49.31 ? 149 GLY A N     1 
ATOM   1141  C CA    . GLY A 1 152 ? 48.470  30.498  122.715 1.00 49.86 ? 149 GLY A CA    1 
ATOM   1142  C C     . GLY A 1 152 ? 47.266  29.649  122.332 1.00 50.66 ? 149 GLY A C     1 
ATOM   1143  O O     . GLY A 1 152 ? 46.481  29.249  123.196 1.00 50.37 ? 149 GLY A O     1 
ATOM   1144  N N     . ILE A 1 153 ? 47.126  29.365  121.038 1.00 51.85 ? 150 ILE A N     1 
ATOM   1145  C CA    . ILE A 1 153 ? 46.016  28.557  120.530 1.00 51.47 ? 150 ILE A CA    1 
ATOM   1146  C C     . ILE A 1 153 ? 46.477  27.133  120.257 1.00 50.27 ? 150 ILE A C     1 
ATOM   1147  O O     . ILE A 1 153 ? 47.412  26.905  119.496 1.00 50.34 ? 150 ILE A O     1 
ATOM   1148  C CB    . ILE A 1 153 ? 45.452  29.150  119.228 1.00 52.13 ? 150 ILE A CB    1 
ATOM   1149  C CG1   . ILE A 1 153 ? 45.109  30.626  119.447 1.00 51.79 ? 150 ILE A CG1   1 
ATOM   1150  C CG2   . ILE A 1 153 ? 44.218  28.366  118.798 1.00 52.19 ? 150 ILE A CG2   1 
ATOM   1151  C CD1   . ILE A 1 153 ? 44.735  31.367  118.188 1.00 52.57 ? 150 ILE A CD1   1 
ATOM   1152  N N     . ARG A 1 154 ? 45.805  26.179  120.882 1.00 49.94 ? 151 ARG A N     1 
ATOM   1153  C CA    . ARG A 1 154 ? 46.146  24.777  120.737 1.00 50.82 ? 151 ARG A CA    1 
ATOM   1154  C C     . ARG A 1 154 ? 45.804  24.244  119.345 1.00 50.99 ? 151 ARG A C     1 
ATOM   1155  O O     . ARG A 1 154 ? 46.697  23.945  118.558 1.00 51.18 ? 151 ARG A O     1 
ATOM   1156  C CB    . ARG A 1 154 ? 45.411  23.962  121.803 1.00 52.68 ? 151 ARG A CB    1 
ATOM   1157  C CG    . ARG A 1 154 ? 45.960  22.565  121.994 1.00 55.32 ? 151 ARG A CG    1 
ATOM   1158  C CD    . ARG A 1 154 ? 47.329  22.598  122.676 1.00 57.94 ? 151 ARG A CD    1 
ATOM   1159  N NE    . ARG A 1 154 ? 47.240  22.948  124.093 1.00 59.20 ? 151 ARG A NE    1 
ATOM   1160  C CZ    . ARG A 1 154 ? 46.510  22.281  124.984 1.00 59.80 ? 151 ARG A CZ    1 
ATOM   1161  N NH1   . ARG A 1 154 ? 45.796  21.222  124.611 1.00 60.44 ? 151 ARG A NH1   1 
ATOM   1162  N NH2   . ARG A 1 154 ? 46.496  22.667  126.251 1.00 58.96 ? 151 ARG A NH2   1 
ATOM   1163  N N     . GLY A 1 155 ? 44.513  24.130  119.042 1.00 50.46 ? 152 GLY A N     1 
ATOM   1164  C CA    . GLY A 1 155 ? 44.105  23.626  117.742 1.00 49.07 ? 152 GLY A CA    1 
ATOM   1165  C C     . GLY A 1 155 ? 42.929  24.353  117.114 1.00 48.45 ? 152 GLY A C     1 
ATOM   1166  O O     . GLY A 1 155 ? 42.245  25.144  117.770 1.00 48.69 ? 152 GLY A O     1 
ATOM   1167  N N     . ILE A 1 156 ? 42.697  24.071  115.832 1.00 47.07 ? 153 ILE A N     1 
ATOM   1168  C CA    . ILE A 1 156 ? 41.604  24.670  115.054 1.00 43.68 ? 153 ILE A CA    1 
ATOM   1169  C C     . ILE A 1 156 ? 40.648  23.581  114.551 1.00 42.74 ? 153 ILE A C     1 
ATOM   1170  O O     . ILE A 1 156 ? 40.988  22.395  114.539 1.00 41.62 ? 153 ILE A O     1 
ATOM   1171  C CB    . ILE A 1 156 ? 42.147  25.411  113.806 1.00 41.87 ? 153 ILE A CB    1 
ATOM   1172  C CG1   . ILE A 1 156 ? 43.217  26.418  114.206 1.00 40.55 ? 153 ILE A CG1   1 
ATOM   1173  C CG2   . ILE A 1 156 ? 41.023  26.113  113.082 1.00 40.91 ? 153 ILE A CG2   1 
ATOM   1174  C CD1   . ILE A 1 156 ? 43.908  27.048  113.013 1.00 39.54 ? 153 ILE A CD1   1 
ATOM   1175  N N     . SER A 1 157 ? 39.454  23.994  114.131 1.00 42.18 ? 154 SER A N     1 
ATOM   1176  C CA    . SER A 1 157 ? 38.452  23.070  113.598 1.00 41.18 ? 154 SER A CA    1 
ATOM   1177  C C     . SER A 1 157 ? 37.679  23.712  112.455 1.00 41.62 ? 154 SER A C     1 
ATOM   1178  O O     . SER A 1 157 ? 36.938  24.676  112.672 1.00 43.66 ? 154 SER A O     1 
ATOM   1179  C CB    . SER A 1 157 ? 37.459  22.666  114.681 1.00 39.72 ? 154 SER A CB    1 
ATOM   1180  O OG    . SER A 1 157 ? 37.957  21.606  115.465 1.00 40.55 ? 154 SER A OG    1 
ATOM   1181  N N     . GLU A 1 158 ? 37.845  23.183  111.243 1.00 40.13 ? 155 GLU A N     1 
ATOM   1182  C CA    . GLU A 1 158 ? 37.134  23.707  110.073 1.00 37.44 ? 155 GLU A CA    1 
ATOM   1183  C C     . GLU A 1 158 ? 35.861  22.908  109.818 1.00 36.37 ? 155 GLU A C     1 
ATOM   1184  O O     . GLU A 1 158 ? 35.889  21.683  109.748 1.00 36.05 ? 155 GLU A O     1 
ATOM   1185  C CB    . GLU A 1 158 ? 38.008  23.643  108.824 1.00 37.72 ? 155 GLU A CB    1 
ATOM   1186  C CG    . GLU A 1 158 ? 38.339  24.992  108.209 1.00 39.42 ? 155 GLU A CG    1 
ATOM   1187  C CD    . GLU A 1 158 ? 37.160  25.961  108.229 1.00 41.51 ? 155 GLU A CD    1 
ATOM   1188  O OE1   . GLU A 1 158 ? 36.078  25.626  107.685 1.00 39.46 ? 155 GLU A OE1   1 
ATOM   1189  O OE2   . GLU A 1 158 ? 37.325  27.066  108.799 1.00 43.64 ? 155 GLU A OE2   1 
ATOM   1190  N N     . GLU A 1 159 ? 34.750  23.618  109.662 1.00 36.69 ? 156 GLU A N     1 
ATOM   1191  C CA    . GLU A 1 159 ? 33.452  23.002  109.426 1.00 35.85 ? 156 GLU A CA    1 
ATOM   1192  C C     . GLU A 1 159 ? 33.139  22.755  107.959 1.00 36.49 ? 156 GLU A C     1 
ATOM   1193  O O     . GLU A 1 159 ? 32.650  21.683  107.582 1.00 34.92 ? 156 GLU A O     1 
ATOM   1194  C CB    . GLU A 1 159 ? 32.353  23.894  109.992 1.00 36.98 ? 156 GLU A CB    1 
ATOM   1195  C CG    . GLU A 1 159 ? 31.648  23.327  111.195 1.00 40.79 ? 156 GLU A CG    1 
ATOM   1196  C CD    . GLU A 1 159 ? 30.962  22.013  110.881 1.00 41.51 ? 156 GLU A CD    1 
ATOM   1197  O OE1   . GLU A 1 159 ? 30.063  22.003  110.012 1.00 39.27 ? 156 GLU A OE1   1 
ATOM   1198  O OE2   . GLU A 1 159 ? 31.324  20.991  111.510 1.00 43.96 ? 156 GLU A OE2   1 
ATOM   1199  N N     . THR A 1 160 ? 33.427  23.754  107.134 1.00 35.08 ? 157 THR A N     1 
ATOM   1200  C CA    . THR A 1 160 ? 33.100  23.667  105.724 1.00 33.86 ? 157 THR A CA    1 
ATOM   1201  C C     . THR A 1 160 ? 34.267  23.516  104.757 1.00 34.95 ? 157 THR A C     1 
ATOM   1202  O O     . THR A 1 160 ? 35.417  23.856  105.068 1.00 35.58 ? 157 THR A O     1 
ATOM   1203  C CB    . THR A 1 160 ? 32.257  24.886  105.307 1.00 32.72 ? 157 THR A CB    1 
ATOM   1204  O OG1   . THR A 1 160 ? 31.486  24.551  104.152 1.00 29.76 ? 157 THR A OG1   1 
ATOM   1205  C CG2   . THR A 1 160 ? 33.160  26.087  104.997 1.00 29.20 ? 157 THR A CG2   1 
ATOM   1206  N N     . THR A 1 161 ? 33.941  23.007  103.573 1.00 32.65 ? 158 THR A N     1 
ATOM   1207  C CA    . THR A 1 161 ? 34.918  22.786  102.521 1.00 31.12 ? 158 THR A CA    1 
ATOM   1208  C C     . THR A 1 161 ? 35.764  24.016  102.258 1.00 29.35 ? 158 THR A C     1 
ATOM   1209  O O     . THR A 1 161 ? 36.985  23.925  102.247 1.00 29.86 ? 158 THR A O     1 
ATOM   1210  C CB    . THR A 1 161 ? 34.238  22.377  101.190 1.00 32.27 ? 158 THR A CB    1 
ATOM   1211  O OG1   . THR A 1 161 ? 33.275  21.340  101.446 1.00 35.38 ? 158 THR A OG1   1 
ATOM   1212  C CG2   . THR A 1 161 ? 35.276  21.857  100.202 1.00 30.08 ? 158 THR A CG2   1 
ATOM   1213  N N     . THR A 1 162 ? 35.134  25.166  102.034 1.00 27.79 ? 159 THR A N     1 
ATOM   1214  C CA    . THR A 1 162 ? 35.901  26.377  101.760 1.00 27.24 ? 159 THR A CA    1 
ATOM   1215  C C     . THR A 1 162 ? 36.991  26.610  102.802 1.00 26.64 ? 159 THR A C     1 
ATOM   1216  O O     . THR A 1 162 ? 38.159  26.788  102.445 1.00 24.92 ? 159 THR A O     1 
ATOM   1217  C CB    . THR A 1 162 ? 34.989  27.638  101.654 1.00 28.02 ? 159 THR A CB    1 
ATOM   1218  O OG1   . THR A 1 162 ? 34.280  27.605  100.399 1.00 27.28 ? 159 THR A OG1   1 
ATOM   1219  C CG2   . THR A 1 162 ? 35.832  28.931  101.715 1.00 24.19 ? 159 THR A CG2   1 
ATOM   1220  N N     . GLY A 1 163 ? 36.616  26.589  104.081 1.00 27.41 ? 160 GLY A N     1 
ATOM   1221  C CA    . GLY A 1 163 ? 37.593  26.806  105.130 1.00 28.24 ? 160 GLY A CA    1 
ATOM   1222  C C     . GLY A 1 163 ? 38.721  25.793  105.037 1.00 29.74 ? 160 GLY A C     1 
ATOM   1223  O O     . GLY A 1 163 ? 39.902  26.150  104.959 1.00 28.57 ? 160 GLY A O     1 
ATOM   1224  N N     . VAL A 1 164 ? 38.346  24.520  105.061 1.00 29.92 ? 161 VAL A N     1 
ATOM   1225  C CA    . VAL A 1 164 ? 39.301  23.436  104.971 1.00 31.75 ? 161 VAL A CA    1 
ATOM   1226  C C     . VAL A 1 164 ? 40.260  23.713  103.817 1.00 33.45 ? 161 VAL A C     1 
ATOM   1227  O O     . VAL A 1 164 ? 41.474  23.522  103.939 1.00 33.69 ? 161 VAL A O     1 
ATOM   1228  C CB    . VAL A 1 164 ? 38.564  22.109  104.750 1.00 31.14 ? 161 VAL A CB    1 
ATOM   1229  C CG1   . VAL A 1 164 ? 39.481  21.093  104.151 1.00 33.69 ? 161 VAL A CG1   1 
ATOM   1230  C CG2   . VAL A 1 164 ? 38.017  21.613  106.072 1.00 32.26 ? 161 VAL A CG2   1 
ATOM   1231  N N     . HIS A 1 165 ? 39.714  24.191  102.705 1.00 34.42 ? 162 HIS A N     1 
ATOM   1232  C CA    . HIS A 1 165 ? 40.526  24.513  101.543 1.00 35.34 ? 162 HIS A CA    1 
ATOM   1233  C C     . HIS A 1 165 ? 41.580  25.539  101.903 1.00 33.45 ? 162 HIS A C     1 
ATOM   1234  O O     . HIS A 1 165 ? 42.716  25.461  101.448 1.00 32.72 ? 162 HIS A O     1 
ATOM   1235  C CB    . HIS A 1 165 ? 39.649  25.052  100.414 1.00 41.81 ? 162 HIS A CB    1 
ATOM   1236  C CG    . HIS A 1 165 ? 39.616  24.163  99.209  1.00 48.45 ? 162 HIS A CG    1 
ATOM   1237  N ND1   . HIS A 1 165 ? 40.654  24.109  98.302  1.00 52.03 ? 162 HIS A ND1   1 
ATOM   1238  C CD2   . HIS A 1 165 ? 38.703  23.246  98.798  1.00 50.60 ? 162 HIS A CD2   1 
ATOM   1239  C CE1   . HIS A 1 165 ? 40.381  23.196  97.386  1.00 54.52 ? 162 HIS A CE1   1 
ATOM   1240  N NE2   . HIS A 1 165 ? 39.204  22.658  97.663  1.00 53.46 ? 162 HIS A NE2   1 
ATOM   1241  N N     . ASN A 1 166 ? 41.189  26.501  102.726 1.00 32.14 ? 163 ASN A N     1 
ATOM   1242  C CA    . ASN A 1 166 ? 42.095  27.549  103.163 1.00 31.91 ? 163 ASN A CA    1 
ATOM   1243  C C     . ASN A 1 166 ? 43.215  26.972  104.061 1.00 30.77 ? 163 ASN A C     1 
ATOM   1244  O O     . ASN A 1 166 ? 44.378  27.337  103.920 1.00 27.98 ? 163 ASN A O     1 
ATOM   1245  C CB    . ASN A 1 166 ? 41.284  28.624  103.890 1.00 32.17 ? 163 ASN A CB    1 
ATOM   1246  C CG    . ASN A 1 166 ? 42.105  29.850  104.232 1.00 34.08 ? 163 ASN A CG    1 
ATOM   1247  O OD1   . ASN A 1 166 ? 42.643  30.532  103.345 1.00 35.62 ? 163 ASN A OD1   1 
ATOM   1248  N ND2   . ASN A 1 166 ? 42.202  30.146  105.531 1.00 33.14 ? 163 ASN A ND2   1 
ATOM   1249  N N     . LEU A 1 167 ? 42.871  26.062  104.967 1.00 30.63 ? 164 LEU A N     1 
ATOM   1250  C CA    . LEU A 1 167 ? 43.881  25.465  105.841 1.00 32.93 ? 164 LEU A CA    1 
ATOM   1251  C C     . LEU A 1 167 ? 45.028  24.830  105.056 1.00 34.38 ? 164 LEU A C     1 
ATOM   1252  O O     . LEU A 1 167 ? 46.189  24.949  105.440 1.00 35.61 ? 164 LEU A O     1 
ATOM   1253  C CB    . LEU A 1 167 ? 43.249  24.404  106.744 1.00 31.94 ? 164 LEU A CB    1 
ATOM   1254  C CG    . LEU A 1 167 ? 42.366  24.918  107.877 1.00 31.35 ? 164 LEU A CG    1 
ATOM   1255  C CD1   . LEU A 1 167 ? 41.819  23.731  108.623 1.00 30.44 ? 164 LEU A CD1   1 
ATOM   1256  C CD2   . LEU A 1 167 ? 43.173  25.839  108.812 1.00 29.87 ? 164 LEU A CD2   1 
ATOM   1257  N N     . TYR A 1 168 ? 44.695  24.147  103.964 1.00 35.74 ? 165 TYR A N     1 
ATOM   1258  C CA    . TYR A 1 168 ? 45.700  23.512  103.131 1.00 35.93 ? 165 TYR A CA    1 
ATOM   1259  C C     . TYR A 1 168 ? 46.539  24.574  102.420 1.00 38.63 ? 165 TYR A C     1 
ATOM   1260  O O     . TYR A 1 168 ? 47.774  24.518  102.440 1.00 39.53 ? 165 TYR A O     1 
ATOM   1261  C CB    . TYR A 1 168 ? 45.037  22.589  102.106 1.00 33.50 ? 165 TYR A CB    1 
ATOM   1262  C CG    . TYR A 1 168 ? 44.419  21.338  102.698 1.00 34.25 ? 165 TYR A CG    1 
ATOM   1263  C CD1   . TYR A 1 168 ? 45.194  20.424  103.411 1.00 34.77 ? 165 TYR A CD1   1 
ATOM   1264  C CD2   . TYR A 1 168 ? 43.056  21.068  102.555 1.00 34.66 ? 165 TYR A CD2   1 
ATOM   1265  C CE1   . TYR A 1 168 ? 44.633  19.273  103.972 1.00 34.15 ? 165 TYR A CE1   1 
ATOM   1266  C CE2   . TYR A 1 168 ? 42.482  19.919  103.113 1.00 34.38 ? 165 TYR A CE2   1 
ATOM   1267  C CZ    . TYR A 1 168 ? 43.278  19.030  103.821 1.00 34.73 ? 165 TYR A CZ    1 
ATOM   1268  O OH    . TYR A 1 168 ? 42.716  17.915  104.401 1.00 35.78 ? 165 TYR A OH    1 
ATOM   1269  N N     . LYS A 1 169 ? 45.874  25.540  101.795 1.00 38.87 ? 166 LYS A N     1 
ATOM   1270  C CA    . LYS A 1 169 ? 46.589  26.586  101.091 1.00 41.85 ? 166 LYS A CA    1 
ATOM   1271  C C     . LYS A 1 169 ? 47.503  27.324  102.061 1.00 44.20 ? 166 LYS A C     1 
ATOM   1272  O O     . LYS A 1 169 ? 48.556  27.841  101.677 1.00 45.25 ? 166 LYS A O     1 
ATOM   1273  C CB    . LYS A 1 169 ? 45.616  27.569  100.453 1.00 43.80 ? 166 LYS A CB    1 
ATOM   1274  C CG    . LYS A 1 169 ? 46.301  28.653  99.640  1.00 46.78 ? 166 LYS A CG    1 
ATOM   1275  C CD    . LYS A 1 169 ? 45.296  29.628  99.031  1.00 50.10 ? 166 LYS A CD    1 
ATOM   1276  C CE    . LYS A 1 169 ? 44.540  30.424  100.090 1.00 51.91 ? 166 LYS A CE    1 
ATOM   1277  N NZ    . LYS A 1 169 ? 45.398  31.377  100.868 1.00 54.07 ? 166 LYS A NZ    1 
ATOM   1278  N N     . MET A 1 170 ? 47.100  27.378  103.323 1.00 45.18 ? 167 MET A N     1 
ATOM   1279  C CA    . MET A 1 170 ? 47.904  28.045  104.325 1.00 45.82 ? 167 MET A CA    1 
ATOM   1280  C C     . MET A 1 170 ? 49.105  27.185  104.689 1.00 45.89 ? 167 MET A C     1 
ATOM   1281  O O     . MET A 1 170 ? 50.247  27.625  104.569 1.00 44.50 ? 167 MET A O     1 
ATOM   1282  C CB    . MET A 1 170 ? 47.079  28.334  105.581 1.00 46.07 ? 167 MET A CB    1 
ATOM   1283  C CG    . MET A 1 170 ? 46.100  29.482  105.417 1.00 46.87 ? 167 MET A CG    1 
ATOM   1284  S SD    . MET A 1 170 ? 45.434  30.000  107.003 1.00 47.53 ? 167 MET A SD    1 
ATOM   1285  C CE    . MET A 1 170 ? 44.300  28.681  107.336 1.00 44.98 ? 167 MET A CE    1 
ATOM   1286  N N     . MET A 1 171 ? 48.839  25.959  105.136 1.00 46.35 ? 168 MET A N     1 
ATOM   1287  C CA    . MET A 1 171 ? 49.904  25.034  105.518 1.00 47.61 ? 168 MET A CA    1 
ATOM   1288  C C     . MET A 1 171 ? 50.886  24.900  104.373 1.00 48.21 ? 168 MET A C     1 
ATOM   1289  O O     . MET A 1 171 ? 52.095  24.863  104.573 1.00 48.81 ? 168 MET A O     1 
ATOM   1290  C CB    . MET A 1 171 ? 49.336  23.657  105.852 1.00 47.70 ? 168 MET A CB    1 
ATOM   1291  C CG    . MET A 1 171 ? 50.393  22.628  106.251 1.00 49.54 ? 168 MET A CG    1 
ATOM   1292  S SD    . MET A 1 171 ? 51.159  22.937  107.863 1.00 51.58 ? 168 MET A SD    1 
ATOM   1293  C CE    . MET A 1 171 ? 52.566  23.936  107.396 1.00 51.42 ? 168 MET A CE    1 
ATOM   1294  N N     . ALA A 1 172 ? 50.350  24.838  103.164 1.00 49.97 ? 169 ALA A N     1 
ATOM   1295  C CA    . ALA A 1 172 ? 51.175  24.709  101.976 1.00 50.88 ? 169 ALA A CA    1 
ATOM   1296  C C     . ALA A 1 172 ? 52.154  25.878  101.865 1.00 51.09 ? 169 ALA A C     1 
ATOM   1297  O O     . ALA A 1 172 ? 53.289  25.691  101.434 1.00 51.83 ? 169 ALA A O     1 
ATOM   1298  C CB    . ALA A 1 172 ? 50.291  24.628  100.739 1.00 50.43 ? 169 ALA A CB    1 
ATOM   1299  N N     . ASN A 1 173 ? 51.708  27.076  102.247 1.00 51.56 ? 170 ASN A N     1 
ATOM   1300  C CA    . ASN A 1 173 ? 52.554  28.278  102.211 1.00 50.59 ? 170 ASN A CA    1 
ATOM   1301  C C     . ASN A 1 173 ? 53.337  28.393  103.529 1.00 50.17 ? 170 ASN A C     1 
ATOM   1302  O O     . ASN A 1 173 ? 54.099  29.342  103.732 1.00 48.54 ? 170 ASN A O     1 
ATOM   1303  C CB    . ASN A 1 173 ? 51.704  29.544  102.029 1.00 51.12 ? 170 ASN A CB    1 
ATOM   1304  C CG    . ASN A 1 173 ? 51.201  29.728  100.605 1.00 51.22 ? 170 ASN A CG    1 
ATOM   1305  O OD1   . ASN A 1 173 ? 51.984  29.839  99.662  1.00 50.83 ? 170 ASN A OD1   1 
ATOM   1306  N ND2   . ASN A 1 173 ? 49.882  29.777  100.450 1.00 51.42 ? 170 ASN A ND2   1 
ATOM   1307  N N     . GLY A 1 174 ? 53.128  27.420  104.415 1.00 50.03 ? 171 GLY A N     1 
ATOM   1308  C CA    . GLY A 1 174 ? 53.798  27.413  105.703 1.00 49.73 ? 171 GLY A CA    1 
ATOM   1309  C C     . GLY A 1 174 ? 53.450  28.630  106.539 1.00 49.55 ? 171 GLY A C     1 
ATOM   1310  O O     . GLY A 1 174 ? 54.262  29.098  107.335 1.00 49.22 ? 171 GLY A O     1 
ATOM   1311  N N     . ILE A 1 175 ? 52.237  29.143  106.353 1.00 49.87 ? 172 ILE A N     1 
ATOM   1312  C CA    . ILE A 1 175 ? 51.769  30.320  107.078 1.00 48.15 ? 172 ILE A CA    1 
ATOM   1313  C C     . ILE A 1 175 ? 50.755  29.913  108.143 1.00 46.97 ? 172 ILE A C     1 
ATOM   1314  O O     . ILE A 1 175 ? 50.150  30.759  108.792 1.00 47.01 ? 172 ILE A O     1 
ATOM   1315  C CB    . ILE A 1 175 ? 51.118  31.332  106.118 1.00 49.05 ? 172 ILE A CB    1 
ATOM   1316  C CG1   . ILE A 1 175 ? 52.031  31.563  104.908 1.00 50.26 ? 172 ILE A CG1   1 
ATOM   1317  C CG2   . ILE A 1 175 ? 50.869  32.649  106.848 1.00 50.57 ? 172 ILE A CG2   1 
ATOM   1318  C CD1   . ILE A 1 175 ? 51.452  32.492  103.845 1.00 51.80 ? 172 ILE A CD1   1 
ATOM   1319  N N     . LEU A 1 176 ? 50.567  28.609  108.305 1.00 45.23 ? 173 LEU A N     1 
ATOM   1320  C CA    . LEU A 1 176 ? 49.642  28.077  109.295 1.00 44.19 ? 173 LEU A CA    1 
ATOM   1321  C C     . LEU A 1 176 ? 50.498  27.706  110.502 1.00 44.81 ? 173 LEU A C     1 
ATOM   1322  O O     . LEU A 1 176 ? 51.293  26.763  110.450 1.00 44.70 ? 173 LEU A O     1 
ATOM   1323  C CB    . LEU A 1 176 ? 48.914  26.846  108.723 1.00 42.98 ? 173 LEU A CB    1 
ATOM   1324  C CG    . LEU A 1 176 ? 47.705  26.171  109.400 1.00 40.98 ? 173 LEU A CG    1 
ATOM   1325  C CD1   . LEU A 1 176 ? 48.145  25.186  110.444 1.00 39.83 ? 173 LEU A CD1   1 
ATOM   1326  C CD2   . LEU A 1 176 ? 46.790  27.218  109.991 1.00 41.69 ? 173 LEU A CD2   1 
ATOM   1327  N N     . LYS A 1 177 ? 50.331  28.461  111.583 1.00 45.12 ? 174 LYS A N     1 
ATOM   1328  C CA    . LYS A 1 177 ? 51.098  28.264  112.804 1.00 46.03 ? 174 LYS A CA    1 
ATOM   1329  C C     . LYS A 1 177 ? 50.351  27.530  113.924 1.00 46.99 ? 174 LYS A C     1 
ATOM   1330  O O     . LYS A 1 177 ? 50.607  27.773  115.106 1.00 48.44 ? 174 LYS A O     1 
ATOM   1331  C CB    . LYS A 1 177 ? 51.566  29.628  113.332 1.00 45.91 ? 174 LYS A CB    1 
ATOM   1332  C CG    . LYS A 1 177 ? 52.039  30.598  112.263 1.00 45.60 ? 174 LYS A CG    1 
ATOM   1333  C CD    . LYS A 1 177 ? 53.279  30.107  111.525 1.00 47.22 ? 174 LYS A CD    1 
ATOM   1334  C CE    . LYS A 1 177 ? 53.679  31.118  110.453 1.00 49.48 ? 174 LYS A CE    1 
ATOM   1335  N NZ    . LYS A 1 177 ? 54.976  30.802  109.777 1.00 51.03 ? 174 LYS A NZ    1 
ATOM   1336  N N     . VAL A 1 178 ? 49.433  26.637  113.579 1.00 46.78 ? 175 VAL A N     1 
ATOM   1337  C CA    . VAL A 1 178 ? 48.699  25.916  114.613 1.00 47.03 ? 175 VAL A CA    1 
ATOM   1338  C C     . VAL A 1 178 ? 47.963  24.703  114.063 1.00 46.51 ? 175 VAL A C     1 
ATOM   1339  O O     . VAL A 1 178 ? 47.313  24.770  113.021 1.00 44.87 ? 175 VAL A O     1 
ATOM   1340  C CB    . VAL A 1 178 ? 47.699  26.860  115.354 1.00 47.95 ? 175 VAL A CB    1 
ATOM   1341  C CG1   . VAL A 1 178 ? 46.905  27.660  114.356 1.00 49.09 ? 175 VAL A CG1   1 
ATOM   1342  C CG2   . VAL A 1 178 ? 46.761  26.056  116.247 1.00 47.63 ? 175 VAL A CG2   1 
ATOM   1343  N N     . PRO A 1 179 ? 48.069  23.567  114.765 1.00 46.77 ? 176 PRO A N     1 
ATOM   1344  C CA    . PRO A 1 179 ? 47.417  22.318  114.358 1.00 46.68 ? 176 PRO A CA    1 
ATOM   1345  C C     . PRO A 1 179 ? 45.903  22.444  114.190 1.00 46.65 ? 176 PRO A C     1 
ATOM   1346  O O     . PRO A 1 179 ? 45.187  22.847  115.111 1.00 46.71 ? 176 PRO A O     1 
ATOM   1347  C CB    . PRO A 1 179 ? 47.809  21.345  115.472 1.00 46.97 ? 176 PRO A CB    1 
ATOM   1348  C CG    . PRO A 1 179 ? 47.989  22.243  116.658 1.00 47.46 ? 176 PRO A CG    1 
ATOM   1349  C CD    . PRO A 1 179 ? 48.742  23.407  116.066 1.00 46.79 ? 176 PRO A CD    1 
ATOM   1350  N N     . ALA A 1 180 ? 45.419  22.092  113.004 1.00 45.35 ? 177 ALA A N     1 
ATOM   1351  C CA    . ALA A 1 180 ? 43.996  22.168  112.715 1.00 44.38 ? 177 ALA A CA    1 
ATOM   1352  C C     . ALA A 1 180 ? 43.471  20.829  112.250 1.00 43.21 ? 177 ALA A C     1 
ATOM   1353  O O     . ALA A 1 180 ? 44.204  20.029  111.668 1.00 42.74 ? 177 ALA A O     1 
ATOM   1354  C CB    . ALA A 1 180 ? 43.737  23.216  111.646 1.00 44.13 ? 177 ALA A CB    1 
ATOM   1355  N N     . ILE A 1 181 ? 42.194  20.586  112.512 1.00 41.78 ? 178 ILE A N     1 
ATOM   1356  C CA    . ILE A 1 181 ? 41.573  19.346  112.093 1.00 39.87 ? 178 ILE A CA    1 
ATOM   1357  C C     . ILE A 1 181 ? 40.537  19.622  111.012 1.00 39.26 ? 178 ILE A C     1 
ATOM   1358  O O     . ILE A 1 181 ? 39.693  20.516  111.137 1.00 38.00 ? 178 ILE A O     1 
ATOM   1359  C CB    . ILE A 1 181 ? 40.914  18.610  113.282 1.00 39.82 ? 178 ILE A CB    1 
ATOM   1360  C CG1   . ILE A 1 181 ? 41.974  17.797  114.030 1.00 39.21 ? 178 ILE A CG1   1 
ATOM   1361  C CG2   . ILE A 1 181 ? 39.793  17.709  112.789 1.00 39.46 ? 178 ILE A CG2   1 
ATOM   1362  C CD1   . ILE A 1 181 ? 41.420  16.878  115.101 1.00 38.18 ? 178 ILE A CD1   1 
ATOM   1363  N N     . ASN A 1 182 ? 40.626  18.850  109.937 1.00 38.48 ? 179 ASN A N     1 
ATOM   1364  C CA    . ASN A 1 182 ? 39.708  18.978  108.818 1.00 38.59 ? 179 ASN A CA    1 
ATOM   1365  C C     . ASN A 1 182 ? 38.435  18.221  109.187 1.00 38.12 ? 179 ASN A C     1 
ATOM   1366  O O     . ASN A 1 182 ? 38.380  16.997  109.053 1.00 39.40 ? 179 ASN A O     1 
ATOM   1367  C CB    . ASN A 1 182 ? 40.343  18.360  107.576 1.00 39.74 ? 179 ASN A CB    1 
ATOM   1368  C CG    . ASN A 1 182 ? 39.496  18.526  106.345 1.00 39.39 ? 179 ASN A CG    1 
ATOM   1369  O OD1   . ASN A 1 182 ? 38.265  18.565  106.420 1.00 36.49 ? 179 ASN A OD1   1 
ATOM   1370  N ND2   . ASN A 1 182 ? 40.153  18.599  105.186 1.00 40.32 ? 179 ASN A ND2   1 
ATOM   1371  N N     . VAL A 1 183 ? 37.417  18.943  109.652 1.00 36.17 ? 180 VAL A N     1 
ATOM   1372  C CA    . VAL A 1 183 ? 36.161  18.313  110.056 1.00 34.00 ? 180 VAL A CA    1 
ATOM   1373  C C     . VAL A 1 183 ? 35.214  18.072  108.885 1.00 33.81 ? 180 VAL A C     1 
ATOM   1374  O O     . VAL A 1 183 ? 34.428  17.121  108.901 1.00 31.73 ? 180 VAL A O     1 
ATOM   1375  C CB    . VAL A 1 183 ? 35.437  19.169  111.118 1.00 32.94 ? 180 VAL A CB    1 
ATOM   1376  C CG1   . VAL A 1 183 ? 34.203  18.449  111.627 1.00 32.89 ? 180 VAL A CG1   1 
ATOM   1377  C CG2   . VAL A 1 183 ? 36.375  19.460  112.265 1.00 33.32 ? 180 VAL A CG2   1 
ATOM   1378  N N     . ASN A 1 184 ? 35.297  18.934  107.871 1.00 33.90 ? 181 ASN A N     1 
ATOM   1379  C CA    . ASN A 1 184 ? 34.444  18.828  106.683 1.00 33.88 ? 181 ASN A CA    1 
ATOM   1380  C C     . ASN A 1 184 ? 34.662  17.551  105.891 1.00 34.09 ? 181 ASN A C     1 
ATOM   1381  O O     . ASN A 1 184 ? 33.706  16.889  105.492 1.00 33.26 ? 181 ASN A O     1 
ATOM   1382  C CB    . ASN A 1 184 ? 34.661  20.010  105.744 1.00 33.51 ? 181 ASN A CB    1 
ATOM   1383  C CG    . ASN A 1 184 ? 33.835  19.899  104.469 1.00 34.76 ? 181 ASN A CG    1 
ATOM   1384  O OD1   . ASN A 1 184 ? 34.112  19.066  103.596 1.00 32.98 ? 181 ASN A OD1   1 
ATOM   1385  N ND2   . ASN A 1 184 ? 32.803  20.738  104.361 1.00 33.66 ? 181 ASN A ND2   1 
ATOM   1386  N N     . ASP A 1 185 ? 35.921  17.204  105.660 1.00 34.50 ? 182 ASP A N     1 
ATOM   1387  C CA    . ASP A 1 185 ? 36.219  16.010  104.887 1.00 34.65 ? 182 ASP A CA    1 
ATOM   1388  C C     . ASP A 1 185 ? 36.086  14.710  105.654 1.00 35.59 ? 182 ASP A C     1 
ATOM   1389  O O     . ASP A 1 185 ? 36.589  13.674  105.248 1.00 35.76 ? 182 ASP A O     1 
ATOM   1390  C CB    . ASP A 1 185 ? 37.593  16.137  104.248 1.00 34.64 ? 182 ASP A CB    1 
ATOM   1391  C CG    . ASP A 1 185 ? 37.594  17.141  103.119 1.00 34.34 ? 182 ASP A CG    1 
ATOM   1392  O OD1   . ASP A 1 185 ? 36.621  17.119  102.340 1.00 36.02 ? 182 ASP A OD1   1 
ATOM   1393  O OD2   . ASP A 1 185 ? 38.546  17.940  103.000 1.00 35.50 ? 182 ASP A OD2   1 
ATOM   1394  N N     . SER A 1 186 ? 35.387  14.763  106.773 1.00 36.85 ? 183 SER A N     1 
ATOM   1395  C CA    . SER A 1 186 ? 35.156  13.560  107.549 1.00 38.64 ? 183 SER A CA    1 
ATOM   1396  C C     . SER A 1 186 ? 33.913  12.915  106.913 1.00 38.43 ? 183 SER A C     1 
ATOM   1397  O O     . SER A 1 186 ? 32.918  13.591  106.662 1.00 39.27 ? 183 SER A O     1 
ATOM   1398  C CB    . SER A 1 186 ? 34.905  13.932  109.014 1.00 38.77 ? 183 SER A CB    1 
ATOM   1399  O OG    . SER A 1 186 ? 34.204  12.906  109.682 1.00 43.41 ? 183 SER A OG    1 
ATOM   1400  N N     . VAL A 1 187 ? 33.965  11.619  106.635 1.00 38.19 ? 184 VAL A N     1 
ATOM   1401  C CA    . VAL A 1 187 ? 32.834  10.955  105.988 1.00 38.44 ? 184 VAL A CA    1 
ATOM   1402  C C     . VAL A 1 187 ? 31.478  11.374  106.542 1.00 38.28 ? 184 VAL A C     1 
ATOM   1403  O O     . VAL A 1 187 ? 30.633  11.866  105.801 1.00 39.08 ? 184 VAL A O     1 
ATOM   1404  C CB    . VAL A 1 187 ? 32.919  9.409   106.087 1.00 38.84 ? 184 VAL A CB    1 
ATOM   1405  C CG1   . VAL A 1 187 ? 31.928  8.787   105.103 1.00 37.95 ? 184 VAL A CG1   1 
ATOM   1406  C CG2   . VAL A 1 187 ? 34.332  8.925   105.798 1.00 40.05 ? 184 VAL A CG2   1 
ATOM   1407  N N     . THR A 1 188 ? 31.269  11.175  107.839 1.00 36.64 ? 185 THR A N     1 
ATOM   1408  C CA    . THR A 1 188 ? 30.000  11.530  108.460 1.00 35.83 ? 185 THR A CA    1 
ATOM   1409  C C     . THR A 1 188 ? 29.612  13.004  108.302 1.00 34.89 ? 185 THR A C     1 
ATOM   1410  O O     . THR A 1 188 ? 28.534  13.414  108.759 1.00 33.91 ? 185 THR A O     1 
ATOM   1411  C CB    . THR A 1 188 ? 30.002  11.181  109.965 1.00 36.66 ? 185 THR A CB    1 
ATOM   1412  O OG1   . THR A 1 188 ? 31.166  11.747  110.585 1.00 36.88 ? 185 THR A OG1   1 
ATOM   1413  C CG2   . THR A 1 188 ? 29.979  9.678   110.164 1.00 34.18 ? 185 THR A CG2   1 
ATOM   1414  N N     . LYS A 1 189 ? 30.478  13.794  107.665 1.00 32.81 ? 186 LYS A N     1 
ATOM   1415  C CA    . LYS A 1 189 ? 30.193  15.215  107.451 1.00 32.50 ? 186 LYS A CA    1 
ATOM   1416  C C     . LYS A 1 189 ? 29.907  15.567  105.989 1.00 31.05 ? 186 LYS A C     1 
ATOM   1417  O O     . LYS A 1 189 ? 28.775  15.857  105.629 1.00 30.43 ? 186 LYS A O     1 
ATOM   1418  C CB    . LYS A 1 189 ? 31.351  16.078  107.950 1.00 32.37 ? 186 LYS A CB    1 
ATOM   1419  C CG    . LYS A 1 189 ? 30.950  17.516  108.256 1.00 31.68 ? 186 LYS A CG    1 
ATOM   1420  C CD    . LYS A 1 189 ? 30.688  18.335  107.009 1.00 30.57 ? 186 LYS A CD    1 
ATOM   1421  C CE    . LYS A 1 189 ? 30.308  19.768  107.373 1.00 30.63 ? 186 LYS A CE    1 
ATOM   1422  N NZ    . LYS A 1 189 ? 30.157  20.650  106.172 1.00 28.17 ? 186 LYS A NZ    1 
ATOM   1423  N N     . SER A 1 190 ? 30.949  15.548  105.164 1.00 29.98 ? 187 SER A N     1 
ATOM   1424  C CA    . SER A 1 190 ? 30.851  15.858  103.735 1.00 29.73 ? 187 SER A CA    1 
ATOM   1425  C C     . SER A 1 190 ? 29.859  14.988  102.963 1.00 29.41 ? 187 SER A C     1 
ATOM   1426  O O     . SER A 1 190 ? 29.235  15.448  102.007 1.00 29.05 ? 187 SER A O     1 
ATOM   1427  C CB    . SER A 1 190 ? 32.221  15.689  103.082 1.00 30.26 ? 187 SER A CB    1 
ATOM   1428  O OG    . SER A 1 190 ? 32.686  14.359  103.270 1.00 29.60 ? 187 SER A OG    1 
ATOM   1429  N N     . LYS A 1 191 ? 29.736  13.725  103.360 1.00 28.24 ? 188 LYS A N     1 
ATOM   1430  C CA    . LYS A 1 191 ? 28.842  12.800  102.668 1.00 27.09 ? 188 LYS A CA    1 
ATOM   1431  C C     . LYS A 1 191 ? 27.444  12.734  103.259 1.00 26.22 ? 188 LYS A C     1 
ATOM   1432  O O     . LYS A 1 191 ? 26.646  11.852  102.908 1.00 26.10 ? 188 LYS A O     1 
ATOM   1433  C CB    . LYS A 1 191 ? 29.468  11.402  102.622 1.00 25.80 ? 188 LYS A CB    1 
ATOM   1434  C CG    . LYS A 1 191 ? 30.525  11.239  101.545 1.00 23.80 ? 188 LYS A CG    1 
ATOM   1435  C CD    . LYS A 1 191 ? 29.919  10.888  100.172 1.00 28.75 ? 188 LYS A CD    1 
ATOM   1436  C CE    . LYS A 1 191 ? 31.015  10.303  99.258  1.00 31.04 ? 188 LYS A CE    1 
ATOM   1437  N NZ    . LYS A 1 191 ? 30.559  9.593   98.008  1.00 32.90 ? 188 LYS A NZ    1 
ATOM   1438  N N     . PHE A 1 192 ? 27.142  13.674  104.151 1.00 26.21 ? 189 PHE A N     1 
ATOM   1439  C CA    . PHE A 1 192 ? 25.827  13.734  104.779 1.00 25.34 ? 189 PHE A CA    1 
ATOM   1440  C C     . PHE A 1 192 ? 25.343  15.173  104.878 1.00 25.93 ? 189 PHE A C     1 
ATOM   1441  O O     . PHE A 1 192 ? 24.236  15.498  104.444 1.00 29.30 ? 189 PHE A O     1 
ATOM   1442  C CB    . PHE A 1 192 ? 25.864  13.100  106.174 1.00 22.20 ? 189 PHE A CB    1 
ATOM   1443  C CG    . PHE A 1 192 ? 26.168  11.631  106.166 1.00 20.26 ? 189 PHE A CG    1 
ATOM   1444  C CD1   . PHE A 1 192 ? 27.464  11.172  105.964 1.00 19.43 ? 189 PHE A CD1   1 
ATOM   1445  C CD2   . PHE A 1 192 ? 25.146  10.697  106.330 1.00 19.90 ? 189 PHE A CD2   1 
ATOM   1446  C CE1   . PHE A 1 192 ? 27.740  9.808   105.922 1.00 19.36 ? 189 PHE A CE1   1 
ATOM   1447  C CE2   . PHE A 1 192 ? 25.413  9.326   106.289 1.00 17.98 ? 189 PHE A CE2   1 
ATOM   1448  C CZ    . PHE A 1 192 ? 26.706  8.883   106.084 1.00 18.73 ? 189 PHE A CZ    1 
ATOM   1449  N N     . ASP A 1 193 ? 26.174  16.031  105.451 1.00 26.18 ? 190 ASP A N     1 
ATOM   1450  C CA    . ASP A 1 193 ? 25.845  17.434  105.636 1.00 28.01 ? 190 ASP A CA    1 
ATOM   1451  C C     . ASP A 1 193 ? 25.745  18.165  104.304 1.00 28.52 ? 190 ASP A C     1 
ATOM   1452  O O     . ASP A 1 193 ? 24.744  18.836  104.022 1.00 28.43 ? 190 ASP A O     1 
ATOM   1453  C CB    . ASP A 1 193 ? 26.923  18.098  106.517 1.00 30.02 ? 190 ASP A CB    1 
ATOM   1454  C CG    . ASP A 1 193 ? 26.741  19.602  106.652 1.00 30.66 ? 190 ASP A CG    1 
ATOM   1455  O OD1   . ASP A 1 193 ? 26.737  20.310  105.620 1.00 29.49 ? 190 ASP A OD1   1 
ATOM   1456  O OD2   . ASP A 1 193 ? 26.615  20.081  107.801 1.00 33.80 ? 190 ASP A OD2   1 
ATOM   1457  N N     . ASN A 1 194 ? 26.779  18.033  103.483 1.00 26.56 ? 191 ASN A N     1 
ATOM   1458  C CA    . ASN A 1 194 ? 26.800  18.704  102.197 1.00 27.75 ? 191 ASN A CA    1 
ATOM   1459  C C     . ASN A 1 194 ? 25.764  18.118  101.237 1.00 29.68 ? 191 ASN A C     1 
ATOM   1460  O O     . ASN A 1 194 ? 25.034  18.852  100.546 1.00 28.18 ? 191 ASN A O     1 
ATOM   1461  C CB    . ASN A 1 194 ? 28.210  18.618  101.576 1.00 27.26 ? 191 ASN A CB    1 
ATOM   1462  C CG    . ASN A 1 194 ? 29.318  19.161  102.503 1.00 26.88 ? 191 ASN A CG    1 
ATOM   1463  O OD1   . ASN A 1 194 ? 30.352  19.618  102.035 1.00 28.53 ? 191 ASN A OD1   1 
ATOM   1464  N ND2   . ASN A 1 194 ? 29.104  19.092  103.808 1.00 26.76 ? 191 ASN A ND2   1 
ATOM   1465  N N     . LEU A 1 195 ? 25.674  16.794  101.218 1.00 29.33 ? 192 LEU A N     1 
ATOM   1466  C CA    . LEU A 1 195 ? 24.747  16.130  100.324 1.00 28.12 ? 192 LEU A CA    1 
ATOM   1467  C C     . LEU A 1 195 ? 23.287  16.223  100.766 1.00 28.14 ? 192 LEU A C     1 
ATOM   1468  O O     . LEU A 1 195 ? 22.519  17.016  100.229 1.00 27.73 ? 192 LEU A O     1 
ATOM   1469  C CB    . LEU A 1 195 ? 25.158  14.667  100.159 1.00 27.75 ? 192 LEU A CB    1 
ATOM   1470  C CG    . LEU A 1 195 ? 24.473  13.956  98.986  1.00 26.80 ? 192 LEU A CG    1 
ATOM   1471  C CD1   . LEU A 1 195 ? 24.945  14.528  97.669  1.00 19.82 ? 192 LEU A CD1   1 
ATOM   1472  C CD2   . LEU A 1 195 ? 24.778  12.472  99.066  1.00 28.45 ? 192 LEU A CD2   1 
ATOM   1473  N N     . TYR A 1 196 ? 22.912  15.408  101.749 1.00 29.68 ? 193 TYR A N     1 
ATOM   1474  C CA    . TYR A 1 196 ? 21.539  15.361  102.262 1.00 28.06 ? 193 TYR A CA    1 
ATOM   1475  C C     . TYR A 1 196 ? 21.053  16.654  102.897 1.00 27.84 ? 193 TYR A C     1 
ATOM   1476  O O     . TYR A 1 196 ? 19.860  16.974  102.850 1.00 27.18 ? 193 TYR A O     1 
ATOM   1477  C CB    . TYR A 1 196 ? 21.407  14.223  103.275 1.00 29.20 ? 193 TYR A CB    1 
ATOM   1478  C CG    . TYR A 1 196 ? 21.901  12.886  102.765 1.00 28.32 ? 193 TYR A CG    1 
ATOM   1479  C CD1   . TYR A 1 196 ? 21.488  12.384  101.528 1.00 28.66 ? 193 TYR A CD1   1 
ATOM   1480  C CD2   . TYR A 1 196 ? 22.761  12.113  103.531 1.00 27.18 ? 193 TYR A CD2   1 
ATOM   1481  C CE1   . TYR A 1 196 ? 21.931  11.135  101.081 1.00 28.21 ? 193 TYR A CE1   1 
ATOM   1482  C CE2   . TYR A 1 196 ? 23.201  10.882  103.095 1.00 27.24 ? 193 TYR A CE2   1 
ATOM   1483  C CZ    . TYR A 1 196 ? 22.789  10.394  101.876 1.00 26.55 ? 193 TYR A CZ    1 
ATOM   1484  O OH    . TYR A 1 196 ? 23.264  9.174   101.474 1.00 24.93 ? 193 TYR A OH    1 
ATOM   1485  N N     . GLY A 1 197 ? 21.972  17.385  103.512 1.00 27.88 ? 194 GLY A N     1 
ATOM   1486  C CA    . GLY A 1 197 ? 21.599  18.635  104.129 1.00 27.96 ? 194 GLY A CA    1 
ATOM   1487  C C     . GLY A 1 197 ? 21.052  19.594  103.090 1.00 28.28 ? 194 GLY A C     1 
ATOM   1488  O O     . GLY A 1 197 ? 19.903  20.012  103.173 1.00 30.09 ? 194 GLY A O     1 
ATOM   1489  N N     . CYS A 1 198 ? 21.852  19.934  102.086 1.00 28.13 ? 195 CYS A N     1 
ATOM   1490  C CA    . CYS A 1 198 ? 21.389  20.878  101.069 1.00 28.01 ? 195 CYS A CA    1 
ATOM   1491  C C     . CYS A 1 198 ? 20.145  20.394  100.333 1.00 28.02 ? 195 CYS A C     1 
ATOM   1492  O O     . CYS A 1 198 ? 19.269  21.193  99.985  1.00 28.24 ? 195 CYS A O     1 
ATOM   1493  C CB    . CYS A 1 198 ? 22.491  21.163  100.064 1.00 25.56 ? 195 CYS A CB    1 
ATOM   1494  S SG    . CYS A 1 198 ? 23.930  21.864  100.795 1.00 26.55 ? 195 CYS A SG    1 
ATOM   1495  N N     . ARG A 1 199 ? 20.078  19.085  100.113 1.00 26.74 ? 196 ARG A N     1 
ATOM   1496  C CA    . ARG A 1 199 ? 18.971  18.458  99.414  1.00 26.46 ? 196 ARG A CA    1 
ATOM   1497  C C     . ARG A 1 199 ? 17.643  18.884  100.025 1.00 27.54 ? 196 ARG A C     1 
ATOM   1498  O O     . ARG A 1 199 ? 16.628  18.927  99.344  1.00 28.66 ? 196 ARG A O     1 
ATOM   1499  C CB    . ARG A 1 199 ? 19.128  16.934  99.475  1.00 24.90 ? 196 ARG A CB    1 
ATOM   1500  C CG    . ARG A 1 199 ? 18.213  16.188  98.544  1.00 24.35 ? 196 ARG A CG    1 
ATOM   1501  C CD    . ARG A 1 199 ? 18.481  14.695  98.534  1.00 27.13 ? 196 ARG A CD    1 
ATOM   1502  N NE    . ARG A 1 199 ? 18.116  14.038  99.788  1.00 28.60 ? 196 ARG A NE    1 
ATOM   1503  C CZ    . ARG A 1 199 ? 18.248  12.732  100.016 1.00 29.50 ? 196 ARG A CZ    1 
ATOM   1504  N NH1   . ARG A 1 199 ? 18.737  11.939  99.072  1.00 28.13 ? 196 ARG A NH1   1 
ATOM   1505  N NH2   . ARG A 1 199 ? 17.889  12.215  101.187 1.00 28.20 ? 196 ARG A NH2   1 
ATOM   1506  N N     . GLU A 1 200 ? 17.654  19.200  101.315 1.00 28.50 ? 197 GLU A N     1 
ATOM   1507  C CA    . GLU A 1 200 ? 16.439  19.635  101.993 1.00 26.77 ? 197 GLU A CA    1 
ATOM   1508  C C     . GLU A 1 200 ? 16.423  21.138  102.269 1.00 26.49 ? 197 GLU A C     1 
ATOM   1509  O O     . GLU A 1 200 ? 15.364  21.753  102.299 1.00 28.03 ? 197 GLU A O     1 
ATOM   1510  C CB    . GLU A 1 200 ? 16.265  18.870  103.307 1.00 27.17 ? 197 GLU A CB    1 
ATOM   1511  C CG    . GLU A 1 200 ? 15.887  17.394  103.127 1.00 25.90 ? 197 GLU A CG    1 
ATOM   1512  C CD    . GLU A 1 200 ? 15.646  16.665  104.441 1.00 23.63 ? 197 GLU A CD    1 
ATOM   1513  O OE1   . GLU A 1 200 ? 15.192  17.298  105.414 1.00 22.13 ? 197 GLU A OE1   1 
ATOM   1514  O OE2   . GLU A 1 200 ? 15.900  15.447  104.494 1.00 25.12 ? 197 GLU A OE2   1 
ATOM   1515  N N     . SER A 1 201 ? 17.595  21.735  102.443 1.00 25.94 ? 198 SER A N     1 
ATOM   1516  C CA    . SER A 1 201 ? 17.665  23.158  102.765 1.00 27.89 ? 198 SER A CA    1 
ATOM   1517  C C     . SER A 1 201 ? 17.672  24.150  101.586 1.00 26.11 ? 198 SER A C     1 
ATOM   1518  O O     . SER A 1 201 ? 17.210  25.284  101.742 1.00 25.84 ? 198 SER A O     1 
ATOM   1519  C CB    . SER A 1 201 ? 18.878  23.423  103.677 1.00 27.22 ? 198 SER A CB    1 
ATOM   1520  O OG    . SER A 1 201 ? 20.086  23.072  103.029 1.00 32.25 ? 198 SER A OG    1 
ATOM   1521  N N     . LEU A 1 202 ? 18.202  23.745  100.429 1.00 24.16 ? 199 LEU A N     1 
ATOM   1522  C CA    . LEU A 1 202 ? 18.226  24.635  99.262  1.00 22.35 ? 199 LEU A CA    1 
ATOM   1523  C C     . LEU A 1 202 ? 16.813  25.048  98.878  1.00 20.71 ? 199 LEU A C     1 
ATOM   1524  O O     . LEU A 1 202 ? 16.508  26.230  98.836  1.00 21.15 ? 199 LEU A O     1 
ATOM   1525  C CB    . LEU A 1 202 ? 18.873  23.960  98.046  1.00 22.86 ? 199 LEU A CB    1 
ATOM   1526  C CG    . LEU A 1 202 ? 18.577  24.687  96.717  1.00 24.09 ? 199 LEU A CG    1 
ATOM   1527  C CD1   . LEU A 1 202 ? 19.319  26.014  96.670  1.00 23.26 ? 199 LEU A CD1   1 
ATOM   1528  C CD2   . LEU A 1 202 ? 18.977  23.828  95.536  1.00 22.56 ? 199 LEU A CD2   1 
ATOM   1529  N N     . ILE A 1 203 ? 15.952  24.070  98.604  1.00 19.25 ? 200 ILE A N     1 
ATOM   1530  C CA    . ILE A 1 203 ? 14.583  24.374  98.204  1.00 18.77 ? 200 ILE A CA    1 
ATOM   1531  C C     . ILE A 1 203 ? 13.871  25.220  99.241  1.00 17.55 ? 200 ILE A C     1 
ATOM   1532  O O     . ILE A 1 203 ? 13.215  26.203  98.907  1.00 15.76 ? 200 ILE A O     1 
ATOM   1533  C CB    . ILE A 1 203 ? 13.740  23.108  97.981  1.00 21.18 ? 200 ILE A CB    1 
ATOM   1534  C CG1   . ILE A 1 203 ? 14.488  22.109  97.094  1.00 24.58 ? 200 ILE A CG1   1 
ATOM   1535  C CG2   . ILE A 1 203 ? 12.441  23.491  97.282  1.00 19.90 ? 200 ILE A CG2   1 
ATOM   1536  C CD1   . ILE A 1 203 ? 14.747  22.615  95.687  1.00 27.75 ? 200 ILE A CD1   1 
ATOM   1537  N N     . ASP A 1 204 ? 13.993  24.812  100.499 1.00 17.34 ? 201 ASP A N     1 
ATOM   1538  C CA    . ASP A 1 204 ? 13.379  25.517  101.620 1.00 16.27 ? 201 ASP A CA    1 
ATOM   1539  C C     . ASP A 1 204 ? 13.672  27.019  101.457 1.00 15.54 ? 201 ASP A C     1 
ATOM   1540  O O     . ASP A 1 204 ? 12.749  27.832  101.424 1.00 14.31 ? 201 ASP A O     1 
ATOM   1541  C CB    . ASP A 1 204 ? 13.959  24.963  102.924 1.00 18.51 ? 201 ASP A CB    1 
ATOM   1542  C CG    . ASP A 1 204 ? 13.106  25.281  104.152 1.00 21.54 ? 201 ASP A CG    1 
ATOM   1543  O OD1   . ASP A 1 204 ? 12.118  26.037  104.062 1.00 22.37 ? 201 ASP A OD1   1 
ATOM   1544  O OD2   . ASP A 1 204 ? 13.450  24.763  105.234 1.00 22.78 ? 201 ASP A OD2   1 
ATOM   1545  N N     . GLY A 1 205 ? 14.947  27.377  101.331 1.00 14.26 ? 202 GLY A N     1 
ATOM   1546  C CA    . GLY A 1 205 ? 15.301  28.771  101.151 1.00 16.90 ? 202 GLY A CA    1 
ATOM   1547  C C     . GLY A 1 205 ? 14.634  29.408  99.935  1.00 18.89 ? 202 GLY A C     1 
ATOM   1548  O O     . GLY A 1 205 ? 14.073  30.498  100.022 1.00 18.81 ? 202 GLY A O     1 
ATOM   1549  N N     . ILE A 1 206 ? 14.695  28.733  98.794  1.00 19.05 ? 203 ILE A N     1 
ATOM   1550  C CA    . ILE A 1 206 ? 14.085  29.255  97.581  1.00 20.66 ? 203 ILE A CA    1 
ATOM   1551  C C     . ILE A 1 206 ? 12.582  29.523  97.747  1.00 21.79 ? 203 ILE A C     1 
ATOM   1552  O O     . ILE A 1 206 ? 12.061  30.551  97.290  1.00 20.74 ? 203 ILE A O     1 
ATOM   1553  C CB    . ILE A 1 206 ? 14.288  28.273  96.426  1.00 19.06 ? 203 ILE A CB    1 
ATOM   1554  C CG1   . ILE A 1 206 ? 15.786  28.204  96.091  1.00 17.48 ? 203 ILE A CG1   1 
ATOM   1555  C CG2   . ILE A 1 206 ? 13.399  28.668  95.247  1.00 20.30 ? 203 ILE A CG2   1 
ATOM   1556  C CD1   . ILE A 1 206 ? 16.155  27.235  94.999  1.00 14.57 ? 203 ILE A CD1   1 
ATOM   1557  N N     . LYS A 1 207 ? 11.911  28.585  98.409  1.00 20.85 ? 204 LYS A N     1 
ATOM   1558  C CA    . LYS A 1 207 ? 10.479  28.630  98.661  1.00 22.18 ? 204 LYS A CA    1 
ATOM   1559  C C     . LYS A 1 207 ? 10.059  29.761  99.593  1.00 23.25 ? 204 LYS A C     1 
ATOM   1560  O O     . LYS A 1 207 ? 9.247   30.606  99.230  1.00 24.32 ? 204 LYS A O     1 
ATOM   1561  C CB    . LYS A 1 207 ? 10.019  27.291  99.266  1.00 24.05 ? 204 LYS A CB    1 
ATOM   1562  C CG    . LYS A 1 207 ? 10.008  26.108  98.297  1.00 22.01 ? 204 LYS A CG    1 
ATOM   1563  C CD    . LYS A 1 207 ? 8.754   26.110  97.449  1.00 22.17 ? 204 LYS A CD    1 
ATOM   1564  C CE    . LYS A 1 207 ? 8.513   24.764  96.789  1.00 19.44 ? 204 LYS A CE    1 
ATOM   1565  N NZ    . LYS A 1 207 ? 7.501   24.929  95.727  1.00 20.88 ? 204 LYS A NZ    1 
ATOM   1566  N N     . ARG A 1 208 ? 10.594  29.766  100.811 1.00 25.60 ? 205 ARG A N     1 
ATOM   1567  C CA    . ARG A 1 208 ? 10.243  30.818  101.761 1.00 25.08 ? 205 ARG A CA    1 
ATOM   1568  C C     . ARG A 1 208 ? 10.508  32.178  101.158 1.00 23.95 ? 205 ARG A C     1 
ATOM   1569  O O     . ARG A 1 208 ? 9.828   33.139  101.480 1.00 25.40 ? 205 ARG A O     1 
ATOM   1570  C CB    . ARG A 1 208 ? 11.041  30.682  103.060 1.00 24.17 ? 205 ARG A CB    1 
ATOM   1571  C CG    . ARG A 1 208 ? 10.730  29.416  103.820 1.00 26.75 ? 205 ARG A CG    1 
ATOM   1572  C CD    . ARG A 1 208 ? 11.396  29.395  105.170 1.00 25.09 ? 205 ARG A CD    1 
ATOM   1573  N NE    . ARG A 1 208 ? 11.476  28.034  105.689 1.00 27.03 ? 205 ARG A NE    1 
ATOM   1574  C CZ    . ARG A 1 208 ? 11.713  27.727  106.961 1.00 28.57 ? 205 ARG A CZ    1 
ATOM   1575  N NH1   . ARG A 1 208 ? 11.886  28.691  107.856 1.00 27.78 ? 205 ARG A NH1   1 
ATOM   1576  N NH2   . ARG A 1 208 ? 11.796  26.455  107.338 1.00 26.95 ? 205 ARG A NH2   1 
ATOM   1577  N N     . ALA A 1 209 ? 11.496  32.269  100.278 1.00 24.03 ? 206 ALA A N     1 
ATOM   1578  C CA    . ALA A 1 209 ? 11.804  33.559  99.669  1.00 26.51 ? 206 ALA A CA    1 
ATOM   1579  C C     . ALA A 1 209 ? 10.931  33.939  98.473  1.00 25.92 ? 206 ALA A C     1 
ATOM   1580  O O     . ALA A 1 209 ? 10.567  35.102  98.332  1.00 27.73 ? 206 ALA A O     1 
ATOM   1581  C CB    . ALA A 1 209 ? 13.278  33.610  99.260  1.00 23.41 ? 206 ALA A CB    1 
ATOM   1582  N N     . THR A 1 210 ? 10.582  32.959  97.639  1.00 25.50 ? 207 THR A N     1 
ATOM   1583  C CA    . THR A 1 210 ? 9.819   33.238  96.419  1.00 25.24 ? 207 THR A CA    1 
ATOM   1584  C C     . THR A 1 210 ? 8.477   32.524  96.234  1.00 26.28 ? 207 THR A C     1 
ATOM   1585  O O     . THR A 1 210 ? 7.595   33.027  95.516  1.00 28.28 ? 207 THR A O     1 
ATOM   1586  C CB    . THR A 1 210 ? 10.669  32.902  95.167  1.00 24.21 ? 207 THR A CB    1 
ATOM   1587  O OG1   . THR A 1 210 ? 10.812  31.474  95.070  1.00 25.62 ? 207 THR A OG1   1 
ATOM   1588  C CG2   . THR A 1 210 ? 12.071  33.521  95.260  1.00 20.89 ? 207 THR A CG2   1 
ATOM   1589  N N     . ASP A 1 211 ? 8.330   31.362  96.868  1.00 24.71 ? 208 ASP A N     1 
ATOM   1590  C CA    . ASP A 1 211 ? 7.122   30.542  96.750  1.00 25.05 ? 208 ASP A CA    1 
ATOM   1591  C C     . ASP A 1 211 ? 6.926   30.053  95.303  1.00 24.72 ? 208 ASP A C     1 
ATOM   1592  O O     . ASP A 1 211 ? 5.824   29.701  94.905  1.00 21.44 ? 208 ASP A O     1 
ATOM   1593  C CB    . ASP A 1 211 ? 5.871   31.303  97.219  1.00 25.89 ? 208 ASP A CB    1 
ATOM   1594  C CG    . ASP A 1 211 ? 5.774   31.385  98.728  1.00 27.11 ? 208 ASP A CG    1 
ATOM   1595  O OD1   . ASP A 1 211 ? 5.933   30.341  99.391  1.00 31.35 ? 208 ASP A OD1   1 
ATOM   1596  O OD2   . ASP A 1 211 ? 5.540   32.486  99.254  1.00 29.04 ? 208 ASP A OD2   1 
ATOM   1597  N N     . VAL A 1 212 ? 8.010   30.007  94.533  1.00 24.97 ? 209 VAL A N     1 
ATOM   1598  C CA    . VAL A 1 212 ? 7.934   29.568  93.147  1.00 26.10 ? 209 VAL A CA    1 
ATOM   1599  C C     . VAL A 1 212 ? 7.690   28.062  92.990  1.00 27.97 ? 209 VAL A C     1 
ATOM   1600  O O     . VAL A 1 212 ? 8.078   27.253  93.840  1.00 29.52 ? 209 VAL A O     1 
ATOM   1601  C CB    . VAL A 1 212 ? 9.214   29.952  92.350  1.00 25.25 ? 209 VAL A CB    1 
ATOM   1602  C CG1   . VAL A 1 212 ? 10.415  29.146  92.834  1.00 27.20 ? 209 VAL A CG1   1 
ATOM   1603  C CG2   . VAL A 1 212 ? 8.982   29.721  90.866  1.00 24.78 ? 209 VAL A CG2   1 
ATOM   1604  N N     . MET A 1 213 ? 7.036   27.693  91.894  1.00 27.44 ? 210 MET A N     1 
ATOM   1605  C CA    . MET A 1 213 ? 6.760   26.299  91.600  1.00 26.25 ? 210 MET A CA    1 
ATOM   1606  C C     . MET A 1 213 ? 8.075   25.727  91.070  1.00 25.62 ? 210 MET A C     1 
ATOM   1607  O O     . MET A 1 213 ? 8.710   26.338  90.208  1.00 26.89 ? 210 MET A O     1 
ATOM   1608  C CB    . MET A 1 213 ? 5.683   26.212  90.514  1.00 27.14 ? 210 MET A CB    1 
ATOM   1609  C CG    . MET A 1 213 ? 5.173   24.815  90.214  1.00 28.39 ? 210 MET A CG    1 
ATOM   1610  S SD    . MET A 1 213 ? 3.822   24.356  91.321  1.00 34.97 ? 210 MET A SD    1 
ATOM   1611  C CE    . MET A 1 213 ? 3.886   22.545  91.253  1.00 31.05 ? 210 MET A CE    1 
ATOM   1612  N N     . ILE A 1 214 ? 8.498   24.579  91.594  1.00 23.95 ? 211 ILE A N     1 
ATOM   1613  C CA    . ILE A 1 214 ? 9.739   23.944  91.144  1.00 21.95 ? 211 ILE A CA    1 
ATOM   1614  C C     . ILE A 1 214 ? 9.406   23.001  89.993  1.00 22.13 ? 211 ILE A C     1 
ATOM   1615  O O     . ILE A 1 214 ? 10.205  22.819  89.076  1.00 21.40 ? 211 ILE A O     1 
ATOM   1616  C CB    . ILE A 1 214 ? 10.437  23.156  92.311  1.00 20.02 ? 211 ILE A CB    1 
ATOM   1617  C CG1   . ILE A 1 214 ? 10.911  24.144  93.369  1.00 16.59 ? 211 ILE A CG1   1 
ATOM   1618  C CG2   . ILE A 1 214 ? 11.690  22.414  91.812  1.00 19.02 ? 211 ILE A CG2   1 
ATOM   1619  C CD1   . ILE A 1 214 ? 11.956  25.103  92.820  1.00 10.93 ? 211 ILE A CD1   1 
ATOM   1620  N N     . ALA A 1 215 ? 8.206   22.429  90.029  1.00 21.01 ? 212 ALA A N     1 
ATOM   1621  C CA    . ALA A 1 215 ? 7.778   21.514  88.979  1.00 19.70 ? 212 ALA A CA    1 
ATOM   1622  C C     . ALA A 1 215 ? 7.623   22.258  87.626  1.00 20.76 ? 212 ALA A C     1 
ATOM   1623  O O     . ALA A 1 215 ? 7.025   23.346  87.566  1.00 19.85 ? 212 ALA A O     1 
ATOM   1624  C CB    . ALA A 1 215 ? 6.447   20.849  89.384  1.00 14.57 ? 212 ALA A CB    1 
ATOM   1625  N N     . GLY A 1 216 ? 8.166   21.671  86.553  1.00 19.35 ? 213 GLY A N     1 
ATOM   1626  C CA    . GLY A 1 216 ? 8.050   22.276  85.227  1.00 21.19 ? 213 GLY A CA    1 
ATOM   1627  C C     . GLY A 1 216 ? 9.106   23.313  84.850  1.00 21.86 ? 213 GLY A C     1 
ATOM   1628  O O     . GLY A 1 216 ? 9.221   23.718  83.696  1.00 20.88 ? 213 GLY A O     1 
ATOM   1629  N N     . LYS A 1 217 ? 9.888   23.737  85.835  1.00 23.68 ? 214 LYS A N     1 
ATOM   1630  C CA    . LYS A 1 217 ? 10.938  24.727  85.629  1.00 22.94 ? 214 LYS A CA    1 
ATOM   1631  C C     . LYS A 1 217 ? 12.211  24.063  85.177  1.00 23.29 ? 214 LYS A C     1 
ATOM   1632  O O     . LYS A 1 217 ? 12.400  22.855  85.335  1.00 24.68 ? 214 LYS A O     1 
ATOM   1633  C CB    . LYS A 1 217 ? 11.258  25.455  86.939  1.00 22.40 ? 214 LYS A CB    1 
ATOM   1634  C CG    . LYS A 1 217 ? 10.799  26.891  87.024  1.00 23.53 ? 214 LYS A CG    1 
ATOM   1635  C CD    . LYS A 1 217 ? 9.284   27.013  86.983  1.00 21.53 ? 214 LYS A CD    1 
ATOM   1636  C CE    . LYS A 1 217 ? 8.836   28.262  87.744  1.00 22.09 ? 214 LYS A CE    1 
ATOM   1637  N NZ    . LYS A 1 217 ? 7.353   28.391  87.834  1.00 23.04 ? 214 LYS A NZ    1 
ATOM   1638  N N     . VAL A 1 218 ? 13.101  24.871  84.632  1.00 22.69 ? 215 VAL A N     1 
ATOM   1639  C CA    . VAL A 1 218 ? 14.408  24.394  84.230  1.00 22.59 ? 215 VAL A CA    1 
ATOM   1640  C C     . VAL A 1 218 ? 15.396  24.974  85.245  1.00 21.45 ? 215 VAL A C     1 
ATOM   1641  O O     . VAL A 1 218 ? 15.478  26.187  85.408  1.00 20.11 ? 215 VAL A O     1 
ATOM   1642  C CB    . VAL A 1 218 ? 14.773  24.902  82.833  1.00 21.98 ? 215 VAL A CB    1 
ATOM   1643  C CG1   . VAL A 1 218 ? 16.264  24.725  82.601  1.00 21.06 ? 215 VAL A CG1   1 
ATOM   1644  C CG2   . VAL A 1 218 ? 13.979  24.131  81.786  1.00 23.22 ? 215 VAL A CG2   1 
ATOM   1645  N N     . ALA A 1 219 ? 16.131  24.112  85.940  1.00 21.60 ? 216 ALA A N     1 
ATOM   1646  C CA    . ALA A 1 219 ? 17.102  24.601  86.926  1.00 21.74 ? 216 ALA A CA    1 
ATOM   1647  C C     . ALA A 1 219 ? 18.536  24.321  86.494  1.00 20.29 ? 216 ALA A C     1 
ATOM   1648  O O     . ALA A 1 219 ? 18.842  23.269  85.931  1.00 19.90 ? 216 ALA A O     1 
ATOM   1649  C CB    . ALA A 1 219 ? 16.824  23.978  88.301  1.00 20.64 ? 216 ALA A CB    1 
ATOM   1650  N N     . VAL A 1 220 ? 19.413  25.277  86.758  1.00 19.05 ? 217 VAL A N     1 
ATOM   1651  C CA    . VAL A 1 220 ? 20.815  25.144  86.401  1.00 18.98 ? 217 VAL A CA    1 
ATOM   1652  C C     . VAL A 1 220 ? 21.625  25.187  87.677  1.00 19.01 ? 217 VAL A C     1 
ATOM   1653  O O     . VAL A 1 220 ? 21.585  26.164  88.415  1.00 20.46 ? 217 VAL A O     1 
ATOM   1654  C CB    . VAL A 1 220 ? 21.259  26.304  85.482  1.00 19.86 ? 217 VAL A CB    1 
ATOM   1655  C CG1   . VAL A 1 220 ? 22.749  26.197  85.176  1.00 18.07 ? 217 VAL A CG1   1 
ATOM   1656  C CG2   . VAL A 1 220 ? 20.439  26.277  84.207  1.00 19.40 ? 217 VAL A CG2   1 
ATOM   1657  N N     . VAL A 1 221 ? 22.355  24.120  87.945  1.00 19.08 ? 218 VAL A N     1 
ATOM   1658  C CA    . VAL A 1 221 ? 23.155  24.072  89.144  1.00 18.84 ? 218 VAL A CA    1 
ATOM   1659  C C     . VAL A 1 221 ? 24.600  24.030  88.734  1.00 20.38 ? 218 VAL A C     1 
ATOM   1660  O O     . VAL A 1 221 ? 25.055  23.039  88.160  1.00 20.91 ? 218 VAL A O     1 
ATOM   1661  C CB    . VAL A 1 221 ? 22.836  22.833  89.983  1.00 17.73 ? 218 VAL A CB    1 
ATOM   1662  C CG1   . VAL A 1 221 ? 23.702  22.817  91.212  1.00 16.81 ? 218 VAL A CG1   1 
ATOM   1663  C CG2   . VAL A 1 221 ? 21.377  22.830  90.355  1.00 18.29 ? 218 VAL A CG2   1 
ATOM   1664  N N     . ALA A 1 222 ? 25.311  25.123  89.015  1.00 21.33 ? 219 ALA A N     1 
ATOM   1665  C CA    . ALA A 1 222 ? 26.732  25.246  88.685  1.00 20.49 ? 219 ALA A CA    1 
ATOM   1666  C C     . ALA A 1 222 ? 27.533  24.407  89.665  1.00 20.58 ? 219 ALA A C     1 
ATOM   1667  O O     . ALA A 1 222 ? 27.481  24.644  90.878  1.00 18.97 ? 219 ALA A O     1 
ATOM   1668  C CB    . ALA A 1 222 ? 27.165  26.696  88.784  1.00 22.83 ? 219 ALA A CB    1 
ATOM   1669  N N     . GLY A 1 223 ? 28.267  23.426  89.145  1.00 19.63 ? 220 GLY A N     1 
ATOM   1670  C CA    . GLY A 1 223 ? 29.070  22.569  90.006  1.00 22.18 ? 220 GLY A CA    1 
ATOM   1671  C C     . GLY A 1 223 ? 28.338  21.309  90.449  1.00 23.90 ? 220 GLY A C     1 
ATOM   1672  O O     . GLY A 1 223 ? 27.173  21.372  90.862  1.00 22.91 ? 220 GLY A O     1 
ATOM   1673  N N     . TYR A 1 224 ? 29.003  20.159  90.346  1.00 25.08 ? 221 TYR A N     1 
ATOM   1674  C CA    . TYR A 1 224 ? 28.387  18.904  90.752  1.00 26.33 ? 221 TYR A CA    1 
ATOM   1675  C C     . TYR A 1 224 ? 29.212  18.213  91.836  1.00 27.85 ? 221 TYR A C     1 
ATOM   1676  O O     . TYR A 1 224 ? 29.648  17.063  91.673  1.00 27.19 ? 221 TYR A O     1 
ATOM   1677  C CB    . TYR A 1 224 ? 28.180  17.962  89.546  1.00 26.43 ? 221 TYR A CB    1 
ATOM   1678  C CG    . TYR A 1 224 ? 27.194  16.832  89.820  1.00 26.64 ? 221 TYR A CG    1 
ATOM   1679  C CD1   . TYR A 1 224 ? 25.862  17.100  90.149  1.00 26.95 ? 221 TYR A CD1   1 
ATOM   1680  C CD2   . TYR A 1 224 ? 27.601  15.496  89.782  1.00 25.91 ? 221 TYR A CD2   1 
ATOM   1681  C CE1   . TYR A 1 224 ? 24.962  16.059  90.437  1.00 26.92 ? 221 TYR A CE1   1 
ATOM   1682  C CE2   . TYR A 1 224 ? 26.720  14.456  90.064  1.00 24.30 ? 221 TYR A CE2   1 
ATOM   1683  C CZ    . TYR A 1 224 ? 25.402  14.737  90.392  1.00 26.97 ? 221 TYR A CZ    1 
ATOM   1684  O OH    . TYR A 1 224 ? 24.531  13.698  90.673  1.00 25.07 ? 221 TYR A OH    1 
ATOM   1685  N N     . GLY A 1 225 ? 29.413  18.931  92.944  1.00 28.17 ? 222 GLY A N     1 
ATOM   1686  C CA    . GLY A 1 225 ? 30.164  18.399  94.070  1.00 27.75 ? 222 GLY A CA    1 
ATOM   1687  C C     . GLY A 1 225 ? 29.197  17.840  95.099  1.00 28.61 ? 222 GLY A C     1 
ATOM   1688  O O     . GLY A 1 225 ? 28.045  17.565  94.773  1.00 29.74 ? 222 GLY A O     1 
ATOM   1689  N N     . ASP A 1 226 ? 29.632  17.672  96.342  1.00 28.77 ? 223 ASP A N     1 
ATOM   1690  C CA    . ASP A 1 226 ? 28.727  17.145  97.354  1.00 29.59 ? 223 ASP A CA    1 
ATOM   1691  C C     . ASP A 1 226 ? 27.480  18.017  97.476  1.00 28.70 ? 223 ASP A C     1 
ATOM   1692  O O     . ASP A 1 226 ? 26.373  17.509  97.625  1.00 29.74 ? 223 ASP A O     1 
ATOM   1693  C CB    . ASP A 1 226 ? 29.444  17.026  98.697  1.00 31.34 ? 223 ASP A CB    1 
ATOM   1694  C CG    . ASP A 1 226 ? 30.561  15.992  98.659  1.00 34.31 ? 223 ASP A CG    1 
ATOM   1695  O OD1   . ASP A 1 226 ? 30.275  14.827  98.290  1.00 33.69 ? 223 ASP A OD1   1 
ATOM   1696  O OD2   . ASP A 1 226 ? 31.720  16.350  98.982  1.00 35.16 ? 223 ASP A OD2   1 
ATOM   1697  N N     . VAL A 1 227 ? 27.653  19.329  97.391  1.00 28.12 ? 224 VAL A N     1 
ATOM   1698  C CA    . VAL A 1 227 ? 26.519  20.237  97.483  1.00 28.68 ? 224 VAL A CA    1 
ATOM   1699  C C     . VAL A 1 227 ? 25.706  20.213  96.192  1.00 27.61 ? 224 VAL A C     1 
ATOM   1700  O O     . VAL A 1 227 ? 24.474  20.141  96.234  1.00 27.29 ? 224 VAL A O     1 
ATOM   1701  C CB    . VAL A 1 227 ? 26.986  21.688  97.755  1.00 29.26 ? 224 VAL A CB    1 
ATOM   1702  C CG1   . VAL A 1 227 ? 25.787  22.631  97.746  1.00 27.64 ? 224 VAL A CG1   1 
ATOM   1703  C CG2   . VAL A 1 227 ? 27.694  21.752  99.106  1.00 28.22 ? 224 VAL A CG2   1 
ATOM   1704  N N     . GLY A 1 228 ? 26.413  20.277  95.061  1.00 25.71 ? 225 GLY A N     1 
ATOM   1705  C CA    . GLY A 1 228 ? 25.773  20.252  93.758  1.00 24.25 ? 225 GLY A CA    1 
ATOM   1706  C C     . GLY A 1 228 ? 24.912  19.008  93.604  1.00 23.54 ? 225 GLY A C     1 
ATOM   1707  O O     . GLY A 1 228 ? 23.792  19.086  93.123  1.00 23.94 ? 225 GLY A O     1 
ATOM   1708  N N     . LYS A 1 229 ? 25.441  17.860  94.023  1.00 22.30 ? 226 LYS A N     1 
ATOM   1709  C CA    . LYS A 1 229 ? 24.710  16.596  93.956  1.00 20.55 ? 226 LYS A CA    1 
ATOM   1710  C C     . LYS A 1 229 ? 23.429  16.684  94.763  1.00 19.93 ? 226 LYS A C     1 
ATOM   1711  O O     . LYS A 1 229 ? 22.366  16.232  94.312  1.00 19.85 ? 226 LYS A O     1 
ATOM   1712  C CB    . LYS A 1 229 ? 25.557  15.447  94.510  1.00 19.09 ? 226 LYS A CB    1 
ATOM   1713  C CG    . LYS A 1 229 ? 26.684  14.979  93.602  1.00 19.88 ? 226 LYS A CG    1 
ATOM   1714  C CD    . LYS A 1 229 ? 27.440  13.792  94.209  1.00 20.37 ? 226 LYS A CD    1 
ATOM   1715  C CE    . LYS A 1 229 ? 28.454  13.207  93.227  1.00 19.06 ? 226 LYS A CE    1 
ATOM   1716  N NZ    . LYS A 1 229 ? 29.618  14.107  92.944  1.00 23.48 ? 226 LYS A NZ    1 
ATOM   1717  N N     . GLY A 1 230 ? 23.539  17.261  95.958  1.00 19.42 ? 227 GLY A N     1 
ATOM   1718  C CA    . GLY A 1 230 ? 22.383  17.388  96.828  1.00 17.88 ? 227 GLY A CA    1 
ATOM   1719  C C     . GLY A 1 230 ? 21.310  18.301  96.257  1.00 19.66 ? 227 GLY A C     1 
ATOM   1720  O O     . GLY A 1 230 ? 20.124  17.947  96.217  1.00 17.60 ? 227 GLY A O     1 
ATOM   1721  N N     . CYS A 1 231 ? 21.732  19.479  95.809  1.00 19.35 ? 228 CYS A N     1 
ATOM   1722  C CA    . CYS A 1 231 ? 20.818  20.456  95.249  1.00 19.76 ? 228 CYS A CA    1 
ATOM   1723  C C     . CYS A 1 231 ? 20.114  19.927  94.003  1.00 19.70 ? 228 CYS A C     1 
ATOM   1724  O O     . CYS A 1 231 ? 18.885  20.018  93.894  1.00 18.47 ? 228 CYS A O     1 
ATOM   1725  C CB    . CYS A 1 231 ? 21.575  21.742  94.919  1.00 20.03 ? 228 CYS A CB    1 
ATOM   1726  S SG    . CYS A 1 231 ? 22.180  22.611  96.377  1.00 26.63 ? 228 CYS A SG    1 
ATOM   1727  N N     . ALA A 1 232 ? 20.893  19.370  93.076  1.00 18.14 ? 229 ALA A N     1 
ATOM   1728  C CA    . ALA A 1 232 ? 20.352  18.836  91.834  1.00 19.98 ? 229 ALA A CA    1 
ATOM   1729  C C     . ALA A 1 232 ? 19.264  17.810  92.097  1.00 21.60 ? 229 ALA A C     1 
ATOM   1730  O O     . ALA A 1 232 ? 18.167  17.886  91.540  1.00 20.98 ? 229 ALA A O     1 
ATOM   1731  C CB    . ALA A 1 232 ? 21.451  18.191  91.012  1.00 19.49 ? 229 ALA A CB    1 
ATOM   1732  N N     . GLN A 1 233 ? 19.581  16.844  92.949  1.00 23.87 ? 230 GLN A N     1 
ATOM   1733  C CA    . GLN A 1 233 ? 18.640  15.789  93.274  1.00 24.17 ? 230 GLN A CA    1 
ATOM   1734  C C     . GLN A 1 233 ? 17.358  16.360  93.868  1.00 22.98 ? 230 GLN A C     1 
ATOM   1735  O O     . GLN A 1 233 ? 16.265  15.897  93.549  1.00 21.35 ? 230 GLN A O     1 
ATOM   1736  C CB    . GLN A 1 233 ? 19.286  14.799  94.242  1.00 28.53 ? 230 GLN A CB    1 
ATOM   1737  C CG    . GLN A 1 233 ? 18.432  13.583  94.550  1.00 31.90 ? 230 GLN A CG    1 
ATOM   1738  C CD    . GLN A 1 233 ? 19.212  12.524  95.300  1.00 34.54 ? 230 GLN A CD    1 
ATOM   1739  O OE1   . GLN A 1 233 ? 18.682  11.458  95.619  1.00 38.42 ? 230 GLN A OE1   1 
ATOM   1740  N NE2   . GLN A 1 233 ? 20.477  12.807  95.582  1.00 33.99 ? 230 GLN A NE2   1 
ATOM   1741  N N     . ALA A 1 234 ? 17.481  17.376  94.713  1.00 21.27 ? 231 ALA A N     1 
ATOM   1742  C CA    . ALA A 1 234 ? 16.287  17.966  95.307  1.00 22.50 ? 231 ALA A CA    1 
ATOM   1743  C C     . ALA A 1 234 ? 15.396  18.586  94.224  1.00 23.71 ? 231 ALA A C     1 
ATOM   1744  O O     . ALA A 1 234 ? 14.224  18.224  94.084  1.00 23.10 ? 231 ALA A O     1 
ATOM   1745  C CB    . ALA A 1 234 ? 16.677  19.015  96.321  1.00 19.40 ? 231 ALA A CB    1 
ATOM   1746  N N     . LEU A 1 235 ? 15.964  19.514  93.461  1.00 22.85 ? 232 LEU A N     1 
ATOM   1747  C CA    . LEU A 1 235 ? 15.238  20.178  92.395  1.00 23.94 ? 232 LEU A CA    1 
ATOM   1748  C C     . LEU A 1 235 ? 14.480  19.240  91.461  1.00 24.97 ? 232 LEU A C     1 
ATOM   1749  O O     . LEU A 1 235 ? 13.286  19.433  91.222  1.00 26.53 ? 232 LEU A O     1 
ATOM   1750  C CB    . LEU A 1 235 ? 16.204  21.027  91.575  1.00 21.50 ? 232 LEU A CB    1 
ATOM   1751  C CG    . LEU A 1 235 ? 16.837  22.095  92.455  1.00 19.01 ? 232 LEU A CG    1 
ATOM   1752  C CD1   . LEU A 1 235 ? 18.183  22.460  91.889  1.00 17.68 ? 232 LEU A CD1   1 
ATOM   1753  C CD2   . LEU A 1 235 ? 15.896  23.301  92.574  1.00 14.66 ? 232 LEU A CD2   1 
ATOM   1754  N N     . ARG A 1 236 ? 15.148  18.218  90.940  1.00 24.47 ? 233 ARG A N     1 
ATOM   1755  C CA    . ARG A 1 236 ? 14.466  17.332  90.015  1.00 27.78 ? 233 ARG A CA    1 
ATOM   1756  C C     . ARG A 1 236 ? 13.456  16.402  90.685  1.00 28.84 ? 233 ARG A C     1 
ATOM   1757  O O     . ARG A 1 236 ? 12.626  15.785  90.009  1.00 29.82 ? 233 ARG A O     1 
ATOM   1758  C CB    . ARG A 1 236 ? 15.472  16.518  89.212  1.00 30.24 ? 233 ARG A CB    1 
ATOM   1759  C CG    . ARG A 1 236 ? 15.871  15.223  89.830  1.00 31.75 ? 233 ARG A CG    1 
ATOM   1760  C CD    . ARG A 1 236 ? 16.361  14.344  88.721  1.00 35.50 ? 233 ARG A CD    1 
ATOM   1761  N NE    . ARG A 1 236 ? 17.238  13.291  89.200  1.00 38.66 ? 233 ARG A NE    1 
ATOM   1762  C CZ    . ARG A 1 236 ? 18.044  12.598  88.408  1.00 40.59 ? 233 ARG A CZ    1 
ATOM   1763  N NH1   . ARG A 1 236 ? 18.073  12.857  87.104  1.00 40.87 ? 233 ARG A NH1   1 
ATOM   1764  N NH2   . ARG A 1 236 ? 18.813  11.650  88.920  1.00 41.86 ? 233 ARG A NH2   1 
ATOM   1765  N N     . GLY A 1 237 ? 13.545  16.301  92.007  1.00 27.80 ? 234 GLY A N     1 
ATOM   1766  C CA    . GLY A 1 237 ? 12.614  15.487  92.744  1.00 24.59 ? 234 GLY A CA    1 
ATOM   1767  C C     . GLY A 1 237 ? 11.260  16.159  92.686  1.00 26.53 ? 234 GLY A C     1 
ATOM   1768  O O     . GLY A 1 237 ? 10.231  15.498  92.811  1.00 26.58 ? 234 GLY A O     1 
ATOM   1769  N N     . PHE A 1 238 ? 11.248  17.477  92.495  1.00 27.50 ? 235 PHE A N     1 
ATOM   1770  C CA    . PHE A 1 238 ? 9.990   18.217  92.409  1.00 28.59 ? 235 PHE A CA    1 
ATOM   1771  C C     . PHE A 1 238 ? 9.492   18.381  90.971  1.00 26.94 ? 235 PHE A C     1 
ATOM   1772  O O     . PHE A 1 238 ? 8.462   19.011  90.733  1.00 28.05 ? 235 PHE A O     1 
ATOM   1773  C CB    . PHE A 1 238 ? 10.107  19.601  93.074  1.00 30.39 ? 235 PHE A CB    1 
ATOM   1774  C CG    . PHE A 1 238 ? 10.136  19.559  94.583  1.00 35.98 ? 235 PHE A CG    1 
ATOM   1775  C CD1   . PHE A 1 238 ? 9.196   18.817  95.301  1.00 37.77 ? 235 PHE A CD1   1 
ATOM   1776  C CD2   . PHE A 1 238 ? 11.098  20.281  95.296  1.00 39.61 ? 235 PHE A CD2   1 
ATOM   1777  C CE1   . PHE A 1 238 ? 9.213   18.796  96.702  1.00 37.94 ? 235 PHE A CE1   1 
ATOM   1778  C CE2   . PHE A 1 238 ? 11.120  20.261  96.697  1.00 39.55 ? 235 PHE A CE2   1 
ATOM   1779  C CZ    . PHE A 1 238 ? 10.177  19.519  97.395  1.00 37.64 ? 235 PHE A CZ    1 
ATOM   1780  N N     . GLY A 1 239 ? 10.214  17.819  90.009  1.00 25.33 ? 236 GLY A N     1 
ATOM   1781  C CA    . GLY A 1 239 ? 9.765   17.925  88.630  1.00 24.85 ? 236 GLY A CA    1 
ATOM   1782  C C     . GLY A 1 239 ? 10.449  19.009  87.824  1.00 25.34 ? 236 GLY A C     1 
ATOM   1783  O O     . GLY A 1 239 ? 9.963   19.423  86.777  1.00 27.33 ? 236 GLY A O     1 
ATOM   1784  N N     . ALA A 1 240 ? 11.576  19.488  88.329  1.00 25.84 ? 237 ALA A N     1 
ATOM   1785  C CA    . ALA A 1 240 ? 12.346  20.515  87.652  1.00 24.07 ? 237 ALA A CA    1 
ATOM   1786  C C     . ALA A 1 240 ? 13.377  19.821  86.761  1.00 24.48 ? 237 ALA A C     1 
ATOM   1787  O O     . ALA A 1 240 ? 13.874  18.743  87.115  1.00 24.89 ? 237 ALA A O     1 
ATOM   1788  C CB    . ALA A 1 240 ? 13.046  21.387  88.683  1.00 23.28 ? 237 ALA A CB    1 
ATOM   1789  N N     . ARG A 1 241 ? 13.682  20.421  85.608  1.00 22.90 ? 238 ARG A N     1 
ATOM   1790  C CA    . ARG A 1 241 ? 14.669  19.860  84.689  1.00 23.76 ? 238 ARG A CA    1 
ATOM   1791  C C     . ARG A 1 241 ? 15.994  20.514  85.086  1.00 24.31 ? 238 ARG A C     1 
ATOM   1792  O O     . ARG A 1 241 ? 16.177  21.729  84.929  1.00 25.53 ? 238 ARG A O     1 
ATOM   1793  C CB    . ARG A 1 241 ? 14.329  20.191  83.226  1.00 24.05 ? 238 ARG A CB    1 
ATOM   1794  C CG    . ARG A 1 241 ? 14.523  19.036  82.262  1.00 23.33 ? 238 ARG A CG    1 
ATOM   1795  C CD    . ARG A 1 241 ? 15.101  19.471  80.916  1.00 24.48 ? 238 ARG A CD    1 
ATOM   1796  N NE    . ARG A 1 241 ? 14.314  20.511  80.260  1.00 24.55 ? 238 ARG A NE    1 
ATOM   1797  C CZ    . ARG A 1 241 ? 14.790  21.305  79.306  1.00 24.80 ? 238 ARG A CZ    1 
ATOM   1798  N NH1   . ARG A 1 241 ? 16.046  21.172  78.902  1.00 22.78 ? 238 ARG A NH1   1 
ATOM   1799  N NH2   . ARG A 1 241 ? 14.019  22.234  78.760  1.00 22.49 ? 238 ARG A NH2   1 
ATOM   1800  N N     . VAL A 1 242 ? 16.917  19.703  85.590  1.00 21.37 ? 239 VAL A N     1 
ATOM   1801  C CA    . VAL A 1 242 ? 18.187  20.210  86.065  1.00 20.08 ? 239 VAL A CA    1 
ATOM   1802  C C     . VAL A 1 242 ? 19.364  20.051  85.126  1.00 20.72 ? 239 VAL A C     1 
ATOM   1803  O O     . VAL A 1 242 ? 19.764  18.933  84.801  1.00 22.14 ? 239 VAL A O     1 
ATOM   1804  C CB    . VAL A 1 242 ? 18.549  19.551  87.417  1.00 19.98 ? 239 VAL A CB    1 
ATOM   1805  C CG1   . VAL A 1 242 ? 19.806  20.183  87.984  1.00 16.11 ? 239 VAL A CG1   1 
ATOM   1806  C CG2   . VAL A 1 242 ? 17.355  19.672  88.384  1.00 12.09 ? 239 VAL A CG2   1 
ATOM   1807  N N     . ILE A 1 243 ? 19.917  21.182  84.699  1.00 20.38 ? 240 ILE A N     1 
ATOM   1808  C CA    . ILE A 1 243 ? 21.077  21.191  83.820  1.00 19.82 ? 240 ILE A CA    1 
ATOM   1809  C C     . ILE A 1 243 ? 22.263  21.496  84.729  1.00 19.95 ? 240 ILE A C     1 
ATOM   1810  O O     . ILE A 1 243 ? 22.172  22.336  85.639  1.00 20.70 ? 240 ILE A O     1 
ATOM   1811  C CB    . ILE A 1 243 ? 20.929  22.262  82.703  1.00 22.65 ? 240 ILE A CB    1 
ATOM   1812  C CG1   . ILE A 1 243 ? 19.715  21.934  81.832  1.00 23.78 ? 240 ILE A CG1   1 
ATOM   1813  C CG2   . ILE A 1 243 ? 22.156  22.274  81.809  1.00 18.97 ? 240 ILE A CG2   1 
ATOM   1814  C CD1   . ILE A 1 243 ? 19.347  23.041  80.858  1.00 26.19 ? 240 ILE A CD1   1 
ATOM   1815  N N     . ILE A 1 244 ? 23.376  20.818  84.490  1.00 18.92 ? 241 ILE A N     1 
ATOM   1816  C CA    . ILE A 1 244 ? 24.556  20.970  85.323  1.00 20.02 ? 241 ILE A CA    1 
ATOM   1817  C C     . ILE A 1 244 ? 25.764  21.541  84.584  1.00 22.23 ? 241 ILE A C     1 
ATOM   1818  O O     . ILE A 1 244 ? 25.877  21.399  83.364  1.00 23.32 ? 241 ILE A O     1 
ATOM   1819  C CB    . ILE A 1 244 ? 24.910  19.580  85.916  1.00 20.01 ? 241 ILE A CB    1 
ATOM   1820  C CG1   . ILE A 1 244 ? 23.767  19.125  86.828  1.00 18.25 ? 241 ILE A CG1   1 
ATOM   1821  C CG2   . ILE A 1 244 ? 26.245  19.619  86.639  1.00 18.06 ? 241 ILE A CG2   1 
ATOM   1822  C CD1   . ILE A 1 244 ? 23.918  17.719  87.341  1.00 19.75 ? 241 ILE A CD1   1 
ATOM   1823  N N     . THR A 1 245 ? 26.651  22.217  85.309  1.00 21.69 ? 242 THR A N     1 
ATOM   1824  C CA    . THR A 1 245 ? 27.860  22.742  84.687  1.00 24.31 ? 242 THR A CA    1 
ATOM   1825  C C     . THR A 1 245 ? 29.022  22.257  85.550  1.00 24.57 ? 242 THR A C     1 
ATOM   1826  O O     . THR A 1 245 ? 28.895  22.166  86.770  1.00 25.88 ? 242 THR A O     1 
ATOM   1827  C CB    . THR A 1 245 ? 27.855  24.309  84.579  1.00 24.05 ? 242 THR A CB    1 
ATOM   1828  O OG1   . THR A 1 245 ? 28.203  24.905  85.831  1.00 26.24 ? 242 THR A OG1   1 
ATOM   1829  C CG2   . THR A 1 245 ? 26.477  24.802  84.149  1.00 24.27 ? 242 THR A CG2   1 
ATOM   1830  N N     . GLU A 1 246 ? 30.138  21.896  84.926  1.00 25.42 ? 243 GLU A N     1 
ATOM   1831  C CA    . GLU A 1 246 ? 31.289  21.418  85.697  1.00 24.11 ? 243 GLU A CA    1 
ATOM   1832  C C     . GLU A 1 246 ? 32.604  21.634  84.963  1.00 26.71 ? 243 GLU A C     1 
ATOM   1833  O O     . GLU A 1 246 ? 32.629  21.864  83.744  1.00 27.90 ? 243 GLU A O     1 
ATOM   1834  C CB    . GLU A 1 246 ? 31.146  19.931  86.027  1.00 21.57 ? 243 GLU A CB    1 
ATOM   1835  C CG    . GLU A 1 246 ? 30.712  19.597  87.455  1.00 20.78 ? 243 GLU A CG    1 
ATOM   1836  C CD    . GLU A 1 246 ? 31.803  19.835  88.515  1.00 23.93 ? 243 GLU A CD    1 
ATOM   1837  O OE1   . GLU A 1 246 ? 32.969  20.114  88.151  1.00 22.94 ? 243 GLU A OE1   1 
ATOM   1838  O OE2   . GLU A 1 246 ? 31.483  19.732  89.725  1.00 24.99 ? 243 GLU A OE2   1 
ATOM   1839  N N     . ILE A 1 247 ? 33.697  21.567  85.724  1.00 27.43 ? 244 ILE A N     1 
ATOM   1840  C CA    . ILE A 1 247 ? 35.040  21.725  85.171  1.00 27.27 ? 244 ILE A CA    1 
ATOM   1841  C C     . ILE A 1 247 ? 35.826  20.445  85.409  1.00 28.03 ? 244 ILE A C     1 
ATOM   1842  O O     . ILE A 1 247 ? 36.907  20.254  84.851  1.00 28.48 ? 244 ILE A O     1 
ATOM   1843  C CB    . ILE A 1 247 ? 35.806  22.904  85.824  1.00 26.58 ? 244 ILE A CB    1 
ATOM   1844  C CG1   . ILE A 1 247 ? 35.794  22.787  87.357  1.00 26.38 ? 244 ILE A CG1   1 
ATOM   1845  C CG2   . ILE A 1 247 ? 35.234  24.211  85.348  1.00 27.63 ? 244 ILE A CG2   1 
ATOM   1846  C CD1   . ILE A 1 247 ? 36.919  21.935  87.945  1.00 18.51 ? 244 ILE A CD1   1 
ATOM   1847  N N     . ASP A 1 248 ? 35.284  19.578  86.256  1.00 25.90 ? 245 ASP A N     1 
ATOM   1848  C CA    . ASP A 1 248 ? 35.933  18.321  86.576  1.00 26.49 ? 245 ASP A CA    1 
ATOM   1849  C C     . ASP A 1 248 ? 35.265  17.222  85.735  1.00 27.61 ? 245 ASP A C     1 
ATOM   1850  O O     . ASP A 1 248 ? 34.059  16.962  85.863  1.00 26.10 ? 245 ASP A O     1 
ATOM   1851  C CB    . ASP A 1 248 ? 35.768  18.025  88.069  1.00 27.42 ? 245 ASP A CB    1 
ATOM   1852  C CG    . ASP A 1 248 ? 36.535  16.791  88.513  1.00 30.19 ? 245 ASP A CG    1 
ATOM   1853  O OD1   . ASP A 1 248 ? 36.658  15.834  87.721  1.00 30.64 ? 245 ASP A OD1   1 
ATOM   1854  O OD2   . ASP A 1 248 ? 37.012  16.774  89.669  1.00 34.26 ? 245 ASP A OD2   1 
ATOM   1855  N N     . PRO A 1 249 ? 36.045  16.561  84.861  1.00 28.37 ? 246 PRO A N     1 
ATOM   1856  C CA    . PRO A 1 249 ? 35.520  15.493  84.003  1.00 26.76 ? 246 PRO A CA    1 
ATOM   1857  C C     . PRO A 1 249 ? 34.848  14.370  84.780  1.00 26.48 ? 246 PRO A C     1 
ATOM   1858  O O     . PRO A 1 249 ? 33.867  13.792  84.316  1.00 28.35 ? 246 PRO A O     1 
ATOM   1859  C CB    . PRO A 1 249 ? 36.760  15.015  83.256  1.00 27.40 ? 246 PRO A CB    1 
ATOM   1860  C CG    . PRO A 1 249 ? 37.854  15.262  84.249  1.00 26.96 ? 246 PRO A CG    1 
ATOM   1861  C CD    . PRO A 1 249 ? 37.514  16.636  84.747  1.00 27.31 ? 246 PRO A CD    1 
ATOM   1862  N N     . ILE A 1 250 ? 35.366  14.054  85.962  1.00 25.01 ? 247 ILE A N     1 
ATOM   1863  C CA    . ILE A 1 250 ? 34.770  12.985  86.756  1.00 23.81 ? 247 ILE A CA    1 
ATOM   1864  C C     . ILE A 1 250 ? 33.371  13.377  87.221  1.00 24.18 ? 247 ILE A C     1 
ATOM   1865  O O     . ILE A 1 250 ? 32.402  12.654  86.993  1.00 25.64 ? 247 ILE A O     1 
ATOM   1866  C CB    . ILE A 1 250 ? 35.634  12.639  87.987  1.00 23.29 ? 247 ILE A CB    1 
ATOM   1867  C CG1   . ILE A 1 250 ? 37.044  12.238  87.544  1.00 24.05 ? 247 ILE A CG1   1 
ATOM   1868  C CG2   . ILE A 1 250 ? 34.992  11.501  88.760  1.00 20.87 ? 247 ILE A CG2   1 
ATOM   1869  C CD1   . ILE A 1 250 ? 37.962  11.804  88.685  1.00 23.67 ? 247 ILE A CD1   1 
ATOM   1870  N N     . ASN A 1 251 ? 33.263  14.529  87.873  1.00 25.02 ? 248 ASN A N     1 
ATOM   1871  C CA    . ASN A 1 251 ? 31.978  15.004  88.365  1.00 22.47 ? 248 ASN A CA    1 
ATOM   1872  C C     . ASN A 1 251 ? 31.029  15.141  87.173  1.00 21.02 ? 248 ASN A C     1 
ATOM   1873  O O     . ASN A 1 251 ? 29.876  14.749  87.246  1.00 22.29 ? 248 ASN A O     1 
ATOM   1874  C CB    . ASN A 1 251 ? 32.159  16.342  89.090  1.00 22.17 ? 248 ASN A CB    1 
ATOM   1875  C CG    . ASN A 1 251 ? 32.873  16.189  90.441  1.00 24.97 ? 248 ASN A CG    1 
ATOM   1876  O OD1   . ASN A 1 251 ? 32.257  16.306  91.511  1.00 24.51 ? 248 ASN A OD1   1 
ATOM   1877  N ND2   . ASN A 1 251 ? 34.168  15.913  90.393  1.00 25.54 ? 248 ASN A ND2   1 
ATOM   1878  N N     . ALA A 1 252 ? 31.535  15.674  86.069  1.00 20.30 ? 249 ALA A N     1 
ATOM   1879  C CA    . ALA A 1 252 ? 30.744  15.861  84.863  1.00 19.15 ? 249 ALA A CA    1 
ATOM   1880  C C     . ALA A 1 252 ? 30.138  14.536  84.372  1.00 18.84 ? 249 ALA A C     1 
ATOM   1881  O O     . ALA A 1 252 ? 28.955  14.491  84.028  1.00 16.05 ? 249 ALA A O     1 
ATOM   1882  C CB    . ALA A 1 252 ? 31.611  16.507  83.761  1.00 18.44 ? 249 ALA A CB    1 
ATOM   1883  N N     . LEU A 1 253 ? 30.948  13.471  84.347  1.00 19.02 ? 250 LEU A N     1 
ATOM   1884  C CA    . LEU A 1 253 ? 30.478  12.148  83.929  1.00 19.49 ? 250 LEU A CA    1 
ATOM   1885  C C     . LEU A 1 253 ? 29.527  11.592  84.983  1.00 22.84 ? 250 LEU A C     1 
ATOM   1886  O O     . LEU A 1 253 ? 28.593  10.847  84.647  1.00 25.12 ? 250 LEU A O     1 
ATOM   1887  C CB    . LEU A 1 253 ? 31.644  11.161  83.718  1.00 17.83 ? 250 LEU A CB    1 
ATOM   1888  C CG    . LEU A 1 253 ? 31.280  9.748   83.213  1.00 17.68 ? 250 LEU A CG    1 
ATOM   1889  C CD1   . LEU A 1 253 ? 30.580  9.840   81.856  1.00 17.79 ? 250 LEU A CD1   1 
ATOM   1890  C CD2   . LEU A 1 253 ? 32.530  8.897   83.077  1.00 16.15 ? 250 LEU A CD2   1 
ATOM   1891  N N     . GLN A 1 254 ? 29.752  11.938  86.251  1.00 20.79 ? 251 GLN A N     1 
ATOM   1892  C CA    . GLN A 1 254 ? 28.851  11.456  87.286  1.00 22.21 ? 251 GLN A CA    1 
ATOM   1893  C C     . GLN A 1 254 ? 27.453  11.990  87.006  1.00 23.17 ? 251 GLN A C     1 
ATOM   1894  O O     . GLN A 1 254 ? 26.482  11.232  86.979  1.00 23.61 ? 251 GLN A O     1 
ATOM   1895  C CB    . GLN A 1 254 ? 29.278  11.927  88.671  1.00 23.29 ? 251 GLN A CB    1 
ATOM   1896  C CG    . GLN A 1 254 ? 30.495  11.229  89.232  1.00 25.93 ? 251 GLN A CG    1 
ATOM   1897  C CD    . GLN A 1 254 ? 30.691  11.556  90.694  1.00 26.61 ? 251 GLN A CD    1 
ATOM   1898  O OE1   . GLN A 1 254 ? 30.577  10.683  91.557  1.00 25.70 ? 251 GLN A OE1   1 
ATOM   1899  N NE2   . GLN A 1 254 ? 30.965  12.825  90.986  1.00 25.42 ? 251 GLN A NE2   1 
ATOM   1900  N N     . ALA A 1 255 ? 27.357  13.299  86.794  1.00 22.57 ? 252 ALA A N     1 
ATOM   1901  C CA    . ALA A 1 255 ? 26.073  13.921  86.515  1.00 23.91 ? 252 ALA A CA    1 
ATOM   1902  C C     . ALA A 1 255 ? 25.444  13.364  85.238  1.00 25.17 ? 252 ALA A C     1 
ATOM   1903  O O     . ALA A 1 255 ? 24.227  13.199  85.160  1.00 23.93 ? 252 ALA A O     1 
ATOM   1904  C CB    . ALA A 1 255 ? 26.229  15.425  86.391  1.00 21.89 ? 252 ALA A CB    1 
ATOM   1905  N N     . ALA A 1 256 ? 26.273  13.082  84.237  1.00 25.62 ? 253 ALA A N     1 
ATOM   1906  C CA    . ALA A 1 256 ? 25.745  12.557  82.988  1.00 27.79 ? 253 ALA A CA    1 
ATOM   1907  C C     . ALA A 1 256 ? 25.159  11.159  83.205  1.00 29.64 ? 253 ALA A C     1 
ATOM   1908  O O     . ALA A 1 256 ? 24.115  10.831  82.642  1.00 29.42 ? 253 ALA A O     1 
ATOM   1909  C CB    . ALA A 1 256 ? 26.828  12.526  81.923  1.00 25.11 ? 253 ALA A CB    1 
ATOM   1910  N N     . MET A 1 257 ? 25.825  10.350  84.031  1.00 29.91 ? 254 MET A N     1 
ATOM   1911  C CA    . MET A 1 257 ? 25.359  8.997   84.324  1.00 30.07 ? 254 MET A CA    1 
ATOM   1912  C C     . MET A 1 257 ? 24.081  9.037   85.143  1.00 30.96 ? 254 MET A C     1 
ATOM   1913  O O     . MET A 1 257 ? 23.366  8.041   85.240  1.00 30.56 ? 254 MET A O     1 
ATOM   1914  C CB    . MET A 1 257 ? 26.419  8.214   85.097  1.00 32.22 ? 254 MET A CB    1 
ATOM   1915  C CG    . MET A 1 257 ? 27.696  7.978   84.321  1.00 34.35 ? 254 MET A CG    1 
ATOM   1916  S SD    . MET A 1 257 ? 27.354  7.033   82.835  1.00 35.89 ? 254 MET A SD    1 
ATOM   1917  C CE    . MET A 1 257 ? 27.144  5.357   83.545  1.00 33.50 ? 254 MET A CE    1 
ATOM   1918  N N     . GLU A 1 258 ? 23.807  10.189  85.746  1.00 30.21 ? 255 GLU A N     1 
ATOM   1919  C CA    . GLU A 1 258 ? 22.605  10.355  86.543  1.00 30.29 ? 255 GLU A CA    1 
ATOM   1920  C C     . GLU A 1 258 ? 21.475  10.902  85.693  1.00 29.95 ? 255 GLU A C     1 
ATOM   1921  O O     . GLU A 1 258 ? 20.395  11.199  86.203  1.00 31.72 ? 255 GLU A O     1 
ATOM   1922  C CB    . GLU A 1 258 ? 22.838  11.309  87.703  1.00 31.64 ? 255 GLU A CB    1 
ATOM   1923  C CG    . GLU A 1 258 ? 23.723  10.772  88.783  1.00 35.00 ? 255 GLU A CG    1 
ATOM   1924  C CD    . GLU A 1 258 ? 23.286  9.410   89.276  1.00 36.79 ? 255 GLU A CD    1 
ATOM   1925  O OE1   . GLU A 1 258 ? 22.081  9.081   89.176  1.00 35.88 ? 255 GLU A OE1   1 
ATOM   1926  O OE2   . GLU A 1 258 ? 24.163  8.675   89.779  1.00 39.19 ? 255 GLU A OE2   1 
ATOM   1927  N N     . GLY A 1 259 ? 21.735  11.059  84.402  1.00 28.26 ? 256 GLY A N     1 
ATOM   1928  C CA    . GLY A 1 259 ? 20.713  11.560  83.506  1.00 28.07 ? 256 GLY A CA    1 
ATOM   1929  C C     . GLY A 1 259 ? 20.587  13.067  83.466  1.00 27.83 ? 256 GLY A C     1 
ATOM   1930  O O     . GLY A 1 259 ? 19.552  13.595  83.043  1.00 28.11 ? 256 GLY A O     1 
ATOM   1931  N N     . TYR A 1 260 ? 21.636  13.757  83.903  1.00 25.73 ? 257 TYR A N     1 
ATOM   1932  C CA    . TYR A 1 260 ? 21.648  15.215  83.903  1.00 25.34 ? 257 TYR A CA    1 
ATOM   1933  C C     . TYR A 1 260 ? 22.356  15.708  82.647  1.00 24.75 ? 257 TYR A C     1 
ATOM   1934  O O     . TYR A 1 260 ? 23.309  15.092  82.173  1.00 24.31 ? 257 TYR A O     1 
ATOM   1935  C CB    . TYR A 1 260 ? 22.385  15.749  85.138  1.00 25.11 ? 257 TYR A CB    1 
ATOM   1936  C CG    . TYR A 1 260 ? 21.667  15.567  86.466  1.00 25.59 ? 257 TYR A CG    1 
ATOM   1937  C CD1   . TYR A 1 260 ? 20.547  16.331  86.794  1.00 23.67 ? 257 TYR A CD1   1 
ATOM   1938  C CD2   . TYR A 1 260 ? 22.145  14.664  87.413  1.00 24.65 ? 257 TYR A CD2   1 
ATOM   1939  C CE1   . TYR A 1 260 ? 19.926  16.202  88.036  1.00 25.43 ? 257 TYR A CE1   1 
ATOM   1940  C CE2   . TYR A 1 260 ? 21.535  14.526  88.655  1.00 25.87 ? 257 TYR A CE2   1 
ATOM   1941  C CZ    . TYR A 1 260 ? 20.429  15.296  88.966  1.00 26.72 ? 257 TYR A CZ    1 
ATOM   1942  O OH    . TYR A 1 260 ? 19.843  15.157  90.212  1.00 26.56 ? 257 TYR A OH    1 
ATOM   1943  N N     . GLU A 1 261 ? 21.878  16.824  82.114  1.00 24.79 ? 258 GLU A N     1 
ATOM   1944  C CA    . GLU A 1 261 ? 22.471  17.420  80.923  1.00 26.39 ? 258 GLU A CA    1 
ATOM   1945  C C     . GLU A 1 261 ? 23.606  18.298  81.423  1.00 25.70 ? 258 GLU A C     1 
ATOM   1946  O O     . GLU A 1 261 ? 23.401  19.126  82.295  1.00 26.73 ? 258 GLU A O     1 
ATOM   1947  C CB    . GLU A 1 261 ? 21.447  18.299  80.195  1.00 25.97 ? 258 GLU A CB    1 
ATOM   1948  C CG    . GLU A 1 261 ? 21.927  18.865  78.858  1.00 24.09 ? 258 GLU A CG    1 
ATOM   1949  C CD    . GLU A 1 261 ? 21.071  20.025  78.335  1.00 24.80 ? 258 GLU A CD    1 
ATOM   1950  O OE1   . GLU A 1 261 ? 19.851  20.086  78.630  1.00 20.87 ? 258 GLU A OE1   1 
ATOM   1951  O OE2   . GLU A 1 261 ? 21.627  20.878  77.614  1.00 27.15 ? 258 GLU A OE2   1 
ATOM   1952  N N     . VAL A 1 262 ? 24.804  18.122  80.889  1.00 24.66 ? 259 VAL A N     1 
ATOM   1953  C CA    . VAL A 1 262 ? 25.907  18.958  81.336  1.00 24.10 ? 259 VAL A CA    1 
ATOM   1954  C C     . VAL A 1 262 ? 26.444  19.893  80.243  1.00 23.08 ? 259 VAL A C     1 
ATOM   1955  O O     . VAL A 1 262 ? 27.034  19.424  79.274  1.00 25.45 ? 259 VAL A O     1 
ATOM   1956  C CB    . VAL A 1 262 ? 27.060  18.083  81.853  1.00 23.40 ? 259 VAL A CB    1 
ATOM   1957  C CG1   . VAL A 1 262 ? 28.152  18.962  82.417  1.00 22.07 ? 259 VAL A CG1   1 
ATOM   1958  C CG2   . VAL A 1 262 ? 26.533  17.103  82.905  1.00 22.33 ? 259 VAL A CG2   1 
ATOM   1959  N N     . THR A 1 263 ? 26.219  21.200  80.382  1.00 21.40 ? 260 THR A N     1 
ATOM   1960  C CA    . THR A 1 263 ? 26.727  22.187  79.413  1.00 22.24 ? 260 THR A CA    1 
ATOM   1961  C C     . THR A 1 263 ? 27.474  23.294  80.117  1.00 24.55 ? 260 THR A C     1 
ATOM   1962  O O     . THR A 1 263 ? 27.801  23.196  81.302  1.00 23.55 ? 260 THR A O     1 
ATOM   1963  C CB    . THR A 1 263 ? 25.647  22.961  78.634  1.00 20.85 ? 260 THR A CB    1 
ATOM   1964  O OG1   . THR A 1 263 ? 24.339  22.545  79.037  1.00 22.60 ? 260 THR A OG1   1 
ATOM   1965  C CG2   . THR A 1 263 ? 25.856  22.797  77.148  1.00 18.68 ? 260 THR A CG2   1 
ATOM   1966  N N     . THR A 1 264 ? 27.703  24.378  79.382  1.00 26.59 ? 261 THR A N     1 
ATOM   1967  C CA    . THR A 1 264 ? 28.401  25.513  79.963  1.00 29.64 ? 261 THR A CA    1 
ATOM   1968  C C     . THR A 1 264 ? 27.422  26.570  80.474  1.00 30.03 ? 261 THR A C     1 
ATOM   1969  O O     . THR A 1 264 ? 26.305  26.712  79.972  1.00 28.58 ? 261 THR A O     1 
ATOM   1970  C CB    . THR A 1 264 ? 29.375  26.169  78.950  1.00 30.38 ? 261 THR A CB    1 
ATOM   1971  O OG1   . THR A 1 264 ? 28.646  26.699  77.844  1.00 33.53 ? 261 THR A OG1   1 
ATOM   1972  C CG2   . THR A 1 264 ? 30.389  25.153  78.442  1.00 32.38 ? 261 THR A CG2   1 
ATOM   1973  N N     . MET A 1 265 ? 27.843  27.303  81.493  1.00 30.37 ? 262 MET A N     1 
ATOM   1974  C CA    . MET A 1 265 ? 27.004  28.348  82.039  1.00 31.06 ? 262 MET A CA    1 
ATOM   1975  C C     . MET A 1 265 ? 26.613  29.303  80.916  1.00 31.74 ? 262 MET A C     1 
ATOM   1976  O O     . MET A 1 265 ? 25.518  29.872  80.940  1.00 31.97 ? 262 MET A O     1 
ATOM   1977  C CB    . MET A 1 265 ? 27.749  29.099  83.141  1.00 31.19 ? 262 MET A CB    1 
ATOM   1978  C CG    . MET A 1 265 ? 27.093  28.977  84.502  1.00 30.79 ? 262 MET A CG    1 
ATOM   1979  S SD    . MET A 1 265 ? 25.383  29.528  84.434  1.00 28.46 ? 262 MET A SD    1 
ATOM   1980  C CE    . MET A 1 265 ? 25.660  31.125  83.880  1.00 30.11 ? 262 MET A CE    1 
ATOM   1981  N N     . ASP A 1 266 ? 27.496  29.463  79.927  1.00 32.25 ? 263 ASP A N     1 
ATOM   1982  C CA    . ASP A 1 266 ? 27.223  30.352  78.791  1.00 32.61 ? 263 ASP A CA    1 
ATOM   1983  C C     . ASP A 1 266 ? 26.001  29.925  78.004  1.00 32.08 ? 263 ASP A C     1 
ATOM   1984  O O     . ASP A 1 266 ? 25.349  30.745  77.366  1.00 32.82 ? 263 ASP A O     1 
ATOM   1985  C CB    . ASP A 1 266 ? 28.395  30.399  77.821  1.00 31.57 ? 263 ASP A CB    1 
ATOM   1986  C CG    . ASP A 1 266 ? 29.576  31.122  78.380  1.00 33.03 ? 263 ASP A CG    1 
ATOM   1987  O OD1   . ASP A 1 266 ? 29.392  31.925  79.312  1.00 34.08 ? 263 ASP A OD1   1 
ATOM   1988  O OD2   . ASP A 1 266 ? 30.691  30.890  77.884  1.00 35.45 ? 263 ASP A OD2   1 
ATOM   1989  N N     . GLU A 1 267 ? 25.712  28.633  78.016  1.00 32.68 ? 264 GLU A N     1 
ATOM   1990  C CA    . GLU A 1 267 ? 24.550  28.143  77.299  1.00 33.01 ? 264 GLU A CA    1 
ATOM   1991  C C     . GLU A 1 267 ? 23.361  28.059  78.233  1.00 31.55 ? 264 GLU A C     1 
ATOM   1992  O O     . GLU A 1 267 ? 22.307  28.620  77.949  1.00 32.93 ? 264 GLU A O     1 
ATOM   1993  C CB    . GLU A 1 267 ? 24.840  26.783  76.685  1.00 36.43 ? 264 GLU A CB    1 
ATOM   1994  C CG    . GLU A 1 267 ? 25.929  26.828  75.644  1.00 39.85 ? 264 GLU A CG    1 
ATOM   1995  C CD    . GLU A 1 267 ? 25.670  25.850  74.528  1.00 44.75 ? 264 GLU A CD    1 
ATOM   1996  O OE1   . GLU A 1 267 ? 25.651  24.625  74.802  1.00 46.83 ? 264 GLU A OE1   1 
ATOM   1997  O OE2   . GLU A 1 267 ? 25.472  26.306  73.384  1.00 45.58 ? 264 GLU A OE2   1 
ATOM   1998  N N     . ALA A 1 268 ? 23.540  27.375  79.356  1.00 30.15 ? 265 ALA A N     1 
ATOM   1999  C CA    . ALA A 1 268 ? 22.480  27.221  80.343  1.00 30.10 ? 265 ALA A CA    1 
ATOM   2000  C C     . ALA A 1 268 ? 21.870  28.557  80.774  1.00 28.98 ? 265 ALA A C     1 
ATOM   2001  O O     . ALA A 1 268 ? 20.708  28.608  81.179  1.00 29.56 ? 265 ALA A O     1 
ATOM   2002  C CB    . ALA A 1 268 ? 23.016  26.486  81.569  1.00 30.59 ? 265 ALA A CB    1 
ATOM   2003  N N     . CYS A 1 269 ? 22.647  29.634  80.704  1.00 27.06 ? 266 CYS A N     1 
ATOM   2004  C CA    . CYS A 1 269 ? 22.125  30.927  81.110  1.00 27.65 ? 266 CYS A CA    1 
ATOM   2005  C C     . CYS A 1 269 ? 20.993  31.380  80.206  1.00 29.43 ? 266 CYS A C     1 
ATOM   2006  O O     . CYS A 1 269 ? 20.271  32.315  80.537  1.00 29.94 ? 266 CYS A O     1 
ATOM   2007  C CB    . CYS A 1 269 ? 23.219  32.004  81.126  1.00 27.25 ? 266 CYS A CB    1 
ATOM   2008  S SG    . CYS A 1 269 ? 23.774  32.614  79.524  1.00 24.94 ? 266 CYS A SG    1 
ATOM   2009  N N     . GLN A 1 270 ? 20.820  30.719  79.068  1.00 30.24 ? 267 GLN A N     1 
ATOM   2010  C CA    . GLN A 1 270 ? 19.746  31.133  78.175  1.00 31.51 ? 267 GLN A CA    1 
ATOM   2011  C C     . GLN A 1 270 ? 18.460  30.366  78.415  1.00 31.77 ? 267 GLN A C     1 
ATOM   2012  O O     . GLN A 1 270 ? 17.384  30.833  78.049  1.00 30.97 ? 267 GLN A O     1 
ATOM   2013  C CB    . GLN A 1 270 ? 20.153  30.965  76.727  1.00 31.85 ? 267 GLN A CB    1 
ATOM   2014  C CG    . GLN A 1 270 ? 21.541  31.452  76.423  1.00 34.51 ? 267 GLN A CG    1 
ATOM   2015  C CD    . GLN A 1 270 ? 21.929  31.184  74.980  1.00 36.87 ? 267 GLN A CD    1 
ATOM   2016  O OE1   . GLN A 1 270 ? 23.119  31.116  74.654  1.00 39.23 ? 267 GLN A OE1   1 
ATOM   2017  N NE2   . GLN A 1 270 ? 20.926  31.030  74.104  1.00 33.13 ? 267 GLN A NE2   1 
ATOM   2018  N N     . GLU A 1 271 ? 18.558  29.196  79.032  1.00 31.26 ? 268 GLU A N     1 
ATOM   2019  C CA    . GLU A 1 271 ? 17.361  28.411  79.251  1.00 32.29 ? 268 GLU A CA    1 
ATOM   2020  C C     . GLU A 1 271 ? 16.972  28.122  80.695  1.00 31.65 ? 268 GLU A C     1 
ATOM   2021  O O     . GLU A 1 271 ? 15.964  27.471  80.945  1.00 31.78 ? 268 GLU A O     1 
ATOM   2022  C CB    . GLU A 1 271 ? 17.460  27.111  78.460  1.00 33.42 ? 268 GLU A CB    1 
ATOM   2023  C CG    . GLU A 1 271 ? 18.866  26.578  78.338  1.00 35.42 ? 268 GLU A CG    1 
ATOM   2024  C CD    . GLU A 1 271 ? 18.892  25.185  77.751  1.00 36.25 ? 268 GLU A CD    1 
ATOM   2025  O OE1   . GLU A 1 271 ? 20.003  24.646  77.556  1.00 37.10 ? 268 GLU A OE1   1 
ATOM   2026  O OE2   . GLU A 1 271 ? 17.796  24.633  77.494  1.00 35.15 ? 268 GLU A OE2   1 
ATOM   2027  N N     . GLY A 1 272 ? 17.743  28.626  81.649  1.00 31.96 ? 269 GLY A N     1 
ATOM   2028  C CA    . GLY A 1 272 ? 17.407  28.386  83.043  1.00 29.74 ? 269 GLY A CA    1 
ATOM   2029  C C     . GLY A 1 272 ? 16.307  29.288  83.594  1.00 29.17 ? 269 GLY A C     1 
ATOM   2030  O O     . GLY A 1 272 ? 16.128  30.418  83.138  1.00 29.11 ? 269 GLY A O     1 
ATOM   2031  N N     . ASN A 1 273 ? 15.559  28.771  84.570  1.00 28.25 ? 270 ASN A N     1 
ATOM   2032  C CA    . ASN A 1 273 ? 14.490  29.512  85.240  1.00 26.62 ? 270 ASN A CA    1 
ATOM   2033  C C     . ASN A 1 273 ? 14.955  29.706  86.690  1.00 26.93 ? 270 ASN A C     1 
ATOM   2034  O O     . ASN A 1 273 ? 14.548  30.650  87.368  1.00 25.11 ? 270 ASN A O     1 
ATOM   2035  C CB    . ASN A 1 273 ? 13.174  28.720  85.215  1.00 26.43 ? 270 ASN A CB    1 
ATOM   2036  C CG    . ASN A 1 273 ? 12.613  28.558  83.815  1.00 28.60 ? 270 ASN A CG    1 
ATOM   2037  O OD1   . ASN A 1 273 ? 12.199  29.524  83.185  1.00 29.85 ? 270 ASN A OD1   1 
ATOM   2038  N ND2   . ASN A 1 273 ? 12.599  27.329  83.324  1.00 29.52 ? 270 ASN A ND2   1 
ATOM   2039  N N     . ILE A 1 274 ? 15.821  28.799  87.144  1.00 27.05 ? 271 ILE A N     1 
ATOM   2040  C CA    . ILE A 1 274 ? 16.370  28.842  88.494  1.00 26.27 ? 271 ILE A CA    1 
ATOM   2041  C C     . ILE A 1 274 ? 17.858  28.504  88.454  1.00 26.71 ? 271 ILE A C     1 
ATOM   2042  O O     . ILE A 1 274 ? 18.249  27.501  87.860  1.00 29.77 ? 271 ILE A O     1 
ATOM   2043  C CB    . ILE A 1 274 ? 15.665  27.828  89.398  1.00 26.36 ? 271 ILE A CB    1 
ATOM   2044  C CG1   . ILE A 1 274 ? 14.153  28.035  89.307  1.00 19.33 ? 271 ILE A CG1   1 
ATOM   2045  C CG2   . ILE A 1 274 ? 16.182  27.971  90.836  1.00 26.18 ? 271 ILE A CG2   1 
ATOM   2046  C CD1   . ILE A 1 274 ? 13.368  27.082  90.147  1.00 15.49 ? 271 ILE A CD1   1 
ATOM   2047  N N     . PHE A 1 275 ? 18.682  29.338  89.082  1.00 25.99 ? 272 PHE A N     1 
ATOM   2048  C CA    . PHE A 1 275 ? 20.129  29.134  89.111  1.00 24.02 ? 272 PHE A CA    1 
ATOM   2049  C C     . PHE A 1 275 ? 20.650  28.989  90.542  1.00 24.80 ? 272 PHE A C     1 
ATOM   2050  O O     . PHE A 1 275 ? 20.274  29.751  91.428  1.00 25.47 ? 272 PHE A O     1 
ATOM   2051  C CB    . PHE A 1 275 ? 20.847  30.304  88.432  1.00 23.16 ? 272 PHE A CB    1 
ATOM   2052  C CG    . PHE A 1 275 ? 20.546  30.434  86.959  1.00 22.15 ? 272 PHE A CG    1 
ATOM   2053  C CD1   . PHE A 1 275 ? 19.421  31.128  86.520  1.00 21.02 ? 272 PHE A CD1   1 
ATOM   2054  C CD2   . PHE A 1 275 ? 21.386  29.857  86.013  1.00 20.54 ? 272 PHE A CD2   1 
ATOM   2055  C CE1   . PHE A 1 275 ? 19.142  31.246  85.157  1.00 22.14 ? 272 PHE A CE1   1 
ATOM   2056  C CE2   . PHE A 1 275 ? 21.120  29.972  84.650  1.00 22.05 ? 272 PHE A CE2   1 
ATOM   2057  C CZ    . PHE A 1 275 ? 19.995  30.667  84.220  1.00 21.41 ? 272 PHE A CZ    1 
ATOM   2058  N N     . VAL A 1 276 ? 21.521  28.010  90.759  1.00 23.91 ? 273 VAL A N     1 
ATOM   2059  C CA    . VAL A 1 276 ? 22.085  27.749  92.072  1.00 21.67 ? 273 VAL A CA    1 
ATOM   2060  C C     . VAL A 1 276 ? 23.570  27.456  91.916  1.00 22.03 ? 273 VAL A C     1 
ATOM   2061  O O     . VAL A 1 276 ? 23.949  26.459  91.299  1.00 23.03 ? 273 VAL A O     1 
ATOM   2062  C CB    . VAL A 1 276 ? 21.382  26.528  92.723  1.00 24.73 ? 273 VAL A CB    1 
ATOM   2063  C CG1   . VAL A 1 276 ? 21.981  26.224  94.089  1.00 22.17 ? 273 VAL A CG1   1 
ATOM   2064  C CG2   . VAL A 1 276 ? 19.881  26.797  92.848  1.00 25.95 ? 273 VAL A CG2   1 
ATOM   2065  N N     . THR A 1 277 ? 24.415  28.332  92.455  1.00 22.26 ? 274 THR A N     1 
ATOM   2066  C CA    . THR A 1 277 ? 25.863  28.151  92.381  1.00 20.28 ? 274 THR A CA    1 
ATOM   2067  C C     . THR A 1 277 ? 26.293  27.392  93.624  1.00 20.45 ? 274 THR A C     1 
ATOM   2068  O O     . THR A 1 277 ? 26.024  27.821  94.744  1.00 20.29 ? 274 THR A O     1 
ATOM   2069  C CB    . THR A 1 277 ? 26.604  29.509  92.298  1.00 20.79 ? 274 THR A CB    1 
ATOM   2070  O OG1   . THR A 1 277 ? 26.438  30.243  93.515  1.00 20.62 ? 274 THR A OG1   1 
ATOM   2071  C CG2   . THR A 1 277 ? 26.047  30.333  91.155  1.00 15.21 ? 274 THR A CG2   1 
ATOM   2072  N N     . THR A 1 278 ? 26.933  26.245  93.420  1.00 21.28 ? 275 THR A N     1 
ATOM   2073  C CA    . THR A 1 278 ? 27.375  25.391  94.519  1.00 22.86 ? 275 THR A CA    1 
ATOM   2074  C C     . THR A 1 278 ? 28.863  25.168  94.412  1.00 26.66 ? 275 THR A C     1 
ATOM   2075  O O     . THR A 1 278 ? 29.388  24.146  94.848  1.00 27.74 ? 275 THR A O     1 
ATOM   2076  C CB    . THR A 1 278 ? 26.740  24.020  94.448  1.00 21.33 ? 275 THR A CB    1 
ATOM   2077  O OG1   . THR A 1 278 ? 27.370  23.281  93.397  1.00 18.88 ? 275 THR A OG1   1 
ATOM   2078  C CG2   . THR A 1 278 ? 25.255  24.137  94.163  1.00 21.57 ? 275 THR A CG2   1 
ATOM   2079  N N     . THR A 1 279 ? 29.529  26.141  93.818  1.00 29.97 ? 276 THR A N     1 
ATOM   2080  C CA    . THR A 1 279 ? 30.966  26.117  93.608  1.00 33.25 ? 276 THR A CA    1 
ATOM   2081  C C     . THR A 1 279 ? 31.630  26.943  94.706  1.00 37.05 ? 276 THR A C     1 
ATOM   2082  O O     . THR A 1 279 ? 30.972  27.763  95.351  1.00 41.00 ? 276 THR A O     1 
ATOM   2083  C CB    . THR A 1 279 ? 31.295  26.781  92.265  1.00 33.73 ? 276 THR A CB    1 
ATOM   2084  O OG1   . THR A 1 279 ? 30.721  26.019  91.186  1.00 35.39 ? 276 THR A OG1   1 
ATOM   2085  C CG2   . THR A 1 279 ? 32.759  26.888  92.085  1.00 34.47 ? 276 THR A CG2   1 
ATOM   2086  N N     . GLY A 1 280 ? 32.914  26.742  94.957  1.00 36.26 ? 277 GLY A N     1 
ATOM   2087  C CA    . GLY A 1 280 ? 33.547  27.578  95.960  1.00 36.30 ? 277 GLY A CA    1 
ATOM   2088  C C     . GLY A 1 280 ? 34.413  28.546  95.181  1.00 36.70 ? 277 GLY A C     1 
ATOM   2089  O O     . GLY A 1 280 ? 35.348  29.154  95.711  1.00 38.33 ? 277 GLY A O     1 
ATOM   2090  N N     . CYS A 1 281 ? 34.089  28.681  93.902  1.00 35.27 ? 278 CYS A N     1 
ATOM   2091  C CA    . CYS A 1 281 ? 34.846  29.518  92.987  1.00 34.70 ? 278 CYS A CA    1 
ATOM   2092  C C     . CYS A 1 281 ? 34.175  30.845  92.668  1.00 34.14 ? 278 CYS A C     1 
ATOM   2093  O O     . CYS A 1 281 ? 33.023  31.067  93.028  1.00 32.74 ? 278 CYS A O     1 
ATOM   2094  C CB    . CYS A 1 281 ? 35.087  28.739  91.687  1.00 32.96 ? 278 CYS A CB    1 
ATOM   2095  S SG    . CYS A 1 281 ? 36.063  29.566  90.445  1.00 34.04 ? 278 CYS A SG    1 
ATOM   2096  N N     . ILE A 1 282 ? 34.911  31.711  91.975  1.00 34.60 ? 279 ILE A N     1 
ATOM   2097  C CA    . ILE A 1 282 ? 34.426  33.031  91.580  1.00 34.39 ? 279 ILE A CA    1 
ATOM   2098  C C     . ILE A 1 282 ? 33.953  33.050  90.125  1.00 34.54 ? 279 ILE A C     1 
ATOM   2099  O O     . ILE A 1 282 ? 34.133  32.085  89.376  1.00 35.00 ? 279 ILE A O     1 
ATOM   2100  C CB    . ILE A 1 282 ? 35.540  34.103  91.698  1.00 34.95 ? 279 ILE A CB    1 
ATOM   2101  C CG1   . ILE A 1 282 ? 36.694  33.752  90.745  1.00 33.95 ? 279 ILE A CG1   1 
ATOM   2102  C CG2   . ILE A 1 282 ? 36.016  34.214  93.144  1.00 33.27 ? 279 ILE A CG2   1 
ATOM   2103  C CD1   . ILE A 1 282 ? 37.805  34.794  90.665  1.00 35.79 ? 279 ILE A CD1   1 
ATOM   2104  N N     . ASP A 1 283 ? 33.358  34.174  89.743  1.00 34.28 ? 280 ASP A N     1 
ATOM   2105  C CA    . ASP A 1 283 ? 32.870  34.402  88.385  1.00 34.77 ? 280 ASP A CA    1 
ATOM   2106  C C     . ASP A 1 283 ? 32.069  33.245  87.781  1.00 33.42 ? 280 ASP A C     1 
ATOM   2107  O O     . ASP A 1 283 ? 32.450  32.706  86.754  1.00 36.28 ? 280 ASP A O     1 
ATOM   2108  C CB    . ASP A 1 283 ? 34.048  34.729  87.456  1.00 34.40 ? 280 ASP A CB    1 
ATOM   2109  C CG    . ASP A 1 283 ? 34.981  35.804  88.027  1.00 35.51 ? 280 ASP A CG    1 
ATOM   2110  O OD1   . ASP A 1 283 ? 34.544  36.595  88.896  1.00 36.19 ? 280 ASP A OD1   1 
ATOM   2111  O OD2   . ASP A 1 283 ? 36.155  35.861  87.588  1.00 32.78 ? 280 ASP A OD2   1 
ATOM   2112  N N     . ILE A 1 284 ? 30.955  32.875  88.400  1.00 31.72 ? 281 ILE A N     1 
ATOM   2113  C CA    . ILE A 1 284 ? 30.139  31.780  87.901  1.00 28.43 ? 281 ILE A CA    1 
ATOM   2114  C C     . ILE A 1 284 ? 28.957  32.331  87.120  1.00 28.72 ? 281 ILE A C     1 
ATOM   2115  O O     . ILE A 1 284 ? 28.564  31.787  86.077  1.00 28.79 ? 281 ILE A O     1 
ATOM   2116  C CB    . ILE A 1 284 ? 29.598  30.949  89.050  1.00 28.92 ? 281 ILE A CB    1 
ATOM   2117  C CG1   . ILE A 1 284 ? 30.741  30.601  90.018  1.00 28.67 ? 281 ILE A CG1   1 
ATOM   2118  C CG2   . ILE A 1 284 ? 28.874  29.712  88.498  1.00 27.82 ? 281 ILE A CG2   1 
ATOM   2119  C CD1   . ILE A 1 284 ? 31.801  29.671  89.460  1.00 26.42 ? 281 ILE A CD1   1 
ATOM   2120  N N     . ILE A 1 285 ? 28.376  33.403  87.641  1.00 25.68 ? 282 ILE A N     1 
ATOM   2121  C CA    . ILE A 1 285 ? 27.256  34.035  86.979  1.00 26.59 ? 282 ILE A CA    1 
ATOM   2122  C C     . ILE A 1 285 ? 27.583  35.509  86.823  1.00 26.18 ? 282 ILE A C     1 
ATOM   2123  O O     . ILE A 1 285 ? 27.689  36.245  87.804  1.00 28.22 ? 282 ILE A O     1 
ATOM   2124  C CB    . ILE A 1 285 ? 25.949  33.861  87.772  1.00 26.43 ? 282 ILE A CB    1 
ATOM   2125  C CG1   . ILE A 1 285 ? 25.631  32.366  87.921  1.00 25.03 ? 282 ILE A CG1   1 
ATOM   2126  C CG2   . ILE A 1 285 ? 24.818  34.572  87.047  1.00 25.83 ? 282 ILE A CG2   1 
ATOM   2127  C CD1   . ILE A 1 285 ? 24.238  32.086  88.469  1.00 23.41 ? 282 ILE A CD1   1 
ATOM   2128  N N     . LEU A 1 286 ? 27.751  35.926  85.576  1.00 24.53 ? 283 LEU A N     1 
ATOM   2129  C CA    . LEU A 1 286 ? 28.123  37.287  85.271  1.00 23.46 ? 283 LEU A CA    1 
ATOM   2130  C C     . LEU A 1 286 ? 27.051  38.049  84.503  1.00 23.80 ? 283 LEU A C     1 
ATOM   2131  O O     . LEU A 1 286 ? 25.997  37.501  84.168  1.00 22.99 ? 283 LEU A O     1 
ATOM   2132  C CB    . LEU A 1 286 ? 29.422  37.262  84.471  1.00 23.36 ? 283 LEU A CB    1 
ATOM   2133  C CG    . LEU A 1 286 ? 30.572  36.513  85.151  1.00 23.24 ? 283 LEU A CG    1 
ATOM   2134  C CD1   . LEU A 1 286 ? 31.570  36.037  84.113  1.00 24.34 ? 283 LEU A CD1   1 
ATOM   2135  C CD2   . LEU A 1 286 ? 31.231  37.406  86.168  1.00 22.57 ? 283 LEU A CD2   1 
ATOM   2136  N N     . GLY A 1 287 ? 27.337  39.320  84.235  1.00 22.92 ? 284 GLY A N     1 
ATOM   2137  C CA    . GLY A 1 287 ? 26.409  40.151  83.497  1.00 23.01 ? 284 GLY A CA    1 
ATOM   2138  C C     . GLY A 1 287 ? 26.079  39.588  82.122  1.00 21.40 ? 284 GLY A C     1 
ATOM   2139  O O     . GLY A 1 287 ? 24.926  39.623  81.700  1.00 21.10 ? 284 GLY A O     1 
ATOM   2140  N N     . ARG A 1 288 ? 27.074  39.049  81.422  1.00 21.99 ? 285 ARG A N     1 
ATOM   2141  C CA    . ARG A 1 288 ? 26.831  38.480  80.088  1.00 24.33 ? 285 ARG A CA    1 
ATOM   2142  C C     . ARG A 1 288 ? 25.744  37.407  80.199  1.00 25.65 ? 285 ARG A C     1 
ATOM   2143  O O     . ARG A 1 288 ? 24.917  37.235  79.304  1.00 24.38 ? 285 ARG A O     1 
ATOM   2144  C CB    . ARG A 1 288 ? 28.113  37.862  79.512  1.00 22.55 ? 285 ARG A CB    1 
ATOM   2145  C CG    . ARG A 1 288 ? 28.620  36.632  80.267  1.00 24.03 ? 285 ARG A CG    1 
ATOM   2146  C CD    . ARG A 1 288 ? 29.396  35.711  79.326  1.00 24.52 ? 285 ARG A CD    1 
ATOM   2147  N NE    . ARG A 1 288 ? 30.832  35.778  79.561  1.00 26.57 ? 285 ARG A NE    1 
ATOM   2148  C CZ    . ARG A 1 288 ? 31.529  34.808  80.142  1.00 29.93 ? 285 ARG A CZ    1 
ATOM   2149  N NH1   . ARG A 1 288 ? 30.907  33.702  80.528  1.00 32.26 ? 285 ARG A NH1   1 
ATOM   2150  N NH2   . ARG A 1 288 ? 32.837  34.947  80.358  1.00 30.14 ? 285 ARG A NH2   1 
ATOM   2151  N N     . HIS A 1 289 ? 25.764  36.698  81.323  1.00 28.04 ? 286 HIS A N     1 
ATOM   2152  C CA    . HIS A 1 289 ? 24.797  35.646  81.612  1.00 27.97 ? 286 HIS A CA    1 
ATOM   2153  C C     . HIS A 1 289 ? 23.427  36.244  81.980  1.00 28.00 ? 286 HIS A C     1 
ATOM   2154  O O     . HIS A 1 289 ? 22.407  35.856  81.407  1.00 25.42 ? 286 HIS A O     1 
ATOM   2155  C CB    . HIS A 1 289 ? 25.327  34.779  82.761  1.00 28.30 ? 286 HIS A CB    1 
ATOM   2156  C CG    . HIS A 1 289 ? 26.584  34.032  82.426  1.00 30.74 ? 286 HIS A CG    1 
ATOM   2157  N ND1   . HIS A 1 289 ? 27.618  33.868  83.328  1.00 32.15 ? 286 HIS A ND1   1 
ATOM   2158  C CD2   . HIS A 1 289 ? 26.959  33.373  81.304  1.00 30.79 ? 286 HIS A CD2   1 
ATOM   2159  C CE1   . HIS A 1 289 ? 28.573  33.142  82.775  1.00 31.35 ? 286 HIS A CE1   1 
ATOM   2160  N NE2   . HIS A 1 289 ? 28.198  32.828  81.546  1.00 31.79 ? 286 HIS A NE2   1 
ATOM   2161  N N     . PHE A 1 290 ? 23.409  37.182  82.931  1.00 27.86 ? 287 PHE A N     1 
ATOM   2162  C CA    . PHE A 1 290 ? 22.152  37.801  83.360  1.00 29.29 ? 287 PHE A CA    1 
ATOM   2163  C C     . PHE A 1 290 ? 21.353  38.279  82.169  1.00 30.66 ? 287 PHE A C     1 
ATOM   2164  O O     . PHE A 1 290 ? 20.179  37.943  82.028  1.00 31.06 ? 287 PHE A O     1 
ATOM   2165  C CB    . PHE A 1 290 ? 22.397  38.998  84.302  1.00 28.98 ? 287 PHE A CB    1 
ATOM   2166  C CG    . PHE A 1 290 ? 22.697  38.609  85.735  1.00 27.66 ? 287 PHE A CG    1 
ATOM   2167  C CD1   . PHE A 1 290 ? 21.816  37.802  86.460  1.00 26.73 ? 287 PHE A CD1   1 
ATOM   2168  C CD2   . PHE A 1 290 ? 23.862  39.047  86.356  1.00 26.29 ? 287 PHE A CD2   1 
ATOM   2169  C CE1   . PHE A 1 290 ? 22.097  37.441  87.776  1.00 25.34 ? 287 PHE A CE1   1 
ATOM   2170  C CE2   . PHE A 1 290 ? 24.150  38.694  87.662  1.00 24.82 ? 287 PHE A CE2   1 
ATOM   2171  C CZ    . PHE A 1 290 ? 23.266  37.888  88.375  1.00 27.04 ? 287 PHE A CZ    1 
ATOM   2172  N N     . GLU A 1 291 ? 22.008  39.061  81.316  1.00 31.65 ? 288 GLU A N     1 
ATOM   2173  C CA    . GLU A 1 291 ? 21.387  39.612  80.119  1.00 33.74 ? 288 GLU A CA    1 
ATOM   2174  C C     . GLU A 1 291 ? 20.726  38.571  79.226  1.00 33.36 ? 288 GLU A C     1 
ATOM   2175  O O     . GLU A 1 291 ? 19.943  38.915  78.349  1.00 33.99 ? 288 GLU A O     1 
ATOM   2176  C CB    . GLU A 1 291 ? 22.430  40.389  79.314  1.00 35.23 ? 288 GLU A CB    1 
ATOM   2177  C CG    . GLU A 1 291 ? 23.072  41.492  80.126  1.00 39.74 ? 288 GLU A CG    1 
ATOM   2178  C CD    . GLU A 1 291 ? 24.207  42.215  79.409  1.00 43.24 ? 288 GLU A CD    1 
ATOM   2179  O OE1   . GLU A 1 291 ? 25.023  41.539  78.731  1.00 43.74 ? 288 GLU A OE1   1 
ATOM   2180  O OE2   . GLU A 1 291 ? 24.286  43.463  79.541  1.00 43.54 ? 288 GLU A OE2   1 
ATOM   2181  N N     . GLN A 1 292 ? 21.018  37.298  79.443  1.00 33.67 ? 289 GLN A N     1 
ATOM   2182  C CA    . GLN A 1 292 ? 20.414  36.274  78.601  1.00 34.90 ? 289 GLN A CA    1 
ATOM   2183  C C     . GLN A 1 292 ? 19.364  35.449  79.316  1.00 33.44 ? 289 GLN A C     1 
ATOM   2184  O O     . GLN A 1 292 ? 18.685  34.637  78.692  1.00 32.53 ? 289 GLN A O     1 
ATOM   2185  C CB    . GLN A 1 292 ? 21.481  35.320  78.053  1.00 36.58 ? 289 GLN A CB    1 
ATOM   2186  C CG    . GLN A 1 292 ? 22.533  35.972  77.194  1.00 39.28 ? 289 GLN A CG    1 
ATOM   2187  C CD    . GLN A 1 292 ? 22.835  35.144  75.968  1.00 43.29 ? 289 GLN A CD    1 
ATOM   2188  O OE1   . GLN A 1 292 ? 22.055  35.133  75.003  1.00 42.08 ? 289 GLN A OE1   1 
ATOM   2189  N NE2   . GLN A 1 292 ? 23.964  34.422  76.000  1.00 43.76 ? 289 GLN A NE2   1 
ATOM   2190  N N     . MET A 1 293 ? 19.232  35.648  80.621  1.00 33.08 ? 290 MET A N     1 
ATOM   2191  C CA    . MET A 1 293 ? 18.270  34.880  81.395  1.00 33.87 ? 290 MET A CA    1 
ATOM   2192  C C     . MET A 1 293 ? 16.816  35.149  81.059  1.00 34.88 ? 290 MET A C     1 
ATOM   2193  O O     . MET A 1 293 ? 16.459  36.222  80.570  1.00 34.45 ? 290 MET A O     1 
ATOM   2194  C CB    . MET A 1 293 ? 18.480  35.112  82.890  1.00 32.67 ? 290 MET A CB    1 
ATOM   2195  C CG    . MET A 1 293 ? 19.641  34.345  83.469  1.00 31.16 ? 290 MET A CG    1 
ATOM   2196  S SD    . MET A 1 293 ? 19.935  34.806  85.190  1.00 26.72 ? 290 MET A SD    1 
ATOM   2197  C CE    . MET A 1 293 ? 21.709  34.589  85.290  1.00 26.13 ? 290 MET A CE    1 
ATOM   2198  N N     . LYS A 1 294 ? 15.981  34.156  81.333  1.00 34.95 ? 291 LYS A N     1 
ATOM   2199  C CA    . LYS A 1 294 ? 14.563  34.285  81.084  1.00 34.91 ? 291 LYS A CA    1 
ATOM   2200  C C     . LYS A 1 294 ? 13.962  35.214  82.124  1.00 33.81 ? 291 LYS A C     1 
ATOM   2201  O O     . LYS A 1 294 ? 14.505  35.365  83.220  1.00 36.05 ? 291 LYS A O     1 
ATOM   2202  C CB    . LYS A 1 294 ? 13.903  32.915  81.131  1.00 35.74 ? 291 LYS A CB    1 
ATOM   2203  C CG    . LYS A 1 294 ? 14.100  32.149  79.854  1.00 38.06 ? 291 LYS A CG    1 
ATOM   2204  C CD    . LYS A 1 294 ? 13.054  31.072  79.731  1.00 43.61 ? 291 LYS A CD    1 
ATOM   2205  C CE    . LYS A 1 294 ? 12.893  30.611  78.281  1.00 45.15 ? 291 LYS A CE    1 
ATOM   2206  N NZ    . LYS A 1 294 ? 14.157  30.082  77.705  1.00 44.22 ? 291 LYS A NZ    1 
ATOM   2207  N N     . ASP A 1 295 ? 12.847  35.846  81.778  1.00 31.19 ? 292 ASP A N     1 
ATOM   2208  C CA    . ASP A 1 295 ? 12.192  36.789  82.678  1.00 28.43 ? 292 ASP A CA    1 
ATOM   2209  C C     . ASP A 1 295 ? 11.897  36.176  84.047  1.00 28.09 ? 292 ASP A C     1 
ATOM   2210  O O     . ASP A 1 295 ? 11.506  35.014  84.144  1.00 29.19 ? 292 ASP A O     1 
ATOM   2211  C CB    . ASP A 1 295 ? 10.897  37.308  82.040  1.00 25.51 ? 292 ASP A CB    1 
ATOM   2212  C CG    . ASP A 1 295 ? 10.273  38.449  82.829  1.00 25.85 ? 292 ASP A CG    1 
ATOM   2213  O OD1   . ASP A 1 295 ? 11.020  39.349  83.260  1.00 27.46 ? 292 ASP A OD1   1 
ATOM   2214  O OD2   . ASP A 1 295 ? 9.039   38.456  83.012  1.00 23.67 ? 292 ASP A OD2   1 
ATOM   2215  N N     . ASP A 1 296 ? 12.096  36.965  85.100  1.00 24.80 ? 293 ASP A N     1 
ATOM   2216  C CA    . ASP A 1 296 ? 11.835  36.518  86.462  1.00 24.67 ? 293 ASP A CA    1 
ATOM   2217  C C     . ASP A 1 296 ? 12.628  35.282  86.907  1.00 24.08 ? 293 ASP A C     1 
ATOM   2218  O O     . ASP A 1 296 ? 12.166  34.506  87.752  1.00 19.87 ? 293 ASP A O     1 
ATOM   2219  C CB    . ASP A 1 296 ? 10.338  36.254  86.630  1.00 26.90 ? 293 ASP A CB    1 
ATOM   2220  C CG    . ASP A 1 296 ? 9.651   37.298  87.506  1.00 28.69 ? 293 ASP A CG    1 
ATOM   2221  O OD1   . ASP A 1 296 ? 10.343  38.238  87.968  1.00 25.08 ? 293 ASP A OD1   1 
ATOM   2222  O OD2   . ASP A 1 296 ? 8.422   37.167  87.731  1.00 28.75 ? 293 ASP A OD2   1 
ATOM   2223  N N     . ALA A 1 297 ? 13.813  35.110  86.326  1.00 23.08 ? 294 ALA A N     1 
ATOM   2224  C CA    . ALA A 1 297 ? 14.671  33.987  86.666  1.00 21.44 ? 294 ALA A CA    1 
ATOM   2225  C C     . ALA A 1 297 ? 15.200  34.167  88.081  1.00 20.62 ? 294 ALA A C     1 
ATOM   2226  O O     . ALA A 1 297 ? 15.746  35.211  88.418  1.00 19.97 ? 294 ALA A O     1 
ATOM   2227  C CB    . ALA A 1 297 ? 15.826  33.894  85.688  1.00 20.13 ? 294 ALA A CB    1 
ATOM   2228  N N     . ILE A 1 298 ? 15.035  33.139  88.905  1.00 20.23 ? 295 ILE A N     1 
ATOM   2229  C CA    . ILE A 1 298 ? 15.506  33.189  90.281  1.00 19.00 ? 295 ILE A CA    1 
ATOM   2230  C C     . ILE A 1 298 ? 16.963  32.745  90.329  1.00 21.39 ? 295 ILE A C     1 
ATOM   2231  O O     . ILE A 1 298 ? 17.295  31.639  89.890  1.00 20.70 ? 295 ILE A O     1 
ATOM   2232  C CB    . ILE A 1 298 ? 14.670  32.265  91.172  1.00 18.42 ? 295 ILE A CB    1 
ATOM   2233  C CG1   . ILE A 1 298 ? 13.213  32.715  91.161  1.00 16.70 ? 295 ILE A CG1   1 
ATOM   2234  C CG2   . ILE A 1 298 ? 15.199  32.279  92.576  1.00 18.69 ? 295 ILE A CG2   1 
ATOM   2235  C CD1   . ILE A 1 298 ? 12.268  31.685  91.691  1.00 16.67 ? 295 ILE A CD1   1 
ATOM   2236  N N     . VAL A 1 299 ? 17.832  33.608  90.853  1.00 22.04 ? 296 VAL A N     1 
ATOM   2237  C CA    . VAL A 1 299 ? 19.262  33.299  90.951  1.00 22.84 ? 296 VAL A CA    1 
ATOM   2238  C C     . VAL A 1 299 ? 19.728  33.317  92.405  1.00 23.76 ? 296 VAL A C     1 
ATOM   2239  O O     . VAL A 1 299 ? 19.424  34.253  93.144  1.00 23.81 ? 296 VAL A O     1 
ATOM   2240  C CB    . VAL A 1 299 ? 20.131  34.330  90.179  1.00 24.41 ? 296 VAL A CB    1 
ATOM   2241  C CG1   . VAL A 1 299 ? 21.601  33.983  90.330  1.00 25.03 ? 296 VAL A CG1   1 
ATOM   2242  C CG2   . VAL A 1 299 ? 19.749  34.371  88.709  1.00 23.72 ? 296 VAL A CG2   1 
ATOM   2243  N N     . CYS A 1 300 ? 20.464  32.295  92.826  1.00 23.05 ? 297 CYS A N     1 
ATOM   2244  C CA    . CYS A 1 300 ? 20.951  32.274  94.193  1.00 24.39 ? 297 CYS A CA    1 
ATOM   2245  C C     . CYS A 1 300 ? 22.253  31.511  94.288  1.00 24.92 ? 297 CYS A C     1 
ATOM   2246  O O     . CYS A 1 300 ? 22.727  30.958  93.305  1.00 26.10 ? 297 CYS A O     1 
ATOM   2247  C CB    . CYS A 1 300 ? 19.914  31.664  95.134  1.00 23.76 ? 297 CYS A CB    1 
ATOM   2248  S SG    . CYS A 1 300 ? 19.513  29.973  94.755  1.00 27.41 ? 297 CYS A SG    1 
ATOM   2249  N N     . ASN A 1 301 ? 22.829  31.496  95.483  1.00 25.21 ? 298 ASN A N     1 
ATOM   2250  C CA    . ASN A 1 301 ? 24.090  30.832  95.740  1.00 24.18 ? 298 ASN A CA    1 
ATOM   2251  C C     . ASN A 1 301 ? 24.030  30.054  97.051  1.00 24.99 ? 298 ASN A C     1 
ATOM   2252  O O     . ASN A 1 301 ? 23.348  30.447  98.001  1.00 24.38 ? 298 ASN A O     1 
ATOM   2253  C CB    . ASN A 1 301 ? 25.204  31.875  95.815  1.00 25.13 ? 298 ASN A CB    1 
ATOM   2254  C CG    . ASN A 1 301 ? 26.421  31.382  96.599  1.00 27.73 ? 298 ASN A CG    1 
ATOM   2255  O OD1   . ASN A 1 301 ? 27.092  30.434  96.201  1.00 26.06 ? 298 ASN A OD1   1 
ATOM   2256  N ND2   . ASN A 1 301 ? 26.705  32.034  97.723  1.00 28.19 ? 298 ASN A ND2   1 
ATOM   2257  N N     . ILE A 1 302 ? 24.751  28.946  97.112  1.00 24.41 ? 299 ILE A N     1 
ATOM   2258  C CA    . ILE A 1 302 ? 24.745  28.153  98.325  1.00 24.39 ? 299 ILE A CA    1 
ATOM   2259  C C     . ILE A 1 302 ? 26.179  27.856  98.776  1.00 24.59 ? 299 ILE A C     1 
ATOM   2260  O O     . ILE A 1 302 ? 26.401  27.128  99.739  1.00 24.87 ? 299 ILE A O     1 
ATOM   2261  C CB    . ILE A 1 302 ? 23.929  26.849  98.112  1.00 23.33 ? 299 ILE A CB    1 
ATOM   2262  C CG1   . ILE A 1 302 ? 23.653  26.191  99.465  1.00 24.00 ? 299 ILE A CG1   1 
ATOM   2263  C CG2   . ILE A 1 302 ? 24.656  25.919  97.155  1.00 20.95 ? 299 ILE A CG2   1 
ATOM   2264  C CD1   . ILE A 1 302 ? 22.397  25.323  99.488  1.00 25.66 ? 299 ILE A CD1   1 
ATOM   2265  N N     . GLY A 1 303 ? 27.143  28.451  98.076  1.00 26.15 ? 300 GLY A N     1 
ATOM   2266  C CA    . GLY A 1 303 ? 28.547  28.286  98.413  1.00 27.27 ? 300 GLY A CA    1 
ATOM   2267  C C     . GLY A 1 303 ? 28.844  29.150  99.625  1.00 28.77 ? 300 GLY A C     1 
ATOM   2268  O O     . GLY A 1 303 ? 28.185  30.176  99.832  1.00 28.44 ? 300 GLY A O     1 
ATOM   2269  N N     . HIS A 1 304 ? 29.836  28.764  100.420 1.00 29.00 ? 301 HIS A N     1 
ATOM   2270  C CA    . HIS A 1 304 ? 30.145  29.519  101.623 1.00 29.64 ? 301 HIS A CA    1 
ATOM   2271  C C     . HIS A 1 304 ? 30.212  31.049  101.485 1.00 29.94 ? 301 HIS A C     1 
ATOM   2272  O O     . HIS A 1 304 ? 29.474  31.776  102.152 1.00 29.61 ? 301 HIS A O     1 
ATOM   2273  C CB    . HIS A 1 304 ? 31.440  29.018  102.240 1.00 30.00 ? 301 HIS A CB    1 
ATOM   2274  C CG    . HIS A 1 304 ? 31.775  29.706  103.522 1.00 29.43 ? 301 HIS A CG    1 
ATOM   2275  N ND1   . HIS A 1 304 ? 31.069  29.490  104.686 1.00 27.14 ? 301 HIS A ND1   1 
ATOM   2276  C CD2   . HIS A 1 304 ? 32.678  30.676  103.798 1.00 28.65 ? 301 HIS A CD2   1 
ATOM   2277  C CE1   . HIS A 1 304 ? 31.524  30.302  105.623 1.00 27.77 ? 301 HIS A CE1   1 
ATOM   2278  N NE2   . HIS A 1 304 ? 32.500  31.032  105.110 1.00 30.00 ? 301 HIS A NE2   1 
ATOM   2279  N N     . PHE A 1 305 ? 31.107  31.539  100.638 1.00 30.06 ? 302 PHE A N     1 
ATOM   2280  C CA    . PHE A 1 305 ? 31.255  32.974  100.446 1.00 30.72 ? 302 PHE A CA    1 
ATOM   2281  C C     . PHE A 1 305 ? 30.412  33.466  99.275  1.00 31.23 ? 302 PHE A C     1 
ATOM   2282  O O     . PHE A 1 305 ? 30.113  32.702  98.358  1.00 31.66 ? 302 PHE A O     1 
ATOM   2283  C CB    . PHE A 1 305 ? 32.728  33.312  100.192 1.00 32.22 ? 302 PHE A CB    1 
ATOM   2284  C CG    . PHE A 1 305 ? 33.610  33.147  101.397 1.00 31.66 ? 302 PHE A CG    1 
ATOM   2285  C CD1   . PHE A 1 305 ? 33.292  33.778  102.592 1.00 32.51 ? 302 PHE A CD1   1 
ATOM   2286  C CD2   . PHE A 1 305 ? 34.781  32.406  101.324 1.00 31.70 ? 302 PHE A CD2   1 
ATOM   2287  C CE1   . PHE A 1 305 ? 34.132  33.677  103.700 1.00 33.21 ? 302 PHE A CE1   1 
ATOM   2288  C CE2   . PHE A 1 305 ? 35.632  32.298  102.424 1.00 32.54 ? 302 PHE A CE2   1 
ATOM   2289  C CZ    . PHE A 1 305 ? 35.307  32.936  103.616 1.00 32.26 ? 302 PHE A CZ    1 
ATOM   2290  N N     . ASP A 1 306 ? 30.023  34.738  99.320  1.00 30.88 ? 303 ASP A N     1 
ATOM   2291  C CA    . ASP A 1 306 ? 29.226  35.347  98.255  1.00 29.25 ? 303 ASP A CA    1 
ATOM   2292  C C     . ASP A 1 306 ? 30.163  35.895  97.180  1.00 28.42 ? 303 ASP A C     1 
ATOM   2293  O O     . ASP A 1 306 ? 30.374  37.100  97.102  1.00 26.10 ? 303 ASP A O     1 
ATOM   2294  C CB    . ASP A 1 306 ? 28.357  36.494  98.807  1.00 30.97 ? 303 ASP A CB    1 
ATOM   2295  C CG    . ASP A 1 306 ? 29.178  37.579  99.529  1.00 31.93 ? 303 ASP A CG    1 
ATOM   2296  O OD1   . ASP A 1 306 ? 28.980  38.778  99.234  1.00 33.06 ? 303 ASP A OD1   1 
ATOM   2297  O OD2   . ASP A 1 306 ? 30.013  37.238  100.396 1.00 30.87 ? 303 ASP A OD2   1 
ATOM   2298  N N     . VAL A 1 307 ? 30.714  35.016  96.343  1.00 28.88 ? 304 VAL A N     1 
ATOM   2299  C CA    . VAL A 1 307 ? 31.642  35.442  95.290  1.00 29.67 ? 304 VAL A CA    1 
ATOM   2300  C C     . VAL A 1 307 ? 31.369  34.786  93.947  1.00 31.25 ? 304 VAL A C     1 
ATOM   2301  O O     . VAL A 1 307 ? 32.146  34.945  93.000  1.00 32.87 ? 304 VAL A O     1 
ATOM   2302  C CB    . VAL A 1 307 ? 33.090  35.098  95.659  1.00 30.97 ? 304 VAL A CB    1 
ATOM   2303  C CG1   . VAL A 1 307 ? 33.543  35.916  96.870  1.00 28.75 ? 304 VAL A CG1   1 
ATOM   2304  C CG2   . VAL A 1 307 ? 33.195  33.585  95.944  1.00 27.50 ? 304 VAL A CG2   1 
ATOM   2305  N N     . GLU A 1 308 ? 30.264  34.057  93.860  1.00 32.27 ? 305 GLU A N     1 
ATOM   2306  C CA    . GLU A 1 308 ? 29.918  33.350  92.635  1.00 31.65 ? 305 GLU A CA    1 
ATOM   2307  C C     . GLU A 1 308 ? 29.029  34.128  91.685  1.00 32.09 ? 305 GLU A C     1 
ATOM   2308  O O     . GLU A 1 308 ? 29.162  34.000  90.466  1.00 33.88 ? 305 GLU A O     1 
ATOM   2309  C CB    . GLU A 1 308 ? 29.255  32.028  92.984  1.00 31.54 ? 305 GLU A CB    1 
ATOM   2310  C CG    . GLU A 1 308 ? 30.080  31.183  93.918  1.00 31.98 ? 305 GLU A CG    1 
ATOM   2311  C CD    . GLU A 1 308 ? 29.656  29.739  93.886  1.00 33.07 ? 305 GLU A CD    1 
ATOM   2312  O OE1   . GLU A 1 308 ? 29.624  29.156  92.782  1.00 31.29 ? 305 GLU A OE1   1 
ATOM   2313  O OE2   . GLU A 1 308 ? 29.351  29.190  94.966  1.00 34.45 ? 305 GLU A OE2   1 
ATOM   2314  N N     . ILE A 1 309 ? 28.114  34.917  92.242  1.00 30.46 ? 306 ILE A N     1 
ATOM   2315  C CA    . ILE A 1 309 ? 27.202  35.722  91.440  1.00 27.48 ? 306 ILE A CA    1 
ATOM   2316  C C     . ILE A 1 309 ? 27.653  37.160  91.483  1.00 27.87 ? 306 ILE A C     1 
ATOM   2317  O O     . ILE A 1 309 ? 27.876  37.706  92.555  1.00 27.67 ? 306 ILE A O     1 
ATOM   2318  C CB    . ILE A 1 309 ? 25.773  35.694  91.991  1.00 25.73 ? 306 ILE A CB    1 
ATOM   2319  C CG1   . ILE A 1 309 ? 25.240  34.267  92.008  1.00 26.36 ? 306 ILE A CG1   1 
ATOM   2320  C CG2   . ILE A 1 309 ? 24.887  36.605  91.159  1.00 23.70 ? 306 ILE A CG2   1 
ATOM   2321  C CD1   . ILE A 1 309 ? 23.942  34.135  92.752  1.00 24.88 ? 306 ILE A CD1   1 
ATOM   2322  N N     . ASP A 1 310 ? 27.760  37.786  90.322  1.00 28.22 ? 307 ASP A N     1 
ATOM   2323  C CA    . ASP A 1 310 ? 28.178  39.172  90.269  1.00 29.25 ? 307 ASP A CA    1 
ATOM   2324  C C     . ASP A 1 310 ? 27.019  40.086  90.665  1.00 30.26 ? 307 ASP A C     1 
ATOM   2325  O O     . ASP A 1 310 ? 26.479  40.812  89.825  1.00 32.53 ? 307 ASP A O     1 
ATOM   2326  C CB    . ASP A 1 310 ? 28.643  39.529  88.852  1.00 30.46 ? 307 ASP A CB    1 
ATOM   2327  C CG    . ASP A 1 310 ? 29.522  40.764  88.820  1.00 30.29 ? 307 ASP A CG    1 
ATOM   2328  O OD1   . ASP A 1 310 ? 29.226  41.747  89.534  1.00 28.73 ? 307 ASP A OD1   1 
ATOM   2329  O OD2   . ASP A 1 310 ? 30.512  40.752  88.069  1.00 33.55 ? 307 ASP A OD2   1 
ATOM   2330  N N     . VAL A 1 311 ? 26.643  40.059  91.939  1.00 29.38 ? 308 VAL A N     1 
ATOM   2331  C CA    . VAL A 1 311 ? 25.559  40.896  92.436  1.00 29.24 ? 308 VAL A CA    1 
ATOM   2332  C C     . VAL A 1 311 ? 25.895  42.373  92.213  1.00 30.59 ? 308 VAL A C     1 
ATOM   2333  O O     . VAL A 1 311 ? 25.012  43.198  91.969  1.00 28.82 ? 308 VAL A O     1 
ATOM   2334  C CB    . VAL A 1 311 ? 25.326  40.650  93.940  1.00 30.12 ? 308 VAL A CB    1 
ATOM   2335  C CG1   . VAL A 1 311 ? 24.205  41.540  94.455  1.00 30.47 ? 308 VAL A CG1   1 
ATOM   2336  C CG2   . VAL A 1 311 ? 24.973  39.190  94.171  1.00 29.86 ? 308 VAL A CG2   1 
ATOM   2337  N N     . LYS A 1 312 ? 27.180  42.703  92.300  1.00 33.67 ? 309 LYS A N     1 
ATOM   2338  C CA    . LYS A 1 312 ? 27.634  44.075  92.105  1.00 35.85 ? 309 LYS A CA    1 
ATOM   2339  C C     . LYS A 1 312 ? 27.155  44.563  90.746  1.00 35.88 ? 309 LYS A C     1 
ATOM   2340  O O     . LYS A 1 312 ? 26.612  45.664  90.623  1.00 36.88 ? 309 LYS A O     1 
ATOM   2341  C CB    . LYS A 1 312 ? 29.161  44.139  92.173  1.00 38.67 ? 309 LYS A CB    1 
ATOM   2342  C CG    . LYS A 1 312 ? 29.736  45.551  92.047  1.00 42.75 ? 309 LYS A CG    1 
ATOM   2343  C CD    . LYS A 1 312 ? 30.121  46.137  93.399  1.00 45.98 ? 309 LYS A CD    1 
ATOM   2344  C CE    . LYS A 1 312 ? 31.277  45.355  94.025  1.00 49.26 ? 309 LYS A CE    1 
ATOM   2345  N NZ    . LYS A 1 312 ? 31.831  45.980  95.268  1.00 50.05 ? 309 LYS A NZ    1 
ATOM   2346  N N     . TRP A 1 313 ? 27.356  43.730  89.728  1.00 35.21 ? 310 TRP A N     1 
ATOM   2347  C CA    . TRP A 1 313 ? 26.947  44.054  88.368  1.00 34.77 ? 310 TRP A CA    1 
ATOM   2348  C C     . TRP A 1 313 ? 25.465  44.402  88.299  1.00 35.33 ? 310 TRP A C     1 
ATOM   2349  O O     . TRP A 1 313 ? 25.088  45.399  87.682  1.00 36.00 ? 310 TRP A O     1 
ATOM   2350  C CB    . TRP A 1 313 ? 27.205  42.872  87.426  1.00 34.32 ? 310 TRP A CB    1 
ATOM   2351  C CG    . TRP A 1 313 ? 26.909  43.206  85.990  1.00 33.48 ? 310 TRP A CG    1 
ATOM   2352  C CD1   . TRP A 1 313 ? 27.753  43.820  85.105  1.00 33.12 ? 310 TRP A CD1   1 
ATOM   2353  C CD2   . TRP A 1 313 ? 25.664  43.023  85.298  1.00 32.54 ? 310 TRP A CD2   1 
ATOM   2354  N NE1   . TRP A 1 313 ? 27.108  44.034  83.909  1.00 32.25 ? 310 TRP A NE1   1 
ATOM   2355  C CE2   . TRP A 1 313 ? 25.826  43.556  83.999  1.00 31.74 ? 310 TRP A CE2   1 
ATOM   2356  C CE3   . TRP A 1 313 ? 24.428  42.466  85.649  1.00 32.65 ? 310 TRP A CE3   1 
ATOM   2357  C CZ2   . TRP A 1 313 ? 24.797  43.550  83.048  1.00 31.42 ? 310 TRP A CZ2   1 
ATOM   2358  C CZ3   . TRP A 1 313 ? 23.400  42.463  84.697  1.00 34.68 ? 310 TRP A CZ3   1 
ATOM   2359  C CH2   . TRP A 1 313 ? 23.596  43.003  83.413  1.00 31.56 ? 310 TRP A CH2   1 
ATOM   2360  N N     . LEU A 1 314 ? 24.624  43.577  88.916  1.00 34.78 ? 311 LEU A N     1 
ATOM   2361  C CA    . LEU A 1 314 ? 23.191  43.827  88.890  1.00 37.45 ? 311 LEU A CA    1 
ATOM   2362  C C     . LEU A 1 314 ? 22.817  45.213  89.401  1.00 38.50 ? 311 LEU A C     1 
ATOM   2363  O O     . LEU A 1 314 ? 21.961  45.877  88.813  1.00 37.63 ? 311 LEU A O     1 
ATOM   2364  C CB    . LEU A 1 314 ? 22.432  42.775  89.711  1.00 39.98 ? 311 LEU A CB    1 
ATOM   2365  C CG    . LEU A 1 314 ? 22.346  41.342  89.180  1.00 41.85 ? 311 LEU A CG    1 
ATOM   2366  C CD1   . LEU A 1 314 ? 21.715  40.462  90.252  1.00 44.79 ? 311 LEU A CD1   1 
ATOM   2367  C CD2   . LEU A 1 314 ? 21.522  41.295  87.902  1.00 42.67 ? 311 LEU A CD2   1 
ATOM   2368  N N     . ASN A 1 315 ? 23.450  45.650  90.487  1.00 38.52 ? 312 ASN A N     1 
ATOM   2369  C CA    . ASN A 1 315 ? 23.142  46.967  91.038  1.00 39.62 ? 312 ASN A CA    1 
ATOM   2370  C C     . ASN A 1 315 ? 23.657  48.069  90.138  1.00 41.36 ? 312 ASN A C     1 
ATOM   2371  O O     . ASN A 1 315 ? 23.090  49.163  90.081  1.00 42.83 ? 312 ASN A O     1 
ATOM   2372  C CB    . ASN A 1 315 ? 23.775  47.158  92.412  1.00 37.38 ? 312 ASN A CB    1 
ATOM   2373  C CG    . ASN A 1 315 ? 23.298  46.153  93.414  1.00 34.84 ? 312 ASN A CG    1 
ATOM   2374  O OD1   . ASN A 1 315 ? 22.103  45.876  93.510  1.00 30.87 ? 312 ASN A OD1   1 
ATOM   2375  N ND2   . ASN A 1 315 ? 24.231  45.605  94.188  1.00 34.17 ? 312 ASN A ND2   1 
ATOM   2376  N N     . GLU A 1 316 ? 24.740  47.783  89.435  1.00 42.16 ? 313 GLU A N     1 
ATOM   2377  C CA    . GLU A 1 316 ? 25.319  48.792  88.577  1.00 43.87 ? 313 GLU A CA    1 
ATOM   2378  C C     . GLU A 1 316 ? 24.870  48.703  87.124  1.00 43.69 ? 313 GLU A C     1 
ATOM   2379  O O     . GLU A 1 316 ? 25.532  49.246  86.246  1.00 45.64 ? 313 GLU A O     1 
ATOM   2380  C CB    . GLU A 1 316 ? 26.848  48.717  88.668  1.00 45.79 ? 313 GLU A CB    1 
ATOM   2381  C CG    . GLU A 1 316 ? 27.435  49.181  90.007  1.00 49.45 ? 313 GLU A CG    1 
ATOM   2382  C CD    . GLU A 1 316 ? 28.942  48.945  90.100  1.00 52.05 ? 313 GLU A CD    1 
ATOM   2383  O OE1   . GLU A 1 316 ? 29.641  49.156  89.084  1.00 53.94 ? 313 GLU A OE1   1 
ATOM   2384  O OE2   . GLU A 1 316 ? 29.431  48.555  91.187  1.00 53.04 ? 313 GLU A OE2   1 
ATOM   2385  N N     . ASN A 1 317 ? 23.746  48.045  86.855  1.00 41.84 ? 314 ASN A N     1 
ATOM   2386  C CA    . ASN A 1 317 ? 23.289  47.913  85.472  1.00 39.48 ? 314 ASN A CA    1 
ATOM   2387  C C     . ASN A 1 317 ? 21.792  47.787  85.295  1.00 38.62 ? 314 ASN A C     1 
ATOM   2388  O O     . ASN A 1 317 ? 21.256  48.094  84.235  1.00 40.80 ? 314 ASN A O     1 
ATOM   2389  C CB    . ASN A 1 317 ? 23.960  46.715  84.826  1.00 39.72 ? 314 ASN A CB    1 
ATOM   2390  C CG    . ASN A 1 317 ? 25.407  46.967  84.525  1.00 40.12 ? 314 ASN A CG    1 
ATOM   2391  O OD1   . ASN A 1 317 ? 25.739  47.687  83.578  1.00 39.56 ? 314 ASN A OD1   1 
ATOM   2392  N ND2   . ASN A 1 317 ? 26.288  46.387  85.338  1.00 39.48 ? 314 ASN A ND2   1 
ATOM   2393  N N     . ALA A 1 318 ? 21.113  47.319  86.327  1.00 36.28 ? 315 ALA A N     1 
ATOM   2394  C CA    . ALA A 1 318 ? 19.674  47.171  86.251  1.00 35.24 ? 315 ALA A CA    1 
ATOM   2395  C C     . ALA A 1 318 ? 19.060  48.567  86.229  1.00 33.74 ? 315 ALA A C     1 
ATOM   2396  O O     . ALA A 1 318 ? 19.614  49.496  86.812  1.00 32.74 ? 315 ALA A O     1 
ATOM   2397  C CB    . ALA A 1 318 ? 19.173  46.387  87.462  1.00 34.45 ? 315 ALA A CB    1 
ATOM   2398  N N     . VAL A 1 319 ? 17.931  48.725  85.544  1.00 31.98 ? 316 VAL A N     1 
ATOM   2399  C CA    . VAL A 1 319 ? 17.275  50.030  85.503  1.00 32.43 ? 316 VAL A CA    1 
ATOM   2400  C C     . VAL A 1 319 ? 16.210  50.136  86.587  1.00 32.66 ? 316 VAL A C     1 
ATOM   2401  O O     . VAL A 1 319 ? 15.628  51.206  86.798  1.00 30.60 ? 316 VAL A O     1 
ATOM   2402  C CB    . VAL A 1 319 ? 16.610  50.317  84.129  1.00 31.53 ? 316 VAL A CB    1 
ATOM   2403  C CG1   . VAL A 1 319 ? 17.684  50.534  83.066  1.00 31.06 ? 316 VAL A CG1   1 
ATOM   2404  C CG2   . VAL A 1 319 ? 15.678  49.178  83.744  1.00 30.06 ? 316 VAL A CG2   1 
ATOM   2405  N N     . GLU A 1 320 ? 15.969  49.015  87.267  1.00 33.75 ? 317 GLU A N     1 
ATOM   2406  C CA    . GLU A 1 320 ? 14.986  48.917  88.349  1.00 35.07 ? 317 GLU A CA    1 
ATOM   2407  C C     . GLU A 1 320 ? 15.410  47.867  89.353  1.00 36.13 ? 317 GLU A C     1 
ATOM   2408  O O     . GLU A 1 320 ? 15.885  46.790  88.983  1.00 38.61 ? 317 GLU A O     1 
ATOM   2409  C CB    . GLU A 1 320 ? 13.605  48.537  87.808  1.00 35.17 ? 317 GLU A CB    1 
ATOM   2410  C CG    . GLU A 1 320 ? 12.804  49.689  87.234  1.00 38.02 ? 317 GLU A CG    1 
ATOM   2411  C CD    . GLU A 1 320 ? 11.515  49.249  86.540  1.00 39.37 ? 317 GLU A CD    1 
ATOM   2412  O OE1   . GLU A 1 320 ? 10.843  48.309  87.026  1.00 38.05 ? 317 GLU A OE1   1 
ATOM   2413  O OE2   . GLU A 1 320 ? 11.170  49.862  85.506  1.00 42.15 ? 317 GLU A OE2   1 
ATOM   2414  N N     . LYS A 1 321 ? 15.229  48.176  90.631  1.00 36.96 ? 318 LYS A N     1 
ATOM   2415  C CA    . LYS A 1 321 ? 15.575  47.252  91.705  1.00 36.66 ? 318 LYS A CA    1 
ATOM   2416  C C     . LYS A 1 321 ? 14.562  47.424  92.831  1.00 36.45 ? 318 LYS A C     1 
ATOM   2417  O O     . LYS A 1 321 ? 14.556  48.451  93.517  1.00 37.46 ? 318 LYS A O     1 
ATOM   2418  C CB    . LYS A 1 321 ? 16.981  47.537  92.220  1.00 37.40 ? 318 LYS A CB    1 
ATOM   2419  C CG    . LYS A 1 321 ? 17.397  46.672  93.397  1.00 39.39 ? 318 LYS A CG    1 
ATOM   2420  C CD    . LYS A 1 321 ? 18.699  47.177  94.002  1.00 39.40 ? 318 LYS A CD    1 
ATOM   2421  C CE    . LYS A 1 321 ? 19.095  46.376  95.227  1.00 40.35 ? 318 LYS A CE    1 
ATOM   2422  N NZ    . LYS A 1 321 ? 20.413  46.812  95.769  1.00 40.62 ? 318 LYS A NZ    1 
ATOM   2423  N N     . VAL A 1 322 ? 13.695  46.428  93.004  1.00 34.22 ? 319 VAL A N     1 
ATOM   2424  C CA    . VAL A 1 322 ? 12.684  46.477  94.048  1.00 33.24 ? 319 VAL A CA    1 
ATOM   2425  C C     . VAL A 1 322 ? 12.866  45.356  95.065  1.00 32.46 ? 319 VAL A C     1 
ATOM   2426  O O     . VAL A 1 322 ? 12.977  44.181  94.700  1.00 32.18 ? 319 VAL A O     1 
ATOM   2427  C CB    . VAL A 1 322 ? 11.252  46.349  93.466  1.00 33.84 ? 319 VAL A CB    1 
ATOM   2428  C CG1   . VAL A 1 322 ? 10.230  46.497  94.586  1.00 32.37 ? 319 VAL A CG1   1 
ATOM   2429  C CG2   . VAL A 1 322 ? 11.021  47.392  92.382  1.00 34.10 ? 319 VAL A CG2   1 
ATOM   2430  N N     . ASN A 1 323 ? 12.901  45.729  96.341  1.00 30.62 ? 320 ASN A N     1 
ATOM   2431  C CA    . ASN A 1 323 ? 13.043  44.775  97.433  1.00 28.61 ? 320 ASN A CA    1 
ATOM   2432  C C     . ASN A 1 323 ? 11.651  44.298  97.814  1.00 29.35 ? 320 ASN A C     1 
ATOM   2433  O O     . ASN A 1 323 ? 10.837  45.074  98.309  1.00 30.86 ? 320 ASN A O     1 
ATOM   2434  C CB    . ASN A 1 323 ? 13.710  45.438  98.634  1.00 25.64 ? 320 ASN A CB    1 
ATOM   2435  C CG    . ASN A 1 323 ? 13.701  44.551  99.877  1.00 26.51 ? 320 ASN A CG    1 
ATOM   2436  O OD1   . ASN A 1 323 ? 12.911  44.762  100.796 1.00 25.84 ? 320 ASN A OD1   1 
ATOM   2437  N ND2   . ASN A 1 323 ? 14.574  43.552  99.904  1.00 21.40 ? 320 ASN A ND2   1 
ATOM   2438  N N     . ILE A 1 324 ? 11.373  43.025  97.560  1.00 29.45 ? 321 ILE A N     1 
ATOM   2439  C CA    . ILE A 1 324 ? 10.075  42.442  97.875  1.00 28.09 ? 321 ILE A CA    1 
ATOM   2440  C C     . ILE A 1 324 ? 9.944   42.266  99.375  1.00 28.60 ? 321 ILE A C     1 
ATOM   2441  O O     . ILE A 1 324 ? 8.913   42.607  99.968  1.00 27.09 ? 321 ILE A O     1 
ATOM   2442  C CB    . ILE A 1 324 ? 9.932   41.080  97.210  1.00 25.36 ? 321 ILE A CB    1 
ATOM   2443  C CG1   . ILE A 1 324 ? 10.355  41.193  95.748  1.00 24.55 ? 321 ILE A CG1   1 
ATOM   2444  C CG2   . ILE A 1 324 ? 8.517   40.582  97.348  1.00 26.19 ? 321 ILE A CG2   1 
ATOM   2445  C CD1   . ILE A 1 324 ? 9.767   42.398  95.030  1.00 19.94 ? 321 ILE A CD1   1 
ATOM   2446  N N     . LYS A 1 325 ? 11.010  41.730  99.968  1.00 29.33 ? 322 LYS A N     1 
ATOM   2447  C CA    . LYS A 1 325 ? 11.091  41.480  101.404 1.00 30.73 ? 322 LYS A CA    1 
ATOM   2448  C C     . LYS A 1 325 ? 12.532  41.135  101.754 1.00 32.74 ? 322 LYS A C     1 
ATOM   2449  O O     . LYS A 1 325 ? 13.351  40.908  100.864 1.00 35.19 ? 322 LYS A O     1 
ATOM   2450  C CB    . LYS A 1 325 ? 10.145  40.345  101.807 1.00 29.29 ? 322 LYS A CB    1 
ATOM   2451  C CG    . LYS A 1 325 ? 10.419  39.016  101.133 1.00 31.20 ? 322 LYS A CG    1 
ATOM   2452  C CD    . LYS A 1 325 ? 9.187   38.122  101.164 1.00 30.60 ? 322 LYS A CD    1 
ATOM   2453  C CE    . LYS A 1 325 ? 9.537   36.674  100.896 1.00 31.43 ? 322 LYS A CE    1 
ATOM   2454  N NZ    . LYS A 1 325 ? 10.223  36.073  102.068 1.00 31.23 ? 322 LYS A NZ    1 
ATOM   2455  N N     . PRO A 1 326 ? 12.871  41.113  103.050 1.00 34.30 ? 323 PRO A N     1 
ATOM   2456  C CA    . PRO A 1 326 ? 14.245  40.792  103.440 1.00 35.07 ? 323 PRO A CA    1 
ATOM   2457  C C     . PRO A 1 326 ? 14.886  39.679  102.609 1.00 35.25 ? 323 PRO A C     1 
ATOM   2458  O O     . PRO A 1 326 ? 14.285  38.627  102.372 1.00 35.80 ? 323 PRO A O     1 
ATOM   2459  C CB    . PRO A 1 326 ? 14.096  40.437  104.914 1.00 35.48 ? 323 PRO A CB    1 
ATOM   2460  C CG    . PRO A 1 326 ? 13.037  41.417  105.355 1.00 34.84 ? 323 PRO A CG    1 
ATOM   2461  C CD    . PRO A 1 326 ? 12.019  41.300  104.239 1.00 34.55 ? 323 PRO A CD    1 
ATOM   2462  N N     . GLN A 1 327 ? 16.105  39.939  102.152 1.00 33.76 ? 324 GLN A N     1 
ATOM   2463  C CA    . GLN A 1 327 ? 16.855  38.981  101.358 1.00 32.30 ? 324 GLN A CA    1 
ATOM   2464  C C     . GLN A 1 327 ? 16.218  38.585  100.021 1.00 31.50 ? 324 GLN A C     1 
ATOM   2465  O O     . GLN A 1 327 ? 16.611  37.582  99.417  1.00 30.70 ? 324 GLN A O     1 
ATOM   2466  C CB    . GLN A 1 327 ? 17.148  37.739  102.196 1.00 32.28 ? 324 GLN A CB    1 
ATOM   2467  C CG    . GLN A 1 327 ? 18.247  37.963  103.227 1.00 34.45 ? 324 GLN A CG    1 
ATOM   2468  C CD    . GLN A 1 327 ? 17.817  38.878  104.359 1.00 35.82 ? 324 GLN A CD    1 
ATOM   2469  O OE1   . GLN A 1 327 ? 16.853  38.580  105.080 1.00 37.02 ? 324 GLN A OE1   1 
ATOM   2470  N NE2   . GLN A 1 327 ? 18.523  39.995  104.525 1.00 33.49 ? 324 GLN A NE2   1 
ATOM   2471  N N     . VAL A 1 328 ? 15.251  39.374  99.554  1.00 28.72 ? 325 VAL A N     1 
ATOM   2472  C CA    . VAL A 1 328 ? 14.607  39.086  98.275  1.00 26.21 ? 325 VAL A CA    1 
ATOM   2473  C C     . VAL A 1 328 ? 14.433  40.328  97.397  1.00 25.99 ? 325 VAL A C     1 
ATOM   2474  O O     . VAL A 1 328 ? 13.492  41.108  97.555  1.00 24.96 ? 325 VAL A O     1 
ATOM   2475  C CB    . VAL A 1 328 ? 13.235  38.420  98.473  1.00 25.19 ? 325 VAL A CB    1 
ATOM   2476  C CG1   . VAL A 1 328 ? 12.602  38.133  97.117  1.00 21.24 ? 325 VAL A CG1   1 
ATOM   2477  C CG2   . VAL A 1 328 ? 13.401  37.130  99.275  1.00 25.02 ? 325 VAL A CG2   1 
ATOM   2478  N N     . ASP A 1 329 ? 15.345  40.494  96.451  1.00 25.45 ? 326 ASP A N     1 
ATOM   2479  C CA    . ASP A 1 329 ? 15.316  41.636  95.553  1.00 28.41 ? 326 ASP A CA    1 
ATOM   2480  C C     . ASP A 1 329 ? 14.978  41.244  94.114  1.00 29.74 ? 326 ASP A C     1 
ATOM   2481  O O     . ASP A 1 329 ? 15.393  40.189  93.626  1.00 30.78 ? 326 ASP A O     1 
ATOM   2482  C CB    . ASP A 1 329 ? 16.665  42.344  95.616  1.00 28.95 ? 326 ASP A CB    1 
ATOM   2483  C CG    . ASP A 1 329 ? 16.919  42.953  96.969  1.00 30.41 ? 326 ASP A CG    1 
ATOM   2484  O OD1   . ASP A 1 329 ? 18.090  43.074  97.378  1.00 31.49 ? 326 ASP A OD1   1 
ATOM   2485  O OD2   . ASP A 1 329 ? 15.928  43.325  97.620  1.00 33.46 ? 326 ASP A OD2   1 
ATOM   2486  N N     . ARG A 1 330 ? 14.209  42.090  93.441  1.00 30.26 ? 327 ARG A N     1 
ATOM   2487  C CA    . ARG A 1 330 ? 13.820  41.837  92.064  1.00 30.51 ? 327 ARG A CA    1 
ATOM   2488  C C     . ARG A 1 330 ? 14.336  42.969  91.208  1.00 31.03 ? 327 ARG A C     1 
ATOM   2489  O O     . ARG A 1 330 ? 14.013  44.133  91.442  1.00 31.15 ? 327 ARG A O     1 
ATOM   2490  C CB    . ARG A 1 330 ? 12.295  41.770  91.939  1.00 31.09 ? 327 ARG A CB    1 
ATOM   2491  C CG    . ARG A 1 330 ? 11.801  41.162  90.639  1.00 29.90 ? 327 ARG A CG    1 
ATOM   2492  C CD    . ARG A 1 330 ? 10.302  41.199  90.576  1.00 30.05 ? 327 ARG A CD    1 
ATOM   2493  N NE    . ARG A 1 330 ? 9.790   40.468  89.425  1.00 31.19 ? 327 ARG A NE    1 
ATOM   2494  C CZ    . ARG A 1 330 ? 8.574   40.633  88.915  1.00 32.61 ? 327 ARG A CZ    1 
ATOM   2495  N NH1   . ARG A 1 330 ? 7.738   41.514  89.456  1.00 32.75 ? 327 ARG A NH1   1 
ATOM   2496  N NH2   . ARG A 1 330 ? 8.194   39.918  87.860  1.00 32.35 ? 327 ARG A NH2   1 
ATOM   2497  N N     . TYR A 1 331 ? 15.140  42.626  90.212  1.00 32.51 ? 328 TYR A N     1 
ATOM   2498  C CA    . TYR A 1 331 ? 15.704  43.627  89.316  1.00 32.29 ? 328 TYR A CA    1 
ATOM   2499  C C     . TYR A 1 331 ? 15.023  43.588  87.964  1.00 32.31 ? 328 TYR A C     1 
ATOM   2500  O O     . TYR A 1 331 ? 14.308  42.642  87.648  1.00 33.42 ? 328 TYR A O     1 
ATOM   2501  C CB    . TYR A 1 331 ? 17.194  43.369  89.067  1.00 32.31 ? 328 TYR A CB    1 
ATOM   2502  C CG    . TYR A 1 331 ? 18.074  43.394  90.285  1.00 32.36 ? 328 TYR A CG    1 
ATOM   2503  C CD1   . TYR A 1 331 ? 18.134  42.302  91.162  1.00 32.35 ? 328 TYR A CD1   1 
ATOM   2504  C CD2   . TYR A 1 331 ? 18.887  44.496  90.540  1.00 33.02 ? 328 TYR A CD2   1 
ATOM   2505  C CE1   . TYR A 1 331 ? 19.000  42.313  92.265  1.00 31.81 ? 328 TYR A CE1   1 
ATOM   2506  C CE2   . TYR A 1 331 ? 19.747  44.520  91.631  1.00 33.26 ? 328 TYR A CE2   1 
ATOM   2507  C CZ    . TYR A 1 331 ? 19.802  43.430  92.486  1.00 31.81 ? 328 TYR A CZ    1 
ATOM   2508  O OH    . TYR A 1 331 ? 20.662  43.479  93.548  1.00 29.88 ? 328 TYR A OH    1 
ATOM   2509  N N     . ARG A 1 332 ? 15.265  44.631  87.177  1.00 31.11 ? 329 ARG A N     1 
ATOM   2510  C CA    . ARG A 1 332 ? 14.753  44.740  85.827  1.00 31.16 ? 329 ARG A CA    1 
ATOM   2511  C C     . ARG A 1 332 ? 15.892  45.322  84.998  1.00 30.88 ? 329 ARG A C     1 
ATOM   2512  O O     . ARG A 1 332 ? 16.339  46.446  85.240  1.00 30.21 ? 329 ARG A O     1 
ATOM   2513  C CB    . ARG A 1 332 ? 13.532  45.646  85.772  1.00 33.18 ? 329 ARG A CB    1 
ATOM   2514  C CG    . ARG A 1 332 ? 13.206  46.179  84.380  1.00 34.22 ? 329 ARG A CG    1 
ATOM   2515  C CD    . ARG A 1 332 ? 11.760  46.637  84.284  1.00 35.77 ? 329 ARG A CD    1 
ATOM   2516  N NE    . ARG A 1 332 ? 10.903  45.502  83.976  1.00 41.18 ? 329 ARG A NE    1 
ATOM   2517  C CZ    . ARG A 1 332 ? 9.576   45.503  84.047  1.00 41.73 ? 329 ARG A CZ    1 
ATOM   2518  N NH1   . ARG A 1 332 ? 8.923   46.593  84.423  1.00 43.21 ? 329 ARG A NH1   1 
ATOM   2519  N NH2   . ARG A 1 332 ? 8.900   44.406  83.735  1.00 41.85 ? 329 ARG A NH2   1 
ATOM   2520  N N     . LEU A 1 333 ? 16.369  44.539  84.033  1.00 29.31 ? 330 LEU A N     1 
ATOM   2521  C CA    . LEU A 1 333 ? 17.471  44.958  83.183  1.00 30.17 ? 330 LEU A CA    1 
ATOM   2522  C C     . LEU A 1 333 ? 17.003  45.870  82.063  1.00 30.83 ? 330 LEU A C     1 
ATOM   2523  O O     . LEU A 1 333 ? 15.810  46.114  81.900  1.00 30.75 ? 330 LEU A O     1 
ATOM   2524  C CB    . LEU A 1 333 ? 18.175  43.738  82.592  1.00 27.49 ? 330 LEU A CB    1 
ATOM   2525  C CG    . LEU A 1 333 ? 18.390  42.613  83.606  1.00 27.35 ? 330 LEU A CG    1 
ATOM   2526  C CD1   . LEU A 1 333 ? 19.239  41.531  82.989  1.00 26.21 ? 330 LEU A CD1   1 
ATOM   2527  C CD2   . LEU A 1 333 ? 19.052  43.166  84.860  1.00 27.62 ? 330 LEU A CD2   1 
ATOM   2528  N N     . LYS A 1 334 ? 17.957  46.366  81.287  1.00 31.73 ? 331 LYS A N     1 
ATOM   2529  C CA    . LYS A 1 334 ? 17.636  47.242  80.183  1.00 32.38 ? 331 LYS A CA    1 
ATOM   2530  C C     . LYS A 1 334 ? 16.886  46.491  79.082  1.00 32.17 ? 331 LYS A C     1 
ATOM   2531  O O     . LYS A 1 334 ? 16.141  47.101  78.312  1.00 31.14 ? 331 LYS A O     1 
ATOM   2532  C CB    . LYS A 1 334 ? 18.912  47.879  79.654  1.00 32.53 ? 331 LYS A CB    1 
ATOM   2533  C CG    . LYS A 1 334 ? 19.536  48.835  80.646  1.00 37.15 ? 331 LYS A CG    1 
ATOM   2534  C CD    . LYS A 1 334 ? 20.956  49.225  80.245  1.00 41.20 ? 331 LYS A CD    1 
ATOM   2535  C CE    . LYS A 1 334 ? 21.564  50.211  81.236  1.00 42.41 ? 331 LYS A CE    1 
ATOM   2536  N NZ    . LYS A 1 334 ? 23.020  50.407  80.984  1.00 44.97 ? 331 LYS A NZ    1 
ATOM   2537  N N     . ASN A 1 335 ? 17.066  45.168  79.028  1.00 32.65 ? 332 ASN A N     1 
ATOM   2538  C CA    . ASN A 1 335 ? 16.383  44.349  78.022  1.00 32.35 ? 332 ASN A CA    1 
ATOM   2539  C C     . ASN A 1 335 ? 14.897  44.175  78.368  1.00 31.79 ? 332 ASN A C     1 
ATOM   2540  O O     . ASN A 1 335 ? 14.158  43.503  77.647  1.00 31.33 ? 332 ASN A O     1 
ATOM   2541  C CB    . ASN A 1 335 ? 17.052  42.972  77.866  1.00 32.69 ? 332 ASN A CB    1 
ATOM   2542  C CG    . ASN A 1 335 ? 17.129  42.195  79.174  1.00 35.01 ? 332 ASN A CG    1 
ATOM   2543  O OD1   . ASN A 1 335 ? 16.427  42.508  80.140  1.00 37.28 ? 332 ASN A OD1   1 
ATOM   2544  N ND2   . ASN A 1 335 ? 17.978  41.164  79.205  1.00 33.88 ? 332 ASN A ND2   1 
ATOM   2545  N N     . GLY A 1 336 ? 14.471  44.781  79.475  1.00 30.45 ? 333 GLY A N     1 
ATOM   2546  C CA    . GLY A 1 336 ? 13.076  44.693  79.871  1.00 29.97 ? 333 GLY A CA    1 
ATOM   2547  C C     . GLY A 1 336 ? 12.714  43.500  80.735  1.00 30.42 ? 333 GLY A C     1 
ATOM   2548  O O     . GLY A 1 336 ? 11.621  43.460  81.301  1.00 29.05 ? 333 GLY A O     1 
ATOM   2549  N N     . ARG A 1 337 ? 13.630  42.539  80.852  1.00 31.10 ? 334 ARG A N     1 
ATOM   2550  C CA    . ARG A 1 337 ? 13.379  41.339  81.648  1.00 31.52 ? 334 ARG A CA    1 
ATOM   2551  C C     . ARG A 1 337 ? 13.758  41.473  83.125  1.00 31.63 ? 334 ARG A C     1 
ATOM   2552  O O     . ARG A 1 337 ? 14.647  42.242  83.494  1.00 32.47 ? 334 ARG A O     1 
ATOM   2553  C CB    . ARG A 1 337 ? 14.071  40.142  80.990  1.00 30.88 ? 334 ARG A CB    1 
ATOM   2554  C CG    . ARG A 1 337 ? 13.530  39.874  79.559  1.00 33.37 ? 334 ARG A CG    1 
ATOM   2555  C CD    . ARG A 1 337 ? 13.744  38.436  79.072  1.00 32.42 ? 334 ARG A CD    1 
ATOM   2556  N NE    . ARG A 1 337 ? 15.151  38.053  79.135  1.00 37.01 ? 334 ARG A NE    1 
ATOM   2557  C CZ    . ARG A 1 337 ? 16.107  38.542  78.350  1.00 37.70 ? 334 ARG A CZ    1 
ATOM   2558  N NH1   . ARG A 1 337 ? 15.807  39.440  77.413  1.00 38.73 ? 334 ARG A NH1   1 
ATOM   2559  N NH2   . ARG A 1 337 ? 17.367  38.155  78.528  1.00 35.88 ? 334 ARG A NH2   1 
ATOM   2560  N N     . ARG A 1 338 ? 13.068  40.738  83.986  1.00 31.45 ? 335 ARG A N     1 
ATOM   2561  C CA    . ARG A 1 338 ? 13.360  40.826  85.409  1.00 30.67 ? 335 ARG A CA    1 
ATOM   2562  C C     . ARG A 1 338 ? 14.169  39.660  85.952  1.00 29.19 ? 335 ARG A C     1 
ATOM   2563  O O     . ARG A 1 338 ? 14.203  38.590  85.342  1.00 28.38 ? 335 ARG A O     1 
ATOM   2564  C CB    . ARG A 1 338 ? 12.054  40.990  86.184  1.00 31.69 ? 335 ARG A CB    1 
ATOM   2565  C CG    . ARG A 1 338 ? 11.450  42.389  86.007  1.00 33.29 ? 335 ARG A CG    1 
ATOM   2566  C CD    . ARG A 1 338 ? 9.940   42.352  86.111  1.00 33.70 ? 335 ARG A CD    1 
ATOM   2567  N NE    . ARG A 1 338 ? 9.382   41.553  85.031  1.00 32.84 ? 335 ARG A NE    1 
ATOM   2568  C CZ    . ARG A 1 338 ? 8.088   41.319  84.859  1.00 32.36 ? 335 ARG A CZ    1 
ATOM   2569  N NH1   . ARG A 1 338 ? 7.196   41.827  85.700  1.00 32.50 ? 335 ARG A NH1   1 
ATOM   2570  N NH2   . ARG A 1 338 ? 7.691   40.565  83.847  1.00 31.14 ? 335 ARG A NH2   1 
ATOM   2571  N N     . ILE A 1 339 ? 14.840  39.897  87.084  1.00 28.50 ? 336 ILE A N     1 
ATOM   2572  C CA    . ILE A 1 339 ? 15.657  38.886  87.758  1.00 27.21 ? 336 ILE A CA    1 
ATOM   2573  C C     . ILE A 1 339 ? 15.538  38.908  89.287  1.00 26.68 ? 336 ILE A C     1 
ATOM   2574  O O     . ILE A 1 339 ? 15.791  39.930  89.935  1.00 27.46 ? 336 ILE A O     1 
ATOM   2575  C CB    . ILE A 1 339 ? 17.135  39.027  87.376  1.00 26.80 ? 336 ILE A CB    1 
ATOM   2576  C CG1   . ILE A 1 339 ? 17.311  38.622  85.911  1.00 25.93 ? 336 ILE A CG1   1 
ATOM   2577  C CG2   . ILE A 1 339 ? 17.995  38.116  88.284  1.00 28.12 ? 336 ILE A CG2   1 
ATOM   2578  C CD1   . ILE A 1 339 ? 18.689  38.826  85.358  1.00 24.80 ? 336 ILE A CD1   1 
ATOM   2579  N N     . ILE A 1 340 ? 15.163  37.767  89.860  1.00 25.38 ? 337 ILE A N     1 
ATOM   2580  C CA    . ILE A 1 340 ? 15.003  37.644  91.313  1.00 23.54 ? 337 ILE A CA    1 
ATOM   2581  C C     . ILE A 1 340 ? 16.262  37.137  92.013  1.00 22.70 ? 337 ILE A C     1 
ATOM   2582  O O     . ILE A 1 340 ? 16.635  35.971  91.881  1.00 22.90 ? 337 ILE A O     1 
ATOM   2583  C CB    . ILE A 1 340 ? 13.813  36.706  91.654  1.00 22.43 ? 337 ILE A CB    1 
ATOM   2584  C CG1   . ILE A 1 340 ? 12.510  37.330  91.150  1.00 21.19 ? 337 ILE A CG1   1 
ATOM   2585  C CG2   . ILE A 1 340 ? 13.719  36.502  93.162  1.00 23.99 ? 337 ILE A CG2   1 
ATOM   2586  C CD1   . ILE A 1 340 ? 11.302  36.413  91.229  1.00 20.36 ? 337 ILE A CD1   1 
ATOM   2587  N N     . LEU A 1 341 ? 16.899  38.026  92.771  1.00 22.79 ? 338 LEU A N     1 
ATOM   2588  C CA    . LEU A 1 341 ? 18.125  37.715  93.504  1.00 22.59 ? 338 LEU A CA    1 
ATOM   2589  C C     . LEU A 1 341 ? 17.786  37.406  94.958  1.00 22.42 ? 338 LEU A C     1 
ATOM   2590  O O     . LEU A 1 341 ? 16.979  38.092  95.566  1.00 21.30 ? 338 LEU A O     1 
ATOM   2591  C CB    . LEU A 1 341 ? 19.084  38.919  93.448  1.00 23.93 ? 338 LEU A CB    1 
ATOM   2592  C CG    . LEU A 1 341 ? 20.597  38.787  93.660  1.00 24.69 ? 338 LEU A CG    1 
ATOM   2593  C CD1   . LEU A 1 341 ? 20.905  38.217  95.034  1.00 26.38 ? 338 LEU A CD1   1 
ATOM   2594  C CD2   . LEU A 1 341 ? 21.171  37.886  92.576  1.00 27.65 ? 338 LEU A CD2   1 
ATOM   2595  N N     . LEU A 1 342 ? 18.426  36.386  95.519  1.00 24.04 ? 339 LEU A N     1 
ATOM   2596  C CA    . LEU A 1 342 ? 18.173  36.001  96.906  1.00 24.15 ? 339 LEU A CA    1 
ATOM   2597  C C     . LEU A 1 342 ? 19.379  36.186  97.838  1.00 24.32 ? 339 LEU A C     1 
ATOM   2598  O O     . LEU A 1 342 ? 20.514  35.876  97.474  1.00 24.10 ? 339 LEU A O     1 
ATOM   2599  C CB    . LEU A 1 342 ? 17.700  34.550  96.957  1.00 22.24 ? 339 LEU A CB    1 
ATOM   2600  C CG    . LEU A 1 342 ? 16.602  34.176  95.952  1.00 21.38 ? 339 LEU A CG    1 
ATOM   2601  C CD1   . LEU A 1 342 ? 16.154  32.758  96.273  1.00 18.61 ? 339 LEU A CD1   1 
ATOM   2602  C CD2   . LEU A 1 342 ? 15.426  35.156  95.995  1.00 16.47 ? 339 LEU A CD2   1 
ATOM   2603  N N     . ALA A 1 343 ? 19.109  36.703  99.037  1.00 25.44 ? 340 ALA A N     1 
ATOM   2604  C CA    . ALA A 1 343 ? 20.125  36.953  100.062 1.00 26.17 ? 340 ALA A CA    1 
ATOM   2605  C C     . ALA A 1 343 ? 21.338  37.743  99.573  1.00 28.01 ? 340 ALA A C     1 
ATOM   2606  O O     . ALA A 1 343 ? 22.406  37.697  100.193 1.00 29.25 ? 340 ALA A O     1 
ATOM   2607  C CB    . ALA A 1 343 ? 20.581  35.638  100.677 1.00 27.51 ? 340 ALA A CB    1 
ATOM   2608  N N     . GLU A 1 344 ? 21.166  38.473  98.474  1.00 29.83 ? 341 GLU A N     1 
ATOM   2609  C CA    . GLU A 1 344 ? 22.233  39.278  97.889  1.00 31.69 ? 341 GLU A CA    1 
ATOM   2610  C C     . GLU A 1 344 ? 23.446  38.432  97.563  1.00 31.89 ? 341 GLU A C     1 
ATOM   2611  O O     . GLU A 1 344 ? 24.583  38.903  97.623  1.00 31.51 ? 341 GLU A O     1 
ATOM   2612  C CB    . GLU A 1 344 ? 22.641  40.413  98.840  1.00 34.41 ? 341 GLU A CB    1 
ATOM   2613  C CG    . GLU A 1 344 ? 21.532  41.421  99.109  1.00 38.18 ? 341 GLU A CG    1 
ATOM   2614  C CD    . GLU A 1 344 ? 21.954  42.534  100.060 1.00 42.46 ? 341 GLU A CD    1 
ATOM   2615  O OE1   . GLU A 1 344 ? 22.885  43.298  99.720  1.00 42.97 ? 341 GLU A OE1   1 
ATOM   2616  O OE2   . GLU A 1 344 ? 21.345  42.645  101.152 1.00 45.43 ? 341 GLU A OE2   1 
ATOM   2617  N N     . GLY A 1 345 ? 23.218  37.173  97.221  1.00 31.97 ? 342 GLY A N     1 
ATOM   2618  C CA    . GLY A 1 345 ? 24.346  36.329  96.888  1.00 31.73 ? 342 GLY A CA    1 
ATOM   2619  C C     . GLY A 1 345 ? 24.889  35.486  98.024  1.00 30.70 ? 342 GLY A C     1 
ATOM   2620  O O     . GLY A 1 345 ? 25.696  34.598  97.772  1.00 32.12 ? 342 GLY A O     1 
ATOM   2621  N N     . ARG A 1 346 ? 24.480  35.744  99.264  1.00 30.84 ? 343 ARG A N     1 
ATOM   2622  C CA    . ARG A 1 346 ? 24.960  34.934  100.387 1.00 30.69 ? 343 ARG A CA    1 
ATOM   2623  C C     . ARG A 1 346 ? 24.236  33.589  100.391 1.00 30.69 ? 343 ARG A C     1 
ATOM   2624  O O     . ARG A 1 346 ? 23.126  33.480  99.860  1.00 31.54 ? 343 ARG A O     1 
ATOM   2625  C CB    . ARG A 1 346 ? 24.720  35.641  101.723 1.00 31.25 ? 343 ARG A CB    1 
ATOM   2626  C CG    . ARG A 1 346 ? 25.711  36.737  102.039 1.00 32.67 ? 343 ARG A CG    1 
ATOM   2627  C CD    . ARG A 1 346 ? 25.588  37.894  101.069 1.00 34.85 ? 343 ARG A CD    1 
ATOM   2628  N NE    . ARG A 1 346 ? 26.476  38.990  101.441 1.00 36.25 ? 343 ARG A NE    1 
ATOM   2629  C CZ    . ARG A 1 346 ? 26.505  40.167  100.827 1.00 35.78 ? 343 ARG A CZ    1 
ATOM   2630  N NH1   . ARG A 1 346 ? 25.692  40.405  99.809  1.00 35.31 ? 343 ARG A NH1   1 
ATOM   2631  N NH2   . ARG A 1 346 ? 27.346  41.107  101.231 1.00 36.24 ? 343 ARG A NH2   1 
ATOM   2632  N N     . LEU A 1 347 ? 24.861  32.575  100.992 1.00 28.52 ? 344 LEU A N     1 
ATOM   2633  C CA    . LEU A 1 347 ? 24.287  31.232  101.062 1.00 25.74 ? 344 LEU A CA    1 
ATOM   2634  C C     . LEU A 1 347 ? 22.803  31.302  101.379 1.00 24.65 ? 344 LEU A C     1 
ATOM   2635  O O     . LEU A 1 347 ? 22.401  31.702  102.479 1.00 26.16 ? 344 LEU A O     1 
ATOM   2636  C CB    . LEU A 1 347 ? 25.037  30.375  102.090 1.00 26.28 ? 344 LEU A CB    1 
ATOM   2637  C CG    . LEU A 1 347 ? 24.981  30.616  103.603 1.00 25.32 ? 344 LEU A CG    1 
ATOM   2638  C CD1   . LEU A 1 347 ? 25.706  29.489  104.288 1.00 23.87 ? 344 LEU A CD1   1 
ATOM   2639  C CD2   . LEU A 1 347 ? 25.603  31.937  103.980 1.00 26.35 ? 344 LEU A CD2   1 
ATOM   2640  N N     . VAL A 1 348 ? 21.999  30.898  100.395 1.00 23.54 ? 345 VAL A N     1 
ATOM   2641  C CA    . VAL A 1 348 ? 20.543  30.944  100.464 1.00 21.43 ? 345 VAL A CA    1 
ATOM   2642  C C     . VAL A 1 348 ? 19.862  29.993  101.437 1.00 21.62 ? 345 VAL A C     1 
ATOM   2643  O O     . VAL A 1 348 ? 18.782  30.301  101.946 1.00 22.24 ? 345 VAL A O     1 
ATOM   2644  C CB    . VAL A 1 348 ? 19.914  30.747  99.032  1.00 20.15 ? 345 VAL A CB    1 
ATOM   2645  C CG1   . VAL A 1 348 ? 20.006  29.300  98.593  1.00 20.50 ? 345 VAL A CG1   1 
ATOM   2646  C CG2   . VAL A 1 348 ? 18.481  31.230  99.020  1.00 16.93 ? 345 VAL A CG2   1 
ATOM   2647  N N     . ASN A 1 349 ? 20.462  28.843  101.716 1.00 22.20 ? 346 ASN A N     1 
ATOM   2648  C CA    . ASN A 1 349 ? 19.820  27.919  102.648 1.00 24.00 ? 346 ASN A CA    1 
ATOM   2649  C C     . ASN A 1 349 ? 19.723  28.514  104.059 1.00 25.63 ? 346 ASN A C     1 
ATOM   2650  O O     . ASN A 1 349 ? 18.747  28.274  104.775 1.00 24.86 ? 346 ASN A O     1 
ATOM   2651  C CB    . ASN A 1 349 ? 20.562  26.585  102.681 1.00 25.50 ? 346 ASN A CB    1 
ATOM   2652  C CG    . ASN A 1 349 ? 21.961  26.709  103.228 1.00 28.92 ? 346 ASN A CG    1 
ATOM   2653  O OD1   . ASN A 1 349 ? 22.384  25.881  104.034 1.00 30.88 ? 346 ASN A OD1   1 
ATOM   2654  N ND2   . ASN A 1 349 ? 22.697  27.739  102.789 1.00 28.42 ? 346 ASN A ND2   1 
ATOM   2655  N N     . LEU A 1 350 ? 20.725  29.300  104.449 1.00 26.31 ? 347 LEU A N     1 
ATOM   2656  C CA    . LEU A 1 350 ? 20.730  29.947  105.760 1.00 26.04 ? 347 LEU A CA    1 
ATOM   2657  C C     . LEU A 1 350 ? 20.216  31.376  105.639 1.00 26.95 ? 347 LEU A C     1 
ATOM   2658  O O     . LEU A 1 350 ? 19.589  31.899  106.568 1.00 27.31 ? 347 LEU A O     1 
ATOM   2659  C CB    . LEU A 1 350 ? 22.150  29.969  106.352 1.00 24.52 ? 347 LEU A CB    1 
ATOM   2660  C CG    . LEU A 1 350 ? 22.584  28.691  107.068 1.00 25.03 ? 347 LEU A CG    1 
ATOM   2661  C CD1   . LEU A 1 350 ? 24.083  28.637  107.116 1.00 23.05 ? 347 LEU A CD1   1 
ATOM   2662  C CD2   . LEU A 1 350 ? 21.976  28.646  108.478 1.00 22.47 ? 347 LEU A CD2   1 
ATOM   2663  N N     . GLY A 1 351 ? 20.485  32.003  104.494 1.00 25.57 ? 348 GLY A N     1 
ATOM   2664  C CA    . GLY A 1 351 ? 20.060  33.377  104.282 1.00 24.58 ? 348 GLY A CA    1 
ATOM   2665  C C     . GLY A 1 351 ? 18.567  33.587  104.159 1.00 24.74 ? 348 GLY A C     1 
ATOM   2666  O O     . GLY A 1 351 ? 18.042  34.625  104.562 1.00 25.28 ? 348 GLY A O     1 
ATOM   2667  N N     . CYS A 1 352 ? 17.883  32.601  103.594 1.00 24.98 ? 349 CYS A N     1 
ATOM   2668  C CA    . CYS A 1 352 ? 16.444  32.686  103.397 1.00 24.21 ? 349 CYS A CA    1 
ATOM   2669  C C     . CYS A 1 352 ? 15.702  31.549  104.075 1.00 24.98 ? 349 CYS A C     1 
ATOM   2670  O O     . CYS A 1 352 ? 14.557  31.267  103.727 1.00 25.49 ? 349 CYS A O     1 
ATOM   2671  C CB    . CYS A 1 352 ? 16.119  32.642  101.898 1.00 24.23 ? 349 CYS A CB    1 
ATOM   2672  S SG    . CYS A 1 352 ? 16.728  34.024  100.933 1.00 26.04 ? 349 CYS A SG    1 
ATOM   2673  N N     . ALA A 1 353 ? 16.334  30.884  105.032 1.00 25.75 ? 350 ALA A N     1 
ATOM   2674  C CA    . ALA A 1 353 ? 15.665  29.780  105.709 1.00 26.59 ? 350 ALA A CA    1 
ATOM   2675  C C     . ALA A 1 353 ? 16.337  29.453  107.041 1.00 26.74 ? 350 ALA A C     1 
ATOM   2676  O O     . ALA A 1 353 ? 16.884  30.337  107.691 1.00 26.73 ? 350 ALA A O     1 
ATOM   2677  C CB    . ALA A 1 353 ? 15.646  28.550  104.798 1.00 28.22 ? 350 ALA A CB    1 
ATOM   2678  N N     . MET A 1 354 ? 16.298  28.189  107.443 1.00 26.31 ? 351 MET A N     1 
ATOM   2679  C CA    . MET A 1 354 ? 16.894  27.787  108.710 1.00 27.08 ? 351 MET A CA    1 
ATOM   2680  C C     . MET A 1 354 ? 18.083  26.849  108.543 1.00 25.46 ? 351 MET A C     1 
ATOM   2681  O O     . MET A 1 354 ? 18.439  26.117  109.469 1.00 23.64 ? 351 MET A O     1 
ATOM   2682  C CB    . MET A 1 354 ? 15.831  27.112  109.574 1.00 28.37 ? 351 MET A CB    1 
ATOM   2683  C CG    . MET A 1 354 ? 14.596  27.965  109.773 1.00 31.16 ? 351 MET A CG    1 
ATOM   2684  S SD    . MET A 1 354 ? 15.003  29.442  110.693 1.00 34.42 ? 351 MET A SD    1 
ATOM   2685  C CE    . MET A 1 354 ? 14.957  28.823  112.422 1.00 34.14 ? 351 MET A CE    1 
ATOM   2686  N N     . GLY A 1 355 ? 18.702  26.878  107.369 1.00 24.29 ? 352 GLY A N     1 
ATOM   2687  C CA    . GLY A 1 355 ? 19.833  25.997  107.135 1.00 25.33 ? 352 GLY A CA    1 
ATOM   2688  C C     . GLY A 1 355 ? 19.374  24.547  107.134 1.00 24.24 ? 352 GLY A C     1 
ATOM   2689  O O     . GLY A 1 355 ? 18.174  24.276  107.006 1.00 23.20 ? 352 GLY A O     1 
ATOM   2690  N N     . HIS A 1 356 ? 20.324  23.624  107.276 1.00 23.03 ? 353 HIS A N     1 
ATOM   2691  C CA    . HIS A 1 356 ? 20.020  22.190  107.296 1.00 25.77 ? 353 HIS A CA    1 
ATOM   2692  C C     . HIS A 1 356 ? 19.261  21.812  108.574 1.00 25.75 ? 353 HIS A C     1 
ATOM   2693  O O     . HIS A 1 356 ? 19.408  22.451  109.613 1.00 22.70 ? 353 HIS A O     1 
ATOM   2694  C CB    . HIS A 1 356 ? 21.307  21.355  107.239 1.00 25.78 ? 353 HIS A CB    1 
ATOM   2695  C CG    . HIS A 1 356 ? 22.160  21.624  106.042 1.00 24.22 ? 353 HIS A CG    1 
ATOM   2696  N ND1   . HIS A 1 356 ? 23.463  21.190  105.954 1.00 25.09 ? 353 HIS A ND1   1 
ATOM   2697  C CD2   . HIS A 1 356 ? 21.903  22.282  104.889 1.00 26.54 ? 353 HIS A CD2   1 
ATOM   2698  C CE1   . HIS A 1 356 ? 23.976  21.571  104.797 1.00 26.79 ? 353 HIS A CE1   1 
ATOM   2699  N NE2   . HIS A 1 356 ? 23.049  22.236  104.133 1.00 27.99 ? 353 HIS A NE2   1 
ATOM   2700  N N     . PRO A 1 357 ? 18.425  20.773  108.499 1.00 26.55 ? 354 PRO A N     1 
ATOM   2701  C CA    . PRO A 1 357 ? 17.664  20.339  109.675 1.00 27.92 ? 354 PRO A CA    1 
ATOM   2702  C C     . PRO A 1 357 ? 18.609  19.971  110.821 1.00 28.93 ? 354 PRO A C     1 
ATOM   2703  O O     . PRO A 1 357 ? 19.811  19.789  110.623 1.00 30.32 ? 354 PRO A O     1 
ATOM   2704  C CB    . PRO A 1 357 ? 16.886  19.129  109.158 1.00 28.82 ? 354 PRO A CB    1 
ATOM   2705  C CG    . PRO A 1 357 ? 16.658  19.479  107.709 1.00 28.35 ? 354 PRO A CG    1 
ATOM   2706  C CD    . PRO A 1 357 ? 17.998  20.054  107.285 1.00 26.60 ? 354 PRO A CD    1 
ATOM   2707  N N     . SER A 1 358 ? 18.065  19.853  112.024 1.00 31.03 ? 355 SER A N     1 
ATOM   2708  C CA    . SER A 1 358 ? 18.869  19.521  113.190 1.00 31.09 ? 355 SER A CA    1 
ATOM   2709  C C     . SER A 1 358 ? 19.513  18.123  113.152 1.00 31.07 ? 355 SER A C     1 
ATOM   2710  O O     . SER A 1 358 ? 20.641  17.950  113.633 1.00 29.24 ? 355 SER A O     1 
ATOM   2711  C CB    . SER A 1 358 ? 18.015  19.662  114.448 1.00 32.62 ? 355 SER A CB    1 
ATOM   2712  O OG    . SER A 1 358 ? 16.900  18.796  114.378 1.00 35.80 ? 355 SER A OG    1 
ATOM   2713  N N     . PHE A 1 359 ? 18.816  17.136  112.583 1.00 29.47 ? 356 PHE A N     1 
ATOM   2714  C CA    . PHE A 1 359 ? 19.351  15.771  112.525 1.00 30.73 ? 356 PHE A CA    1 
ATOM   2715  C C     . PHE A 1 359 ? 20.733  15.655  111.871 1.00 30.44 ? 356 PHE A C     1 
ATOM   2716  O O     . PHE A 1 359 ? 21.713  15.268  112.527 1.00 30.51 ? 356 PHE A O     1 
ATOM   2717  C CB    . PHE A 1 359 ? 18.378  14.816  111.808 1.00 31.95 ? 356 PHE A CB    1 
ATOM   2718  C CG    . PHE A 1 359 ? 18.762  13.355  111.931 1.00 31.96 ? 356 PHE A CG    1 
ATOM   2719  C CD1   . PHE A 1 359 ? 18.622  12.684  113.146 1.00 33.21 ? 356 PHE A CD1   1 
ATOM   2720  C CD2   . PHE A 1 359 ? 19.308  12.668  110.852 1.00 31.10 ? 356 PHE A CD2   1 
ATOM   2721  C CE1   . PHE A 1 359 ? 19.026  11.349  113.281 1.00 31.90 ? 356 PHE A CE1   1 
ATOM   2722  C CE2   . PHE A 1 359 ? 19.717  11.332  110.981 1.00 31.77 ? 356 PHE A CE2   1 
ATOM   2723  C CZ    . PHE A 1 359 ? 19.574  10.675  112.199 1.00 30.59 ? 356 PHE A CZ    1 
ATOM   2724  N N     . VAL A 1 360 ? 20.829  15.998  110.590 1.00 28.52 ? 357 VAL A N     1 
ATOM   2725  C CA    . VAL A 1 360 ? 22.109  15.882  109.903 1.00 27.70 ? 357 VAL A CA    1 
ATOM   2726  C C     . VAL A 1 360 ? 23.188  16.780  110.536 1.00 27.73 ? 357 VAL A C     1 
ATOM   2727  O O     . VAL A 1 360 ? 24.359  16.400  110.594 1.00 27.67 ? 357 VAL A O     1 
ATOM   2728  C CB    . VAL A 1 360 ? 21.946  16.180  108.381 1.00 26.36 ? 357 VAL A CB    1 
ATOM   2729  C CG1   . VAL A 1 360 ? 21.631  17.655  108.167 1.00 26.58 ? 357 VAL A CG1   1 
ATOM   2730  C CG2   . VAL A 1 360 ? 23.188  15.753  107.621 1.00 22.87 ? 357 VAL A CG2   1 
ATOM   2731  N N     . MET A 1 361 ? 22.800  17.954  111.030 1.00 27.33 ? 358 MET A N     1 
ATOM   2732  C CA    . MET A 1 361 ? 23.771  18.857  111.646 1.00 29.07 ? 358 MET A CA    1 
ATOM   2733  C C     . MET A 1 361 ? 24.452  18.218  112.849 1.00 30.01 ? 358 MET A C     1 
ATOM   2734  O O     . MET A 1 361 ? 25.584  18.567  113.194 1.00 29.82 ? 358 MET A O     1 
ATOM   2735  C CB    . MET A 1 361 ? 23.102  20.177  112.028 1.00 29.30 ? 358 MET A CB    1 
ATOM   2736  C CG    . MET A 1 361 ? 22.783  21.052  110.811 1.00 29.38 ? 358 MET A CG    1 
ATOM   2737  S SD    . MET A 1 361 ? 24.172  21.093  109.628 1.00 32.02 ? 358 MET A SD    1 
ATOM   2738  C CE    . MET A 1 361 ? 25.514  21.741  110.655 1.00 29.14 ? 358 MET A CE    1 
ATOM   2739  N N     . SER A 1 362 ? 23.767  17.262  113.468 1.00 30.50 ? 359 SER A N     1 
ATOM   2740  C CA    . SER A 1 362 ? 24.326  16.553  114.604 1.00 30.96 ? 359 SER A CA    1 
ATOM   2741  C C     . SER A 1 362 ? 25.575  15.799  114.148 1.00 32.51 ? 359 SER A C     1 
ATOM   2742  O O     . SER A 1 362 ? 26.570  15.748  114.873 1.00 33.91 ? 359 SER A O     1 
ATOM   2743  C CB    . SER A 1 362 ? 23.313  15.568  115.175 1.00 31.99 ? 359 SER A CB    1 
ATOM   2744  O OG    . SER A 1 362 ? 23.881  14.859  116.259 1.00 32.13 ? 359 SER A OG    1 
ATOM   2745  N N     . ASN A 1 363 ? 25.510  15.208  112.953 1.00 31.83 ? 360 ASN A N     1 
ATOM   2746  C CA    . ASN A 1 363 ? 26.647  14.483  112.377 1.00 32.39 ? 360 ASN A CA    1 
ATOM   2747  C C     . ASN A 1 363 ? 27.830  15.432  112.276 1.00 34.40 ? 360 ASN A C     1 
ATOM   2748  O O     . ASN A 1 363 ? 28.950  15.092  112.663 1.00 35.82 ? 360 ASN A O     1 
ATOM   2749  C CB    . ASN A 1 363 ? 26.320  13.969  110.966 1.00 30.27 ? 360 ASN A CB    1 
ATOM   2750  C CG    . ASN A 1 363 ? 25.824  12.535  110.954 1.00 29.47 ? 360 ASN A CG    1 
ATOM   2751  O OD1   . ASN A 1 363 ? 25.102  12.095  111.850 1.00 27.29 ? 360 ASN A OD1   1 
ATOM   2752  N ND2   . ASN A 1 363 ? 26.201  11.801  109.917 1.00 29.85 ? 360 ASN A ND2   1 
ATOM   2753  N N     . SER A 1 364 ? 27.583  16.629  111.751 1.00 34.94 ? 361 SER A N     1 
ATOM   2754  C CA    . SER A 1 364 ? 28.661  17.599  111.608 1.00 35.03 ? 361 SER A CA    1 
ATOM   2755  C C     . SER A 1 364 ? 29.195  18.051  112.958 1.00 34.95 ? 361 SER A C     1 
ATOM   2756  O O     . SER A 1 364 ? 30.391  17.943  113.228 1.00 34.27 ? 361 SER A O     1 
ATOM   2757  C CB    . SER A 1 364 ? 28.189  18.808  110.821 1.00 33.49 ? 361 SER A CB    1 
ATOM   2758  O OG    . SER A 1 364 ? 27.754  18.418  109.540 1.00 34.18 ? 361 SER A OG    1 
ATOM   2759  N N     . PHE A 1 365 ? 28.310  18.548  113.811 1.00 34.97 ? 362 PHE A N     1 
ATOM   2760  C CA    . PHE A 1 365 ? 28.742  19.021  115.115 1.00 35.58 ? 362 PHE A CA    1 
ATOM   2761  C C     . PHE A 1 365 ? 29.326  17.939  116.022 1.00 37.45 ? 362 PHE A C     1 
ATOM   2762  O O     . PHE A 1 365 ? 30.154  18.243  116.884 1.00 36.94 ? 362 PHE A O     1 
ATOM   2763  C CB    . PHE A 1 365 ? 27.601  19.735  115.823 1.00 34.42 ? 362 PHE A CB    1 
ATOM   2764  C CG    . PHE A 1 365 ? 27.116  20.957  115.099 1.00 32.42 ? 362 PHE A CG    1 
ATOM   2765  C CD1   . PHE A 1 365 ? 27.953  21.642  114.222 1.00 30.70 ? 362 PHE A CD1   1 
ATOM   2766  C CD2   . PHE A 1 365 ? 25.838  21.446  115.331 1.00 29.46 ? 362 PHE A CD2   1 
ATOM   2767  C CE1   . PHE A 1 365 ? 27.518  22.803  113.583 1.00 30.21 ? 362 PHE A CE1   1 
ATOM   2768  C CE2   . PHE A 1 365 ? 25.393  22.600  114.699 1.00 31.22 ? 362 PHE A CE2   1 
ATOM   2769  C CZ    . PHE A 1 365 ? 26.238  23.285  113.824 1.00 30.56 ? 362 PHE A CZ    1 
ATOM   2770  N N     . THR A 1 366 ? 28.911  16.685  115.837 1.00 37.93 ? 363 THR A N     1 
ATOM   2771  C CA    . THR A 1 366 ? 29.456  15.610  116.659 1.00 37.40 ? 363 THR A CA    1 
ATOM   2772  C C     . THR A 1 366 ? 30.942  15.487  116.358 1.00 38.38 ? 363 THR A C     1 
ATOM   2773  O O     . THR A 1 366 ? 31.754  15.282  117.267 1.00 38.87 ? 363 THR A O     1 
ATOM   2774  C CB    . THR A 1 366 ? 28.789  14.256  116.383 1.00 36.67 ? 363 THR A CB    1 
ATOM   2775  O OG1   . THR A 1 366 ? 27.452  14.274  116.891 1.00 39.46 ? 363 THR A OG1   1 
ATOM   2776  C CG2   . THR A 1 366 ? 29.567  13.126  117.057 1.00 34.81 ? 363 THR A CG2   1 
ATOM   2777  N N     . ASN A 1 367 ? 31.290  15.606  115.078 1.00 36.95 ? 364 ASN A N     1 
ATOM   2778  C CA    . ASN A 1 367 ? 32.686  15.530  114.658 1.00 37.19 ? 364 ASN A CA    1 
ATOM   2779  C C     . ASN A 1 367 ? 33.411  16.759  115.192 1.00 36.71 ? 364 ASN A C     1 
ATOM   2780  O O     . ASN A 1 367 ? 34.604  16.714  115.477 1.00 35.16 ? 364 ASN A O     1 
ATOM   2781  C CB    . ASN A 1 367 ? 32.806  15.523  113.126 1.00 37.36 ? 364 ASN A CB    1 
ATOM   2782  C CG    . ASN A 1 367 ? 32.333  14.223  112.495 1.00 37.06 ? 364 ASN A CG    1 
ATOM   2783  O OD1   . ASN A 1 367 ? 32.903  13.168  112.729 1.00 36.51 ? 364 ASN A OD1   1 
ATOM   2784  N ND2   . ASN A 1 367 ? 31.292  14.304  111.681 1.00 36.30 ? 364 ASN A ND2   1 
ATOM   2785  N N     . GLN A 1 368 ? 32.672  17.859  115.307 1.00 37.98 ? 365 GLN A N     1 
ATOM   2786  C CA    . GLN A 1 368 ? 33.216  19.122  115.788 1.00 38.88 ? 365 GLN A CA    1 
ATOM   2787  C C     . GLN A 1 368 ? 33.628  18.990  117.256 1.00 40.25 ? 365 GLN A C     1 
ATOM   2788  O O     . GLN A 1 368 ? 34.756  19.318  117.633 1.00 39.01 ? 365 GLN A O     1 
ATOM   2789  C CB    . GLN A 1 368 ? 32.167  20.228  115.615 1.00 38.10 ? 365 GLN A CB    1 
ATOM   2790  C CG    . GLN A 1 368 ? 32.748  21.621  115.542 1.00 37.04 ? 365 GLN A CG    1 
ATOM   2791  C CD    . GLN A 1 368 ? 33.787  21.753  114.453 1.00 37.39 ? 365 GLN A CD    1 
ATOM   2792  O OE1   . GLN A 1 368 ? 33.484  22.085  113.305 1.00 34.95 ? 365 GLN A OE1   1 
ATOM   2793  N NE2   . GLN A 1 368 ? 35.034  21.479  114.811 1.00 38.48 ? 365 GLN A NE2   1 
ATOM   2794  N N     . VAL A 1 369 ? 32.708  18.505  118.080 1.00 41.37 ? 366 VAL A N     1 
ATOM   2795  C CA    . VAL A 1 369 ? 32.984  18.316  119.495 1.00 42.99 ? 366 VAL A CA    1 
ATOM   2796  C C     . VAL A 1 369 ? 34.125  17.318  119.649 1.00 44.46 ? 366 VAL A C     1 
ATOM   2797  O O     . VAL A 1 369 ? 34.998  17.452  120.508 1.00 44.59 ? 366 VAL A O     1 
ATOM   2798  C CB    . VAL A 1 369 ? 31.776  17.738  120.210 1.00 42.72 ? 366 VAL A CB    1 
ATOM   2799  C CG1   . VAL A 1 369 ? 32.094  17.564  121.677 1.00 44.95 ? 366 VAL A CG1   1 
ATOM   2800  C CG2   . VAL A 1 369 ? 30.579  18.634  120.002 1.00 42.06 ? 366 VAL A CG2   1 
ATOM   2801  N N     . MET A 1 370 ? 34.088  16.305  118.796 1.00 44.42 ? 367 MET A N     1 
ATOM   2802  C CA    . MET A 1 370 ? 35.079  15.244  118.783 1.00 43.94 ? 367 MET A CA    1 
ATOM   2803  C C     . MET A 1 370 ? 36.465  15.794  118.447 1.00 43.64 ? 367 MET A C     1 
ATOM   2804  O O     . MET A 1 370 ? 37.459  15.405  119.056 1.00 44.52 ? 367 MET A O     1 
ATOM   2805  C CB    . MET A 1 370 ? 34.656  14.210  117.753 1.00 43.88 ? 367 MET A CB    1 
ATOM   2806  C CG    . MET A 1 370 ? 34.972  12.799  118.082 1.00 44.43 ? 367 MET A CG    1 
ATOM   2807  S SD    . MET A 1 370 ? 33.988  11.777  117.005 1.00 47.43 ? 367 MET A SD    1 
ATOM   2808  C CE    . MET A 1 370 ? 32.560  11.496  118.050 1.00 45.05 ? 367 MET A CE    1 
ATOM   2809  N N     . ALA A 1 371 ? 36.526  16.691  117.467 1.00 42.65 ? 368 ALA A N     1 
ATOM   2810  C CA    . ALA A 1 371 ? 37.786  17.286  117.047 1.00 41.85 ? 368 ALA A CA    1 
ATOM   2811  C C     . ALA A 1 371 ? 38.360  18.131  118.176 1.00 41.29 ? 368 ALA A C     1 
ATOM   2812  O O     . ALA A 1 371 ? 39.560  18.074  118.455 1.00 42.15 ? 368 ALA A O     1 
ATOM   2813  C CB    . ALA A 1 371 ? 37.575  18.146  115.792 1.00 39.50 ? 368 ALA A CB    1 
ATOM   2814  N N     . GLN A 1 372 ? 37.500  18.919  118.817 1.00 40.02 ? 369 GLN A N     1 
ATOM   2815  C CA    . GLN A 1 372 ? 37.924  19.769  119.920 1.00 39.07 ? 369 GLN A CA    1 
ATOM   2816  C C     . GLN A 1 372 ? 38.548  18.888  121.010 1.00 38.73 ? 369 GLN A C     1 
ATOM   2817  O O     . GLN A 1 372 ? 39.706  19.073  121.386 1.00 37.73 ? 369 GLN A O     1 
ATOM   2818  C CB    . GLN A 1 372 ? 36.728  20.561  120.472 1.00 38.79 ? 369 GLN A CB    1 
ATOM   2819  C CG    . GLN A 1 372 ? 36.203  21.684  119.559 1.00 35.61 ? 369 GLN A CG    1 
ATOM   2820  C CD    . GLN A 1 372 ? 37.187  22.840  119.391 1.00 37.22 ? 369 GLN A CD    1 
ATOM   2821  O OE1   . GLN A 1 372 ? 37.625  23.441  120.368 1.00 37.59 ? 369 GLN A OE1   1 
ATOM   2822  N NE2   . GLN A 1 372 ? 37.525  23.162  118.142 1.00 35.25 ? 369 GLN A NE2   1 
ATOM   2823  N N     . ILE A 1 373 ? 37.792  17.915  121.502 1.00 39.24 ? 370 ILE A N     1 
ATOM   2824  C CA    . ILE A 1 373 ? 38.315  17.019  122.526 1.00 40.54 ? 370 ILE A CA    1 
ATOM   2825  C C     . ILE A 1 373 ? 39.687  16.474  122.125 1.00 41.94 ? 370 ILE A C     1 
ATOM   2826  O O     . ILE A 1 373 ? 40.629  16.516  122.916 1.00 41.97 ? 370 ILE A O     1 
ATOM   2827  C CB    . ILE A 1 373 ? 37.349  15.846  122.773 1.00 40.33 ? 370 ILE A CB    1 
ATOM   2828  C CG1   . ILE A 1 373 ? 36.092  16.367  123.468 1.00 38.71 ? 370 ILE A CG1   1 
ATOM   2829  C CG2   . ILE A 1 373 ? 38.024  14.764  123.597 1.00 38.91 ? 370 ILE A CG2   1 
ATOM   2830  C CD1   . ILE A 1 373 ? 35.115  15.290  123.832 1.00 39.91 ? 370 ILE A CD1   1 
ATOM   2831  N N     . GLU A 1 374 ? 39.798  15.977  120.895 1.00 42.03 ? 371 GLU A N     1 
ATOM   2832  C CA    . GLU A 1 374 ? 41.059  15.426  120.402 1.00 43.23 ? 371 GLU A CA    1 
ATOM   2833  C C     . GLU A 1 374 ? 42.184  16.457  120.457 1.00 43.82 ? 371 GLU A C     1 
ATOM   2834  O O     . GLU A 1 374 ? 43.220  16.244  121.087 1.00 42.58 ? 371 GLU A O     1 
ATOM   2835  C CB    . GLU A 1 374 ? 40.906  14.938  118.953 1.00 42.68 ? 371 GLU A CB    1 
ATOM   2836  C CG    . GLU A 1 374 ? 40.208  13.600  118.791 1.00 42.76 ? 371 GLU A CG    1 
ATOM   2837  C CD    . GLU A 1 374 ? 40.966  12.452  119.455 1.00 44.14 ? 371 GLU A CD    1 
ATOM   2838  O OE1   . GLU A 1 374 ? 40.602  12.071  120.594 1.00 44.47 ? 371 GLU A OE1   1 
ATOM   2839  O OE2   . GLU A 1 374 ? 41.930  11.939  118.841 1.00 41.72 ? 371 GLU A OE2   1 
ATOM   2840  N N     . LEU A 1 375 ? 41.964  17.573  119.778 1.00 44.58 ? 372 LEU A N     1 
ATOM   2841  C CA    . LEU A 1 375 ? 42.931  18.654  119.708 1.00 45.22 ? 372 LEU A CA    1 
ATOM   2842  C C     . LEU A 1 375 ? 43.326  19.232  121.070 1.00 46.55 ? 372 LEU A C     1 
ATOM   2843  O O     . LEU A 1 375 ? 44.472  19.661  121.269 1.00 45.24 ? 372 LEU A O     1 
ATOM   2844  C CB    . LEU A 1 375 ? 42.364  19.753  118.814 1.00 43.10 ? 372 LEU A CB    1 
ATOM   2845  C CG    . LEU A 1 375 ? 43.174  20.089  117.565 1.00 43.34 ? 372 LEU A CG    1 
ATOM   2846  C CD1   . LEU A 1 375 ? 43.709  18.828  116.913 1.00 43.26 ? 372 LEU A CD1   1 
ATOM   2847  C CD2   . LEU A 1 375 ? 42.287  20.859  116.610 1.00 43.10 ? 372 LEU A CD2   1 
ATOM   2848  N N     . TRP A 1 376 ? 42.381  19.236  122.004 1.00 47.21 ? 373 TRP A N     1 
ATOM   2849  C CA    . TRP A 1 376 ? 42.635  19.777  123.330 1.00 49.13 ? 373 TRP A CA    1 
ATOM   2850  C C     . TRP A 1 376 ? 43.215  18.747  124.304 1.00 50.01 ? 373 TRP A C     1 
ATOM   2851  O O     . TRP A 1 376 ? 44.021  19.083  125.164 1.00 49.43 ? 373 TRP A O     1 
ATOM   2852  C CB    . TRP A 1 376 ? 41.343  20.367  123.900 1.00 49.01 ? 373 TRP A CB    1 
ATOM   2853  C CG    . TRP A 1 376 ? 41.536  21.089  125.190 1.00 49.55 ? 373 TRP A CG    1 
ATOM   2854  C CD1   . TRP A 1 376 ? 40.980  20.773  126.400 1.00 49.02 ? 373 TRP A CD1   1 
ATOM   2855  C CD2   . TRP A 1 376 ? 42.361  22.238  125.413 1.00 49.10 ? 373 TRP A CD2   1 
ATOM   2856  N NE1   . TRP A 1 376 ? 41.412  21.656  127.361 1.00 49.18 ? 373 TRP A NE1   1 
ATOM   2857  C CE2   . TRP A 1 376 ? 42.261  22.564  126.783 1.00 49.65 ? 373 TRP A CE2   1 
ATOM   2858  C CE3   . TRP A 1 376 ? 43.177  23.024  124.588 1.00 48.73 ? 373 TRP A CE3   1 
ATOM   2859  C CZ2   . TRP A 1 376 ? 42.947  23.641  127.346 1.00 49.83 ? 373 TRP A CZ2   1 
ATOM   2860  C CZ3   . TRP A 1 376 ? 43.859  24.095  125.149 1.00 47.89 ? 373 TRP A CZ3   1 
ATOM   2861  C CH2   . TRP A 1 376 ? 43.739  24.393  126.513 1.00 49.43 ? 373 TRP A CH2   1 
ATOM   2862  N N     . THR A 1 377 ? 42.814  17.491  124.156 1.00 52.34 ? 374 THR A N     1 
ATOM   2863  C CA    . THR A 1 377 ? 43.289  16.429  125.034 1.00 54.03 ? 374 THR A CA    1 
ATOM   2864  C C     . THR A 1 377 ? 44.600  15.782  124.577 1.00 54.48 ? 374 THR A C     1 
ATOM   2865  O O     . THR A 1 377 ? 45.452  15.455  125.402 1.00 54.85 ? 374 THR A O     1 
ATOM   2866  C CB    . THR A 1 377 ? 42.223  15.325  125.180 1.00 54.65 ? 374 THR A CB    1 
ATOM   2867  O OG1   . THR A 1 377 ? 40.980  15.915  125.570 1.00 54.92 ? 374 THR A OG1   1 
ATOM   2868  C CG2   . THR A 1 377 ? 42.643  14.313  126.251 1.00 56.76 ? 374 THR A CG2   1 
ATOM   2869  N N     . HIS A 1 378 ? 44.761  15.602  123.270 1.00 55.24 ? 375 HIS A N     1 
ATOM   2870  C CA    . HIS A 1 378 ? 45.970  14.985  122.726 1.00 56.04 ? 375 HIS A CA    1 
ATOM   2871  C C     . HIS A 1 378 ? 46.670  15.906  121.730 1.00 57.25 ? 375 HIS A C     1 
ATOM   2872  O O     . HIS A 1 378 ? 46.707  15.623  120.532 1.00 58.36 ? 375 HIS A O     1 
ATOM   2873  C CB    . HIS A 1 378 ? 45.616  13.669  122.031 1.00 55.05 ? 375 HIS A CB    1 
ATOM   2874  C CG    . HIS A 1 378 ? 44.670  12.814  122.810 1.00 55.09 ? 375 HIS A CG    1 
ATOM   2875  N ND1   . HIS A 1 378 ? 43.344  13.142  122.985 1.00 56.20 ? 375 HIS A ND1   1 
ATOM   2876  C CD2   . HIS A 1 378 ? 44.858  11.652  123.475 1.00 56.43 ? 375 HIS A CD2   1 
ATOM   2877  C CE1   . HIS A 1 378 ? 42.755  12.219  123.724 1.00 55.78 ? 375 HIS A CE1   1 
ATOM   2878  N NE2   . HIS A 1 378 ? 43.652  11.303  124.036 1.00 56.04 ? 375 HIS A NE2   1 
ATOM   2879  N N     . PRO A 1 379 ? 47.249  17.014  122.215 1.00 57.99 ? 376 PRO A N     1 
ATOM   2880  C CA    . PRO A 1 379 ? 47.943  17.970  121.343 1.00 58.75 ? 376 PRO A CA    1 
ATOM   2881  C C     . PRO A 1 379 ? 49.165  17.406  120.626 1.00 59.58 ? 376 PRO A C     1 
ATOM   2882  O O     . PRO A 1 379 ? 49.455  17.779  119.483 1.00 59.40 ? 376 PRO A O     1 
ATOM   2883  C CB    . PRO A 1 379 ? 48.307  19.102  122.301 1.00 58.37 ? 376 PRO A CB    1 
ATOM   2884  C CG    . PRO A 1 379 ? 48.521  18.380  123.596 1.00 58.64 ? 376 PRO A CG    1 
ATOM   2885  C CD    . PRO A 1 379 ? 47.353  17.423  123.627 1.00 58.24 ? 376 PRO A CD    1 
ATOM   2886  N N     . ASP A 1 380 ? 49.884  16.522  121.310 1.00 60.11 ? 377 ASP A N     1 
ATOM   2887  C CA    . ASP A 1 380 ? 51.082  15.903  120.759 1.00 60.23 ? 377 ASP A CA    1 
ATOM   2888  C C     . ASP A 1 380 ? 50.746  14.942  119.633 1.00 59.44 ? 377 ASP A C     1 
ATOM   2889  O O     . ASP A 1 380 ? 51.605  14.587  118.828 1.00 59.67 ? 377 ASP A O     1 
ATOM   2890  C CB    . ASP A 1 380 ? 51.848  15.167  121.866 1.00 62.11 ? 377 ASP A CB    1 
ATOM   2891  C CG    . ASP A 1 380 ? 52.888  16.053  122.552 1.00 63.03 ? 377 ASP A CG    1 
ATOM   2892  O OD1   . ASP A 1 380 ? 53.348  15.688  123.656 1.00 63.47 ? 377 ASP A OD1   1 
ATOM   2893  O OD2   . ASP A 1 380 ? 53.258  17.106  121.982 1.00 63.69 ? 377 ASP A OD2   1 
ATOM   2894  N N     . LYS A 1 381 ? 49.490  14.526  119.566 1.00 58.49 ? 378 LYS A N     1 
ATOM   2895  C CA    . LYS A 1 381 ? 49.082  13.607  118.519 1.00 57.43 ? 378 LYS A CA    1 
ATOM   2896  C C     . LYS A 1 381 ? 48.777  14.347  117.211 1.00 55.89 ? 378 LYS A C     1 
ATOM   2897  O O     . LYS A 1 381 ? 48.408  13.723  116.215 1.00 56.31 ? 378 LYS A O     1 
ATOM   2898  C CB    . LYS A 1 381 ? 47.865  12.802  118.981 1.00 58.62 ? 378 LYS A CB    1 
ATOM   2899  C CG    . LYS A 1 381 ? 47.847  11.367  118.466 1.00 60.37 ? 378 LYS A CG    1 
ATOM   2900  C CD    . LYS A 1 381 ? 46.737  10.552  119.106 1.00 61.17 ? 378 LYS A CD    1 
ATOM   2901  C CE    . LYS A 1 381 ? 45.366  11.046  118.674 1.00 61.55 ? 378 LYS A CE    1 
ATOM   2902  N NZ    . LYS A 1 381 ? 44.268  10.263  119.321 1.00 62.53 ? 378 LYS A NZ    1 
ATOM   2903  N N     . TYR A 1 382 ? 48.943  15.671  117.215 1.00 53.94 ? 379 TYR A N     1 
ATOM   2904  C CA    . TYR A 1 382 ? 48.693  16.493  116.023 1.00 51.86 ? 379 TYR A CA    1 
ATOM   2905  C C     . TYR A 1 382 ? 49.736  17.604  115.823 1.00 50.84 ? 379 TYR A C     1 
ATOM   2906  O O     . TYR A 1 382 ? 49.630  18.687  116.401 1.00 50.42 ? 379 TYR A O     1 
ATOM   2907  C CB    . TYR A 1 382 ? 47.292  17.136  116.072 1.00 49.81 ? 379 TYR A CB    1 
ATOM   2908  C CG    . TYR A 1 382 ? 46.143  16.173  116.301 1.00 49.71 ? 379 TYR A CG    1 
ATOM   2909  C CD1   . TYR A 1 382 ? 45.714  15.870  117.593 1.00 48.92 ? 379 TYR A CD1   1 
ATOM   2910  C CD2   . TYR A 1 382 ? 45.499  15.544  115.229 1.00 48.04 ? 379 TYR A CD2   1 
ATOM   2911  C CE1   . TYR A 1 382 ? 44.673  14.962  117.820 1.00 47.34 ? 379 TYR A CE1   1 
ATOM   2912  C CE2   . TYR A 1 382 ? 44.455  14.629  115.445 1.00 47.05 ? 379 TYR A CE2   1 
ATOM   2913  C CZ    . TYR A 1 382 ? 44.051  14.342  116.747 1.00 46.82 ? 379 TYR A CZ    1 
ATOM   2914  O OH    . TYR A 1 382 ? 43.055  13.426  116.995 1.00 42.59 ? 379 TYR A OH    1 
ATOM   2915  N N     . PRO A 1 383 ? 50.761  17.348  114.997 1.00 50.69 ? 380 PRO A N     1 
ATOM   2916  C CA    . PRO A 1 383 ? 51.787  18.369  114.759 1.00 50.20 ? 380 PRO A CA    1 
ATOM   2917  C C     . PRO A 1 383 ? 51.146  19.559  114.059 1.00 50.04 ? 380 PRO A C     1 
ATOM   2918  O O     . PRO A 1 383 ? 49.926  19.651  113.982 1.00 50.45 ? 380 PRO A O     1 
ATOM   2919  C CB    . PRO A 1 383 ? 52.787  17.653  113.857 1.00 49.24 ? 380 PRO A CB    1 
ATOM   2920  C CG    . PRO A 1 383 ? 52.635  16.217  114.255 1.00 50.71 ? 380 PRO A CG    1 
ATOM   2921  C CD    . PRO A 1 383 ? 51.137  16.076  114.361 1.00 50.12 ? 380 PRO A CD    1 
ATOM   2922  N N     . VAL A 1 384 ? 51.966  20.461  113.539 1.00 49.79 ? 381 VAL A N     1 
ATOM   2923  C CA    . VAL A 1 384 ? 51.443  21.627  112.845 1.00 50.03 ? 381 VAL A CA    1 
ATOM   2924  C C     . VAL A 1 384 ? 51.020  21.232  111.432 1.00 50.09 ? 381 VAL A C     1 
ATOM   2925  O O     . VAL A 1 384 ? 51.854  20.874  110.601 1.00 50.28 ? 381 VAL A O     1 
ATOM   2926  C CB    . VAL A 1 384 ? 52.502  22.754  112.740 1.00 50.85 ? 381 VAL A CB    1 
ATOM   2927  C CG1   . VAL A 1 384 ? 51.826  24.049  112.326 1.00 49.07 ? 381 VAL A CG1   1 
ATOM   2928  C CG2   . VAL A 1 384 ? 53.243  22.927  114.071 1.00 52.95 ? 381 VAL A CG2   1 
ATOM   2929  N N     . GLY A 1 385 ? 49.723  21.303  111.161 1.00 49.32 ? 382 GLY A N     1 
ATOM   2930  C CA    . GLY A 1 385 ? 49.223  20.947  109.846 1.00 48.05 ? 382 GLY A CA    1 
ATOM   2931  C C     . GLY A 1 385 ? 47.725  20.730  109.902 1.00 47.94 ? 382 GLY A C     1 
ATOM   2932  O O     . GLY A 1 385 ? 47.048  21.305  110.750 1.00 47.59 ? 382 GLY A O     1 
ATOM   2933  N N     . VAL A 1 386 ? 47.196  19.902  109.010 1.00 46.98 ? 383 VAL A N     1 
ATOM   2934  C CA    . VAL A 1 386 ? 45.761  19.634  109.001 1.00 46.28 ? 383 VAL A CA    1 
ATOM   2935  C C     . VAL A 1 386 ? 45.494  18.143  108.822 1.00 45.91 ? 383 VAL A C     1 
ATOM   2936  O O     . VAL A 1 386 ? 45.919  17.546  107.832 1.00 46.75 ? 383 VAL A O     1 
ATOM   2937  C CB    . VAL A 1 386 ? 45.062  20.454  107.886 1.00 46.01 ? 383 VAL A CB    1 
ATOM   2938  C CG1   . VAL A 1 386 ? 45.970  20.562  106.682 1.00 45.86 ? 383 VAL A CG1   1 
ATOM   2939  C CG2   . VAL A 1 386 ? 43.736  19.815  107.512 1.00 45.95 ? 383 VAL A CG2   1 
ATOM   2940  N N     . HIS A 1 387 ? 44.794  17.544  109.783 1.00 44.40 ? 384 HIS A N     1 
ATOM   2941  C CA    . HIS A 1 387 ? 44.507  16.114  109.721 1.00 43.14 ? 384 HIS A CA    1 
ATOM   2942  C C     . HIS A 1 387 ? 43.024  15.765  109.829 1.00 41.62 ? 384 HIS A C     1 
ATOM   2943  O O     . HIS A 1 387 ? 42.190  16.617  110.136 1.00 41.69 ? 384 HIS A O     1 
ATOM   2944  C CB    . HIS A 1 387 ? 45.269  15.374  110.827 1.00 44.18 ? 384 HIS A CB    1 
ATOM   2945  C CG    . HIS A 1 387 ? 46.443  16.132  111.373 1.00 44.62 ? 384 HIS A CG    1 
ATOM   2946  N ND1   . HIS A 1 387 ? 46.302  17.182  112.254 1.00 43.19 ? 384 HIS A ND1   1 
ATOM   2947  C CD2   . HIS A 1 387 ? 47.777  15.989  111.166 1.00 43.34 ? 384 HIS A CD2   1 
ATOM   2948  C CE1   . HIS A 1 387 ? 47.498  17.650  112.569 1.00 43.28 ? 384 HIS A CE1   1 
ATOM   2949  N NE2   . HIS A 1 387 ? 48.409  16.944  111.923 1.00 42.19 ? 384 HIS A NE2   1 
ATOM   2950  N N     . PHE A 1 388 ? 42.700  14.501  109.578 1.00 38.04 ? 385 PHE A N     1 
ATOM   2951  C CA    . PHE A 1 388 ? 41.322  14.042  109.669 1.00 38.38 ? 385 PHE A CA    1 
ATOM   2952  C C     . PHE A 1 388 ? 41.188  13.306  110.994 1.00 38.27 ? 385 PHE A C     1 
ATOM   2953  O O     . PHE A 1 388 ? 42.187  13.070  111.673 1.00 39.38 ? 385 PHE A O     1 
ATOM   2954  C CB    . PHE A 1 388 ? 41.002  13.068  108.527 1.00 36.23 ? 385 PHE A CB    1 
ATOM   2955  C CG    . PHE A 1 388 ? 41.431  13.557  107.181 1.00 34.57 ? 385 PHE A CG    1 
ATOM   2956  C CD1   . PHE A 1 388 ? 40.701  14.537  106.511 1.00 35.98 ? 385 PHE A CD1   1 
ATOM   2957  C CD2   . PHE A 1 388 ? 42.583  13.064  106.587 1.00 33.42 ? 385 PHE A CD2   1 
ATOM   2958  C CE1   . PHE A 1 388 ? 41.122  15.014  105.269 1.00 33.89 ? 385 PHE A CE1   1 
ATOM   2959  C CE2   . PHE A 1 388 ? 43.010  13.533  105.349 1.00 31.46 ? 385 PHE A CE2   1 
ATOM   2960  C CZ    . PHE A 1 388 ? 42.280  14.509  104.689 1.00 30.94 ? 385 PHE A CZ    1 
ATOM   2961  N N     . LEU A 1 389 ? 39.963  12.956  111.371 1.00 37.34 ? 386 LEU A N     1 
ATOM   2962  C CA    . LEU A 1 389 ? 39.750  12.208  112.601 1.00 38.23 ? 386 LEU A CA    1 
ATOM   2963  C C     . LEU A 1 389 ? 39.935  10.731  112.267 1.00 39.23 ? 386 LEU A C     1 
ATOM   2964  O O     . LEU A 1 389 ? 39.751  10.324  111.118 1.00 41.12 ? 386 LEU A O     1 
ATOM   2965  C CB    . LEU A 1 389 ? 38.340  12.444  113.156 1.00 38.16 ? 386 LEU A CB    1 
ATOM   2966  C CG    . LEU A 1 389 ? 38.083  13.749  113.926 1.00 38.98 ? 386 LEU A CG    1 
ATOM   2967  C CD1   . LEU A 1 389 ? 38.199  14.918  112.983 1.00 39.25 ? 386 LEU A CD1   1 
ATOM   2968  C CD2   . LEU A 1 389 ? 36.697  13.728  114.566 1.00 39.09 ? 386 LEU A CD2   1 
ATOM   2969  N N     . PRO A 1 390 ? 40.339  9.914   113.248 1.00 39.36 ? 387 PRO A N     1 
ATOM   2970  C CA    . PRO A 1 390 ? 40.526  8.485   112.977 1.00 38.36 ? 387 PRO A CA    1 
ATOM   2971  C C     . PRO A 1 390 ? 39.230  7.905   112.427 1.00 36.53 ? 387 PRO A C     1 
ATOM   2972  O O     . PRO A 1 390 ? 38.144  8.252   112.893 1.00 34.84 ? 387 PRO A O     1 
ATOM   2973  C CB    . PRO A 1 390 ? 40.883  7.922   114.352 1.00 39.32 ? 387 PRO A CB    1 
ATOM   2974  C CG    . PRO A 1 390 ? 41.653  9.050   114.962 1.00 41.53 ? 387 PRO A CG    1 
ATOM   2975  C CD    . PRO A 1 390 ? 40.788  10.253  114.608 1.00 39.88 ? 387 PRO A CD    1 
ATOM   2976  N N     . LYS A 1 391 ? 39.334  7.024   111.441 1.00 34.68 ? 388 LYS A N     1 
ATOM   2977  C CA    . LYS A 1 391 ? 38.124  6.462   110.864 1.00 34.76 ? 388 LYS A CA    1 
ATOM   2978  C C     . LYS A 1 391 ? 37.217  5.827   111.913 1.00 34.25 ? 388 LYS A C     1 
ATOM   2979  O O     . LYS A 1 391 ? 35.999  5.914   111.802 1.00 34.65 ? 388 LYS A O     1 
ATOM   2980  C CB    . LYS A 1 391 ? 38.460  5.450   109.754 1.00 34.11 ? 388 LYS A CB    1 
ATOM   2981  C CG    . LYS A 1 391 ? 37.228  4.844   109.064 1.00 31.80 ? 388 LYS A CG    1 
ATOM   2982  C CD    . LYS A 1 391 ? 37.606  3.914   107.905 1.00 29.00 ? 388 LYS A CD    1 
ATOM   2983  C CE    . LYS A 1 391 ? 38.117  4.683   106.705 1.00 26.63 ? 388 LYS A CE    1 
ATOM   2984  N NZ    . LYS A 1 391 ? 37.060  5.585   106.156 1.00 22.37 ? 388 LYS A NZ    1 
ATOM   2985  N N     . LYS A 1 392 ? 37.793  5.217   112.947 1.00 35.61 ? 389 LYS A N     1 
ATOM   2986  C CA    . LYS A 1 392 ? 36.964  4.584   113.978 1.00 35.89 ? 389 LYS A CA    1 
ATOM   2987  C C     . LYS A 1 392 ? 36.038  5.587   114.669 1.00 34.51 ? 389 LYS A C     1 
ATOM   2988  O O     . LYS A 1 392 ? 34.989  5.210   115.193 1.00 35.64 ? 389 LYS A O     1 
ATOM   2989  C CB    . LYS A 1 392 ? 37.834  3.880   115.012 1.00 36.91 ? 389 LYS A CB    1 
ATOM   2990  C CG    . LYS A 1 392 ? 37.203  2.612   115.554 1.00 39.16 ? 389 LYS A CG    1 
ATOM   2991  C CD    . LYS A 1 392 ? 38.114  1.950   116.582 1.00 41.47 ? 389 LYS A CD    1 
ATOM   2992  C CE    . LYS A 1 392 ? 37.732  0.506   116.765 1.00 40.85 ? 389 LYS A CE    1 
ATOM   2993  N NZ    . LYS A 1 392 ? 36.256  0.398   116.879 1.00 43.42 ? 389 LYS A NZ    1 
ATOM   2994  N N     . LEU A 1 393 ? 36.432  6.859   114.670 1.00 33.11 ? 390 LEU A N     1 
ATOM   2995  C CA    . LEU A 1 393 ? 35.630  7.922   115.278 1.00 32.80 ? 390 LEU A CA    1 
ATOM   2996  C C     . LEU A 1 393 ? 34.483  8.312   114.342 1.00 33.04 ? 390 LEU A C     1 
ATOM   2997  O O     . LEU A 1 393 ? 33.397  8.679   114.795 1.00 32.92 ? 390 LEU A O     1 
ATOM   2998  C CB    . LEU A 1 393 ? 36.493  9.154   115.566 1.00 32.64 ? 390 LEU A CB    1 
ATOM   2999  C CG    . LEU A 1 393 ? 37.544  9.014   116.674 1.00 33.56 ? 390 LEU A CG    1 
ATOM   3000  C CD1   . LEU A 1 393 ? 38.318  10.317  116.850 1.00 30.67 ? 390 LEU A CD1   1 
ATOM   3001  C CD2   . LEU A 1 393 ? 36.842  8.628   117.963 1.00 31.86 ? 390 LEU A CD2   1 
ATOM   3002  N N     . ASP A 1 394 ? 34.743  8.234   113.037 1.00 32.81 ? 391 ASP A N     1 
ATOM   3003  C CA    . ASP A 1 394 ? 33.757  8.549   112.008 1.00 32.05 ? 391 ASP A CA    1 
ATOM   3004  C C     . ASP A 1 394 ? 32.611  7.544   112.125 1.00 32.07 ? 391 ASP A C     1 
ATOM   3005  O O     . ASP A 1 394 ? 31.434  7.910   112.178 1.00 30.22 ? 391 ASP A O     1 
ATOM   3006  C CB    . ASP A 1 394 ? 34.398  8.426   110.622 1.00 33.18 ? 391 ASP A CB    1 
ATOM   3007  C CG    . ASP A 1 394 ? 34.152  9.636   109.742 1.00 32.08 ? 391 ASP A CG    1 
ATOM   3008  O OD1   . ASP A 1 394 ? 32.998  10.092  109.657 1.00 35.26 ? 391 ASP A OD1   1 
ATOM   3009  O OD2   . ASP A 1 394 ? 35.115  10.125  109.120 1.00 31.98 ? 391 ASP A OD2   1 
ATOM   3010  N N     . GLU A 1 395 ? 32.968  6.267   112.179 1.00 32.14 ? 392 GLU A N     1 
ATOM   3011  C CA    . GLU A 1 395 ? 31.981  5.212   112.294 1.00 32.44 ? 392 GLU A CA    1 
ATOM   3012  C C     . GLU A 1 395 ? 31.161  5.426   113.561 1.00 32.63 ? 392 GLU A C     1 
ATOM   3013  O O     . GLU A 1 395 ? 29.945  5.219   113.564 1.00 31.69 ? 392 GLU A O     1 
ATOM   3014  C CB    . GLU A 1 395 ? 32.676  3.848   112.331 1.00 32.66 ? 392 GLU A CB    1 
ATOM   3015  C CG    . GLU A 1 395 ? 33.758  3.701   111.275 1.00 35.99 ? 392 GLU A CG    1 
ATOM   3016  C CD    . GLU A 1 395 ? 34.261  2.273   111.119 1.00 40.50 ? 392 GLU A CD    1 
ATOM   3017  O OE1   . GLU A 1 395 ? 34.450  1.581   112.150 1.00 41.75 ? 392 GLU A OE1   1 
ATOM   3018  O OE2   . GLU A 1 395 ? 34.480  1.848   109.963 1.00 42.07 ? 392 GLU A OE2   1 
ATOM   3019  N N     . ALA A 1 396 ? 31.826  5.856   114.630 1.00 32.53 ? 393 ALA A N     1 
ATOM   3020  C CA    . ALA A 1 396 ? 31.149  6.102   115.903 1.00 32.58 ? 393 ALA A CA    1 
ATOM   3021  C C     . ALA A 1 396 ? 30.095  7.205   115.763 1.00 31.93 ? 393 ALA A C     1 
ATOM   3022  O O     . ALA A 1 396 ? 29.002  7.110   116.342 1.00 29.82 ? 393 ALA A O     1 
ATOM   3023  C CB    . ALA A 1 396 ? 32.177  6.483   116.978 1.00 34.49 ? 393 ALA A CB    1 
ATOM   3024  N N     . VAL A 1 397 ? 30.438  8.240   114.990 1.00 30.71 ? 394 VAL A N     1 
ATOM   3025  C CA    . VAL A 1 397 ? 29.554  9.374   114.728 1.00 31.23 ? 394 VAL A CA    1 
ATOM   3026  C C     . VAL A 1 397 ? 28.288  8.890   114.036 1.00 31.04 ? 394 VAL A C     1 
ATOM   3027  O O     . VAL A 1 397 ? 27.176  9.195   114.457 1.00 31.51 ? 394 VAL A O     1 
ATOM   3028  C CB    . VAL A 1 397 ? 30.237  10.427  113.813 1.00 32.26 ? 394 VAL A CB    1 
ATOM   3029  C CG1   . VAL A 1 397 ? 29.248  11.528  113.438 1.00 31.10 ? 394 VAL A CG1   1 
ATOM   3030  C CG2   . VAL A 1 397 ? 31.444  11.019  114.520 1.00 31.70 ? 394 VAL A CG2   1 
ATOM   3031  N N     . ALA A 1 398 ? 28.455  8.131   112.962 1.00 31.33 ? 395 ALA A N     1 
ATOM   3032  C CA    . ALA A 1 398 ? 27.305  7.616   112.239 1.00 30.66 ? 395 ALA A CA    1 
ATOM   3033  C C     . ALA A 1 398 ? 26.536  6.653   113.131 1.00 30.44 ? 395 ALA A C     1 
ATOM   3034  O O     . ALA A 1 398 ? 25.328  6.773   113.276 1.00 31.80 ? 395 ALA A O     1 
ATOM   3035  C CB    . ALA A 1 398 ? 27.756  6.914   110.961 1.00 31.13 ? 395 ALA A CB    1 
ATOM   3036  N N     . GLU A 1 399 ? 27.238  5.704   113.736 1.00 30.70 ? 396 GLU A N     1 
ATOM   3037  C CA    . GLU A 1 399 ? 26.591  4.719   114.595 1.00 32.69 ? 396 GLU A CA    1 
ATOM   3038  C C     . GLU A 1 399 ? 25.740  5.348   115.684 1.00 32.16 ? 396 GLU A C     1 
ATOM   3039  O O     . GLU A 1 399 ? 24.702  4.808   116.053 1.00 32.25 ? 396 GLU A O     1 
ATOM   3040  C CB    . GLU A 1 399 ? 27.638  3.806   115.238 1.00 34.78 ? 396 GLU A CB    1 
ATOM   3041  C CG    . GLU A 1 399 ? 27.088  2.870   116.295 1.00 40.03 ? 396 GLU A CG    1 
ATOM   3042  C CD    . GLU A 1 399 ? 27.886  1.585   116.372 1.00 44.75 ? 396 GLU A CD    1 
ATOM   3043  O OE1   . GLU A 1 399 ? 29.133  1.669   116.415 1.00 46.94 ? 396 GLU A OE1   1 
ATOM   3044  O OE2   . GLU A 1 399 ? 27.267  0.492   116.388 1.00 46.99 ? 396 GLU A OE2   1 
ATOM   3045  N N     . ALA A 1 400 ? 26.177  6.490   116.197 1.00 33.11 ? 397 ALA A N     1 
ATOM   3046  C CA    . ALA A 1 400 ? 25.424  7.153   117.244 1.00 34.17 ? 397 ALA A CA    1 
ATOM   3047  C C     . ALA A 1 400 ? 24.092  7.709   116.718 1.00 34.51 ? 397 ALA A C     1 
ATOM   3048  O O     . ALA A 1 400 ? 23.243  8.120   117.498 1.00 36.79 ? 397 ALA A O     1 
ATOM   3049  C CB    . ALA A 1 400 ? 26.268  8.272   117.873 1.00 34.51 ? 397 ALA A CB    1 
ATOM   3050  N N     . HIS A 1 401 ? 23.891  7.722   115.404 1.00 33.01 ? 398 HIS A N     1 
ATOM   3051  C CA    . HIS A 1 401 ? 22.626  8.241   114.888 1.00 32.09 ? 398 HIS A CA    1 
ATOM   3052  C C     . HIS A 1 401 ? 21.661  7.184   114.392 1.00 31.33 ? 398 HIS A C     1 
ATOM   3053  O O     . HIS A 1 401 ? 20.554  7.509   113.956 1.00 32.11 ? 398 HIS A O     1 
ATOM   3054  C CB    . HIS A 1 401 ? 22.871  9.253   113.775 1.00 29.81 ? 398 HIS A CB    1 
ATOM   3055  C CG    . HIS A 1 401 ? 23.524  10.507  114.250 1.00 29.17 ? 398 HIS A CG    1 
ATOM   3056  N ND1   . HIS A 1 401 ? 24.879  10.597  114.479 1.00 30.24 ? 398 HIS A ND1   1 
ATOM   3057  C CD2   . HIS A 1 401 ? 23.004  11.713  114.575 1.00 28.25 ? 398 HIS A CD2   1 
ATOM   3058  C CE1   . HIS A 1 401 ? 25.169  11.807  114.923 1.00 30.10 ? 398 HIS A CE1   1 
ATOM   3059  N NE2   . HIS A 1 401 ? 24.048  12.504  114.989 1.00 29.99 ? 398 HIS A NE2   1 
ATOM   3060  N N     . LEU A 1 402 ? 22.089  5.927   114.464 1.00 30.41 ? 399 LEU A N     1 
ATOM   3061  C CA    . LEU A 1 402 ? 21.285  4.801   114.016 1.00 29.52 ? 399 LEU A CA    1 
ATOM   3062  C C     . LEU A 1 402 ? 20.097  4.547   114.927 1.00 30.13 ? 399 LEU A C     1 
ATOM   3063  O O     . LEU A 1 402 ? 19.004  4.180   114.467 1.00 29.24 ? 399 LEU A O     1 
ATOM   3064  C CB    . LEU A 1 402 ? 22.158  3.545   113.937 1.00 28.70 ? 399 LEU A CB    1 
ATOM   3065  C CG    . LEU A 1 402 ? 22.969  3.279   112.664 1.00 28.76 ? 399 LEU A CG    1 
ATOM   3066  C CD1   . LEU A 1 402 ? 23.801  4.490   112.306 1.00 30.79 ? 399 LEU A CD1   1 
ATOM   3067  C CD2   . LEU A 1 402 ? 23.866  2.061   112.872 1.00 28.10 ? 399 LEU A CD2   1 
ATOM   3068  N N     . GLY A 1 403 ? 20.325  4.734   116.224 1.00 30.95 ? 400 GLY A N     1 
ATOM   3069  C CA    . GLY A 1 403 ? 19.285  4.517   117.212 1.00 30.48 ? 400 GLY A CA    1 
ATOM   3070  C C     . GLY A 1 403 ? 17.980  5.224   116.911 1.00 32.24 ? 400 GLY A C     1 
ATOM   3071  O O     . GLY A 1 403 ? 16.933  4.579   116.824 1.00 32.37 ? 400 GLY A O     1 
ATOM   3072  N N     . LYS A 1 404 ? 18.027  6.541   116.744 1.00 32.92 ? 401 LYS A N     1 
ATOM   3073  C CA    . LYS A 1 404 ? 16.812  7.292   116.470 1.00 35.37 ? 401 LYS A CA    1 
ATOM   3074  C C     . LYS A 1 404 ? 16.062  6.837   115.208 1.00 36.89 ? 401 LYS A C     1 
ATOM   3075  O O     . LYS A 1 404 ? 14.831  6.764   115.215 1.00 38.01 ? 401 LYS A O     1 
ATOM   3076  C CB    . LYS A 1 404 ? 17.126  8.795   116.387 1.00 36.35 ? 401 LYS A CB    1 
ATOM   3077  C CG    . LYS A 1 404 ? 15.878  9.650   116.168 1.00 36.33 ? 401 LYS A CG    1 
ATOM   3078  C CD    . LYS A 1 404 ? 15.977  11.028  116.791 1.00 33.29 ? 401 LYS A CD    1 
ATOM   3079  C CE    . LYS A 1 404 ? 14.604  11.679  116.818 1.00 32.51 ? 401 LYS A CE    1 
ATOM   3080  N NZ    . LYS A 1 404 ? 13.562  10.741  117.357 1.00 30.70 ? 401 LYS A NZ    1 
ATOM   3081  N N     . LEU A 1 405 ? 16.797  6.520   114.141 1.00 37.18 ? 402 LEU A N     1 
ATOM   3082  C CA    . LEU A 1 405 ? 16.190  6.076   112.879 1.00 35.88 ? 402 LEU A CA    1 
ATOM   3083  C C     . LEU A 1 405 ? 15.762  4.621   112.932 1.00 36.50 ? 402 LEU A C     1 
ATOM   3084  O O     . LEU A 1 405 ? 15.161  4.097   111.992 1.00 36.52 ? 402 LEU A O     1 
ATOM   3085  C CB    . LEU A 1 405 ? 17.175  6.274   111.727 1.00 33.11 ? 402 LEU A CB    1 
ATOM   3086  C CG    . LEU A 1 405 ? 17.615  7.729   111.574 1.00 32.88 ? 402 LEU A CG    1 
ATOM   3087  C CD1   . LEU A 1 405 ? 18.665  7.846   110.478 1.00 32.90 ? 402 LEU A CD1   1 
ATOM   3088  C CD2   . LEU A 1 405 ? 16.395  8.592   111.268 1.00 29.89 ? 402 LEU A CD2   1 
ATOM   3089  N N     . ASN A 1 406 ? 16.086  3.972   114.042 1.00 39.35 ? 403 ASN A N     1 
ATOM   3090  C CA    . ASN A 1 406 ? 15.743  2.573   114.244 1.00 41.12 ? 403 ASN A CA    1 
ATOM   3091  C C     . ASN A 1 406 ? 16.405  1.630   113.268 1.00 40.19 ? 403 ASN A C     1 
ATOM   3092  O O     . ASN A 1 406 ? 15.765  0.742   112.715 1.00 39.07 ? 403 ASN A O     1 
ATOM   3093  C CB    . ASN A 1 406 ? 14.236  2.386   114.183 1.00 44.02 ? 403 ASN A CB    1 
ATOM   3094  C CG    . ASN A 1 406 ? 13.591  2.621   115.512 1.00 48.70 ? 403 ASN A CG    1 
ATOM   3095  O OD1   . ASN A 1 406 ? 13.626  3.737   116.051 1.00 50.24 ? 403 ASN A OD1   1 
ATOM   3096  N ND2   . ASN A 1 406 ? 13.012  1.562   116.075 1.00 51.10 ? 403 ASN A ND2   1 
ATOM   3097  N N     . VAL A 1 407 ? 17.699  1.828   113.069 1.00 40.77 ? 404 VAL A N     1 
ATOM   3098  C CA    . VAL A 1 407 ? 18.466  0.984   112.171 1.00 40.90 ? 404 VAL A CA    1 
ATOM   3099  C C     . VAL A 1 407 ? 19.067  -0.170  112.952 1.00 40.26 ? 404 VAL A C     1 
ATOM   3100  O O     . VAL A 1 407 ? 19.677  0.036   113.997 1.00 42.10 ? 404 VAL A O     1 
ATOM   3101  C CB    . VAL A 1 407 ? 19.618  1.765   111.532 1.00 41.03 ? 404 VAL A CB    1 
ATOM   3102  C CG1   . VAL A 1 407 ? 20.500  0.815   110.733 1.00 40.48 ? 404 VAL A CG1   1 
ATOM   3103  C CG2   . VAL A 1 407 ? 19.064  2.870   110.643 1.00 41.22 ? 404 VAL A CG2   1 
ATOM   3104  N N     . LYS A 1 408 ? 18.896  -1.390  112.466 1.00 38.52 ? 405 LYS A N     1 
ATOM   3105  C CA    . LYS A 1 408 ? 19.481  -2.515  113.172 1.00 36.38 ? 405 LYS A CA    1 
ATOM   3106  C C     . LYS A 1 408 ? 20.797  -2.926  112.507 1.00 34.05 ? 405 LYS A C     1 
ATOM   3107  O O     . LYS A 1 408 ? 20.814  -3.737  111.586 1.00 34.09 ? 405 LYS A O     1 
ATOM   3108  C CB    . LYS A 1 408 ? 18.502  -3.689  113.217 1.00 37.85 ? 405 LYS A CB    1 
ATOM   3109  C CG    . LYS A 1 408 ? 17.114  -3.304  113.740 1.00 39.42 ? 405 LYS A CG    1 
ATOM   3110  C CD    . LYS A 1 408 ? 16.324  -4.514  114.235 1.00 39.87 ? 405 LYS A CD    1 
ATOM   3111  C CE    . LYS A 1 408 ? 14.849  -4.173  114.361 1.00 41.56 ? 405 LYS A CE    1 
ATOM   3112  N NZ    . LYS A 1 408 ? 14.660  -2.868  115.053 1.00 42.73 ? 405 LYS A NZ    1 
ATOM   3113  N N     . LEU A 1 409 ? 21.899  -2.347  112.980 1.00 31.74 ? 406 LEU A N     1 
ATOM   3114  C CA    . LEU A 1 409 ? 23.220  -2.646  112.446 1.00 32.24 ? 406 LEU A CA    1 
ATOM   3115  C C     . LEU A 1 409 ? 23.522  -4.130  112.616 1.00 33.70 ? 406 LEU A C     1 
ATOM   3116  O O     . LEU A 1 409 ? 23.025  -4.762  113.549 1.00 36.14 ? 406 LEU A O     1 
ATOM   3117  C CB    . LEU A 1 409 ? 24.282  -1.811  113.168 1.00 29.51 ? 406 LEU A CB    1 
ATOM   3118  C CG    . LEU A 1 409 ? 25.694  -1.792  112.571 1.00 30.24 ? 406 LEU A CG    1 
ATOM   3119  C CD1   . LEU A 1 409 ? 25.612  -1.397  111.104 1.00 31.23 ? 406 LEU A CD1   1 
ATOM   3120  C CD2   . LEU A 1 409 ? 26.587  -0.814  113.327 1.00 28.69 ? 406 LEU A CD2   1 
ATOM   3121  N N     . THR A 1 410 ? 24.325  -4.696  111.721 1.00 33.44 ? 407 THR A N     1 
ATOM   3122  C CA    . THR A 1 410 ? 24.671  -6.108  111.823 1.00 34.15 ? 407 THR A CA    1 
ATOM   3123  C C     . THR A 1 410 ? 26.084  -6.287  112.358 1.00 35.76 ? 407 THR A C     1 
ATOM   3124  O O     . THR A 1 410 ? 26.986  -5.525  112.010 1.00 34.60 ? 407 THR A O     1 
ATOM   3125  C CB    . THR A 1 410 ? 24.571  -6.832  110.453 1.00 33.25 ? 407 THR A CB    1 
ATOM   3126  O OG1   . THR A 1 410 ? 23.194  -6.986  110.091 1.00 33.95 ? 407 THR A OG1   1 
ATOM   3127  C CG2   . THR A 1 410 ? 25.225  -8.203  110.521 1.00 31.46 ? 407 THR A CG2   1 
ATOM   3128  N N     . LYS A 1 411 ? 26.267  -7.296  113.206 1.00 37.91 ? 408 LYS A N     1 
ATOM   3129  C CA    . LYS A 1 411 ? 27.575  -7.580  113.782 1.00 39.29 ? 408 LYS A CA    1 
ATOM   3130  C C     . LYS A 1 411 ? 28.253  -8.759  113.085 1.00 39.61 ? 408 LYS A C     1 
ATOM   3131  O O     . LYS A 1 411 ? 27.651  -9.823  112.935 1.00 40.01 ? 408 LYS A O     1 
ATOM   3132  C CB    . LYS A 1 411 ? 27.435  -7.873  115.275 1.00 41.06 ? 408 LYS A CB    1 
ATOM   3133  C CG    . LYS A 1 411 ? 27.024  -6.662  116.120 1.00 44.29 ? 408 LYS A CG    1 
ATOM   3134  C CD    . LYS A 1 411 ? 28.086  -5.561  116.089 1.00 43.97 ? 408 LYS A CD    1 
ATOM   3135  C CE    . LYS A 1 411 ? 29.396  -6.034  116.719 1.00 44.62 ? 408 LYS A CE    1 
ATOM   3136  N NZ    . LYS A 1 411 ? 30.436  -4.962  116.803 1.00 44.89 ? 408 LYS A NZ    1 
ATOM   3137  N N     . LEU A 1 412 ? 29.499  -8.560  112.653 1.00 39.78 ? 409 LEU A N     1 
ATOM   3138  C CA    . LEU A 1 412 ? 30.275  -9.609  111.995 1.00 38.68 ? 409 LEU A CA    1 
ATOM   3139  C C     . LEU A 1 412 ? 30.450  -10.751 112.975 1.00 40.70 ? 409 LEU A C     1 
ATOM   3140  O O     . LEU A 1 412 ? 30.691  -10.520 114.162 1.00 41.47 ? 409 LEU A O     1 
ATOM   3141  C CB    . LEU A 1 412 ? 31.674  -9.119  111.626 1.00 37.98 ? 409 LEU A CB    1 
ATOM   3142  C CG    . LEU A 1 412 ? 31.906  -8.169  110.461 1.00 36.27 ? 409 LEU A CG    1 
ATOM   3143  C CD1   . LEU A 1 412 ? 31.506  -8.837  109.168 1.00 34.35 ? 409 LEU A CD1   1 
ATOM   3144  C CD2   . LEU A 1 412 ? 31.109  -6.902  110.699 1.00 39.10 ? 409 LEU A CD2   1 
ATOM   3145  N N     . THR A 1 413 ? 30.339  -11.982 112.487 1.00 40.51 ? 410 THR A N     1 
ATOM   3146  C CA    . THR A 1 413 ? 30.524  -13.137 113.346 1.00 40.13 ? 410 THR A CA    1 
ATOM   3147  C C     . THR A 1 413 ? 32.025  -13.377 113.434 1.00 41.18 ? 410 THR A C     1 
ATOM   3148  O O     . THR A 1 413 ? 32.811  -12.707 112.756 1.00 41.43 ? 410 THR A O     1 
ATOM   3149  C CB    . THR A 1 413 ? 29.840  -14.396 112.765 1.00 40.71 ? 410 THR A CB    1 
ATOM   3150  O OG1   . THR A 1 413 ? 30.447  -14.743 111.511 1.00 41.90 ? 410 THR A OG1   1 
ATOM   3151  C CG2   . THR A 1 413 ? 28.364  -14.148 112.566 1.00 38.77 ? 410 THR A CG2   1 
ATOM   3152  N N     . GLU A 1 414 ? 32.425  -14.326 114.269 1.00 42.15 ? 411 GLU A N     1 
ATOM   3153  C CA    . GLU A 1 414 ? 33.833  -14.646 114.415 1.00 43.31 ? 411 GLU A CA    1 
ATOM   3154  C C     . GLU A 1 414 ? 34.438  -15.035 113.064 1.00 42.11 ? 411 GLU A C     1 
ATOM   3155  O O     . GLU A 1 414 ? 35.436  -14.447 112.633 1.00 40.58 ? 411 GLU A O     1 
ATOM   3156  C CB    . GLU A 1 414 ? 34.002  -15.794 115.417 1.00 45.44 ? 411 GLU A CB    1 
ATOM   3157  C CG    . GLU A 1 414 ? 35.435  -16.270 115.598 1.00 49.04 ? 411 GLU A CG    1 
ATOM   3158  C CD    . GLU A 1 414 ? 36.358  -15.162 116.061 1.00 51.60 ? 411 GLU A CD    1 
ATOM   3159  O OE1   . GLU A 1 414 ? 37.550  -15.441 116.320 1.00 54.21 ? 411 GLU A OE1   1 
ATOM   3160  O OE2   . GLU A 1 414 ? 35.888  -14.007 116.165 1.00 52.94 ? 411 GLU A OE2   1 
ATOM   3161  N N     . LYS A 1 415 ? 33.819  -16.009 112.396 1.00 41.24 ? 412 LYS A N     1 
ATOM   3162  C CA    . LYS A 1 415 ? 34.310  -16.484 111.099 1.00 41.74 ? 412 LYS A CA    1 
ATOM   3163  C C     . LYS A 1 415 ? 34.365  -15.363 110.068 1.00 40.53 ? 412 LYS A C     1 
ATOM   3164  O O     . LYS A 1 415 ? 35.393  -15.153 109.415 1.00 39.33 ? 412 LYS A O     1 
ATOM   3165  C CB    . LYS A 1 415 ? 33.423  -17.619 110.571 1.00 43.96 ? 412 LYS A CB    1 
ATOM   3166  C CG    . LYS A 1 415 ? 34.186  -18.748 109.870 1.00 47.59 ? 412 LYS A CG    1 
ATOM   3167  C CD    . LYS A 1 415 ? 34.983  -18.257 108.651 1.00 50.95 ? 412 LYS A CD    1 
ATOM   3168  C CE    . LYS A 1 415 ? 36.023  -19.280 108.158 1.00 52.05 ? 412 LYS A CE    1 
ATOM   3169  N NZ    . LYS A 1 415 ? 35.507  -20.669 107.926 1.00 54.14 ? 412 LYS A NZ    1 
ATOM   3170  N N     . GLN A 1 416 ? 33.253  -14.648 109.927 1.00 39.29 ? 413 GLN A N     1 
ATOM   3171  C CA    . GLN A 1 416 ? 33.177  -13.543 108.982 1.00 38.07 ? 413 GLN A CA    1 
ATOM   3172  C C     . GLN A 1 416 ? 34.313  -12.558 109.161 1.00 36.74 ? 413 GLN A C     1 
ATOM   3173  O O     . GLN A 1 416 ? 35.046  -12.282 108.211 1.00 38.01 ? 413 GLN A O     1 
ATOM   3174  C CB    . GLN A 1 416 ? 31.847  -12.816 109.124 1.00 38.77 ? 413 GLN A CB    1 
ATOM   3175  C CG    . GLN A 1 416 ? 30.720  -13.478 108.374 1.00 40.26 ? 413 GLN A CG    1 
ATOM   3176  C CD    . GLN A 1 416 ? 29.369  -12.878 108.697 1.00 41.53 ? 413 GLN A CD    1 
ATOM   3177  O OE1   . GLN A 1 416 ? 28.395  -13.109 107.986 1.00 41.98 ? 413 GLN A OE1   1 
ATOM   3178  N NE2   . GLN A 1 416 ? 29.299  -12.114 109.780 1.00 42.63 ? 413 GLN A NE2   1 
ATOM   3179  N N     . ALA A 1 417 ? 34.466  -12.032 110.373 1.00 35.35 ? 414 ALA A N     1 
ATOM   3180  C CA    . ALA A 1 417 ? 35.523  -11.058 110.645 1.00 34.86 ? 414 ALA A CA    1 
ATOM   3181  C C     . ALA A 1 417 ? 36.903  -11.595 110.281 1.00 35.52 ? 414 ALA A C     1 
ATOM   3182  O O     . ALA A 1 417 ? 37.766  -10.847 109.813 1.00 35.72 ? 414 ALA A O     1 
ATOM   3183  C CB    . ALA A 1 417 ? 35.483  -10.632 112.113 1.00 33.05 ? 414 ALA A CB    1 
ATOM   3184  N N     . GLN A 1 418 ? 37.111  -12.889 110.492 1.00 36.06 ? 415 GLN A N     1 
ATOM   3185  C CA    . GLN A 1 418 ? 38.392  -13.512 110.161 1.00 37.19 ? 415 GLN A CA    1 
ATOM   3186  C C     . GLN A 1 418 ? 38.610  -13.540 108.641 1.00 36.15 ? 415 GLN A C     1 
ATOM   3187  O O     . GLN A 1 418 ? 39.682  -13.176 108.143 1.00 32.37 ? 415 GLN A O     1 
ATOM   3188  C CB    . GLN A 1 418 ? 38.427  -14.941 110.707 1.00 39.86 ? 415 GLN A CB    1 
ATOM   3189  C CG    . GLN A 1 418 ? 38.578  -15.051 112.217 1.00 42.57 ? 415 GLN A CG    1 
ATOM   3190  C CD    . GLN A 1 418 ? 40.022  -14.897 112.652 1.00 44.92 ? 415 GLN A CD    1 
ATOM   3191  O OE1   . GLN A 1 418 ? 40.567  -13.794 112.686 1.00 44.64 ? 415 GLN A OE1   1 
ATOM   3192  N NE2   . GLN A 1 418 ? 40.659  -16.020 112.967 1.00 47.85 ? 415 GLN A NE2   1 
ATOM   3193  N N     . TYR A 1 419 ? 37.577  -13.983 107.925 1.00 36.44 ? 416 TYR A N     1 
ATOM   3194  C CA    . TYR A 1 419 ? 37.597  -14.085 106.467 1.00 36.86 ? 416 TYR A CA    1 
ATOM   3195  C C     . TYR A 1 419 ? 37.903  -12.731 105.822 1.00 35.94 ? 416 TYR A C     1 
ATOM   3196  O O     . TYR A 1 419 ? 38.708  -12.637 104.891 1.00 33.99 ? 416 TYR A O     1 
ATOM   3197  C CB    . TYR A 1 419 ? 36.236  -14.604 105.976 1.00 39.98 ? 416 TYR A CB    1 
ATOM   3198  C CG    . TYR A 1 419 ? 36.099  -14.681 104.471 1.00 41.35 ? 416 TYR A CG    1 
ATOM   3199  C CD1   . TYR A 1 419 ? 36.812  -15.628 103.732 1.00 42.23 ? 416 TYR A CD1   1 
ATOM   3200  C CD2   . TYR A 1 419 ? 35.291  -13.779 103.781 1.00 41.18 ? 416 TYR A CD2   1 
ATOM   3201  C CE1   . TYR A 1 419 ? 36.728  -15.670 102.342 1.00 41.94 ? 416 TYR A CE1   1 
ATOM   3202  C CE2   . TYR A 1 419 ? 35.199  -13.813 102.393 1.00 41.67 ? 416 TYR A CE2   1 
ATOM   3203  C CZ    . TYR A 1 419 ? 35.921  -14.759 101.679 1.00 41.71 ? 416 TYR A CZ    1 
ATOM   3204  O OH    . TYR A 1 419 ? 35.837  -14.783 100.306 1.00 40.79 ? 416 TYR A OH    1 
ATOM   3205  N N     . LEU A 1 420 ? 37.249  -11.690 106.331 1.00 34.81 ? 417 LEU A N     1 
ATOM   3206  C CA    . LEU A 1 420 ? 37.433  -10.333 105.836 1.00 34.78 ? 417 LEU A CA    1 
ATOM   3207  C C     . LEU A 1 420 ? 38.730  -9.717  106.342 1.00 35.51 ? 417 LEU A C     1 
ATOM   3208  O O     . LEU A 1 420 ? 39.256  -8.783  105.740 1.00 36.08 ? 417 LEU A O     1 
ATOM   3209  C CB    . LEU A 1 420 ? 36.254  -9.453  106.259 1.00 33.20 ? 417 LEU A CB    1 
ATOM   3210  C CG    . LEU A 1 420 ? 34.916  -9.738  105.577 1.00 32.87 ? 417 LEU A CG    1 
ATOM   3211  C CD1   . LEU A 1 420 ? 33.834  -8.764  106.054 1.00 31.97 ? 417 LEU A CD1   1 
ATOM   3212  C CD2   . LEU A 1 420 ? 35.113  -9.624  104.083 1.00 31.56 ? 417 LEU A CD2   1 
ATOM   3213  N N     . GLY A 1 421 ? 39.244  -10.232 107.451 1.00 36.02 ? 418 GLY A N     1 
ATOM   3214  C CA    . GLY A 1 421 ? 40.475  -9.688  107.982 1.00 37.66 ? 418 GLY A CA    1 
ATOM   3215  C C     . GLY A 1 421 ? 40.266  -8.308  108.584 1.00 40.07 ? 418 GLY A C     1 
ATOM   3216  O O     . GLY A 1 421 ? 40.933  -7.338  108.192 1.00 38.67 ? 418 GLY A O     1 
ATOM   3217  N N     . MET A 1 422 ? 39.328  -8.220  109.528 1.00 41.84 ? 419 MET A N     1 
ATOM   3218  C CA    . MET A 1 422 ? 39.022  -6.966  110.221 1.00 44.07 ? 419 MET A CA    1 
ATOM   3219  C C     . MET A 1 422 ? 38.228  -7.189  111.509 1.00 44.58 ? 419 MET A C     1 
ATOM   3220  O O     . MET A 1 422 ? 37.381  -8.079  111.586 1.00 44.54 ? 419 MET A O     1 
ATOM   3221  C CB    . MET A 1 422 ? 38.256  -6.008  109.300 1.00 44.01 ? 419 MET A CB    1 
ATOM   3222  C CG    . MET A 1 422 ? 37.092  -6.650  108.578 1.00 43.68 ? 419 MET A CG    1 
ATOM   3223  S SD    . MET A 1 422 ? 36.105  -5.455  107.655 1.00 42.80 ? 419 MET A SD    1 
ATOM   3224  C CE    . MET A 1 422 ? 34.451  -5.888  108.266 1.00 43.59 ? 419 MET A CE    1 
ATOM   3225  N N     . SER A 1 423 ? 38.516  -6.380  112.525 1.00 45.67 ? 420 SER A N     1 
ATOM   3226  C CA    . SER A 1 423 ? 37.827  -6.507  113.803 1.00 46.77 ? 420 SER A CA    1 
ATOM   3227  C C     . SER A 1 423 ? 36.333  -6.319  113.626 1.00 47.70 ? 420 SER A C     1 
ATOM   3228  O O     . SER A 1 423 ? 35.891  -5.451  112.880 1.00 47.61 ? 420 SER A O     1 
ATOM   3229  C CB    . SER A 1 423 ? 38.329  -5.474  114.810 1.00 46.20 ? 420 SER A CB    1 
ATOM   3230  O OG    . SER A 1 423 ? 37.590  -5.585  116.016 1.00 46.04 ? 420 SER A OG    1 
ATOM   3231  N N     . CYS A 1 424 ? 35.550  -7.124  114.325 1.00 48.89 ? 421 CYS A N     1 
ATOM   3232  C CA    . CYS A 1 424 ? 34.110  -7.002  114.221 1.00 50.80 ? 421 CYS A CA    1 
ATOM   3233  C C     . CYS A 1 424 ? 33.662  -5.692  114.871 1.00 51.08 ? 421 CYS A C     1 
ATOM   3234  O O     . CYS A 1 424 ? 32.466  -5.433  115.014 1.00 51.72 ? 421 CYS A O     1 
ATOM   3235  C CB    . CYS A 1 424 ? 33.438  -8.194  114.894 1.00 52.08 ? 421 CYS A CB    1 
ATOM   3236  S SG    . CYS A 1 424 ? 33.893  -8.378  116.614 1.00 56.73 ? 421 CYS A SG    1 
ATOM   3237  N N     . ASP A 1 425 ? 34.634  -4.871  115.259 1.00 50.75 ? 422 ASP A N     1 
ATOM   3238  C CA    . ASP A 1 425 ? 34.364  -3.574  115.874 1.00 50.09 ? 422 ASP A CA    1 
ATOM   3239  C C     . ASP A 1 425 ? 35.254  -2.508  115.258 1.00 48.89 ? 422 ASP A C     1 
ATOM   3240  O O     . ASP A 1 425 ? 34.824  -1.377  115.039 1.00 48.71 ? 422 ASP A O     1 
ATOM   3241  C CB    . ASP A 1 425 ? 34.622  -3.624  117.384 1.00 50.87 ? 422 ASP A CB    1 
ATOM   3242  C CG    . ASP A 1 425 ? 33.451  -4.194  118.159 1.00 51.83 ? 422 ASP A CG    1 
ATOM   3243  O OD1   . ASP A 1 425 ? 32.340  -3.629  118.050 1.00 53.18 ? 422 ASP A OD1   1 
ATOM   3244  O OD2   . ASP A 1 425 ? 33.643  -5.199  118.877 1.00 51.68 ? 422 ASP A OD2   1 
ATOM   3245  N N     . GLY A 1 426 ? 36.504  -2.884  114.993 1.00 47.62 ? 423 GLY A N     1 
ATOM   3246  C CA    . GLY A 1 426 ? 37.473  -1.966  114.410 1.00 44.04 ? 423 GLY A CA    1 
ATOM   3247  C C     . GLY A 1 426 ? 36.994  -1.352  113.117 1.00 40.19 ? 423 GLY A C     1 
ATOM   3248  O O     . GLY A 1 426 ? 35.904  -1.693  112.658 1.00 41.41 ? 423 GLY A O     1 
ATOM   3249  N N     . PRO A 1 427 ? 37.772  -0.443  112.505 1.00 37.47 ? 424 PRO A N     1 
ATOM   3250  C CA    . PRO A 1 427 ? 37.388  0.206   111.243 1.00 36.04 ? 424 PRO A CA    1 
ATOM   3251  C C     . PRO A 1 427 ? 37.025  -0.828  110.187 1.00 34.35 ? 424 PRO A C     1 
ATOM   3252  O O     . PRO A 1 427 ? 37.730  -1.813  110.007 1.00 33.92 ? 424 PRO A O     1 
ATOM   3253  C CB    . PRO A 1 427 ? 38.635  1.016   110.875 1.00 36.45 ? 424 PRO A CB    1 
ATOM   3254  C CG    . PRO A 1 427 ? 39.746  0.240   111.518 1.00 35.42 ? 424 PRO A CG    1 
ATOM   3255  C CD    . PRO A 1 427 ? 39.156  -0.095  112.863 1.00 36.02 ? 424 PRO A CD    1 
ATOM   3256  N N     . PHE A 1 428 ? 35.917  -0.593  109.493 1.00 34.71 ? 425 PHE A N     1 
ATOM   3257  C CA    . PHE A 1 428 ? 35.433  -1.524  108.474 1.00 32.55 ? 425 PHE A CA    1 
ATOM   3258  C C     . PHE A 1 428 ? 35.930  -1.268  107.063 1.00 32.27 ? 425 PHE A C     1 
ATOM   3259  O O     . PHE A 1 428 ? 35.826  -2.144  106.205 1.00 33.50 ? 425 PHE A O     1 
ATOM   3260  C CB    . PHE A 1 428 ? 33.915  -1.524  108.468 1.00 30.48 ? 425 PHE A CB    1 
ATOM   3261  C CG    . PHE A 1 428 ? 33.312  -1.864  109.798 1.00 31.71 ? 425 PHE A CG    1 
ATOM   3262  C CD1   . PHE A 1 428 ? 33.419  -3.153  110.316 1.00 30.23 ? 425 PHE A CD1   1 
ATOM   3263  C CD2   . PHE A 1 428 ? 32.649  -0.887  110.544 1.00 30.21 ? 425 PHE A CD2   1 
ATOM   3264  C CE1   . PHE A 1 428 ? 32.881  -3.470  111.555 1.00 30.37 ? 425 PHE A CE1   1 
ATOM   3265  C CE2   . PHE A 1 428 ? 32.105  -1.198  111.787 1.00 31.04 ? 425 PHE A CE2   1 
ATOM   3266  C CZ    . PHE A 1 428 ? 32.222  -2.490  112.291 1.00 31.01 ? 425 PHE A CZ    1 
ATOM   3267  N N     . LYS A 1 429 ? 36.474  -0.079  106.824 1.00 30.97 ? 426 LYS A N     1 
ATOM   3268  C CA    . LYS A 1 429 ? 36.960  0.270   105.496 1.00 30.74 ? 426 LYS A CA    1 
ATOM   3269  C C     . LYS A 1 429 ? 38.385  0.813   105.449 1.00 30.67 ? 426 LYS A C     1 
ATOM   3270  O O     . LYS A 1 429 ? 38.892  1.379   106.414 1.00 30.90 ? 426 LYS A O     1 
ATOM   3271  C CB    . LYS A 1 429 ? 36.028  1.298   104.833 1.00 30.95 ? 426 LYS A CB    1 
ATOM   3272  C CG    . LYS A 1 429 ? 34.986  0.723   103.872 1.00 30.82 ? 426 LYS A CG    1 
ATOM   3273  C CD    . LYS A 1 429 ? 33.869  0.020   104.609 1.00 29.55 ? 426 LYS A CD    1 
ATOM   3274  C CE    . LYS A 1 429 ? 32.807  -0.507  103.667 1.00 24.50 ? 426 LYS A CE    1 
ATOM   3275  N NZ    . LYS A 1 429 ? 31.618  -0.777  104.495 1.00 23.03 ? 426 LYS A NZ    1 
ATOM   3276  N N     . PRO A 1 430 ? 39.052  0.634   104.302 1.00 31.38 ? 427 PRO A N     1 
ATOM   3277  C CA    . PRO A 1 430 ? 40.416  1.118   104.132 1.00 31.64 ? 427 PRO A CA    1 
ATOM   3278  C C     . PRO A 1 430 ? 40.417  2.635   104.128 1.00 33.07 ? 427 PRO A C     1 
ATOM   3279  O O     . PRO A 1 430 ? 39.422  3.277   103.789 1.00 32.68 ? 427 PRO A O     1 
ATOM   3280  C CB    . PRO A 1 430 ? 40.826  0.527   102.793 1.00 30.10 ? 427 PRO A CB    1 
ATOM   3281  C CG    . PRO A 1 430 ? 39.539  0.480   102.046 1.00 31.41 ? 427 PRO A CG    1 
ATOM   3282  C CD    . PRO A 1 430 ? 38.597  -0.064  103.088 1.00 30.07 ? 427 PRO A CD    1 
ATOM   3283  N N     . ASP A 1 431 ? 41.550  3.197   104.506 1.00 35.64 ? 428 ASP A N     1 
ATOM   3284  C CA    . ASP A 1 431 ? 41.712  4.630   104.577 1.00 38.62 ? 428 ASP A CA    1 
ATOM   3285  C C     . ASP A 1 431 ? 41.269  5.377   103.317 1.00 37.73 ? 428 ASP A C     1 
ATOM   3286  O O     . ASP A 1 431 ? 40.790  6.507   103.406 1.00 36.97 ? 428 ASP A O     1 
ATOM   3287  C CB    . ASP A 1 431 ? 43.173  4.946   104.892 1.00 42.43 ? 428 ASP A CB    1 
ATOM   3288  C CG    . ASP A 1 431 ? 43.373  6.378   105.300 1.00 46.28 ? 428 ASP A CG    1 
ATOM   3289  O OD1   . ASP A 1 431 ? 42.596  6.859   106.150 1.00 49.41 ? 428 ASP A OD1   1 
ATOM   3290  O OD2   . ASP A 1 431 ? 44.307  7.018   104.779 1.00 49.89 ? 428 ASP A OD2   1 
ATOM   3291  N N     . HIS A 1 432 ? 41.405  4.750   102.153 1.00 36.99 ? 429 HIS A N     1 
ATOM   3292  C CA    . HIS A 1 432 ? 41.042  5.411   100.897 1.00 37.00 ? 429 HIS A CA    1 
ATOM   3293  C C     . HIS A 1 432 ? 39.598  5.231   100.423 1.00 35.03 ? 429 HIS A C     1 
ATOM   3294  O O     . HIS A 1 432 ? 39.220  5.771   99.377  1.00 34.65 ? 429 HIS A O     1 
ATOM   3295  C CB    . HIS A 1 432 ? 41.977  4.949   99.777  1.00 40.06 ? 429 HIS A CB    1 
ATOM   3296  C CG    . HIS A 1 432 ? 41.875  3.486   99.486  1.00 42.69 ? 429 HIS A CG    1 
ATOM   3297  N ND1   . HIS A 1 432 ? 42.373  2.522   100.337 1.00 43.22 ? 429 HIS A ND1   1 
ATOM   3298  C CD2   . HIS A 1 432 ? 41.271  2.821   98.475  1.00 43.37 ? 429 HIS A CD2   1 
ATOM   3299  C CE1   . HIS A 1 432 ? 42.079  1.325   99.863  1.00 44.27 ? 429 HIS A CE1   1 
ATOM   3300  N NE2   . HIS A 1 432 ? 41.409  1.479   98.734  1.00 46.07 ? 429 HIS A NE2   1 
ATOM   3301  N N     . TYR A 1 433 ? 38.798  4.481   101.177 1.00 32.44 ? 430 TYR A N     1 
ATOM   3302  C CA    . TYR A 1 433 ? 37.399  4.243   100.800 1.00 30.03 ? 430 TYR A CA    1 
ATOM   3303  C C     . TYR A 1 433 ? 36.668  5.565   100.522 1.00 27.95 ? 430 TYR A C     1 
ATOM   3304  O O     . TYR A 1 433 ? 36.929  6.569   101.182 1.00 29.47 ? 430 TYR A O     1 
ATOM   3305  C CB    . TYR A 1 433 ? 36.676  3.467   101.912 1.00 27.06 ? 430 TYR A CB    1 
ATOM   3306  C CG    . TYR A 1 433 ? 35.400  2.837   101.442 1.00 25.51 ? 430 TYR A CG    1 
ATOM   3307  C CD1   . TYR A 1 433 ? 35.423  1.810   100.497 1.00 26.40 ? 430 TYR A CD1   1 
ATOM   3308  C CD2   . TYR A 1 433 ? 34.171  3.296   101.888 1.00 23.34 ? 430 TYR A CD2   1 
ATOM   3309  C CE1   . TYR A 1 433 ? 34.249  1.263   100.001 1.00 25.37 ? 430 TYR A CE1   1 
ATOM   3310  C CE2   . TYR A 1 433 ? 32.986  2.758   101.402 1.00 26.25 ? 430 TYR A CE2   1 
ATOM   3311  C CZ    . TYR A 1 433 ? 33.028  1.740   100.455 1.00 26.30 ? 430 TYR A CZ    1 
ATOM   3312  O OH    . TYR A 1 433 ? 31.852  1.215   99.968  1.00 24.54 ? 430 TYR A OH    1 
ATOM   3313  N N     . ARG A 1 434 ? 35.759  5.566   99.548  1.00 25.70 ? 431 ARG A N     1 
ATOM   3314  C CA    . ARG A 1 434 ? 35.021  6.780   99.189  1.00 25.02 ? 431 ARG A CA    1 
ATOM   3315  C C     . ARG A 1 434 ? 33.531  6.746   99.509  1.00 24.92 ? 431 ARG A C     1 
ATOM   3316  O O     . ARG A 1 434 ? 32.832  7.747   99.336  1.00 25.94 ? 431 ARG A O     1 
ATOM   3317  C CB    . ARG A 1 434 ? 35.205  7.096   97.691  1.00 23.28 ? 431 ARG A CB    1 
ATOM   3318  C CG    . ARG A 1 434 ? 36.649  7.392   97.283  1.00 21.13 ? 431 ARG A CG    1 
ATOM   3319  C CD    . ARG A 1 434 ? 36.753  8.027   95.915  1.00 20.16 ? 431 ARG A CD    1 
ATOM   3320  N NE    . ARG A 1 434 ? 38.147  8.292   95.570  1.00 20.34 ? 431 ARG A NE    1 
ATOM   3321  C CZ    . ARG A 1 434 ? 38.968  7.410   95.006  1.00 20.99 ? 431 ARG A CZ    1 
ATOM   3322  N NH1   . ARG A 1 434 ? 38.535  6.192   94.702  1.00 19.61 ? 431 ARG A NH1   1 
ATOM   3323  N NH2   . ARG A 1 434 ? 40.234  7.736   94.776  1.00 19.38 ? 431 ARG A NH2   1 
ATOM   3324  N N     . TYR A 1 435 ? 33.036  5.604   99.970  1.00 25.34 ? 432 TYR A N     1 
ATOM   3325  C CA    . TYR A 1 435 ? 31.618  5.475   100.310 1.00 26.58 ? 432 TYR A CA    1 
ATOM   3326  C C     . TYR A 1 435 ? 30.733  5.947   99.171  1.00 27.49 ? 432 TYR A C     1 
ATOM   3327  O O     . TYR A 1 435 ? 31.187  5.906   98.014  1.00 30.00 ? 432 TYR A O     1 
ATOM   3328  C CB    . TYR A 1 435 ? 31.290  6.263   101.591 1.00 25.20 ? 432 TYR A CB    1 
ATOM   3329  C CG    . TYR A 1 435 ? 32.144  5.876   102.781 1.00 24.17 ? 432 TYR A CG    1 
ATOM   3330  C CD1   . TYR A 1 435 ? 33.439  6.371   102.920 1.00 23.86 ? 432 TYR A CD1   1 
ATOM   3331  C CD2   . TYR A 1 435 ? 31.687  4.950   103.724 1.00 24.10 ? 432 TYR A CD2   1 
ATOM   3332  C CE1   . TYR A 1 435 ? 34.265  5.947   103.959 1.00 25.17 ? 432 TYR A CE1   1 
ATOM   3333  C CE2   . TYR A 1 435 ? 32.498  4.520   104.763 1.00 23.30 ? 432 TYR A CE2   1 
ATOM   3334  C CZ    . TYR A 1 435 ? 33.794  5.017   104.877 1.00 25.86 ? 432 TYR A CZ    1 
ATOM   3335  O OH    . TYR A 1 435 ? 34.646  4.568   105.869 1.00 22.82 ? 432 TYR A OH    1 
ATOM   3336  O OXT   . TYR A 1 435 ? 29.564  6.316   99.426  1.00 36.16 ? 432 TYR A OXT   1 
ATOM   3337  N N     . ASP B 1 6   ? 49.719  -31.989 74.451  1.00 63.62 ? 3   ASP B N     1 
ATOM   3338  C CA    . ASP B 1 6   ? 50.123  -30.780 73.671  1.00 64.15 ? 3   ASP B CA    1 
ATOM   3339  C C     . ASP B 1 6   ? 49.356  -29.528 74.092  1.00 62.52 ? 3   ASP B C     1 
ATOM   3340  O O     . ASP B 1 6   ? 48.453  -29.584 74.929  1.00 62.67 ? 3   ASP B O     1 
ATOM   3341  C CB    . ASP B 1 6   ? 49.925  -31.025 72.168  1.00 66.42 ? 3   ASP B CB    1 
ATOM   3342  C CG    . ASP B 1 6   ? 50.912  -32.037 71.607  1.00 67.99 ? 3   ASP B CG    1 
ATOM   3343  O OD1   . ASP B 1 6   ? 51.003  -33.153 72.167  1.00 68.47 ? 3   ASP B OD1   1 
ATOM   3344  O OD2   . ASP B 1 6   ? 51.593  -31.717 70.609  1.00 68.50 ? 3   ASP B OD2   1 
ATOM   3345  N N     . LYS B 1 7   ? 49.728  -28.398 73.496  1.00 60.08 ? 4   LYS B N     1 
ATOM   3346  C CA    . LYS B 1 7   ? 49.109  -27.114 73.800  1.00 56.78 ? 4   LYS B CA    1 
ATOM   3347  C C     . LYS B 1 7   ? 48.141  -26.697 72.701  1.00 53.97 ? 4   LYS B C     1 
ATOM   3348  O O     . LYS B 1 7   ? 48.565  -26.400 71.586  1.00 53.20 ? 4   LYS B O     1 
ATOM   3349  C CB    . LYS B 1 7   ? 50.192  -26.042 73.943  1.00 57.28 ? 4   LYS B CB    1 
ATOM   3350  C CG    . LYS B 1 7   ? 49.706  -24.688 74.432  1.00 56.82 ? 4   LYS B CG    1 
ATOM   3351  C CD    . LYS B 1 7   ? 49.331  -24.755 75.905  1.00 57.80 ? 4   LYS B CD    1 
ATOM   3352  C CE    . LYS B 1 7   ? 49.103  -23.370 76.502  1.00 57.40 ? 4   LYS B CE    1 
ATOM   3353  N NZ    . LYS B 1 7   ? 50.313  -22.507 76.429  1.00 55.95 ? 4   LYS B NZ    1 
ATOM   3354  N N     . LEU B 1 8   ? 46.847  -26.676 73.011  1.00 50.53 ? 5   LEU B N     1 
ATOM   3355  C CA    . LEU B 1 8   ? 45.853  -26.259 72.027  1.00 47.60 ? 5   LEU B CA    1 
ATOM   3356  C C     . LEU B 1 8   ? 45.971  -24.753 71.810  1.00 45.39 ? 5   LEU B C     1 
ATOM   3357  O O     . LEU B 1 8   ? 46.208  -24.005 72.757  1.00 45.53 ? 5   LEU B O     1 
ATOM   3358  C CB    . LEU B 1 8   ? 44.436  -26.584 72.503  1.00 47.94 ? 5   LEU B CB    1 
ATOM   3359  C CG    . LEU B 1 8   ? 44.027  -28.045 72.699  1.00 46.15 ? 5   LEU B CG    1 
ATOM   3360  C CD1   . LEU B 1 8   ? 44.735  -28.618 73.908  1.00 46.50 ? 5   LEU B CD1   1 
ATOM   3361  C CD2   . LEU B 1 8   ? 42.523  -28.124 72.892  1.00 45.81 ? 5   LEU B CD2   1 
ATOM   3362  N N     . PRO B 1 9   ? 45.801  -24.287 70.564  1.00 43.42 ? 6   PRO B N     1 
ATOM   3363  C CA    . PRO B 1 9   ? 45.899  -22.855 70.255  1.00 42.11 ? 6   PRO B CA    1 
ATOM   3364  C C     . PRO B 1 9   ? 44.802  -22.022 70.901  1.00 40.92 ? 6   PRO B C     1 
ATOM   3365  O O     . PRO B 1 9   ? 44.863  -20.794 70.904  1.00 41.31 ? 6   PRO B O     1 
ATOM   3366  C CB    . PRO B 1 9   ? 45.817  -22.827 68.732  1.00 41.84 ? 6   PRO B CB    1 
ATOM   3367  C CG    . PRO B 1 9   ? 44.908  -23.971 68.434  1.00 43.23 ? 6   PRO B CG    1 
ATOM   3368  C CD    . PRO B 1 9   ? 45.423  -25.054 69.363  1.00 43.60 ? 6   PRO B CD    1 
ATOM   3369  N N     . TYR B 1 10  ? 43.800  -22.705 71.444  1.00 41.02 ? 7   TYR B N     1 
ATOM   3370  C CA    . TYR B 1 10  ? 42.659  -22.063 72.093  1.00 39.78 ? 7   TYR B CA    1 
ATOM   3371  C C     . TYR B 1 10  ? 41.671  -23.160 72.453  1.00 38.44 ? 7   TYR B C     1 
ATOM   3372  O O     . TYR B 1 10  ? 41.939  -24.337 72.218  1.00 39.67 ? 7   TYR B O     1 
ATOM   3373  C CB    . TYR B 1 10  ? 41.986  -21.057 71.138  1.00 39.71 ? 7   TYR B CB    1 
ATOM   3374  C CG    . TYR B 1 10  ? 41.394  -21.653 69.860  1.00 40.48 ? 7   TYR B CG    1 
ATOM   3375  C CD1   . TYR B 1 10  ? 40.231  -22.436 69.890  1.00 41.84 ? 7   TYR B CD1   1 
ATOM   3376  C CD2   . TYR B 1 10  ? 41.994  -21.422 68.617  1.00 40.46 ? 7   TYR B CD2   1 
ATOM   3377  C CE1   . TYR B 1 10  ? 39.681  -22.974 68.711  1.00 41.43 ? 7   TYR B CE1   1 
ATOM   3378  C CE2   . TYR B 1 10  ? 41.456  -21.952 67.439  1.00 40.15 ? 7   TYR B CE2   1 
ATOM   3379  C CZ    . TYR B 1 10  ? 40.303  -22.727 67.488  1.00 41.67 ? 7   TYR B CZ    1 
ATOM   3380  O OH    . TYR B 1 10  ? 39.795  -23.263 66.319  1.00 38.93 ? 7   TYR B OH    1 
ATOM   3381  N N     . LYS B 1 11  ? 40.538  -22.773 73.030  1.00 36.57 ? 8   LYS B N     1 
ATOM   3382  C CA    . LYS B 1 11  ? 39.481  -23.715 73.395  1.00 35.87 ? 8   LYS B CA    1 
ATOM   3383  C C     . LYS B 1 11  ? 38.242  -22.947 73.838  1.00 34.97 ? 8   LYS B C     1 
ATOM   3384  O O     . LYS B 1 11  ? 38.228  -22.313 74.906  1.00 33.48 ? 8   LYS B O     1 
ATOM   3385  C CB    . LYS B 1 11  ? 39.929  -24.661 74.511  1.00 35.46 ? 8   LYS B CB    1 
ATOM   3386  C CG    . LYS B 1 11  ? 38.936  -25.811 74.708  1.00 38.24 ? 8   LYS B CG    1 
ATOM   3387  C CD    . LYS B 1 11  ? 39.303  -26.734 75.849  1.00 40.01 ? 8   LYS B CD    1 
ATOM   3388  C CE    . LYS B 1 11  ? 38.271  -27.850 75.968  1.00 42.18 ? 8   LYS B CE    1 
ATOM   3389  N NZ    . LYS B 1 11  ? 38.451  -28.684 77.189  1.00 43.56 ? 8   LYS B NZ    1 
ATOM   3390  N N     . VAL B 1 12  ? 37.209  -23.015 73.002  1.00 33.84 ? 9   VAL B N     1 
ATOM   3391  C CA    . VAL B 1 12  ? 35.945  -22.323 73.231  1.00 33.21 ? 9   VAL B CA    1 
ATOM   3392  C C     . VAL B 1 12  ? 34.762  -23.239 72.954  1.00 33.55 ? 9   VAL B C     1 
ATOM   3393  O O     . VAL B 1 12  ? 34.941  -24.354 72.481  1.00 34.15 ? 9   VAL B O     1 
ATOM   3394  C CB    . VAL B 1 12  ? 35.828  -21.113 72.304  1.00 33.80 ? 9   VAL B CB    1 
ATOM   3395  C CG1   . VAL B 1 12  ? 36.829  -20.060 72.715  1.00 34.77 ? 9   VAL B CG1   1 
ATOM   3396  C CG2   . VAL B 1 12  ? 36.079  -21.540 70.859  1.00 30.73 ? 9   VAL B CG2   1 
ATOM   3397  N N     . ALA B 1 13  ? 33.553  -22.760 73.223  1.00 32.58 ? 10  ALA B N     1 
ATOM   3398  C CA    . ALA B 1 13  ? 32.365  -23.580 72.992  1.00 33.44 ? 10  ALA B CA    1 
ATOM   3399  C C     . ALA B 1 13  ? 32.169  -23.951 71.518  1.00 33.09 ? 10  ALA B C     1 
ATOM   3400  O O     . ALA B 1 13  ? 31.979  -25.113 71.193  1.00 32.43 ? 10  ALA B O     1 
ATOM   3401  C CB    . ALA B 1 13  ? 31.124  -22.858 73.516  1.00 32.96 ? 10  ALA B CB    1 
ATOM   3402  N N     . ASP B 1 14  ? 32.208  -22.946 70.645  1.00 35.09 ? 11  ASP B N     1 
ATOM   3403  C CA    . ASP B 1 14  ? 32.021  -23.122 69.203  1.00 35.85 ? 11  ASP B CA    1 
ATOM   3404  C C     . ASP B 1 14  ? 32.526  -21.875 68.506  1.00 35.18 ? 11  ASP B C     1 
ATOM   3405  O O     . ASP B 1 14  ? 31.928  -20.806 68.628  1.00 35.71 ? 11  ASP B O     1 
ATOM   3406  C CB    . ASP B 1 14  ? 30.540  -23.318 68.867  1.00 38.01 ? 11  ASP B CB    1 
ATOM   3407  C CG    . ASP B 1 14  ? 30.265  -23.320 67.361  1.00 41.27 ? 11  ASP B CG    1 
ATOM   3408  O OD1   . ASP B 1 14  ? 31.227  -23.404 66.567  1.00 42.17 ? 11  ASP B OD1   1 
ATOM   3409  O OD2   . ASP B 1 14  ? 29.075  -23.249 66.968  1.00 42.15 ? 11  ASP B OD2   1 
ATOM   3410  N N     . ILE B 1 15  ? 33.629  -22.026 67.780  1.00 35.37 ? 12  ILE B N     1 
ATOM   3411  C CA    . ILE B 1 15  ? 34.250  -20.924 67.060  1.00 35.15 ? 12  ILE B CA    1 
ATOM   3412  C C     . ILE B 1 15  ? 33.383  -20.514 65.878  1.00 33.78 ? 12  ILE B C     1 
ATOM   3413  O O     . ILE B 1 15  ? 33.693  -19.569 65.162  1.00 33.15 ? 12  ILE B O     1 
ATOM   3414  C CB    . ILE B 1 15  ? 35.669  -21.312 66.565  1.00 35.82 ? 12  ILE B CB    1 
ATOM   3415  C CG1   . ILE B 1 15  ? 36.481  -20.053 66.254  1.00 37.51 ? 12  ILE B CG1   1 
ATOM   3416  C CG2   . ILE B 1 15  ? 35.576  -22.177 65.316  1.00 35.80 ? 12  ILE B CG2   1 
ATOM   3417  C CD1   . ILE B 1 15  ? 37.943  -20.328 65.951  1.00 37.12 ? 12  ILE B CD1   1 
ATOM   3418  N N     . GLY B 1 16  ? 32.291  -21.237 65.676  1.00 33.33 ? 13  GLY B N     1 
ATOM   3419  C CA    . GLY B 1 16  ? 31.397  -20.904 64.588  1.00 34.44 ? 13  GLY B CA    1 
ATOM   3420  C C     . GLY B 1 16  ? 30.608  -19.659 64.950  1.00 34.82 ? 13  GLY B C     1 
ATOM   3421  O O     . GLY B 1 16  ? 29.899  -19.103 64.117  1.00 34.47 ? 13  GLY B O     1 
ATOM   3422  N N     . LEU B 1 17  ? 30.741  -19.218 66.197  1.00 34.79 ? 14  LEU B N     1 
ATOM   3423  C CA    . LEU B 1 17  ? 30.033  -18.036 66.678  1.00 34.26 ? 14  LEU B CA    1 
ATOM   3424  C C     . LEU B 1 17  ? 30.821  -16.760 66.417  1.00 34.28 ? 14  LEU B C     1 
ATOM   3425  O O     . LEU B 1 17  ? 30.339  -15.660 66.661  1.00 35.15 ? 14  LEU B O     1 
ATOM   3426  C CB    . LEU B 1 17  ? 29.753  -18.170 68.179  1.00 34.64 ? 14  LEU B CB    1 
ATOM   3427  C CG    . LEU B 1 17  ? 28.559  -19.017 68.640  1.00 33.77 ? 14  LEU B CG    1 
ATOM   3428  C CD1   . LEU B 1 17  ? 28.553  -20.343 67.930  1.00 36.62 ? 14  LEU B CD1   1 
ATOM   3429  C CD2   . LEU B 1 17  ? 28.630  -19.229 70.137  1.00 30.82 ? 14  LEU B CD2   1 
ATOM   3430  N N     . ALA B 1 18  ? 32.035  -16.909 65.908  1.00 34.97 ? 15  ALA B N     1 
ATOM   3431  C CA    . ALA B 1 18  ? 32.891  -15.769 65.635  1.00 34.05 ? 15  ALA B CA    1 
ATOM   3432  C C     . ALA B 1 18  ? 32.226  -14.652 64.839  1.00 34.66 ? 15  ALA B C     1 
ATOM   3433  O O     . ALA B 1 18  ? 32.413  -13.483 65.155  1.00 35.02 ? 15  ALA B O     1 
ATOM   3434  C CB    . ALA B 1 18  ? 34.148  -16.231 64.925  1.00 33.63 ? 15  ALA B CB    1 
ATOM   3435  N N     . ALA B 1 19  ? 31.466  -14.996 63.803  1.00 34.75 ? 16  ALA B N     1 
ATOM   3436  C CA    . ALA B 1 19  ? 30.818  -13.964 62.987  1.00 33.89 ? 16  ALA B CA    1 
ATOM   3437  C C     . ALA B 1 19  ? 29.913  -13.091 63.843  1.00 32.72 ? 16  ALA B C     1 
ATOM   3438  O O     . ALA B 1 19  ? 29.965  -11.866 63.769  1.00 31.98 ? 16  ALA B O     1 
ATOM   3439  C CB    . ALA B 1 19  ? 30.015  -14.592 61.849  1.00 32.52 ? 16  ALA B CB    1 
ATOM   3440  N N     . TRP B 1 20  ? 29.084  -13.733 64.654  1.00 31.26 ? 17  TRP B N     1 
ATOM   3441  C CA    . TRP B 1 20  ? 28.171  -13.006 65.518  1.00 32.33 ? 17  TRP B CA    1 
ATOM   3442  C C     . TRP B 1 20  ? 28.955  -12.222 66.584  1.00 31.90 ? 17  TRP B C     1 
ATOM   3443  O O     . TRP B 1 20  ? 28.629  -11.066 66.879  1.00 29.14 ? 17  TRP B O     1 
ATOM   3444  C CB    . TRP B 1 20  ? 27.185  -13.987 66.161  1.00 31.41 ? 17  TRP B CB    1 
ATOM   3445  C CG    . TRP B 1 20  ? 26.240  -13.366 67.129  1.00 32.23 ? 17  TRP B CG    1 
ATOM   3446  C CD1   . TRP B 1 20  ? 25.756  -12.090 67.101  1.00 31.03 ? 17  TRP B CD1   1 
ATOM   3447  C CD2   . TRP B 1 20  ? 25.625  -14.009 68.252  1.00 32.67 ? 17  TRP B CD2   1 
ATOM   3448  N NE1   . TRP B 1 20  ? 24.878  -11.899 68.139  1.00 32.82 ? 17  TRP B NE1   1 
ATOM   3449  C CE2   . TRP B 1 20  ? 24.778  -13.061 68.860  1.00 33.14 ? 17  TRP B CE2   1 
ATOM   3450  C CE3   . TRP B 1 20  ? 25.705  -15.296 68.802  1.00 32.36 ? 17  TRP B CE3   1 
ATOM   3451  C CZ2   . TRP B 1 20  ? 24.016  -13.360 69.992  1.00 34.17 ? 17  TRP B CZ2   1 
ATOM   3452  C CZ3   . TRP B 1 20  ? 24.945  -15.592 69.931  1.00 32.88 ? 17  TRP B CZ3   1 
ATOM   3453  C CH2   . TRP B 1 20  ? 24.114  -14.630 70.511  1.00 33.81 ? 17  TRP B CH2   1 
ATOM   3454  N N     . GLY B 1 21  ? 29.988  -12.855 67.142  1.00 31.97 ? 18  GLY B N     1 
ATOM   3455  C CA    . GLY B 1 21  ? 30.809  -12.198 68.140  1.00 30.74 ? 18  GLY B CA    1 
ATOM   3456  C C     . GLY B 1 21  ? 31.476  -10.966 67.557  1.00 31.65 ? 18  GLY B C     1 
ATOM   3457  O O     . GLY B 1 21  ? 31.518  -9.912  68.192  1.00 31.89 ? 18  GLY B O     1 
ATOM   3458  N N     . ARG B 1 22  ? 31.997  -11.093 66.338  1.00 32.61 ? 19  ARG B N     1 
ATOM   3459  C CA    . ARG B 1 22  ? 32.663  -9.976  65.666  1.00 31.58 ? 19  ARG B CA    1 
ATOM   3460  C C     . ARG B 1 22  ? 31.702  -8.824  65.454  1.00 31.12 ? 19  ARG B C     1 
ATOM   3461  O O     . ARG B 1 22  ? 32.098  -7.658  65.456  1.00 32.09 ? 19  ARG B O     1 
ATOM   3462  C CB    . ARG B 1 22  ? 33.237  -10.418 64.318  1.00 30.76 ? 19  ARG B CB    1 
ATOM   3463  C CG    . ARG B 1 22  ? 33.866  -9.284  63.494  1.00 30.62 ? 19  ARG B CG    1 
ATOM   3464  C CD    . ARG B 1 22  ? 34.881  -8.464  64.298  1.00 32.09 ? 19  ARG B CD    1 
ATOM   3465  N NE    . ARG B 1 22  ? 36.003  -9.269  64.782  1.00 31.45 ? 19  ARG B NE    1 
ATOM   3466  C CZ    . ARG B 1 22  ? 36.971  -8.813  65.574  1.00 30.83 ? 19  ARG B CZ    1 
ATOM   3467  N NH1   . ARG B 1 22  ? 36.967  -7.550  65.978  1.00 27.97 ? 19  ARG B NH1   1 
ATOM   3468  N NH2   . ARG B 1 22  ? 37.940  -9.630  65.973  1.00 31.63 ? 19  ARG B NH2   1 
ATOM   3469  N N     . LYS B 1 23  ? 30.431  -9.144  65.265  1.00 30.24 ? 20  LYS B N     1 
ATOM   3470  C CA    . LYS B 1 23  ? 29.436  -8.105  65.055  1.00 30.95 ? 20  LYS B CA    1 
ATOM   3471  C C     . LYS B 1 23  ? 29.173  -7.415  66.389  1.00 30.80 ? 20  LYS B C     1 
ATOM   3472  O O     . LYS B 1 23  ? 29.115  -6.180  66.465  1.00 28.00 ? 20  LYS B O     1 
ATOM   3473  C CB    . LYS B 1 23  ? 28.167  -8.725  64.468  1.00 30.60 ? 20  LYS B CB    1 
ATOM   3474  C CG    . LYS B 1 23  ? 28.336  -9.118  63.003  1.00 33.46 ? 20  LYS B CG    1 
ATOM   3475  C CD    . LYS B 1 23  ? 27.527  -10.342 62.617  1.00 36.76 ? 20  LYS B CD    1 
ATOM   3476  C CE    . LYS B 1 23  ? 26.076  -10.152 62.941  1.00 40.17 ? 20  LYS B CE    1 
ATOM   3477  N NZ    . LYS B 1 23  ? 25.608  -8.892  62.318  1.00 43.78 ? 20  LYS B NZ    1 
ATOM   3478  N N     . ALA B 1 24  ? 29.063  -8.224  67.441  1.00 31.49 ? 21  ALA B N     1 
ATOM   3479  C CA    . ALA B 1 24  ? 28.831  -7.725  68.792  1.00 32.69 ? 21  ALA B CA    1 
ATOM   3480  C C     . ALA B 1 24  ? 29.966  -6.798  69.210  1.00 33.18 ? 21  ALA B C     1 
ATOM   3481  O O     . ALA B 1 24  ? 29.764  -5.865  69.995  1.00 33.56 ? 21  ALA B O     1 
ATOM   3482  C CB    . ALA B 1 24  ? 28.725  -8.885  69.769  1.00 33.47 ? 21  ALA B CB    1 
ATOM   3483  N N     . LEU B 1 25  ? 31.161  -7.056  68.688  1.00 33.20 ? 22  LEU B N     1 
ATOM   3484  C CA    . LEU B 1 25  ? 32.293  -6.205  69.007  1.00 33.64 ? 22  LEU B CA    1 
ATOM   3485  C C     . LEU B 1 25  ? 32.172  -4.879  68.250  1.00 34.26 ? 22  LEU B C     1 
ATOM   3486  O O     . LEU B 1 25  ? 32.404  -3.814  68.829  1.00 33.07 ? 22  LEU B O     1 
ATOM   3487  C CB    . LEU B 1 25  ? 33.614  -6.885  68.654  1.00 33.77 ? 22  LEU B CB    1 
ATOM   3488  C CG    . LEU B 1 25  ? 33.936  -8.252  69.265  1.00 34.92 ? 22  LEU B CG    1 
ATOM   3489  C CD1   . LEU B 1 25  ? 35.392  -8.580  68.973  1.00 33.92 ? 22  LEU B CD1   1 
ATOM   3490  C CD2   . LEU B 1 25  ? 33.692  -8.252  70.762  1.00 34.75 ? 22  LEU B CD2   1 
ATOM   3491  N N     . ASP B 1 26  ? 31.799  -4.939  66.969  1.00 34.70 ? 23  ASP B N     1 
ATOM   3492  C CA    . ASP B 1 26  ? 31.660  -3.713  66.169  1.00 34.73 ? 23  ASP B CA    1 
ATOM   3493  C C     . ASP B 1 26  ? 30.824  -2.694  66.932  1.00 34.47 ? 23  ASP B C     1 
ATOM   3494  O O     . ASP B 1 26  ? 31.198  -1.528  67.058  1.00 35.33 ? 23  ASP B O     1 
ATOM   3495  C CB    . ASP B 1 26  ? 30.984  -3.988  64.816  1.00 33.58 ? 23  ASP B CB    1 
ATOM   3496  C CG    . ASP B 1 26  ? 31.813  -4.892  63.907  1.00 35.95 ? 23  ASP B CG    1 
ATOM   3497  O OD1   . ASP B 1 26  ? 33.037  -4.661  63.782  1.00 36.81 ? 23  ASP B OD1   1 
ATOM   3498  O OD2   . ASP B 1 26  ? 31.228  -5.824  63.306  1.00 34.48 ? 23  ASP B OD2   1 
ATOM   3499  N N     . ILE B 1 27  ? 29.691  -3.164  67.441  1.00 32.43 ? 24  ILE B N     1 
ATOM   3500  C CA    . ILE B 1 27  ? 28.772  -2.337  68.200  1.00 29.02 ? 24  ILE B CA    1 
ATOM   3501  C C     . ILE B 1 27  ? 29.453  -1.866  69.484  1.00 26.83 ? 24  ILE B C     1 
ATOM   3502  O O     . ILE B 1 27  ? 29.415  -0.684  69.821  1.00 26.28 ? 24  ILE B O     1 
ATOM   3503  C CB    . ILE B 1 27  ? 27.494  -3.148  68.529  1.00 27.56 ? 24  ILE B CB    1 
ATOM   3504  C CG1   . ILE B 1 27  ? 26.763  -3.465  67.220  1.00 25.68 ? 24  ILE B CG1   1 
ATOM   3505  C CG2   . ILE B 1 27  ? 26.604  -2.387  69.526  1.00 24.18 ? 24  ILE B CG2   1 
ATOM   3506  C CD1   . ILE B 1 27  ? 25.654  -4.485  67.338  1.00 22.41 ? 24  ILE B CD1   1 
ATOM   3507  N N     . ALA B 1 28  ? 30.092  -2.799  70.182  1.00 26.85 ? 25  ALA B N     1 
ATOM   3508  C CA    . ALA B 1 28  ? 30.773  -2.491  71.435  1.00 28.60 ? 25  ALA B CA    1 
ATOM   3509  C C     . ALA B 1 28  ? 31.842  -1.419  71.271  1.00 30.00 ? 25  ALA B C     1 
ATOM   3510  O O     . ALA B 1 28  ? 31.896  -0.459  72.047  1.00 29.29 ? 25  ALA B O     1 
ATOM   3511  C CB    . ALA B 1 28  ? 31.389  -3.750  72.016  1.00 26.99 ? 25  ALA B CB    1 
ATOM   3512  N N     . GLU B 1 29  ? 32.690  -1.586  70.259  1.00 30.75 ? 26  GLU B N     1 
ATOM   3513  C CA    . GLU B 1 29  ? 33.766  -0.630  70.011  1.00 30.21 ? 26  GLU B CA    1 
ATOM   3514  C C     . GLU B 1 29  ? 33.223  0.785   69.891  1.00 28.26 ? 26  GLU B C     1 
ATOM   3515  O O     . GLU B 1 29  ? 33.899  1.749   70.247  1.00 28.62 ? 26  GLU B O     1 
ATOM   3516  C CB    . GLU B 1 29  ? 34.534  -0.990  68.735  1.00 30.89 ? 26  GLU B CB    1 
ATOM   3517  C CG    . GLU B 1 29  ? 35.286  -2.323  68.776  1.00 34.92 ? 26  GLU B CG    1 
ATOM   3518  C CD    . GLU B 1 29  ? 36.023  -2.611  67.468  1.00 36.36 ? 26  GLU B CD    1 
ATOM   3519  O OE1   . GLU B 1 29  ? 35.571  -2.112  66.411  1.00 38.14 ? 26  GLU B OE1   1 
ATOM   3520  O OE2   . GLU B 1 29  ? 37.044  -3.336  67.491  1.00 37.39 ? 26  GLU B OE2   1 
ATOM   3521  N N     . ASN B 1 30  ? 31.992  0.913   69.413  1.00 25.55 ? 27  ASN B N     1 
ATOM   3522  C CA    . ASN B 1 30  ? 31.404  2.234   69.235  1.00 24.30 ? 27  ASN B CA    1 
ATOM   3523  C C     . ASN B 1 30  ? 30.830  2.809   70.540  1.00 24.70 ? 27  ASN B C     1 
ATOM   3524  O O     . ASN B 1 30  ? 30.483  3.989   70.616  1.00 21.75 ? 27  ASN B O     1 
ATOM   3525  C CB    . ASN B 1 30  ? 30.321  2.165   68.154  1.00 21.85 ? 27  ASN B CB    1 
ATOM   3526  C CG    . ASN B 1 30  ? 30.237  3.432   67.333  1.00 20.19 ? 27  ASN B CG    1 
ATOM   3527  O OD1   . ASN B 1 30  ? 29.210  3.720   66.747  1.00 20.18 ? 27  ASN B OD1   1 
ATOM   3528  N ND2   . ASN B 1 30  ? 31.325  4.191   67.282  1.00 19.49 ? 27  ASN B ND2   1 
ATOM   3529  N N     . GLU B 1 31  ? 30.751  1.960   71.563  1.00 27.50 ? 28  GLU B N     1 
ATOM   3530  C CA    . GLU B 1 31  ? 30.227  2.326   72.883  1.00 27.99 ? 28  GLU B CA    1 
ATOM   3531  C C     . GLU B 1 31  ? 31.315  2.500   73.929  1.00 28.87 ? 28  GLU B C     1 
ATOM   3532  O O     . GLU B 1 31  ? 31.018  2.838   75.075  1.00 32.02 ? 28  GLU B O     1 
ATOM   3533  C CB    . GLU B 1 31  ? 29.267  1.244   73.382  1.00 28.68 ? 28  GLU B CB    1 
ATOM   3534  C CG    . GLU B 1 31  ? 27.857  1.425   72.929  1.00 28.85 ? 28  GLU B CG    1 
ATOM   3535  C CD    . GLU B 1 31  ? 27.233  2.631   73.562  1.00 28.70 ? 28  GLU B CD    1 
ATOM   3536  O OE1   . GLU B 1 31  ? 26.966  2.587   74.777  1.00 29.92 ? 28  GLU B OE1   1 
ATOM   3537  O OE2   . GLU B 1 31  ? 27.019  3.629   72.851  1.00 29.73 ? 28  GLU B OE2   1 
ATOM   3538  N N     . MET B 1 32  ? 32.566  2.247   73.555  1.00 28.43 ? 29  MET B N     1 
ATOM   3539  C CA    . MET B 1 32  ? 33.675  2.368   74.500  1.00 27.71 ? 29  MET B CA    1 
ATOM   3540  C C     . MET B 1 32  ? 34.749  3.336   74.009  1.00 26.29 ? 29  MET B C     1 
ATOM   3541  O O     . MET B 1 32  ? 35.831  2.915   73.613  1.00 26.98 ? 29  MET B O     1 
ATOM   3542  C CB    . MET B 1 32  ? 34.295  0.990   74.742  1.00 28.40 ? 29  MET B CB    1 
ATOM   3543  C CG    . MET B 1 32  ? 33.272  -0.090  75.085  1.00 28.40 ? 29  MET B CG    1 
ATOM   3544  S SD    . MET B 1 32  ? 33.993  -1.740  75.154  1.00 29.59 ? 29  MET B SD    1 
ATOM   3545  C CE    . MET B 1 32  ? 34.289  -1.927  76.944  1.00 27.81 ? 29  MET B CE    1 
ATOM   3546  N N     . PRO B 1 33  ? 34.463  4.650   74.036  1.00 25.67 ? 30  PRO B N     1 
ATOM   3547  C CA    . PRO B 1 33  ? 35.405  5.682   73.591  1.00 25.89 ? 30  PRO B CA    1 
ATOM   3548  C C     . PRO B 1 33  ? 36.784  5.591   74.241  1.00 26.10 ? 30  PRO B C     1 
ATOM   3549  O O     . PRO B 1 33  ? 37.800  5.835   73.590  1.00 25.97 ? 30  PRO B O     1 
ATOM   3550  C CB    . PRO B 1 33  ? 34.698  6.983   73.960  1.00 24.56 ? 30  PRO B CB    1 
ATOM   3551  C CG    . PRO B 1 33  ? 33.267  6.627   73.835  1.00 27.94 ? 30  PRO B CG    1 
ATOM   3552  C CD    . PRO B 1 33  ? 33.205  5.264   74.488  1.00 25.98 ? 30  PRO B CD    1 
ATOM   3553  N N     . GLY B 1 34  ? 36.804  5.262   75.528  1.00 25.49 ? 31  GLY B N     1 
ATOM   3554  C CA    . GLY B 1 34  ? 38.057  5.160   76.250  1.00 27.35 ? 31  GLY B CA    1 
ATOM   3555  C C     . GLY B 1 34  ? 39.035  4.213   75.584  1.00 26.39 ? 31  GLY B C     1 
ATOM   3556  O O     . GLY B 1 34  ? 40.126  4.609   75.198  1.00 25.74 ? 31  GLY B O     1 
ATOM   3557  N N     . LEU B 1 35  ? 38.634  2.955   75.451  1.00 27.88 ? 32  LEU B N     1 
ATOM   3558  C CA    . LEU B 1 35  ? 39.465  1.945   74.817  1.00 30.29 ? 32  LEU B CA    1 
ATOM   3559  C C     . LEU B 1 35  ? 39.845  2.314   73.380  1.00 30.14 ? 32  LEU B C     1 
ATOM   3560  O O     . LEU B 1 35  ? 40.967  2.051   72.958  1.00 31.02 ? 32  LEU B O     1 
ATOM   3561  C CB    . LEU B 1 35  ? 38.745  0.592   74.821  1.00 30.75 ? 32  LEU B CB    1 
ATOM   3562  C CG    . LEU B 1 35  ? 38.530  -0.081  76.179  1.00 32.83 ? 32  LEU B CG    1 
ATOM   3563  C CD1   . LEU B 1 35  ? 37.658  -1.307  75.982  1.00 31.70 ? 32  LEU B CD1   1 
ATOM   3564  C CD2   . LEU B 1 35  ? 39.879  -0.459  76.807  1.00 32.67 ? 32  LEU B CD2   1 
ATOM   3565  N N     . MET B 1 36  ? 38.924  2.923   72.636  1.00 30.35 ? 33  MET B N     1 
ATOM   3566  C CA    . MET B 1 36  ? 39.210  3.293   71.253  1.00 33.06 ? 33  MET B CA    1 
ATOM   3567  C C     . MET B 1 36  ? 40.155  4.486   71.141  1.00 34.83 ? 33  MET B C     1 
ATOM   3568  O O     . MET B 1 36  ? 40.914  4.599   70.177  1.00 34.25 ? 33  MET B O     1 
ATOM   3569  C CB    . MET B 1 36  ? 37.912  3.586   70.498  1.00 32.13 ? 33  MET B CB    1 
ATOM   3570  C CG    . MET B 1 36  ? 36.971  2.396   70.421  1.00 31.96 ? 33  MET B CG    1 
ATOM   3571  S SD    . MET B 1 36  ? 37.764  0.907   69.755  1.00 34.79 ? 33  MET B SD    1 
ATOM   3572  C CE    . MET B 1 36  ? 37.880  1.315   67.979  1.00 29.19 ? 33  MET B CE    1 
ATOM   3573  N N     . ARG B 1 37  ? 40.101  5.381   72.118  1.00 36.88 ? 34  ARG B N     1 
ATOM   3574  C CA    . ARG B 1 37  ? 40.976  6.536   72.117  1.00 38.53 ? 34  ARG B CA    1 
ATOM   3575  C C     . ARG B 1 37  ? 42.373  6.071   72.495  1.00 38.72 ? 34  ARG B C     1 
ATOM   3576  O O     . ARG B 1 37  ? 43.366  6.730   72.200  1.00 38.86 ? 34  ARG B O     1 
ATOM   3577  C CB    . ARG B 1 37  ? 40.473  7.575   73.116  1.00 41.67 ? 34  ARG B CB    1 
ATOM   3578  C CG    . ARG B 1 37  ? 39.931  8.817   72.443  1.00 45.34 ? 34  ARG B CG    1 
ATOM   3579  C CD    . ARG B 1 37  ? 41.038  9.501   71.674  1.00 50.01 ? 34  ARG B CD    1 
ATOM   3580  N NE    . ARG B 1 37  ? 42.007  10.150  72.557  1.00 54.06 ? 34  ARG B NE    1 
ATOM   3581  C CZ    . ARG B 1 37  ? 43.191  10.613  72.160  1.00 55.78 ? 34  ARG B CZ    1 
ATOM   3582  N NH1   . ARG B 1 37  ? 43.561  10.491  70.889  1.00 56.62 ? 34  ARG B NH1   1 
ATOM   3583  N NH2   . ARG B 1 37  ? 43.997  11.219  73.028  1.00 55.57 ? 34  ARG B NH2   1 
ATOM   3584  N N     . MET B 1 38  ? 42.439  4.913   73.137  1.00 38.85 ? 35  MET B N     1 
ATOM   3585  C CA    . MET B 1 38  ? 43.703  4.345   73.561  1.00 39.86 ? 35  MET B CA    1 
ATOM   3586  C C     . MET B 1 38  ? 44.447  3.753   72.364  1.00 40.21 ? 35  MET B C     1 
ATOM   3587  O O     . MET B 1 38  ? 45.672  3.813   72.290  1.00 40.03 ? 35  MET B O     1 
ATOM   3588  C CB    . MET B 1 38  ? 43.460  3.270   74.619  1.00 39.37 ? 35  MET B CB    1 
ATOM   3589  C CG    . MET B 1 38  ? 44.568  3.175   75.655  1.00 41.81 ? 35  MET B CG    1 
ATOM   3590  S SD    . MET B 1 38  ? 44.635  4.634   76.695  1.00 41.58 ? 35  MET B SD    1 
ATOM   3591  C CE    . MET B 1 38  ? 43.622  4.095   77.992  1.00 43.01 ? 35  MET B CE    1 
ATOM   3592  N N     . ARG B 1 39  ? 43.699  3.195   71.419  1.00 41.71 ? 36  ARG B N     1 
ATOM   3593  C CA    . ARG B 1 39  ? 44.283  2.596   70.223  1.00 43.61 ? 36  ARG B CA    1 
ATOM   3594  C C     . ARG B 1 39  ? 44.850  3.643   69.258  1.00 46.12 ? 36  ARG B C     1 
ATOM   3595  O O     . ARG B 1 39  ? 46.009  3.561   68.843  1.00 47.58 ? 36  ARG B O     1 
ATOM   3596  C CB    . ARG B 1 39  ? 43.233  1.762   69.484  1.00 42.17 ? 36  ARG B CB    1 
ATOM   3597  C CG    . ARG B 1 39  ? 42.616  0.637   70.290  1.00 41.24 ? 36  ARG B CG    1 
ATOM   3598  C CD    . ARG B 1 39  ? 41.563  -0.078  69.466  1.00 39.64 ? 36  ARG B CD    1 
ATOM   3599  N NE    . ARG B 1 39  ? 41.017  -1.257  70.132  1.00 39.31 ? 36  ARG B NE    1 
ATOM   3600  C CZ    . ARG B 1 39  ? 40.142  -2.086  69.569  1.00 39.30 ? 36  ARG B CZ    1 
ATOM   3601  N NH1   . ARG B 1 39  ? 39.717  -1.858  68.332  1.00 37.97 ? 36  ARG B NH1   1 
ATOM   3602  N NH2   . ARG B 1 39  ? 39.692  -3.142  70.239  1.00 39.07 ? 36  ARG B NH2   1 
ATOM   3603  N N     . GLU B 1 40  ? 44.030  4.626   68.899  1.00 47.95 ? 37  GLU B N     1 
ATOM   3604  C CA    . GLU B 1 40  ? 44.454  5.662   67.968  1.00 51.01 ? 37  GLU B CA    1 
ATOM   3605  C C     . GLU B 1 40  ? 45.563  6.532   68.528  1.00 52.04 ? 37  GLU B C     1 
ATOM   3606  O O     . GLU B 1 40  ? 46.194  7.294   67.799  1.00 53.28 ? 37  GLU B O     1 
ATOM   3607  C CB    . GLU B 1 40  ? 43.276  6.554   67.589  1.00 52.42 ? 37  GLU B CB    1 
ATOM   3608  C CG    . GLU B 1 40  ? 42.505  7.077   68.775  1.00 56.06 ? 37  GLU B CG    1 
ATOM   3609  C CD    . GLU B 1 40  ? 41.718  8.322   68.434  1.00 58.15 ? 37  GLU B CD    1 
ATOM   3610  O OE1   . GLU B 1 40  ? 42.341  9.403   68.333  1.00 59.09 ? 37  GLU B OE1   1 
ATOM   3611  O OE2   . GLU B 1 40  ? 40.481  8.217   68.257  1.00 60.28 ? 37  GLU B OE2   1 
ATOM   3612  N N     . ARG B 1 41  ? 45.806  6.424   69.823  1.00 51.62 ? 38  ARG B N     1 
ATOM   3613  C CA    . ARG B 1 41  ? 46.834  7.240   70.416  1.00 52.07 ? 38  ARG B CA    1 
ATOM   3614  C C     . ARG B 1 41  ? 48.130  6.475   70.644  1.00 50.61 ? 38  ARG B C     1 
ATOM   3615  O O     . ARG B 1 41  ? 49.198  7.068   70.707  1.00 50.31 ? 38  ARG B O     1 
ATOM   3616  C CB    . ARG B 1 41  ? 46.329  7.824   71.735  1.00 54.55 ? 38  ARG B CB    1 
ATOM   3617  C CG    . ARG B 1 41  ? 47.316  8.745   72.412  1.00 58.14 ? 38  ARG B CG    1 
ATOM   3618  C CD    . ARG B 1 41  ? 46.847  9.134   73.801  1.00 61.16 ? 38  ARG B CD    1 
ATOM   3619  N NE    . ARG B 1 41  ? 47.747  10.111  74.409  1.00 64.78 ? 38  ARG B NE    1 
ATOM   3620  C CZ    . ARG B 1 41  ? 47.641  10.557  75.656  1.00 66.41 ? 38  ARG B CZ    1 
ATOM   3621  N NH1   . ARG B 1 41  ? 46.669  10.114  76.445  1.00 66.19 ? 38  ARG B NH1   1 
ATOM   3622  N NH2   . ARG B 1 41  ? 48.510  11.452  76.112  1.00 67.49 ? 38  ARG B NH2   1 
ATOM   3623  N N     . TYR B 1 42  ? 48.040  5.156   70.751  1.00 48.97 ? 39  TYR B N     1 
ATOM   3624  C CA    . TYR B 1 42  ? 49.224  4.350   71.002  1.00 47.84 ? 39  TYR B CA    1 
ATOM   3625  C C     . TYR B 1 42  ? 49.408  3.239   69.978  1.00 46.53 ? 39  TYR B C     1 
ATOM   3626  O O     . TYR B 1 42  ? 50.217  2.336   70.167  1.00 45.00 ? 39  TYR B O     1 
ATOM   3627  C CB    . TYR B 1 42  ? 49.141  3.766   72.412  1.00 48.15 ? 39  TYR B CB    1 
ATOM   3628  C CG    . TYR B 1 42  ? 49.154  4.824   73.493  1.00 51.13 ? 39  TYR B CG    1 
ATOM   3629  C CD1   . TYR B 1 42  ? 50.327  5.511   73.805  1.00 53.80 ? 39  TYR B CD1   1 
ATOM   3630  C CD2   . TYR B 1 42  ? 47.992  5.171   74.180  1.00 51.88 ? 39  TYR B CD2   1 
ATOM   3631  C CE1   . TYR B 1 42  ? 50.344  6.520   74.774  1.00 53.03 ? 39  TYR B CE1   1 
ATOM   3632  C CE2   . TYR B 1 42  ? 47.996  6.177   75.148  1.00 52.47 ? 39  TYR B CE2   1 
ATOM   3633  C CZ    . TYR B 1 42  ? 49.176  6.846   75.438  1.00 53.62 ? 39  TYR B CZ    1 
ATOM   3634  O OH    . TYR B 1 42  ? 49.187  7.842   76.390  1.00 54.13 ? 39  TYR B OH    1 
ATOM   3635  N N     . SER B 1 43  ? 48.662  3.309   68.885  1.00 46.04 ? 40  SER B N     1 
ATOM   3636  C CA    . SER B 1 43  ? 48.774  2.283   67.868  1.00 46.07 ? 40  SER B CA    1 
ATOM   3637  C C     . SER B 1 43  ? 50.193  2.198   67.329  1.00 46.86 ? 40  SER B C     1 
ATOM   3638  O O     . SER B 1 43  ? 50.845  1.158   67.449  1.00 47.46 ? 40  SER B O     1 
ATOM   3639  C CB    . SER B 1 43  ? 47.810  2.552   66.725  1.00 45.28 ? 40  SER B CB    1 
ATOM   3640  O OG    . SER B 1 43  ? 47.994  1.587   65.709  1.00 45.87 ? 40  SER B OG    1 
ATOM   3641  N N     . ALA B 1 44  ? 50.664  3.296   66.741  1.00 46.22 ? 41  ALA B N     1 
ATOM   3642  C CA    . ALA B 1 44  ? 52.003  3.358   66.162  1.00 45.70 ? 41  ALA B CA    1 
ATOM   3643  C C     . ALA B 1 44  ? 53.088  3.265   67.239  1.00 45.50 ? 41  ALA B C     1 
ATOM   3644  O O     . ALA B 1 44  ? 54.141  2.665   67.024  1.00 45.33 ? 41  ALA B O     1 
ATOM   3645  C CB    . ALA B 1 44  ? 52.161  4.640   65.357  1.00 43.77 ? 41  ALA B CB    1 
ATOM   3646  N N     . SER B 1 45  ? 52.815  3.858   68.396  1.00 45.31 ? 42  SER B N     1 
ATOM   3647  C CA    . SER B 1 45  ? 53.740  3.849   69.526  1.00 44.20 ? 42  SER B CA    1 
ATOM   3648  C C     . SER B 1 45  ? 54.063  2.420   69.991  1.00 43.77 ? 42  SER B C     1 
ATOM   3649  O O     . SER B 1 45  ? 55.199  2.119   70.333  1.00 44.94 ? 42  SER B O     1 
ATOM   3650  C CB    . SER B 1 45  ? 53.129  4.659   70.685  1.00 45.17 ? 42  SER B CB    1 
ATOM   3651  O OG    . SER B 1 45  ? 53.849  4.501   71.897  1.00 44.89 ? 42  SER B OG    1 
ATOM   3652  N N     . LYS B 1 46  ? 53.061  1.545   69.995  1.00 42.55 ? 43  LYS B N     1 
ATOM   3653  C CA    . LYS B 1 46  ? 53.243  0.157   70.423  1.00 40.99 ? 43  LYS B CA    1 
ATOM   3654  C C     . LYS B 1 46  ? 53.956  0.088   71.777  1.00 40.15 ? 43  LYS B C     1 
ATOM   3655  O O     . LYS B 1 46  ? 54.874  -0.705  71.969  1.00 40.24 ? 43  LYS B O     1 
ATOM   3656  C CB    . LYS B 1 46  ? 54.044  -0.620  69.371  1.00 39.25 ? 43  LYS B CB    1 
ATOM   3657  C CG    . LYS B 1 46  ? 53.431  -0.633  67.974  1.00 37.06 ? 43  LYS B CG    1 
ATOM   3658  C CD    . LYS B 1 46  ? 52.217  -1.547  67.857  1.00 36.53 ? 43  LYS B CD    1 
ATOM   3659  C CE    . LYS B 1 46  ? 51.669  -1.530  66.418  1.00 36.22 ? 43  LYS B CE    1 
ATOM   3660  N NZ    . LYS B 1 46  ? 50.544  -2.483  66.165  1.00 35.57 ? 43  LYS B NZ    1 
ATOM   3661  N N     . PRO B 1 47  ? 53.517  0.903   72.745  1.00 40.38 ? 44  PRO B N     1 
ATOM   3662  C CA    . PRO B 1 47  ? 54.141  0.910   74.071  1.00 40.65 ? 44  PRO B CA    1 
ATOM   3663  C C     . PRO B 1 47  ? 54.219  -0.438  74.774  1.00 41.08 ? 44  PRO B C     1 
ATOM   3664  O O     . PRO B 1 47  ? 55.179  -0.713  75.493  1.00 41.73 ? 44  PRO B O     1 
ATOM   3665  C CB    . PRO B 1 47  ? 53.276  1.899   74.850  1.00 40.72 ? 44  PRO B CB    1 
ATOM   3666  C CG    . PRO B 1 47  ? 51.924  1.683   74.248  1.00 40.64 ? 44  PRO B CG    1 
ATOM   3667  C CD    . PRO B 1 47  ? 52.257  1.666   72.767  1.00 40.28 ? 44  PRO B CD    1 
ATOM   3668  N N     . LEU B 1 48  ? 53.211  -1.279  74.584  1.00 42.06 ? 45  LEU B N     1 
ATOM   3669  C CA    . LEU B 1 48  ? 53.206  -2.571  75.252  1.00 42.43 ? 45  LEU B CA    1 
ATOM   3670  C C     . LEU B 1 48  ? 54.001  -3.639  74.528  1.00 42.12 ? 45  LEU B C     1 
ATOM   3671  O O     . LEU B 1 48  ? 53.891  -4.823  74.841  1.00 43.25 ? 45  LEU B O     1 
ATOM   3672  C CB    . LEU B 1 48  ? 51.774  -3.044  75.473  1.00 42.41 ? 45  LEU B CB    1 
ATOM   3673  C CG    . LEU B 1 48  ? 50.987  -2.226  76.498  1.00 42.61 ? 45  LEU B CG    1 
ATOM   3674  C CD1   . LEU B 1 48  ? 49.566  -2.763  76.562  1.00 42.74 ? 45  LEU B CD1   1 
ATOM   3675  C CD2   . LEU B 1 48  ? 51.657  -2.289  77.867  1.00 40.32 ? 45  LEU B CD2   1 
ATOM   3676  N N     . LYS B 1 49  ? 54.817  -3.222  73.570  1.00 42.19 ? 46  LYS B N     1 
ATOM   3677  C CA    . LYS B 1 49  ? 55.633  -4.165  72.823  1.00 41.37 ? 46  LYS B CA    1 
ATOM   3678  C C     . LYS B 1 49  ? 56.520  -4.969  73.774  1.00 41.02 ? 46  LYS B C     1 
ATOM   3679  O O     . LYS B 1 49  ? 57.112  -4.422  74.727  1.00 39.51 ? 46  LYS B O     1 
ATOM   3680  C CB    . LYS B 1 49  ? 56.498  -3.420  71.803  1.00 42.51 ? 46  LYS B CB    1 
ATOM   3681  C CG    . LYS B 1 49  ? 57.438  -4.314  71.022  1.00 43.10 ? 46  LYS B CG    1 
ATOM   3682  C CD    . LYS B 1 49  ? 58.271  -3.510  70.029  1.00 44.49 ? 46  LYS B CD    1 
ATOM   3683  C CE    . LYS B 1 49  ? 59.283  -4.411  69.332  1.00 44.95 ? 46  LYS B CE    1 
ATOM   3684  N NZ    . LYS B 1 49  ? 60.200  -3.700  68.400  1.00 45.69 ? 46  LYS B NZ    1 
ATOM   3685  N N     . GLY B 1 50  ? 56.586  -6.274  73.510  1.00 39.98 ? 47  GLY B N     1 
ATOM   3686  C CA    . GLY B 1 50  ? 57.390  -7.174  74.318  1.00 37.57 ? 47  GLY B CA    1 
ATOM   3687  C C     . GLY B 1 50  ? 56.667  -7.673  75.552  1.00 36.05 ? 47  GLY B C     1 
ATOM   3688  O O     . GLY B 1 50  ? 57.147  -8.561  76.250  1.00 35.48 ? 47  GLY B O     1 
ATOM   3689  N N     . ALA B 1 51  ? 55.499  -7.118  75.824  1.00 34.59 ? 48  ALA B N     1 
ATOM   3690  C CA    . ALA B 1 51  ? 54.755  -7.528  77.002  1.00 35.13 ? 48  ALA B CA    1 
ATOM   3691  C C     . ALA B 1 51  ? 53.928  -8.782  76.768  1.00 35.36 ? 48  ALA B C     1 
ATOM   3692  O O     . ALA B 1 51  ? 53.162  -8.851  75.809  1.00 36.55 ? 48  ALA B O     1 
ATOM   3693  C CB    . ALA B 1 51  ? 53.853  -6.398  77.452  1.00 35.77 ? 48  ALA B CB    1 
ATOM   3694  N N     . ARG B 1 52  ? 54.088  -9.782  77.629  1.00 33.35 ? 49  ARG B N     1 
ATOM   3695  C CA    . ARG B 1 52  ? 53.301  -11.001 77.495  1.00 33.95 ? 49  ARG B CA    1 
ATOM   3696  C C     . ARG B 1 52  ? 52.273  -10.987 78.612  1.00 34.75 ? 49  ARG B C     1 
ATOM   3697  O O     . ARG B 1 52  ? 52.525  -11.471 79.715  1.00 35.67 ? 49  ARG B O     1 
ATOM   3698  C CB    . ARG B 1 52  ? 54.179  -12.257 77.579  1.00 33.12 ? 49  ARG B CB    1 
ATOM   3699  C CG    . ARG B 1 52  ? 55.003  -12.516 76.316  1.00 33.12 ? 49  ARG B CG    1 
ATOM   3700  C CD    . ARG B 1 52  ? 55.668  -13.886 76.346  1.00 35.19 ? 49  ARG B CD    1 
ATOM   3701  N NE    . ARG B 1 52  ? 56.555  -14.015 77.494  1.00 35.97 ? 49  ARG B NE    1 
ATOM   3702  C CZ    . ARG B 1 52  ? 57.674  -13.314 77.652  1.00 36.80 ? 49  ARG B CZ    1 
ATOM   3703  N NH1   . ARG B 1 52  ? 58.054  -12.443 76.722  1.00 35.57 ? 49  ARG B NH1   1 
ATOM   3704  N NH2   . ARG B 1 52  ? 58.386  -13.446 78.764  1.00 35.79 ? 49  ARG B NH2   1 
ATOM   3705  N N     . ILE B 1 53  ? 51.108  -10.419 78.309  1.00 34.27 ? 50  ILE B N     1 
ATOM   3706  C CA    . ILE B 1 53  ? 50.031  -10.286 79.274  1.00 32.55 ? 50  ILE B CA    1 
ATOM   3707  C C     . ILE B 1 53  ? 49.120  -11.498 79.354  1.00 32.68 ? 50  ILE B C     1 
ATOM   3708  O O     . ILE B 1 53  ? 48.570  -11.942 78.350  1.00 32.12 ? 50  ILE B O     1 
ATOM   3709  C CB    . ILE B 1 53  ? 49.138  -9.080  78.944  1.00 32.89 ? 50  ILE B CB    1 
ATOM   3710  C CG1   . ILE B 1 53  ? 50.000  -7.843  78.708  1.00 33.50 ? 50  ILE B CG1   1 
ATOM   3711  C CG2   . ILE B 1 53  ? 48.147  -8.842  80.073  1.00 31.95 ? 50  ILE B CG2   1 
ATOM   3712  C CD1   . ILE B 1 53  ? 49.211  -6.646  78.252  1.00 33.51 ? 50  ILE B CD1   1 
ATOM   3713  N N     . ALA B 1 54  ? 48.963  -12.015 80.566  1.00 31.91 ? 51  ALA B N     1 
ATOM   3714  C CA    . ALA B 1 54  ? 48.093  -13.148 80.822  1.00 30.85 ? 51  ALA B CA    1 
ATOM   3715  C C     . ALA B 1 54  ? 46.877  -12.588 81.553  1.00 31.05 ? 51  ALA B C     1 
ATOM   3716  O O     . ALA B 1 54  ? 46.992  -12.139 82.694  1.00 30.82 ? 51  ALA B O     1 
ATOM   3717  C CB    . ALA B 1 54  ? 48.798  -14.172 81.702  1.00 30.36 ? 51  ALA B CB    1 
ATOM   3718  N N     . GLY B 1 55  ? 45.719  -12.611 80.905  1.00 30.07 ? 52  GLY B N     1 
ATOM   3719  C CA    . GLY B 1 55  ? 44.531  -12.086 81.546  1.00 29.80 ? 52  GLY B CA    1 
ATOM   3720  C C     . GLY B 1 55  ? 43.583  -13.144 82.071  1.00 29.95 ? 52  GLY B C     1 
ATOM   3721  O O     . GLY B 1 55  ? 43.419  -14.203 81.465  1.00 29.70 ? 52  GLY B O     1 
ATOM   3722  N N     . CYS B 1 56  ? 42.972  -12.852 83.218  1.00 30.07 ? 53  CYS B N     1 
ATOM   3723  C CA    . CYS B 1 56  ? 41.991  -13.740 83.848  1.00 29.25 ? 53  CYS B CA    1 
ATOM   3724  C C     . CYS B 1 56  ? 40.787  -12.866 84.220  1.00 29.90 ? 53  CYS B C     1 
ATOM   3725  O O     . CYS B 1 56  ? 40.675  -12.398 85.354  1.00 31.01 ? 53  CYS B O     1 
ATOM   3726  C CB    . CYS B 1 56  ? 42.561  -14.390 85.099  1.00 26.26 ? 53  CYS B CB    1 
ATOM   3727  S SG    . CYS B 1 56  ? 41.467  -15.610 85.831  1.00 30.18 ? 53  CYS B SG    1 
ATOM   3728  N N     . LEU B 1 57  ? 39.896  -12.648 83.253  1.00 30.18 ? 54  LEU B N     1 
ATOM   3729  C CA    . LEU B 1 57  ? 38.714  -11.810 83.456  1.00 30.13 ? 54  LEU B CA    1 
ATOM   3730  C C     . LEU B 1 57  ? 37.562  -12.248 82.537  1.00 29.63 ? 54  LEU B C     1 
ATOM   3731  O O     . LEU B 1 57  ? 37.774  -12.508 81.350  1.00 30.76 ? 54  LEU B O     1 
ATOM   3732  C CB    . LEU B 1 57  ? 39.080  -10.338 83.170  1.00 29.67 ? 54  LEU B CB    1 
ATOM   3733  C CG    . LEU B 1 57  ? 38.181  -9.177  83.620  1.00 29.93 ? 54  LEU B CG    1 
ATOM   3734  C CD1   . LEU B 1 57  ? 38.987  -7.894  83.618  1.00 33.07 ? 54  LEU B CD1   1 
ATOM   3735  C CD2   . LEU B 1 57  ? 36.978  -9.039  82.728  1.00 29.77 ? 54  LEU B CD2   1 
ATOM   3736  N N     . HIS B 1 58  ? 36.353  -12.316 83.097  1.00 27.69 ? 55  HIS B N     1 
ATOM   3737  C CA    . HIS B 1 58  ? 35.127  -12.700 82.374  1.00 24.67 ? 55  HIS B CA    1 
ATOM   3738  C C     . HIS B 1 58  ? 35.250  -12.484 80.864  1.00 23.02 ? 55  HIS B C     1 
ATOM   3739  O O     . HIS B 1 58  ? 35.211  -11.347 80.391  1.00 20.15 ? 55  HIS B O     1 
ATOM   3740  C CB    . HIS B 1 58  ? 33.958  -11.864 82.895  1.00 21.08 ? 55  HIS B CB    1 
ATOM   3741  C CG    . HIS B 1 58  ? 33.887  -11.799 84.384  1.00 21.61 ? 55  HIS B CG    1 
ATOM   3742  N ND1   . HIS B 1 58  ? 33.369  -12.820 85.156  1.00 19.75 ? 55  HIS B ND1   1 
ATOM   3743  C CD2   . HIS B 1 58  ? 34.308  -10.850 85.252  1.00 18.97 ? 55  HIS B CD2   1 
ATOM   3744  C CE1   . HIS B 1 58  ? 33.467  -12.501 86.432  1.00 15.50 ? 55  HIS B CE1   1 
ATOM   3745  N NE2   . HIS B 1 58  ? 34.033  -11.311 86.517  1.00 17.30 ? 55  HIS B NE2   1 
ATOM   3746  N N     . MET B 1 59  ? 35.394  -13.577 80.118  1.00 23.01 ? 56  MET B N     1 
ATOM   3747  C CA    . MET B 1 59  ? 35.550  -13.494 78.664  1.00 24.63 ? 56  MET B CA    1 
ATOM   3748  C C     . MET B 1 59  ? 34.227  -13.090 78.012  1.00 25.39 ? 56  MET B C     1 
ATOM   3749  O O     . MET B 1 59  ? 33.394  -13.936 77.667  1.00 27.04 ? 56  MET B O     1 
ATOM   3750  C CB    . MET B 1 59  ? 36.038  -14.825 78.119  1.00 22.05 ? 56  MET B CB    1 
ATOM   3751  C CG    . MET B 1 59  ? 36.357  -14.791 76.650  1.00 23.83 ? 56  MET B CG    1 
ATOM   3752  S SD    . MET B 1 59  ? 37.528  -13.498 76.224  1.00 25.89 ? 56  MET B SD    1 
ATOM   3753  C CE    . MET B 1 59  ? 36.479  -12.326 75.292  1.00 23.42 ? 56  MET B CE    1 
ATOM   3754  N N     . THR B 1 60  ? 34.066  -11.781 77.836  1.00 24.47 ? 57  THR B N     1 
ATOM   3755  C CA    . THR B 1 60  ? 32.845  -11.208 77.298  1.00 23.14 ? 57  THR B CA    1 
ATOM   3756  C C     . THR B 1 60  ? 33.085  -10.251 76.134  1.00 24.21 ? 57  THR B C     1 
ATOM   3757  O O     . THR B 1 60  ? 34.224  -9.952  75.767  1.00 25.00 ? 57  THR B O     1 
ATOM   3758  C CB    . THR B 1 60  ? 32.120  -10.387 78.389  1.00 22.49 ? 57  THR B CB    1 
ATOM   3759  O OG1   . THR B 1 60  ? 32.992  -9.330  78.825  1.00 18.62 ? 57  THR B OG1   1 
ATOM   3760  C CG2   . THR B 1 60  ? 31.751  -11.261 79.577  1.00 20.44 ? 57  THR B CG2   1 
ATOM   3761  N N     . VAL B 1 61  ? 31.989  -9.755  75.577  1.00 22.53 ? 58  VAL B N     1 
ATOM   3762  C CA    . VAL B 1 61  ? 32.077  -8.806  74.501  1.00 23.85 ? 58  VAL B CA    1 
ATOM   3763  C C     . VAL B 1 61  ? 32.937  -7.620  74.908  1.00 26.11 ? 58  VAL B C     1 
ATOM   3764  O O     . VAL B 1 61  ? 33.790  -7.193  74.127  1.00 28.02 ? 58  VAL B O     1 
ATOM   3765  C CB    . VAL B 1 61  ? 30.697  -8.279  74.112  1.00 23.36 ? 58  VAL B CB    1 
ATOM   3766  C CG1   . VAL B 1 61  ? 30.836  -7.216  73.034  1.00 20.82 ? 58  VAL B CG1   1 
ATOM   3767  C CG2   . VAL B 1 61  ? 29.835  -9.431  73.637  1.00 23.78 ? 58  VAL B CG2   1 
ATOM   3768  N N     . GLU B 1 62  ? 32.724  -7.082  76.111  1.00 25.11 ? 59  GLU B N     1 
ATOM   3769  C CA    . GLU B 1 62  ? 33.508  -5.933  76.561  1.00 25.40 ? 59  GLU B CA    1 
ATOM   3770  C C     . GLU B 1 62  ? 34.979  -6.300  76.708  1.00 26.19 ? 59  GLU B C     1 
ATOM   3771  O O     . GLU B 1 62  ? 35.871  -5.567  76.248  1.00 26.80 ? 59  GLU B O     1 
ATOM   3772  C CB    . GLU B 1 62  ? 32.980  -5.391  77.895  1.00 26.12 ? 59  GLU B CB    1 
ATOM   3773  C CG    . GLU B 1 62  ? 31.572  -4.818  77.839  1.00 25.26 ? 59  GLU B CG    1 
ATOM   3774  C CD    . GLU B 1 62  ? 30.542  -5.841  77.430  1.00 26.42 ? 59  GLU B CD    1 
ATOM   3775  O OE1   . GLU B 1 62  ? 30.608  -6.975  77.938  1.00 29.49 ? 59  GLU B OE1   1 
ATOM   3776  O OE2   . GLU B 1 62  ? 29.663  -5.518  76.609  1.00 30.63 ? 59  GLU B OE2   1 
ATOM   3777  N N     . THR B 1 63  ? 35.219  -7.439  77.357  1.00 25.92 ? 60  THR B N     1 
ATOM   3778  C CA    . THR B 1 63  ? 36.570  -7.952  77.577  1.00 25.45 ? 60  THR B CA    1 
ATOM   3779  C C     . THR B 1 63  ? 37.267  -8.274  76.260  1.00 26.09 ? 60  THR B C     1 
ATOM   3780  O O     . THR B 1 63  ? 38.494  -8.284  76.196  1.00 28.20 ? 60  THR B O     1 
ATOM   3781  C CB    . THR B 1 63  ? 36.545  -9.228  78.438  1.00 24.59 ? 60  THR B CB    1 
ATOM   3782  O OG1   . THR B 1 63  ? 36.137  -8.891  79.765  1.00 25.07 ? 60  THR B OG1   1 
ATOM   3783  C CG2   . THR B 1 63  ? 37.903  -9.904  78.460  1.00 22.41 ? 60  THR B CG2   1 
ATOM   3784  N N     . ALA B 1 64  ? 36.489  -8.550  75.215  1.00 24.83 ? 61  ALA B N     1 
ATOM   3785  C CA    . ALA B 1 64  ? 37.081  -8.854  73.912  1.00 25.03 ? 61  ALA B CA    1 
ATOM   3786  C C     . ALA B 1 64  ? 37.669  -7.559  73.360  1.00 24.29 ? 61  ALA B C     1 
ATOM   3787  O O     . ALA B 1 64  ? 38.801  -7.535  72.881  1.00 23.92 ? 61  ALA B O     1 
ATOM   3788  C CB    . ALA B 1 64  ? 36.024  -9.417  72.948  1.00 23.73 ? 61  ALA B CB    1 
ATOM   3789  N N     . VAL B 1 65  ? 36.889  -6.484  73.430  1.00 23.31 ? 62  VAL B N     1 
ATOM   3790  C CA    . VAL B 1 65  ? 37.361  -5.191  72.957  1.00 23.18 ? 62  VAL B CA    1 
ATOM   3791  C C     . VAL B 1 65  ? 38.619  -4.775  73.739  1.00 24.07 ? 62  VAL B C     1 
ATOM   3792  O O     . VAL B 1 65  ? 39.436  -4.001  73.244  1.00 22.45 ? 62  VAL B O     1 
ATOM   3793  C CB    . VAL B 1 65  ? 36.288  -4.107  73.133  1.00 19.42 ? 62  VAL B CB    1 
ATOM   3794  C CG1   . VAL B 1 65  ? 36.823  -2.776  72.683  1.00 17.55 ? 62  VAL B CG1   1 
ATOM   3795  C CG2   . VAL B 1 65  ? 35.049  -4.479  72.370  1.00 17.15 ? 62  VAL B CG2   1 
ATOM   3796  N N     . LEU B 1 66  ? 38.760  -5.299  74.957  1.00 25.45 ? 63  LEU B N     1 
ATOM   3797  C CA    . LEU B 1 66  ? 39.910  -5.000  75.812  1.00 28.20 ? 63  LEU B CA    1 
ATOM   3798  C C     . LEU B 1 66  ? 41.153  -5.680  75.246  1.00 29.18 ? 63  LEU B C     1 
ATOM   3799  O O     . LEU B 1 66  ? 42.150  -5.031  74.913  1.00 29.80 ? 63  LEU B O     1 
ATOM   3800  C CB    . LEU B 1 66  ? 39.651  -5.503  77.234  1.00 30.97 ? 63  LEU B CB    1 
ATOM   3801  C CG    . LEU B 1 66  ? 40.840  -5.502  78.204  1.00 32.74 ? 63  LEU B CG    1 
ATOM   3802  C CD1   . LEU B 1 66  ? 41.425  -4.104  78.289  1.00 33.14 ? 63  LEU B CD1   1 
ATOM   3803  C CD2   . LEU B 1 66  ? 40.395  -5.985  79.590  1.00 31.87 ? 63  LEU B CD2   1 
ATOM   3804  N N     . ILE B 1 67  ? 41.071  -6.999  75.151  1.00 28.70 ? 64  ILE B N     1 
ATOM   3805  C CA    . ILE B 1 67  ? 42.129  -7.830  74.611  1.00 29.20 ? 64  ILE B CA    1 
ATOM   3806  C C     . ILE B 1 67  ? 42.618  -7.262  73.283  1.00 29.84 ? 64  ILE B C     1 
ATOM   3807  O O     . ILE B 1 67  ? 43.818  -7.103  73.067  1.00 29.96 ? 64  ILE B O     1 
ATOM   3808  C CB    . ILE B 1 67  ? 41.598  -9.255  74.390  1.00 29.46 ? 64  ILE B CB    1 
ATOM   3809  C CG1   . ILE B 1 67  ? 41.123  -9.822  75.726  1.00 27.63 ? 64  ILE B CG1   1 
ATOM   3810  C CG2   . ILE B 1 67  ? 42.662  -10.136 73.765  1.00 30.84 ? 64  ILE B CG2   1 
ATOM   3811  C CD1   . ILE B 1 67  ? 40.385  -11.116 75.594  1.00 30.20 ? 64  ILE B CD1   1 
ATOM   3812  N N     . GLU B 1 68  ? 41.695  -6.946  72.385  1.00 29.40 ? 65  GLU B N     1 
ATOM   3813  C CA    . GLU B 1 68  ? 42.102  -6.401  71.102  1.00 30.40 ? 65  GLU B CA    1 
ATOM   3814  C C     . GLU B 1 68  ? 42.833  -5.075  71.207  1.00 31.70 ? 65  GLU B C     1 
ATOM   3815  O O     . GLU B 1 68  ? 43.634  -4.742  70.334  1.00 32.68 ? 65  GLU B O     1 
ATOM   3816  C CB    . GLU B 1 68  ? 40.899  -6.260  70.165  1.00 31.22 ? 65  GLU B CB    1 
ATOM   3817  C CG    . GLU B 1 68  ? 40.496  -7.582  69.518  1.00 31.60 ? 65  GLU B CG    1 
ATOM   3818  C CD    . GLU B 1 68  ? 39.722  -7.399  68.235  1.00 33.21 ? 65  GLU B CD    1 
ATOM   3819  O OE1   . GLU B 1 68  ? 39.595  -8.386  67.487  1.00 33.45 ? 65  GLU B OE1   1 
ATOM   3820  O OE2   . GLU B 1 68  ? 39.243  -6.269  67.970  1.00 36.00 ? 65  GLU B OE2   1 
ATOM   3821  N N     . THR B 1 69  ? 42.559  -4.324  72.270  1.00 32.57 ? 66  THR B N     1 
ATOM   3822  C CA    . THR B 1 69  ? 43.208  -3.036  72.499  1.00 32.55 ? 66  THR B CA    1 
ATOM   3823  C C     . THR B 1 69  ? 44.654  -3.290  72.942  1.00 32.60 ? 66  THR B C     1 
ATOM   3824  O O     . THR B 1 69  ? 45.596  -2.642  72.471  1.00 30.19 ? 66  THR B O     1 
ATOM   3825  C CB    . THR B 1 69  ? 42.465  -2.233  73.600  1.00 33.56 ? 66  THR B CB    1 
ATOM   3826  O OG1   . THR B 1 69  ? 41.093  -2.064  73.212  1.00 32.93 ? 66  THR B OG1   1 
ATOM   3827  C CG2   . THR B 1 69  ? 43.104  -0.854  73.800  1.00 29.26 ? 66  THR B CG2   1 
ATOM   3828  N N     . LEU B 1 70  ? 44.813  -4.249  73.849  1.00 33.29 ? 67  LEU B N     1 
ATOM   3829  C CA    . LEU B 1 70  ? 46.118  -4.623  74.354  1.00 34.07 ? 67  LEU B CA    1 
ATOM   3830  C C     . LEU B 1 70  ? 47.006  -5.049  73.189  1.00 36.79 ? 67  LEU B C     1 
ATOM   3831  O O     . LEU B 1 70  ? 48.192  -4.686  73.132  1.00 38.94 ? 67  LEU B O     1 
ATOM   3832  C CB    . LEU B 1 70  ? 45.978  -5.763  75.363  1.00 33.03 ? 67  LEU B CB    1 
ATOM   3833  C CG    . LEU B 1 70  ? 45.320  -5.366  76.686  1.00 32.69 ? 67  LEU B CG    1 
ATOM   3834  C CD1   . LEU B 1 70  ? 45.171  -6.594  77.557  1.00 32.68 ? 67  LEU B CD1   1 
ATOM   3835  C CD2   . LEU B 1 70  ? 46.175  -4.307  77.395  1.00 32.36 ? 67  LEU B CD2   1 
ATOM   3836  N N     . VAL B 1 71  ? 46.425  -5.805  72.257  1.00 35.81 ? 68  VAL B N     1 
ATOM   3837  C CA    . VAL B 1 71  ? 47.152  -6.276  71.082  1.00 35.24 ? 68  VAL B CA    1 
ATOM   3838  C C     . VAL B 1 71  ? 47.555  -5.114  70.170  1.00 35.88 ? 68  VAL B C     1 
ATOM   3839  O O     . VAL B 1 71  ? 48.678  -5.079  69.670  1.00 36.87 ? 68  VAL B O     1 
ATOM   3840  C CB    . VAL B 1 71  ? 46.313  -7.287  70.268  1.00 34.88 ? 68  VAL B CB    1 
ATOM   3841  C CG1   . VAL B 1 71  ? 47.010  -7.624  68.967  1.00 34.38 ? 68  VAL B CG1   1 
ATOM   3842  C CG2   . VAL B 1 71  ? 46.091  -8.543  71.082  1.00 35.27 ? 68  VAL B CG2   1 
ATOM   3843  N N     . THR B 1 72  ? 46.640  -4.174  69.945  1.00 36.11 ? 69  THR B N     1 
ATOM   3844  C CA    . THR B 1 72  ? 46.908  -3.005  69.100  1.00 36.32 ? 69  THR B CA    1 
ATOM   3845  C C     . THR B 1 72  ? 48.085  -2.182  69.650  1.00 38.00 ? 69  THR B C     1 
ATOM   3846  O O     . THR B 1 72  ? 48.780  -1.496  68.895  1.00 39.09 ? 69  THR B O     1 
ATOM   3847  C CB    . THR B 1 72  ? 45.656  -2.079  69.019  1.00 36.26 ? 69  THR B CB    1 
ATOM   3848  O OG1   . THR B 1 72  ? 44.556  -2.806  68.459  1.00 36.03 ? 69  THR B OG1   1 
ATOM   3849  C CG2   . THR B 1 72  ? 45.939  -0.857  68.151  1.00 34.16 ? 69  THR B CG2   1 
ATOM   3850  N N     . LEU B 1 73  ? 48.296  -2.251  70.963  1.00 38.09 ? 70  LEU B N     1 
ATOM   3851  C CA    . LEU B 1 73  ? 49.379  -1.529  71.617  1.00 38.06 ? 70  LEU B CA    1 
ATOM   3852  C C     . LEU B 1 73  ? 50.670  -2.349  71.639  1.00 38.51 ? 70  LEU B C     1 
ATOM   3853  O O     . LEU B 1 73  ? 51.603  -2.061  72.400  1.00 37.46 ? 70  LEU B O     1 
ATOM   3854  C CB    . LEU B 1 73  ? 48.972  -1.151  73.051  1.00 40.08 ? 70  LEU B CB    1 
ATOM   3855  C CG    . LEU B 1 73  ? 48.206  0.164   73.266  1.00 39.91 ? 70  LEU B CG    1 
ATOM   3856  C CD1   . LEU B 1 73  ? 46.931  0.197   72.441  1.00 39.13 ? 70  LEU B CD1   1 
ATOM   3857  C CD2   . LEU B 1 73  ? 47.893  0.319   74.747  1.00 41.00 ? 70  LEU B CD2   1 
ATOM   3858  N N     . GLY B 1 74  ? 50.701  -3.381  70.804  1.00 38.58 ? 71  GLY B N     1 
ATOM   3859  C CA    . GLY B 1 74  ? 51.876  -4.225  70.694  1.00 38.85 ? 71  GLY B CA    1 
ATOM   3860  C C     . GLY B 1 74  ? 52.133  -5.282  71.754  1.00 38.70 ? 71  GLY B C     1 
ATOM   3861  O O     . GLY B 1 74  ? 53.252  -5.772  71.851  1.00 40.22 ? 71  GLY B O     1 
ATOM   3862  N N     . ALA B 1 75  ? 51.131  -5.650  72.545  1.00 37.97 ? 72  ALA B N     1 
ATOM   3863  C CA    . ALA B 1 75  ? 51.339  -6.675  73.563  1.00 36.91 ? 72  ALA B CA    1 
ATOM   3864  C C     . ALA B 1 75  ? 50.853  -8.030  73.077  1.00 37.51 ? 72  ALA B C     1 
ATOM   3865  O O     . ALA B 1 75  ? 49.991  -8.115  72.212  1.00 38.77 ? 72  ALA B O     1 
ATOM   3866  C CB    . ALA B 1 75  ? 50.614  -6.301  74.841  1.00 34.70 ? 72  ALA B CB    1 
ATOM   3867  N N     . GLU B 1 76  ? 51.424  -9.094  73.622  1.00 37.86 ? 73  GLU B N     1 
ATOM   3868  C CA    . GLU B 1 76  ? 51.006  -10.442 73.274  1.00 37.45 ? 73  GLU B CA    1 
ATOM   3869  C C     . GLU B 1 76  ? 50.065  -10.837 74.394  1.00 36.53 ? 73  GLU B C     1 
ATOM   3870  O O     . GLU B 1 76  ? 50.360  -10.618 75.572  1.00 36.87 ? 73  GLU B O     1 
ATOM   3871  C CB    . GLU B 1 76  ? 52.207  -11.400 73.209  1.00 37.82 ? 73  GLU B CB    1 
ATOM   3872  C CG    . GLU B 1 76  ? 52.645  -11.732 71.778  1.00 37.06 ? 73  GLU B CG    1 
ATOM   3873  C CD    . GLU B 1 76  ? 53.917  -12.564 71.728  1.00 38.82 ? 73  GLU B CD    1 
ATOM   3874  O OE1   . GLU B 1 76  ? 53.940  -13.675 72.296  1.00 38.91 ? 73  GLU B OE1   1 
ATOM   3875  O OE2   . GLU B 1 76  ? 54.900  -12.107 71.113  1.00 39.28 ? 73  GLU B OE2   1 
ATOM   3876  N N     . VAL B 1 77  ? 48.933  -11.421 74.028  1.00 36.55 ? 74  VAL B N     1 
ATOM   3877  C CA    . VAL B 1 77  ? 47.925  -11.781 75.011  1.00 35.13 ? 74  VAL B CA    1 
ATOM   3878  C C     . VAL B 1 77  ? 47.378  -13.197 74.923  1.00 34.91 ? 74  VAL B C     1 
ATOM   3879  O O     . VAL B 1 77  ? 47.148  -13.731 73.831  1.00 34.28 ? 74  VAL B O     1 
ATOM   3880  C CB    . VAL B 1 77  ? 46.722  -10.795 74.929  1.00 34.81 ? 74  VAL B CB    1 
ATOM   3881  C CG1   . VAL B 1 77  ? 45.655  -11.167 75.942  1.00 35.34 ? 74  VAL B CG1   1 
ATOM   3882  C CG2   . VAL B 1 77  ? 47.209  -9.375  75.145  1.00 33.05 ? 74  VAL B CG2   1 
ATOM   3883  N N     . GLN B 1 78  ? 47.190  -13.780 76.106  1.00 33.33 ? 75  GLN B N     1 
ATOM   3884  C CA    . GLN B 1 78  ? 46.626  -15.107 76.298  1.00 34.21 ? 75  GLN B CA    1 
ATOM   3885  C C     . GLN B 1 78  ? 45.568  -14.853 77.370  1.00 34.25 ? 75  GLN B C     1 
ATOM   3886  O O     . GLN B 1 78  ? 45.855  -14.206 78.379  1.00 35.14 ? 75  GLN B O     1 
ATOM   3887  C CB    . GLN B 1 78  ? 47.703  -16.099 76.749  1.00 32.71 ? 75  GLN B CB    1 
ATOM   3888  C CG    . GLN B 1 78  ? 48.583  -16.539 75.578  1.00 32.72 ? 75  GLN B CG    1 
ATOM   3889  C CD    . GLN B 1 78  ? 49.470  -17.749 75.880  1.00 34.32 ? 75  GLN B CD    1 
ATOM   3890  O OE1   . GLN B 1 78  ? 49.899  -18.452 74.956  1.00 35.07 ? 75  GLN B OE1   1 
ATOM   3891  N NE2   . GLN B 1 78  ? 49.753  -17.994 77.160  1.00 33.08 ? 75  GLN B NE2   1 
ATOM   3892  N N     . TRP B 1 79  ? 44.350  -15.349 77.147  1.00 33.27 ? 76  TRP B N     1 
ATOM   3893  C CA    . TRP B 1 79  ? 43.250  -15.065 78.063  1.00 32.76 ? 76  TRP B CA    1 
ATOM   3894  C C     . TRP B 1 79  ? 42.412  -16.231 78.587  1.00 32.79 ? 76  TRP B C     1 
ATOM   3895  O O     . TRP B 1 79  ? 42.281  -17.275 77.946  1.00 34.13 ? 76  TRP B O     1 
ATOM   3896  C CB    . TRP B 1 79  ? 42.310  -14.056 77.382  1.00 32.88 ? 76  TRP B CB    1 
ATOM   3897  C CG    . TRP B 1 79  ? 41.677  -13.070 78.312  1.00 34.56 ? 76  TRP B CG    1 
ATOM   3898  C CD1   . TRP B 1 79  ? 40.523  -13.225 79.019  1.00 33.73 ? 76  TRP B CD1   1 
ATOM   3899  C CD2   . TRP B 1 79  ? 42.200  -11.787 78.669  1.00 34.82 ? 76  TRP B CD2   1 
ATOM   3900  N NE1   . TRP B 1 79  ? 40.292  -12.117 79.798  1.00 35.48 ? 76  TRP B NE1   1 
ATOM   3901  C CE2   . TRP B 1 79  ? 41.308  -11.218 79.603  1.00 36.35 ? 76  TRP B CE2   1 
ATOM   3902  C CE3   . TRP B 1 79  ? 43.338  -11.063 78.292  1.00 33.68 ? 76  TRP B CE3   1 
ATOM   3903  C CZ2   . TRP B 1 79  ? 41.519  -9.954  80.166  1.00 36.66 ? 76  TRP B CZ2   1 
ATOM   3904  C CZ3   . TRP B 1 79  ? 43.548  -9.808  78.851  1.00 34.15 ? 76  TRP B CZ3   1 
ATOM   3905  C CH2   . TRP B 1 79  ? 42.644  -9.267  79.777  1.00 34.92 ? 76  TRP B CH2   1 
ATOM   3906  N N     . SER B 1 80  ? 41.829  -16.022 79.765  1.00 32.23 ? 77  SER B N     1 
ATOM   3907  C CA    . SER B 1 80  ? 40.951  -17.002 80.401  1.00 31.88 ? 77  SER B CA    1 
ATOM   3908  C C     . SER B 1 80  ? 39.955  -16.233 81.272  1.00 30.42 ? 77  SER B C     1 
ATOM   3909  O O     . SER B 1 80  ? 40.239  -15.111 81.710  1.00 30.16 ? 77  SER B O     1 
ATOM   3910  C CB    . SER B 1 80  ? 41.750  -18.019 81.247  1.00 31.33 ? 77  SER B CB    1 
ATOM   3911  O OG    . SER B 1 80  ? 42.016  -17.559 82.562  1.00 31.56 ? 77  SER B OG    1 
ATOM   3912  N N     . SER B 1 81  ? 38.785  -16.822 81.505  1.00 28.92 ? 78  SER B N     1 
ATOM   3913  C CA    . SER B 1 81  ? 37.758  -16.168 82.310  1.00 29.74 ? 78  SER B CA    1 
ATOM   3914  C C     . SER B 1 81  ? 37.989  -16.350 83.807  1.00 28.82 ? 78  SER B C     1 
ATOM   3915  O O     . SER B 1 81  ? 38.596  -17.336 84.237  1.00 26.82 ? 78  SER B O     1 
ATOM   3916  C CB    . SER B 1 81  ? 36.368  -16.710 81.950  1.00 31.57 ? 78  SER B CB    1 
ATOM   3917  O OG    . SER B 1 81  ? 35.374  -16.151 82.791  1.00 30.92 ? 78  SER B OG    1 
ATOM   3918  N N     . CYS B 1 82  ? 37.501  -15.393 84.594  1.00 27.37 ? 79  CYS B N     1 
ATOM   3919  C CA    . CYS B 1 82  ? 37.650  -15.480 86.035  1.00 26.49 ? 79  CYS B CA    1 
ATOM   3920  C C     . CYS B 1 82  ? 36.383  -16.042 86.690  1.00 25.44 ? 79  CYS B C     1 
ATOM   3921  O O     . CYS B 1 82  ? 36.142  -15.826 87.878  1.00 28.11 ? 79  CYS B O     1 
ATOM   3922  C CB    . CYS B 1 82  ? 38.011  -14.106 86.626  1.00 24.94 ? 79  CYS B CB    1 
ATOM   3923  S SG    . CYS B 1 82  ? 36.725  -12.847 86.566  1.00 22.59 ? 79  CYS B SG    1 
ATOM   3924  N N     . ASN B 1 83  ? 35.585  -16.777 85.914  1.00 23.10 ? 80  ASN B N     1 
ATOM   3925  C CA    . ASN B 1 83  ? 34.347  -17.405 86.410  1.00 22.75 ? 80  ASN B CA    1 
ATOM   3926  C C     . ASN B 1 83  ? 33.799  -18.452 85.429  1.00 23.56 ? 80  ASN B C     1 
ATOM   3927  O O     . ASN B 1 83  ? 33.838  -18.263 84.212  1.00 25.28 ? 80  ASN B O     1 
ATOM   3928  C CB    . ASN B 1 83  ? 33.276  -16.353 86.706  1.00 19.46 ? 80  ASN B CB    1 
ATOM   3929  C CG    . ASN B 1 83  ? 32.085  -16.934 87.446  1.00 20.60 ? 80  ASN B CG    1 
ATOM   3930  O OD1   . ASN B 1 83  ? 31.220  -17.578 86.850  1.00 19.62 ? 80  ASN B OD1   1 
ATOM   3931  N ND2   . ASN B 1 83  ? 32.040  -16.712 88.769  1.00 18.70 ? 80  ASN B ND2   1 
ATOM   3932  N N     . ILE B 1 84  ? 33.277  -19.549 85.964  1.00 23.41 ? 81  ILE B N     1 
ATOM   3933  C CA    . ILE B 1 84  ? 32.769  -20.637 85.139  1.00 24.43 ? 81  ILE B CA    1 
ATOM   3934  C C     . ILE B 1 84  ? 31.514  -20.381 84.305  1.00 25.10 ? 81  ILE B C     1 
ATOM   3935  O O     . ILE B 1 84  ? 31.201  -21.158 83.392  1.00 26.69 ? 81  ILE B O     1 
ATOM   3936  C CB    . ILE B 1 84  ? 32.530  -21.898 86.009  1.00 23.61 ? 81  ILE B CB    1 
ATOM   3937  C CG1   . ILE B 1 84  ? 31.571  -21.575 87.158  1.00 21.95 ? 81  ILE B CG1   1 
ATOM   3938  C CG2   . ILE B 1 84  ? 33.855  -22.400 86.530  1.00 23.78 ? 81  ILE B CG2   1 
ATOM   3939  C CD1   . ILE B 1 84  ? 31.085  -22.797 87.926  1.00 21.34 ? 81  ILE B CD1   1 
ATOM   3940  N N     . PHE B 1 85  ? 30.809  -19.294 84.591  1.00 24.75 ? 82  PHE B N     1 
ATOM   3941  C CA    . PHE B 1 85  ? 29.588  -19.011 83.862  1.00 24.39 ? 82  PHE B CA    1 
ATOM   3942  C C     . PHE B 1 85  ? 29.540  -17.654 83.185  1.00 25.53 ? 82  PHE B C     1 
ATOM   3943  O O     . PHE B 1 85  ? 28.586  -17.360 82.473  1.00 26.83 ? 82  PHE B O     1 
ATOM   3944  C CB    . PHE B 1 85  ? 28.401  -19.116 84.800  1.00 23.66 ? 82  PHE B CB    1 
ATOM   3945  C CG    . PHE B 1 85  ? 28.237  -20.463 85.428  1.00 27.63 ? 82  PHE B CG    1 
ATOM   3946  C CD1   . PHE B 1 85  ? 28.181  -21.611 84.640  1.00 27.23 ? 82  PHE B CD1   1 
ATOM   3947  C CD2   . PHE B 1 85  ? 28.052  -20.583 86.808  1.00 27.07 ? 82  PHE B CD2   1 
ATOM   3948  C CE1   . PHE B 1 85  ? 27.935  -22.853 85.204  1.00 25.70 ? 82  PHE B CE1   1 
ATOM   3949  C CE2   . PHE B 1 85  ? 27.805  -21.833 87.388  1.00 26.86 ? 82  PHE B CE2   1 
ATOM   3950  C CZ    . PHE B 1 85  ? 27.745  -22.966 86.582  1.00 27.13 ? 82  PHE B CZ    1 
ATOM   3951  N N     . SER B 1 86  ? 30.554  -16.820 83.392  1.00 24.38 ? 83  SER B N     1 
ATOM   3952  C CA    . SER B 1 86  ? 30.502  -15.482 82.818  1.00 23.23 ? 83  SER B CA    1 
ATOM   3953  C C     . SER B 1 86  ? 30.909  -15.377 81.367  1.00 22.04 ? 83  SER B C     1 
ATOM   3954  O O     . SER B 1 86  ? 30.621  -14.393 80.709  1.00 24.30 ? 83  SER B O     1 
ATOM   3955  C CB    . SER B 1 86  ? 31.339  -14.510 83.649  1.00 24.27 ? 83  SER B CB    1 
ATOM   3956  O OG    . SER B 1 86  ? 32.706  -14.892 83.698  1.00 25.75 ? 83  SER B OG    1 
ATOM   3957  N N     . THR B 1 87  ? 31.585  -16.389 80.860  1.00 22.62 ? 84  THR B N     1 
ATOM   3958  C CA    . THR B 1 87  ? 32.035  -16.359 79.490  1.00 22.06 ? 84  THR B CA    1 
ATOM   3959  C C     . THR B 1 87  ? 30.901  -16.261 78.487  1.00 23.46 ? 84  THR B C     1 
ATOM   3960  O O     . THR B 1 87  ? 29.875  -16.939 78.622  1.00 24.06 ? 84  THR B O     1 
ATOM   3961  C CB    . THR B 1 87  ? 32.842  -17.591 79.186  1.00 21.41 ? 84  THR B CB    1 
ATOM   3962  O OG1   . THR B 1 87  ? 34.008  -17.588 80.003  1.00 24.12 ? 84  THR B OG1   1 
ATOM   3963  C CG2   . THR B 1 87  ? 33.250  -17.610 77.710  1.00 21.79 ? 84  THR B CG2   1 
ATOM   3964  N N     . GLN B 1 88  ? 31.090  -15.397 77.495  1.00 21.11 ? 85  GLN B N     1 
ATOM   3965  C CA    . GLN B 1 88  ? 30.120  -15.213 76.431  1.00 23.32 ? 85  GLN B CA    1 
ATOM   3966  C C     . GLN B 1 88  ? 30.747  -15.854 75.188  1.00 25.13 ? 85  GLN B C     1 
ATOM   3967  O O     . GLN B 1 88  ? 31.627  -15.264 74.553  1.00 24.90 ? 85  GLN B O     1 
ATOM   3968  C CB    . GLN B 1 88  ? 29.848  -13.715 76.223  1.00 21.95 ? 85  GLN B CB    1 
ATOM   3969  C CG    . GLN B 1 88  ? 29.150  -13.061 77.429  1.00 21.10 ? 85  GLN B CG    1 
ATOM   3970  C CD    . GLN B 1 88  ? 29.002  -11.539 77.331  1.00 21.43 ? 85  GLN B CD    1 
ATOM   3971  O OE1   . GLN B 1 88  ? 28.279  -10.929 78.117  1.00 20.64 ? 85  GLN B OE1   1 
ATOM   3972  N NE2   . GLN B 1 88  ? 29.693  -10.925 76.371  1.00 20.07 ? 85  GLN B NE2   1 
ATOM   3973  N N     . ASP B 1 89  ? 30.291  -17.070 74.870  1.00 25.20 ? 86  ASP B N     1 
ATOM   3974  C CA    . ASP B 1 89  ? 30.798  -17.878 73.751  1.00 24.32 ? 86  ASP B CA    1 
ATOM   3975  C C     . ASP B 1 89  ? 31.071  -17.189 72.416  1.00 25.96 ? 86  ASP B C     1 
ATOM   3976  O O     . ASP B 1 89  ? 32.097  -17.440 71.787  1.00 29.06 ? 86  ASP B O     1 
ATOM   3977  C CB    . ASP B 1 89  ? 29.876  -19.081 73.516  1.00 21.59 ? 86  ASP B CB    1 
ATOM   3978  C CG    . ASP B 1 89  ? 29.769  -19.999 74.741  1.00 21.80 ? 86  ASP B CG    1 
ATOM   3979  O OD1   . ASP B 1 89  ? 30.738  -20.186 75.484  1.00 23.96 ? 86  ASP B OD1   1 
ATOM   3980  O OD2   . ASP B 1 89  ? 28.587  -20.590 74.941  1.00 19.39 ? 86  ASP B OD2   1 
ATOM   3981  N N     . HIS B 1 90  ? 30.178  -16.330 71.953  1.00 27.41 ? 87  HIS B N     1 
ATOM   3982  C CA    . HIS B 1 90  ? 30.437  -15.677 70.682  1.00 29.73 ? 87  HIS B CA    1 
ATOM   3983  C C     . HIS B 1 90  ? 31.592  -14.678 70.794  1.00 30.97 ? 87  HIS B C     1 
ATOM   3984  O O     . HIS B 1 90  ? 32.302  -14.434 69.813  1.00 32.37 ? 87  HIS B O     1 
ATOM   3985  C CB    . HIS B 1 90  ? 29.164  -14.990 70.154  1.00 30.59 ? 87  HIS B CB    1 
ATOM   3986  C CG    . HIS B 1 90  ? 28.667  -13.869 71.015  1.00 30.88 ? 87  HIS B CG    1 
ATOM   3987  N ND1   . HIS B 1 90  ? 28.472  -14.004 72.371  1.00 31.79 ? 87  HIS B ND1   1 
ATOM   3988  C CD2   . HIS B 1 90  ? 28.273  -12.611 70.699  1.00 30.45 ? 87  HIS B CD2   1 
ATOM   3989  C CE1   . HIS B 1 90  ? 27.975  -12.878 72.855  1.00 32.25 ? 87  HIS B CE1   1 
ATOM   3990  N NE2   . HIS B 1 90  ? 27.844  -12.018 71.862  1.00 30.77 ? 87  HIS B NE2   1 
ATOM   3991  N N     . ALA B 1 91  ? 31.798  -14.116 71.985  1.00 29.07 ? 88  ALA B N     1 
ATOM   3992  C CA    . ALA B 1 91  ? 32.888  -13.165 72.198  1.00 30.04 ? 88  ALA B CA    1 
ATOM   3993  C C     . ALA B 1 91  ? 34.223  -13.911 72.345  1.00 29.48 ? 88  ALA B C     1 
ATOM   3994  O O     . ALA B 1 91  ? 35.285  -13.406 71.958  1.00 28.24 ? 88  ALA B O     1 
ATOM   3995  C CB    . ALA B 1 91  ? 32.617  -12.309 73.452  1.00 30.18 ? 88  ALA B CB    1 
ATOM   3996  N N     . ALA B 1 92  ? 34.156  -15.110 72.916  1.00 28.81 ? 89  ALA B N     1 
ATOM   3997  C CA    . ALA B 1 92  ? 35.335  -15.942 73.103  1.00 28.13 ? 89  ALA B CA    1 
ATOM   3998  C C     . ALA B 1 92  ? 35.766  -16.473 71.729  1.00 29.20 ? 89  ALA B C     1 
ATOM   3999  O O     . ALA B 1 92  ? 36.959  -16.583 71.440  1.00 28.90 ? 89  ALA B O     1 
ATOM   4000  C CB    . ALA B 1 92  ? 35.003  -17.098 74.043  1.00 26.86 ? 89  ALA B CB    1 
ATOM   4001  N N     . ALA B 1 93  ? 34.782  -16.790 70.888  1.00 28.92 ? 90  ALA B N     1 
ATOM   4002  C CA    . ALA B 1 93  ? 35.030  -17.288 69.538  1.00 31.22 ? 90  ALA B CA    1 
ATOM   4003  C C     . ALA B 1 93  ? 35.700  -16.233 68.672  1.00 31.27 ? 90  ALA B C     1 
ATOM   4004  O O     . ALA B 1 93  ? 36.695  -16.511 68.007  1.00 35.23 ? 90  ALA B O     1 
ATOM   4005  C CB    . ALA B 1 93  ? 33.710  -17.718 68.882  1.00 33.10 ? 90  ALA B CB    1 
ATOM   4006  N N     . ALA B 1 94  ? 35.159  -15.020 68.682  1.00 30.15 ? 91  ALA B N     1 
ATOM   4007  C CA    . ALA B 1 94  ? 35.714  -13.944 67.876  1.00 30.09 ? 91  ALA B CA    1 
ATOM   4008  C C     . ALA B 1 94  ? 37.199  -13.748 68.157  1.00 30.63 ? 91  ALA B C     1 
ATOM   4009  O O     . ALA B 1 94  ? 37.995  -13.542 67.239  1.00 30.20 ? 91  ALA B O     1 
ATOM   4010  C CB    . ALA B 1 94  ? 34.952  -12.651 68.140  1.00 29.39 ? 91  ALA B CB    1 
ATOM   4011  N N     . ILE B 1 95  ? 37.564  -13.805 69.432  1.00 30.22 ? 92  ILE B N     1 
ATOM   4012  C CA    . ILE B 1 95  ? 38.946  -13.645 69.846  1.00 31.44 ? 92  ILE B CA    1 
ATOM   4013  C C     . ILE B 1 95  ? 39.785  -14.819 69.346  1.00 32.68 ? 92  ILE B C     1 
ATOM   4014  O O     . ILE B 1 95  ? 40.900  -14.632 68.862  1.00 32.02 ? 92  ILE B O     1 
ATOM   4015  C CB    . ILE B 1 95  ? 39.058  -13.564 71.390  1.00 32.02 ? 92  ILE B CB    1 
ATOM   4016  C CG1   . ILE B 1 95  ? 38.387  -12.281 71.895  1.00 31.16 ? 92  ILE B CG1   1 
ATOM   4017  C CG2   . ILE B 1 95  ? 40.512  -13.595 71.815  1.00 32.05 ? 92  ILE B CG2   1 
ATOM   4018  C CD1   . ILE B 1 95  ? 38.966  -11.016 71.298  1.00 30.41 ? 92  ILE B CD1   1 
ATOM   4019  N N     . ALA B 1 96  ? 39.246  -16.029 69.462  1.00 33.57 ? 93  ALA B N     1 
ATOM   4020  C CA    . ALA B 1 96  ? 39.956  -17.221 69.012  1.00 34.58 ? 93  ALA B CA    1 
ATOM   4021  C C     . ALA B 1 96  ? 40.283  -17.160 67.521  1.00 35.39 ? 93  ALA B C     1 
ATOM   4022  O O     . ALA B 1 96  ? 41.387  -17.522 67.105  1.00 35.34 ? 93  ALA B O     1 
ATOM   4023  C CB    . ALA B 1 96  ? 39.127  -18.472 69.311  1.00 35.36 ? 93  ALA B CB    1 
ATOM   4024  N N     . LYS B 1 97  ? 39.327  -16.695 66.724  1.00 34.24 ? 94  LYS B N     1 
ATOM   4025  C CA    . LYS B 1 97  ? 39.523  -16.605 65.287  1.00 35.90 ? 94  LYS B CA    1 
ATOM   4026  C C     . LYS B 1 97  ? 40.565  -15.562 64.886  1.00 35.61 ? 94  LYS B C     1 
ATOM   4027  O O     . LYS B 1 97  ? 41.168  -15.658 63.811  1.00 36.65 ? 94  LYS B O     1 
ATOM   4028  C CB    . LYS B 1 97  ? 38.184  -16.313 64.594  1.00 37.60 ? 94  LYS B CB    1 
ATOM   4029  C CG    . LYS B 1 97  ? 38.300  -16.189 63.080  1.00 40.04 ? 94  LYS B CG    1 
ATOM   4030  C CD    . LYS B 1 97  ? 37.057  -16.698 62.361  1.00 41.71 ? 94  LYS B CD    1 
ATOM   4031  C CE    . LYS B 1 97  ? 37.026  -18.221 62.279  1.00 44.09 ? 94  LYS B CE    1 
ATOM   4032  N NZ    . LYS B 1 97  ? 38.044  -18.776 61.325  1.00 44.87 ? 94  LYS B NZ    1 
ATOM   4033  N N     . ALA B 1 98  ? 40.781  -14.578 65.754  1.00 33.51 ? 95  ALA B N     1 
ATOM   4034  C CA    . ALA B 1 98  ? 41.758  -13.526 65.497  1.00 32.11 ? 95  ALA B CA    1 
ATOM   4035  C C     . ALA B 1 98  ? 43.180  -13.972 65.853  1.00 32.99 ? 95  ALA B C     1 
ATOM   4036  O O     . ALA B 1 98  ? 44.116  -13.181 65.793  1.00 31.60 ? 95  ALA B O     1 
ATOM   4037  C CB    . ALA B 1 98  ? 41.391  -12.273 66.291  1.00 32.50 ? 95  ALA B CB    1 
ATOM   4038  N N     . GLY B 1 99  ? 43.338  -15.233 66.247  1.00 33.42 ? 96  GLY B N     1 
ATOM   4039  C CA    . GLY B 1 99  ? 44.660  -15.743 66.586  1.00 33.04 ? 96  GLY B CA    1 
ATOM   4040  C C     . GLY B 1 99  ? 45.079  -15.546 68.033  1.00 33.26 ? 96  GLY B C     1 
ATOM   4041  O O     . GLY B 1 99  ? 46.184  -15.926 68.431  1.00 31.30 ? 96  GLY B O     1 
ATOM   4042  N N     . ILE B 1 100 ? 44.202  -14.946 68.829  1.00 33.54 ? 97  ILE B N     1 
ATOM   4043  C CA    . ILE B 1 100 ? 44.506  -14.707 70.231  1.00 33.41 ? 97  ILE B CA    1 
ATOM   4044  C C     . ILE B 1 100 ? 44.116  -15.927 71.062  1.00 34.30 ? 97  ILE B C     1 
ATOM   4045  O O     . ILE B 1 100 ? 42.949  -16.289 71.135  1.00 34.04 ? 97  ILE B O     1 
ATOM   4046  C CB    . ILE B 1 100 ? 43.741  -13.477 70.762  1.00 32.16 ? 97  ILE B CB    1 
ATOM   4047  C CG1   . ILE B 1 100 ? 43.957  -12.273 69.844  1.00 31.87 ? 97  ILE B CG1   1 
ATOM   4048  C CG2   . ILE B 1 100 ? 44.240  -13.129 72.137  1.00 33.11 ? 97  ILE B CG2   1 
ATOM   4049  C CD1   . ILE B 1 100 ? 43.166  -11.050 70.274  1.00 32.29 ? 97  ILE B CD1   1 
ATOM   4050  N N     . PRO B 1 101 ? 45.102  -16.590 71.681  1.00 35.88 ? 98  PRO B N     1 
ATOM   4051  C CA    . PRO B 1 101 ? 44.856  -17.777 72.511  1.00 36.35 ? 98  PRO B CA    1 
ATOM   4052  C C     . PRO B 1 101 ? 43.892  -17.468 73.647  1.00 37.57 ? 98  PRO B C     1 
ATOM   4053  O O     . PRO B 1 101 ? 44.187  -16.650 74.529  1.00 37.98 ? 98  PRO B O     1 
ATOM   4054  C CB    . PRO B 1 101 ? 46.248  -18.131 73.043  1.00 36.91 ? 98  PRO B CB    1 
ATOM   4055  C CG    . PRO B 1 101 ? 47.157  -17.662 71.968  1.00 37.07 ? 98  PRO B CG    1 
ATOM   4056  C CD    . PRO B 1 101 ? 46.546  -16.329 71.543  1.00 37.36 ? 98  PRO B CD    1 
ATOM   4057  N N     . VAL B 1 102 ? 42.742  -18.125 73.629  1.00 36.15 ? 99  VAL B N     1 
ATOM   4058  C CA    . VAL B 1 102 ? 41.746  -17.930 74.666  1.00 34.30 ? 99  VAL B CA    1 
ATOM   4059  C C     . VAL B 1 102 ? 41.202  -19.275 75.099  1.00 33.70 ? 99  VAL B C     1 
ATOM   4060  O O     . VAL B 1 102 ? 40.844  -20.100 74.265  1.00 33.87 ? 99  VAL B O     1 
ATOM   4061  C CB    . VAL B 1 102 ? 40.589  -17.063 74.152  1.00 34.45 ? 99  VAL B CB    1 
ATOM   4062  C CG1   . VAL B 1 102 ? 39.405  -17.171 75.070  1.00 30.25 ? 99  VAL B CG1   1 
ATOM   4063  C CG2   . VAL B 1 102 ? 41.037  -15.627 74.070  1.00 37.00 ? 99  VAL B CG2   1 
ATOM   4064  N N     . TYR B 1 103 ? 41.141  -19.502 76.404  1.00 32.86 ? 100 TYR B N     1 
ATOM   4065  C CA    . TYR B 1 103 ? 40.622  -20.764 76.921  1.00 32.53 ? 100 TYR B CA    1 
ATOM   4066  C C     . TYR B 1 103 ? 39.476  -20.430 77.866  1.00 33.14 ? 100 TYR B C     1 
ATOM   4067  O O     . TYR B 1 103 ? 39.688  -20.188 79.060  1.00 33.14 ? 100 TYR B O     1 
ATOM   4068  C CB    . TYR B 1 103 ? 41.729  -21.541 77.645  1.00 31.33 ? 100 TYR B CB    1 
ATOM   4069  C CG    . TYR B 1 103 ? 42.991  -21.647 76.821  1.00 30.87 ? 100 TYR B CG    1 
ATOM   4070  C CD1   . TYR B 1 103 ? 43.897  -20.590 76.769  1.00 32.55 ? 100 TYR B CD1   1 
ATOM   4071  C CD2   . TYR B 1 103 ? 43.224  -22.749 76.007  1.00 31.33 ? 100 TYR B CD2   1 
ATOM   4072  C CE1   . TYR B 1 103 ? 44.990  -20.623 75.921  1.00 34.27 ? 100 TYR B CE1   1 
ATOM   4073  C CE2   . TYR B 1 103 ? 44.313  -22.794 75.154  1.00 33.10 ? 100 TYR B CE2   1 
ATOM   4074  C CZ    . TYR B 1 103 ? 45.190  -21.725 75.110  1.00 35.49 ? 100 TYR B CZ    1 
ATOM   4075  O OH    . TYR B 1 103 ? 46.239  -21.737 74.214  1.00 37.98 ? 100 TYR B OH    1 
ATOM   4076  N N     . ALA B 1 104 ? 38.261  -20.413 77.316  1.00 31.88 ? 101 ALA B N     1 
ATOM   4077  C CA    . ALA B 1 104 ? 37.087  -20.063 78.096  1.00 29.72 ? 101 ALA B CA    1 
ATOM   4078  C C     . ALA B 1 104 ? 35.778  -20.335 77.371  1.00 28.29 ? 101 ALA B C     1 
ATOM   4079  O O     . ALA B 1 104 ? 35.651  -20.061 76.180  1.00 27.58 ? 101 ALA B O     1 
ATOM   4080  C CB    . ALA B 1 104 ? 37.156  -18.587 78.474  1.00 28.07 ? 101 ALA B CB    1 
ATOM   4081  N N     . TRP B 1 105 ? 34.808  -20.868 78.104  1.00 27.19 ? 102 TRP B N     1 
ATOM   4082  C CA    . TRP B 1 105 ? 33.486  -21.146 77.571  1.00 27.49 ? 102 TRP B CA    1 
ATOM   4083  C C     . TRP B 1 105 ? 32.528  -21.119 78.757  1.00 27.02 ? 102 TRP B C     1 
ATOM   4084  O O     . TRP B 1 105 ? 32.952  -21.357 79.892  1.00 26.53 ? 102 TRP B O     1 
ATOM   4085  C CB    . TRP B 1 105 ? 33.473  -22.498 76.871  1.00 26.09 ? 102 TRP B CB    1 
ATOM   4086  C CG    . TRP B 1 105 ? 33.856  -23.644 77.741  1.00 27.78 ? 102 TRP B CG    1 
ATOM   4087  C CD1   . TRP B 1 105 ? 33.019  -24.413 78.506  1.00 28.17 ? 102 TRP B CD1   1 
ATOM   4088  C CD2   . TRP B 1 105 ? 35.174  -24.171 77.933  1.00 26.95 ? 102 TRP B CD2   1 
ATOM   4089  N NE1   . TRP B 1 105 ? 33.737  -25.388 79.156  1.00 28.24 ? 102 TRP B NE1   1 
ATOM   4090  C CE2   . TRP B 1 105 ? 35.061  -25.262 78.824  1.00 28.47 ? 102 TRP B CE2   1 
ATOM   4091  C CE3   . TRP B 1 105 ? 36.440  -23.827 77.440  1.00 26.51 ? 102 TRP B CE3   1 
ATOM   4092  C CZ2   . TRP B 1 105 ? 36.169  -26.014 79.233  1.00 28.96 ? 102 TRP B CZ2   1 
ATOM   4093  C CZ3   . TRP B 1 105 ? 37.542  -24.574 77.845  1.00 26.96 ? 102 TRP B CZ3   1 
ATOM   4094  C CH2   . TRP B 1 105 ? 37.399  -25.655 78.732  1.00 27.58 ? 102 TRP B CH2   1 
ATOM   4095  N N     . LYS B 1 106 ? 31.262  -20.784 78.495  1.00 27.58 ? 103 LYS B N     1 
ATOM   4096  C CA    . LYS B 1 106 ? 30.217  -20.726 79.530  1.00 28.37 ? 103 LYS B CA    1 
ATOM   4097  C C     . LYS B 1 106 ? 29.885  -22.135 79.991  1.00 28.34 ? 103 LYS B C     1 
ATOM   4098  O O     . LYS B 1 106 ? 29.655  -23.006 79.167  1.00 28.22 ? 103 LYS B O     1 
ATOM   4099  C CB    . LYS B 1 106 ? 28.937  -20.085 78.963  1.00 27.74 ? 103 LYS B CB    1 
ATOM   4100  C CG    . LYS B 1 106 ? 27.875  -19.687 80.015  1.00 23.62 ? 103 LYS B CG    1 
ATOM   4101  C CD    . LYS B 1 106 ? 26.748  -18.844 79.393  1.00 19.76 ? 103 LYS B CD    1 
ATOM   4102  C CE    . LYS B 1 106 ? 25.714  -18.348 80.438  1.00 17.95 ? 103 LYS B CE    1 
ATOM   4103  N NZ    . LYS B 1 106 ? 26.005  -17.009 81.065  1.00 12.37 ? 103 LYS B NZ    1 
ATOM   4104  N N     . GLY B 1 107 ? 29.867  -22.361 81.303  1.00 30.08 ? 104 GLY B N     1 
ATOM   4105  C CA    . GLY B 1 107 ? 29.539  -23.686 81.818  1.00 30.36 ? 104 GLY B CA    1 
ATOM   4106  C C     . GLY B 1 107 ? 30.720  -24.575 82.170  1.00 30.42 ? 104 GLY B C     1 
ATOM   4107  O O     . GLY B 1 107 ? 30.606  -25.796 82.142  1.00 29.91 ? 104 GLY B O     1 
ATOM   4108  N N     . GLU B 1 108 ? 31.855  -23.970 82.500  1.00 31.11 ? 105 GLU B N     1 
ATOM   4109  C CA    . GLU B 1 108 ? 33.049  -24.730 82.864  1.00 32.54 ? 105 GLU B CA    1 
ATOM   4110  C C     . GLU B 1 108 ? 32.851  -25.482 84.173  1.00 33.72 ? 105 GLU B C     1 
ATOM   4111  O O     . GLU B 1 108 ? 31.809  -25.393 84.820  1.00 34.69 ? 105 GLU B O     1 
ATOM   4112  C CB    . GLU B 1 108 ? 34.260  -23.795 83.015  1.00 31.01 ? 105 GLU B CB    1 
ATOM   4113  C CG    . GLU B 1 108 ? 34.861  -23.313 81.709  1.00 29.46 ? 105 GLU B CG    1 
ATOM   4114  C CD    . GLU B 1 108 ? 35.753  -22.095 81.890  1.00 28.86 ? 105 GLU B CD    1 
ATOM   4115  O OE1   . GLU B 1 108 ? 36.585  -22.090 82.825  1.00 30.80 ? 105 GLU B OE1   1 
ATOM   4116  O OE2   . GLU B 1 108 ? 35.631  -21.143 81.093  1.00 25.14 ? 105 GLU B OE2   1 
ATOM   4117  N N     . THR B 1 109 ? 33.874  -26.233 84.547  1.00 35.27 ? 106 THR B N     1 
ATOM   4118  C CA    . THR B 1 109 ? 33.873  -26.987 85.783  1.00 35.25 ? 106 THR B CA    1 
ATOM   4119  C C     . THR B 1 109 ? 35.099  -26.486 86.512  1.00 36.00 ? 106 THR B C     1 
ATOM   4120  O O     . THR B 1 109 ? 35.955  -25.831 85.910  1.00 35.46 ? 106 THR B O     1 
ATOM   4121  C CB    . THR B 1 109 ? 34.044  -28.491 85.539  1.00 35.49 ? 106 THR B CB    1 
ATOM   4122  O OG1   . THR B 1 109 ? 35.308  -28.727 84.905  1.00 34.73 ? 106 THR B OG1   1 
ATOM   4123  C CG2   . THR B 1 109 ? 32.933  -29.014 84.654  1.00 34.95 ? 106 THR B CG2   1 
ATOM   4124  N N     . ASP B 1 110 ? 35.179  -26.792 87.802  1.00 37.35 ? 107 ASP B N     1 
ATOM   4125  C CA    . ASP B 1 110 ? 36.309  -26.374 88.616  1.00 37.20 ? 107 ASP B CA    1 
ATOM   4126  C C     . ASP B 1 110 ? 37.609  -26.887 87.995  1.00 36.59 ? 107 ASP B C     1 
ATOM   4127  O O     . ASP B 1 110 ? 38.603  -26.174 87.931  1.00 36.85 ? 107 ASP B O     1 
ATOM   4128  C CB    . ASP B 1 110 ? 36.172  -26.924 90.045  1.00 38.32 ? 107 ASP B CB    1 
ATOM   4129  C CG    . ASP B 1 110 ? 34.821  -26.594 90.694  1.00 40.63 ? 107 ASP B CG    1 
ATOM   4130  O OD1   . ASP B 1 110 ? 34.405  -25.411 90.697  1.00 37.25 ? 107 ASP B OD1   1 
ATOM   4131  O OD2   . ASP B 1 110 ? 34.178  -27.534 91.218  1.00 44.05 ? 107 ASP B OD2   1 
ATOM   4132  N N     . GLU B 1 111 ? 37.596  -28.130 87.531  1.00 37.55 ? 108 GLU B N     1 
ATOM   4133  C CA    . GLU B 1 111 ? 38.783  -28.728 86.940  1.00 39.04 ? 108 GLU B CA    1 
ATOM   4134  C C     . GLU B 1 111 ? 39.165  -28.023 85.653  1.00 36.91 ? 108 GLU B C     1 
ATOM   4135  O O     . GLU B 1 111 ? 40.344  -27.785 85.389  1.00 37.55 ? 108 GLU B O     1 
ATOM   4136  C CB    . GLU B 1 111 ? 38.553  -30.211 86.646  1.00 43.86 ? 108 GLU B CB    1 
ATOM   4137  C CG    . GLU B 1 111 ? 38.002  -31.036 87.805  1.00 50.88 ? 108 GLU B CG    1 
ATOM   4138  C CD    . GLU B 1 111 ? 36.553  -30.688 88.146  1.00 55.42 ? 108 GLU B CD    1 
ATOM   4139  O OE1   . GLU B 1 111 ? 36.334  -29.849 89.050  1.00 57.66 ? 108 GLU B OE1   1 
ATOM   4140  O OE2   . GLU B 1 111 ? 35.631  -31.257 87.509  1.00 57.97 ? 108 GLU B OE2   1 
ATOM   4141  N N     . GLU B 1 112 ? 38.162  -27.686 84.851  1.00 34.28 ? 109 GLU B N     1 
ATOM   4142  C CA    . GLU B 1 112 ? 38.402  -27.014 83.584  1.00 32.08 ? 109 GLU B CA    1 
ATOM   4143  C C     . GLU B 1 112 ? 38.730  -25.544 83.782  1.00 30.57 ? 109 GLU B C     1 
ATOM   4144  O O     . GLU B 1 112 ? 39.421  -24.937 82.954  1.00 29.56 ? 109 GLU B O     1 
ATOM   4145  C CB    . GLU B 1 112 ? 37.180  -27.160 82.680  1.00 33.18 ? 109 GLU B CB    1 
ATOM   4146  C CG    . GLU B 1 112 ? 36.823  -28.606 82.374  1.00 37.95 ? 109 GLU B CG    1 
ATOM   4147  C CD    . GLU B 1 112 ? 35.580  -28.731 81.515  1.00 39.53 ? 109 GLU B CD    1 
ATOM   4148  O OE1   . GLU B 1 112 ? 34.515  -28.217 81.926  1.00 40.40 ? 109 GLU B OE1   1 
ATOM   4149  O OE2   . GLU B 1 112 ? 35.670  -29.340 80.429  1.00 41.39 ? 109 GLU B OE2   1 
ATOM   4150  N N     . TYR B 1 113 ? 38.232  -24.969 84.873  1.00 29.76 ? 110 TYR B N     1 
ATOM   4151  C CA    . TYR B 1 113 ? 38.487  -23.561 85.176  1.00 30.69 ? 110 TYR B CA    1 
ATOM   4152  C C     . TYR B 1 113 ? 39.982  -23.396 85.402  1.00 30.09 ? 110 TYR B C     1 
ATOM   4153  O O     . TYR B 1 113 ? 40.641  -22.571 84.772  1.00 28.89 ? 110 TYR B O     1 
ATOM   4154  C CB    . TYR B 1 113 ? 37.721  -23.138 86.444  1.00 30.95 ? 110 TYR B CB    1 
ATOM   4155  C CG    . TYR B 1 113 ? 37.970  -21.707 86.884  1.00 30.52 ? 110 TYR B CG    1 
ATOM   4156  C CD1   . TYR B 1 113 ? 37.596  -20.626 86.083  1.00 31.22 ? 110 TYR B CD1   1 
ATOM   4157  C CD2   . TYR B 1 113 ? 38.603  -21.438 88.087  1.00 31.10 ? 110 TYR B CD2   1 
ATOM   4158  C CE1   . TYR B 1 113 ? 37.850  -19.315 86.475  1.00 29.81 ? 110 TYR B CE1   1 
ATOM   4159  C CE2   . TYR B 1 113 ? 38.864  -20.129 88.487  1.00 31.82 ? 110 TYR B CE2   1 
ATOM   4160  C CZ    . TYR B 1 113 ? 38.486  -19.074 87.679  1.00 31.15 ? 110 TYR B CZ    1 
ATOM   4161  O OH    . TYR B 1 113 ? 38.756  -17.790 88.100  1.00 31.63 ? 110 TYR B OH    1 
ATOM   4162  N N     . LEU B 1 114 ? 40.509  -24.214 86.299  1.00 29.54 ? 111 LEU B N     1 
ATOM   4163  C CA    . LEU B 1 114 ? 41.919  -24.185 86.620  1.00 31.32 ? 111 LEU B CA    1 
ATOM   4164  C C     . LEU B 1 114 ? 42.727  -24.442 85.343  1.00 31.05 ? 111 LEU B C     1 
ATOM   4165  O O     . LEU B 1 114 ? 43.659  -23.696 85.018  1.00 30.85 ? 111 LEU B O     1 
ATOM   4166  C CB    . LEU B 1 114 ? 42.199  -25.266 87.660  1.00 32.02 ? 111 LEU B CB    1 
ATOM   4167  C CG    . LEU B 1 114 ? 43.332  -25.032 88.639  1.00 33.19 ? 111 LEU B CG    1 
ATOM   4168  C CD1   . LEU B 1 114 ? 43.515  -26.306 89.435  1.00 33.09 ? 111 LEU B CD1   1 
ATOM   4169  C CD2   . LEU B 1 114 ? 44.614  -24.654 87.901  1.00 34.02 ? 111 LEU B CD2   1 
ATOM   4170  N N     . TRP B 1 115 ? 42.356  -25.499 84.625  1.00 30.15 ? 112 TRP B N     1 
ATOM   4171  C CA    . TRP B 1 115 ? 43.025  -25.873 83.384  1.00 31.60 ? 112 TRP B CA    1 
ATOM   4172  C C     . TRP B 1 115 ? 43.093  -24.701 82.416  1.00 31.69 ? 112 TRP B C     1 
ATOM   4173  O O     . TRP B 1 115 ? 44.122  -24.483 81.778  1.00 33.26 ? 112 TRP B O     1 
ATOM   4174  C CB    . TRP B 1 115 ? 42.287  -27.040 82.696  1.00 32.38 ? 112 TRP B CB    1 
ATOM   4175  C CG    . TRP B 1 115 ? 42.918  -27.474 81.396  1.00 34.14 ? 112 TRP B CG    1 
ATOM   4176  C CD1   . TRP B 1 115 ? 43.916  -28.401 81.234  1.00 35.18 ? 112 TRP B CD1   1 
ATOM   4177  C CD2   . TRP B 1 115 ? 42.636  -26.958 80.085  1.00 34.20 ? 112 TRP B CD2   1 
ATOM   4178  N NE1   . TRP B 1 115 ? 44.269  -28.489 79.906  1.00 34.66 ? 112 TRP B NE1   1 
ATOM   4179  C CE2   . TRP B 1 115 ? 43.502  -27.616 79.180  1.00 33.27 ? 112 TRP B CE2   1 
ATOM   4180  C CE3   . TRP B 1 115 ? 41.741  -26.005 79.589  1.00 35.49 ? 112 TRP B CE3   1 
ATOM   4181  C CZ2   . TRP B 1 115 ? 43.498  -27.350 77.806  1.00 33.54 ? 112 TRP B CZ2   1 
ATOM   4182  C CZ3   . TRP B 1 115 ? 41.737  -25.738 78.212  1.00 35.57 ? 112 TRP B CZ3   1 
ATOM   4183  C CH2   . TRP B 1 115 ? 42.612  -26.411 77.342  1.00 33.80 ? 112 TRP B CH2   1 
ATOM   4184  N N     . CYS B 1 116 ? 41.998  -23.956 82.287  1.00 32.41 ? 113 CYS B N     1 
ATOM   4185  C CA    . CYS B 1 116 ? 41.990  -22.815 81.376  1.00 32.87 ? 113 CYS B CA    1 
ATOM   4186  C C     . CYS B 1 116 ? 43.018  -21.758 81.754  1.00 33.56 ? 113 CYS B C     1 
ATOM   4187  O O     . CYS B 1 116 ? 43.750  -21.284 80.893  1.00 36.04 ? 113 CYS B O     1 
ATOM   4188  C CB    . CYS B 1 116 ? 40.594  -22.180 81.294  1.00 32.07 ? 113 CYS B CB    1 
ATOM   4189  S SG    . CYS B 1 116 ? 39.509  -22.901 80.027  1.00 30.84 ? 113 CYS B SG    1 
ATOM   4190  N N     . ILE B 1 117 ? 43.093  -21.390 83.029  1.00 34.75 ? 114 ILE B N     1 
ATOM   4191  C CA    . ILE B 1 117 ? 44.065  -20.377 83.449  1.00 35.13 ? 114 ILE B CA    1 
ATOM   4192  C C     . ILE B 1 117 ? 45.501  -20.841 83.165  1.00 35.67 ? 114 ILE B C     1 
ATOM   4193  O O     . ILE B 1 117 ? 46.333  -20.066 82.686  1.00 35.03 ? 114 ILE B O     1 
ATOM   4194  C CB    . ILE B 1 117 ? 43.933  -20.061 84.960  1.00 34.92 ? 114 ILE B CB    1 
ATOM   4195  C CG1   . ILE B 1 117 ? 42.469  -19.769 85.296  1.00 33.32 ? 114 ILE B CG1   1 
ATOM   4196  C CG2   . ILE B 1 117 ? 44.808  -18.854 85.320  1.00 34.41 ? 114 ILE B CG2   1 
ATOM   4197  C CD1   . ILE B 1 117 ? 42.201  -19.531 86.768  1.00 28.62 ? 114 ILE B CD1   1 
ATOM   4198  N N     . GLU B 1 118 ? 45.776  -22.113 83.440  1.00 35.32 ? 115 GLU B N     1 
ATOM   4199  C CA    . GLU B 1 118 ? 47.109  -22.667 83.224  1.00 36.77 ? 115 GLU B CA    1 
ATOM   4200  C C     . GLU B 1 118 ? 47.565  -22.668 81.770  1.00 36.65 ? 115 GLU B C     1 
ATOM   4201  O O     . GLU B 1 118 ? 48.754  -22.797 81.488  1.00 36.27 ? 115 GLU B O     1 
ATOM   4202  C CB    . GLU B 1 118 ? 47.178  -24.080 83.793  1.00 36.14 ? 115 GLU B CB    1 
ATOM   4203  C CG    . GLU B 1 118 ? 46.792  -24.117 85.261  1.00 41.34 ? 115 GLU B CG    1 
ATOM   4204  C CD    . GLU B 1 118 ? 47.093  -25.444 85.919  1.00 43.34 ? 115 GLU B CD    1 
ATOM   4205  O OE1   . GLU B 1 118 ? 46.606  -26.484 85.423  1.00 44.09 ? 115 GLU B OE1   1 
ATOM   4206  O OE2   . GLU B 1 118 ? 47.817  -25.445 86.937  1.00 45.95 ? 115 GLU B OE2   1 
ATOM   4207  N N     . GLN B 1 119 ? 46.633  -22.521 80.839  1.00 37.08 ? 116 GLN B N     1 
ATOM   4208  C CA    . GLN B 1 119 ? 47.016  -22.507 79.433  1.00 38.01 ? 116 GLN B CA    1 
ATOM   4209  C C     . GLN B 1 119 ? 47.522  -21.124 79.031  1.00 36.98 ? 116 GLN B C     1 
ATOM   4210  O O     . GLN B 1 119 ? 48.007  -20.929 77.922  1.00 37.42 ? 116 GLN B O     1 
ATOM   4211  C CB    . GLN B 1 119 ? 45.827  -22.905 78.547  1.00 38.19 ? 116 GLN B CB    1 
ATOM   4212  C CG    . GLN B 1 119 ? 45.254  -24.270 78.866  1.00 38.48 ? 116 GLN B CG    1 
ATOM   4213  C CD    . GLN B 1 119 ? 46.270  -25.389 78.697  1.00 39.54 ? 116 GLN B CD    1 
ATOM   4214  O OE1   . GLN B 1 119 ? 46.847  -25.565 77.617  1.00 38.94 ? 116 GLN B OE1   1 
ATOM   4215  N NE2   . GLN B 1 119 ? 46.494  -26.155 79.766  1.00 37.12 ? 116 GLN B NE2   1 
ATOM   4216  N N     . THR B 1 120 ? 47.425  -20.166 79.942  1.00 36.86 ? 117 THR B N     1 
ATOM   4217  C CA    . THR B 1 120 ? 47.871  -18.816 79.648  1.00 36.78 ? 117 THR B CA    1 
ATOM   4218  C C     . THR B 1 120 ? 49.171  -18.455 80.373  1.00 36.39 ? 117 THR B C     1 
ATOM   4219  O O     . THR B 1 120 ? 49.696  -17.353 80.211  1.00 37.60 ? 117 THR B O     1 
ATOM   4220  C CB    . THR B 1 120 ? 46.767  -17.798 80.021  1.00 38.05 ? 117 THR B CB    1 
ATOM   4221  O OG1   . THR B 1 120 ? 46.604  -17.766 81.443  1.00 35.98 ? 117 THR B OG1   1 
ATOM   4222  C CG2   . THR B 1 120 ? 45.429  -18.214 79.387  1.00 37.71 ? 117 THR B CG2   1 
ATOM   4223  N N     . LEU B 1 121 ? 49.704  -19.383 81.160  1.00 34.51 ? 118 LEU B N     1 
ATOM   4224  C CA    . LEU B 1 121 ? 50.930  -19.112 81.900  1.00 34.26 ? 118 LEU B CA    1 
ATOM   4225  C C     . LEU B 1 121 ? 52.175  -19.007 81.014  1.00 35.09 ? 118 LEU B C     1 
ATOM   4226  O O     . LEU B 1 121 ? 52.985  -18.087 81.172  1.00 33.48 ? 118 LEU B O     1 
ATOM   4227  C CB    . LEU B 1 121 ? 51.128  -20.175 82.984  1.00 32.79 ? 118 LEU B CB    1 
ATOM   4228  C CG    . LEU B 1 121 ? 50.017  -20.159 84.044  1.00 32.87 ? 118 LEU B CG    1 
ATOM   4229  C CD1   . LEU B 1 121 ? 50.148  -21.332 85.011  1.00 30.74 ? 118 LEU B CD1   1 
ATOM   4230  C CD2   . LEU B 1 121 ? 50.077  -18.841 84.785  1.00 31.63 ? 118 LEU B CD2   1 
ATOM   4231  N N     . TYR B 1 122 ? 52.314  -19.928 80.068  1.00 35.71 ? 119 TYR B N     1 
ATOM   4232  C CA    . TYR B 1 122 ? 53.468  -19.927 79.181  1.00 36.70 ? 119 TYR B CA    1 
ATOM   4233  C C     . TYR B 1 122 ? 53.114  -19.547 77.749  1.00 38.00 ? 119 TYR B C     1 
ATOM   4234  O O     . TYR B 1 122 ? 52.183  -20.101 77.159  1.00 38.09 ? 119 TYR B O     1 
ATOM   4235  C CB    . TYR B 1 122 ? 54.141  -21.304 79.195  1.00 35.71 ? 119 TYR B CB    1 
ATOM   4236  C CG    . TYR B 1 122 ? 54.676  -21.695 80.549  1.00 35.51 ? 119 TYR B CG    1 
ATOM   4237  C CD1   . TYR B 1 122 ? 53.872  -22.349 81.481  1.00 36.28 ? 119 TYR B CD1   1 
ATOM   4238  C CD2   . TYR B 1 122 ? 55.987  -21.389 80.911  1.00 36.15 ? 119 TYR B CD2   1 
ATOM   4239  C CE1   . TYR B 1 122 ? 54.363  -22.692 82.744  1.00 36.49 ? 119 TYR B CE1   1 
ATOM   4240  C CE2   . TYR B 1 122 ? 56.491  -21.726 82.171  1.00 35.77 ? 119 TYR B CE2   1 
ATOM   4241  C CZ    . TYR B 1 122 ? 55.673  -22.378 83.079  1.00 36.37 ? 119 TYR B CZ    1 
ATOM   4242  O OH    . TYR B 1 122 ? 56.158  -22.724 84.321  1.00 38.15 ? 119 TYR B OH    1 
ATOM   4243  N N     . PHE B 1 123 ? 53.866  -18.599 77.196  1.00 39.40 ? 120 PHE B N     1 
ATOM   4244  C CA    . PHE B 1 123 ? 53.642  -18.132 75.830  1.00 40.57 ? 120 PHE B CA    1 
ATOM   4245  C C     . PHE B 1 123 ? 54.499  -18.840 74.795  1.00 42.74 ? 120 PHE B C     1 
ATOM   4246  O O     . PHE B 1 123 ? 55.415  -19.604 75.123  1.00 43.77 ? 120 PHE B O     1 
ATOM   4247  C CB    . PHE B 1 123 ? 53.898  -16.624 75.723  1.00 39.55 ? 120 PHE B CB    1 
ATOM   4248  C CG    . PHE B 1 123 ? 52.819  -15.780 76.325  1.00 38.41 ? 120 PHE B CG    1 
ATOM   4249  C CD1   . PHE B 1 123 ? 52.468  -15.929 77.662  1.00 37.41 ? 120 PHE B CD1   1 
ATOM   4250  C CD2   . PHE B 1 123 ? 52.163  -14.822 75.559  1.00 37.19 ? 120 PHE B CD2   1 
ATOM   4251  C CE1   . PHE B 1 123 ? 51.477  -15.135 78.232  1.00 38.05 ? 120 PHE B CE1   1 
ATOM   4252  C CE2   . PHE B 1 123 ? 51.167  -14.019 76.120  1.00 38.22 ? 120 PHE B CE2   1 
ATOM   4253  C CZ    . PHE B 1 123 ? 50.825  -14.177 77.460  1.00 37.03 ? 120 PHE B CZ    1 
ATOM   4254  N N     . LYS B 1 124 ? 54.203  -18.561 73.533  1.00 44.45 ? 121 LYS B N     1 
ATOM   4255  C CA    . LYS B 1 124 ? 54.924  -19.171 72.430  1.00 46.39 ? 121 LYS B CA    1 
ATOM   4256  C C     . LYS B 1 124 ? 56.392  -18.770 72.468  1.00 46.80 ? 121 LYS B C     1 
ATOM   4257  O O     . LYS B 1 124 ? 57.207  -19.311 71.719  1.00 49.06 ? 121 LYS B O     1 
ATOM   4258  C CB    . LYS B 1 124 ? 54.296  -18.736 71.100  1.00 48.83 ? 121 LYS B CB    1 
ATOM   4259  C CG    . LYS B 1 124 ? 54.587  -19.656 69.908  1.00 52.01 ? 121 LYS B CG    1 
ATOM   4260  C CD    . LYS B 1 124 ? 54.010  -21.070 70.112  1.00 53.82 ? 121 LYS B CD    1 
ATOM   4261  C CE    . LYS B 1 124 ? 53.554  -21.729 68.795  1.00 54.09 ? 121 LYS B CE    1 
ATOM   4262  N NZ    . LYS B 1 124 ? 54.583  -21.834 67.708  1.00 54.28 ? 121 LYS B NZ    1 
ATOM   4263  N N     . ASP B 1 125 ? 56.732  -17.827 73.344  1.00 45.64 ? 122 ASP B N     1 
ATOM   4264  C CA    . ASP B 1 125 ? 58.106  -17.357 73.459  1.00 43.18 ? 122 ASP B CA    1 
ATOM   4265  C C     . ASP B 1 125 ? 58.455  -16.914 74.876  1.00 41.58 ? 122 ASP B C     1 
ATOM   4266  O O     . ASP B 1 125 ? 58.979  -15.820 75.080  1.00 41.11 ? 122 ASP B O     1 
ATOM   4267  C CB    . ASP B 1 125 ? 58.333  -16.207 72.481  1.00 43.75 ? 122 ASP B CB    1 
ATOM   4268  C CG    . ASP B 1 125 ? 57.402  -15.041 72.735  1.00 46.57 ? 122 ASP B CG    1 
ATOM   4269  O OD1   . ASP B 1 125 ? 56.247  -15.285 73.139  1.00 48.01 ? 122 ASP B OD1   1 
ATOM   4270  O OD2   . ASP B 1 125 ? 57.819  -13.882 72.527  1.00 47.71 ? 122 ASP B OD2   1 
ATOM   4271  N N     . GLY B 1 126 ? 58.161  -17.769 75.852  1.00 40.50 ? 123 GLY B N     1 
ATOM   4272  C CA    . GLY B 1 126 ? 58.475  -17.447 77.233  1.00 39.08 ? 123 GLY B CA    1 
ATOM   4273  C C     . GLY B 1 126 ? 57.292  -17.336 78.172  1.00 38.15 ? 123 GLY B C     1 
ATOM   4274  O O     . GLY B 1 126 ? 56.145  -17.281 77.731  1.00 37.34 ? 123 GLY B O     1 
ATOM   4275  N N     . PRO B 1 127 ? 57.544  -17.321 79.490  1.00 38.42 ? 124 PRO B N     1 
ATOM   4276  C CA    . PRO B 1 127 ? 56.476  -17.210 80.491  1.00 38.06 ? 124 PRO B CA    1 
ATOM   4277  C C     . PRO B 1 127 ? 55.851  -15.817 80.459  1.00 37.65 ? 124 PRO B C     1 
ATOM   4278  O O     . PRO B 1 127 ? 56.428  -14.886 79.902  1.00 37.73 ? 124 PRO B O     1 
ATOM   4279  C CB    . PRO B 1 127 ? 57.199  -17.478 81.808  1.00 38.06 ? 124 PRO B CB    1 
ATOM   4280  C CG    . PRO B 1 127 ? 58.344  -18.352 81.395  1.00 39.88 ? 124 PRO B CG    1 
ATOM   4281  C CD    . PRO B 1 127 ? 58.820  -17.666 80.134  1.00 38.26 ? 124 PRO B CD    1 
ATOM   4282  N N     . LEU B 1 128 ? 54.682  -15.678 81.073  1.00 38.19 ? 125 LEU B N     1 
ATOM   4283  C CA    . LEU B 1 128 ? 53.979  -14.399 81.109  1.00 38.21 ? 125 LEU B CA    1 
ATOM   4284  C C     . LEU B 1 128 ? 54.806  -13.257 81.709  1.00 38.81 ? 125 LEU B C     1 
ATOM   4285  O O     . LEU B 1 128 ? 55.605  -13.461 82.628  1.00 38.23 ? 125 LEU B O     1 
ATOM   4286  C CB    . LEU B 1 128 ? 52.679  -14.530 81.909  1.00 36.91 ? 125 LEU B CB    1 
ATOM   4287  C CG    . LEU B 1 128 ? 52.824  -14.611 83.431  1.00 33.84 ? 125 LEU B CG    1 
ATOM   4288  C CD1   . LEU B 1 128 ? 51.459  -14.442 84.068  1.00 32.54 ? 125 LEU B CD1   1 
ATOM   4289  C CD2   . LEU B 1 128 ? 53.460  -15.935 83.835  1.00 32.90 ? 125 LEU B CD2   1 
ATOM   4290  N N     . ASN B 1 129 ? 54.570  -12.054 81.187  1.00 40.18 ? 126 ASN B N     1 
ATOM   4291  C CA    . ASN B 1 129 ? 55.240  -10.829 81.621  1.00 40.89 ? 126 ASN B CA    1 
ATOM   4292  C C     . ASN B 1 129 ? 54.389  -10.059 82.618  1.00 40.68 ? 126 ASN B C     1 
ATOM   4293  O O     . ASN B 1 129 ? 54.864  -9.607  83.657  1.00 39.86 ? 126 ASN B O     1 
ATOM   4294  C CB    . ASN B 1 129 ? 55.481  -9.900  80.430  1.00 41.56 ? 126 ASN B CB    1 
ATOM   4295  C CG    . ASN B 1 129 ? 56.803  -10.136 79.776  1.00 44.12 ? 126 ASN B CG    1 
ATOM   4296  O OD1   . ASN B 1 129 ? 57.771  -10.486 80.450  1.00 47.53 ? 126 ASN B OD1   1 
ATOM   4297  N ND2   . ASN B 1 129 ? 56.870  -9.930  78.461  1.00 43.08 ? 126 ASN B ND2   1 
ATOM   4298  N N     . MET B 1 130 ? 53.121  -9.909  82.267  1.00 41.00 ? 127 MET B N     1 
ATOM   4299  C CA    . MET B 1 130 ? 52.176  -9.163  83.070  1.00 40.61 ? 127 MET B CA    1 
ATOM   4300  C C     . MET B 1 130 ? 50.987  -10.007 83.493  1.00 40.88 ? 127 MET B C     1 
ATOM   4301  O O     . MET B 1 130 ? 50.750  -11.094 82.961  1.00 41.26 ? 127 MET B O     1 
ATOM   4302  C CB    . MET B 1 130 ? 51.682  -7.955  82.270  1.00 40.32 ? 127 MET B CB    1 
ATOM   4303  C CG    . MET B 1 130 ? 52.775  -6.952  81.924  1.00 41.48 ? 127 MET B CG    1 
ATOM   4304  S SD    . MET B 1 130 ? 53.369  -6.096  83.399  1.00 41.71 ? 127 MET B SD    1 
ATOM   4305  C CE    . MET B 1 130 ? 52.049  -4.906  83.645  1.00 38.04 ? 127 MET B CE    1 
ATOM   4306  N N     . ILE B 1 131 ? 50.241  -9.481  84.457  1.00 40.10 ? 128 ILE B N     1 
ATOM   4307  C CA    . ILE B 1 131 ? 49.053  -10.137 84.975  1.00 39.42 ? 128 ILE B CA    1 
ATOM   4308  C C     . ILE B 1 131 ? 47.891  -9.147  85.052  1.00 40.14 ? 128 ILE B C     1 
ATOM   4309  O O     . ILE B 1 131 ? 47.915  -8.204  85.856  1.00 40.69 ? 128 ILE B O     1 
ATOM   4310  C CB    . ILE B 1 131 ? 49.303  -10.714 86.384  1.00 37.64 ? 128 ILE B CB    1 
ATOM   4311  C CG1   . ILE B 1 131 ? 50.153  -11.978 86.285  1.00 35.93 ? 128 ILE B CG1   1 
ATOM   4312  C CG2   . ILE B 1 131 ? 47.977  -10.991 87.080  1.00 37.74 ? 128 ILE B CG2   1 
ATOM   4313  C CD1   . ILE B 1 131 ? 50.483  -12.594 87.625  1.00 35.32 ? 128 ILE B CD1   1 
ATOM   4314  N N     . LEU B 1 132 ? 46.898  -9.358  84.188  1.00 38.67 ? 129 LEU B N     1 
ATOM   4315  C CA    . LEU B 1 132 ? 45.689  -8.536  84.149  1.00 36.60 ? 129 LEU B CA    1 
ATOM   4316  C C     . LEU B 1 132 ? 44.672  -9.500  84.741  1.00 37.06 ? 129 LEU B C     1 
ATOM   4317  O O     . LEU B 1 132 ? 44.139  -10.370 84.051  1.00 37.03 ? 129 LEU B O     1 
ATOM   4318  C CB    . LEU B 1 132 ? 45.334  -8.165  82.705  1.00 35.61 ? 129 LEU B CB    1 
ATOM   4319  C CG    . LEU B 1 132 ? 44.286  -7.060  82.515  1.00 35.18 ? 129 LEU B CG    1 
ATOM   4320  C CD1   . LEU B 1 132 ? 44.369  -6.483  81.110  1.00 32.89 ? 129 LEU B CD1   1 
ATOM   4321  C CD2   . LEU B 1 132 ? 42.903  -7.625  82.811  1.00 33.59 ? 129 LEU B CD2   1 
ATOM   4322  N N     . ASP B 1 133 ? 44.436  -9.349  86.039  1.00 37.13 ? 130 ASP B N     1 
ATOM   4323  C CA    . ASP B 1 133 ? 43.548  -10.235 86.778  1.00 35.39 ? 130 ASP B CA    1 
ATOM   4324  C C     . ASP B 1 133 ? 42.293  -9.547  87.315  1.00 33.86 ? 130 ASP B C     1 
ATOM   4325  O O     . ASP B 1 133 ? 42.257  -8.314  87.476  1.00 28.40 ? 130 ASP B O     1 
ATOM   4326  C CB    . ASP B 1 133 ? 44.340  -10.866 87.939  1.00 36.37 ? 130 ASP B CB    1 
ATOM   4327  C CG    . ASP B 1 133 ? 43.705  -12.131 88.469  1.00 37.65 ? 130 ASP B CG    1 
ATOM   4328  O OD1   . ASP B 1 133 ? 42.777  -12.652 87.816  1.00 39.89 ? 130 ASP B OD1   1 
ATOM   4329  O OD2   . ASP B 1 133 ? 44.146  -12.616 89.535  1.00 38.47 ? 130 ASP B OD2   1 
ATOM   4330  N N     . ASP B 1 134 ? 41.277  -10.370 87.590  1.00 32.86 ? 131 ASP B N     1 
ATOM   4331  C CA    . ASP B 1 134 ? 39.993  -9.919  88.122  1.00 32.57 ? 131 ASP B CA    1 
ATOM   4332  C C     . ASP B 1 134 ? 39.535  -10.870 89.224  1.00 32.34 ? 131 ASP B C     1 
ATOM   4333  O O     . ASP B 1 134 ? 38.816  -11.831 88.952  1.00 31.76 ? 131 ASP B O     1 
ATOM   4334  C CB    . ASP B 1 134 ? 38.943  -9.900  87.008  1.00 34.60 ? 131 ASP B CB    1 
ATOM   4335  C CG    . ASP B 1 134 ? 37.589  -9.367  87.473  1.00 36.54 ? 131 ASP B CG    1 
ATOM   4336  O OD1   . ASP B 1 134 ? 37.196  -9.609  88.635  1.00 35.72 ? 131 ASP B OD1   1 
ATOM   4337  O OD2   . ASP B 1 134 ? 36.904  -8.714  86.660  1.00 37.67 ? 131 ASP B OD2   1 
ATOM   4338  N N     . GLY B 1 135 ? 39.956  -10.619 90.461  1.00 31.07 ? 132 GLY B N     1 
ATOM   4339  C CA    . GLY B 1 135 ? 39.527  -11.480 91.551  1.00 31.52 ? 132 GLY B CA    1 
ATOM   4340  C C     . GLY B 1 135 ? 40.650  -12.155 92.311  1.00 31.78 ? 132 GLY B C     1 
ATOM   4341  O O     . GLY B 1 135 ? 40.424  -12.759 93.357  1.00 30.33 ? 132 GLY B O     1 
ATOM   4342  N N     . GLY B 1 136 ? 41.858  -12.061 91.768  1.00 32.90 ? 133 GLY B N     1 
ATOM   4343  C CA    . GLY B 1 136 ? 43.016  -12.651 92.407  1.00 33.78 ? 133 GLY B CA    1 
ATOM   4344  C C     . GLY B 1 136 ? 43.329  -14.103 92.090  1.00 35.68 ? 133 GLY B C     1 
ATOM   4345  O O     . GLY B 1 136 ? 44.370  -14.599 92.520  1.00 36.51 ? 133 GLY B O     1 
ATOM   4346  N N     . ASP B 1 137 ? 42.464  -14.799 91.351  1.00 35.85 ? 134 ASP B N     1 
ATOM   4347  C CA    . ASP B 1 137 ? 42.723  -16.209 91.043  1.00 35.14 ? 134 ASP B CA    1 
ATOM   4348  C C     . ASP B 1 137 ? 44.084  -16.427 90.353  1.00 34.34 ? 134 ASP B C     1 
ATOM   4349  O O     . ASP B 1 137 ? 44.859  -17.301 90.762  1.00 33.05 ? 134 ASP B O     1 
ATOM   4350  C CB    . ASP B 1 137 ? 41.589  -16.810 90.183  1.00 36.82 ? 134 ASP B CB    1 
ATOM   4351  C CG    . ASP B 1 137 ? 40.314  -17.110 90.985  1.00 36.24 ? 134 ASP B CG    1 
ATOM   4352  O OD1   . ASP B 1 137 ? 40.393  -17.784 92.031  1.00 32.64 ? 134 ASP B OD1   1 
ATOM   4353  O OD2   . ASP B 1 137 ? 39.219  -16.683 90.551  1.00 38.94 ? 134 ASP B OD2   1 
ATOM   4354  N N     . LEU B 1 138 ? 44.375  -15.621 89.331  1.00 32.81 ? 135 LEU B N     1 
ATOM   4355  C CA    . LEU B 1 138 ? 45.629  -15.719 88.582  1.00 33.37 ? 135 LEU B CA    1 
ATOM   4356  C C     . LEU B 1 138 ? 46.848  -15.326 89.423  1.00 34.45 ? 135 LEU B C     1 
ATOM   4357  O O     . LEU B 1 138 ? 47.853  -16.045 89.453  1.00 33.42 ? 135 LEU B O     1 
ATOM   4358  C CB    . LEU B 1 138 ? 45.584  -14.809 87.343  1.00 31.73 ? 135 LEU B CB    1 
ATOM   4359  C CG    . LEU B 1 138 ? 46.394  -15.223 86.108  1.00 29.78 ? 135 LEU B CG    1 
ATOM   4360  C CD1   . LEU B 1 138 ? 46.423  -14.081 85.116  1.00 29.37 ? 135 LEU B CD1   1 
ATOM   4361  C CD2   . LEU B 1 138 ? 47.801  -15.612 86.497  1.00 27.46 ? 135 LEU B CD2   1 
ATOM   4362  N N     . THR B 1 139 ? 46.768  -14.177 90.091  1.00 35.17 ? 136 THR B N     1 
ATOM   4363  C CA    . THR B 1 139 ? 47.893  -13.751 90.902  1.00 36.45 ? 136 THR B CA    1 
ATOM   4364  C C     . THR B 1 139 ? 48.096  -14.735 92.048  1.00 37.25 ? 136 THR B C     1 
ATOM   4365  O O     . THR B 1 139 ? 49.223  -14.965 92.468  1.00 37.67 ? 136 THR B O     1 
ATOM   4366  C CB    . THR B 1 139 ? 47.725  -12.298 91.454  1.00 36.03 ? 136 THR B CB    1 
ATOM   4367  O OG1   . THR B 1 139 ? 47.074  -12.323 92.726  1.00 36.98 ? 136 THR B OG1   1 
ATOM   4368  C CG2   . THR B 1 139 ? 46.911  -11.454 90.483  1.00 35.69 ? 136 THR B CG2   1 
ATOM   4369  N N     . ASN B 1 140 ? 47.020  -15.337 92.544  1.00 37.94 ? 137 ASN B N     1 
ATOM   4370  C CA    . ASN B 1 140 ? 47.162  -16.302 93.627  1.00 39.84 ? 137 ASN B CA    1 
ATOM   4371  C C     . ASN B 1 140 ? 47.700  -17.642 93.122  1.00 41.01 ? 137 ASN B C     1 
ATOM   4372  O O     . ASN B 1 140 ? 48.509  -18.286 93.793  1.00 42.13 ? 137 ASN B O     1 
ATOM   4373  C CB    . ASN B 1 140 ? 45.826  -16.535 94.335  1.00 42.07 ? 137 ASN B CB    1 
ATOM   4374  C CG    . ASN B 1 140 ? 45.422  -15.377 95.237  1.00 45.26 ? 137 ASN B CG    1 
ATOM   4375  O OD1   . ASN B 1 140 ? 46.128  -14.366 95.344  1.00 45.33 ? 137 ASN B OD1   1 
ATOM   4376  N ND2   . ASN B 1 140 ? 44.271  -15.522 95.894  1.00 45.01 ? 137 ASN B ND2   1 
ATOM   4377  N N     . LEU B 1 141 ? 47.249  -18.064 91.944  1.00 40.50 ? 138 LEU B N     1 
ATOM   4378  C CA    . LEU B 1 141 ? 47.697  -19.330 91.383  1.00 39.41 ? 138 LEU B CA    1 
ATOM   4379  C C     . LEU B 1 141 ? 49.214  -19.345 91.211  1.00 40.23 ? 138 LEU B C     1 
ATOM   4380  O O     . LEU B 1 141 ? 49.878  -20.326 91.545  1.00 41.10 ? 138 LEU B O     1 
ATOM   4381  C CB    . LEU B 1 141 ? 47.028  -19.590 90.035  1.00 37.98 ? 138 LEU B CB    1 
ATOM   4382  C CG    . LEU B 1 141 ? 47.425  -20.909 89.363  1.00 38.31 ? 138 LEU B CG    1 
ATOM   4383  C CD1   . LEU B 1 141 ? 47.043  -22.076 90.263  1.00 35.65 ? 138 LEU B CD1   1 
ATOM   4384  C CD2   . LEU B 1 141 ? 46.747  -21.027 88.003  1.00 38.37 ? 138 LEU B CD2   1 
ATOM   4385  N N     . ILE B 1 142 ? 49.759  -18.251 90.693  1.00 40.32 ? 139 ILE B N     1 
ATOM   4386  C CA    . ILE B 1 142 ? 51.190  -18.145 90.481  1.00 40.17 ? 139 ILE B CA    1 
ATOM   4387  C C     . ILE B 1 142 ? 51.962  -18.043 91.798  1.00 40.88 ? 139 ILE B C     1 
ATOM   4388  O O     . ILE B 1 142 ? 52.903  -18.798 92.021  1.00 42.67 ? 139 ILE B O     1 
ATOM   4389  C CB    . ILE B 1 142 ? 51.518  -16.944 89.583  1.00 40.95 ? 139 ILE B CB    1 
ATOM   4390  C CG1   . ILE B 1 142 ? 50.938  -17.191 88.188  1.00 39.13 ? 139 ILE B CG1   1 
ATOM   4391  C CG2   . ILE B 1 142 ? 53.028  -16.737 89.500  1.00 41.25 ? 139 ILE B CG2   1 
ATOM   4392  C CD1   . ILE B 1 142 ? 51.234  -16.092 87.209  1.00 41.20 ? 139 ILE B CD1   1 
ATOM   4393  N N     . HIS B 1 143 ? 51.570  -17.131 92.682  1.00 40.31 ? 140 HIS B N     1 
ATOM   4394  C CA    . HIS B 1 143 ? 52.264  -16.998 93.961  1.00 39.66 ? 140 HIS B CA    1 
ATOM   4395  C C     . HIS B 1 143 ? 52.324  -18.303 94.750  1.00 41.00 ? 140 HIS B C     1 
ATOM   4396  O O     . HIS B 1 143 ? 53.155  -18.441 95.635  1.00 41.18 ? 140 HIS B O     1 
ATOM   4397  C CB    . HIS B 1 143 ? 51.606  -15.941 94.854  1.00 38.62 ? 140 HIS B CB    1 
ATOM   4398  C CG    . HIS B 1 143 ? 52.110  -14.548 94.634  1.00 39.01 ? 140 HIS B CG    1 
ATOM   4399  N ND1   . HIS B 1 143 ? 51.847  -13.828 93.489  1.00 38.73 ? 140 HIS B ND1   1 
ATOM   4400  C CD2   . HIS B 1 143 ? 52.846  -13.733 95.428  1.00 39.62 ? 140 HIS B CD2   1 
ATOM   4401  C CE1   . HIS B 1 143 ? 52.397  -12.631 93.588  1.00 38.81 ? 140 HIS B CE1   1 
ATOM   4402  N NE2   . HIS B 1 143 ? 53.010  -12.547 94.756  1.00 38.38 ? 140 HIS B NE2   1 
ATOM   4403  N N     . THR B 1 144 ? 51.458  -19.260 94.436  1.00 42.58 ? 141 THR B N     1 
ATOM   4404  C CA    . THR B 1 144 ? 51.444  -20.516 95.180  1.00 45.18 ? 141 THR B CA    1 
ATOM   4405  C C     . THR B 1 144 ? 51.927  -21.764 94.437  1.00 46.46 ? 141 THR B C     1 
ATOM   4406  O O     . THR B 1 144 ? 52.446  -22.694 95.061  1.00 46.57 ? 141 THR B O     1 
ATOM   4407  C CB    . THR B 1 144 ? 50.047  -20.827 95.693  1.00 45.09 ? 141 THR B CB    1 
ATOM   4408  O OG1   . THR B 1 144 ? 49.159  -20.923 94.575  1.00 47.16 ? 141 THR B OG1   1 
ATOM   4409  C CG2   . THR B 1 144 ? 49.570  -19.740 96.635  1.00 45.45 ? 141 THR B CG2   1 
ATOM   4410  N N     . LYS B 1 145 ? 51.750  -21.798 93.119  1.00 46.79 ? 142 LYS B N     1 
ATOM   4411  C CA    . LYS B 1 145 ? 52.172  -22.960 92.344  1.00 47.97 ? 142 LYS B CA    1 
ATOM   4412  C C     . LYS B 1 145 ? 53.330  -22.675 91.390  1.00 47.24 ? 142 LYS B C     1 
ATOM   4413  O O     . LYS B 1 145 ? 54.097  -23.579 91.059  1.00 47.36 ? 142 LYS B O     1 
ATOM   4414  C CB    . LYS B 1 145 ? 50.988  -23.526 91.544  1.00 49.33 ? 142 LYS B CB    1 
ATOM   4415  C CG    . LYS B 1 145 ? 49.742  -23.738 92.376  1.00 51.21 ? 142 LYS B CG    1 
ATOM   4416  C CD    . LYS B 1 145 ? 50.002  -24.710 93.506  1.00 52.80 ? 142 LYS B CD    1 
ATOM   4417  C CE    . LYS B 1 145 ? 48.791  -24.831 94.411  1.00 52.30 ? 142 LYS B CE    1 
ATOM   4418  N NZ    . LYS B 1 145 ? 48.987  -25.938 95.381  1.00 52.93 ? 142 LYS B NZ    1 
ATOM   4419  N N     . TYR B 1 146 ? 53.456  -21.429 90.941  1.00 46.10 ? 143 TYR B N     1 
ATOM   4420  C CA    . TYR B 1 146 ? 54.532  -21.071 90.020  1.00 45.11 ? 143 TYR B CA    1 
ATOM   4421  C C     . TYR B 1 146 ? 55.373  -19.883 90.518  1.00 43.61 ? 143 TYR B C     1 
ATOM   4422  O O     . TYR B 1 146 ? 55.552  -18.895 89.804  1.00 43.39 ? 143 TYR B O     1 
ATOM   4423  C CB    . TYR B 1 146 ? 53.955  -20.762 88.628  1.00 45.24 ? 143 TYR B CB    1 
ATOM   4424  C CG    . TYR B 1 146 ? 52.995  -21.813 88.089  1.00 45.34 ? 143 TYR B CG    1 
ATOM   4425  C CD1   . TYR B 1 146 ? 51.660  -21.841 88.494  1.00 45.70 ? 143 TYR B CD1   1 
ATOM   4426  C CD2   . TYR B 1 146 ? 53.422  -22.785 87.184  1.00 44.65 ? 143 TYR B CD2   1 
ATOM   4427  C CE1   . TYR B 1 146 ? 50.776  -22.809 88.012  1.00 44.57 ? 143 TYR B CE1   1 
ATOM   4428  C CE2   . TYR B 1 146 ? 52.544  -23.759 86.697  1.00 43.47 ? 143 TYR B CE2   1 
ATOM   4429  C CZ    . TYR B 1 146 ? 51.222  -23.763 87.115  1.00 43.67 ? 143 TYR B CZ    1 
ATOM   4430  O OH    . TYR B 1 146 ? 50.343  -24.709 86.633  1.00 41.25 ? 143 TYR B OH    1 
ATOM   4431  N N     . PRO B 1 147 ? 55.914  -19.973 91.748  1.00 42.78 ? 144 PRO B N     1 
ATOM   4432  C CA    . PRO B 1 147 ? 56.725  -18.871 92.282  1.00 42.86 ? 144 PRO B CA    1 
ATOM   4433  C C     . PRO B 1 147 ? 57.961  -18.544 91.449  1.00 42.95 ? 144 PRO B C     1 
ATOM   4434  O O     . PRO B 1 147 ? 58.457  -17.412 91.471  1.00 43.46 ? 144 PRO B O     1 
ATOM   4435  C CB    . PRO B 1 147 ? 57.064  -19.339 93.693  1.00 41.58 ? 144 PRO B CB    1 
ATOM   4436  C CG    . PRO B 1 147 ? 57.075  -20.820 93.562  1.00 42.56 ? 144 PRO B CG    1 
ATOM   4437  C CD    . PRO B 1 147 ? 55.863  -21.089 92.705  1.00 42.05 ? 144 PRO B CD    1 
ATOM   4438  N N     . GLN B 1 148 ? 58.440  -19.532 90.698  1.00 42.75 ? 145 GLN B N     1 
ATOM   4439  C CA    . GLN B 1 148 ? 59.610  -19.355 89.839  1.00 41.94 ? 145 GLN B CA    1 
ATOM   4440  C C     . GLN B 1 148 ? 59.326  -18.387 88.702  1.00 41.87 ? 145 GLN B C     1 
ATOM   4441  O O     . GLN B 1 148 ? 60.248  -17.932 88.021  1.00 43.60 ? 145 GLN B O     1 
ATOM   4442  C CB    . GLN B 1 148 ? 60.037  -20.691 89.239  1.00 43.00 ? 145 GLN B CB    1 
ATOM   4443  C CG    . GLN B 1 148 ? 59.342  -21.880 89.862  1.00 47.01 ? 145 GLN B CG    1 
ATOM   4444  C CD    . GLN B 1 148 ? 57.902  -22.018 89.423  1.00 46.68 ? 145 GLN B CD    1 
ATOM   4445  O OE1   . GLN B 1 148 ? 57.078  -22.586 90.136  1.00 48.20 ? 145 GLN B OE1   1 
ATOM   4446  N NE2   . GLN B 1 148 ? 57.594  -21.514 88.232  1.00 48.69 ? 145 GLN B NE2   1 
ATOM   4447  N N     . LEU B 1 149 ? 58.054  -18.079 88.476  1.00 39.80 ? 146 LEU B N     1 
ATOM   4448  C CA    . LEU B 1 149 ? 57.708  -17.165 87.395  1.00 36.87 ? 146 LEU B CA    1 
ATOM   4449  C C     . LEU B 1 149 ? 57.578  -15.744 87.911  1.00 34.08 ? 146 LEU B C     1 
ATOM   4450  O O     . LEU B 1 149 ? 57.587  -14.789 87.137  1.00 32.23 ? 146 LEU B O     1 
ATOM   4451  C CB    . LEU B 1 149 ? 56.401  -17.593 86.728  1.00 38.32 ? 146 LEU B CB    1 
ATOM   4452  C CG    . LEU B 1 149 ? 56.334  -18.990 86.106  1.00 38.80 ? 146 LEU B CG    1 
ATOM   4453  C CD1   . LEU B 1 149 ? 54.939  -19.196 85.556  1.00 37.90 ? 146 LEU B CD1   1 
ATOM   4454  C CD2   . LEU B 1 149 ? 57.383  -19.150 84.998  1.00 39.10 ? 146 LEU B CD2   1 
ATOM   4455  N N     . LEU B 1 150 ? 57.464  -15.611 89.226  1.00 32.90 ? 147 LEU B N     1 
ATOM   4456  C CA    . LEU B 1 150 ? 57.325  -14.305 89.845  1.00 32.81 ? 147 LEU B CA    1 
ATOM   4457  C C     . LEU B 1 150 ? 58.381  -13.290 89.398  1.00 33.01 ? 147 LEU B C     1 
ATOM   4458  O O     . LEU B 1 150 ? 58.053  -12.253 88.816  1.00 32.23 ? 147 LEU B O     1 
ATOM   4459  C CB    . LEU B 1 150 ? 57.360  -14.450 91.369  1.00 32.18 ? 147 LEU B CB    1 
ATOM   4460  C CG    . LEU B 1 150 ? 56.056  -14.494 92.175  1.00 33.34 ? 147 LEU B CG    1 
ATOM   4461  C CD1   . LEU B 1 150 ? 54.827  -14.592 91.274  1.00 33.27 ? 147 LEU B CD1   1 
ATOM   4462  C CD2   . LEU B 1 150 ? 56.130  -15.672 93.120  1.00 32.27 ? 147 LEU B CD2   1 
ATOM   4463  N N     . PRO B 1 151 ? 59.668  -13.586 89.641  1.00 33.19 ? 148 PRO B N     1 
ATOM   4464  C CA    . PRO B 1 151 ? 60.744  -12.661 89.254  1.00 34.37 ? 148 PRO B CA    1 
ATOM   4465  C C     . PRO B 1 151 ? 60.686  -12.212 87.793  1.00 34.88 ? 148 PRO B C     1 
ATOM   4466  O O     . PRO B 1 151 ? 61.290  -11.214 87.418  1.00 35.93 ? 148 PRO B O     1 
ATOM   4467  C CB    . PRO B 1 151 ? 62.017  -13.460 89.563  1.00 32.92 ? 148 PRO B CB    1 
ATOM   4468  C CG    . PRO B 1 151 ? 61.587  -14.368 90.681  1.00 31.52 ? 148 PRO B CG    1 
ATOM   4469  C CD    . PRO B 1 151 ? 60.229  -14.831 90.201  1.00 33.40 ? 148 PRO B CD    1 
ATOM   4470  N N     . GLY B 1 152 ? 59.958  -12.953 86.970  1.00 36.83 ? 149 GLY B N     1 
ATOM   4471  C CA    . GLY B 1 152 ? 59.860  -12.603 85.568  1.00 38.00 ? 149 GLY B CA    1 
ATOM   4472  C C     . GLY B 1 152 ? 58.621  -11.799 85.239  1.00 40.26 ? 149 GLY B C     1 
ATOM   4473  O O     . GLY B 1 152 ? 58.423  -11.406 84.082  1.00 41.56 ? 149 GLY B O     1 
ATOM   4474  N N     . ILE B 1 153 ? 57.785  -11.539 86.241  1.00 39.24 ? 150 ILE B N     1 
ATOM   4475  C CA    . ILE B 1 153 ? 56.569  -10.767 86.003  1.00 38.43 ? 150 ILE B CA    1 
ATOM   4476  C C     . ILE B 1 153 ? 56.813  -9.310  86.386  1.00 38.54 ? 150 ILE B C     1 
ATOM   4477  O O     . ILE B 1 153 ? 57.126  -9.006  87.539  1.00 40.33 ? 150 ILE B O     1 
ATOM   4478  C CB    . ILE B 1 153 ? 55.387  -11.331 86.815  1.00 36.70 ? 150 ILE B CB    1 
ATOM   4479  C CG1   . ILE B 1 153 ? 55.197  -12.814 86.490  1.00 34.53 ? 150 ILE B CG1   1 
ATOM   4480  C CG2   . ILE B 1 153 ? 54.124  -10.550 86.489  1.00 33.49 ? 150 ILE B CG2   1 
ATOM   4481  C CD1   . ILE B 1 153 ? 54.342  -13.560 87.498  1.00 30.65 ? 150 ILE B CD1   1 
ATOM   4482  N N     . ARG B 1 154 ? 56.659  -8.414  85.417  1.00 37.59 ? 151 ARG B N     1 
ATOM   4483  C CA    . ARG B 1 154 ? 56.897  -6.990  85.642  1.00 37.48 ? 151 ARG B CA    1 
ATOM   4484  C C     . ARG B 1 154 ? 55.833  -6.302  86.498  1.00 37.84 ? 151 ARG B C     1 
ATOM   4485  O O     . ARG B 1 154 ? 56.158  -5.400  87.273  1.00 38.27 ? 151 ARG B O     1 
ATOM   4486  C CB    . ARG B 1 154 ? 57.043  -6.263  84.290  1.00 35.90 ? 151 ARG B CB    1 
ATOM   4487  C CG    . ARG B 1 154 ? 57.547  -4.822  84.391  1.00 37.07 ? 151 ARG B CG    1 
ATOM   4488  C CD    . ARG B 1 154 ? 58.259  -4.364  83.100  1.00 36.87 ? 151 ARG B CD    1 
ATOM   4489  N NE    . ARG B 1 154 ? 59.351  -5.273  82.719  1.00 35.32 ? 151 ARG B NE    1 
ATOM   4490  C CZ    . ARG B 1 154 ? 60.007  -5.236  81.558  1.00 33.59 ? 151 ARG B CZ    1 
ATOM   4491  N NH1   . ARG B 1 154 ? 59.702  -4.333  80.636  1.00 31.51 ? 151 ARG B NH1   1 
ATOM   4492  N NH2   . ARG B 1 154 ? 60.965  -6.123  81.314  1.00 32.99 ? 151 ARG B NH2   1 
ATOM   4493  N N     . GLY B 1 155 ? 54.572  -6.720  86.360  1.00 37.39 ? 152 GLY B N     1 
ATOM   4494  C CA    . GLY B 1 155 ? 53.506  -6.104  87.138  1.00 36.14 ? 152 GLY B CA    1 
ATOM   4495  C C     . GLY B 1 155 ? 52.160  -6.809  87.131  1.00 37.07 ? 152 GLY B C     1 
ATOM   4496  O O     . GLY B 1 155 ? 51.886  -7.670  86.293  1.00 37.56 ? 152 GLY B O     1 
ATOM   4497  N N     . ILE B 1 156 ? 51.316  -6.436  88.087  1.00 36.53 ? 153 ILE B N     1 
ATOM   4498  C CA    . ILE B 1 156 ? 49.969  -6.984  88.233  1.00 36.13 ? 153 ILE B CA    1 
ATOM   4499  C C     . ILE B 1 156 ? 48.992  -5.819  88.301  1.00 36.29 ? 153 ILE B C     1 
ATOM   4500  O O     . ILE B 1 156 ? 49.333  -4.743  88.787  1.00 36.09 ? 153 ILE B O     1 
ATOM   4501  C CB    . ILE B 1 156 ? 49.816  -7.788  89.545  1.00 36.13 ? 153 ILE B CB    1 
ATOM   4502  C CG1   . ILE B 1 156 ? 50.393  -9.182  89.387  1.00 37.11 ? 153 ILE B CG1   1 
ATOM   4503  C CG2   . ILE B 1 156 ? 48.350  -7.915  89.932  1.00 34.31 ? 153 ILE B CG2   1 
ATOM   4504  C CD1   . ILE B 1 156 ? 50.210  -10.011 90.635  1.00 39.01 ? 153 ILE B CD1   1 
ATOM   4505  N N     . SER B 1 157 ? 47.778  -6.034  87.812  1.00 35.97 ? 154 SER B N     1 
ATOM   4506  C CA    . SER B 1 157 ? 46.751  -4.998  87.861  1.00 35.39 ? 154 SER B CA    1 
ATOM   4507  C C     . SER B 1 157 ? 45.423  -5.696  88.135  1.00 34.09 ? 154 SER B C     1 
ATOM   4508  O O     . SER B 1 157 ? 44.887  -6.368  87.255  1.00 33.70 ? 154 SER B O     1 
ATOM   4509  C CB    . SER B 1 157 ? 46.709  -4.217  86.540  1.00 35.25 ? 154 SER B CB    1 
ATOM   4510  O OG    . SER B 1 157 ? 46.586  -5.074  85.419  1.00 36.50 ? 154 SER B OG    1 
ATOM   4511  N N     . GLU B 1 158 ? 44.929  -5.574  89.371  1.00 33.26 ? 155 GLU B N     1 
ATOM   4512  C CA    . GLU B 1 158 ? 43.667  -6.197  89.780  1.00 33.96 ? 155 GLU B CA    1 
ATOM   4513  C C     . GLU B 1 158 ? 42.545  -5.500  89.039  1.00 34.86 ? 155 GLU B C     1 
ATOM   4514  O O     . GLU B 1 158 ? 42.786  -4.605  88.232  1.00 38.90 ? 155 GLU B O     1 
ATOM   4515  C CB    . GLU B 1 158 ? 43.428  -6.032  91.285  1.00 33.97 ? 155 GLU B CB    1 
ATOM   4516  C CG    . GLU B 1 158 ? 43.092  -7.307  92.053  1.00 33.24 ? 155 GLU B CG    1 
ATOM   4517  C CD    . GLU B 1 158 ? 42.095  -8.208  91.351  1.00 33.76 ? 155 GLU B CD    1 
ATOM   4518  O OE1   . GLU B 1 158 ? 40.909  -7.833  91.220  1.00 32.72 ? 155 GLU B OE1   1 
ATOM   4519  O OE2   . GLU B 1 158 ? 42.510  -9.313  90.931  1.00 36.08 ? 155 GLU B OE2   1 
ATOM   4520  N N     . GLU B 1 159 ? 41.309  -5.870  89.338  1.00 33.90 ? 156 GLU B N     1 
ATOM   4521  C CA    . GLU B 1 159 ? 40.191  -5.251  88.654  1.00 29.58 ? 156 GLU B CA    1 
ATOM   4522  C C     . GLU B 1 159 ? 39.022  -5.003  89.588  1.00 27.95 ? 156 GLU B C     1 
ATOM   4523  O O     . GLU B 1 159 ? 38.420  -3.928  89.602  1.00 25.70 ? 156 GLU B O     1 
ATOM   4524  C CB    . GLU B 1 159 ? 39.777  -6.153  87.501  1.00 30.86 ? 156 GLU B CB    1 
ATOM   4525  C CG    . GLU B 1 159 ? 39.422  -5.392  86.256  1.00 29.56 ? 156 GLU B CG    1 
ATOM   4526  C CD    . GLU B 1 159 ? 38.028  -4.879  86.340  1.00 27.86 ? 156 GLU B CD    1 
ATOM   4527  O OE1   . GLU B 1 159 ? 37.686  -3.954  85.579  1.00 26.37 ? 156 GLU B OE1   1 
ATOM   4528  O OE2   . GLU B 1 159 ? 37.278  -5.423  87.179  1.00 24.70 ? 156 GLU B OE2   1 
ATOM   4529  N N     . THR B 1 160 ? 38.731  -5.993  90.412  1.00 27.14 ? 157 THR B N     1 
ATOM   4530  C CA    . THR B 1 160 ? 37.607  -5.869  91.315  1.00 27.56 ? 157 THR B CA    1 
ATOM   4531  C C     . THR B 1 160 ? 37.967  -5.687  92.791  1.00 28.56 ? 157 THR B C     1 
ATOM   4532  O O     . THR B 1 160 ? 39.108  -5.885  93.209  1.00 28.47 ? 157 THR B O     1 
ATOM   4533  C CB    . THR B 1 160 ? 36.675  -7.083  91.143  1.00 24.90 ? 157 THR B CB    1 
ATOM   4534  O OG1   . THR B 1 160 ? 35.372  -6.757  91.634  1.00 20.30 ? 157 THR B OG1   1 
ATOM   4535  C CG2   . THR B 1 160 ? 37.231  -8.285  91.886  1.00 23.16 ? 157 THR B CG2   1 
ATOM   4536  N N     . THR B 1 161 ? 36.965  -5.307  93.570  1.00 28.53 ? 158 THR B N     1 
ATOM   4537  C CA    . THR B 1 161 ? 37.120  -5.069  94.995  1.00 28.85 ? 158 THR B CA    1 
ATOM   4538  C C     . THR B 1 161 ? 37.713  -6.252  95.755  1.00 27.04 ? 158 THR B C     1 
ATOM   4539  O O     . THR B 1 161 ? 38.741  -6.113  96.410  1.00 28.31 ? 158 THR B O     1 
ATOM   4540  C CB    . THR B 1 161 ? 35.757  -4.707  95.614  1.00 28.81 ? 158 THR B CB    1 
ATOM   4541  O OG1   . THR B 1 161 ? 35.168  -3.649  94.848  1.00 31.34 ? 158 THR B OG1   1 
ATOM   4542  C CG2   . THR B 1 161 ? 35.922  -4.256  97.057  1.00 27.86 ? 158 THR B CG2   1 
ATOM   4543  N N     . THR B 1 162 ? 37.058  -7.408  95.689  1.00 25.35 ? 159 THR B N     1 
ATOM   4544  C CA    . THR B 1 162 ? 37.559  -8.587  96.396  1.00 23.66 ? 159 THR B CA    1 
ATOM   4545  C C     . THR B 1 162 ? 39.028  -8.827  96.076  1.00 23.99 ? 159 THR B C     1 
ATOM   4546  O O     . THR B 1 162 ? 39.827  -9.043  96.980  1.00 24.45 ? 159 THR B O     1 
ATOM   4547  C CB    . THR B 1 162 ? 36.727  -9.875  96.065  1.00 21.16 ? 159 THR B CB    1 
ATOM   4548  O OG1   . THR B 1 162 ? 35.472  -9.831  96.756  1.00 15.59 ? 159 THR B OG1   1 
ATOM   4549  C CG2   . THR B 1 162 ? 37.478  -11.138 96.478  1.00 17.17 ? 159 THR B CG2   1 
ATOM   4550  N N     . GLY B 1 163 ? 39.380  -8.758  94.796  1.00 24.40 ? 160 GLY B N     1 
ATOM   4551  C CA    . GLY B 1 163 ? 40.757  -8.983  94.392  1.00 29.73 ? 160 GLY B CA    1 
ATOM   4552  C C     . GLY B 1 163 ? 41.769  -7.981  94.932  1.00 33.15 ? 160 GLY B C     1 
ATOM   4553  O O     . GLY B 1 163 ? 42.861  -8.351  95.365  1.00 34.56 ? 160 GLY B O     1 
ATOM   4554  N N     . VAL B 1 164 ? 41.421  -6.705  94.883  1.00 34.35 ? 161 VAL B N     1 
ATOM   4555  C CA    . VAL B 1 164 ? 42.299  -5.668  95.376  1.00 36.55 ? 161 VAL B CA    1 
ATOM   4556  C C     . VAL B 1 164 ? 42.450  -5.862  96.883  1.00 37.44 ? 161 VAL B C     1 
ATOM   4557  O O     . VAL B 1 164 ? 43.509  -5.603  97.459  1.00 36.27 ? 161 VAL B O     1 
ATOM   4558  C CB    . VAL B 1 164 ? 41.706  -4.276  95.087  1.00 36.70 ? 161 VAL B CB    1 
ATOM   4559  C CG1   . VAL B 1 164 ? 42.534  -3.205  95.762  1.00 37.57 ? 161 VAL B CG1   1 
ATOM   4560  C CG2   . VAL B 1 164 ? 41.668  -4.044  93.585  1.00 37.36 ? 161 VAL B CG2   1 
ATOM   4561  N N     . HIS B 1 165 ? 41.383  -6.333  97.515  1.00 37.32 ? 162 HIS B N     1 
ATOM   4562  C CA    . HIS B 1 165 ? 41.416  -6.577  98.942  1.00 38.62 ? 162 HIS B CA    1 
ATOM   4563  C C     . HIS B 1 165 ? 42.508  -7.608  99.203  1.00 36.69 ? 162 HIS B C     1 
ATOM   4564  O O     . HIS B 1 165 ? 43.362  -7.408  100.062 1.00 35.77 ? 162 HIS B O     1 
ATOM   4565  C CB    . HIS B 1 165 ? 40.057  -7.105  99.414  1.00 43.48 ? 162 HIS B CB    1 
ATOM   4566  C CG    . HIS B 1 165 ? 39.954  -7.284  100.897 1.00 48.75 ? 162 HIS B CG    1 
ATOM   4567  N ND1   . HIS B 1 165 ? 38.959  -8.038  101.486 1.00 50.28 ? 162 HIS B ND1   1 
ATOM   4568  C CD2   . HIS B 1 165 ? 40.705  -6.793  101.913 1.00 51.89 ? 162 HIS B CD2   1 
ATOM   4569  C CE1   . HIS B 1 165 ? 39.102  -8.003  102.798 1.00 51.33 ? 162 HIS B CE1   1 
ATOM   4570  N NE2   . HIS B 1 165 ? 40.154  -7.254  103.084 1.00 53.50 ? 162 HIS B NE2   1 
ATOM   4571  N N     . ASN B 1 166 ? 42.476  -8.697  98.436  1.00 35.68 ? 163 ASN B N     1 
ATOM   4572  C CA    . ASN B 1 166 ? 43.450  -9.783  98.551  1.00 35.60 ? 163 ASN B CA    1 
ATOM   4573  C C     . ASN B 1 166 ? 44.877  -9.246  98.425  1.00 35.03 ? 163 ASN B C     1 
ATOM   4574  O O     . ASN B 1 166 ? 45.773  -9.670  99.148  1.00 34.77 ? 163 ASN B O     1 
ATOM   4575  C CB    . ASN B 1 166 ? 43.195  -10.831 97.458  1.00 36.02 ? 163 ASN B CB    1 
ATOM   4576  C CG    . ASN B 1 166 ? 44.002  -12.117 97.664  1.00 36.64 ? 163 ASN B CG    1 
ATOM   4577  O OD1   . ASN B 1 166 ? 43.738  -12.885 98.586  1.00 36.14 ? 163 ASN B OD1   1 
ATOM   4578  N ND2   . ASN B 1 166 ? 44.991  -12.348 96.799  1.00 34.86 ? 163 ASN B ND2   1 
ATOM   4579  N N     . LEU B 1 167 ? 45.080  -8.314  97.499  1.00 34.72 ? 164 LEU B N     1 
ATOM   4580  C CA    . LEU B 1 167 ? 46.390  -7.719  97.278  1.00 34.86 ? 164 LEU B CA    1 
ATOM   4581  C C     . LEU B 1 167 ? 46.928  -7.027  98.521  1.00 35.23 ? 164 LEU B C     1 
ATOM   4582  O O     . LEU B 1 167 ? 48.075  -7.236  98.913  1.00 35.79 ? 164 LEU B O     1 
ATOM   4583  C CB    . LEU B 1 167 ? 46.327  -6.717  96.132  1.00 33.00 ? 164 LEU B CB    1 
ATOM   4584  C CG    . LEU B 1 167 ? 46.268  -7.316  94.736  1.00 31.68 ? 164 LEU B CG    1 
ATOM   4585  C CD1   . LEU B 1 167 ? 46.327  -6.166  93.765  1.00 28.91 ? 164 LEU B CD1   1 
ATOM   4586  C CD2   . LEU B 1 167 ? 47.430  -8.293  94.497  1.00 29.64 ? 164 LEU B CD2   1 
ATOM   4587  N N     . TYR B 1 168 ? 46.097  -6.195  99.133  1.00 34.71 ? 165 TYR B N     1 
ATOM   4588  C CA    . TYR B 1 168 ? 46.497  -5.513  100.344 1.00 33.99 ? 165 TYR B CA    1 
ATOM   4589  C C     . TYR B 1 168 ? 46.869  -6.544  101.407 1.00 35.19 ? 165 TYR B C     1 
ATOM   4590  O O     . TYR B 1 168 ? 47.934  -6.457  102.013 1.00 36.27 ? 165 TYR B O     1 
ATOM   4591  C CB    . TYR B 1 168 ? 45.363  -4.636  100.845 1.00 30.78 ? 165 TYR B CB    1 
ATOM   4592  C CG    . TYR B 1 168 ? 45.151  -3.420  99.995  1.00 29.39 ? 165 TYR B CG    1 
ATOM   4593  C CD1   . TYR B 1 168 ? 46.192  -2.523  99.771  1.00 28.09 ? 165 TYR B CD1   1 
ATOM   4594  C CD2   . TYR B 1 168 ? 43.910  -3.162  99.401  1.00 29.82 ? 165 TYR B CD2   1 
ATOM   4595  C CE1   . TYR B 1 168 ? 46.017  -1.402  98.980  1.00 28.74 ? 165 TYR B CE1   1 
ATOM   4596  C CE2   . TYR B 1 168 ? 43.718  -2.036  98.603  1.00 28.98 ? 165 TYR B CE2   1 
ATOM   4597  C CZ    . TYR B 1 168 ? 44.779  -1.162  98.396  1.00 29.68 ? 165 TYR B CZ    1 
ATOM   4598  O OH    . TYR B 1 168 ? 44.621  -0.060  97.592  1.00 29.42 ? 165 TYR B OH    1 
ATOM   4599  N N     . LYS B 1 169 ? 45.988  -7.522  101.609 1.00 36.00 ? 166 LYS B N     1 
ATOM   4600  C CA    . LYS B 1 169 ? 46.199  -8.578  102.595 1.00 38.14 ? 166 LYS B CA    1 
ATOM   4601  C C     . LYS B 1 169 ? 47.516  -9.304  102.340 1.00 39.53 ? 166 LYS B C     1 
ATOM   4602  O O     . LYS B 1 169 ? 48.219  -9.707  103.271 1.00 39.83 ? 166 LYS B O     1 
ATOM   4603  C CB    . LYS B 1 169 ? 45.051  -9.583  102.542 1.00 39.37 ? 166 LYS B CB    1 
ATOM   4604  C CG    . LYS B 1 169 ? 45.152  -10.683 103.584 1.00 42.96 ? 166 LYS B CG    1 
ATOM   4605  C CD    . LYS B 1 169 ? 44.080  -11.753 103.391 1.00 46.16 ? 166 LYS B CD    1 
ATOM   4606  C CE    . LYS B 1 169 ? 44.095  -12.768 104.533 1.00 48.22 ? 166 LYS B CE    1 
ATOM   4607  N NZ    . LYS B 1 169 ? 43.817  -12.157 105.885 1.00 48.50 ? 166 LYS B NZ    1 
ATOM   4608  N N     . MET B 1 170 ? 47.834  -9.472  101.063 1.00 40.01 ? 167 MET B N     1 
ATOM   4609  C CA    . MET B 1 170 ? 49.055  -10.138 100.660 1.00 40.46 ? 167 MET B CA    1 
ATOM   4610  C C     . MET B 1 170 ? 50.285  -9.269  100.968 1.00 40.85 ? 167 MET B C     1 
ATOM   4611  O O     . MET B 1 170 ? 51.265  -9.762  101.512 1.00 39.69 ? 167 MET B O     1 
ATOM   4612  C CB    . MET B 1 170 ? 49.009  -10.467 99.162  1.00 39.91 ? 167 MET B CB    1 
ATOM   4613  C CG    . MET B 1 170 ? 48.217  -11.718 98.777  1.00 39.49 ? 167 MET B CG    1 
ATOM   4614  S SD    . MET B 1 170 ? 48.279  -11.976 96.963  1.00 41.66 ? 167 MET B SD    1 
ATOM   4615  C CE    . MET B 1 170 ? 49.722  -13.078 96.781  1.00 40.64 ? 167 MET B CE    1 
ATOM   4616  N N     . MET B 1 171 ? 50.228  -7.981  100.624 1.00 42.39 ? 168 MET B N     1 
ATOM   4617  C CA    . MET B 1 171 ? 51.349  -7.067  100.865 1.00 44.00 ? 168 MET B CA    1 
ATOM   4618  C C     . MET B 1 171 ? 51.639  -6.970  102.348 1.00 46.23 ? 168 MET B C     1 
ATOM   4619  O O     . MET B 1 171 ? 52.797  -6.972  102.776 1.00 47.25 ? 168 MET B O     1 
ATOM   4620  C CB    . MET B 1 171 ? 51.040  -5.667  100.338 1.00 44.23 ? 168 MET B CB    1 
ATOM   4621  C CG    . MET B 1 171 ? 52.197  -4.678  100.477 1.00 45.36 ? 168 MET B CG    1 
ATOM   4622  S SD    . MET B 1 171 ? 53.612  -5.099  99.430  1.00 46.97 ? 168 MET B SD    1 
ATOM   4623  C CE    . MET B 1 171 ? 54.546  -6.127  100.555 1.00 49.88 ? 168 MET B CE    1 
ATOM   4624  N N     . ALA B 1 172 ? 50.569  -6.878  103.127 1.00 46.42 ? 169 ALA B N     1 
ATOM   4625  C CA    . ALA B 1 172 ? 50.677  -6.775  104.571 1.00 46.63 ? 169 ALA B CA    1 
ATOM   4626  C C     . ALA B 1 172 ? 51.481  -7.955  105.107 1.00 47.05 ? 169 ALA B C     1 
ATOM   4627  O O     . ALA B 1 172 ? 52.344  -7.784  105.964 1.00 47.81 ? 169 ALA B O     1 
ATOM   4628  C CB    . ALA B 1 172 ? 49.293  -6.748  105.195 1.00 45.65 ? 169 ALA B CB    1 
ATOM   4629  N N     . ASN B 1 173 ? 51.195  -9.154  104.606 1.00 47.32 ? 170 ASN B N     1 
ATOM   4630  C CA    . ASN B 1 173 ? 51.922  -10.339 105.045 1.00 47.86 ? 170 ASN B CA    1 
ATOM   4631  C C     . ASN B 1 173 ? 53.180  -10.537 104.205 1.00 48.02 ? 170 ASN B C     1 
ATOM   4632  O O     . ASN B 1 173 ? 53.809  -11.589 104.253 1.00 47.65 ? 170 ASN B O     1 
ATOM   4633  C CB    . ASN B 1 173 ? 51.043  -11.588 104.950 1.00 48.61 ? 170 ASN B CB    1 
ATOM   4634  C CG    . ASN B 1 173 ? 49.958  -11.616 106.004 1.00 49.74 ? 170 ASN B CG    1 
ATOM   4635  O OD1   . ASN B 1 173 ? 50.178  -11.200 107.144 1.00 50.93 ? 170 ASN B OD1   1 
ATOM   4636  N ND2   . ASN B 1 173 ? 48.783  -12.124 105.640 1.00 48.16 ? 170 ASN B ND2   1 
ATOM   4637  N N     . GLY B 1 174 ? 53.535  -9.518  103.430 1.00 48.54 ? 171 GLY B N     1 
ATOM   4638  C CA    . GLY B 1 174 ? 54.720  -9.597  102.596 1.00 49.04 ? 171 GLY B CA    1 
ATOM   4639  C C     . GLY B 1 174 ? 54.802  -10.823 101.707 1.00 49.00 ? 171 GLY B C     1 
ATOM   4640  O O     . GLY B 1 174 ? 55.876  -11.397 101.529 1.00 48.93 ? 171 GLY B O     1 
ATOM   4641  N N     . ILE B 1 175 ? 53.667  -11.222 101.142 1.00 49.74 ? 172 ILE B N     1 
ATOM   4642  C CA    . ILE B 1 175 ? 53.603  -12.381 100.250 1.00 48.77 ? 172 ILE B CA    1 
ATOM   4643  C C     . ILE B 1 175 ? 53.612  -11.904 98.796  1.00 47.93 ? 172 ILE B C     1 
ATOM   4644  O O     . ILE B 1 175 ? 54.087  -12.604 97.902  1.00 48.01 ? 172 ILE B O     1 
ATOM   4645  C CB    . ILE B 1 175 ? 52.320  -13.195 100.498 1.00 49.40 ? 172 ILE B CB    1 
ATOM   4646  C CG1   . ILE B 1 175 ? 52.241  -13.590 101.972 1.00 49.71 ? 172 ILE B CG1   1 
ATOM   4647  C CG2   . ILE B 1 175 ? 52.297  -14.424 99.601  1.00 49.09 ? 172 ILE B CG2   1 
ATOM   4648  C CD1   . ILE B 1 175 ? 50.944  -14.273 102.355 1.00 51.93 ? 172 ILE B CD1   1 
ATOM   4649  N N     . LEU B 1 176 ? 53.087  -10.705 98.571  1.00 46.34 ? 173 LEU B N     1 
ATOM   4650  C CA    . LEU B 1 176 ? 53.039  -10.132 97.232  1.00 45.27 ? 173 LEU B CA    1 
ATOM   4651  C C     . LEU B 1 176 ? 54.473  -9.921  96.737  1.00 45.21 ? 173 LEU B C     1 
ATOM   4652  O O     . LEU B 1 176 ? 55.216  -9.104  97.281  1.00 45.33 ? 173 LEU B O     1 
ATOM   4653  C CB    . LEU B 1 176 ? 52.259  -8.805  97.282  1.00 43.30 ? 173 LEU B CB    1 
ATOM   4654  C CG    . LEU B 1 176 ? 51.989  -7.958  96.032  1.00 40.91 ? 173 LEU B CG    1 
ATOM   4655  C CD1   . LEU B 1 176 ? 53.236  -7.208  95.657  1.00 41.71 ? 173 LEU B CD1   1 
ATOM   4656  C CD2   . LEU B 1 176 ? 51.502  -8.820  94.888  1.00 38.49 ? 173 LEU B CD2   1 
ATOM   4657  N N     . LYS B 1 177 ? 54.863  -10.663 95.706  1.00 44.84 ? 174 LYS B N     1 
ATOM   4658  C CA    . LYS B 1 177 ? 56.222  -10.558 95.172  1.00 45.07 ? 174 LYS B CA    1 
ATOM   4659  C C     . LYS B 1 177 ? 56.301  -9.852  93.817  1.00 44.41 ? 174 LYS B C     1 
ATOM   4660  O O     . LYS B 1 177 ? 57.188  -10.146 93.008  1.00 44.38 ? 174 LYS B O     1 
ATOM   4661  C CB    . LYS B 1 177 ? 56.838  -11.959 95.055  1.00 46.60 ? 174 LYS B CB    1 
ATOM   4662  C CG    . LYS B 1 177 ? 56.892  -12.728 96.375  1.00 47.84 ? 174 LYS B CG    1 
ATOM   4663  C CD    . LYS B 1 177 ? 57.780  -12.011 97.381  1.00 49.81 ? 174 LYS B CD    1 
ATOM   4664  C CE    . LYS B 1 177 ? 57.826  -12.727 98.715  1.00 51.11 ? 174 LYS B CE    1 
ATOM   4665  N NZ    . LYS B 1 177 ? 58.642  -11.931 99.680  1.00 54.60 ? 174 LYS B NZ    1 
ATOM   4666  N N     . VAL B 1 178 ? 55.386  -8.916  93.577  1.00 42.81 ? 175 VAL B N     1 
ATOM   4667  C CA    . VAL B 1 178 ? 55.352  -8.188  92.314  1.00 40.47 ? 175 VAL B CA    1 
ATOM   4668  C C     . VAL B 1 178 ? 54.464  -6.941  92.394  1.00 39.60 ? 175 VAL B C     1 
ATOM   4669  O O     . VAL B 1 178 ? 53.327  -6.996  92.862  1.00 38.96 ? 175 VAL B O     1 
ATOM   4670  C CB    . VAL B 1 178 ? 54.858  -9.110  91.181  1.00 39.19 ? 175 VAL B CB    1 
ATOM   4671  C CG1   . VAL B 1 178 ? 53.625  -9.844  91.630  1.00 40.61 ? 175 VAL B CG1   1 
ATOM   4672  C CG2   . VAL B 1 178 ? 54.566  -8.306  89.924  1.00 38.70 ? 175 VAL B CG2   1 
ATOM   4673  N N     . PRO B 1 179 ? 54.981  -5.797  91.919  1.00 39.12 ? 176 PRO B N     1 
ATOM   4674  C CA    . PRO B 1 179 ? 54.258  -4.521  91.929  1.00 38.62 ? 176 PRO B CA    1 
ATOM   4675  C C     . PRO B 1 179 ? 52.876  -4.596  91.276  1.00 38.84 ? 176 PRO B C     1 
ATOM   4676  O O     . PRO B 1 179 ? 52.733  -5.070  90.152  1.00 39.22 ? 176 PRO B O     1 
ATOM   4677  C CB    . PRO B 1 179 ? 55.205  -3.590  91.175  1.00 37.90 ? 176 PRO B CB    1 
ATOM   4678  C CG    . PRO B 1 179 ? 55.881  -4.518  90.213  1.00 36.68 ? 176 PRO B CG    1 
ATOM   4679  C CD    . PRO B 1 179 ? 56.201  -5.692  91.097  1.00 38.31 ? 176 PRO B CD    1 
ATOM   4680  N N     . ALA B 1 180 ? 51.857  -4.117  91.978  1.00 37.35 ? 177 ALA B N     1 
ATOM   4681  C CA    . ALA B 1 180 ? 50.517  -4.155  91.423  1.00 35.24 ? 177 ALA B CA    1 
ATOM   4682  C C     . ALA B 1 180 ? 49.821  -2.804  91.483  1.00 34.56 ? 177 ALA B C     1 
ATOM   4683  O O     . ALA B 1 180 ? 50.168  -1.929  92.279  1.00 34.72 ? 177 ALA B O     1 
ATOM   4684  C CB    . ALA B 1 180 ? 49.686  -5.207  92.147  1.00 33.66 ? 177 ALA B CB    1 
ATOM   4685  N N     . ILE B 1 181 ? 48.827  -2.637  90.624  1.00 33.84 ? 178 ILE B N     1 
ATOM   4686  C CA    . ILE B 1 181 ? 48.061  -1.407  90.586  1.00 31.44 ? 178 ILE B CA    1 
ATOM   4687  C C     . ILE B 1 181 ? 46.591  -1.712  90.845  1.00 31.40 ? 178 ILE B C     1 
ATOM   4688  O O     . ILE B 1 181 ? 45.948  -2.450  90.095  1.00 31.06 ? 178 ILE B O     1 
ATOM   4689  C CB    . ILE B 1 181 ? 48.209  -0.686  89.227  1.00 30.09 ? 178 ILE B CB    1 
ATOM   4690  C CG1   . ILE B 1 181 ? 49.577  -0.005  89.139  1.00 29.46 ? 178 ILE B CG1   1 
ATOM   4691  C CG2   . ILE B 1 181 ? 47.095  0.328   89.053  1.00 29.56 ? 178 ILE B CG2   1 
ATOM   4692  C CD1   . ILE B 1 181 ? 49.787  0.814   87.873  1.00 27.56 ? 178 ILE B CD1   1 
ATOM   4693  N N     . ASN B 1 182 ? 46.076  -1.148  91.932  1.00 30.58 ? 179 ASN B N     1 
ATOM   4694  C CA    . ASN B 1 182 ? 44.680  -1.312  92.316  1.00 29.12 ? 179 ASN B CA    1 
ATOM   4695  C C     . ASN B 1 182 ? 43.820  -0.468  91.371  1.00 28.21 ? 179 ASN B C     1 
ATOM   4696  O O     . ASN B 1 182 ? 43.639  0.740   91.594  1.00 25.39 ? 179 ASN B O     1 
ATOM   4697  C CB    . ASN B 1 182 ? 44.476  -0.837  93.761  1.00 29.89 ? 179 ASN B CB    1 
ATOM   4698  C CG    . ASN B 1 182 ? 43.006  -0.689  94.126  1.00 29.72 ? 179 ASN B CG    1 
ATOM   4699  O OD1   . ASN B 1 182 ? 42.121  -1.076  93.356  1.00 30.04 ? 179 ASN B OD1   1 
ATOM   4700  N ND2   . ASN B 1 182 ? 42.739  -0.140  95.307  1.00 27.88 ? 179 ASN B ND2   1 
ATOM   4701  N N     . VAL B 1 183 ? 43.307  -1.120  90.322  1.00 27.02 ? 180 VAL B N     1 
ATOM   4702  C CA    . VAL B 1 183 ? 42.463  -0.488  89.295  1.00 25.55 ? 180 VAL B CA    1 
ATOM   4703  C C     . VAL B 1 183 ? 41.038  -0.227  89.788  1.00 25.86 ? 180 VAL B C     1 
ATOM   4704  O O     . VAL B 1 183 ? 40.439  0.798   89.465  1.00 23.32 ? 180 VAL B O     1 
ATOM   4705  C CB    . VAL B 1 183 ? 42.381  -1.382  88.022  1.00 23.76 ? 180 VAL B CB    1 
ATOM   4706  C CG1   . VAL B 1 183 ? 41.378  -0.816  87.024  1.00 22.51 ? 180 VAL B CG1   1 
ATOM   4707  C CG2   . VAL B 1 183 ? 43.729  -1.484  87.392  1.00 21.90 ? 180 VAL B CG2   1 
ATOM   4708  N N     . ASN B 1 184 ? 40.511  -1.170  90.567  1.00 27.59 ? 181 ASN B N     1 
ATOM   4709  C CA    . ASN B 1 184 ? 39.154  -1.074  91.106  1.00 30.41 ? 181 ASN B CA    1 
ATOM   4710  C C     . ASN B 1 184 ? 38.908  0.186   91.908  1.00 30.89 ? 181 ASN B C     1 
ATOM   4711  O O     . ASN B 1 184 ? 37.870  0.829   91.751  1.00 30.39 ? 181 ASN B O     1 
ATOM   4712  C CB    . ASN B 1 184 ? 38.829  -2.279  91.989  1.00 31.88 ? 181 ASN B CB    1 
ATOM   4713  C CG    . ASN B 1 184 ? 37.436  -2.194  92.607  1.00 35.32 ? 181 ASN B CG    1 
ATOM   4714  O OD1   . ASN B 1 184 ? 37.206  -1.463  93.584  1.00 36.81 ? 181 ASN B OD1   1 
ATOM   4715  N ND2   . ASN B 1 184 ? 36.492  -2.929  92.024  1.00 37.19 ? 181 ASN B ND2   1 
ATOM   4716  N N     . ASP B 1 185 ? 39.852  0.544   92.775  1.00 31.13 ? 182 ASP B N     1 
ATOM   4717  C CA    . ASP B 1 185 ? 39.675  1.731   93.597  1.00 31.25 ? 182 ASP B CA    1 
ATOM   4718  C C     . ASP B 1 185 ? 39.994  3.031   92.899  1.00 31.14 ? 182 ASP B C     1 
ATOM   4719  O O     . ASP B 1 185 ? 40.195  4.061   93.533  1.00 32.08 ? 182 ASP B O     1 
ATOM   4720  C CB    . ASP B 1 185 ? 40.457  1.612   94.892  1.00 30.87 ? 182 ASP B CB    1 
ATOM   4721  C CG    . ASP B 1 185 ? 39.771  0.699   95.876  1.00 31.95 ? 182 ASP B CG    1 
ATOM   4722  O OD1   . ASP B 1 185 ? 38.534  0.809   95.976  1.00 32.65 ? 182 ASP B OD1   1 
ATOM   4723  O OD2   . ASP B 1 185 ? 40.453  -0.116  96.543  1.00 32.73 ? 182 ASP B OD2   1 
ATOM   4724  N N     . SER B 1 186 ? 40.038  2.972   91.578  1.00 30.44 ? 183 SER B N     1 
ATOM   4725  C CA    . SER B 1 186 ? 40.263  4.156   90.776  1.00 29.25 ? 183 SER B CA    1 
ATOM   4726  C C     . SER B 1 186 ? 38.847  4.763   90.743  1.00 27.79 ? 183 SER B C     1 
ATOM   4727  O O     . SER B 1 186 ? 37.866  4.028   90.658  1.00 28.76 ? 183 SER B O     1 
ATOM   4728  C CB    . SER B 1 186 ? 40.736  3.725   89.379  1.00 29.19 ? 183 SER B CB    1 
ATOM   4729  O OG    . SER B 1 186 ? 41.163  4.822   88.593  1.00 29.07 ? 183 SER B OG    1 
ATOM   4730  N N     . VAL B 1 187 ? 38.725  6.081   90.860  1.00 26.13 ? 184 VAL B N     1 
ATOM   4731  C CA    . VAL B 1 187 ? 37.404  6.717   90.870  1.00 25.72 ? 184 VAL B CA    1 
ATOM   4732  C C     . VAL B 1 187 ? 36.550  6.331   89.660  1.00 25.75 ? 184 VAL B C     1 
ATOM   4733  O O     . VAL B 1 187 ? 35.425  5.833   89.811  1.00 23.38 ? 184 VAL B O     1 
ATOM   4734  C CB    . VAL B 1 187 ? 37.501  8.272   90.901  1.00 26.70 ? 184 VAL B CB    1 
ATOM   4735  C CG1   . VAL B 1 187 ? 36.118  8.870   91.189  1.00 24.85 ? 184 VAL B CG1   1 
ATOM   4736  C CG2   . VAL B 1 187 ? 38.519  8.727   91.940  1.00 25.03 ? 184 VAL B CG2   1 
ATOM   4737  N N     . THR B 1 188 ? 37.090  6.560   88.464  1.00 25.53 ? 185 THR B N     1 
ATOM   4738  C CA    . THR B 1 188 ? 36.385  6.238   87.230  1.00 26.02 ? 185 THR B CA    1 
ATOM   4739  C C     . THR B 1 188 ? 36.039  4.757   87.108  1.00 26.05 ? 185 THR B C     1 
ATOM   4740  O O     . THR B 1 188 ? 35.591  4.296   86.046  1.00 24.88 ? 185 THR B O     1 
ATOM   4741  C CB    . THR B 1 188 ? 37.214  6.628   86.022  1.00 25.03 ? 185 THR B CB    1 
ATOM   4742  O OG1   . THR B 1 188 ? 38.517  6.051   86.148  1.00 24.99 ? 185 THR B OG1   1 
ATOM   4743  C CG2   . THR B 1 188 ? 37.329  8.129   85.934  1.00 25.48 ? 185 THR B CG2   1 
ATOM   4744  N N     . LYS B 1 189 ? 36.242  4.009   88.188  1.00 24.45 ? 186 LYS B N     1 
ATOM   4745  C CA    . LYS B 1 189 ? 35.943  2.589   88.172  1.00 23.77 ? 186 LYS B CA    1 
ATOM   4746  C C     . LYS B 1 189 ? 34.894  2.280   89.225  1.00 25.10 ? 186 LYS B C     1 
ATOM   4747  O O     . LYS B 1 189 ? 33.719  2.100   88.906  1.00 26.46 ? 186 LYS B O     1 
ATOM   4748  C CB    . LYS B 1 189 ? 37.221  1.779   88.428  1.00 21.93 ? 186 LYS B CB    1 
ATOM   4749  C CG    . LYS B 1 189 ? 37.115  0.305   88.047  1.00 20.81 ? 186 LYS B CG    1 
ATOM   4750  C CD    . LYS B 1 189 ? 36.219  -0.495  89.017  1.00 19.76 ? 186 LYS B CD    1 
ATOM   4751  C CE    . LYS B 1 189 ? 35.940  -1.897  88.485  1.00 19.37 ? 186 LYS B CE    1 
ATOM   4752  N NZ    . LYS B 1 189 ? 35.144  -2.761  89.417  1.00 18.52 ? 186 LYS B NZ    1 
ATOM   4753  N N     . SER B 1 190 ? 35.328  2.236   90.480  1.00 26.93 ? 187 SER B N     1 
ATOM   4754  C CA    . SER B 1 190 ? 34.466  1.950   91.627  1.00 28.70 ? 187 SER B CA    1 
ATOM   4755  C C     . SER B 1 190 ? 33.193  2.790   91.703  1.00 28.80 ? 187 SER B C     1 
ATOM   4756  O O     . SER B 1 190 ? 32.138  2.289   92.105  1.00 29.38 ? 187 SER B O     1 
ATOM   4757  C CB    . SER B 1 190 ? 35.256  2.139   92.928  1.00 29.45 ? 187 SER B CB    1 
ATOM   4758  O OG    . SER B 1 190 ? 35.844  3.429   92.979  1.00 32.48 ? 187 SER B OG    1 
ATOM   4759  N N     . LYS B 1 191 ? 33.294  4.064   91.334  1.00 28.35 ? 188 LYS B N     1 
ATOM   4760  C CA    . LYS B 1 191 ? 32.149  4.968   91.386  1.00 28.32 ? 188 LYS B CA    1 
ATOM   4761  C C     . LYS B 1 191 ? 31.299  4.945   90.134  1.00 28.05 ? 188 LYS B C     1 
ATOM   4762  O O     . LYS B 1 191 ? 30.337  5.705   90.035  1.00 29.28 ? 188 LYS B O     1 
ATOM   4763  C CB    . LYS B 1 191 ? 32.616  6.409   91.629  1.00 29.68 ? 188 LYS B CB    1 
ATOM   4764  C CG    . LYS B 1 191 ? 33.366  6.616   92.940  1.00 29.33 ? 188 LYS B CG    1 
ATOM   4765  C CD    . LYS B 1 191 ? 32.478  6.388   94.145  1.00 32.02 ? 188 LYS B CD    1 
ATOM   4766  C CE    . LYS B 1 191 ? 31.522  7.549   94.350  1.00 34.52 ? 188 LYS B CE    1 
ATOM   4767  N NZ    . LYS B 1 191 ? 30.745  7.425   95.634  1.00 37.93 ? 188 LYS B NZ    1 
ATOM   4768  N N     . PHE B 1 192 ? 31.660  4.108   89.162  1.00 28.68 ? 189 PHE B N     1 
ATOM   4769  C CA    . PHE B 1 192 ? 30.889  4.013   87.915  1.00 26.40 ? 189 PHE B CA    1 
ATOM   4770  C C     . PHE B 1 192 ? 30.537  2.567   87.594  1.00 26.37 ? 189 PHE B C     1 
ATOM   4771  O O     . PHE B 1 192 ? 29.370  2.229   87.381  1.00 26.06 ? 189 PHE B O     1 
ATOM   4772  C CB    . PHE B 1 192 ? 31.663  4.625   86.747  1.00 24.71 ? 189 PHE B CB    1 
ATOM   4773  C CG    . PHE B 1 192 ? 31.916  6.100   86.884  1.00 26.36 ? 189 PHE B CG    1 
ATOM   4774  C CD1   . PHE B 1 192 ? 32.873  6.578   87.776  1.00 25.63 ? 189 PHE B CD1   1 
ATOM   4775  C CD2   . PHE B 1 192 ? 31.174  7.020   86.141  1.00 26.64 ? 189 PHE B CD2   1 
ATOM   4776  C CE1   . PHE B 1 192 ? 33.082  7.941   87.939  1.00 23.63 ? 189 PHE B CE1   1 
ATOM   4777  C CE2   . PHE B 1 192 ? 31.378  8.397   86.297  1.00 25.33 ? 189 PHE B CE2   1 
ATOM   4778  C CZ    . PHE B 1 192 ? 32.331  8.854   87.198  1.00 24.38 ? 189 PHE B CZ    1 
ATOM   4779  N N     . ASP B 1 193 ? 31.561  1.727   87.557  1.00 26.34 ? 190 ASP B N     1 
ATOM   4780  C CA    . ASP B 1 193 ? 31.433  0.306   87.258  1.00 26.08 ? 190 ASP B CA    1 
ATOM   4781  C C     . ASP B 1 193 ? 30.591  -0.371  88.333  1.00 26.66 ? 190 ASP B C     1 
ATOM   4782  O O     . ASP B 1 193 ? 29.505  -0.901  88.076  1.00 25.94 ? 190 ASP B O     1 
ATOM   4783  C CB    . ASP B 1 193 ? 32.843  -0.320  87.225  1.00 25.78 ? 190 ASP B CB    1 
ATOM   4784  C CG    . ASP B 1 193 ? 32.834  -1.830  87.006  1.00 25.65 ? 190 ASP B CG    1 
ATOM   4785  O OD1   . ASP B 1 193 ? 32.277  -2.573  87.854  1.00 26.36 ? 190 ASP B OD1   1 
ATOM   4786  O OD2   . ASP B 1 193 ? 33.402  -2.276  85.984  1.00 23.75 ? 190 ASP B OD2   1 
ATOM   4787  N N     . ASN B 1 194 ? 31.106  -0.339  89.551  1.00 26.40 ? 191 ASN B N     1 
ATOM   4788  C CA    . ASN B 1 194 ? 30.429  -0.958  90.668  1.00 26.72 ? 191 ASN B CA    1 
ATOM   4789  C C     . ASN B 1 194 ? 29.023  -0.405  90.866  1.00 26.90 ? 191 ASN B C     1 
ATOM   4790  O O     . ASN B 1 194 ? 28.071  -1.177  91.062  1.00 26.22 ? 191 ASN B O     1 
ATOM   4791  C CB    . ASN B 1 194 ? 31.270  -0.778  91.946  1.00 27.80 ? 191 ASN B CB    1 
ATOM   4792  C CG    . ASN B 1 194 ? 32.666  -1.412  91.837  1.00 27.44 ? 191 ASN B CG    1 
ATOM   4793  O OD1   . ASN B 1 194 ? 33.108  -2.118  92.748  1.00 28.76 ? 191 ASN B OD1   1 
ATOM   4794  N ND2   . ASN B 1 194 ? 33.363  -1.150  90.732  1.00 25.93 ? 191 ASN B ND2   1 
ATOM   4795  N N     . LEU B 1 195 ? 28.896  0.924   90.781  1.00 26.20 ? 192 LEU B N     1 
ATOM   4796  C CA    . LEU B 1 195 ? 27.611  1.618   90.977  1.00 24.24 ? 192 LEU B CA    1 
ATOM   4797  C C     . LEU B 1 195 ? 26.621  1.540   89.809  1.00 23.73 ? 192 LEU B C     1 
ATOM   4798  O O     . LEU B 1 195 ? 25.640  0.797   89.870  1.00 23.10 ? 192 LEU B O     1 
ATOM   4799  C CB    . LEU B 1 195 ? 27.859  3.090   91.322  1.00 21.61 ? 192 LEU B CB    1 
ATOM   4800  C CG    . LEU B 1 195 ? 26.614  3.876   91.762  1.00 21.87 ? 192 LEU B CG    1 
ATOM   4801  C CD1   . LEU B 1 195 ? 26.161  3.371   93.132  1.00 19.79 ? 192 LEU B CD1   1 
ATOM   4802  C CD2   . LEU B 1 195 ? 26.933  5.377   91.808  1.00 20.45 ? 192 LEU B CD2   1 
ATOM   4803  N N     . TYR B 1 196 ? 26.872  2.320   88.759  1.00 23.39 ? 193 TYR B N     1 
ATOM   4804  C CA    . TYR B 1 196 ? 25.997  2.351   87.589  1.00 23.23 ? 193 TYR B CA    1 
ATOM   4805  C C     . TYR B 1 196 ? 25.946  1.019   86.870  1.00 23.61 ? 193 TYR B C     1 
ATOM   4806  O O     . TYR B 1 196 ? 24.914  0.642   86.334  1.00 24.03 ? 193 TYR B O     1 
ATOM   4807  C CB    . TYR B 1 196 ? 26.441  3.427   86.605  1.00 23.81 ? 193 TYR B CB    1 
ATOM   4808  C CG    . TYR B 1 196 ? 26.621  4.768   87.252  1.00 22.91 ? 193 TYR B CG    1 
ATOM   4809  C CD1   . TYR B 1 196 ? 25.608  5.333   88.023  1.00 21.85 ? 193 TYR B CD1   1 
ATOM   4810  C CD2   . TYR B 1 196 ? 27.821  5.447   87.144  1.00 21.62 ? 193 TYR B CD2   1 
ATOM   4811  C CE1   . TYR B 1 196 ? 25.798  6.537   88.676  1.00 20.09 ? 193 TYR B CE1   1 
ATOM   4812  C CE2   . TYR B 1 196 ? 28.017  6.648   87.787  1.00 22.16 ? 193 TYR B CE2   1 
ATOM   4813  C CZ    . TYR B 1 196 ? 27.008  7.188   88.552  1.00 21.08 ? 193 TYR B CZ    1 
ATOM   4814  O OH    . TYR B 1 196 ? 27.246  8.382   89.188  1.00 23.77 ? 193 TYR B OH    1 
ATOM   4815  N N     . GLY B 1 197 ? 27.059  0.302   86.870  1.00 25.28 ? 194 GLY B N     1 
ATOM   4816  C CA    . GLY B 1 197 ? 27.082  -0.986  86.214  1.00 25.63 ? 194 GLY B CA    1 
ATOM   4817  C C     . GLY B 1 197 ? 26.049  -1.949  86.774  1.00 25.58 ? 194 GLY B C     1 
ATOM   4818  O O     . GLY B 1 197 ? 25.158  -2.385  86.053  1.00 26.94 ? 194 GLY B O     1 
ATOM   4819  N N     . CYS B 1 198 ? 26.143  -2.290  88.058  1.00 24.96 ? 195 CYS B N     1 
ATOM   4820  C CA    . CYS B 1 198 ? 25.170  -3.228  88.630  1.00 22.51 ? 195 CYS B CA    1 
ATOM   4821  C C     . CYS B 1 198 ? 23.757  -2.648  88.585  1.00 21.31 ? 195 CYS B C     1 
ATOM   4822  O O     . CYS B 1 198 ? 22.783  -3.388  88.496  1.00 21.19 ? 195 CYS B O     1 
ATOM   4823  C CB    . CYS B 1 198 ? 25.535  -3.591  90.076  1.00 20.50 ? 195 CYS B CB    1 
ATOM   4824  S SG    . CYS B 1 198 ? 27.167  -4.389  90.281  1.00 23.33 ? 195 CYS B SG    1 
ATOM   4825  N N     . ARG B 1 199 ? 23.649  -1.324  88.642  1.00 20.12 ? 196 ARG B N     1 
ATOM   4826  C CA    . ARG B 1 199 ? 22.350  -0.671  88.620  1.00 19.77 ? 196 ARG B CA    1 
ATOM   4827  C C     . ARG B 1 199 ? 21.575  -1.062  87.362  1.00 21.03 ? 196 ARG B C     1 
ATOM   4828  O O     . ARG B 1 199 ? 20.348  -1.016  87.341  1.00 21.99 ? 196 ARG B O     1 
ATOM   4829  C CB    . ARG B 1 199 ? 22.507  0.858   88.679  1.00 17.66 ? 196 ARG B CB    1 
ATOM   4830  C CG    . ARG B 1 199 ? 21.178  1.582   88.711  1.00 17.09 ? 196 ARG B CG    1 
ATOM   4831  C CD    . ARG B 1 199 ? 21.328  3.083   88.846  1.00 19.62 ? 196 ARG B CD    1 
ATOM   4832  N NE    . ARG B 1 199 ? 21.944  3.711   87.681  1.00 18.51 ? 196 ARG B NE    1 
ATOM   4833  C CZ    . ARG B 1 199 ? 22.172  5.020   87.581  1.00 18.48 ? 196 ARG B CZ    1 
ATOM   4834  N NH1   . ARG B 1 199 ? 21.846  5.833   88.566  1.00 15.96 ? 196 ARG B NH1   1 
ATOM   4835  N NH2   . ARG B 1 199 ? 22.698  5.534   86.483  1.00 21.41 ? 196 ARG B NH2   1 
ATOM   4836  N N     . GLU B 1 200 ? 22.293  -1.433  86.307  1.00 21.20 ? 197 GLU B N     1 
ATOM   4837  C CA    . GLU B 1 200 ? 21.652  -1.853  85.072  1.00 21.47 ? 197 GLU B CA    1 
ATOM   4838  C C     . GLU B 1 200 ? 21.744  -3.370  84.900  1.00 21.42 ? 197 GLU B C     1 
ATOM   4839  O O     . GLU B 1 200 ? 20.780  -4.010  84.507  1.00 23.56 ? 197 GLU B O     1 
ATOM   4840  C CB    . GLU B 1 200 ? 22.281  -1.133  83.865  1.00 21.46 ? 197 GLU B CB    1 
ATOM   4841  C CG    . GLU B 1 200 ? 21.727  0.292   83.631  1.00 20.44 ? 197 GLU B CG    1 
ATOM   4842  C CD    . GLU B 1 200 ? 22.363  1.029   82.442  1.00 20.94 ? 197 GLU B CD    1 
ATOM   4843  O OE1   . GLU B 1 200 ? 22.515  0.428   81.347  1.00 22.20 ? 197 GLU B OE1   1 
ATOM   4844  O OE2   . GLU B 1 200 ? 22.702  2.222   82.601  1.00 19.75 ? 197 GLU B OE2   1 
ATOM   4845  N N     . SER B 1 201 ? 22.881  -3.959  85.247  1.00 22.20 ? 198 SER B N     1 
ATOM   4846  C CA    . SER B 1 201 ? 23.052  -5.400  85.062  1.00 23.48 ? 198 SER B CA    1 
ATOM   4847  C C     . SER B 1 201 ? 22.355  -6.340  86.059  1.00 21.91 ? 198 SER B C     1 
ATOM   4848  O O     . SER B 1 201 ? 21.951  -7.441  85.673  1.00 22.15 ? 198 SER B O     1 
ATOM   4849  C CB    . SER B 1 201 ? 24.555  -5.744  84.977  1.00 23.29 ? 198 SER B CB    1 
ATOM   4850  O OG    . SER B 1 201 ? 25.236  -5.382  86.161  1.00 28.08 ? 198 SER B OG    1 
ATOM   4851  N N     . LEU B 1 202 ? 22.214  -5.926  87.321  1.00 19.97 ? 199 LEU B N     1 
ATOM   4852  C CA    . LEU B 1 202 ? 21.552  -6.763  88.329  1.00 19.13 ? 199 LEU B CA    1 
ATOM   4853  C C     . LEU B 1 202 ? 20.152  -7.215  87.879  1.00 19.30 ? 199 LEU B C     1 
ATOM   4854  O O     . LEU B 1 202 ? 19.905  -8.402  87.737  1.00 17.18 ? 199 LEU B O     1 
ATOM   4855  C CB    . LEU B 1 202 ? 21.433  -6.019  89.661  1.00 17.81 ? 199 LEU B CB    1 
ATOM   4856  C CG    . LEU B 1 202 ? 20.401  -6.691  90.573  1.00 20.78 ? 199 LEU B CG    1 
ATOM   4857  C CD1   . LEU B 1 202 ? 21.008  -7.961  91.208  1.00 18.31 ? 199 LEU B CD1   1 
ATOM   4858  C CD2   . LEU B 1 202 ? 19.929  -5.712  91.635  1.00 20.96 ? 199 LEU B CD2   1 
ATOM   4859  N N     . ILE B 1 203 ? 19.243  -6.264  87.663  1.00 20.48 ? 200 ILE B N     1 
ATOM   4860  C CA    . ILE B 1 203 ? 17.878  -6.583  87.219  1.00 22.32 ? 200 ILE B CA    1 
ATOM   4861  C C     . ILE B 1 203 ? 17.913  -7.379  85.911  1.00 21.07 ? 200 ILE B C     1 
ATOM   4862  O O     . ILE B 1 203 ? 17.104  -8.274  85.686  1.00 18.36 ? 200 ILE B O     1 
ATOM   4863  C CB    . ILE B 1 203 ? 17.036  -5.305  86.966  1.00 24.98 ? 200 ILE B CB    1 
ATOM   4864  C CG1   . ILE B 1 203 ? 16.975  -4.429  88.219  1.00 28.10 ? 200 ILE B CG1   1 
ATOM   4865  C CG2   . ILE B 1 203 ? 15.613  -5.688  86.627  1.00 26.85 ? 200 ILE B CG2   1 
ATOM   4866  C CD1   . ILE B 1 203 ? 16.202  -5.062  89.351  1.00 28.67 ? 200 ILE B CD1   1 
ATOM   4867  N N     . ASP B 1 204 ? 18.865  -7.033  85.057  1.00 19.57 ? 201 ASP B N     1 
ATOM   4868  C CA    . ASP B 1 204 ? 19.022  -7.690  83.772  1.00 20.54 ? 201 ASP B CA    1 
ATOM   4869  C C     . ASP B 1 204 ? 19.241  -9.201  83.993  1.00 20.89 ? 201 ASP B C     1 
ATOM   4870  O O     . ASP B 1 204 ? 18.660  -10.036 83.290  1.00 20.29 ? 201 ASP B O     1 
ATOM   4871  C CB    . ASP B 1 204 ? 20.210  -7.035  83.049  1.00 21.59 ? 201 ASP B CB    1 
ATOM   4872  C CG    . ASP B 1 204 ? 20.247  -7.315  81.554  1.00 23.07 ? 201 ASP B CG    1 
ATOM   4873  O OD1   . ASP B 1 204 ? 19.430  -8.115  81.038  1.00 23.14 ? 201 ASP B OD1   1 
ATOM   4874  O OD2   . ASP B 1 204 ? 21.126  -6.717  80.891  1.00 23.76 ? 201 ASP B OD2   1 
ATOM   4875  N N     . GLY B 1 205 ? 20.062  -9.547  84.983  1.00 19.64 ? 202 GLY B N     1 
ATOM   4876  C CA    . GLY B 1 205 ? 20.322  -10.950 85.271  1.00 19.69 ? 202 GLY B CA    1 
ATOM   4877  C C     . GLY B 1 205 ? 19.148  -11.691 85.890  1.00 19.50 ? 202 GLY B C     1 
ATOM   4878  O O     . GLY B 1 205 ? 18.935  -12.871 85.624  1.00 21.51 ? 202 GLY B O     1 
ATOM   4879  N N     . ILE B 1 206 ? 18.378  -10.998 86.714  1.00 18.82 ? 203 ILE B N     1 
ATOM   4880  C CA    . ILE B 1 206 ? 17.226  -11.580 87.385  1.00 18.00 ? 203 ILE B CA    1 
ATOM   4881  C C     . ILE B 1 206 ? 16.049  -11.798 86.446  1.00 20.15 ? 203 ILE B C     1 
ATOM   4882  O O     . ILE B 1 206 ? 15.258  -12.733 86.631  1.00 21.11 ? 203 ILE B O     1 
ATOM   4883  C CB    . ILE B 1 206 ? 16.750  -10.655 88.515  1.00 16.36 ? 203 ILE B CB    1 
ATOM   4884  C CG1   . ILE B 1 206 ? 17.911  -10.396 89.477  1.00 15.48 ? 203 ILE B CG1   1 
ATOM   4885  C CG2   . ILE B 1 206 ? 15.533  -11.266 89.218  1.00 15.42 ? 203 ILE B CG2   1 
ATOM   4886  C CD1   . ILE B 1 206 ? 17.542  -9.586  90.679  1.00 15.68 ? 203 ILE B CD1   1 
ATOM   4887  N N     . LYS B 1 207 ? 15.939  -10.928 85.444  1.00 19.11 ? 204 LYS B N     1 
ATOM   4888  C CA    . LYS B 1 207 ? 14.841  -10.986 84.486  1.00 19.02 ? 204 LYS B CA    1 
ATOM   4889  C C     . LYS B 1 207 ? 14.982  -12.072 83.427  1.00 19.20 ? 204 LYS B C     1 
ATOM   4890  O O     . LYS B 1 207 ? 14.052  -12.857 83.203  1.00 18.30 ? 204 LYS B O     1 
ATOM   4891  C CB    . LYS B 1 207 ? 14.675  -9.624  83.801  1.00 18.25 ? 204 LYS B CB    1 
ATOM   4892  C CG    . LYS B 1 207 ? 14.188  -8.494  84.716  1.00 14.34 ? 204 LYS B CG    1 
ATOM   4893  C CD    . LYS B 1 207 ? 12.677  -8.483  84.852  1.00 15.15 ? 204 LYS B CD    1 
ATOM   4894  C CE    . LYS B 1 207 ? 12.144  -7.103  85.238  1.00 14.12 ? 204 LYS B CE    1 
ATOM   4895  N NZ    . LYS B 1 207 ? 10.699  -7.204  85.607  1.00 15.90 ? 204 LYS B NZ    1 
ATOM   4896  N N     . ARG B 1 208 ? 16.131  -12.100 82.758  1.00 18.61 ? 205 ARG B N     1 
ATOM   4897  C CA    . ARG B 1 208 ? 16.368  -13.109 81.734  1.00 19.31 ? 205 ARG B CA    1 
ATOM   4898  C C     . ARG B 1 208 ? 16.250  -14.476 82.364  1.00 19.18 ? 205 ARG B C     1 
ATOM   4899  O O     . ARG B 1 208 ? 15.857  -15.436 81.714  1.00 21.23 ? 205 ARG B O     1 
ATOM   4900  C CB    . ARG B 1 208 ? 17.768  -12.963 81.115  1.00 18.60 ? 205 ARG B CB    1 
ATOM   4901  C CG    . ARG B 1 208 ? 17.973  -11.661 80.348  1.00 19.34 ? 205 ARG B CG    1 
ATOM   4902  C CD    . ARG B 1 208 ? 19.203  -11.712 79.481  1.00 16.75 ? 205 ARG B CD    1 
ATOM   4903  N NE    . ARG B 1 208 ? 19.669  -10.365 79.158  1.00 19.36 ? 205 ARG B NE    1 
ATOM   4904  C CZ    . ARG B 1 208 ? 20.580  -10.082 78.231  1.00 19.51 ? 205 ARG B CZ    1 
ATOM   4905  N NH1   . ARG B 1 208 ? 21.131  -11.058 77.522  1.00 21.93 ? 205 ARG B NH1   1 
ATOM   4906  N NH2   . ARG B 1 208 ? 20.948  -8.827  78.016  1.00 18.07 ? 205 ARG B NH2   1 
ATOM   4907  N N     . ALA B 1 209 ? 16.580  -14.554 83.647  1.00 20.17 ? 206 ALA B N     1 
ATOM   4908  C CA    . ALA B 1 209 ? 16.528  -15.829 84.348  1.00 19.40 ? 206 ALA B CA    1 
ATOM   4909  C C     . ALA B 1 209 ? 15.145  -16.239 84.836  1.00 19.19 ? 206 ALA B C     1 
ATOM   4910  O O     . ALA B 1 209 ? 14.766  -17.399 84.700  1.00 19.50 ? 206 ALA B O     1 
ATOM   4911  C CB    . ALA B 1 209 ? 17.500  -15.805 85.516  1.00 16.21 ? 206 ALA B CB    1 
ATOM   4912  N N     . THR B 1 210 ? 14.401  -15.287 85.393  1.00 19.05 ? 207 THR B N     1 
ATOM   4913  C CA    . THR B 1 210 ? 13.087  -15.566 85.969  1.00 19.65 ? 207 THR B CA    1 
ATOM   4914  C C     . THR B 1 210 ? 11.889  -14.810 85.389  1.00 21.12 ? 207 THR B C     1 
ATOM   4915  O O     . THR B 1 210 ? 10.745  -15.267 85.500  1.00 24.56 ? 207 THR B O     1 
ATOM   4916  C CB    . THR B 1 210 ? 13.100  -15.267 87.489  1.00 18.48 ? 207 THR B CB    1 
ATOM   4917  O OG1   . THR B 1 210 ? 13.106  -13.849 87.693  1.00 16.50 ? 207 THR B OG1   1 
ATOM   4918  C CG2   . THR B 1 210 ? 14.363  -15.848 88.140  1.00 19.28 ? 207 THR B CG2   1 
ATOM   4919  N N     . ASP B 1 211 ? 12.150  -13.646 84.801  1.00 20.49 ? 208 ASP B N     1 
ATOM   4920  C CA    . ASP B 1 211 ? 11.103  -12.784 84.241  1.00 22.18 ? 208 ASP B CA    1 
ATOM   4921  C C     . ASP B 1 211 ? 10.128  -12.253 85.280  1.00 20.96 ? 208 ASP B C     1 
ATOM   4922  O O     . ASP B 1 211 ? 9.025   -11.846 84.929  1.00 21.48 ? 208 ASP B O     1 
ATOM   4923  C CB    . ASP B 1 211 ? 10.304  -13.513 83.151  1.00 22.11 ? 208 ASP B CB    1 
ATOM   4924  C CG    . ASP B 1 211 ? 11.028  -13.536 81.829  1.00 22.83 ? 208 ASP B CG    1 
ATOM   4925  O OD1   . ASP B 1 211 ? 11.335  -12.442 81.300  1.00 21.53 ? 208 ASP B OD1   1 
ATOM   4926  O OD2   . ASP B 1 211 ? 11.306  -14.651 81.339  1.00 24.61 ? 208 ASP B OD2   1 
ATOM   4927  N N     . VAL B 1 212 ? 10.542  -12.237 86.547  1.00 21.67 ? 209 VAL B N     1 
ATOM   4928  C CA    . VAL B 1 212 ? 9.681   -11.767 87.647  1.00 21.31 ? 209 VAL B CA    1 
ATOM   4929  C C     . VAL B 1 212 ? 9.450   -10.257 87.661  1.00 21.38 ? 209 VAL B C     1 
ATOM   4930  O O     . VAL B 1 212 ? 10.309  -9.473  87.269  1.00 22.50 ? 209 VAL B O     1 
ATOM   4931  C CB    . VAL B 1 212 ? 10.262  -12.152 89.054  1.00 20.54 ? 209 VAL B CB    1 
ATOM   4932  C CG1   . VAL B 1 212 ? 11.512  -11.314 89.360  1.00 16.81 ? 209 VAL B CG1   1 
ATOM   4933  C CG2   . VAL B 1 212 ? 9.200   -11.937 90.134  1.00 16.99 ? 209 VAL B CG2   1 
ATOM   4934  N N     . MET B 1 213 ? 8.287   -9.847  88.137  1.00 22.31 ? 210 MET B N     1 
ATOM   4935  C CA    . MET B 1 213 ? 7.990   -8.431  88.220  1.00 24.27 ? 210 MET B CA    1 
ATOM   4936  C C     . MET B 1 213 ? 8.694   -7.873  89.480  1.00 24.84 ? 210 MET B C     1 
ATOM   4937  O O     . MET B 1 213 ? 8.681   -8.498  90.545  1.00 23.87 ? 210 MET B O     1 
ATOM   4938  C CB    . MET B 1 213 ? 6.474   -8.235  88.280  1.00 27.24 ? 210 MET B CB    1 
ATOM   4939  C CG    . MET B 1 213 ? 6.040   -6.790  88.448  1.00 32.45 ? 210 MET B CG    1 
ATOM   4940  S SD    . MET B 1 213 ? 4.844   -6.233  87.203  1.00 37.42 ? 210 MET B SD    1 
ATOM   4941  C CE    . MET B 1 213 ? 5.871   -5.075  86.258  1.00 36.37 ? 210 MET B CE    1 
ATOM   4942  N N     . ILE B 1 214 ? 9.343   -6.723  89.349  1.00 23.50 ? 211 ILE B N     1 
ATOM   4943  C CA    . ILE B 1 214 ? 10.050  -6.143  90.478  1.00 24.15 ? 211 ILE B CA    1 
ATOM   4944  C C     . ILE B 1 214 ? 9.090   -5.300  91.317  1.00 26.86 ? 211 ILE B C     1 
ATOM   4945  O O     . ILE B 1 214 ? 9.096   -5.366  92.553  1.00 27.05 ? 211 ILE B O     1 
ATOM   4946  C CB    . ILE B 1 214 ? 11.241  -5.277  89.993  1.00 22.40 ? 211 ILE B CB    1 
ATOM   4947  C CG1   . ILE B 1 214 ? 12.158  -6.121  89.099  1.00 21.15 ? 211 ILE B CG1   1 
ATOM   4948  C CG2   . ILE B 1 214 ? 12.043  -4.752  91.175  1.00 21.40 ? 211 ILE B CG2   1 
ATOM   4949  C CD1   . ILE B 1 214 ? 12.775  -7.317  89.801  1.00 15.41 ? 211 ILE B CD1   1 
ATOM   4950  N N     . ALA B 1 215 ? 8.253   -4.531  90.623  1.00 27.02 ? 212 ALA B N     1 
ATOM   4951  C CA    . ALA B 1 215 ? 7.256   -3.672  91.245  1.00 24.10 ? 212 ALA B CA    1 
ATOM   4952  C C     . ALA B 1 215 ? 6.399   -4.497  92.199  1.00 24.36 ? 212 ALA B C     1 
ATOM   4953  O O     . ALA B 1 215 ? 5.923   -5.584  91.845  1.00 22.51 ? 212 ALA B O     1 
ATOM   4954  C CB    . ALA B 1 215 ? 6.373   -3.039  90.161  1.00 25.38 ? 212 ALA B CB    1 
ATOM   4955  N N     . GLY B 1 216 ? 6.204   -3.972  93.408  1.00 23.48 ? 213 GLY B N     1 
ATOM   4956  C CA    . GLY B 1 216 ? 5.400   -4.665  94.402  1.00 22.82 ? 213 GLY B CA    1 
ATOM   4957  C C     . GLY B 1 216 ? 6.202   -5.569  95.325  1.00 22.97 ? 213 GLY B C     1 
ATOM   4958  O O     . GLY B 1 216 ? 5.897   -5.691  96.503  1.00 23.58 ? 213 GLY B O     1 
ATOM   4959  N N     . LYS B 1 217 ? 7.248   -6.194  94.809  1.00 22.89 ? 214 LYS B N     1 
ATOM   4960  C CA    . LYS B 1 217 ? 8.036   -7.110  95.621  1.00 23.33 ? 214 LYS B CA    1 
ATOM   4961  C C     . LYS B 1 217 ? 8.855   -6.435  96.731  1.00 23.66 ? 214 LYS B C     1 
ATOM   4962  O O     . LYS B 1 217 ? 9.067   -5.214  96.730  1.00 22.96 ? 214 LYS B O     1 
ATOM   4963  C CB    . LYS B 1 217 ? 8.980   -7.928  94.702  1.00 22.63 ? 214 LYS B CB    1 
ATOM   4964  C CG    . LYS B 1 217 ? 8.255   -8.736  93.611  1.00 24.87 ? 214 LYS B CG    1 
ATOM   4965  C CD    . LYS B 1 217 ? 7.676   -10.064 94.112  1.00 23.36 ? 214 LYS B CD    1 
ATOM   4966  C CE    . LYS B 1 217 ? 6.643   -10.670 93.143  1.00 22.79 ? 214 LYS B CE    1 
ATOM   4967  N NZ    . LYS B 1 217 ? 6.956   -10.401 91.708  1.00 21.03 ? 214 LYS B NZ    1 
ATOM   4968  N N     . VAL B 1 218 ? 9.288   -7.234  97.700  1.00 21.74 ? 215 VAL B N     1 
ATOM   4969  C CA    . VAL B 1 218 ? 10.149  -6.721  98.749  1.00 18.89 ? 215 VAL B CA    1 
ATOM   4970  C C     . VAL B 1 218 ? 11.499  -7.301  98.375  1.00 18.91 ? 215 VAL B C     1 
ATOM   4971  O O     . VAL B 1 218 ? 11.624  -8.506  98.170  1.00 18.78 ? 215 VAL B O     1 
ATOM   4972  C CB    . VAL B 1 218 ? 9.770   -7.232  100.162 1.00 18.78 ? 215 VAL B CB    1 
ATOM   4973  C CG1   . VAL B 1 218 ? 10.991  -7.149  101.081 1.00 17.59 ? 215 VAL B CG1   1 
ATOM   4974  C CG2   . VAL B 1 218 ? 8.672   -6.351  100.764 1.00 17.94 ? 215 VAL B CG2   1 
ATOM   4975  N N     . ALA B 1 219 ? 12.507  -6.451  98.259  1.00 17.99 ? 216 ALA B N     1 
ATOM   4976  C CA    . ALA B 1 219 ? 13.839  -6.923  97.913  1.00 17.55 ? 216 ALA B CA    1 
ATOM   4977  C C     . ALA B 1 219 ? 14.800  -6.639  99.058  1.00 17.12 ? 216 ALA B C     1 
ATOM   4978  O O     . ALA B 1 219 ? 14.789  -5.550  99.631  1.00 18.18 ? 216 ALA B O     1 
ATOM   4979  C CB    . ALA B 1 219 ? 14.321  -6.234  96.627  1.00 17.88 ? 216 ALA B CB    1 
ATOM   4980  N N     . VAL B 1 220 ? 15.620  -7.626  99.400  1.00 17.26 ? 217 VAL B N     1 
ATOM   4981  C CA    . VAL B 1 220 ? 16.603  -7.478  100.469 1.00 16.34 ? 217 VAL B CA    1 
ATOM   4982  C C     . VAL B 1 220 ? 17.993  -7.513  99.861  1.00 17.36 ? 217 VAL B C     1 
ATOM   4983  O O     . VAL B 1 220 ? 18.421  -8.533  99.329  1.00 18.73 ? 217 VAL B O     1 
ATOM   4984  C CB    . VAL B 1 220 ? 16.498  -8.631  101.512 1.00 16.58 ? 217 VAL B CB    1 
ATOM   4985  C CG1   . VAL B 1 220 ? 17.576  -8.471  102.585 1.00 8.41  ? 217 VAL B CG1   1 
ATOM   4986  C CG2   . VAL B 1 220 ? 15.114  -8.639  102.138 1.00 14.08 ? 217 VAL B CG2   1 
ATOM   4987  N N     . VAL B 1 221 ? 18.700  -6.397  99.953  1.00 18.30 ? 218 VAL B N     1 
ATOM   4988  C CA    . VAL B 1 221 ? 20.045  -6.302  99.409  1.00 17.96 ? 218 VAL B CA    1 
ATOM   4989  C C     . VAL B 1 221 ? 21.062  -6.369  100.522 1.00 21.35 ? 218 VAL B C     1 
ATOM   4990  O O     . VAL B 1 221 ? 21.161  -5.430  101.327 1.00 22.40 ? 218 VAL B O     1 
ATOM   4991  C CB    . VAL B 1 221 ? 20.239  -4.971  98.664  1.00 16.64 ? 218 VAL B CB    1 
ATOM   4992  C CG1   . VAL B 1 221 ? 21.653  -4.876  98.127  1.00 15.15 ? 218 VAL B CG1   1 
ATOM   4993  C CG2   . VAL B 1 221 ? 19.199  -4.849  97.558  1.00 16.73 ? 218 VAL B CG2   1 
ATOM   4994  N N     . ALA B 1 222 ? 21.825  -7.461  100.560 1.00 22.69 ? 219 ALA B N     1 
ATOM   4995  C CA    . ALA B 1 222 ? 22.848  -7.650  101.588 1.00 23.92 ? 219 ALA B CA    1 
ATOM   4996  C C     . ALA B 1 222 ? 24.045  -6.760  101.320 1.00 25.58 ? 219 ALA B C     1 
ATOM   4997  O O     . ALA B 1 222 ? 24.800  -6.987  100.372 1.00 25.77 ? 219 ALA B O     1 
ATOM   4998  C CB    . ALA B 1 222 ? 23.292  -9.093  101.631 1.00 25.15 ? 219 ALA B CB    1 
ATOM   4999  N N     . GLY B 1 223 ? 24.225  -5.742  102.153 1.00 26.34 ? 220 GLY B N     1 
ATOM   5000  C CA    . GLY B 1 223 ? 25.358  -4.854  101.970 1.00 27.03 ? 220 GLY B CA    1 
ATOM   5001  C C     . GLY B 1 223 ? 24.942  -3.565  101.296 1.00 28.48 ? 220 GLY B C     1 
ATOM   5002  O O     . GLY B 1 223 ? 23.939  -3.511  100.584 1.00 28.42 ? 220 GLY B O     1 
ATOM   5003  N N     . TYR B 1 224 ? 25.705  -2.510  101.543 1.00 29.25 ? 221 TYR B N     1 
ATOM   5004  C CA    . TYR B 1 224 ? 25.390  -1.240  100.934 1.00 28.52 ? 221 TYR B CA    1 
ATOM   5005  C C     . TYR B 1 224 ? 26.647  -0.494  100.529 1.00 28.03 ? 221 TYR B C     1 
ATOM   5006  O O     . TYR B 1 224 ? 26.889  0.632   100.979 1.00 26.27 ? 221 TYR B O     1 
ATOM   5007  C CB    . TYR B 1 224 ? 24.541  -0.376  101.862 1.00 28.62 ? 221 TYR B CB    1 
ATOM   5008  C CG    . TYR B 1 224 ? 23.801  0.728   101.124 1.00 31.69 ? 221 TYR B CG    1 
ATOM   5009  C CD1   . TYR B 1 224 ? 22.735  0.438   100.263 1.00 31.35 ? 221 TYR B CD1   1 
ATOM   5010  C CD2   . TYR B 1 224 ? 24.161  2.067   101.292 1.00 33.16 ? 221 TYR B CD2   1 
ATOM   5011  C CE1   . TYR B 1 224 ? 22.047  1.460   99.596  1.00 31.08 ? 221 TYR B CE1   1 
ATOM   5012  C CE2   . TYR B 1 224 ? 23.482  3.090   100.632 1.00 31.68 ? 221 TYR B CE2   1 
ATOM   5013  C CZ    . TYR B 1 224 ? 22.429  2.786   99.790  1.00 31.87 ? 221 TYR B CZ    1 
ATOM   5014  O OH    . TYR B 1 224 ? 21.764  3.814   99.154  1.00 29.20 ? 221 TYR B OH    1 
ATOM   5015  N N     . GLY B 1 225 ? 27.432  -1.139  99.662  1.00 26.98 ? 222 GLY B N     1 
ATOM   5016  C CA    . GLY B 1 225 ? 28.655  -0.543  99.147  1.00 25.95 ? 222 GLY B CA    1 
ATOM   5017  C C     . GLY B 1 225 ? 28.373  -0.007  97.755  1.00 25.28 ? 222 GLY B C     1 
ATOM   5018  O O     . GLY B 1 225 ? 27.217  0.234   97.419  1.00 24.99 ? 222 GLY B O     1 
ATOM   5019  N N     . ASP B 1 226 ? 29.398  0.181   96.932  1.00 24.72 ? 223 ASP B N     1 
ATOM   5020  C CA    . ASP B 1 226 ? 29.151  0.691   95.586  1.00 26.02 ? 223 ASP B CA    1 
ATOM   5021  C C     . ASP B 1 226 ? 28.162  -0.197  94.837  1.00 24.45 ? 223 ASP B C     1 
ATOM   5022  O O     . ASP B 1 226 ? 27.204  0.292   94.238  1.00 23.54 ? 223 ASP B O     1 
ATOM   5023  C CB    . ASP B 1 226 ? 30.466  0.828   94.829  1.00 27.37 ? 223 ASP B CB    1 
ATOM   5024  C CG    . ASP B 1 226 ? 31.373  1.865   95.464  1.00 30.64 ? 223 ASP B CG    1 
ATOM   5025  O OD1   . ASP B 1 226 ? 30.848  2.938   95.842  1.00 28.27 ? 223 ASP B OD1   1 
ATOM   5026  O OD2   . ASP B 1 226 ? 32.595  1.612   95.592  1.00 33.58 ? 223 ASP B OD2   1 
ATOM   5027  N N     . VAL B 1 227 ? 28.393  -1.502  94.902  1.00 23.33 ? 224 VAL B N     1 
ATOM   5028  C CA    . VAL B 1 227 ? 27.518  -2.478  94.280  1.00 21.36 ? 224 VAL B CA    1 
ATOM   5029  C C     . VAL B 1 227 ? 26.149  -2.428  94.955  1.00 22.58 ? 224 VAL B C     1 
ATOM   5030  O O     . VAL B 1 227 ? 25.114  -2.326  94.287  1.00 24.06 ? 224 VAL B O     1 
ATOM   5031  C CB    . VAL B 1 227 ? 28.065  -3.894  94.458  1.00 20.90 ? 224 VAL B CB    1 
ATOM   5032  C CG1   . VAL B 1 227 ? 27.064  -4.901  93.934  1.00 21.82 ? 224 VAL B CG1   1 
ATOM   5033  C CG2   . VAL B 1 227 ? 29.382  -4.037  93.745  1.00 20.27 ? 224 VAL B CG2   1 
ATOM   5034  N N     . GLY B 1 228 ? 26.153  -2.514  96.285  1.00 20.92 ? 225 GLY B N     1 
ATOM   5035  C CA    . GLY B 1 228 ? 24.909  -2.483  97.034  1.00 19.66 ? 225 GLY B CA    1 
ATOM   5036  C C     . GLY B 1 228 ? 24.072  -1.273  96.669  1.00 20.04 ? 225 GLY B C     1 
ATOM   5037  O O     . GLY B 1 228 ? 22.861  -1.383  96.478  1.00 19.81 ? 225 GLY B O     1 
ATOM   5038  N N     . LYS B 1 229 ? 24.728  -0.118  96.577  1.00 19.30 ? 226 LYS B N     1 
ATOM   5039  C CA    . LYS B 1 229 ? 24.069  1.135   96.224  1.00 19.47 ? 226 LYS B CA    1 
ATOM   5040  C C     . LYS B 1 229 ? 23.400  1.023   94.861  1.00 19.40 ? 226 LYS B C     1 
ATOM   5041  O O     . LYS B 1 229 ? 22.222  1.377   94.704  1.00 18.36 ? 226 LYS B O     1 
ATOM   5042  C CB    . LYS B 1 229 ? 25.088  2.289   96.195  1.00 20.62 ? 226 LYS B CB    1 
ATOM   5043  C CG    . LYS B 1 229 ? 25.572  2.760   97.577  1.00 24.44 ? 226 LYS B CG    1 
ATOM   5044  C CD    . LYS B 1 229 ? 26.548  3.952   97.498  1.00 26.20 ? 226 LYS B CD    1 
ATOM   5045  C CE    . LYS B 1 229 ? 26.873  4.514   98.888  1.00 25.93 ? 226 LYS B CE    1 
ATOM   5046  N NZ    . LYS B 1 229 ? 27.479  3.500   99.815  1.00 29.69 ? 226 LYS B NZ    1 
ATOM   5047  N N     . GLY B 1 230 ? 24.161  0.528   93.885  1.00 17.78 ? 227 GLY B N     1 
ATOM   5048  C CA    . GLY B 1 230 ? 23.651  0.389   92.531  1.00 17.50 ? 227 GLY B CA    1 
ATOM   5049  C C     . GLY B 1 230 ? 22.441  -0.524  92.404  1.00 17.31 ? 227 GLY B C     1 
ATOM   5050  O O     . GLY B 1 230 ? 21.450  -0.174  91.779  1.00 15.00 ? 227 GLY B O     1 
ATOM   5051  N N     . CYS B 1 231 ? 22.529  -1.699  93.015  1.00 18.72 ? 228 CYS B N     1 
ATOM   5052  C CA    . CYS B 1 231 ? 21.461  -2.680  92.978  1.00 19.47 ? 228 CYS B CA    1 
ATOM   5053  C C     . CYS B 1 231 ? 20.205  -2.113  93.625  1.00 21.86 ? 228 CYS B C     1 
ATOM   5054  O O     . CYS B 1 231 ? 19.115  -2.142  93.040  1.00 21.75 ? 228 CYS B O     1 
ATOM   5055  C CB    . CYS B 1 231 ? 21.895  -3.938  93.728  1.00 21.17 ? 228 CYS B CB    1 
ATOM   5056  S SG    . CYS B 1 231 ? 23.417  -4.700  93.134  1.00 25.35 ? 228 CYS B SG    1 
ATOM   5057  N N     . ALA B 1 232 ? 20.374  -1.608  94.846  1.00 23.21 ? 229 ALA B N     1 
ATOM   5058  C CA    . ALA B 1 232 ? 19.279  -1.049  95.619  1.00 21.96 ? 229 ALA B CA    1 
ATOM   5059  C C     . ALA B 1 232 ? 18.499  -0.025  94.803  1.00 21.58 ? 229 ALA B C     1 
ATOM   5060  O O     . ALA B 1 232 ? 17.274  -0.076  94.716  1.00 19.16 ? 229 ALA B O     1 
ATOM   5061  C CB    . ALA B 1 232 ? 19.809  -0.406  96.882  1.00 20.01 ? 229 ALA B CB    1 
ATOM   5062  N N     . GLN B 1 233 ? 19.216  0.912   94.204  1.00 21.91 ? 230 GLN B N     1 
ATOM   5063  C CA    . GLN B 1 233 ? 18.560  1.946   93.429  1.00 23.91 ? 230 GLN B CA    1 
ATOM   5064  C C     . GLN B 1 233 ? 17.755  1.346   92.275  1.00 23.13 ? 230 GLN B C     1 
ATOM   5065  O O     . GLN B 1 233 ? 16.645  1.782   92.000  1.00 22.07 ? 230 GLN B O     1 
ATOM   5066  C CB    . GLN B 1 233 ? 19.600  2.921   92.902  1.00 25.83 ? 230 GLN B CB    1 
ATOM   5067  C CG    . GLN B 1 233 ? 19.075  4.295   92.613  1.00 28.47 ? 230 GLN B CG    1 
ATOM   5068  C CD    . GLN B 1 233 ? 20.136  5.128   91.965  1.00 34.14 ? 230 GLN B CD    1 
ATOM   5069  O OE1   . GLN B 1 233 ? 21.332  4.959   92.249  1.00 34.64 ? 230 GLN B OE1   1 
ATOM   5070  N NE2   . GLN B 1 233 ? 19.721  6.038   91.084  1.00 35.49 ? 230 GLN B NE2   1 
ATOM   5071  N N     . ALA B 1 234 ? 18.316  0.336   91.618  1.00 22.35 ? 231 ALA B N     1 
ATOM   5072  C CA    . ALA B 1 234 ? 17.637  -0.323  90.509  1.00 24.47 ? 231 ALA B CA    1 
ATOM   5073  C C     . ALA B 1 234 ? 16.296  -0.923  90.953  1.00 25.42 ? 231 ALA B C     1 
ATOM   5074  O O     . ALA B 1 234 ? 15.245  -0.598  90.392  1.00 25.78 ? 231 ALA B O     1 
ATOM   5075  C CB    . ALA B 1 234 ? 18.544  -1.414  89.920  1.00 20.53 ? 231 ALA B CB    1 
ATOM   5076  N N     . LEU B 1 235 ? 16.343  -1.783  91.971  1.00 25.42 ? 232 LEU B N     1 
ATOM   5077  C CA    . LEU B 1 235 ? 15.150  -2.430  92.512  1.00 24.33 ? 232 LEU B CA    1 
ATOM   5078  C C     . LEU B 1 235 ? 14.010  -1.477  92.892  1.00 25.01 ? 232 LEU B C     1 
ATOM   5079  O O     . LEU B 1 235 ? 12.849  -1.729  92.567  1.00 23.48 ? 232 LEU B O     1 
ATOM   5080  C CB    . LEU B 1 235 ? 15.533  -3.257  93.729  1.00 23.83 ? 232 LEU B CB    1 
ATOM   5081  C CG    . LEU B 1 235 ? 16.608  -4.295  93.425  1.00 23.79 ? 232 LEU B CG    1 
ATOM   5082  C CD1   . LEU B 1 235 ? 17.162  -4.824  94.723  1.00 23.04 ? 232 LEU B CD1   1 
ATOM   5083  C CD2   . LEU B 1 235 ? 16.024  -5.421  92.561  1.00 20.72 ? 232 LEU B CD2   1 
ATOM   5084  N N     . ARG B 1 236 ? 14.320  -0.390  93.587  1.00 25.48 ? 233 ARG B N     1 
ATOM   5085  C CA    . ARG B 1 236 ? 13.256  0.524   93.983  1.00 27.83 ? 233 ARG B CA    1 
ATOM   5086  C C     . ARG B 1 236 ? 12.828  1.395   92.802  1.00 27.32 ? 233 ARG B C     1 
ATOM   5087  O O     . ARG B 1 236 ? 11.749  1.984   92.813  1.00 24.16 ? 233 ARG B O     1 
ATOM   5088  C CB    . ARG B 1 236 ? 13.696  1.411   95.157  1.00 30.00 ? 233 ARG B CB    1 
ATOM   5089  C CG    . ARG B 1 236 ? 14.627  2.535   94.794  1.00 32.67 ? 233 ARG B CG    1 
ATOM   5090  C CD    . ARG B 1 236 ? 14.688  3.547   95.917  1.00 35.29 ? 233 ARG B CD    1 
ATOM   5091  N NE    . ARG B 1 236 ? 15.652  4.612   95.652  1.00 37.54 ? 233 ARG B NE    1 
ATOM   5092  C CZ    . ARG B 1 236 ? 16.057  5.493   96.562  1.00 40.49 ? 233 ARG B CZ    1 
ATOM   5093  N NH1   . ARG B 1 236 ? 15.573  5.427   97.800  1.00 42.65 ? 233 ARG B NH1   1 
ATOM   5094  N NH2   . ARG B 1 236 ? 16.940  6.436   96.237  1.00 40.91 ? 233 ARG B NH2   1 
ATOM   5095  N N     . GLY B 1 237 ? 13.689  1.467   91.792  1.00 27.48 ? 234 GLY B N     1 
ATOM   5096  C CA    . GLY B 1 237 ? 13.384  2.251   90.618  1.00 27.62 ? 234 GLY B CA    1 
ATOM   5097  C C     . GLY B 1 237 ? 12.257  1.581   89.869  1.00 28.84 ? 234 GLY B C     1 
ATOM   5098  O O     . GLY B 1 237 ? 11.509  2.226   89.137  1.00 29.40 ? 234 GLY B O     1 
ATOM   5099  N N     . PHE B 1 238 ? 12.134  0.273   90.065  1.00 29.04 ? 235 PHE B N     1 
ATOM   5100  C CA    . PHE B 1 238 ? 11.096  -0.502  89.407  1.00 29.50 ? 235 PHE B CA    1 
ATOM   5101  C C     . PHE B 1 238 ? 9.879   -0.704  90.296  1.00 28.01 ? 235 PHE B C     1 
ATOM   5102  O O     . PHE B 1 238 ? 8.950   -1.423  89.937  1.00 28.46 ? 235 PHE B O     1 
ATOM   5103  C CB    . PHE B 1 238 ? 11.637  -1.862  88.949  1.00 30.42 ? 235 PHE B CB    1 
ATOM   5104  C CG    . PHE B 1 238 ? 12.438  -1.805  87.677  1.00 34.75 ? 235 PHE B CG    1 
ATOM   5105  C CD1   . PHE B 1 238 ? 11.930  -1.174  86.540  1.00 36.40 ? 235 PHE B CD1   1 
ATOM   5106  C CD2   . PHE B 1 238 ? 13.684  -2.423  87.596  1.00 36.51 ? 235 PHE B CD2   1 
ATOM   5107  C CE1   . PHE B 1 238 ? 12.652  -1.163  85.342  1.00 37.17 ? 235 PHE B CE1   1 
ATOM   5108  C CE2   . PHE B 1 238 ? 14.414  -2.416  86.404  1.00 37.94 ? 235 PHE B CE2   1 
ATOM   5109  C CZ    . PHE B 1 238 ? 13.894  -1.785  85.276  1.00 38.17 ? 235 PHE B CZ    1 
ATOM   5110  N N     . GLY B 1 239 ? 9.884   -0.076  91.464  1.00 27.41 ? 236 GLY B N     1 
ATOM   5111  C CA    . GLY B 1 239 ? 8.737   -0.192  92.345  1.00 25.87 ? 236 GLY B CA    1 
ATOM   5112  C C     . GLY B 1 239 ? 8.844   -1.282  93.380  1.00 26.16 ? 236 GLY B C     1 
ATOM   5113  O O     . GLY B 1 239 ? 7.842   -1.765  93.900  1.00 28.43 ? 236 GLY B O     1 
ATOM   5114  N N     . ALA B 1 240 ? 10.057  -1.701  93.685  1.00 25.80 ? 237 ALA B N     1 
ATOM   5115  C CA    . ALA B 1 240 ? 10.213  -2.724  94.697  1.00 24.94 ? 237 ALA B CA    1 
ATOM   5116  C C     . ALA B 1 240 ? 10.650  -2.041  95.982  1.00 24.54 ? 237 ALA B C     1 
ATOM   5117  O O     . ALA B 1 240 ? 11.349  -1.023  95.952  1.00 24.08 ? 237 ALA B O     1 
ATOM   5118  C CB    . ALA B 1 240 ? 11.249  -3.735  94.266  1.00 26.16 ? 237 ALA B CB    1 
ATOM   5119  N N     . ARG B 1 241 ? 10.206  -2.589  97.106  1.00 24.47 ? 238 ARG B N     1 
ATOM   5120  C CA    . ARG B 1 241 ? 10.564  -2.035  98.394  1.00 25.64 ? 238 ARG B CA    1 
ATOM   5121  C C     . ARG B 1 241 ? 11.897  -2.697  98.756  1.00 26.46 ? 238 ARG B C     1 
ATOM   5122  O O     . ARG B 1 241 ? 12.002  -3.927  98.823  1.00 26.78 ? 238 ARG B O     1 
ATOM   5123  C CB    . ARG B 1 241 ? 9.487   -2.340  99.433  1.00 25.71 ? 238 ARG B CB    1 
ATOM   5124  C CG    . ARG B 1 241 ? 9.688   -1.626  100.762 1.00 28.35 ? 238 ARG B CG    1 
ATOM   5125  C CD    . ARG B 1 241 ? 8.350   -1.345  101.462 1.00 29.26 ? 238 ARG B CD    1 
ATOM   5126  N NE    . ARG B 1 241 ? 7.571   -2.547  101.765 1.00 30.03 ? 238 ARG B NE    1 
ATOM   5127  C CZ    . ARG B 1 241 ? 7.752   -3.323  102.833 1.00 30.87 ? 238 ARG B CZ    1 
ATOM   5128  N NH1   . ARG B 1 241 ? 8.694   -3.043  103.727 1.00 28.23 ? 238 ARG B NH1   1 
ATOM   5129  N NH2   . ARG B 1 241 ? 6.966   -4.375  103.018 1.00 30.24 ? 238 ARG B NH2   1 
ATOM   5130  N N     . VAL B 1 242 ? 12.913  -1.868  98.970  1.00 24.29 ? 239 VAL B N     1 
ATOM   5131  C CA    . VAL B 1 242 ? 14.235  -2.362  99.278  1.00 23.03 ? 239 VAL B CA    1 
ATOM   5132  C C     . VAL B 1 242 ? 14.617  -2.247  100.750 1.00 24.37 ? 239 VAL B C     1 
ATOM   5133  O O     . VAL B 1 242 ? 14.607  -1.151  101.333 1.00 24.06 ? 239 VAL B O     1 
ATOM   5134  C CB    . VAL B 1 242 ? 15.299  -1.627  98.452  1.00 22.51 ? 239 VAL B CB    1 
ATOM   5135  C CG1   . VAL B 1 242 ? 16.671  -2.239  98.704  1.00 20.03 ? 239 VAL B CG1   1 
ATOM   5136  C CG2   . VAL B 1 242 ? 14.937  -1.688  96.959  1.00 21.68 ? 239 VAL B CG2   1 
ATOM   5137  N N     . ILE B 1 243 ? 14.951  -3.389  101.344 1.00 21.85 ? 240 ILE B N     1 
ATOM   5138  C CA    . ILE B 1 243 ? 15.386  -3.433  102.725 1.00 20.28 ? 240 ILE B CA    1 
ATOM   5139  C C     . ILE B 1 243 ? 16.886  -3.720  102.637 1.00 20.56 ? 240 ILE B C     1 
ATOM   5140  O O     . ILE B 1 243 ? 17.323  -4.588  101.863 1.00 20.88 ? 240 ILE B O     1 
ATOM   5141  C CB    . ILE B 1 243 ? 14.682  -4.556  103.499 1.00 20.58 ? 240 ILE B CB    1 
ATOM   5142  C CG1   . ILE B 1 243 ? 13.175  -4.326  103.487 1.00 18.88 ? 240 ILE B CG1   1 
ATOM   5143  C CG2   . ILE B 1 243 ? 15.162  -4.572  104.947 1.00 21.02 ? 240 ILE B CG2   1 
ATOM   5144  C CD1   . ILE B 1 243 ? 12.393  -5.419  104.189 1.00 22.28 ? 240 ILE B CD1   1 
ATOM   5145  N N     . ILE B 1 244 ? 17.672  -2.984  103.414 1.00 19.68 ? 241 ILE B N     1 
ATOM   5146  C CA    . ILE B 1 244 ? 19.125  -3.125  103.405 1.00 19.90 ? 241 ILE B CA    1 
ATOM   5147  C C     . ILE B 1 244 ? 19.632  -3.808  104.683 1.00 22.94 ? 241 ILE B C     1 
ATOM   5148  O O     . ILE B 1 244 ? 18.948  -3.780  105.715 1.00 22.54 ? 241 ILE B O     1 
ATOM   5149  C CB    . ILE B 1 244 ? 19.791  -1.738  103.319 1.00 19.25 ? 241 ILE B CB    1 
ATOM   5150  C CG1   . ILE B 1 244 ? 19.305  -0.993  102.061 1.00 19.70 ? 241 ILE B CG1   1 
ATOM   5151  C CG2   . ILE B 1 244 ? 21.298  -1.871  103.432 1.00 15.92 ? 241 ILE B CG2   1 
ATOM   5152  C CD1   . ILE B 1 244 ? 19.742  -1.580  100.740 1.00 20.47 ? 241 ILE B CD1   1 
ATOM   5153  N N     . THR B 1 245 ? 20.817  -4.421  104.603 1.00 23.68 ? 242 THR B N     1 
ATOM   5154  C CA    . THR B 1 245 ? 21.465  -5.062  105.750 1.00 27.07 ? 242 THR B CA    1 
ATOM   5155  C C     . THR B 1 245 ? 22.944  -4.644  105.695 1.00 29.53 ? 242 THR B C     1 
ATOM   5156  O O     . THR B 1 245 ? 23.615  -4.892  104.692 1.00 31.76 ? 242 THR B O     1 
ATOM   5157  C CB    . THR B 1 245 ? 21.369  -6.616  105.693 1.00 27.79 ? 242 THR B CB    1 
ATOM   5158  O OG1   . THR B 1 245 ? 22.054  -7.102  104.529 1.00 30.66 ? 242 THR B OG1   1 
ATOM   5159  C CG2   . THR B 1 245 ? 19.909  -7.073  105.656 1.00 25.85 ? 242 THR B CG2   1 
ATOM   5160  N N     . GLU B 1 246 ? 23.455  -4.003  106.745 1.00 29.62 ? 243 GLU B N     1 
ATOM   5161  C CA    . GLU B 1 246 ? 24.857  -3.563  106.743 1.00 31.43 ? 243 GLU B CA    1 
ATOM   5162  C C     . GLU B 1 246 ? 25.556  -3.817  108.067 1.00 32.88 ? 243 GLU B C     1 
ATOM   5163  O O     . GLU B 1 246 ? 24.908  -4.043  109.095 1.00 34.09 ? 243 GLU B O     1 
ATOM   5164  C CB    . GLU B 1 246 ? 24.954  -2.061  106.439 1.00 31.80 ? 243 GLU B CB    1 
ATOM   5165  C CG    . GLU B 1 246 ? 25.331  -1.672  105.014 1.00 33.29 ? 243 GLU B CG    1 
ATOM   5166  C CD    . GLU B 1 246 ? 26.777  -1.975  104.678 1.00 35.79 ? 243 GLU B CD    1 
ATOM   5167  O OE1   . GLU B 1 246 ? 27.526  -2.349  105.599 1.00 38.76 ? 243 GLU B OE1   1 
ATOM   5168  O OE2   . GLU B 1 246 ? 27.170  -1.832  103.493 1.00 36.70 ? 243 GLU B OE2   1 
ATOM   5169  N N     . ILE B 1 247 ? 26.885  -3.776  108.032 1.00 32.03 ? 244 ILE B N     1 
ATOM   5170  C CA    . ILE B 1 247 ? 27.687  -3.953  109.229 1.00 32.78 ? 244 ILE B CA    1 
ATOM   5171  C C     . ILE B 1 247 ? 28.426  -2.640  109.490 1.00 34.80 ? 244 ILE B C     1 
ATOM   5172  O O     . ILE B 1 247 ? 28.832  -2.360  110.618 1.00 36.70 ? 244 ILE B O     1 
ATOM   5173  C CB    . ILE B 1 247 ? 28.702  -5.124  109.084 1.00 31.96 ? 244 ILE B CB    1 
ATOM   5174  C CG1   . ILE B 1 247 ? 29.575  -4.936  107.845 1.00 31.51 ? 244 ILE B CG1   1 
ATOM   5175  C CG2   . ILE B 1 247 ? 27.967  -6.437  108.995 1.00 33.04 ? 244 ILE B CG2   1 
ATOM   5176  C CD1   . ILE B 1 247 ? 30.862  -4.203  108.093 1.00 29.84 ? 244 ILE B CD1   1 
ATOM   5177  N N     . ASP B 1 248 ? 28.599  -1.833  108.446 1.00 34.69 ? 245 ASP B N     1 
ATOM   5178  C CA    . ASP B 1 248 ? 29.270  -0.547  108.584 1.00 34.87 ? 245 ASP B CA    1 
ATOM   5179  C C     . ASP B 1 248 ? 28.204  0.511   108.896 1.00 35.40 ? 245 ASP B C     1 
ATOM   5180  O O     . ASP B 1 248 ? 27.279  0.715   108.110 1.00 35.85 ? 245 ASP B O     1 
ATOM   5181  C CB    . ASP B 1 248 ? 30.010  -0.198  107.291 1.00 35.94 ? 245 ASP B CB    1 
ATOM   5182  C CG    . ASP B 1 248 ? 30.892  1.039   107.437 1.00 37.32 ? 245 ASP B CG    1 
ATOM   5183  O OD1   . ASP B 1 248 ? 30.391  2.071   107.928 1.00 39.03 ? 245 ASP B OD1   1 
ATOM   5184  O OD2   . ASP B 1 248 ? 32.084  0.986   107.055 1.00 37.07 ? 245 ASP B OD2   1 
ATOM   5185  N N     . PRO B 1 249 ? 28.318  1.190   110.053 1.00 34.39 ? 246 PRO B N     1 
ATOM   5186  C CA    . PRO B 1 249 ? 27.345  2.216   110.438 1.00 33.21 ? 246 PRO B CA    1 
ATOM   5187  C C     . PRO B 1 249 ? 27.262  3.373   109.450 1.00 31.02 ? 246 PRO B C     1 
ATOM   5188  O O     . PRO B 1 249 ? 26.203  3.960   109.261 1.00 32.58 ? 246 PRO B O     1 
ATOM   5189  C CB    . PRO B 1 249 ? 27.825  2.649   111.826 1.00 32.94 ? 246 PRO B CB    1 
ATOM   5190  C CG    . PRO B 1 249 ? 29.294  2.468   111.737 1.00 35.40 ? 246 PRO B CG    1 
ATOM   5191  C CD    . PRO B 1 249 ? 29.416  1.128   111.032 1.00 35.50 ? 246 PRO B CD    1 
ATOM   5192  N N     . ILE B 1 250 ? 28.378  3.704   108.819 1.00 30.10 ? 247 ILE B N     1 
ATOM   5193  C CA    . ILE B 1 250 ? 28.374  4.785   107.851 1.00 29.47 ? 247 ILE B CA    1 
ATOM   5194  C C     . ILE B 1 250 ? 27.528  4.388   106.637 1.00 31.00 ? 247 ILE B C     1 
ATOM   5195  O O     . ILE B 1 250 ? 26.636  5.129   106.223 1.00 32.36 ? 247 ILE B O     1 
ATOM   5196  C CB    . ILE B 1 250 ? 29.794  5.137   107.403 1.00 27.68 ? 247 ILE B CB    1 
ATOM   5197  C CG1   . ILE B 1 250 ? 30.620  5.597   108.612 1.00 26.77 ? 247 ILE B CG1   1 
ATOM   5198  C CG2   . ILE B 1 250 ? 29.747  6.225   106.354 1.00 27.55 ? 247 ILE B CG2   1 
ATOM   5199  C CD1   . ILE B 1 250 ? 31.945  6.225   108.250 1.00 20.87 ? 247 ILE B CD1   1 
ATOM   5200  N N     . ASN B 1 251 ? 27.800  3.219   106.066 1.00 30.18 ? 248 ASN B N     1 
ATOM   5201  C CA    . ASN B 1 251 ? 27.025  2.758   104.924 1.00 29.66 ? 248 ASN B CA    1 
ATOM   5202  C C     . ASN B 1 251 ? 25.561  2.615   105.319 1.00 30.24 ? 248 ASN B C     1 
ATOM   5203  O O     . ASN B 1 251 ? 24.666  2.927   104.538 1.00 32.01 ? 248 ASN B O     1 
ATOM   5204  C CB    . ASN B 1 251 ? 27.536  1.410   104.427 1.00 29.54 ? 248 ASN B CB    1 
ATOM   5205  C CG    . ASN B 1 251 ? 28.853  1.522   103.705 1.00 29.89 ? 248 ASN B CG    1 
ATOM   5206  O OD1   . ASN B 1 251 ? 28.929  1.274   102.504 1.00 32.23 ? 248 ASN B OD1   1 
ATOM   5207  N ND2   . ASN B 1 251 ? 29.899  1.900   104.425 1.00 29.60 ? 248 ASN B ND2   1 
ATOM   5208  N N     . ALA B 1 252 ? 25.318  2.142   106.535 1.00 29.32 ? 249 ALA B N     1 
ATOM   5209  C CA    . ALA B 1 252 ? 23.965  1.942   107.011 1.00 28.77 ? 249 ALA B CA    1 
ATOM   5210  C C     . ALA B 1 252 ? 23.205  3.265   107.132 1.00 29.52 ? 249 ALA B C     1 
ATOM   5211  O O     . ALA B 1 252 ? 22.018  3.331   106.810 1.00 30.22 ? 249 ALA B O     1 
ATOM   5212  C CB    . ALA B 1 252 ? 23.988  1.202   108.359 1.00 29.80 ? 249 ALA B CB    1 
ATOM   5213  N N     . LEU B 1 253 ? 23.875  4.314   107.599 1.00 28.69 ? 250 LEU B N     1 
ATOM   5214  C CA    . LEU B 1 253 ? 23.216  5.608   107.734 1.00 28.50 ? 250 LEU B CA    1 
ATOM   5215  C C     . LEU B 1 253 ? 22.919  6.162   106.342 1.00 28.23 ? 250 LEU B C     1 
ATOM   5216  O O     . LEU B 1 253 ? 21.884  6.790   106.111 1.00 28.22 ? 250 LEU B O     1 
ATOM   5217  C CB    . LEU B 1 253 ? 24.104  6.591   108.508 1.00 28.53 ? 250 LEU B CB    1 
ATOM   5218  C CG    . LEU B 1 253 ? 23.497  7.962   108.797 1.00 27.25 ? 250 LEU B CG    1 
ATOM   5219  C CD1   . LEU B 1 253 ? 22.166  7.792   109.513 1.00 27.51 ? 250 LEU B CD1   1 
ATOM   5220  C CD2   . LEU B 1 253 ? 24.456  8.771   109.651 1.00 27.56 ? 250 LEU B CD2   1 
ATOM   5221  N N     . GLN B 1 254 ? 23.826  5.925   105.406 1.00 26.17 ? 251 GLN B N     1 
ATOM   5222  C CA    . GLN B 1 254 ? 23.595  6.398   104.055 1.00 26.01 ? 251 GLN B CA    1 
ATOM   5223  C C     . GLN B 1 254 ? 22.292  5.819   103.516 1.00 25.22 ? 251 GLN B C     1 
ATOM   5224  O O     . GLN B 1 254 ? 21.458  6.539   102.986 1.00 24.95 ? 251 GLN B O     1 
ATOM   5225  C CB    . GLN B 1 254 ? 24.732  5.983   103.139 1.00 26.26 ? 251 GLN B CB    1 
ATOM   5226  C CG    . GLN B 1 254 ? 25.951  6.845   103.229 1.00 26.04 ? 251 GLN B CG    1 
ATOM   5227  C CD    . GLN B 1 254 ? 26.988  6.406   102.234 1.00 27.07 ? 251 GLN B CD    1 
ATOM   5228  O OE1   . GLN B 1 254 ? 27.526  7.221   101.467 1.00 25.29 ? 251 GLN B OE1   1 
ATOM   5229  N NE2   . GLN B 1 254 ? 27.276  5.104   102.226 1.00 25.99 ? 251 GLN B NE2   1 
ATOM   5230  N N     . ALA B 1 255 ? 22.112  4.515   103.671 1.00 23.47 ? 252 ALA B N     1 
ATOM   5231  C CA    . ALA B 1 255 ? 20.909  3.864   103.170 1.00 24.14 ? 252 ALA B CA    1 
ATOM   5232  C C     . ALA B 1 255 ? 19.653  4.401   103.807 1.00 23.59 ? 252 ALA B C     1 
ATOM   5233  O O     . ALA B 1 255 ? 18.632  4.576   103.141 1.00 23.77 ? 252 ALA B O     1 
ATOM   5234  C CB    . ALA B 1 255 ? 20.994  2.365   103.394 1.00 24.42 ? 252 ALA B CB    1 
ATOM   5235  N N     . ALA B 1 256 ? 19.729  4.632   105.112 1.00 25.17 ? 253 ALA B N     1 
ATOM   5236  C CA    . ALA B 1 256 ? 18.594  5.136   105.865 1.00 23.74 ? 253 ALA B CA    1 
ATOM   5237  C C     . ALA B 1 256 ? 18.258  6.567   105.424 1.00 24.39 ? 253 ALA B C     1 
ATOM   5238  O O     . ALA B 1 256 ? 17.087  6.937   105.363 1.00 23.11 ? 253 ALA B O     1 
ATOM   5239  C CB    . ALA B 1 256 ? 18.900  5.071   107.352 1.00 21.57 ? 253 ALA B CB    1 
ATOM   5240  N N     . MET B 1 257 ? 19.288  7.356   105.110 1.00 25.75 ? 254 MET B N     1 
ATOM   5241  C CA    . MET B 1 257 ? 19.118  8.742   104.659 1.00 27.72 ? 254 MET B CA    1 
ATOM   5242  C C     . MET B 1 257 ? 18.573  8.769   103.224 1.00 29.68 ? 254 MET B C     1 
ATOM   5243  O O     . MET B 1 257 ? 18.172  9.816   102.721 1.00 29.17 ? 254 MET B O     1 
ATOM   5244  C CB    . MET B 1 257 ? 20.454  9.493   104.693 1.00 28.96 ? 254 MET B CB    1 
ATOM   5245  C CG    . MET B 1 257 ? 21.061  9.702   106.076 1.00 31.41 ? 254 MET B CG    1 
ATOM   5246  S SD    . MET B 1 257 ? 20.069  10.779  107.141 1.00 34.40 ? 254 MET B SD    1 
ATOM   5247  C CE    . MET B 1 257 ? 20.462  12.428  106.450 1.00 29.14 ? 254 MET B CE    1 
ATOM   5248  N N     . GLU B 1 258 ? 18.574  7.607   102.576 1.00 31.08 ? 255 GLU B N     1 
ATOM   5249  C CA    . GLU B 1 258 ? 18.077  7.470   101.218 1.00 33.47 ? 255 GLU B CA    1 
ATOM   5250  C C     . GLU B 1 258 ? 16.677  6.885   101.227 1.00 34.12 ? 255 GLU B C     1 
ATOM   5251  O O     . GLU B 1 258 ? 16.047  6.752   100.178 1.00 35.77 ? 255 GLU B O     1 
ATOM   5252  C CB    . GLU B 1 258 ? 18.994  6.570   100.398 1.00 34.33 ? 255 GLU B CB    1 
ATOM   5253  C CG    . GLU B 1 258 ? 20.399  7.088   100.296 1.00 36.21 ? 255 GLU B CG    1 
ATOM   5254  C CD    . GLU B 1 258 ? 20.499  8.343   99.445  1.00 38.80 ? 255 GLU B CD    1 
ATOM   5255  O OE1   . GLU B 1 258 ? 19.450  8.979   99.169  1.00 37.75 ? 255 GLU B OE1   1 
ATOM   5256  O OE2   . GLU B 1 258 ? 21.640  8.695   99.063  1.00 39.08 ? 255 GLU B OE2   1 
ATOM   5257  N N     . GLY B 1 259 ? 16.192  6.528   102.412 1.00 33.12 ? 256 GLY B N     1 
ATOM   5258  C CA    . GLY B 1 259 ? 14.846  5.993   102.516 1.00 31.68 ? 256 GLY B CA    1 
ATOM   5259  C C     . GLY B 1 259 ? 14.734  4.490   102.634 1.00 30.36 ? 256 GLY B C     1 
ATOM   5260  O O     . GLY B 1 259 ? 13.635  3.949   102.583 1.00 31.59 ? 256 GLY B O     1 
ATOM   5261  N N     . TYR B 1 260 ? 15.863  3.809   102.792 1.00 29.40 ? 257 TYR B N     1 
ATOM   5262  C CA    . TYR B 1 260 ? 15.855  2.354   102.916 1.00 29.15 ? 257 TYR B CA    1 
ATOM   5263  C C     . TYR B 1 260 ? 15.784  1.895   104.374 1.00 29.87 ? 257 TYR B C     1 
ATOM   5264  O O     . TYR B 1 260 ? 16.452  2.451   105.244 1.00 29.07 ? 257 TYR B O     1 
ATOM   5265  C CB    . TYR B 1 260 ? 17.123  1.769   102.294 1.00 27.53 ? 257 TYR B CB    1 
ATOM   5266  C CG    . TYR B 1 260 ? 17.291  2.009   100.818 1.00 24.43 ? 257 TYR B CG    1 
ATOM   5267  C CD1   . TYR B 1 260 ? 16.526  1.318   99.887  1.00 24.53 ? 257 TYR B CD1   1 
ATOM   5268  C CD2   . TYR B 1 260 ? 18.243  2.912   100.351 1.00 23.46 ? 257 TYR B CD2   1 
ATOM   5269  C CE1   . TYR B 1 260 ? 16.709  1.521   98.520  1.00 24.85 ? 257 TYR B CE1   1 
ATOM   5270  C CE2   . TYR B 1 260 ? 18.434  3.123   99.001  1.00 22.78 ? 257 TYR B CE2   1 
ATOM   5271  C CZ    . TYR B 1 260 ? 17.667  2.426   98.083  1.00 24.33 ? 257 TYR B CZ    1 
ATOM   5272  O OH    . TYR B 1 260 ? 17.863  2.639   96.736  1.00 22.85 ? 257 TYR B OH    1 
ATOM   5273  N N     . GLU B 1 261 ? 14.981  0.870   104.636 1.00 31.88 ? 258 GLU B N     1 
ATOM   5274  C CA    . GLU B 1 261 ? 14.884  0.316   105.986 1.00 34.36 ? 258 GLU B CA    1 
ATOM   5275  C C     . GLU B 1 261 ? 16.167  -0.510  106.160 1.00 34.78 ? 258 GLU B C     1 
ATOM   5276  O O     . GLU B 1 261 ? 16.613  -1.152  105.212 1.00 35.44 ? 258 GLU B O     1 
ATOM   5277  C CB    . GLU B 1 261 ? 13.658  -0.602  106.096 1.00 35.99 ? 258 GLU B CB    1 
ATOM   5278  C CG    . GLU B 1 261 ? 13.359  -1.127  107.505 1.00 36.87 ? 258 GLU B CG    1 
ATOM   5279  C CD    . GLU B 1 261 ? 12.348  -2.280  107.517 1.00 38.89 ? 258 GLU B CD    1 
ATOM   5280  O OE1   . GLU B 1 261 ? 11.673  -2.508  106.482 1.00 40.55 ? 258 GLU B OE1   1 
ATOM   5281  O OE2   . GLU B 1 261 ? 12.223  -2.954  108.566 1.00 37.95 ? 258 GLU B OE2   1 
ATOM   5282  N N     . VAL B 1 262 ? 16.766  -0.493  107.349 1.00 34.63 ? 259 VAL B N     1 
ATOM   5283  C CA    . VAL B 1 262 ? 17.995  -1.260  107.578 1.00 35.14 ? 259 VAL B CA    1 
ATOM   5284  C C     . VAL B 1 262 ? 17.918  -2.190  108.805 1.00 36.24 ? 259 VAL B C     1 
ATOM   5285  O O     . VAL B 1 262 ? 17.989  -1.725  109.946 1.00 39.29 ? 259 VAL B O     1 
ATOM   5286  C CB    . VAL B 1 262 ? 19.206  -0.317  107.764 1.00 34.38 ? 259 VAL B CB    1 
ATOM   5287  C CG1   . VAL B 1 262 ? 20.499  -1.120  107.790 1.00 33.17 ? 259 VAL B CG1   1 
ATOM   5288  C CG2   . VAL B 1 262 ? 19.236  0.713   106.654 1.00 35.90 ? 259 VAL B CG2   1 
ATOM   5289  N N     . THR B 1 263 ? 17.765  -3.494  108.570 1.00 33.54 ? 260 THR B N     1 
ATOM   5290  C CA    . THR B 1 263 ? 17.700  -4.483  109.655 1.00 32.16 ? 260 THR B CA    1 
ATOM   5291  C C     . THR B 1 263 ? 18.663  -5.620  109.391 1.00 31.51 ? 260 THR B C     1 
ATOM   5292  O O     . THR B 1 263 ? 19.539  -5.526  108.529 1.00 28.59 ? 260 THR B O     1 
ATOM   5293  C CB    . THR B 1 263 ? 16.329  -5.157  109.794 1.00 32.19 ? 260 THR B CB    1 
ATOM   5294  O OG1   . THR B 1 263 ? 15.702  -5.223  108.503 1.00 32.82 ? 260 THR B OG1   1 
ATOM   5295  C CG2   . THR B 1 263 ? 15.462  -4.438  110.789 1.00 33.42 ? 260 THR B CG2   1 
ATOM   5296  N N     . THR B 1 264 ? 18.470  -6.716  110.117 1.00 30.13 ? 261 THR B N     1 
ATOM   5297  C CA    . THR B 1 264 ? 19.334  -7.868  109.940 1.00 30.82 ? 261 THR B CA    1 
ATOM   5298  C C     . THR B 1 264 ? 18.700  -8.899  108.993 1.00 29.99 ? 261 THR B C     1 
ATOM   5299  O O     . THR B 1 264 ? 17.495  -8.869  108.728 1.00 26.67 ? 261 THR B O     1 
ATOM   5300  C CB    . THR B 1 264 ? 19.680  -8.520  111.319 1.00 32.38 ? 261 THR B CB    1 
ATOM   5301  O OG1   . THR B 1 264 ? 18.487  -8.971  111.978 1.00 34.10 ? 261 THR B OG1   1 
ATOM   5302  C CG2   . THR B 1 264 ? 20.391  -7.511  112.210 1.00 31.53 ? 261 THR B CG2   1 
ATOM   5303  N N     . MET B 1 265 ? 19.526  -9.794  108.468 1.00 30.97 ? 262 MET B N     1 
ATOM   5304  C CA    . MET B 1 265 ? 19.040  -10.831 107.574 1.00 32.85 ? 262 MET B CA    1 
ATOM   5305  C C     . MET B 1 265 ? 18.120  -11.742 108.367 1.00 33.51 ? 262 MET B C     1 
ATOM   5306  O O     . MET B 1 265 ? 17.174  -12.310 107.812 1.00 32.48 ? 262 MET B O     1 
ATOM   5307  C CB    . MET B 1 265 ? 20.205  -11.648 107.003 1.00 33.12 ? 262 MET B CB    1 
ATOM   5308  C CG    . MET B 1 265 ? 19.805  -12.647 105.922 1.00 32.27 ? 262 MET B CG    1 
ATOM   5309  S SD    . MET B 1 265 ? 19.079  -11.837 104.451 1.00 34.53 ? 262 MET B SD    1 
ATOM   5310  C CE    . MET B 1 265 ? 20.551  -11.017 103.696 1.00 31.14 ? 262 MET B CE    1 
ATOM   5311  N N     . ASP B 1 266 ? 18.387  -11.873 109.666 1.00 34.31 ? 263 ASP B N     1 
ATOM   5312  C CA    . ASP B 1 266 ? 17.558  -12.729 110.512 1.00 35.22 ? 263 ASP B CA    1 
ATOM   5313  C C     . ASP B 1 266 ? 16.150  -12.161 110.536 1.00 35.74 ? 263 ASP B C     1 
ATOM   5314  O O     . ASP B 1 266 ? 15.174  -12.866 110.795 1.00 35.94 ? 263 ASP B O     1 
ATOM   5315  C CB    . ASP B 1 266 ? 18.112  -12.794 111.943 1.00 36.54 ? 263 ASP B CB    1 
ATOM   5316  C CG    . ASP B 1 266 ? 19.561  -13.251 111.995 1.00 38.35 ? 263 ASP B CG    1 
ATOM   5317  O OD1   . ASP B 1 266 ? 19.860  -14.375 111.537 1.00 37.72 ? 263 ASP B OD1   1 
ATOM   5318  O OD2   . ASP B 1 266 ? 20.407  -12.475 112.493 1.00 41.13 ? 263 ASP B OD2   1 
ATOM   5319  N N     . GLU B 1 267 ? 16.049  -10.869 110.265 1.00 36.47 ? 264 GLU B N     1 
ATOM   5320  C CA    . GLU B 1 267 ? 14.753  -10.209 110.247 1.00 37.48 ? 264 GLU B CA    1 
ATOM   5321  C C     . GLU B 1 267 ? 14.195  -10.177 108.823 1.00 35.55 ? 264 GLU B C     1 
ATOM   5322  O O     . GLU B 1 267 ? 13.068  -10.594 108.575 1.00 33.96 ? 264 GLU B O     1 
ATOM   5323  C CB    . GLU B 1 267 ? 14.905  -8.783  110.790 1.00 41.57 ? 264 GLU B CB    1 
ATOM   5324  C CG    . GLU B 1 267 ? 14.641  -8.657  112.273 1.00 43.93 ? 264 GLU B CG    1 
ATOM   5325  C CD    . GLU B 1 267 ? 13.311  -7.976  112.533 1.00 48.07 ? 264 GLU B CD    1 
ATOM   5326  O OE1   . GLU B 1 267 ? 13.223  -6.742  112.305 1.00 48.06 ? 264 GLU B OE1   1 
ATOM   5327  O OE2   . GLU B 1 267 ? 12.354  -8.677  112.940 1.00 48.30 ? 264 GLU B OE2   1 
ATOM   5328  N N     . ALA B 1 268 ? 15.024  -9.696  107.900 1.00 34.60 ? 265 ALA B N     1 
ATOM   5329  C CA    . ALA B 1 268 ? 14.684  -9.561  106.482 1.00 34.08 ? 265 ALA B CA    1 
ATOM   5330  C C     . ALA B 1 268 ? 14.356  -10.866 105.764 1.00 33.14 ? 265 ALA B C     1 
ATOM   5331  O O     . ALA B 1 268 ? 13.587  -10.867 104.810 1.00 33.24 ? 265 ALA B O     1 
ATOM   5332  C CB    . ALA B 1 268 ? 15.830  -8.851  105.750 1.00 32.47 ? 265 ALA B CB    1 
ATOM   5333  N N     . CYS B 1 269 ? 14.947  -11.969 106.209 1.00 32.48 ? 266 CYS B N     1 
ATOM   5334  C CA    . CYS B 1 269 ? 14.688  -13.255 105.571 1.00 32.42 ? 266 CYS B CA    1 
ATOM   5335  C C     . CYS B 1 269 ? 13.223  -13.624 105.721 1.00 32.82 ? 266 CYS B C     1 
ATOM   5336  O O     . CYS B 1 269 ? 12.768  -14.617 105.174 1.00 33.60 ? 266 CYS B O     1 
ATOM   5337  C CB    . CYS B 1 269 ? 15.555  -14.361 106.186 1.00 31.89 ? 266 CYS B CB    1 
ATOM   5338  S SG    . CYS B 1 269 ? 15.215  -14.728 107.931 1.00 31.50 ? 266 CYS B SG    1 
ATOM   5339  N N     . GLN B 1 270 ? 12.483  -12.820 106.471 1.00 32.38 ? 267 GLN B N     1 
ATOM   5340  C CA    . GLN B 1 270 ? 11.073  -13.098 106.676 1.00 31.93 ? 267 GLN B CA    1 
ATOM   5341  C C     . GLN B 1 270 ? 10.186  -12.258 105.794 1.00 31.17 ? 267 GLN B C     1 
ATOM   5342  O O     . GLN B 1 270 ? 8.998   -12.532 105.669 1.00 31.63 ? 267 GLN B O     1 
ATOM   5343  C CB    . GLN B 1 270 ? 10.705  -12.852 108.124 1.00 32.33 ? 267 GLN B CB    1 
ATOM   5344  C CG    . GLN B 1 270 ? 10.856  -14.067 109.007 1.00 35.00 ? 267 GLN B CG    1 
ATOM   5345  C CD    . GLN B 1 270 ? 10.856  -13.694 110.474 1.00 35.10 ? 267 GLN B CD    1 
ATOM   5346  O OE1   . GLN B 1 270 ? 11.904  -13.372 111.042 1.00 34.38 ? 267 GLN B OE1   1 
ATOM   5347  N NE2   . GLN B 1 270 ? 9.674   -13.708 111.093 1.00 32.62 ? 267 GLN B NE2   1 
ATOM   5348  N N     . GLU B 1 271 ? 10.770  -11.236 105.179 1.00 31.06 ? 268 GLU B N     1 
ATOM   5349  C CA    . GLU B 1 271 ? 10.013  -10.333 104.326 1.00 32.88 ? 268 GLU B CA    1 
ATOM   5350  C C     . GLU B 1 271 ? 10.427  -10.357 102.854 1.00 32.33 ? 268 GLU B C     1 
ATOM   5351  O O     . GLU B 1 271 ? 9.610   -10.084 101.978 1.00 33.62 ? 268 GLU B O     1 
ATOM   5352  C CB    . GLU B 1 271 ? 10.149  -8.906  104.848 1.00 35.40 ? 268 GLU B CB    1 
ATOM   5353  C CG    . GLU B 1 271 ? 9.576   -8.638  106.234 1.00 39.01 ? 268 GLU B CG    1 
ATOM   5354  C CD    . GLU B 1 271 ? 10.024  -7.286  106.774 1.00 40.96 ? 268 GLU B CD    1 
ATOM   5355  O OE1   . GLU B 1 271 ? 11.192  -7.187  107.219 1.00 41.95 ? 268 GLU B OE1   1 
ATOM   5356  O OE2   . GLU B 1 271 ? 9.223   -6.327  106.741 1.00 41.98 ? 268 GLU B OE2   1 
ATOM   5357  N N     . GLY B 1 272 ? 11.685  -10.690 102.585 1.00 30.24 ? 269 GLY B N     1 
ATOM   5358  C CA    . GLY B 1 272 ? 12.170  -10.693 101.216 1.00 29.50 ? 269 GLY B CA    1 
ATOM   5359  C C     . GLY B 1 272 ? 11.566  -11.652 100.200 1.00 28.66 ? 269 GLY B C     1 
ATOM   5360  O O     . GLY B 1 272 ? 11.442  -12.854 100.442 1.00 29.53 ? 269 GLY B O     1 
ATOM   5361  N N     . ASN B 1 273 ? 11.191  -11.103 99.047  1.00 27.35 ? 270 ASN B N     1 
ATOM   5362  C CA    . ASN B 1 273 ? 10.642  -11.878 97.938  1.00 24.19 ? 270 ASN B CA    1 
ATOM   5363  C C     . ASN B 1 273 ? 11.817  -12.077 96.991  1.00 23.13 ? 270 ASN B C     1 
ATOM   5364  O O     . ASN B 1 273 ? 11.847  -13.028 96.211  1.00 22.18 ? 270 ASN B O     1 
ATOM   5365  C CB    . ASN B 1 273 ? 9.543   -11.088 97.222  1.00 26.29 ? 270 ASN B CB    1 
ATOM   5366  C CG    . ASN B 1 273 ? 8.312   -10.880 98.085  1.00 28.37 ? 270 ASN B CG    1 
ATOM   5367  O OD1   . ASN B 1 273 ? 7.488   -11.782 98.246  1.00 28.79 ? 270 ASN B OD1   1 
ATOM   5368  N ND2   . ASN B 1 273 ? 8.188   -9.683  98.655  1.00 29.77 ? 270 ASN B ND2   1 
ATOM   5369  N N     . ILE B 1 274 ? 12.782  -11.161 97.093  1.00 20.28 ? 271 ILE B N     1 
ATOM   5370  C CA    . ILE B 1 274 ? 13.993  -11.164 96.272  1.00 19.82 ? 271 ILE B CA    1 
ATOM   5371  C C     . ILE B 1 274 ? 15.224  -10.867 97.145  1.00 20.70 ? 271 ILE B C     1 
ATOM   5372  O O     . ILE B 1 274 ? 15.230  -9.907  97.905  1.00 21.74 ? 271 ILE B O     1 
ATOM   5373  C CB    . ILE B 1 274 ? 13.896  -10.076 95.172  1.00 18.47 ? 271 ILE B CB    1 
ATOM   5374  C CG1   . ILE B 1 274 ? 12.630  -10.296 94.347  1.00 16.07 ? 271 ILE B CG1   1 
ATOM   5375  C CG2   . ILE B 1 274 ? 15.138  -10.086 94.293  1.00 16.60 ? 271 ILE B CG2   1 
ATOM   5376  C CD1   . ILE B 1 274 ? 12.489  -9.349  93.176  1.00 15.73 ? 271 ILE B CD1   1 
ATOM   5377  N N     . PHE B 1 275 ? 16.265  -11.686 97.037  1.00 21.87 ? 272 PHE B N     1 
ATOM   5378  C CA    . PHE B 1 275 ? 17.482  -11.485 97.826  1.00 19.49 ? 272 PHE B CA    1 
ATOM   5379  C C     . PHE B 1 275 ? 18.705  -11.322 96.934  1.00 20.19 ? 272 PHE B C     1 
ATOM   5380  O O     . PHE B 1 275 ? 18.959  -12.155 96.060  1.00 21.89 ? 272 PHE B O     1 
ATOM   5381  C CB    . PHE B 1 275 ? 17.708  -12.661 98.773  1.00 18.15 ? 272 PHE B CB    1 
ATOM   5382  C CG    . PHE B 1 275 ? 16.676  -12.774 99.852  1.00 18.79 ? 272 PHE B CG    1 
ATOM   5383  C CD1   . PHE B 1 275 ? 15.473  -13.432 99.620  1.00 20.43 ? 272 PHE B CD1   1 
ATOM   5384  C CD2   . PHE B 1 275 ? 16.897  -12.201 101.106 1.00 19.25 ? 272 PHE B CD2   1 
ATOM   5385  C CE1   . PHE B 1 275 ? 14.498  -13.518 100.622 1.00 21.35 ? 272 PHE B CE1   1 
ATOM   5386  C CE2   . PHE B 1 275 ? 15.941  -12.282 102.105 1.00 19.33 ? 272 PHE B CE2   1 
ATOM   5387  C CZ    . PHE B 1 275 ? 14.739  -12.940 101.866 1.00 20.46 ? 272 PHE B CZ    1 
ATOM   5388  N N     . VAL B 1 276 ? 19.466  -10.253 97.160  1.00 19.10 ? 273 VAL B N     1 
ATOM   5389  C CA    . VAL B 1 276 ? 20.670  -9.975  96.382  1.00 17.50 ? 273 VAL B CA    1 
ATOM   5390  C C     . VAL B 1 276 ? 21.828  -9.689  97.334  1.00 19.16 ? 273 VAL B C     1 
ATOM   5391  O O     . VAL B 1 276 ? 21.769  -8.732  98.102  1.00 20.54 ? 273 VAL B O     1 
ATOM   5392  C CB    . VAL B 1 276 ? 20.453  -8.733  95.456  1.00 18.86 ? 273 VAL B CB    1 
ATOM   5393  C CG1   . VAL B 1 276 ? 21.711  -8.424  94.679  1.00 13.26 ? 273 VAL B CG1   1 
ATOM   5394  C CG2   . VAL B 1 276 ? 19.280  -8.979  94.512  1.00 16.87 ? 273 VAL B CG2   1 
ATOM   5395  N N     . THR B 1 277 ? 22.879  -10.506 97.285  1.00 19.06 ? 274 THR B N     1 
ATOM   5396  C CA    . THR B 1 277 ? 24.032  -10.306 98.171  1.00 18.22 ? 274 THR B CA    1 
ATOM   5397  C C     . THR B 1 277 ? 25.164  -9.569  97.478  1.00 18.11 ? 274 THR B C     1 
ATOM   5398  O O     . THR B 1 277 ? 25.687  -10.038 96.462  1.00 19.06 ? 274 THR B O     1 
ATOM   5399  C CB    . THR B 1 277 ? 24.589  -11.646 98.686  1.00 20.47 ? 274 THR B CB    1 
ATOM   5400  O OG1   . THR B 1 277 ? 24.956  -12.475 97.574  1.00 21.07 ? 274 THR B OG1   1 
ATOM   5401  C CG2   . THR B 1 277 ? 23.547  -12.361 99.525  1.00 16.09 ? 274 THR B CG2   1 
ATOM   5402  N N     . THR B 1 278 ? 25.546  -8.419  98.027  1.00 17.01 ? 275 THR B N     1 
ATOM   5403  C CA    . THR B 1 278 ? 26.621  -7.598  97.458  1.00 19.03 ? 275 THR B CA    1 
ATOM   5404  C C     . THR B 1 278 ? 27.777  -7.475  98.441  1.00 22.95 ? 275 THR B C     1 
ATOM   5405  O O     . THR B 1 278 ? 28.729  -6.720  98.222  1.00 22.17 ? 275 THR B O     1 
ATOM   5406  C CB    . THR B 1 278 ? 26.155  -6.183  97.161  1.00 17.81 ? 275 THR B CB    1 
ATOM   5407  O OG1   . THR B 1 278 ? 25.899  -5.512  98.401  1.00 14.68 ? 275 THR B OG1   1 
ATOM   5408  C CG2   . THR B 1 278 ? 24.902  -6.199  96.320  1.00 16.55 ? 275 THR B CG2   1 
ATOM   5409  N N     . THR B 1 279 ? 27.648  -8.189  99.552  1.00 26.90 ? 276 THR B N     1 
ATOM   5410  C CA    . THR B 1 279 ? 28.662  -8.216  100.603 1.00 30.41 ? 276 THR B CA    1 
ATOM   5411  C C     . THR B 1 279 ? 29.918  -8.780  99.982  1.00 32.62 ? 276 THR B C     1 
ATOM   5412  O O     . THR B 1 279 ? 29.853  -9.427  98.944  1.00 35.70 ? 276 THR B O     1 
ATOM   5413  C CB    . THR B 1 279 ? 28.209  -9.172  101.733 1.00 30.25 ? 276 THR B CB    1 
ATOM   5414  O OG1   . THR B 1 279 ? 27.216  -8.522  102.539 1.00 31.06 ? 276 THR B OG1   1 
ATOM   5415  C CG2   . THR B 1 279 ? 29.375  -9.630  102.564 1.00 27.98 ? 276 THR B CG2   1 
ATOM   5416  N N     . GLY B 1 280 ? 31.070  -8.532  100.572 1.00 32.95 ? 277 GLY B N     1 
ATOM   5417  C CA    . GLY B 1 280 ? 32.247  -9.130  99.981  1.00 36.41 ? 277 GLY B CA    1 
ATOM   5418  C C     . GLY B 1 280 ? 32.633  -10.378 100.761 1.00 36.48 ? 277 GLY B C     1 
ATOM   5419  O O     . GLY B 1 280 ? 33.640  -11.007 100.459 1.00 37.38 ? 277 GLY B O     1 
ATOM   5420  N N     . CYS B 1 281 ? 31.849  -10.751 101.767 1.00 37.59 ? 278 CYS B N     1 
ATOM   5421  C CA    . CYS B 1 281 ? 32.225  -11.911 102.560 1.00 37.82 ? 278 CYS B CA    1 
ATOM   5422  C C     . CYS B 1 281 ? 31.234  -13.061 102.596 1.00 38.36 ? 278 CYS B C     1 
ATOM   5423  O O     . CYS B 1 281 ? 30.159  -13.003 101.997 1.00 38.35 ? 278 CYS B O     1 
ATOM   5424  C CB    . CYS B 1 281 ? 32.576  -11.482 104.001 1.00 38.45 ? 278 CYS B CB    1 
ATOM   5425  S SG    . CYS B 1 281 ? 31.240  -11.404 105.198 1.00 34.24 ? 278 CYS B SG    1 
ATOM   5426  N N     . ILE B 1 282 ? 31.627  -14.105 103.323 1.00 39.96 ? 279 ILE B N     1 
ATOM   5427  C CA    . ILE B 1 282 ? 30.857  -15.339 103.480 1.00 39.83 ? 279 ILE B CA    1 
ATOM   5428  C C     . ILE B 1 282 ? 29.715  -15.291 104.493 1.00 38.68 ? 279 ILE B C     1 
ATOM   5429  O O     . ILE B 1 282 ? 29.572  -14.340 105.252 1.00 39.59 ? 279 ILE B O     1 
ATOM   5430  C CB    . ILE B 1 282 ? 31.787  -16.507 103.901 1.00 40.57 ? 279 ILE B CB    1 
ATOM   5431  C CG1   . ILE B 1 282 ? 32.353  -16.237 105.301 1.00 41.77 ? 279 ILE B CG1   1 
ATOM   5432  C CG2   . ILE B 1 282 ? 32.936  -16.664 102.899 1.00 39.04 ? 279 ILE B CG2   1 
ATOM   5433  C CD1   . ILE B 1 282 ? 33.215  -17.351 105.846 1.00 45.61 ? 279 ILE B CD1   1 
ATOM   5434  N N     . ASP B 1 283 ? 28.912  -16.350 104.483 1.00 37.99 ? 280 ASP B N     1 
ATOM   5435  C CA    . ASP B 1 283 ? 27.782  -16.520 105.389 1.00 38.03 ? 280 ASP B CA    1 
ATOM   5436  C C     . ASP B 1 283 ? 26.802  -15.359 105.459 1.00 37.08 ? 280 ASP B C     1 
ATOM   5437  O O     . ASP B 1 283 ? 26.692  -14.698 106.482 1.00 39.17 ? 280 ASP B O     1 
ATOM   5438  C CB    . ASP B 1 283 ? 28.307  -16.834 106.791 1.00 38.04 ? 280 ASP B CB    1 
ATOM   5439  C CG    . ASP B 1 283 ? 29.403  -17.897 106.779 1.00 40.20 ? 280 ASP B CG    1 
ATOM   5440  O OD1   . ASP B 1 283 ? 29.208  -18.944 106.117 1.00 36.94 ? 280 ASP B OD1   1 
ATOM   5441  O OD2   . ASP B 1 283 ? 30.454  -17.686 107.432 1.00 40.32 ? 280 ASP B OD2   1 
ATOM   5442  N N     . ILE B 1 284 ? 26.074  -15.113 104.380 1.00 35.79 ? 281 ILE B N     1 
ATOM   5443  C CA    . ILE B 1 284 ? 25.109  -14.023 104.384 1.00 34.57 ? 281 ILE B CA    1 
ATOM   5444  C C     . ILE B 1 284 ? 23.696  -14.592 104.451 1.00 34.20 ? 281 ILE B C     1 
ATOM   5445  O O     . ILE B 1 284 ? 22.851  -14.103 105.200 1.00 35.79 ? 281 ILE B O     1 
ATOM   5446  C CB    . ILE B 1 284 ? 25.217  -13.174 103.126 1.00 34.04 ? 281 ILE B CB    1 
ATOM   5447  C CG1   . ILE B 1 284 ? 26.667  -12.695 102.932 1.00 32.93 ? 281 ILE B CG1   1 
ATOM   5448  C CG2   . ILE B 1 284 ? 24.181  -12.053 103.192 1.00 32.32 ? 281 ILE B CG2   1 
ATOM   5449  C CD1   . ILE B 1 284 ? 27.225  -11.787 104.016 1.00 29.05 ? 281 ILE B CD1   1 
ATOM   5450  N N     . ILE B 1 285 ? 23.447  -15.619 103.648 1.00 33.07 ? 282 ILE B N     1 
ATOM   5451  C CA    . ILE B 1 285 ? 22.155  -16.280 103.629 1.00 32.04 ? 282 ILE B CA    1 
ATOM   5452  C C     . ILE B 1 285 ? 22.399  -17.756 103.934 1.00 32.63 ? 282 ILE B C     1 
ATOM   5453  O O     . ILE B 1 285 ? 23.061  -18.458 103.163 1.00 32.09 ? 282 ILE B O     1 
ATOM   5454  C CB    . ILE B 1 285 ? 21.448  -16.127 102.261 1.00 31.65 ? 282 ILE B CB    1 
ATOM   5455  C CG1   . ILE B 1 285 ? 21.265  -14.633 101.949 1.00 30.53 ? 282 ILE B CG1   1 
ATOM   5456  C CG2   . ILE B 1 285 ? 20.098  -16.837 102.286 1.00 30.10 ? 282 ILE B CG2   1 
ATOM   5457  C CD1   . ILE B 1 285 ? 20.513  -14.329 100.682 1.00 26.84 ? 282 ILE B CD1   1 
ATOM   5458  N N     . LEU B 1 286 ? 21.882  -18.204 105.077 1.00 32.24 ? 283 LEU B N     1 
ATOM   5459  C CA    . LEU B 1 286 ? 22.043  -19.583 105.511 1.00 32.75 ? 283 LEU B CA    1 
ATOM   5460  C C     . LEU B 1 286 ? 20.713  -20.325 105.569 1.00 32.05 ? 283 LEU B C     1 
ATOM   5461  O O     . LEU B 1 286 ? 19.645  -19.729 105.400 1.00 29.78 ? 283 LEU B O     1 
ATOM   5462  C CB    . LEU B 1 286 ? 22.700  -19.641 106.898 1.00 33.76 ? 283 LEU B CB    1 
ATOM   5463  C CG    . LEU B 1 286 ? 24.078  -19.008 107.090 1.00 32.98 ? 283 LEU B CG    1 
ATOM   5464  C CD1   . LEU B 1 286 ? 25.041  -19.440 105.976 1.00 31.86 ? 283 LEU B CD1   1 
ATOM   5465  C CD2   . LEU B 1 286 ? 23.913  -17.519 107.098 1.00 34.35 ? 283 LEU B CD2   1 
ATOM   5466  N N     . GLY B 1 287 ? 20.798  -21.632 105.817 1.00 30.92 ? 284 GLY B N     1 
ATOM   5467  C CA    . GLY B 1 287 ? 19.607  -22.453 105.903 1.00 29.73 ? 284 GLY B CA    1 
ATOM   5468  C C     . GLY B 1 287 ? 18.570  -21.875 106.848 1.00 30.33 ? 284 GLY B C     1 
ATOM   5469  O O     . GLY B 1 287 ? 17.374  -21.944 106.563 1.00 31.92 ? 284 GLY B O     1 
ATOM   5470  N N     . ARG B 1 288 ? 19.018  -21.303 107.969 1.00 30.01 ? 285 ARG B N     1 
ATOM   5471  C CA    . ARG B 1 288 ? 18.102  -20.713 108.951 1.00 28.74 ? 285 ARG B CA    1 
ATOM   5472  C C     . ARG B 1 288 ? 17.269  -19.633 108.269 1.00 27.51 ? 285 ARG B C     1 
ATOM   5473  O O     . ARG B 1 288 ? 16.098  -19.430 108.586 1.00 25.99 ? 285 ARG B O     1 
ATOM   5474  C CB    . ARG B 1 288 ? 18.870  -20.106 110.132 1.00 27.84 ? 285 ARG B CB    1 
ATOM   5475  C CG    . ARG B 1 288 ? 19.830  -18.985 109.759 1.00 29.98 ? 285 ARG B CG    1 
ATOM   5476  C CD    . ARG B 1 288 ? 20.102  -18.055 110.950 1.00 29.77 ? 285 ARG B CD    1 
ATOM   5477  N NE    . ARG B 1 288 ? 21.464  -18.207 111.441 1.00 30.34 ? 285 ARG B NE    1 
ATOM   5478  C CZ    . ARG B 1 288 ? 22.300  -17.195 111.636 1.00 31.64 ? 285 ARG B CZ    1 
ATOM   5479  N NH1   . ARG B 1 288 ? 21.906  -15.958 111.387 1.00 31.66 ? 285 ARG B NH1   1 
ATOM   5480  N NH2   . ARG B 1 288 ? 23.540  -17.424 112.056 1.00 32.37 ? 285 ARG B NH2   1 
ATOM   5481  N N     . HIS B 1 289 ? 17.891  -18.950 107.316 1.00 28.37 ? 286 HIS B N     1 
ATOM   5482  C CA    . HIS B 1 289 ? 17.232  -17.895 106.552 1.00 28.16 ? 286 HIS B CA    1 
ATOM   5483  C C     . HIS B 1 289 ? 16.299  -18.492 105.503 1.00 28.12 ? 286 HIS B C     1 
ATOM   5484  O O     . HIS B 1 289 ? 15.143  -18.086 105.387 1.00 26.91 ? 286 HIS B O     1 
ATOM   5485  C CB    . HIS B 1 289 ? 18.280  -17.021 105.881 1.00 27.41 ? 286 HIS B CB    1 
ATOM   5486  C CG    . HIS B 1 289 ? 19.136  -16.266 106.846 1.00 29.39 ? 286 HIS B CG    1 
ATOM   5487  N ND1   . HIS B 1 289 ? 20.515  -16.319 106.823 1.00 29.70 ? 286 HIS B ND1   1 
ATOM   5488  C CD2   . HIS B 1 289 ? 18.807  -15.446 107.872 1.00 31.15 ? 286 HIS B CD2   1 
ATOM   5489  C CE1   . HIS B 1 289 ? 20.998  -15.566 107.794 1.00 30.76 ? 286 HIS B CE1   1 
ATOM   5490  N NE2   . HIS B 1 289 ? 19.983  -15.025 108.446 1.00 32.61 ? 286 HIS B NE2   1 
ATOM   5491  N N     . PHE B 1 290 ? 16.807  -19.462 104.749 1.00 29.62 ? 287 PHE B N     1 
ATOM   5492  C CA    . PHE B 1 290 ? 16.016  -20.113 103.712 1.00 31.69 ? 287 PHE B CA    1 
ATOM   5493  C C     . PHE B 1 290 ? 14.707  -20.632 104.277 1.00 33.07 ? 287 PHE B C     1 
ATOM   5494  O O     . PHE B 1 290 ? 13.648  -20.453 103.671 1.00 33.42 ? 287 PHE B O     1 
ATOM   5495  C CB    . PHE B 1 290 ? 16.793  -21.283 103.080 1.00 30.41 ? 287 PHE B CB    1 
ATOM   5496  C CG    . PHE B 1 290 ? 17.830  -20.857 102.067 1.00 30.41 ? 287 PHE B CG    1 
ATOM   5497  C CD1   . PHE B 1 290 ? 17.462  -20.136 100.932 1.00 27.49 ? 287 PHE B CD1   1 
ATOM   5498  C CD2   . PHE B 1 290 ? 19.178  -21.176 102.253 1.00 30.53 ? 287 PHE B CD2   1 
ATOM   5499  C CE1   . PHE B 1 290 ? 18.415  -19.735 99.997  1.00 28.19 ? 287 PHE B CE1   1 
ATOM   5500  C CE2   . PHE B 1 290 ? 20.143  -20.780 101.325 1.00 29.37 ? 287 PHE B CE2   1 
ATOM   5501  C CZ    . PHE B 1 290 ? 19.764  -20.059 100.195 1.00 30.84 ? 287 PHE B CZ    1 
ATOM   5502  N N     . GLU B 1 291 ? 14.790  -21.265 105.446 1.00 35.62 ? 288 GLU B N     1 
ATOM   5503  C CA    . GLU B 1 291 ? 13.616  -21.837 106.099 1.00 37.42 ? 288 GLU B CA    1 
ATOM   5504  C C     . GLU B 1 291 ? 12.498  -20.843 106.376 1.00 37.41 ? 288 GLU B C     1 
ATOM   5505  O O     . GLU B 1 291 ? 11.368  -21.238 106.675 1.00 36.43 ? 288 GLU B O     1 
ATOM   5506  C CB    . GLU B 1 291 ? 14.019  -22.504 107.409 1.00 39.90 ? 288 GLU B CB    1 
ATOM   5507  C CG    . GLU B 1 291 ? 15.018  -23.640 107.256 1.00 44.65 ? 288 GLU B CG    1 
ATOM   5508  C CD    . GLU B 1 291 ? 15.253  -24.392 108.563 1.00 47.52 ? 288 GLU B CD    1 
ATOM   5509  O OE1   . GLU B 1 291 ? 15.550  -23.730 109.591 1.00 46.56 ? 288 GLU B OE1   1 
ATOM   5510  O OE2   . GLU B 1 291 ? 15.137  -25.641 108.561 1.00 48.90 ? 288 GLU B OE2   1 
ATOM   5511  N N     . GLN B 1 292 ? 12.806  -19.555 106.265 1.00 38.17 ? 289 GLN B N     1 
ATOM   5512  C CA    . GLN B 1 292 ? 11.810  -18.529 106.542 1.00 38.12 ? 289 GLN B CA    1 
ATOM   5513  C C     . GLN B 1 292 ? 11.424  -17.645 105.370 1.00 36.50 ? 289 GLN B C     1 
ATOM   5514  O O     . GLN B 1 292 ? 10.542  -16.798 105.502 1.00 36.26 ? 289 GLN B O     1 
ATOM   5515  C CB    . GLN B 1 292 ? 12.272  -17.650 107.702 1.00 39.78 ? 289 GLN B CB    1 
ATOM   5516  C CG    . GLN B 1 292 ? 12.249  -18.365 109.034 1.00 44.58 ? 289 GLN B CG    1 
ATOM   5517  C CD    . GLN B 1 292 ? 12.272  -17.403 110.196 1.00 48.60 ? 289 GLN B CD    1 
ATOM   5518  O OE1   . GLN B 1 292 ? 13.276  -16.727 110.439 1.00 51.65 ? 289 GLN B OE1   1 
ATOM   5519  N NE2   . GLN B 1 292 ? 11.154  -17.322 110.918 1.00 49.79 ? 289 GLN B NE2   1 
ATOM   5520  N N     . MET B 1 293 ? 12.068  -17.827 104.223 1.00 34.58 ? 290 MET B N     1 
ATOM   5521  C CA    . MET B 1 293 ? 11.730  -16.994 103.078 1.00 33.64 ? 290 MET B CA    1 
ATOM   5522  C C     . MET B 1 293 ? 10.369  -17.361 102.520 1.00 34.27 ? 290 MET B C     1 
ATOM   5523  O O     . MET B 1 293 ? 9.981   -18.535 102.509 1.00 34.35 ? 290 MET B O     1 
ATOM   5524  C CB    . MET B 1 293 ? 12.769  -17.129 101.980 1.00 32.91 ? 290 MET B CB    1 
ATOM   5525  C CG    . MET B 1 293 ? 14.146  -16.712 102.394 1.00 34.04 ? 290 MET B CG    1 
ATOM   5526  S SD    . MET B 1 293 ? 15.317  -16.971 101.053 1.00 34.88 ? 290 MET B SD    1 
ATOM   5527  C CE    . MET B 1 293 ? 16.722  -16.022 101.644 1.00 35.01 ? 290 MET B CE    1 
ATOM   5528  N N     . LYS B 1 294 ? 9.647   -16.351 102.052 1.00 32.74 ? 291 LYS B N     1 
ATOM   5529  C CA    . LYS B 1 294 ? 8.342   -16.566 101.466 1.00 32.28 ? 291 LYS B CA    1 
ATOM   5530  C C     . LYS B 1 294 ? 8.473   -17.536 100.300 1.00 30.56 ? 291 LYS B C     1 
ATOM   5531  O O     . LYS B 1 294 ? 9.567   -17.764 99.802  1.00 29.66 ? 291 LYS B O     1 
ATOM   5532  C CB    . LYS B 1 294 ? 7.771   -15.240 100.969 1.00 34.54 ? 291 LYS B CB    1 
ATOM   5533  C CG    . LYS B 1 294 ? 7.522   -14.267 102.080 1.00 37.43 ? 291 LYS B CG    1 
ATOM   5534  C CD    . LYS B 1 294 ? 6.821   -13.049 101.575 1.00 41.54 ? 291 LYS B CD    1 
ATOM   5535  C CE    . LYS B 1 294 ? 6.474   -12.119 102.730 1.00 43.59 ? 291 LYS B CE    1 
ATOM   5536  N NZ    . LYS B 1 294 ? 5.556   -12.772 103.704 1.00 43.60 ? 291 LYS B NZ    1 
ATOM   5537  N N     . ASP B 1 295 ? 7.344   -18.098 99.878  1.00 29.95 ? 292 ASP B N     1 
ATOM   5538  C CA    . ASP B 1 295 ? 7.295   -19.055 98.779  1.00 28.38 ? 292 ASP B CA    1 
ATOM   5539  C C     . ASP B 1 295 ? 7.806   -18.442 97.487  1.00 28.25 ? 292 ASP B C     1 
ATOM   5540  O O     . ASP B 1 295 ? 7.428   -17.340 97.114  1.00 28.71 ? 292 ASP B O     1 
ATOM   5541  C CB    . ASP B 1 295 ? 5.858   -19.561 98.594  1.00 26.89 ? 292 ASP B CB    1 
ATOM   5542  C CG    . ASP B 1 295 ? 5.744   -20.654 97.532  1.00 26.74 ? 292 ASP B CG    1 
ATOM   5543  O OD1   . ASP B 1 295 ? 6.698   -21.448 97.368  1.00 24.58 ? 292 ASP B OD1   1 
ATOM   5544  O OD2   . ASP B 1 295 ? 4.686   -20.724 96.869  1.00 26.87 ? 292 ASP B OD2   1 
ATOM   5545  N N     . ASP B 1 296 ? 8.675   -19.177 96.812  1.00 28.27 ? 293 ASP B N     1 
ATOM   5546  C CA    . ASP B 1 296 ? 9.263   -18.726 95.564  1.00 27.72 ? 293 ASP B CA    1 
ATOM   5547  C C     . ASP B 1 296 ? 10.084  -17.447 95.677  1.00 27.23 ? 293 ASP B C     1 
ATOM   5548  O O     . ASP B 1 296 ? 10.008  -16.571 94.818  1.00 26.67 ? 293 ASP B O     1 
ATOM   5549  C CB    . ASP B 1 296 ? 8.188   -18.569 94.494  1.00 27.56 ? 293 ASP B CB    1 
ATOM   5550  C CG    . ASP B 1 296 ? 8.199   -19.719 93.507  1.00 29.67 ? 293 ASP B CG    1 
ATOM   5551  O OD1   . ASP B 1 296 ? 9.287   -20.318 93.351  1.00 31.62 ? 293 ASP B OD1   1 
ATOM   5552  O OD2   . ASP B 1 296 ? 7.150   -20.014 92.890  1.00 29.16 ? 293 ASP B OD2   1 
ATOM   5553  N N     . ALA B 1 297 ? 10.863  -17.343 96.749  1.00 25.79 ? 294 ALA B N     1 
ATOM   5554  C CA    . ALA B 1 297 ? 11.722  -16.184 96.954  1.00 25.49 ? 294 ALA B CA    1 
ATOM   5555  C C     . ALA B 1 297 ? 12.917  -16.344 96.020  1.00 24.81 ? 294 ALA B C     1 
ATOM   5556  O O     . ALA B 1 297 ? 13.501  -17.420 95.961  1.00 25.60 ? 294 ALA B O     1 
ATOM   5557  C CB    . ALA B 1 297 ? 12.199  -16.130 98.402  1.00 25.71 ? 294 ALA B CB    1 
ATOM   5558  N N     . ILE B 1 298 ? 13.271  -15.297 95.278  1.00 22.67 ? 295 ILE B N     1 
ATOM   5559  C CA    . ILE B 1 298 ? 14.409  -15.382 94.369  1.00 20.68 ? 295 ILE B CA    1 
ATOM   5560  C C     . ILE B 1 298 ? 15.684  -14.951 95.093  1.00 22.70 ? 295 ILE B C     1 
ATOM   5561  O O     . ILE B 1 298 ? 15.782  -13.824 95.579  1.00 22.76 ? 295 ILE B O     1 
ATOM   5562  C CB    . ILE B 1 298 ? 14.173  -14.515 93.107  1.00 19.89 ? 295 ILE B CB    1 
ATOM   5563  C CG1   . ILE B 1 298 ? 13.002  -15.094 92.307  1.00 17.89 ? 295 ILE B CG1   1 
ATOM   5564  C CG2   . ILE B 1 298 ? 15.418  -14.483 92.235  1.00 15.92 ? 295 ILE B CG2   1 
ATOM   5565  C CD1   . ILE B 1 298 ? 12.506  -14.185 91.212  1.00 18.07 ? 295 ILE B CD1   1 
ATOM   5566  N N     . VAL B 1 299 ? 16.658  -15.858 95.167  1.00 22.80 ? 296 VAL B N     1 
ATOM   5567  C CA    . VAL B 1 299 ? 17.920  -15.586 95.858  1.00 20.85 ? 296 VAL B CA    1 
ATOM   5568  C C     . VAL B 1 299 ? 19.117  -15.675 94.929  1.00 21.61 ? 296 VAL B C     1 
ATOM   5569  O O     . VAL B 1 299 ? 19.332  -16.698 94.278  1.00 22.34 ? 296 VAL B O     1 
ATOM   5570  C CB    . VAL B 1 299 ? 18.148  -16.589 97.003  1.00 18.66 ? 296 VAL B CB    1 
ATOM   5571  C CG1   . VAL B 1 299 ? 19.396  -16.221 97.793  1.00 15.96 ? 296 VAL B CG1   1 
ATOM   5572  C CG2   . VAL B 1 299 ? 16.926  -16.628 97.889  1.00 20.15 ? 296 VAL B CG2   1 
ATOM   5573  N N     . CYS B 1 300 ? 19.903  -14.610 94.867  1.00 20.68 ? 297 CYS B N     1 
ATOM   5574  C CA    . CYS B 1 300 ? 21.060  -14.632 93.998  1.00 23.00 ? 297 CYS B CA    1 
ATOM   5575  C C     . CYS B 1 300 ? 22.199  -13.842 94.630  1.00 23.44 ? 297 CYS B C     1 
ATOM   5576  O O     . CYS B 1 300 ? 22.007  -13.184 95.640  1.00 24.22 ? 297 CYS B O     1 
ATOM   5577  C CB    . CYS B 1 300 ? 20.703  -14.073 92.611  1.00 22.69 ? 297 CYS B CB    1 
ATOM   5578  S SG    . CYS B 1 300 ? 20.377  -12.303 92.572  1.00 25.23 ? 297 CYS B SG    1 
ATOM   5579  N N     . ASN B 1 301 ? 23.384  -13.939 94.045  1.00 22.89 ? 298 ASN B N     1 
ATOM   5580  C CA    . ASN B 1 301 ? 24.547  -13.240 94.550  1.00 21.88 ? 298 ASN B CA    1 
ATOM   5581  C C     . ASN B 1 301 ? 25.205  -12.414 93.442  1.00 21.30 ? 298 ASN B C     1 
ATOM   5582  O O     . ASN B 1 301 ? 25.197  -12.804 92.275  1.00 20.92 ? 298 ASN B O     1 
ATOM   5583  C CB    . ASN B 1 301 ? 25.573  -14.250 95.082  1.00 23.41 ? 298 ASN B CB    1 
ATOM   5584  C CG    . ASN B 1 301 ? 26.936  -13.608 95.360  1.00 25.77 ? 298 ASN B CG    1 
ATOM   5585  O OD1   . ASN B 1 301 ? 27.045  -12.670 96.150  1.00 24.67 ? 298 ASN B OD1   1 
ATOM   5586  N ND2   . ASN B 1 301 ? 27.975  -14.106 94.698  1.00 24.14 ? 298 ASN B ND2   1 
ATOM   5587  N N     . ILE B 1 302 ? 25.783  -11.275 93.800  1.00 19.54 ? 299 ILE B N     1 
ATOM   5588  C CA    . ILE B 1 302 ? 26.451  -10.468 92.796  1.00 19.79 ? 299 ILE B CA    1 
ATOM   5589  C C     . ILE B 1 302 ? 27.899  -10.189 93.216  1.00 21.45 ? 299 ILE B C     1 
ATOM   5590  O O     . ILE B 1 302 ? 28.605  -9.425  92.570  1.00 20.28 ? 299 ILE B O     1 
ATOM   5591  C CB    . ILE B 1 302 ? 25.659  -9.135  92.505  1.00 18.97 ? 299 ILE B CB    1 
ATOM   5592  C CG1   . ILE B 1 302 ? 26.144  -8.530  91.174  1.00 17.27 ? 299 ILE B CG1   1 
ATOM   5593  C CG2   . ILE B 1 302 ? 25.779  -8.164  93.687  1.00 16.56 ? 299 ILE B CG2   1 
ATOM   5594  C CD1   . ILE B 1 302 ? 25.264  -7.409  90.616  1.00 15.18 ? 299 ILE B CD1   1 
ATOM   5595  N N     . GLY B 1 303 ? 28.346  -10.839 94.291  1.00 24.78 ? 300 GLY B N     1 
ATOM   5596  C CA    . GLY B 1 303 ? 29.724  -10.663 94.748  1.00 26.16 ? 300 GLY B CA    1 
ATOM   5597  C C     . GLY B 1 303 ? 30.658  -11.461 93.856  1.00 27.72 ? 300 GLY B C     1 
ATOM   5598  O O     . GLY B 1 303 ? 30.228  -12.429 93.223  1.00 29.63 ? 300 GLY B O     1 
ATOM   5599  N N     . HIS B 1 304 ? 31.932  -11.091 93.796  1.00 28.62 ? 301 HIS B N     1 
ATOM   5600  C CA    . HIS B 1 304 ? 32.868  -11.810 92.930  1.00 28.30 ? 301 HIS B CA    1 
ATOM   5601  C C     . HIS B 1 304 ? 32.879  -13.328 93.080  1.00 27.56 ? 301 HIS B C     1 
ATOM   5602  O O     . HIS B 1 304 ? 32.778  -14.070 92.097  1.00 26.84 ? 301 HIS B O     1 
ATOM   5603  C CB    . HIS B 1 304 ? 34.290  -11.325 93.140  1.00 28.80 ? 301 HIS B CB    1 
ATOM   5604  C CG    . HIS B 1 304 ? 35.279  -12.021 92.258  1.00 30.62 ? 301 HIS B CG    1 
ATOM   5605  N ND1   . HIS B 1 304 ? 35.394  -11.750 90.912  1.00 29.99 ? 301 HIS B ND1   1 
ATOM   5606  C CD2   . HIS B 1 304 ? 36.163  -13.013 92.522  1.00 31.08 ? 301 HIS B CD2   1 
ATOM   5607  C CE1   . HIS B 1 304 ? 36.310  -12.545 90.387  1.00 31.95 ? 301 HIS B CE1   1 
ATOM   5608  N NE2   . HIS B 1 304 ? 36.792  -13.321 91.342  1.00 31.05 ? 301 HIS B NE2   1 
ATOM   5609  N N     . PHE B 1 305 ? 33.043  -13.787 94.311  1.00 26.15 ? 302 PHE B N     1 
ATOM   5610  C CA    . PHE B 1 305 ? 33.099  -15.216 94.567  1.00 25.41 ? 302 PHE B CA    1 
ATOM   5611  C C     . PHE B 1 305 ? 31.745  -15.718 95.035  1.00 25.29 ? 302 PHE B C     1 
ATOM   5612  O O     . PHE B 1 305 ? 30.965  -14.958 95.606  1.00 24.44 ? 302 PHE B O     1 
ATOM   5613  C CB    . PHE B 1 305 ? 34.178  -15.514 95.623  1.00 23.34 ? 302 PHE B CB    1 
ATOM   5614  C CG    . PHE B 1 305 ? 35.599  -15.401 95.103  1.00 21.49 ? 302 PHE B CG    1 
ATOM   5615  C CD1   . PHE B 1 305 ? 36.034  -16.198 94.046  1.00 22.61 ? 302 PHE B CD1   1 
ATOM   5616  C CD2   . PHE B 1 305 ? 36.517  -14.550 95.709  1.00 20.97 ? 302 PHE B CD2   1 
ATOM   5617  C CE1   . PHE B 1 305 ? 37.368  -16.147 93.610  1.00 21.27 ? 302 PHE B CE1   1 
ATOM   5618  C CE2   . PHE B 1 305 ? 37.852  -14.495 95.282  1.00 18.02 ? 302 PHE B CE2   1 
ATOM   5619  C CZ    . PHE B 1 305 ? 38.275  -15.294 94.236  1.00 18.68 ? 302 PHE B CZ    1 
ATOM   5620  N N     . ASP B 1 306 ? 31.454  -16.988 94.766  1.00 26.11 ? 303 ASP B N     1 
ATOM   5621  C CA    . ASP B 1 306 ? 30.192  -17.570 95.189  1.00 28.75 ? 303 ASP B CA    1 
ATOM   5622  C C     . ASP B 1 306 ? 30.317  -18.128 96.611  1.00 29.19 ? 303 ASP B C     1 
ATOM   5623  O O     . ASP B 1 306 ? 30.162  -19.330 96.839  1.00 28.23 ? 303 ASP B O     1 
ATOM   5624  C CB    . ASP B 1 306 ? 29.742  -18.672 94.218  1.00 31.25 ? 303 ASP B CB    1 
ATOM   5625  C CG    . ASP B 1 306 ? 30.722  -19.850 94.137  1.00 34.15 ? 303 ASP B CG    1 
ATOM   5626  O OD1   . ASP B 1 306 ? 30.271  -21.003 94.351  1.00 34.32 ? 303 ASP B OD1   1 
ATOM   5627  O OD2   . ASP B 1 306 ? 31.921  -19.631 93.845  1.00 36.53 ? 303 ASP B OD2   1 
ATOM   5628  N N     . VAL B 1 307 ? 30.575  -17.238 97.567  1.00 28.10 ? 304 VAL B N     1 
ATOM   5629  C CA    . VAL B 1 307 ? 30.732  -17.645 98.959  1.00 29.30 ? 304 VAL B CA    1 
ATOM   5630  C C     . VAL B 1 307 ? 29.737  -16.984 99.898  1.00 28.88 ? 304 VAL B C     1 
ATOM   5631  O O     . VAL B 1 307 ? 29.809  -17.167 101.113 1.00 28.64 ? 304 VAL B O     1 
ATOM   5632  C CB    . VAL B 1 307 ? 32.132  -17.303 99.467  1.00 31.05 ? 304 VAL B CB    1 
ATOM   5633  C CG1   . VAL B 1 307 ? 33.165  -18.139 98.728  1.00 28.94 ? 304 VAL B CG1   1 
ATOM   5634  C CG2   . VAL B 1 307 ? 32.397  -15.798 99.276  1.00 26.24 ? 304 VAL B CG2   1 
ATOM   5635  N N     . GLU B 1 308 ? 28.804  -16.230 99.321  1.00 29.80 ? 305 GLU B N     1 
ATOM   5636  C CA    . GLU B 1 308 ? 27.794  -15.494 100.085 1.00 27.33 ? 305 GLU B CA    1 
ATOM   5637  C C     . GLU B 1 308 ? 26.520  -16.244 100.360 1.00 27.21 ? 305 GLU B C     1 
ATOM   5638  O O     . GLU B 1 308 ? 25.855  -15.996 101.365 1.00 27.33 ? 305 GLU B O     1 
ATOM   5639  C CB    . GLU B 1 308 ? 27.478  -14.192 99.366  1.00 25.84 ? 305 GLU B CB    1 
ATOM   5640  C CG    . GLU B 1 308 ? 28.732  -13.388 99.173  1.00 28.56 ? 305 GLU B CG    1 
ATOM   5641  C CD    . GLU B 1 308 ? 28.503  -11.927 98.889  1.00 29.96 ? 305 GLU B CD    1 
ATOM   5642  O OE1   . GLU B 1 308 ? 27.676  -11.286 99.576  1.00 30.77 ? 305 GLU B OE1   1 
ATOM   5643  O OE2   . GLU B 1 308 ? 29.182  -11.414 97.976  1.00 31.29 ? 305 GLU B OE2   1 
ATOM   5644  N N     . ILE B 1 309 ? 26.170  -17.154 99.462  1.00 29.09 ? 306 ILE B N     1 
ATOM   5645  C CA    . ILE B 1 309 ? 24.953  -17.940 99.616  1.00 30.25 ? 306 ILE B CA    1 
ATOM   5646  C C     . ILE B 1 309 ? 25.324  -19.387 99.904  1.00 31.39 ? 306 ILE B C     1 
ATOM   5647  O O     . ILE B 1 309 ? 26.173  -19.968 99.227  1.00 32.16 ? 306 ILE B O     1 
ATOM   5648  C CB    . ILE B 1 309 ? 24.078  -17.868 98.333  1.00 28.60 ? 306 ILE B CB    1 
ATOM   5649  C CG1   . ILE B 1 309 ? 23.679  -16.419 98.048  1.00 31.18 ? 306 ILE B CG1   1 
ATOM   5650  C CG2   . ILE B 1 309 ? 22.843  -18.726 98.493  1.00 25.69 ? 306 ILE B CG2   1 
ATOM   5651  C CD1   . ILE B 1 309 ? 22.749  -16.252 96.849  1.00 32.45 ? 306 ILE B CD1   1 
ATOM   5652  N N     . ASP B 1 310 ? 24.692  -19.965 100.918 1.00 32.50 ? 307 ASP B N     1 
ATOM   5653  C CA    . ASP B 1 310 ? 24.957  -21.354 101.282 1.00 34.13 ? 307 ASP B CA    1 
ATOM   5654  C C     . ASP B 1 310 ? 24.178  -22.293 100.357 1.00 33.83 ? 307 ASP B C     1 
ATOM   5655  O O     . ASP B 1 310 ? 23.181  -22.907 100.770 1.00 32.77 ? 307 ASP B O     1 
ATOM   5656  C CB    . ASP B 1 310 ? 24.540  -21.616 102.736 1.00 36.79 ? 307 ASP B CB    1 
ATOM   5657  C CG    . ASP B 1 310 ? 25.144  -22.895 103.291 1.00 39.04 ? 307 ASP B CG    1 
ATOM   5658  O OD1   . ASP B 1 310 ? 25.292  -23.864 102.512 1.00 40.65 ? 307 ASP B OD1   1 
ATOM   5659  O OD2   . ASP B 1 310 ? 25.465  -22.934 104.498 1.00 40.59 ? 307 ASP B OD2   1 
ATOM   5660  N N     . VAL B 1 311 ? 24.637  -22.397 99.110  1.00 32.76 ? 308 VAL B N     1 
ATOM   5661  C CA    . VAL B 1 311 ? 23.994  -23.252 98.118  1.00 32.08 ? 308 VAL B CA    1 
ATOM   5662  C C     . VAL B 1 311 ? 24.089  -24.735 98.524  1.00 31.89 ? 308 VAL B C     1 
ATOM   5663  O O     . VAL B 1 311 ? 23.173  -25.513 98.269  1.00 29.64 ? 308 VAL B O     1 
ATOM   5664  C CB    . VAL B 1 311 ? 24.622  -23.047 96.709  1.00 32.33 ? 308 VAL B CB    1 
ATOM   5665  C CG1   . VAL B 1 311 ? 23.872  -23.883 95.672  1.00 32.26 ? 308 VAL B CG1   1 
ATOM   5666  C CG2   . VAL B 1 311 ? 24.579  -21.576 96.327  1.00 29.65 ? 308 VAL B CG2   1 
ATOM   5667  N N     . LYS B 1 312 ? 25.188  -25.133 99.158  1.00 32.97 ? 309 LYS B N     1 
ATOM   5668  C CA    . LYS B 1 312 ? 25.316  -26.529 99.579  1.00 34.86 ? 309 LYS B CA    1 
ATOM   5669  C C     . LYS B 1 312 ? 24.147  -26.944 100.466 1.00 34.05 ? 309 LYS B C     1 
ATOM   5670  O O     . LYS B 1 312 ? 23.582  -28.024 100.290 1.00 31.51 ? 309 LYS B O     1 
ATOM   5671  C CB    . LYS B 1 312 ? 26.626  -26.755 100.342 1.00 36.79 ? 309 LYS B CB    1 
ATOM   5672  C CG    . LYS B 1 312 ? 27.855  -26.845 99.457  1.00 41.76 ? 309 LYS B CG    1 
ATOM   5673  C CD    . LYS B 1 312 ? 29.110  -27.118 100.276 1.00 44.01 ? 309 LYS B CD    1 
ATOM   5674  C CE    . LYS B 1 312 ? 30.313  -27.310 99.364  1.00 45.19 ? 309 LYS B CE    1 
ATOM   5675  N NZ    . LYS B 1 312 ? 30.532  -26.127 98.492  1.00 45.12 ? 309 LYS B NZ    1 
ATOM   5676  N N     . TRP B 1 313 ? 23.786  -26.074 101.407 1.00 33.03 ? 310 TRP B N     1 
ATOM   5677  C CA    . TRP B 1 313 ? 22.696  -26.350 102.331 1.00 32.55 ? 310 TRP B CA    1 
ATOM   5678  C C     . TRP B 1 313 ? 21.397  -26.675 101.609 1.00 33.44 ? 310 TRP B C     1 
ATOM   5679  O O     . TRP B 1 313 ? 20.671  -27.598 101.997 1.00 31.19 ? 310 TRP B O     1 
ATOM   5680  C CB    . TRP B 1 313 ? 22.453  -25.158 103.263 1.00 33.95 ? 310 TRP B CB    1 
ATOM   5681  C CG    . TRP B 1 313 ? 21.474  -25.485 104.354 1.00 34.91 ? 310 TRP B CG    1 
ATOM   5682  C CD1   . TRP B 1 313 ? 21.761  -26.036 105.576 1.00 34.24 ? 310 TRP B CD1   1 
ATOM   5683  C CD2   . TRP B 1 313 ? 20.046  -25.375 104.288 1.00 35.50 ? 310 TRP B CD2   1 
ATOM   5684  N NE1   . TRP B 1 313 ? 20.598  -26.279 106.270 1.00 35.98 ? 310 TRP B NE1   1 
ATOM   5685  C CE2   . TRP B 1 313 ? 19.531  -25.883 105.504 1.00 36.48 ? 310 TRP B CE2   1 
ATOM   5686  C CE3   . TRP B 1 313 ? 19.152  -24.902 103.320 1.00 36.42 ? 310 TRP B CE3   1 
ATOM   5687  C CZ2   . TRP B 1 313 ? 18.159  -25.931 105.776 1.00 36.67 ? 310 TRP B CZ2   1 
ATOM   5688  C CZ3   . TRP B 1 313 ? 17.786  -24.951 103.589 1.00 38.26 ? 310 TRP B CZ3   1 
ATOM   5689  C CH2   . TRP B 1 313 ? 17.303  -25.463 104.810 1.00 38.41 ? 310 TRP B CH2   1 
ATOM   5690  N N     . LEU B 1 314 ? 21.094  -25.897 100.574 1.00 33.83 ? 311 LEU B N     1 
ATOM   5691  C CA    . LEU B 1 314 ? 19.881  -26.120 99.807  1.00 35.14 ? 311 LEU B CA    1 
ATOM   5692  C C     . LEU B 1 314 ? 19.928  -27.489 99.145  1.00 35.91 ? 311 LEU B C     1 
ATOM   5693  O O     . LEU B 1 314 ? 18.918  -28.199 99.088  1.00 35.19 ? 311 LEU B O     1 
ATOM   5694  C CB    . LEU B 1 314 ? 19.703  -25.041 98.732  1.00 35.21 ? 311 LEU B CB    1 
ATOM   5695  C CG    . LEU B 1 314 ? 19.122  -23.687 99.149  1.00 37.13 ? 311 LEU B CG    1 
ATOM   5696  C CD1   . LEU B 1 314 ? 19.116  -22.737 97.948  1.00 35.15 ? 311 LEU B CD1   1 
ATOM   5697  C CD2   . LEU B 1 314 ? 17.712  -23.890 99.683  1.00 35.25 ? 311 LEU B CD2   1 
ATOM   5698  N N     . ASN B 1 315 ? 21.098  -27.868 98.644  1.00 34.85 ? 312 ASN B N     1 
ATOM   5699  C CA    . ASN B 1 315 ? 21.199  -29.154 97.974  1.00 35.38 ? 312 ASN B CA    1 
ATOM   5700  C C     . ASN B 1 315 ? 21.087  -30.332 98.918  1.00 35.48 ? 312 ASN B C     1 
ATOM   5701  O O     . ASN B 1 315 ? 20.543  -31.372 98.561  1.00 37.28 ? 312 ASN B O     1 
ATOM   5702  C CB    . ASN B 1 315 ? 22.503  -29.258 97.190  1.00 32.59 ? 312 ASN B CB    1 
ATOM   5703  C CG    . ASN B 1 315 ? 22.558  -28.293 96.041  1.00 30.92 ? 312 ASN B CG    1 
ATOM   5704  O OD1   . ASN B 1 315 ? 21.540  -28.022 95.394  1.00 28.43 ? 312 ASN B OD1   1 
ATOM   5705  N ND2   . ASN B 1 315 ? 23.750  -27.771 95.763  1.00 29.31 ? 312 ASN B ND2   1 
ATOM   5706  N N     . GLU B 1 316 ? 21.589  -30.168 100.133 1.00 36.67 ? 313 GLU B N     1 
ATOM   5707  C CA    . GLU B 1 316 ? 21.550  -31.256 101.090 1.00 36.88 ? 313 GLU B CA    1 
ATOM   5708  C C     . GLU B 1 316 ? 20.337  -31.205 102.012 1.00 37.39 ? 313 GLU B C     1 
ATOM   5709  O O     . GLU B 1 316 ? 20.237  -31.988 102.946 1.00 40.21 ? 313 GLU B O     1 
ATOM   5710  C CB    . GLU B 1 316 ? 22.845  -31.257 101.903 1.00 37.36 ? 313 GLU B CB    1 
ATOM   5711  C CG    . GLU B 1 316 ? 24.109  -31.331 101.040 1.00 39.34 ? 313 GLU B CG    1 
ATOM   5712  C CD    . GLU B 1 316 ? 25.393  -31.255 101.851 1.00 39.40 ? 313 GLU B CD    1 
ATOM   5713  O OE1   . GLU B 1 316 ? 25.469  -30.398 102.756 1.00 41.56 ? 313 GLU B OE1   1 
ATOM   5714  O OE2   . GLU B 1 316 ? 26.330  -32.040 101.584 1.00 39.06 ? 313 GLU B OE2   1 
ATOM   5715  N N     . ASN B 1 317 ? 19.400  -30.303 101.746 1.00 37.25 ? 314 ASN B N     1 
ATOM   5716  C CA    . ASN B 1 317 ? 18.220  -30.196 102.594 1.00 36.55 ? 314 ASN B CA    1 
ATOM   5717  C C     . ASN B 1 317 ? 16.902  -30.035 101.872 1.00 36.96 ? 314 ASN B C     1 
ATOM   5718  O O     . ASN B 1 317 ? 15.844  -30.297 102.440 1.00 38.62 ? 314 ASN B O     1 
ATOM   5719  C CB    . ASN B 1 317 ? 18.399  -29.051 103.567 1.00 36.61 ? 314 ASN B CB    1 
ATOM   5720  C CG    . ASN B 1 317 ? 19.441  -29.346 104.581 1.00 35.63 ? 314 ASN B CG    1 
ATOM   5721  O OD1   . ASN B 1 317 ? 19.201  -30.087 105.533 1.00 38.83 ? 314 ASN B OD1   1 
ATOM   5722  N ND2   . ASN B 1 317 ? 20.623  -28.791 104.382 1.00 35.84 ? 314 ASN B ND2   1 
ATOM   5723  N N     . ALA B 1 318 ? 16.959  -29.593 100.625 1.00 36.15 ? 315 ALA B N     1 
ATOM   5724  C CA    . ALA B 1 318 ? 15.749  -29.416 99.849  1.00 35.76 ? 315 ALA B CA    1 
ATOM   5725  C C     . ALA B 1 318 ? 15.155  -30.795 99.570  1.00 35.28 ? 315 ALA B C     1 
ATOM   5726  O O     . ALA B 1 318 ? 15.890  -31.761 99.387  1.00 35.13 ? 315 ALA B O     1 
ATOM   5727  C CB    . ALA B 1 318 ? 16.076  -28.713 98.557  1.00 36.00 ? 315 ALA B CB    1 
ATOM   5728  N N     . VAL B 1 319 ? 13.829  -30.883 99.548  1.00 34.87 ? 316 VAL B N     1 
ATOM   5729  C CA    . VAL B 1 319 ? 13.144  -32.146 99.280  1.00 35.70 ? 316 VAL B CA    1 
ATOM   5730  C C     . VAL B 1 319 ? 12.817  -32.266 97.779  1.00 34.37 ? 316 VAL B C     1 
ATOM   5731  O O     . VAL B 1 319 ? 12.262  -33.266 97.326  1.00 32.33 ? 316 VAL B O     1 
ATOM   5732  C CB    . VAL B 1 319 ? 11.820  -32.246 100.089 1.00 36.26 ? 316 VAL B CB    1 
ATOM   5733  C CG1   . VAL B 1 319 ? 10.776  -31.321 99.484  1.00 38.33 ? 316 VAL B CG1   1 
ATOM   5734  C CG2   . VAL B 1 319 ? 11.306  -33.678 100.105 1.00 38.67 ? 316 VAL B CG2   1 
ATOM   5735  N N     . GLU B 1 320 ? 13.168  -31.236 97.018  1.00 34.38 ? 317 GLU B N     1 
ATOM   5736  C CA    . GLU B 1 320 ? 12.911  -31.202 95.582  1.00 35.05 ? 317 GLU B CA    1 
ATOM   5737  C C     . GLU B 1 320 ? 13.829  -30.188 94.948  1.00 33.59 ? 317 GLU B C     1 
ATOM   5738  O O     . GLU B 1 320 ? 14.170  -29.184 95.564  1.00 34.57 ? 317 GLU B O     1 
ATOM   5739  C CB    . GLU B 1 320 ? 11.464  -30.790 95.311  1.00 36.91 ? 317 GLU B CB    1 
ATOM   5740  C CG    . GLU B 1 320 ? 10.496  -31.948 95.288  1.00 41.55 ? 317 GLU B CG    1 
ATOM   5741  C CD    . GLU B 1 320 ? 9.041   -31.518 95.294  1.00 43.32 ? 317 GLU B CD    1 
ATOM   5742  O OE1   . GLU B 1 320 ? 8.677   -30.572 94.564  1.00 43.71 ? 317 GLU B OE1   1 
ATOM   5743  O OE2   . GLU B 1 320 ? 8.255   -32.154 96.033  1.00 47.92 ? 317 GLU B OE2   1 
ATOM   5744  N N     . LYS B 1 321 ? 14.238  -30.444 93.717  1.00 32.44 ? 318 LYS B N     1 
ATOM   5745  C CA    . LYS B 1 321 ? 15.102  -29.508 93.016  1.00 30.76 ? 318 LYS B CA    1 
ATOM   5746  C C     . LYS B 1 321 ? 14.919  -29.728 91.531  1.00 30.67 ? 318 LYS B C     1 
ATOM   5747  O O     . LYS B 1 321 ? 15.285  -30.788 91.020  1.00 28.41 ? 318 LYS B O     1 
ATOM   5748  C CB    . LYS B 1 321 ? 16.558  -29.728 93.397  1.00 30.64 ? 318 LYS B CB    1 
ATOM   5749  C CG    . LYS B 1 321 ? 17.549  -28.945 92.549  1.00 30.45 ? 318 LYS B CG    1 
ATOM   5750  C CD    . LYS B 1 321 ? 18.964  -29.423 92.814  1.00 29.56 ? 318 LYS B CD    1 
ATOM   5751  C CE    . LYS B 1 321 ? 19.982  -28.573 92.078  1.00 31.23 ? 318 LYS B CE    1 
ATOM   5752  N NZ    . LYS B 1 321 ? 21.372  -28.955 92.472  1.00 31.29 ? 318 LYS B NZ    1 
ATOM   5753  N N     . VAL B 1 322 ? 14.320  -28.746 90.853  1.00 30.94 ? 319 VAL B N     1 
ATOM   5754  C CA    . VAL B 1 322 ? 14.106  -28.845 89.414  1.00 31.97 ? 319 VAL B CA    1 
ATOM   5755  C C     . VAL B 1 322 ? 14.847  -27.731 88.694  1.00 31.86 ? 319 VAL B C     1 
ATOM   5756  O O     . VAL B 1 322 ? 14.820  -26.575 89.113  1.00 33.44 ? 319 VAL B O     1 
ATOM   5757  C CB    . VAL B 1 322 ? 12.585  -28.800 89.019  1.00 32.76 ? 319 VAL B CB    1 
ATOM   5758  C CG1   . VAL B 1 322 ? 11.805  -29.860 89.792  1.00 33.33 ? 319 VAL B CG1   1 
ATOM   5759  C CG2   . VAL B 1 322 ? 11.999  -27.433 89.284  1.00 38.20 ? 319 VAL B CG2   1 
ATOM   5760  N N     . ASN B 1 323 ? 15.531  -28.095 87.617  1.00 31.59 ? 320 ASN B N     1 
ATOM   5761  C CA    . ASN B 1 323 ? 16.282  -27.132 86.829  1.00 30.51 ? 320 ASN B CA    1 
ATOM   5762  C C     . ASN B 1 323 ? 15.381  -26.518 85.761  1.00 30.58 ? 320 ASN B C     1 
ATOM   5763  O O     . ASN B 1 323 ? 15.093  -27.146 84.749  1.00 33.87 ? 320 ASN B O     1 
ATOM   5764  C CB    . ASN B 1 323 ? 17.476  -27.825 86.174  1.00 28.09 ? 320 ASN B CB    1 
ATOM   5765  C CG    . ASN B 1 323 ? 18.255  -26.907 85.266  1.00 30.08 ? 320 ASN B CG    1 
ATOM   5766  O OD1   . ASN B 1 323 ? 18.326  -27.131 84.052  1.00 31.83 ? 320 ASN B OD1   1 
ATOM   5767  N ND2   . ASN B 1 323 ? 18.847  -25.864 85.841  1.00 27.79 ? 320 ASN B ND2   1 
ATOM   5768  N N     . ILE B 1 324 ? 14.916  -25.298 85.993  1.00 29.38 ? 321 ILE B N     1 
ATOM   5769  C CA    . ILE B 1 324 ? 14.059  -24.629 85.026  1.00 27.42 ? 321 ILE B CA    1 
ATOM   5770  C C     . ILE B 1 324 ? 14.798  -24.505 83.710  1.00 26.63 ? 321 ILE B C     1 
ATOM   5771  O O     . ILE B 1 324 ? 14.292  -24.895 82.650  1.00 26.51 ? 321 ILE B O     1 
ATOM   5772  C CB    . ILE B 1 324 ? 13.701  -23.225 85.491  1.00 26.61 ? 321 ILE B CB    1 
ATOM   5773  C CG1   . ILE B 1 324 ? 13.258  -23.262 86.958  1.00 23.83 ? 321 ILE B CG1   1 
ATOM   5774  C CG2   . ILE B 1 324 ? 12.649  -22.648 84.561  1.00 27.44 ? 321 ILE B CG2   1 
ATOM   5775  C CD1   . ILE B 1 324 ? 12.151  -24.245 87.247  1.00 22.88 ? 321 ILE B CD1   1 
ATOM   5776  N N     . LYS B 1 325 ? 16.002  -23.950 83.801  1.00 25.76 ? 322 LYS B N     1 
ATOM   5777  C CA    . LYS B 1 325 ? 16.880  -23.743 82.656  1.00 27.01 ? 322 LYS B CA    1 
ATOM   5778  C C     . LYS B 1 325 ? 18.282  -23.388 83.157  1.00 27.44 ? 322 LYS B C     1 
ATOM   5779  O O     . LYS B 1 325 ? 18.471  -23.149 84.344  1.00 27.71 ? 322 LYS B O     1 
ATOM   5780  C CB    . LYS B 1 325 ? 16.346  -22.628 81.744  1.00 24.72 ? 322 LYS B CB    1 
ATOM   5781  C CG    . LYS B 1 325 ? 16.103  -21.286 82.401  1.00 24.38 ? 322 LYS B CG    1 
ATOM   5782  C CD    . LYS B 1 325 ? 15.958  -20.232 81.320  1.00 28.34 ? 322 LYS B CD    1 
ATOM   5783  C CE    . LYS B 1 325 ? 15.745  -18.848 81.865  1.00 27.93 ? 322 LYS B CE    1 
ATOM   5784  N NZ    . LYS B 1 325 ? 14.395  -18.772 82.459  1.00 33.48 ? 322 LYS B NZ    1 
ATOM   5785  N N     . PRO B 1 326 ? 19.280  -23.355 82.254  1.00 27.50 ? 323 PRO B N     1 
ATOM   5786  C CA    . PRO B 1 326 ? 20.658  -23.026 82.649  1.00 27.16 ? 323 PRO B CA    1 
ATOM   5787  C C     . PRO B 1 326 ? 20.749  -21.928 83.724  1.00 27.19 ? 323 PRO B C     1 
ATOM   5788  O O     . PRO B 1 326 ? 20.162  -20.853 83.581  1.00 26.66 ? 323 PRO B O     1 
ATOM   5789  C CB    . PRO B 1 326 ? 21.296  -22.616 81.326  1.00 27.22 ? 323 PRO B CB    1 
ATOM   5790  C CG    . PRO B 1 326 ? 20.633  -23.577 80.362  1.00 26.69 ? 323 PRO B CG    1 
ATOM   5791  C CD    . PRO B 1 326 ? 19.178  -23.546 80.792  1.00 24.69 ? 323 PRO B CD    1 
ATOM   5792  N N     . GLN B 1 327 ? 21.474  -22.216 84.805  1.00 26.36 ? 324 GLN B N     1 
ATOM   5793  C CA    . GLN B 1 327 ? 21.645  -21.268 85.908  1.00 23.80 ? 324 GLN B CA    1 
ATOM   5794  C C     . GLN B 1 327 ? 20.358  -20.927 86.647  1.00 21.80 ? 324 GLN B C     1 
ATOM   5795  O O     . GLN B 1 327 ? 20.301  -19.957 87.402  1.00 20.99 ? 324 GLN B O     1 
ATOM   5796  C CB    . GLN B 1 327 ? 22.295  -19.974 85.398  1.00 25.18 ? 324 GLN B CB    1 
ATOM   5797  C CG    . GLN B 1 327 ? 23.787  -20.127 85.089  1.00 27.48 ? 324 GLN B CG    1 
ATOM   5798  C CD    . GLN B 1 327 ? 24.055  -21.108 83.969  1.00 25.98 ? 324 GLN B CD    1 
ATOM   5799  O OE1   . GLN B 1 327 ? 23.747  -20.841 82.804  1.00 29.02 ? 324 GLN B OE1   1 
ATOM   5800  N NE2   . GLN B 1 327 ? 24.621  -22.251 84.313  1.00 24.86 ? 324 GLN B NE2   1 
ATOM   5801  N N     . VAL B 1 328 ? 19.319  -21.719 86.444  1.00 20.24 ? 325 VAL B N     1 
ATOM   5802  C CA    . VAL B 1 328 ? 18.067  -21.453 87.123  1.00 20.23 ? 325 VAL B CA    1 
ATOM   5803  C C     . VAL B 1 328 ? 17.520  -22.697 87.805  1.00 22.07 ? 325 VAL B C     1 
ATOM   5804  O O     . VAL B 1 328 ? 16.924  -23.563 87.175  1.00 22.73 ? 325 VAL B O     1 
ATOM   5805  C CB    . VAL B 1 328 ? 17.013  -20.899 86.149  1.00 17.63 ? 325 VAL B CB    1 
ATOM   5806  C CG1   . VAL B 1 328 ? 15.726  -20.611 86.889  1.00 16.58 ? 325 VAL B CG1   1 
ATOM   5807  C CG2   . VAL B 1 328 ? 17.518  -19.633 85.519  1.00 18.31 ? 325 VAL B CG2   1 
ATOM   5808  N N     . ASP B 1 329 ? 17.721  -22.783 89.107  1.00 24.17 ? 326 ASP B N     1 
ATOM   5809  C CA    . ASP B 1 329 ? 17.236  -23.936 89.844  1.00 27.91 ? 326 ASP B CA    1 
ATOM   5810  C C     . ASP B 1 329 ? 16.111  -23.521 90.782  1.00 28.21 ? 326 ASP B C     1 
ATOM   5811  O O     . ASP B 1 329 ? 16.105  -22.410 91.309  1.00 29.01 ? 326 ASP B O     1 
ATOM   5812  C CB    . ASP B 1 329 ? 18.395  -24.570 90.615  1.00 29.24 ? 326 ASP B CB    1 
ATOM   5813  C CG    . ASP B 1 329 ? 19.426  -25.192 89.694  1.00 31.62 ? 326 ASP B CG    1 
ATOM   5814  O OD1   . ASP B 1 329 ? 20.607  -25.265 90.082  1.00 36.28 ? 326 ASP B OD1   1 
ATOM   5815  O OD2   . ASP B 1 329 ? 19.057  -25.617 88.583  1.00 32.03 ? 326 ASP B OD2   1 
ATOM   5816  N N     . ARG B 1 330 ? 15.136  -24.402 90.957  1.00 29.17 ? 327 ARG B N     1 
ATOM   5817  C CA    . ARG B 1 330 ? 14.014  -24.109 91.837  1.00 29.42 ? 327 ARG B CA    1 
ATOM   5818  C C     . ARG B 1 330 ? 13.923  -25.256 92.822  1.00 29.31 ? 327 ARG B C     1 
ATOM   5819  O O     . ARG B 1 330 ? 13.749  -26.402 92.425  1.00 27.78 ? 327 ARG B O     1 
ATOM   5820  C CB    . ARG B 1 330 ? 12.721  -24.001 91.027  1.00 29.58 ? 327 ARG B CB    1 
ATOM   5821  C CG    . ARG B 1 330 ? 11.550  -23.357 91.774  1.00 29.38 ? 327 ARG B CG    1 
ATOM   5822  C CD    . ARG B 1 330 ? 10.264  -23.447 90.966  1.00 29.95 ? 327 ARG B CD    1 
ATOM   5823  N NE    . ARG B 1 330 ? 9.128   -22.832 91.651  1.00 32.43 ? 327 ARG B NE    1 
ATOM   5824  C CZ    . ARG B 1 330 ? 7.853   -23.143 91.419  1.00 34.14 ? 327 ARG B CZ    1 
ATOM   5825  N NH1   . ARG B 1 330 ? 7.540   -24.066 90.521  1.00 36.18 ? 327 ARG B NH1   1 
ATOM   5826  N NH2   . ARG B 1 330 ? 6.884   -22.537 92.088  1.00 33.86 ? 327 ARG B NH2   1 
ATOM   5827  N N     . TYR B 1 331 ? 14.071  -24.943 94.107  1.00 31.10 ? 328 TYR B N     1 
ATOM   5828  C CA    . TYR B 1 331 ? 14.019  -25.962 95.163  1.00 31.57 ? 328 TYR B CA    1 
ATOM   5829  C C     . TYR B 1 331 ? 12.708  -25.917 95.928  1.00 31.83 ? 328 TYR B C     1 
ATOM   5830  O O     . TYR B 1 331 ? 11.978  -24.920 95.882  1.00 31.86 ? 328 TYR B O     1 
ATOM   5831  C CB    . TYR B 1 331 ? 15.140  -25.770 96.200  1.00 30.37 ? 328 TYR B CB    1 
ATOM   5832  C CG    . TYR B 1 331 ? 16.548  -25.731 95.667  1.00 31.20 ? 328 TYR B CG    1 
ATOM   5833  C CD1   . TYR B 1 331 ? 17.105  -24.538 95.199  1.00 31.28 ? 328 TYR B CD1   1 
ATOM   5834  C CD2   . TYR B 1 331 ? 17.340  -26.884 95.649  1.00 30.31 ? 328 TYR B CD2   1 
ATOM   5835  C CE1   . TYR B 1 331 ? 18.421  -24.493 94.727  1.00 31.63 ? 328 TYR B CE1   1 
ATOM   5836  C CE2   . TYR B 1 331 ? 18.649  -26.851 95.178  1.00 30.58 ? 328 TYR B CE2   1 
ATOM   5837  C CZ    . TYR B 1 331 ? 19.183  -25.653 94.719  1.00 31.78 ? 328 TYR B CZ    1 
ATOM   5838  O OH    . TYR B 1 331 ? 20.470  -25.616 94.246  1.00 32.85 ? 328 TYR B OH    1 
ATOM   5839  N N     . ARG B 1 332 ? 12.425  -27.001 96.644  1.00 31.80 ? 329 ARG B N     1 
ATOM   5840  C CA    . ARG B 1 332 ? 11.236  -27.084 97.481  1.00 32.95 ? 329 ARG B CA    1 
ATOM   5841  C C     . ARG B 1 332 ? 11.695  -27.612 98.831  1.00 33.42 ? 329 ARG B C     1 
ATOM   5842  O O     . ARG B 1 332 ? 12.182  -28.736 98.922  1.00 32.80 ? 329 ARG B O     1 
ATOM   5843  C CB    . ARG B 1 332 ? 10.203  -28.016 96.881  1.00 32.17 ? 329 ARG B CB    1 
ATOM   5844  C CG    . ARG B 1 332 ? 8.991   -28.185 97.773  1.00 34.90 ? 329 ARG B CG    1 
ATOM   5845  C CD    . ARG B 1 332 ? 7.798   -28.681 96.990  1.00 36.70 ? 329 ARG B CD    1 
ATOM   5846  N NE    . ARG B 1 332 ? 6.599   -27.927 97.338  1.00 37.69 ? 329 ARG B NE    1 
ATOM   5847  C CZ    . ARG B 1 332 ? 5.610   -27.681 96.488  1.00 39.85 ? 329 ARG B CZ    1 
ATOM   5848  N NH1   . ARG B 1 332 ? 5.682   -28.133 95.243  1.00 40.09 ? 329 ARG B NH1   1 
ATOM   5849  N NH2   . ARG B 1 332 ? 4.555   -26.977 96.876  1.00 39.83 ? 329 ARG B NH2   1 
ATOM   5850  N N     . LEU B 1 333 ? 11.556  -26.785 99.868  1.00 34.45 ? 330 LEU B N     1 
ATOM   5851  C CA    . LEU B 1 333 ? 11.981  -27.149 101.222 1.00 34.52 ? 330 LEU B CA    1 
ATOM   5852  C C     . LEU B 1 333 ? 10.999  -28.079 101.938 1.00 35.34 ? 330 LEU B C     1 
ATOM   5853  O O     . LEU B 1 333 ? 9.867   -28.268 101.494 1.00 36.58 ? 330 LEU B O     1 
ATOM   5854  C CB    . LEU B 1 333 ? 12.206  -25.879 102.053 1.00 32.52 ? 330 LEU B CB    1 
ATOM   5855  C CG    . LEU B 1 333 ? 13.125  -24.810 101.447 1.00 31.65 ? 330 LEU B CG    1 
ATOM   5856  C CD1   . LEU B 1 333 ? 13.335  -23.674 102.429 1.00 31.69 ? 330 LEU B CD1   1 
ATOM   5857  C CD2   . LEU B 1 333 ? 14.453  -25.420 101.086 1.00 31.92 ? 330 LEU B CD2   1 
ATOM   5858  N N     . LYS B 1 334 ? 11.435  -28.652 103.056 1.00 37.24 ? 331 LYS B N     1 
ATOM   5859  C CA    . LYS B 1 334 ? 10.583  -29.556 103.819 1.00 36.91 ? 331 LYS B CA    1 
ATOM   5860  C C     . LYS B 1 334 ? 9.283   -28.873 104.240 1.00 36.16 ? 331 LYS B C     1 
ATOM   5861  O O     . LYS B 1 334 ? 8.249   -29.531 104.361 1.00 36.17 ? 331 LYS B O     1 
ATOM   5862  C CB    . LYS B 1 334 ? 11.348  -30.088 105.034 1.00 39.70 ? 331 LYS B CB    1 
ATOM   5863  C CG    . LYS B 1 334 ? 12.693  -30.708 104.660 1.00 43.52 ? 331 LYS B CG    1 
ATOM   5864  C CD    . LYS B 1 334 ? 13.502  -31.198 105.871 1.00 47.64 ? 331 LYS B CD    1 
ATOM   5865  C CE    . LYS B 1 334 ? 12.888  -32.457 106.513 1.00 51.16 ? 331 LYS B CE    1 
ATOM   5866  N NZ    . LYS B 1 334 ? 13.711  -33.013 107.643 1.00 50.12 ? 331 LYS B NZ    1 
ATOM   5867  N N     . ASN B 1 335 ? 9.326   -27.555 104.439 1.00 35.71 ? 332 ASN B N     1 
ATOM   5868  C CA    . ASN B 1 335 ? 8.125   -26.809 104.821 1.00 35.19 ? 332 ASN B CA    1 
ATOM   5869  C C     . ASN B 1 335 ? 7.134   -26.661 103.664 1.00 35.36 ? 332 ASN B C     1 
ATOM   5870  O O     . ASN B 1 335 ? 6.021   -26.173 103.857 1.00 36.40 ? 332 ASN B O     1 
ATOM   5871  C CB    . ASN B 1 335 ? 8.472   -25.409 105.371 1.00 35.19 ? 332 ASN B CB    1 
ATOM   5872  C CG    . ASN B 1 335 ? 9.224   -24.532 104.367 1.00 35.73 ? 332 ASN B CG    1 
ATOM   5873  O OD1   . ASN B 1 335 ? 9.051   -24.655 103.156 1.00 37.43 ? 332 ASN B OD1   1 
ATOM   5874  N ND2   . ASN B 1 335 ? 10.050  -23.622 104.882 1.00 33.58 ? 332 ASN B ND2   1 
ATOM   5875  N N     . GLY B 1 336 ? 7.530   -27.075 102.465 1.00 33.99 ? 333 GLY B N     1 
ATOM   5876  C CA    . GLY B 1 336 ? 6.635   -26.956 101.331 1.00 33.48 ? 333 GLY B CA    1 
ATOM   5877  C C     . GLY B 1 336 ? 6.912   -25.736 100.465 1.00 33.52 ? 333 GLY B C     1 
ATOM   5878  O O     . GLY B 1 336 ? 6.724   -25.785 99.253  1.00 33.58 ? 333 GLY B O     1 
ATOM   5879  N N     . ARG B 1 337 ? 7.358   -24.640 101.073 1.00 33.23 ? 334 ARG B N     1 
ATOM   5880  C CA    . ARG B 1 337 ? 7.643   -23.435 100.303 1.00 32.09 ? 334 ARG B CA    1 
ATOM   5881  C C     . ARG B 1 337 ? 8.854   -23.626 99.388  1.00 32.14 ? 334 ARG B C     1 
ATOM   5882  O O     . ARG B 1 337 ? 9.775   -24.390 99.695  1.00 33.06 ? 334 ARG B O     1 
ATOM   5883  C CB    . ARG B 1 337 ? 7.839   -22.229 101.235 1.00 30.91 ? 334 ARG B CB    1 
ATOM   5884  C CG    . ARG B 1 337 ? 6.580   -21.881 102.051 1.00 30.25 ? 334 ARG B CG    1 
ATOM   5885  C CD    . ARG B 1 337 ? 6.623   -20.456 102.626 1.00 30.18 ? 334 ARG B CD    1 
ATOM   5886  N NE    . ARG B 1 337 ? 7.845   -20.223 103.391 1.00 30.88 ? 334 ARG B NE    1 
ATOM   5887  C CZ    . ARG B 1 337 ? 8.089   -20.757 104.584 1.00 29.46 ? 334 ARG B CZ    1 
ATOM   5888  N NH1   . ARG B 1 337 ? 7.184   -21.546 105.151 1.00 28.14 ? 334 ARG B NH1   1 
ATOM   5889  N NH2   . ARG B 1 337 ? 9.249   -20.528 105.190 1.00 27.43 ? 334 ARG B NH2   1 
ATOM   5890  N N     . ARG B 1 338 ? 8.845   -22.929 98.258  1.00 31.31 ? 335 ARG B N     1 
ATOM   5891  C CA    . ARG B 1 338 ? 9.920   -23.045 97.285  1.00 29.87 ? 335 ARG B CA    1 
ATOM   5892  C C     . ARG B 1 338 ? 10.877  -21.870 97.226  1.00 28.05 ? 335 ARG B C     1 
ATOM   5893  O O     . ARG B 1 338 ? 10.553  -20.770 97.667  1.00 27.62 ? 335 ARG B O     1 
ATOM   5894  C CB    . ARG B 1 338 ? 9.305   -23.305 95.913  1.00 30.97 ? 335 ARG B CB    1 
ATOM   5895  C CG    . ARG B 1 338 ? 8.623   -24.659 95.865  1.00 31.77 ? 335 ARG B CG    1 
ATOM   5896  C CD    . ARG B 1 338 ? 7.497   -24.670 94.877  1.00 31.78 ? 335 ARG B CD    1 
ATOM   5897  N NE    . ARG B 1 338 ? 6.480   -23.693 95.237  1.00 29.96 ? 335 ARG B NE    1 
ATOM   5898  C CZ    . ARG B 1 338 ? 5.273   -23.660 94.692  1.00 29.47 ? 335 ARG B CZ    1 
ATOM   5899  N NH1   . ARG B 1 338 ? 4.951   -24.555 93.771  1.00 30.82 ? 335 ARG B NH1   1 
ATOM   5900  N NH2   . ARG B 1 338 ? 4.395   -22.739 95.059  1.00 28.93 ? 335 ARG B NH2   1 
ATOM   5901  N N     . ILE B 1 339 ? 12.067  -22.127 96.682  1.00 27.19 ? 336 ILE B N     1 
ATOM   5902  C CA    . ILE B 1 339 ? 13.126  -21.119 96.546  1.00 26.41 ? 336 ILE B CA    1 
ATOM   5903  C C     . ILE B 1 339 ? 13.838  -21.204 95.182  1.00 24.45 ? 336 ILE B C     1 
ATOM   5904  O O     . ILE B 1 339 ? 14.333  -22.262 94.793  1.00 24.43 ? 336 ILE B O     1 
ATOM   5905  C CB    . ILE B 1 339 ? 14.195  -21.292 97.656  1.00 26.52 ? 336 ILE B CB    1 
ATOM   5906  C CG1   . ILE B 1 339 ? 13.563  -21.077 99.028  1.00 28.12 ? 336 ILE B CG1   1 
ATOM   5907  C CG2   . ILE B 1 339 ? 15.320  -20.293 97.460  1.00 25.82 ? 336 ILE B CG2   1 
ATOM   5908  C CD1   . ILE B 1 339 ? 14.490  -21.407 100.181 1.00 29.53 ? 336 ILE B CD1   1 
ATOM   5909  N N     . ILE B 1 340 ? 13.883  -20.080 94.468  1.00 22.25 ? 337 ILE B N     1 
ATOM   5910  C CA    . ILE B 1 340 ? 14.538  -20.017 93.157  1.00 20.89 ? 337 ILE B CA    1 
ATOM   5911  C C     . ILE B 1 340 ? 15.956  -19.447 93.300  1.00 21.35 ? 337 ILE B C     1 
ATOM   5912  O O     . ILE B 1 340 ? 16.146  -18.285 93.680  1.00 22.12 ? 337 ILE B O     1 
ATOM   5913  C CB    . ILE B 1 340 ? 13.695  -19.167 92.165  1.00 18.93 ? 337 ILE B CB    1 
ATOM   5914  C CG1   . ILE B 1 340 ? 12.395  -19.915 91.843  1.00 17.44 ? 337 ILE B CG1   1 
ATOM   5915  C CG2   . ILE B 1 340 ? 14.479  -18.891 90.876  1.00 20.20 ? 337 ILE B CG2   1 
ATOM   5916  C CD1   . ILE B 1 340 ? 11.276  -19.046 91.327  1.00 13.34 ? 337 ILE B CD1   1 
ATOM   5917  N N     . LEU B 1 341 ? 16.942  -20.292 93.010  1.00 21.14 ? 338 LEU B N     1 
ATOM   5918  C CA    . LEU B 1 341 ? 18.352  -19.940 93.109  1.00 22.59 ? 338 LEU B CA    1 
ATOM   5919  C C     . LEU B 1 341 ? 18.878  -19.624 91.716  1.00 21.26 ? 338 LEU B C     1 
ATOM   5920  O O     . LEU B 1 341 ? 18.560  -20.329 90.769  1.00 21.98 ? 338 LEU B O     1 
ATOM   5921  C CB    . LEU B 1 341 ? 19.131  -21.127 93.705  1.00 23.00 ? 338 LEU B CB    1 
ATOM   5922  C CG    . LEU B 1 341 ? 20.443  -20.873 94.450  1.00 24.20 ? 338 LEU B CG    1 
ATOM   5923  C CD1   . LEU B 1 341 ? 21.513  -20.357 93.515  1.00 25.65 ? 338 LEU B CD1   1 
ATOM   5924  C CD2   . LEU B 1 341 ? 20.169  -19.864 95.560  1.00 27.26 ? 338 LEU B CD2   1 
ATOM   5925  N N     . LEU B 1 342 ? 19.693  -18.578 91.597  1.00 20.45 ? 339 LEU B N     1 
ATOM   5926  C CA    . LEU B 1 342 ? 20.246  -18.187 90.298  1.00 21.55 ? 339 LEU B CA    1 
ATOM   5927  C C     . LEU B 1 342 ? 21.766  -18.332 90.190  1.00 20.82 ? 339 LEU B C     1 
ATOM   5928  O O     . LEU B 1 342 ? 22.492  -17.980 91.113  1.00 22.54 ? 339 LEU B O     1 
ATOM   5929  C CB    . LEU B 1 342 ? 19.859  -16.736 89.973  1.00 21.13 ? 339 LEU B CB    1 
ATOM   5930  C CG    . LEU B 1 342 ? 18.388  -16.337 90.103  1.00 19.10 ? 339 LEU B CG    1 
ATOM   5931  C CD1   . LEU B 1 342 ? 18.235  -15.003 89.409  1.00 17.95 ? 339 LEU B CD1   1 
ATOM   5932  C CD2   . LEU B 1 342 ? 17.444  -17.391 89.503  1.00 17.80 ? 339 LEU B CD2   1 
ATOM   5933  N N     . ALA B 1 343 ? 22.232  -18.848 89.053  1.00 20.91 ? 340 ALA B N     1 
ATOM   5934  C CA    . ALA B 1 343 ? 23.657  -19.060 88.786  1.00 20.65 ? 340 ALA B CA    1 
ATOM   5935  C C     . ALA B 1 343 ? 24.371  -19.883 89.872  1.00 21.55 ? 340 ALA B C     1 
ATOM   5936  O O     . ALA B 1 343 ? 25.586  -19.788 90.034  1.00 20.97 ? 340 ALA B O     1 
ATOM   5937  C CB    . ALA B 1 343 ? 24.353  -17.714 88.603  1.00 19.05 ? 340 ALA B CB    1 
ATOM   5938  N N     . GLU B 1 344 ? 23.606  -20.691 90.605  1.00 23.17 ? 341 GLU B N     1 
ATOM   5939  C CA    . GLU B 1 344 ? 24.133  -21.530 91.683  1.00 24.97 ? 341 GLU B CA    1 
ATOM   5940  C C     . GLU B 1 344 ? 24.920  -20.709 92.691  1.00 24.25 ? 341 GLU B C     1 
ATOM   5941  O O     . GLU B 1 344 ? 25.906  -21.177 93.268  1.00 23.87 ? 341 GLU B O     1 
ATOM   5942  C CB    . GLU B 1 344 ? 24.998  -22.671 91.110  1.00 24.21 ? 341 GLU B CB    1 
ATOM   5943  C CG    . GLU B 1 344 ? 24.151  -23.742 90.440  1.00 28.86 ? 341 GLU B CG    1 
ATOM   5944  C CD    . GLU B 1 344 ? 24.951  -24.788 89.670  1.00 34.68 ? 341 GLU B CD    1 
ATOM   5945  O OE1   . GLU B 1 344 ? 25.518  -25.714 90.305  1.00 37.10 ? 341 GLU B OE1   1 
ATOM   5946  O OE2   . GLU B 1 344 ? 25.003  -24.686 88.419  1.00 36.68 ? 341 GLU B OE2   1 
ATOM   5947  N N     . GLY B 1 345 ? 24.477  -19.475 92.895  1.00 22.54 ? 342 GLY B N     1 
ATOM   5948  C CA    . GLY B 1 345 ? 25.147  -18.613 93.842  1.00 23.55 ? 342 GLY B CA    1 
ATOM   5949  C C     . GLY B 1 345 ? 26.269  -17.771 93.263  1.00 24.35 ? 342 GLY B C     1 
ATOM   5950  O O     . GLY B 1 345 ? 26.866  -16.983 93.990  1.00 27.61 ? 342 GLY B O     1 
ATOM   5951  N N     . ARG B 1 346 ? 26.570  -17.913 91.975  1.00 23.05 ? 343 ARG B N     1 
ATOM   5952  C CA    . ARG B 1 346 ? 27.642  -17.115 91.378  1.00 21.21 ? 343 ARG B CA    1 
ATOM   5953  C C     . ARG B 1 346 ? 27.109  -15.779 90.868  1.00 20.50 ? 343 ARG B C     1 
ATOM   5954  O O     . ARG B 1 346 ? 25.903  -15.624 90.721  1.00 20.88 ? 343 ARG B O     1 
ATOM   5955  C CB    . ARG B 1 346 ? 28.314  -17.926 90.295  1.00 19.88 ? 343 ARG B CB    1 
ATOM   5956  C CG    . ARG B 1 346 ? 28.997  -19.108 90.934  1.00 24.15 ? 343 ARG B CG    1 
ATOM   5957  C CD    . ARG B 1 346 ? 29.412  -20.160 89.955  1.00 28.43 ? 343 ARG B CD    1 
ATOM   5958  N NE    . ARG B 1 346 ? 29.927  -21.365 90.609  1.00 28.53 ? 343 ARG B NE    1 
ATOM   5959  C CZ    . ARG B 1 346 ? 29.224  -22.159 91.413  1.00 28.98 ? 343 ARG B CZ    1 
ATOM   5960  N NH1   . ARG B 1 346 ? 27.956  -21.890 91.701  1.00 30.92 ? 343 ARG B NH1   1 
ATOM   5961  N NH2   . ARG B 1 346 ? 29.777  -23.258 91.892  1.00 27.18 ? 343 ARG B NH2   1 
ATOM   5962  N N     . LEU B 1 347 ? 27.987  -14.805 90.629  1.00 19.96 ? 344 LEU B N     1 
ATOM   5963  C CA    . LEU B 1 347 ? 27.527  -13.495 90.177  1.00 21.17 ? 344 LEU B CA    1 
ATOM   5964  C C     . LEU B 1 347 ? 26.518  -13.595 89.032  1.00 21.26 ? 344 LEU B C     1 
ATOM   5965  O O     . LEU B 1 347 ? 26.861  -13.882 87.892  1.00 21.33 ? 344 LEU B O     1 
ATOM   5966  C CB    . LEU B 1 347 ? 28.701  -12.582 89.802  1.00 20.33 ? 344 LEU B CB    1 
ATOM   5967  C CG    . LEU B 1 347 ? 29.671  -12.881 88.663  1.00 20.59 ? 344 LEU B CG    1 
ATOM   5968  C CD1   . LEU B 1 347 ? 30.661  -11.735 88.591  1.00 19.36 ? 344 LEU B CD1   1 
ATOM   5969  C CD2   . LEU B 1 347 ? 30.397  -14.197 88.896  1.00 22.24 ? 344 LEU B CD2   1 
ATOM   5970  N N     . VAL B 1 348 ? 25.263  -13.331 89.389  1.00 22.22 ? 345 VAL B N     1 
ATOM   5971  C CA    . VAL B 1 348 ? 24.113  -13.397 88.503  1.00 21.90 ? 345 VAL B CA    1 
ATOM   5972  C C     . VAL B 1 348 ? 24.091  -12.494 87.272  1.00 22.92 ? 345 VAL B C     1 
ATOM   5973  O O     . VAL B 1 348 ? 23.618  -12.919 86.206  1.00 24.46 ? 345 VAL B O     1 
ATOM   5974  C CB    . VAL B 1 348 ? 22.834  -13.126 89.291  1.00 21.84 ? 345 VAL B CB    1 
ATOM   5975  C CG1   . VAL B 1 348 ? 22.823  -11.668 89.756  1.00 19.37 ? 345 VAL B CG1   1 
ATOM   5976  C CG2   . VAL B 1 348 ? 21.617  -13.466 88.445  1.00 21.69 ? 345 VAL B CG2   1 
ATOM   5977  N N     . ASN B 1 349 ? 24.579  -11.262 87.407  1.00 21.01 ? 346 ASN B N     1 
ATOM   5978  C CA    . ASN B 1 349 ? 24.556  -10.335 86.280  1.00 21.69 ? 346 ASN B CA    1 
ATOM   5979  C C     . ASN B 1 349 ? 25.320  -10.887 85.074  1.00 23.65 ? 346 ASN B C     1 
ATOM   5980  O O     . ASN B 1 349 ? 24.892  -10.732 83.931  1.00 24.40 ? 346 ASN B O     1 
ATOM   5981  C CB    . ASN B 1 349 ? 25.095  -8.947  86.685  1.00 19.10 ? 346 ASN B CB    1 
ATOM   5982  C CG    . ASN B 1 349 ? 26.574  -8.955  87.075  1.00 18.40 ? 346 ASN B CG    1 
ATOM   5983  O OD1   . ASN B 1 349 ? 27.279  -7.973  86.839  1.00 18.15 ? 346 ASN B OD1   1 
ATOM   5984  N ND2   . ASN B 1 349 ? 27.039  -10.038 87.683  1.00 15.18 ? 346 ASN B ND2   1 
ATOM   5985  N N     . LEU B 1 350 ? 26.439  -11.555 85.341  1.00 25.32 ? 347 LEU B N     1 
ATOM   5986  C CA    . LEU B 1 350 ? 27.275  -12.149 84.304  1.00 23.72 ? 347 LEU B CA    1 
ATOM   5987  C C     . LEU B 1 350 ? 26.902  -13.609 84.033  1.00 24.24 ? 347 LEU B C     1 
ATOM   5988  O O     . LEU B 1 350 ? 27.117  -14.110 82.924  1.00 23.47 ? 347 LEU B O     1 
ATOM   5989  C CB    . LEU B 1 350 ? 28.748  -12.067 84.714  1.00 23.68 ? 347 LEU B CB    1 
ATOM   5990  C CG    . LEU B 1 350 ? 29.488  -10.760 84.429  1.00 23.26 ? 347 LEU B CG    1 
ATOM   5991  C CD1   . LEU B 1 350 ? 30.747  -10.736 85.245  1.00 20.69 ? 347 LEU B CD1   1 
ATOM   5992  C CD2   . LEU B 1 350 ? 29.798  -10.637 82.929  1.00 20.89 ? 347 LEU B CD2   1 
ATOM   5993  N N     . GLY B 1 351 ? 26.352  -14.280 85.044  1.00 22.80 ? 348 GLY B N     1 
ATOM   5994  C CA    . GLY B 1 351 ? 25.956  -15.665 84.889  1.00 23.66 ? 348 GLY B CA    1 
ATOM   5995  C C     . GLY B 1 351 ? 24.608  -15.833 84.215  1.00 24.08 ? 348 GLY B C     1 
ATOM   5996  O O     . GLY B 1 351 ? 24.407  -16.772 83.446  1.00 24.22 ? 348 GLY B O     1 
ATOM   5997  N N     . CYS B 1 352 ? 23.679  -14.929 84.513  1.00 24.21 ? 349 CYS B N     1 
ATOM   5998  C CA    . CYS B 1 352 ? 22.346  -14.973 83.931  1.00 22.09 ? 349 CYS B CA    1 
ATOM   5999  C C     . CYS B 1 352 ? 22.135  -13.902 82.861  1.00 22.53 ? 349 CYS B C     1 
ATOM   6000  O O     . CYS B 1 352 ? 21.054  -13.819 82.268  1.00 22.41 ? 349 CYS B O     1 
ATOM   6001  C CB    . CYS B 1 352 ? 21.284  -14.831 85.027  1.00 21.76 ? 349 CYS B CB    1 
ATOM   6002  S SG    . CYS B 1 352 ? 21.262  -16.194 86.227  1.00 23.48 ? 349 CYS B SG    1 
ATOM   6003  N N     . ALA B 1 353 ? 23.147  -13.077 82.600  1.00 20.11 ? 350 ALA B N     1 
ATOM   6004  C CA    . ALA B 1 353 ? 22.988  -12.066 81.552  1.00 20.73 ? 350 ALA B CA    1 
ATOM   6005  C C     . ALA B 1 353 ? 24.274  -11.717 80.803  1.00 19.81 ? 350 ALA B C     1 
ATOM   6006  O O     . ALA B 1 353 ? 25.069  -12.593 80.482  1.00 19.79 ? 350 ALA B O     1 
ATOM   6007  C CB    . ALA B 1 353 ? 22.341  -10.794 82.126  1.00 20.71 ? 350 ALA B CB    1 
ATOM   6008  N N     . MET B 1 354 ? 24.482  -10.435 80.537  1.00 19.74 ? 351 MET B N     1 
ATOM   6009  C CA    . MET B 1 354 ? 25.653  -10.007 79.793  1.00 20.54 ? 351 MET B CA    1 
ATOM   6010  C C     . MET B 1 354 ? 26.586  -9.106  80.592  1.00 21.76 ? 351 MET B C     1 
ATOM   6011  O O     . MET B 1 354 ? 27.441  -8.422  80.026  1.00 22.04 ? 351 MET B O     1 
ATOM   6012  C CB    . MET B 1 354 ? 25.194  -9.296  78.516  1.00 21.82 ? 351 MET B CB    1 
ATOM   6013  C CG    . MET B 1 354 ? 24.304  -10.173 77.617  1.00 23.29 ? 351 MET B CG    1 
ATOM   6014  S SD    . MET B 1 354 ? 25.166  -11.588 76.922  1.00 21.88 ? 351 MET B SD    1 
ATOM   6015  C CE    . MET B 1 354 ? 26.048  -10.802 75.579  1.00 21.71 ? 351 MET B CE    1 
ATOM   6016  N N     . GLY B 1 355 ? 26.442  -9.114  81.910  1.00 21.85 ? 352 GLY B N     1 
ATOM   6017  C CA    . GLY B 1 355 ? 27.296  -8.263  82.715  1.00 20.71 ? 352 GLY B CA    1 
ATOM   6018  C C     . GLY B 1 355 ? 26.946  -6.812  82.429  1.00 21.52 ? 352 GLY B C     1 
ATOM   6019  O O     . GLY B 1 355 ? 25.865  -6.521  81.908  1.00 21.53 ? 352 GLY B O     1 
ATOM   6020  N N     . HIS B 1 356 ? 27.853  -5.902  82.760  1.00 19.48 ? 353 HIS B N     1 
ATOM   6021  C CA    . HIS B 1 356 ? 27.609  -4.488  82.546  1.00 21.96 ? 353 HIS B CA    1 
ATOM   6022  C C     . HIS B 1 356 ? 27.661  -4.115  81.061  1.00 23.49 ? 353 HIS B C     1 
ATOM   6023  O O     . HIS B 1 356 ? 28.305  -4.802  80.268  1.00 24.15 ? 353 HIS B O     1 
ATOM   6024  C CB    . HIS B 1 356 ? 28.637  -3.661  83.319  1.00 20.38 ? 353 HIS B CB    1 
ATOM   6025  C CG    . HIS B 1 356 ? 28.609  -3.892  84.800  1.00 22.03 ? 353 HIS B CG    1 
ATOM   6026  N ND1   . HIS B 1 356 ? 29.549  -3.352  85.656  1.00 21.54 ? 353 HIS B ND1   1 
ATOM   6027  C CD2   . HIS B 1 356 ? 27.751  -4.593  85.580  1.00 22.02 ? 353 HIS B CD2   1 
ATOM   6028  C CE1   . HIS B 1 356 ? 29.267  -3.709  86.895  1.00 24.29 ? 353 HIS B CE1   1 
ATOM   6029  N NE2   . HIS B 1 356 ? 28.179  -4.461  86.878  1.00 24.60 ? 353 HIS B NE2   1 
ATOM   6030  N N     . PRO B 1 357 ? 26.944  -3.044  80.665  1.00 23.20 ? 354 PRO B N     1 
ATOM   6031  C CA    . PRO B 1 357 ? 26.951  -2.611  79.267  1.00 22.46 ? 354 PRO B CA    1 
ATOM   6032  C C     . PRO B 1 357 ? 28.349  -2.093  78.944  1.00 22.10 ? 354 PRO B C     1 
ATOM   6033  O O     . PRO B 1 357 ? 29.064  -1.593  79.812  1.00 23.93 ? 354 PRO B O     1 
ATOM   6034  C CB    . PRO B 1 357 ? 25.926  -1.483  79.235  1.00 23.19 ? 354 PRO B CB    1 
ATOM   6035  C CG    . PRO B 1 357 ? 24.988  -1.841  80.329  1.00 24.38 ? 354 PRO B CG    1 
ATOM   6036  C CD    . PRO B 1 357 ? 25.896  -2.343  81.425  1.00 22.86 ? 354 PRO B CD    1 
ATOM   6037  N N     . SER B 1 358 ? 28.725  -2.207  77.685  1.00 21.71 ? 355 SER B N     1 
ATOM   6038  C CA    . SER B 1 358 ? 30.023  -1.777  77.213  1.00 22.06 ? 355 SER B CA    1 
ATOM   6039  C C     . SER B 1 358 ? 30.457  -0.338  77.550  1.00 22.49 ? 355 SER B C     1 
ATOM   6040  O O     . SER B 1 358 ? 31.655  -0.089  77.717  1.00 23.16 ? 355 SER B O     1 
ATOM   6041  C CB    . SER B 1 358 ? 30.063  -1.983  75.705  1.00 21.81 ? 355 SER B CB    1 
ATOM   6042  O OG    . SER B 1 358 ? 28.948  -1.340  75.120  1.00 22.59 ? 355 SER B OG    1 
ATOM   6043  N N     . PHE B 1 359 ? 29.519  0.605   77.659  1.00 22.17 ? 356 PHE B N     1 
ATOM   6044  C CA    . PHE B 1 359 ? 29.910  1.992   77.959  1.00 21.54 ? 356 PHE B CA    1 
ATOM   6045  C C     . PHE B 1 359 ? 30.640  2.138   79.300  1.00 21.52 ? 356 PHE B C     1 
ATOM   6046  O O     . PHE B 1 359 ? 31.775  2.608   79.346  1.00 20.19 ? 356 PHE B O     1 
ATOM   6047  C CB    . PHE B 1 359 ? 28.697  2.947   77.935  1.00 21.19 ? 356 PHE B CB    1 
ATOM   6048  C CG    . PHE B 1 359 ? 29.076  4.405   78.079  1.00 20.17 ? 356 PHE B CG    1 
ATOM   6049  C CD1   . PHE B 1 359 ? 29.729  5.078   77.056  1.00 18.69 ? 356 PHE B CD1   1 
ATOM   6050  C CD2   . PHE B 1 359 ? 28.855  5.078   79.286  1.00 21.62 ? 356 PHE B CD2   1 
ATOM   6051  C CE1   . PHE B 1 359 ? 30.166  6.400   77.221  1.00 18.07 ? 356 PHE B CE1   1 
ATOM   6052  C CE2   . PHE B 1 359 ? 29.284  6.398   79.466  1.00 19.41 ? 356 PHE B CE2   1 
ATOM   6053  C CZ    . PHE B 1 359 ? 29.942  7.061   78.433  1.00 19.88 ? 356 PHE B CZ    1 
ATOM   6054  N N     . VAL B 1 360 ? 29.995  1.733   80.389  1.00 22.30 ? 357 VAL B N     1 
ATOM   6055  C CA    . VAL B 1 360 ? 30.619  1.841   81.702  1.00 22.47 ? 357 VAL B CA    1 
ATOM   6056  C C     . VAL B 1 360 ? 31.865  0.948   81.784  1.00 24.71 ? 357 VAL B C     1 
ATOM   6057  O O     . VAL B 1 360 ? 32.819  1.266   82.488  1.00 26.98 ? 357 VAL B O     1 
ATOM   6058  C CB    . VAL B 1 360 ? 29.628  1.452   82.804  1.00 21.82 ? 357 VAL B CB    1 
ATOM   6059  C CG1   . VAL B 1 360 ? 29.482  -0.045  82.840  1.00 22.87 ? 357 VAL B CG1   1 
ATOM   6060  C CG2   . VAL B 1 360 ? 30.070  2.012   84.131  1.00 21.54 ? 357 VAL B CG2   1 
ATOM   6061  N N     . MET B 1 361 ? 31.863  -0.172  81.066  1.00 25.15 ? 358 MET B N     1 
ATOM   6062  C CA    . MET B 1 361 ? 33.029  -1.055  81.096  1.00 24.92 ? 358 MET B CA    1 
ATOM   6063  C C     . MET B 1 361 ? 34.221  -0.388  80.413  1.00 25.20 ? 358 MET B C     1 
ATOM   6064  O O     . MET B 1 361 ? 35.370  -0.696  80.717  1.00 24.78 ? 358 MET B O     1 
ATOM   6065  C CB    . MET B 1 361 ? 32.726  -2.393  80.426  1.00 23.79 ? 358 MET B CB    1 
ATOM   6066  C CG    . MET B 1 361 ? 31.864  -3.328  81.256  1.00 23.77 ? 358 MET B CG    1 
ATOM   6067  S SD    . MET B 1 361 ? 32.468  -3.479  82.965  1.00 27.48 ? 358 MET B SD    1 
ATOM   6068  C CE    . MET B 1 361 ? 34.133  -4.048  82.681  1.00 19.44 ? 358 MET B CE    1 
ATOM   6069  N N     . SER B 1 362 ? 33.947  0.539   79.499  1.00 25.23 ? 359 SER B N     1 
ATOM   6070  C CA    . SER B 1 362 ? 35.021  1.233   78.798  1.00 26.33 ? 359 SER B CA    1 
ATOM   6071  C C     . SER B 1 362 ? 35.862  1.993   79.826  1.00 26.81 ? 359 SER B C     1 
ATOM   6072  O O     . SER B 1 362 ? 37.078  2.124   79.682  1.00 25.33 ? 359 SER B O     1 
ATOM   6073  C CB    . SER B 1 362 ? 34.445  2.196   77.755  1.00 25.48 ? 359 SER B CB    1 
ATOM   6074  O OG    . SER B 1 362 ? 35.473  2.909   77.083  1.00 24.94 ? 359 SER B OG    1 
ATOM   6075  N N     . ASN B 1 363 ? 35.184  2.491   80.860  1.00 28.20 ? 360 ASN B N     1 
ATOM   6076  C CA    . ASN B 1 363 ? 35.822  3.223   81.958  1.00 27.37 ? 360 ASN B CA    1 
ATOM   6077  C C     . ASN B 1 363 ? 36.803  2.288   82.671  1.00 27.77 ? 360 ASN B C     1 
ATOM   6078  O O     . ASN B 1 363 ? 37.999  2.570   82.781  1.00 26.72 ? 360 ASN B O     1 
ATOM   6079  C CB    . ASN B 1 363 ? 34.750  3.702   82.943  1.00 25.97 ? 360 ASN B CB    1 
ATOM   6080  C CG    . ASN B 1 363 ? 34.459  5.196   82.824  1.00 27.12 ? 360 ASN B CG    1 
ATOM   6081  O OD1   . ASN B 1 363 ? 34.463  5.771   81.729  1.00 24.69 ? 360 ASN B OD1   1 
ATOM   6082  N ND2   . ASN B 1 363 ? 34.193  5.829   83.961  1.00 27.24 ? 360 ASN B ND2   1 
ATOM   6083  N N     . SER B 1 364 ? 36.282  1.164   83.143  1.00 27.64 ? 361 SER B N     1 
ATOM   6084  C CA    . SER B 1 364 ? 37.097  0.193   83.848  1.00 28.79 ? 361 SER B CA    1 
ATOM   6085  C C     . SER B 1 364 ? 38.287  -0.243  83.009  1.00 28.65 ? 361 SER B C     1 
ATOM   6086  O O     . SER B 1 364 ? 39.440  -0.157  83.444  1.00 27.82 ? 361 SER B O     1 
ATOM   6087  C CB    . SER B 1 364 ? 36.260  -1.028  84.198  1.00 28.38 ? 361 SER B CB    1 
ATOM   6088  O OG    . SER B 1 364 ? 34.971  -0.622  84.616  1.00 30.97 ? 361 SER B OG    1 
ATOM   6089  N N     . PHE B 1 365 ? 38.010  -0.694  81.794  1.00 26.96 ? 362 PHE B N     1 
ATOM   6090  C CA    . PHE B 1 365 ? 39.081  -1.164  80.947  1.00 25.84 ? 362 PHE B CA    1 
ATOM   6091  C C     . PHE B 1 365 ? 40.085  -0.114  80.472  1.00 26.97 ? 362 PHE B C     1 
ATOM   6092  O O     . PHE B 1 365 ? 41.232  -0.448  80.183  1.00 26.81 ? 362 PHE B O     1 
ATOM   6093  C CB    . PHE B 1 365 ? 38.493  -1.947  79.780  1.00 24.25 ? 362 PHE B CB    1 
ATOM   6094  C CG    . PHE B 1 365 ? 37.794  -3.213  80.205  1.00 23.45 ? 362 PHE B CG    1 
ATOM   6095  C CD1   . PHE B 1 365 ? 37.985  -3.749  81.494  1.00 22.23 ? 362 PHE B CD1   1 
ATOM   6096  C CD2   . PHE B 1 365 ? 36.978  -3.898  79.313  1.00 21.26 ? 362 PHE B CD2   1 
ATOM   6097  C CE1   . PHE B 1 365 ? 37.375  -4.946  81.866  1.00 19.51 ? 362 PHE B CE1   1 
ATOM   6098  C CE2   . PHE B 1 365 ? 36.367  -5.090  79.676  1.00 21.52 ? 362 PHE B CE2   1 
ATOM   6099  C CZ    . PHE B 1 365 ? 36.566  -5.616  80.953  1.00 21.41 ? 362 PHE B CZ    1 
ATOM   6100  N N     . THR B 1 366 ? 39.678  1.149   80.400  1.00 28.23 ? 363 THR B N     1 
ATOM   6101  C CA    . THR B 1 366 ? 40.619  2.189   80.000  1.00 30.19 ? 363 THR B CA    1 
ATOM   6102  C C     . THR B 1 366 ? 41.684  2.303   81.100  1.00 30.75 ? 363 THR B C     1 
ATOM   6103  O O     . THR B 1 366 ? 42.854  2.561   80.824  1.00 28.57 ? 363 THR B O     1 
ATOM   6104  C CB    . THR B 1 366 ? 39.925  3.549   79.810  1.00 32.44 ? 363 THR B CB    1 
ATOM   6105  O OG1   . THR B 1 366 ? 39.208  3.546   78.568  1.00 36.15 ? 363 THR B OG1   1 
ATOM   6106  C CG2   . THR B 1 366 ? 40.942  4.682   79.789  1.00 33.08 ? 363 THR B CG2   1 
ATOM   6107  N N     . ASN B 1 367 ? 41.266  2.100   82.347  1.00 31.06 ? 364 ASN B N     1 
ATOM   6108  C CA    . ASN B 1 367 ? 42.179  2.150   83.489  1.00 31.75 ? 364 ASN B CA    1 
ATOM   6109  C C     . ASN B 1 367 ? 43.098  0.931   83.450  1.00 32.37 ? 364 ASN B C     1 
ATOM   6110  O O     . ASN B 1 367 ? 44.283  1.016   83.775  1.00 32.57 ? 364 ASN B O     1 
ATOM   6111  C CB    . ASN B 1 367 ? 41.387  2.154   84.811  1.00 32.69 ? 364 ASN B CB    1 
ATOM   6112  C CG    . ASN B 1 367 ? 40.771  3.519   85.135  1.00 32.88 ? 364 ASN B CG    1 
ATOM   6113  O OD1   . ASN B 1 367 ? 41.470  4.446   85.522  1.00 33.13 ? 364 ASN B OD1   1 
ATOM   6114  N ND2   . ASN B 1 367 ? 39.463  3.640   84.966  1.00 30.97 ? 364 ASN B ND2   1 
ATOM   6115  N N     . GLN B 1 368 ? 42.534  -0.207  83.054  1.00 33.37 ? 365 GLN B N     1 
ATOM   6116  C CA    . GLN B 1 368 ? 43.281  -1.459  82.979  1.00 33.02 ? 365 GLN B CA    1 
ATOM   6117  C C     . GLN B 1 368 ? 44.456  -1.285  82.017  1.00 31.07 ? 365 GLN B C     1 
ATOM   6118  O O     . GLN B 1 368 ? 45.595  -1.605  82.347  1.00 31.08 ? 365 GLN B O     1 
ATOM   6119  C CB    . GLN B 1 368 ? 42.353  -2.590  82.510  1.00 33.79 ? 365 GLN B CB    1 
ATOM   6120  C CG    . GLN B 1 368 ? 42.815  -3.992  82.898  1.00 34.51 ? 365 GLN B CG    1 
ATOM   6121  C CD    . GLN B 1 368 ? 42.922  -4.175  84.407  1.00 34.89 ? 365 GLN B CD    1 
ATOM   6122  O OE1   . GLN B 1 368 ? 41.922  -4.211  85.122  1.00 33.28 ? 365 GLN B OE1   1 
ATOM   6123  N NE2   . GLN B 1 368 ? 44.152  -4.290  84.894  1.00 35.70 ? 365 GLN B NE2   1 
ATOM   6124  N N     . VAL B 1 369 ? 44.175  -0.766  80.831  1.00 30.34 ? 366 VAL B N     1 
ATOM   6125  C CA    . VAL B 1 369 ? 45.206  -0.537  79.837  1.00 28.82 ? 366 VAL B CA    1 
ATOM   6126  C C     . VAL B 1 369 ? 46.256  0.450   80.366  1.00 29.86 ? 366 VAL B C     1 
ATOM   6127  O O     . VAL B 1 369 ? 47.459  0.230   80.212  1.00 30.33 ? 366 VAL B O     1 
ATOM   6128  C CB    . VAL B 1 369 ? 44.582  0.002   78.550  1.00 28.12 ? 366 VAL B CB    1 
ATOM   6129  C CG1   . VAL B 1 369 ? 45.667  0.353   77.542  1.00 28.73 ? 366 VAL B CG1   1 
ATOM   6130  C CG2   . VAL B 1 369 ? 43.630  -1.032  77.992  1.00 25.54 ? 366 VAL B CG2   1 
ATOM   6131  N N     . MET B 1 370 ? 45.806  1.526   81.005  1.00 28.06 ? 367 MET B N     1 
ATOM   6132  C CA    . MET B 1 370 ? 46.725  2.501   81.558  1.00 26.32 ? 367 MET B CA    1 
ATOM   6133  C C     . MET B 1 370 ? 47.619  1.824   82.605  1.00 27.49 ? 367 MET B C     1 
ATOM   6134  O O     . MET B 1 370 ? 48.816  2.095   82.669  1.00 27.20 ? 367 MET B O     1 
ATOM   6135  C CB    . MET B 1 370 ? 45.957  3.661   82.190  1.00 27.17 ? 367 MET B CB    1 
ATOM   6136  C CG    . MET B 1 370 ? 45.090  4.436   81.219  1.00 29.20 ? 367 MET B CG    1 
ATOM   6137  S SD    . MET B 1 370 ? 44.182  5.788   82.018  1.00 35.20 ? 367 MET B SD    1 
ATOM   6138  C CE    . MET B 1 370 ? 44.187  7.045   80.726  1.00 29.86 ? 367 MET B CE    1 
ATOM   6139  N N     . ALA B 1 371 ? 47.036  0.930   83.402  1.00 28.35 ? 368 ALA B N     1 
ATOM   6140  C CA    . ALA B 1 371 ? 47.772  0.209   84.434  1.00 29.61 ? 368 ALA B CA    1 
ATOM   6141  C C     . ALA B 1 371 ? 48.850  -0.690  83.815  1.00 30.65 ? 368 ALA B C     1 
ATOM   6142  O O     . ALA B 1 371 ? 49.968  -0.776  84.334  1.00 31.37 ? 368 ALA B O     1 
ATOM   6143  C CB    . ALA B 1 371 ? 46.803  -0.633  85.286  1.00 29.30 ? 368 ALA B CB    1 
ATOM   6144  N N     . GLN B 1 372 ? 48.502  -1.360  82.716  1.00 30.03 ? 369 GLN B N     1 
ATOM   6145  C CA    . GLN B 1 372 ? 49.439  -2.234  82.019  1.00 29.68 ? 369 GLN B CA    1 
ATOM   6146  C C     . GLN B 1 372 ? 50.590  -1.389  81.449  1.00 29.59 ? 369 GLN B C     1 
ATOM   6147  O O     . GLN B 1 372 ? 51.760  -1.746  81.586  1.00 28.99 ? 369 GLN B O     1 
ATOM   6148  C CB    . GLN B 1 372 ? 48.736  -3.003  80.885  1.00 27.74 ? 369 GLN B CB    1 
ATOM   6149  C CG    . GLN B 1 372 ? 47.829  -4.145  81.326  1.00 29.00 ? 369 GLN B CG    1 
ATOM   6150  C CD    . GLN B 1 372 ? 48.603  -5.348  81.894  1.00 31.57 ? 369 GLN B CD    1 
ATOM   6151  O OE1   . GLN B 1 372 ? 49.610  -5.772  81.333  1.00 30.81 ? 369 GLN B OE1   1 
ATOM   6152  N NE2   . GLN B 1 372 ? 48.115  -5.906  83.003  1.00 31.11 ? 369 GLN B NE2   1 
ATOM   6153  N N     . ILE B 1 373 ? 50.262  -0.266  80.819  1.00 28.57 ? 370 ILE B N     1 
ATOM   6154  C CA    . ILE B 1 373 ? 51.300  0.596   80.268  1.00 29.74 ? 370 ILE B CA    1 
ATOM   6155  C C     . ILE B 1 373 ? 52.220  1.103   81.386  1.00 32.83 ? 370 ILE B C     1 
ATOM   6156  O O     . ILE B 1 373 ? 53.437  0.978   81.299  1.00 34.14 ? 370 ILE B O     1 
ATOM   6157  C CB    . ILE B 1 373 ? 50.697  1.815   79.531  1.00 27.92 ? 370 ILE B CB    1 
ATOM   6158  C CG1   . ILE B 1 373 ? 49.880  1.347   78.323  1.00 26.49 ? 370 ILE B CG1   1 
ATOM   6159  C CG2   . ILE B 1 373 ? 51.805  2.742   79.061  1.00 25.92 ? 370 ILE B CG2   1 
ATOM   6160  C CD1   . ILE B 1 373 ? 49.182  2.464   77.589  1.00 23.56 ? 370 ILE B CD1   1 
ATOM   6161  N N     . GLU B 1 374 ? 51.639  1.664   82.441  1.00 34.28 ? 371 GLU B N     1 
ATOM   6162  C CA    . GLU B 1 374 ? 52.434  2.193   83.544  1.00 35.56 ? 371 GLU B CA    1 
ATOM   6163  C C     . GLU B 1 374 ? 53.394  1.153   84.115  1.00 36.05 ? 371 GLU B C     1 
ATOM   6164  O O     . GLU B 1 374 ? 54.592  1.388   84.219  1.00 35.76 ? 371 GLU B O     1 
ATOM   6165  C CB    . GLU B 1 374 ? 51.520  2.713   84.667  1.00 34.29 ? 371 GLU B CB    1 
ATOM   6166  C CG    . GLU B 1 374 ? 50.832  4.018   84.340  1.00 34.36 ? 371 GLU B CG    1 
ATOM   6167  C CD    . GLU B 1 374 ? 51.798  5.197   84.270  1.00 35.78 ? 371 GLU B CD    1 
ATOM   6168  O OE1   . GLU B 1 374 ? 51.743  5.959   83.276  1.00 35.14 ? 371 GLU B OE1   1 
ATOM   6169  O OE2   . GLU B 1 374 ? 52.603  5.369   85.216  1.00 36.65 ? 371 GLU B OE2   1 
ATOM   6170  N N     . LEU B 1 375 ? 52.851  0.001   84.478  1.00 36.16 ? 372 LEU B N     1 
ATOM   6171  C CA    . LEU B 1 375 ? 53.638  -1.069  85.057  1.00 36.76 ? 372 LEU B CA    1 
ATOM   6172  C C     . LEU B 1 375 ? 54.719  -1.609  84.114  1.00 38.09 ? 372 LEU B C     1 
ATOM   6173  O O     . LEU B 1 375 ? 55.828  -1.947  84.546  1.00 36.71 ? 372 LEU B O     1 
ATOM   6174  C CB    . LEU B 1 375 ? 52.689  -2.188  85.504  1.00 34.92 ? 372 LEU B CB    1 
ATOM   6175  C CG    . LEU B 1 375 ? 52.508  -2.356  87.018  1.00 34.66 ? 372 LEU B CG    1 
ATOM   6176  C CD1   . LEU B 1 375 ? 52.604  -1.007  87.719  1.00 35.43 ? 372 LEU B CD1   1 
ATOM   6177  C CD2   . LEU B 1 375 ? 51.178  -3.021  87.294  1.00 33.88 ? 372 LEU B CD2   1 
ATOM   6178  N N     . TRP B 1 376 ? 54.392  -1.671  82.830  1.00 38.05 ? 373 TRP B N     1 
ATOM   6179  C CA    . TRP B 1 376 ? 55.317  -2.184  81.839  1.00 39.80 ? 373 TRP B CA    1 
ATOM   6180  C C     . TRP B 1 376 ? 56.310  -1.146  81.310  1.00 42.60 ? 373 TRP B C     1 
ATOM   6181  O O     . TRP B 1 376 ? 57.478  -1.461  81.093  1.00 43.12 ? 373 TRP B O     1 
ATOM   6182  C CB    . TRP B 1 376 ? 54.523  -2.784  80.683  1.00 38.19 ? 373 TRP B CB    1 
ATOM   6183  C CG    . TRP B 1 376 ? 55.366  -3.368  79.618  1.00 35.70 ? 373 TRP B CG    1 
ATOM   6184  C CD1   . TRP B 1 376 ? 55.557  -2.874  78.355  1.00 34.63 ? 373 TRP B CD1   1 
ATOM   6185  C CD2   . TRP B 1 376 ? 56.153  -4.559  79.711  1.00 34.26 ? 373 TRP B CD2   1 
ATOM   6186  N NE1   . TRP B 1 376 ? 56.417  -3.690  77.657  1.00 35.45 ? 373 TRP B NE1   1 
ATOM   6187  C CE2   . TRP B 1 376 ? 56.798  -4.730  78.464  1.00 34.25 ? 373 TRP B CE2   1 
ATOM   6188  C CE3   . TRP B 1 376 ? 56.376  -5.500  80.727  1.00 31.95 ? 373 TRP B CE3   1 
ATOM   6189  C CZ2   . TRP B 1 376 ? 57.651  -5.802  78.208  1.00 34.03 ? 373 TRP B CZ2   1 
ATOM   6190  C CZ3   . TRP B 1 376 ? 57.223  -6.564  80.476  1.00 30.35 ? 373 TRP B CZ3   1 
ATOM   6191  C CH2   . TRP B 1 376 ? 57.851  -6.709  79.228  1.00 33.97 ? 373 TRP B CH2   1 
ATOM   6192  N N     . THR B 1 377 ? 55.843  0.087   81.117  1.00 45.71 ? 374 THR B N     1 
ATOM   6193  C CA    . THR B 1 377 ? 56.677  1.176   80.594  1.00 48.61 ? 374 THR B CA    1 
ATOM   6194  C C     . THR B 1 377 ? 57.585  1.809   81.648  1.00 48.93 ? 374 THR B C     1 
ATOM   6195  O O     . THR B 1 377 ? 58.721  2.185   81.354  1.00 48.04 ? 374 THR B O     1 
ATOM   6196  C CB    . THR B 1 377 ? 55.809  2.316   79.982  1.00 49.98 ? 374 THR B CB    1 
ATOM   6197  O OG1   . THR B 1 377 ? 54.906  1.771   79.012  1.00 52.89 ? 374 THR B OG1   1 
ATOM   6198  C CG2   . THR B 1 377 ? 56.686  3.355   79.301  1.00 52.04 ? 374 THR B CG2   1 
ATOM   6199  N N     . HIS B 1 378 ? 57.074  1.922   82.871  1.00 49.81 ? 375 HIS B N     1 
ATOM   6200  C CA    . HIS B 1 378 ? 57.815  2.528   83.973  1.00 50.83 ? 375 HIS B CA    1 
ATOM   6201  C C     . HIS B 1 378 ? 57.922  1.572   85.164  1.00 52.96 ? 375 HIS B C     1 
ATOM   6202  O O     . HIS B 1 378 ? 57.426  1.865   86.252  1.00 52.83 ? 375 HIS B O     1 
ATOM   6203  C CB    . HIS B 1 378 ? 57.107  3.811   84.402  1.00 48.90 ? 375 HIS B CB    1 
ATOM   6204  C CG    . HIS B 1 378 ? 56.732  4.697   83.256  1.00 47.86 ? 375 HIS B CG    1 
ATOM   6205  N ND1   . HIS B 1 378 ? 55.504  5.311   83.161  1.00 48.64 ? 375 HIS B ND1   1 
ATOM   6206  C CD2   . HIS B 1 378 ? 57.419  5.060   82.147  1.00 46.99 ? 375 HIS B CD2   1 
ATOM   6207  C CE1   . HIS B 1 378 ? 55.447  6.011   82.041  1.00 47.12 ? 375 HIS B CE1   1 
ATOM   6208  N NE2   . HIS B 1 378 ? 56.596  5.876   81.408  1.00 45.24 ? 375 HIS B NE2   1 
ATOM   6209  N N     . PRO B 1 379 ? 58.594  0.424   84.978  1.00 54.79 ? 376 PRO B N     1 
ATOM   6210  C CA    . PRO B 1 379 ? 58.736  -0.547  86.067  1.00 56.77 ? 376 PRO B CA    1 
ATOM   6211  C C     . PRO B 1 379 ? 59.324  0.013   87.363  1.00 58.60 ? 376 PRO B C     1 
ATOM   6212  O O     . PRO B 1 379 ? 58.838  -0.292  88.456  1.00 59.15 ? 376 PRO B O     1 
ATOM   6213  C CB    . PRO B 1 379 ? 59.619  -1.630  85.447  1.00 55.78 ? 376 PRO B CB    1 
ATOM   6214  C CG    . PRO B 1 379 ? 60.463  -0.862  84.481  1.00 55.41 ? 376 PRO B CG    1 
ATOM   6215  C CD    . PRO B 1 379 ? 59.450  0.056   83.835  1.00 55.33 ? 376 PRO B CD    1 
ATOM   6216  N N     . ASP B 1 380 ? 60.369  0.826   87.235  1.00 60.17 ? 377 ASP B N     1 
ATOM   6217  C CA    . ASP B 1 380 ? 61.042  1.418   88.390  1.00 60.93 ? 377 ASP B CA    1 
ATOM   6218  C C     . ASP B 1 380 ? 60.117  2.294   89.218  1.00 59.37 ? 377 ASP B C     1 
ATOM   6219  O O     . ASP B 1 380 ? 60.142  2.266   90.447  1.00 59.07 ? 377 ASP B O     1 
ATOM   6220  C CB    . ASP B 1 380 ? 62.251  2.242   87.930  1.00 63.56 ? 377 ASP B CB    1 
ATOM   6221  C CG    . ASP B 1 380 ? 63.296  1.395   87.205  1.00 66.28 ? 377 ASP B CG    1 
ATOM   6222  O OD1   . ASP B 1 380 ? 62.979  0.853   86.119  1.00 68.07 ? 377 ASP B OD1   1 
ATOM   6223  O OD2   . ASP B 1 380 ? 64.430  1.269   87.724  1.00 66.07 ? 377 ASP B OD2   1 
ATOM   6224  N N     . LYS B 1 381 ? 59.292  3.067   88.530  1.00 57.66 ? 378 LYS B N     1 
ATOM   6225  C CA    . LYS B 1 381 ? 58.364  3.962   89.192  1.00 55.59 ? 378 LYS B CA    1 
ATOM   6226  C C     . LYS B 1 381 ? 57.358  3.234   90.106  1.00 54.34 ? 378 LYS B C     1 
ATOM   6227  O O     . LYS B 1 381 ? 56.658  3.873   90.893  1.00 54.50 ? 378 LYS B O     1 
ATOM   6228  C CB    . LYS B 1 381 ? 57.658  4.792   88.118  1.00 56.97 ? 378 LYS B CB    1 
ATOM   6229  C CG    . LYS B 1 381 ? 56.739  5.887   88.614  1.00 58.58 ? 378 LYS B CG    1 
ATOM   6230  C CD    . LYS B 1 381 ? 56.456  6.867   87.486  1.00 59.87 ? 378 LYS B CD    1 
ATOM   6231  C CE    . LYS B 1 381 ? 55.328  7.804   87.844  1.00 61.22 ? 378 LYS B CE    1 
ATOM   6232  N NZ    . LYS B 1 381 ? 54.037  7.072   87.867  1.00 61.27 ? 378 LYS B NZ    1 
ATOM   6233  N N     . TYR B 1 382 ? 57.289  1.904   90.017  1.00 52.16 ? 379 TYR B N     1 
ATOM   6234  C CA    . TYR B 1 382 ? 56.365  1.131   90.861  1.00 49.47 ? 379 TYR B CA    1 
ATOM   6235  C C     . TYR B 1 382 ? 57.034  -0.068  91.543  1.00 48.51 ? 379 TYR B C     1 
ATOM   6236  O O     . TYR B 1 382 ? 57.124  -1.158  90.979  1.00 48.04 ? 379 TYR B O     1 
ATOM   6237  C CB    . TYR B 1 382 ? 55.157  0.622   90.058  1.00 46.47 ? 379 TYR B CB    1 
ATOM   6238  C CG    . TYR B 1 382 ? 54.311  1.692   89.394  1.00 44.82 ? 379 TYR B CG    1 
ATOM   6239  C CD1   . TYR B 1 382 ? 54.541  2.071   88.069  1.00 43.96 ? 379 TYR B CD1   1 
ATOM   6240  C CD2   . TYR B 1 382 ? 53.267  2.312   90.080  1.00 43.17 ? 379 TYR B CD2   1 
ATOM   6241  C CE1   . TYR B 1 382 ? 53.750  3.041   87.442  1.00 41.83 ? 379 TYR B CE1   1 
ATOM   6242  C CE2   . TYR B 1 382 ? 52.470  3.288   89.459  1.00 42.22 ? 379 TYR B CE2   1 
ATOM   6243  C CZ    . TYR B 1 382 ? 52.718  3.644   88.143  1.00 41.30 ? 379 TYR B CZ    1 
ATOM   6244  O OH    . TYR B 1 382 ? 51.941  4.605   87.537  1.00 37.52 ? 379 TYR B OH    1 
ATOM   6245  N N     . PRO B 1 383 ? 57.520  0.124   92.771  1.00 47.23 ? 380 PRO B N     1 
ATOM   6246  C CA    . PRO B 1 383 ? 58.165  -0.983  93.476  1.00 46.71 ? 380 PRO B CA    1 
ATOM   6247  C C     . PRO B 1 383 ? 57.123  -2.004  93.904  1.00 45.28 ? 380 PRO B C     1 
ATOM   6248  O O     . PRO B 1 383 ? 55.929  -1.799  93.710  1.00 45.34 ? 380 PRO B O     1 
ATOM   6249  C CB    . PRO B 1 383 ? 58.831  -0.292  94.663  1.00 46.20 ? 380 PRO B CB    1 
ATOM   6250  C CG    . PRO B 1 383 ? 57.890  0.840   94.950  1.00 46.79 ? 380 PRO B CG    1 
ATOM   6251  C CD    . PRO B 1 383 ? 57.599  1.366   93.557  1.00 47.09 ? 380 PRO B CD    1 
ATOM   6252  N N     . VAL B 1 384 ? 57.578  -3.096  94.499  1.00 43.71 ? 381 VAL B N     1 
ATOM   6253  C CA    . VAL B 1 384 ? 56.673  -4.134  94.948  1.00 44.01 ? 381 VAL B CA    1 
ATOM   6254  C C     . VAL B 1 384 ? 55.616  -3.602  95.910  1.00 44.98 ? 381 VAL B C     1 
ATOM   6255  O O     . VAL B 1 384 ? 55.919  -3.147  97.011  1.00 45.95 ? 381 VAL B O     1 
ATOM   6256  C CB    . VAL B 1 384 ? 57.447  -5.274  95.623  1.00 42.28 ? 381 VAL B CB    1 
ATOM   6257  C CG1   . VAL B 1 384 ? 56.479  -6.294  96.188  1.00 42.07 ? 381 VAL B CG1   1 
ATOM   6258  C CG2   . VAL B 1 384 ? 58.374  -5.923  94.616  1.00 42.29 ? 381 VAL B CG2   1 
ATOM   6259  N N     . GLY B 1 385 ? 54.364  -3.666  95.476  1.00 46.25 ? 382 GLY B N     1 
ATOM   6260  C CA    . GLY B 1 385 ? 53.263  -3.190  96.295  1.00 45.35 ? 382 GLY B CA    1 
ATOM   6261  C C     . GLY B 1 385 ? 52.069  -2.802  95.441  1.00 45.11 ? 382 GLY B C     1 
ATOM   6262  O O     . GLY B 1 385 ? 52.166  -2.740  94.212  1.00 43.57 ? 382 GLY B O     1 
ATOM   6263  N N     . VAL B 1 386 ? 50.938  -2.543  96.089  1.00 44.84 ? 383 VAL B N     1 
ATOM   6264  C CA    . VAL B 1 386 ? 49.726  -2.160  95.373  1.00 44.80 ? 383 VAL B CA    1 
ATOM   6265  C C     . VAL B 1 386 ? 49.568  -0.636  95.336  1.00 43.97 ? 383 VAL B C     1 
ATOM   6266  O O     . VAL B 1 386 ? 49.516  0.025   96.373  1.00 41.56 ? 383 VAL B O     1 
ATOM   6267  C CB    . VAL B 1 386 ? 48.478  -2.853  96.001  1.00 44.92 ? 383 VAL B CB    1 
ATOM   6268  C CG1   . VAL B 1 386 ? 48.594  -2.887  97.504  1.00 44.57 ? 383 VAL B CG1   1 
ATOM   6269  C CG2   . VAL B 1 386 ? 47.208  -2.139  95.576  1.00 44.69 ? 383 VAL B CG2   1 
ATOM   6270  N N     . HIS B 1 387 ? 49.493  -0.089  94.126  1.00 44.05 ? 384 HIS B N     1 
ATOM   6271  C CA    . HIS B 1 387 ? 49.385  1.357   93.943  1.00 44.49 ? 384 HIS B CA    1 
ATOM   6272  C C     . HIS B 1 387 ? 48.116  1.826   93.235  1.00 44.09 ? 384 HIS B C     1 
ATOM   6273  O O     . HIS B 1 387 ? 47.363  1.036   92.656  1.00 43.63 ? 384 HIS B O     1 
ATOM   6274  C CB    . HIS B 1 387 ? 50.604  1.860   93.160  1.00 45.39 ? 384 HIS B CB    1 
ATOM   6275  C CG    . HIS B 1 387 ? 51.911  1.374   93.708  1.00 47.80 ? 384 HIS B CG    1 
ATOM   6276  N ND1   . HIS B 1 387 ? 52.982  1.058   92.902  1.00 48.15 ? 384 HIS B ND1   1 
ATOM   6277  C CD2   . HIS B 1 387 ? 52.308  1.123   94.979  1.00 48.40 ? 384 HIS B CD2   1 
ATOM   6278  C CE1   . HIS B 1 387 ? 53.980  0.627   93.653  1.00 50.24 ? 384 HIS B CE1   1 
ATOM   6279  N NE2   . HIS B 1 387 ? 53.597  0.657   94.917  1.00 49.34 ? 384 HIS B NE2   1 
ATOM   6280  N N     . PHE B 1 388 ? 47.882  3.130   93.301  1.00 43.01 ? 385 PHE B N     1 
ATOM   6281  C CA    . PHE B 1 388 ? 46.731  3.729   92.651  1.00 41.43 ? 385 PHE B CA    1 
ATOM   6282  C C     . PHE B 1 388 ? 47.277  4.386   91.399  1.00 41.84 ? 385 PHE B C     1 
ATOM   6283  O O     . PHE B 1 388 ? 48.490  4.494   91.218  1.00 42.02 ? 385 PHE B O     1 
ATOM   6284  C CB    . PHE B 1 388 ? 46.083  4.807   93.533  1.00 39.06 ? 385 PHE B CB    1 
ATOM   6285  C CG    . PHE B 1 388 ? 45.504  4.289   94.822  1.00 37.98 ? 385 PHE B CG    1 
ATOM   6286  C CD1   . PHE B 1 388 ? 44.512  3.323   94.822  1.00 36.43 ? 385 PHE B CD1   1 
ATOM   6287  C CD2   . PHE B 1 388 ? 45.940  4.796   96.043  1.00 38.63 ? 385 PHE B CD2   1 
ATOM   6288  C CE1   . PHE B 1 388 ? 43.959  2.865   96.021  1.00 36.91 ? 385 PHE B CE1   1 
ATOM   6289  C CE2   . PHE B 1 388 ? 45.393  4.345   97.245  1.00 36.70 ? 385 PHE B CE2   1 
ATOM   6290  C CZ    . PHE B 1 388 ? 44.400  3.379   97.233  1.00 35.47 ? 385 PHE B CZ    1 
ATOM   6291  N N     . LEU B 1 389 ? 46.376  4.820   90.532  1.00 42.07 ? 386 LEU B N     1 
ATOM   6292  C CA    . LEU B 1 389 ? 46.769  5.489   89.310  1.00 41.65 ? 386 LEU B CA    1 
ATOM   6293  C C     . LEU B 1 389 ? 46.677  6.976   89.621  1.00 41.40 ? 386 LEU B C     1 
ATOM   6294  O O     . LEU B 1 389 ? 45.808  7.404   90.385  1.00 42.27 ? 386 LEU B O     1 
ATOM   6295  C CB    . LEU B 1 389 ? 45.803  5.132   88.182  1.00 42.36 ? 386 LEU B CB    1 
ATOM   6296  C CG    . LEU B 1 389 ? 46.411  4.540   86.911  1.00 43.55 ? 386 LEU B CG    1 
ATOM   6297  C CD1   . LEU B 1 389 ? 47.037  3.197   87.228  1.00 42.95 ? 386 LEU B CD1   1 
ATOM   6298  C CD2   . LEU B 1 389 ? 45.326  4.381   85.852  1.00 42.72 ? 386 LEU B CD2   1 
ATOM   6299  N N     . PRO B 1 390 ? 47.569  7.787   89.044  1.00 40.08 ? 387 PRO B N     1 
ATOM   6300  C CA    . PRO B 1 390 ? 47.519  9.227   89.311  1.00 39.51 ? 387 PRO B CA    1 
ATOM   6301  C C     . PRO B 1 390 ? 46.153  9.839   88.960  1.00 38.13 ? 387 PRO B C     1 
ATOM   6302  O O     . PRO B 1 390 ? 45.560  9.500   87.933  1.00 37.30 ? 387 PRO B O     1 
ATOM   6303  C CB    . PRO B 1 390 ? 48.654  9.778   88.442  1.00 39.17 ? 387 PRO B CB    1 
ATOM   6304  C CG    . PRO B 1 390 ? 48.718  8.799   87.307  1.00 40.16 ? 387 PRO B CG    1 
ATOM   6305  C CD    . PRO B 1 390 ? 48.584  7.474   88.028  1.00 40.06 ? 387 PRO B CD    1 
ATOM   6306  N N     . LYS B 1 391 ? 45.663  10.733  89.815  1.00 36.41 ? 388 LYS B N     1 
ATOM   6307  C CA    . LYS B 1 391 ? 44.374  11.372  89.588  1.00 36.48 ? 388 LYS B CA    1 
ATOM   6308  C C     . LYS B 1 391 ? 44.324  12.044  88.218  1.00 37.11 ? 388 LYS B C     1 
ATOM   6309  O O     . LYS B 1 391 ? 43.269  12.103  87.595  1.00 40.22 ? 388 LYS B O     1 
ATOM   6310  C CB    . LYS B 1 391 ? 44.073  12.393  90.697  1.00 35.49 ? 388 LYS B CB    1 
ATOM   6311  C CG    . LYS B 1 391 ? 42.677  13.019  90.632  1.00 33.80 ? 388 LYS B CG    1 
ATOM   6312  C CD    . LYS B 1 391 ? 42.331  13.803  91.900  1.00 33.06 ? 388 LYS B CD    1 
ATOM   6313  C CE    . LYS B 1 391 ? 42.231  12.899  93.129  1.00 34.25 ? 388 LYS B CE    1 
ATOM   6314  N NZ    . LYS B 1 391 ? 41.191  11.827  93.003  1.00 33.72 ? 388 LYS B NZ    1 
ATOM   6315  N N     . LYS B 1 392 ? 45.454  12.543  87.737  1.00 36.77 ? 389 LYS B N     1 
ATOM   6316  C CA    . LYS B 1 392 ? 45.479  13.173  86.429  1.00 37.00 ? 389 LYS B CA    1 
ATOM   6317  C C     . LYS B 1 392 ? 45.035  12.142  85.376  1.00 37.87 ? 389 LYS B C     1 
ATOM   6318  O O     . LYS B 1 392 ? 44.337  12.473  84.407  1.00 37.55 ? 389 LYS B O     1 
ATOM   6319  C CB    . LYS B 1 392 ? 46.888  13.686  86.135  1.00 37.64 ? 389 LYS B CB    1 
ATOM   6320  C CG    . LYS B 1 392 ? 47.114  14.105  84.696  1.00 39.17 ? 389 LYS B CG    1 
ATOM   6321  C CD    . LYS B 1 392 ? 46.191  15.236  84.311  1.00 39.38 ? 389 LYS B CD    1 
ATOM   6322  C CE    . LYS B 1 392 ? 46.517  16.488  85.099  1.00 39.28 ? 389 LYS B CE    1 
ATOM   6323  N NZ    . LYS B 1 392 ? 47.888  16.972  84.792  1.00 36.35 ? 389 LYS B NZ    1 
ATOM   6324  N N     . LEU B 1 393 ? 45.428  10.889  85.590  1.00 37.07 ? 390 LEU B N     1 
ATOM   6325  C CA    . LEU B 1 393 ? 45.071  9.795   84.693  1.00 37.12 ? 390 LEU B CA    1 
ATOM   6326  C C     . LEU B 1 393 ? 43.595  9.419   84.878  1.00 35.96 ? 390 LEU B C     1 
ATOM   6327  O O     . LEU B 1 393 ? 42.881  9.136   83.909  1.00 35.25 ? 390 LEU B O     1 
ATOM   6328  C CB    . LEU B 1 393 ? 45.968  8.579   84.971  1.00 37.13 ? 390 LEU B CB    1 
ATOM   6329  C CG    . LEU B 1 393 ? 47.029  8.224   83.920  1.00 38.83 ? 390 LEU B CG    1 
ATOM   6330  C CD1   . LEU B 1 393 ? 47.877  9.433   83.574  1.00 39.16 ? 390 LEU B CD1   1 
ATOM   6331  C CD2   . LEU B 1 393 ? 47.907  7.101   84.455  1.00 38.56 ? 390 LEU B CD2   1 
ATOM   6332  N N     . ASP B 1 394 ? 43.145  9.434   86.130  1.00 34.81 ? 391 ASP B N     1 
ATOM   6333  C CA    . ASP B 1 394 ? 41.759  9.111   86.465  1.00 33.85 ? 391 ASP B CA    1 
ATOM   6334  C C     . ASP B 1 394 ? 40.803  10.056  85.735  1.00 33.60 ? 391 ASP B C     1 
ATOM   6335  O O     . ASP B 1 394 ? 39.843  9.620   85.098  1.00 34.38 ? 391 ASP B O     1 
ATOM   6336  C CB    . ASP B 1 394 ? 41.540  9.256   87.969  1.00 33.24 ? 391 ASP B CB    1 
ATOM   6337  C CG    . ASP B 1 394 ? 40.706  8.145   88.546  1.00 31.90 ? 391 ASP B CG    1 
ATOM   6338  O OD1   . ASP B 1 394 ? 39.784  7.665   87.862  1.00 34.32 ? 391 ASP B OD1   1 
ATOM   6339  O OD2   . ASP B 1 394 ? 40.964  7.759   89.698  1.00 32.03 ? 391 ASP B OD2   1 
ATOM   6340  N N     . GLU B 1 395 ? 41.069  11.352  85.830  1.00 32.62 ? 392 GLU B N     1 
ATOM   6341  C CA    . GLU B 1 395 ? 40.216  12.338  85.178  1.00 32.92 ? 392 GLU B CA    1 
ATOM   6342  C C     . GLU B 1 395 ? 40.257  12.161  83.657  1.00 29.96 ? 392 GLU B C     1 
ATOM   6343  O O     . GLU B 1 395 ? 39.261  12.401  82.975  1.00 28.99 ? 392 GLU B O     1 
ATOM   6344  C CB    . GLU B 1 395 ? 40.674  13.757  85.545  1.00 32.96 ? 392 GLU B CB    1 
ATOM   6345  C CG    . GLU B 1 395 ? 40.883  13.950  87.018  1.00 35.90 ? 392 GLU B CG    1 
ATOM   6346  C CD    . GLU B 1 395 ? 41.399  15.335  87.349  1.00 39.39 ? 392 GLU B CD    1 
ATOM   6347  O OE1   . GLU B 1 395 ? 42.316  15.811  86.643  1.00 40.58 ? 392 GLU B OE1   1 
ATOM   6348  O OE2   . GLU B 1 395 ? 40.894  15.942  88.324  1.00 39.68 ? 392 GLU B OE2   1 
ATOM   6349  N N     . ALA B 1 396 ? 41.414  11.742  83.145  1.00 28.03 ? 393 ALA B N     1 
ATOM   6350  C CA    . ALA B 1 396 ? 41.618  11.523  81.712  1.00 26.79 ? 393 ALA B CA    1 
ATOM   6351  C C     . ALA B 1 396 ? 40.627  10.486  81.179  1.00 26.56 ? 393 ALA B C     1 
ATOM   6352  O O     . ALA B 1 396 ? 40.052  10.651  80.091  1.00 25.61 ? 393 ALA B O     1 
ATOM   6353  C CB    . ALA B 1 396 ? 43.054  11.061  81.458  1.00 23.47 ? 393 ALA B CB    1 
ATOM   6354  N N     . VAL B 1 397 ? 40.450  9.425   81.963  1.00 24.73 ? 394 VAL B N     1 
ATOM   6355  C CA    . VAL B 1 397 ? 39.525  8.353   81.640  1.00 25.03 ? 394 VAL B CA    1 
ATOM   6356  C C     . VAL B 1 397 ? 38.109  8.937   81.535  1.00 26.18 ? 394 VAL B C     1 
ATOM   6357  O O     . VAL B 1 397 ? 37.453  8.832   80.493  1.00 25.92 ? 394 VAL B O     1 
ATOM   6358  C CB    . VAL B 1 397 ? 39.580  7.263   82.739  1.00 23.48 ? 394 VAL B CB    1 
ATOM   6359  C CG1   . VAL B 1 397 ? 38.396  6.336   82.635  1.00 22.95 ? 394 VAL B CG1   1 
ATOM   6360  C CG2   . VAL B 1 397 ? 40.878  6.486   82.616  1.00 20.50 ? 394 VAL B CG2   1 
ATOM   6361  N N     . ALA B 1 398 ? 37.658  9.577   82.610  1.00 27.02 ? 395 ALA B N     1 
ATOM   6362  C CA    . ALA B 1 398 ? 36.327  10.176  82.636  1.00 28.70 ? 395 ALA B CA    1 
ATOM   6363  C C     . ALA B 1 398 ? 36.098  11.120  81.453  1.00 29.41 ? 395 ALA B C     1 
ATOM   6364  O O     . ALA B 1 398 ? 35.054  11.069  80.803  1.00 28.38 ? 395 ALA B O     1 
ATOM   6365  C CB    . ALA B 1 398 ? 36.117  10.925  83.948  1.00 26.97 ? 395 ALA B CB    1 
ATOM   6366  N N     . GLU B 1 399 ? 37.084  11.976  81.190  1.00 29.94 ? 396 GLU B N     1 
ATOM   6367  C CA    . GLU B 1 399 ? 36.998  12.947  80.102  1.00 31.00 ? 396 GLU B CA    1 
ATOM   6368  C C     . GLU B 1 399 ? 36.948  12.323  78.709  1.00 30.77 ? 396 GLU B C     1 
ATOM   6369  O O     . GLU B 1 399 ? 36.457  12.945  77.772  1.00 31.80 ? 396 GLU B O     1 
ATOM   6370  C CB    . GLU B 1 399 ? 38.170  13.921  80.172  1.00 31.30 ? 396 GLU B CB    1 
ATOM   6371  C CG    . GLU B 1 399 ? 38.222  14.918  79.032  1.00 34.56 ? 396 GLU B CG    1 
ATOM   6372  C CD    . GLU B 1 399 ? 39.295  15.975  79.242  1.00 37.77 ? 396 GLU B CD    1 
ATOM   6373  O OE1   . GLU B 1 399 ? 40.465  15.586  79.479  1.00 40.80 ? 396 GLU B OE1   1 
ATOM   6374  O OE2   . GLU B 1 399 ? 38.973  17.187  79.174  1.00 36.65 ? 396 GLU B OE2   1 
ATOM   6375  N N     . ALA B 1 400 ? 37.459  11.103  78.571  1.00 29.36 ? 397 ALA B N     1 
ATOM   6376  C CA    . ALA B 1 400 ? 37.459  10.438  77.274  1.00 29.02 ? 397 ALA B CA    1 
ATOM   6377  C C     . ALA B 1 400 ? 36.065  9.948   76.875  1.00 28.58 ? 397 ALA B C     1 
ATOM   6378  O O     . ALA B 1 400 ? 35.811  9.668   75.710  1.00 30.65 ? 397 ALA B O     1 
ATOM   6379  C CB    . ALA B 1 400 ? 38.450  9.261   77.277  1.00 26.74 ? 397 ALA B CB    1 
ATOM   6380  N N     . HIS B 1 401 ? 35.154  9.859   77.832  1.00 27.46 ? 398 HIS B N     1 
ATOM   6381  C CA    . HIS B 1 401 ? 33.812  9.398   77.523  1.00 28.08 ? 398 HIS B CA    1 
ATOM   6382  C C     . HIS B 1 401 ? 32.791  10.516  77.449  1.00 28.63 ? 398 HIS B C     1 
ATOM   6383  O O     . HIS B 1 401 ? 31.613  10.270  77.183  1.00 29.86 ? 398 HIS B O     1 
ATOM   6384  C CB    . HIS B 1 401 ? 33.368  8.363   78.556  1.00 26.64 ? 398 HIS B CB    1 
ATOM   6385  C CG    . HIS B 1 401 ? 34.264  7.170   78.611  1.00 25.52 ? 398 HIS B CG    1 
ATOM   6386  N ND1   . HIS B 1 401 ? 35.495  7.200   79.227  1.00 25.73 ? 398 HIS B ND1   1 
ATOM   6387  C CD2   . HIS B 1 401 ? 34.148  5.937   78.061  1.00 25.95 ? 398 HIS B CD2   1 
ATOM   6388  C CE1   . HIS B 1 401 ? 36.098  6.037   79.057  1.00 27.63 ? 398 HIS B CE1   1 
ATOM   6389  N NE2   . HIS B 1 401 ? 35.302  5.252   78.352  1.00 26.97 ? 398 HIS B NE2   1 
ATOM   6390  N N     . LEU B 1 402 ? 33.245  11.743  77.671  1.00 28.86 ? 399 LEU B N     1 
ATOM   6391  C CA    . LEU B 1 402 ? 32.359  12.893  77.637  1.00 28.29 ? 399 LEU B CA    1 
ATOM   6392  C C     . LEU B 1 402 ? 31.792  13.123  76.249  1.00 28.16 ? 399 LEU B C     1 
ATOM   6393  O O     . LEU B 1 402 ? 30.596  13.400  76.089  1.00 26.95 ? 399 LEU B O     1 
ATOM   6394  C CB    . LEU B 1 402 ? 33.104  14.144  78.114  1.00 28.12 ? 399 LEU B CB    1 
ATOM   6395  C CG    . LEU B 1 402 ? 32.764  14.598  79.536  1.00 27.93 ? 399 LEU B CG    1 
ATOM   6396  C CD1   . LEU B 1 402 ? 32.824  13.431  80.480  1.00 26.75 ? 399 LEU B CD1   1 
ATOM   6397  C CD2   . LEU B 1 402 ? 33.737  15.693  79.974  1.00 28.88 ? 399 LEU B CD2   1 
ATOM   6398  N N     . GLY B 1 403 ? 32.661  13.007  75.249  1.00 29.05 ? 400 GLY B N     1 
ATOM   6399  C CA    . GLY B 1 403 ? 32.256  13.212  73.869  1.00 28.42 ? 400 GLY B CA    1 
ATOM   6400  C C     . GLY B 1 403 ? 31.040  12.404  73.467  1.00 30.13 ? 400 GLY B C     1 
ATOM   6401  O O     . GLY B 1 403 ? 30.073  12.960  72.942  1.00 31.89 ? 400 GLY B O     1 
ATOM   6402  N N     . LYS B 1 404 ? 31.085  11.099  73.718  1.00 28.89 ? 401 LYS B N     1 
ATOM   6403  C CA    . LYS B 1 404 ? 30.001  10.180  73.384  1.00 28.91 ? 401 LYS B CA    1 
ATOM   6404  C C     . LYS B 1 404 ? 28.642  10.657  73.925  1.00 29.22 ? 401 LYS B C     1 
ATOM   6405  O O     . LYS B 1 404 ? 27.621  10.551  73.242  1.00 27.43 ? 401 LYS B O     1 
ATOM   6406  C CB    . LYS B 1 404 ? 30.342  8.786   73.946  1.00 29.94 ? 401 LYS B CB    1 
ATOM   6407  C CG    . LYS B 1 404 ? 30.058  7.590   73.017  1.00 31.20 ? 401 LYS B CG    1 
ATOM   6408  C CD    . LYS B 1 404 ? 28.579  7.272   72.931  1.00 34.21 ? 401 LYS B CD    1 
ATOM   6409  C CE    . LYS B 1 404 ? 28.288  6.188   71.918  1.00 33.40 ? 401 LYS B CE    1 
ATOM   6410  N NZ    . LYS B 1 404 ? 28.660  6.639   70.555  1.00 36.45 ? 401 LYS B NZ    1 
ATOM   6411  N N     . LEU B 1 405 ? 28.634  11.187  75.148  1.00 29.93 ? 402 LEU B N     1 
ATOM   6412  C CA    . LEU B 1 405 ? 27.403  11.668  75.781  1.00 28.09 ? 402 LEU B CA    1 
ATOM   6413  C C     . LEU B 1 405 ? 27.096  13.109  75.411  1.00 28.03 ? 402 LEU B C     1 
ATOM   6414  O O     . LEU B 1 405 ? 26.062  13.663  75.791  1.00 27.15 ? 402 LEU B O     1 
ATOM   6415  C CB    . LEU B 1 405 ? 27.515  11.545  77.301  1.00 26.21 ? 402 LEU B CB    1 
ATOM   6416  C CG    . LEU B 1 405 ? 27.879  10.138  77.771  1.00 24.59 ? 402 LEU B CG    1 
ATOM   6417  C CD1   . LEU B 1 405 ? 27.714  10.051  79.285  1.00 24.38 ? 402 LEU B CD1   1 
ATOM   6418  C CD2   . LEU B 1 405 ? 26.983  9.123   77.083  1.00 22.73 ? 402 LEU B CD2   1 
ATOM   6419  N N     . ASN B 1 406 ? 28.010  13.706  74.657  1.00 30.00 ? 403 ASN B N     1 
ATOM   6420  C CA    . ASN B 1 406 ? 27.889  15.090  74.216  1.00 30.26 ? 403 ASN B CA    1 
ATOM   6421  C C     . ASN B 1 406 ? 27.765  16.008  75.438  1.00 30.01 ? 403 ASN B C     1 
ATOM   6422  O O     . ASN B 1 406 ? 26.798  16.753  75.593  1.00 27.20 ? 403 ASN B O     1 
ATOM   6423  C CB    . ASN B 1 406 ? 26.692  15.255  73.267  1.00 31.43 ? 403 ASN B CB    1 
ATOM   6424  C CG    . ASN B 1 406 ? 26.855  16.444  72.328  1.00 35.44 ? 403 ASN B CG    1 
ATOM   6425  O OD1   . ASN B 1 406 ? 26.748  17.608  72.745  1.00 35.11 ? 403 ASN B OD1   1 
ATOM   6426  N ND2   . ASN B 1 406 ? 27.133  16.156  71.048  1.00 36.68 ? 403 ASN B ND2   1 
ATOM   6427  N N     . VAL B 1 407 ? 28.764  15.915  76.310  1.00 30.23 ? 404 VAL B N     1 
ATOM   6428  C CA    . VAL B 1 407 ? 28.831  16.723  77.514  1.00 31.15 ? 404 VAL B CA    1 
ATOM   6429  C C     . VAL B 1 407 ? 29.786  17.881  77.243  1.00 31.08 ? 404 VAL B C     1 
ATOM   6430  O O     . VAL B 1 407 ? 30.839  17.699  76.648  1.00 31.56 ? 404 VAL B O     1 
ATOM   6431  C CB    . VAL B 1 407 ? 29.361  15.891  78.717  1.00 31.62 ? 404 VAL B CB    1 
ATOM   6432  C CG1   . VAL B 1 407 ? 29.657  16.799  79.901  1.00 31.74 ? 404 VAL B CG1   1 
ATOM   6433  C CG2   . VAL B 1 407 ? 28.327  14.839  79.109  1.00 31.07 ? 404 VAL B CG2   1 
ATOM   6434  N N     . LYS B 1 408 ? 29.411  19.083  77.650  1.00 31.53 ? 405 LYS B N     1 
ATOM   6435  C CA    . LYS B 1 408 ? 30.285  20.217  77.441  1.00 32.15 ? 405 LYS B CA    1 
ATOM   6436  C C     . LYS B 1 408 ? 30.982  20.598  78.755  1.00 31.60 ? 405 LYS B C     1 
ATOM   6437  O O     . LYS B 1 408 ? 30.393  21.228  79.634  1.00 32.96 ? 405 LYS B O     1 
ATOM   6438  C CB    . LYS B 1 408 ? 29.490  21.384  76.849  1.00 34.10 ? 405 LYS B CB    1 
ATOM   6439  C CG    . LYS B 1 408 ? 29.037  21.116  75.403  1.00 39.01 ? 405 LYS B CG    1 
ATOM   6440  C CD    . LYS B 1 408 ? 28.414  22.356  74.751  1.00 41.83 ? 405 LYS B CD    1 
ATOM   6441  C CE    . LYS B 1 408 ? 27.905  22.055  73.350  1.00 43.32 ? 405 LYS B CE    1 
ATOM   6442  N NZ    . LYS B 1 408 ? 26.918  20.924  73.348  1.00 42.07 ? 405 LYS B NZ    1 
ATOM   6443  N N     . LEU B 1 409 ? 32.237  20.177  78.892  1.00 29.59 ? 406 LEU B N     1 
ATOM   6444  C CA    . LEU B 1 409 ? 33.009  20.472  80.091  1.00 28.75 ? 406 LEU B CA    1 
ATOM   6445  C C     . LEU B 1 409 ? 33.360  21.943  80.083  1.00 29.14 ? 406 LEU B C     1 
ATOM   6446  O O     . LEU B 1 409 ? 33.619  22.527  79.019  1.00 30.23 ? 406 LEU B O     1 
ATOM   6447  C CB    . LEU B 1 409 ? 34.312  19.642  80.139  1.00 27.21 ? 406 LEU B CB    1 
ATOM   6448  C CG    . LEU B 1 409 ? 35.070  19.589  81.481  1.00 28.15 ? 406 LEU B CG    1 
ATOM   6449  C CD1   . LEU B 1 409 ? 34.127  19.113  82.587  1.00 25.41 ? 406 LEU B CD1   1 
ATOM   6450  C CD2   . LEU B 1 409 ? 36.272  18.652  81.389  1.00 25.01 ? 406 LEU B CD2   1 
ATOM   6451  N N     . THR B 1 410 ? 33.361  22.551  81.262  1.00 28.18 ? 407 THR B N     1 
ATOM   6452  C CA    . THR B 1 410 ? 33.696  23.963  81.375  1.00 28.66 ? 407 THR B CA    1 
ATOM   6453  C C     . THR B 1 410 ? 35.184  24.131  81.677  1.00 29.69 ? 407 THR B C     1 
ATOM   6454  O O     . THR B 1 410 ? 35.763  23.364  82.454  1.00 28.43 ? 407 THR B O     1 
ATOM   6455  C CB    . THR B 1 410 ? 32.845  24.646  82.488  1.00 30.44 ? 407 THR B CB    1 
ATOM   6456  O OG1   . THR B 1 410 ? 31.494  24.816  82.013  1.00 30.53 ? 407 THR B OG1   1 
ATOM   6457  C CG2   . THR B 1 410 ? 33.426  25.997  82.875  1.00 26.13 ? 407 THR B CG2   1 
ATOM   6458  N N     . LYS B 1 411 ? 35.811  25.118  81.037  1.00 30.48 ? 408 LYS B N     1 
ATOM   6459  C CA    . LYS B 1 411 ? 37.229  25.391  81.265  1.00 31.58 ? 408 LYS B CA    1 
ATOM   6460  C C     . LYS B 1 411 ? 37.394  26.526  82.269  1.00 32.28 ? 408 LYS B C     1 
ATOM   6461  O O     . LYS B 1 411 ? 36.741  27.562  82.167  1.00 30.81 ? 408 LYS B O     1 
ATOM   6462  C CB    . LYS B 1 411 ? 37.930  25.749  79.954  1.00 31.95 ? 408 LYS B CB    1 
ATOM   6463  C CG    . LYS B 1 411 ? 38.976  24.718  79.509  1.00 34.24 ? 408 LYS B CG    1 
ATOM   6464  C CD    . LYS B 1 411 ? 40.053  24.552  80.574  1.00 35.92 ? 408 LYS B CD    1 
ATOM   6465  C CE    . LYS B 1 411 ? 41.238  23.702  80.114  1.00 34.53 ? 408 LYS B CE    1 
ATOM   6466  N NZ    . LYS B 1 411 ? 40.899  22.276  79.919  1.00 37.62 ? 408 LYS B NZ    1 
ATOM   6467  N N     . LEU B 1 412 ? 38.246  26.316  83.266  1.00 34.41 ? 409 LEU B N     1 
ATOM   6468  C CA    . LEU B 1 412 ? 38.479  27.358  84.257  1.00 35.23 ? 409 LEU B CA    1 
ATOM   6469  C C     . LEU B 1 412 ? 39.256  28.478  83.605  1.00 35.41 ? 409 LEU B C     1 
ATOM   6470  O O     . LEU B 1 412 ? 40.137  28.224  82.786  1.00 35.08 ? 409 LEU B O     1 
ATOM   6471  C CB    . LEU B 1 412 ? 39.288  26.836  85.440  1.00 34.90 ? 409 LEU B CB    1 
ATOM   6472  C CG    . LEU B 1 412 ? 38.583  26.066  86.553  1.00 35.00 ? 409 LEU B CG    1 
ATOM   6473  C CD1   . LEU B 1 412 ? 39.534  25.919  87.731  1.00 33.30 ? 409 LEU B CD1   1 
ATOM   6474  C CD2   . LEU B 1 412 ? 37.349  26.813  86.985  1.00 34.00 ? 409 LEU B CD2   1 
ATOM   6475  N N     . THR B 1 413 ? 38.920  29.715  83.962  1.00 35.33 ? 410 THR B N     1 
ATOM   6476  C CA    . THR B 1 413 ? 39.631  30.866  83.426  1.00 35.89 ? 410 THR B CA    1 
ATOM   6477  C C     . THR B 1 413 ? 40.947  30.975  84.210  1.00 36.20 ? 410 THR B C     1 
ATOM   6478  O O     . THR B 1 413 ? 41.128  30.292  85.216  1.00 34.18 ? 410 THR B O     1 
ATOM   6479  C CB    . THR B 1 413 ? 38.800  32.180  83.572  1.00 35.83 ? 410 THR B CB    1 
ATOM   6480  O OG1   . THR B 1 413 ? 38.701  32.549  84.955  1.00 34.72 ? 410 THR B OG1   1 
ATOM   6481  C CG2   . THR B 1 413 ? 37.398  31.993  83.003  1.00 33.52 ? 410 THR B CG2   1 
ATOM   6482  N N     . GLU B 1 414 ? 41.868  31.803  83.725  1.00 38.24 ? 411 GLU B N     1 
ATOM   6483  C CA    . GLU B 1 414 ? 43.160  32.000  84.379  1.00 39.28 ? 411 GLU B CA    1 
ATOM   6484  C C     . GLU B 1 414 ? 42.883  32.532  85.782  1.00 38.79 ? 411 GLU B C     1 
ATOM   6485  O O     . GLU B 1 414 ? 43.434  32.043  86.764  1.00 36.72 ? 411 GLU B O     1 
ATOM   6486  C CB    . GLU B 1 414 ? 43.986  33.027  83.593  1.00 43.43 ? 411 GLU B CB    1 
ATOM   6487  C CG    . GLU B 1 414 ? 45.443  32.650  83.334  1.00 50.05 ? 411 GLU B CG    1 
ATOM   6488  C CD    . GLU B 1 414 ? 46.255  32.522  84.608  1.00 53.89 ? 411 GLU B CD    1 
ATOM   6489  O OE1   . GLU B 1 414 ? 45.994  31.575  85.385  1.00 56.16 ? 411 GLU B OE1   1 
ATOM   6490  O OE2   . GLU B 1 414 ? 47.150  33.370  84.833  1.00 56.04 ? 411 GLU B OE2   1 
ATOM   6491  N N     . LYS B 1 415 ? 42.007  33.531  85.858  1.00 38.71 ? 412 LYS B N     1 
ATOM   6492  C CA    . LYS B 1 415 ? 41.645  34.136  87.131  1.00 38.97 ? 412 LYS B CA    1 
ATOM   6493  C C     . LYS B 1 415 ? 41.035  33.104  88.075  1.00 38.40 ? 412 LYS B C     1 
ATOM   6494  O O     . LYS B 1 415 ? 41.437  33.003  89.236  1.00 38.95 ? 412 LYS B O     1 
ATOM   6495  C CB    . LYS B 1 415 ? 40.671  35.291  86.905  1.00 40.17 ? 412 LYS B CB    1 
ATOM   6496  C CG    . LYS B 1 415 ? 40.254  36.037  88.172  1.00 44.32 ? 412 LYS B CG    1 
ATOM   6497  C CD    . LYS B 1 415 ? 39.346  37.224  87.832  1.00 46.76 ? 412 LYS B CD    1 
ATOM   6498  C CE    . LYS B 1 415 ? 38.803  37.919  89.082  1.00 48.37 ? 412 LYS B CE    1 
ATOM   6499  N NZ    . LYS B 1 415 ? 37.780  38.965  88.746  1.00 47.11 ? 412 LYS B NZ    1 
ATOM   6500  N N     . GLN B 1 416 ? 40.074  32.333  87.574  1.00 36.72 ? 413 GLN B N     1 
ATOM   6501  C CA    . GLN B 1 416 ? 39.429  31.306  88.383  1.00 35.95 ? 413 GLN B CA    1 
ATOM   6502  C C     . GLN B 1 416 ? 40.416  30.266  88.883  1.00 35.35 ? 413 GLN B C     1 
ATOM   6503  O O     . GLN B 1 416 ? 40.383  29.879  90.046  1.00 35.73 ? 413 GLN B O     1 
ATOM   6504  C CB    . GLN B 1 416 ? 38.331  30.599  87.591  1.00 35.43 ? 413 GLN B CB    1 
ATOM   6505  C CG    . GLN B 1 416 ? 37.095  31.443  87.393  1.00 37.57 ? 413 GLN B CG    1 
ATOM   6506  C CD    . GLN B 1 416 ? 35.977  30.707  86.687  1.00 38.58 ? 413 GLN B CD    1 
ATOM   6507  O OE1   . GLN B 1 416 ? 34.813  31.099  86.787  1.00 39.02 ? 413 GLN B OE1   1 
ATOM   6508  N NE2   . GLN B 1 416 ? 36.317  29.652  85.962  1.00 38.87 ? 413 GLN B NE2   1 
ATOM   6509  N N     . ALA B 1 417 ? 41.292  29.803  88.001  1.00 35.80 ? 414 ALA B N     1 
ATOM   6510  C CA    . ALA B 1 417 ? 42.268  28.789  88.378  1.00 37.19 ? 414 ALA B CA    1 
ATOM   6511  C C     . ALA B 1 417 ? 43.165  29.266  89.511  1.00 38.29 ? 414 ALA B C     1 
ATOM   6512  O O     . ALA B 1 417 ? 43.419  28.531  90.470  1.00 38.43 ? 414 ALA B O     1 
ATOM   6513  C CB    . ALA B 1 417 ? 43.110  28.394  87.165  1.00 36.21 ? 414 ALA B CB    1 
ATOM   6514  N N     . GLN B 1 418 ? 43.642  30.500  89.402  1.00 38.76 ? 415 GLN B N     1 
ATOM   6515  C CA    . GLN B 1 418 ? 44.508  31.062  90.424  1.00 40.24 ? 415 GLN B CA    1 
ATOM   6516  C C     . GLN B 1 418 ? 43.768  31.250  91.739  1.00 39.31 ? 415 GLN B C     1 
ATOM   6517  O O     . GLN B 1 418 ? 44.352  31.103  92.816  1.00 38.67 ? 415 GLN B O     1 
ATOM   6518  C CB    . GLN B 1 418 ? 45.083  32.391  89.943  1.00 42.02 ? 415 GLN B CB    1 
ATOM   6519  C CG    . GLN B 1 418 ? 45.809  32.247  88.622  1.00 47.38 ? 415 GLN B CG    1 
ATOM   6520  C CD    . GLN B 1 418 ? 47.072  33.059  88.566  1.00 51.26 ? 415 GLN B CD    1 
ATOM   6521  O OE1   . GLN B 1 418 ? 47.977  32.886  89.402  1.00 53.14 ? 415 GLN B OE1   1 
ATOM   6522  N NE2   . GLN B 1 418 ? 47.155  33.957  87.579  1.00 52.10 ? 415 GLN B NE2   1 
ATOM   6523  N N     . TYR B 1 419 ? 42.482  31.576  91.647  1.00 38.18 ? 416 TYR B N     1 
ATOM   6524  C CA    . TYR B 1 419 ? 41.663  31.768  92.835  1.00 37.32 ? 416 TYR B CA    1 
ATOM   6525  C C     . TYR B 1 419 ? 41.516  30.449  93.570  1.00 37.82 ? 416 TYR B C     1 
ATOM   6526  O O     . TYR B 1 419 ? 41.661  30.380  94.795  1.00 36.56 ? 416 TYR B O     1 
ATOM   6527  C CB    . TYR B 1 419 ? 40.276  32.275  92.455  1.00 36.97 ? 416 TYR B CB    1 
ATOM   6528  C CG    . TYR B 1 419 ? 39.373  32.451  93.649  1.00 35.86 ? 416 TYR B CG    1 
ATOM   6529  C CD1   . TYR B 1 419 ? 39.502  33.561  94.484  1.00 36.46 ? 416 TYR B CD1   1 
ATOM   6530  C CD2   . TYR B 1 419 ? 38.410  31.494  93.967  1.00 35.08 ? 416 TYR B CD2   1 
ATOM   6531  C CE1   . TYR B 1 419 ? 38.692  33.719  95.608  1.00 34.91 ? 416 TYR B CE1   1 
ATOM   6532  C CE2   . TYR B 1 419 ? 37.595  31.641  95.091  1.00 35.66 ? 416 TYR B CE2   1 
ATOM   6533  C CZ    . TYR B 1 419 ? 37.740  32.759  95.903  1.00 34.72 ? 416 TYR B CZ    1 
ATOM   6534  O OH    . TYR B 1 419 ? 36.911  32.936  96.982  1.00 32.26 ? 416 TYR B OH    1 
ATOM   6535  N N     . LEU B 1 420 ? 41.217  29.406  92.802  1.00 38.20 ? 417 LEU B N     1 
ATOM   6536  C CA    . LEU B 1 420 ? 41.041  28.069  93.347  1.00 39.42 ? 417 LEU B CA    1 
ATOM   6537  C C     . LEU B 1 420 ? 42.377  27.427  93.707  1.00 40.17 ? 417 LEU B C     1 
ATOM   6538  O O     . LEU B 1 420 ? 42.422  26.388  94.372  1.00 40.00 ? 417 LEU B O     1 
ATOM   6539  C CB    . LEU B 1 420 ? 40.302  27.192  92.339  1.00 38.01 ? 417 LEU B CB    1 
ATOM   6540  C CG    . LEU B 1 420 ? 38.834  27.547  92.120  1.00 37.30 ? 417 LEU B CG    1 
ATOM   6541  C CD1   . LEU B 1 420 ? 38.188  26.546  91.160  1.00 37.00 ? 417 LEU B CD1   1 
ATOM   6542  C CD2   . LEU B 1 420 ? 38.115  27.526  93.455  1.00 35.59 ? 417 LEU B CD2   1 
ATOM   6543  N N     . GLY B 1 421 ? 43.460  28.051  93.257  1.00 40.79 ? 418 GLY B N     1 
ATOM   6544  C CA    . GLY B 1 421 ? 44.783  27.526  93.534  1.00 41.77 ? 418 GLY B CA    1 
ATOM   6545  C C     . GLY B 1 421 ? 45.026  26.182  92.872  1.00 43.21 ? 418 GLY B C     1 
ATOM   6546  O O     . GLY B 1 421 ? 45.442  25.227  93.538  1.00 43.87 ? 418 GLY B O     1 
ATOM   6547  N N     . MET B 1 422 ? 44.764  26.103  91.566  1.00 43.86 ? 419 MET B N     1 
ATOM   6548  C CA    . MET B 1 422 ? 44.965  24.866  90.804  1.00 44.53 ? 419 MET B CA    1 
ATOM   6549  C C     . MET B 1 422 ? 45.089  25.122  89.305  1.00 44.76 ? 419 MET B C     1 
ATOM   6550  O O     . MET B 1 422 ? 44.753  26.199  88.814  1.00 43.44 ? 419 MET B O     1 
ATOM   6551  C CB    . MET B 1 422 ? 43.809  23.891  91.044  1.00 43.59 ? 419 MET B CB    1 
ATOM   6552  C CG    . MET B 1 422 ? 42.462  24.454  90.667  1.00 42.45 ? 419 MET B CG    1 
ATOM   6553  S SD    . MET B 1 422 ? 41.105  23.396  91.171  1.00 42.88 ? 419 MET B SD    1 
ATOM   6554  C CE    . MET B 1 422 ? 40.056  23.556  89.766  1.00 41.50 ? 419 MET B CE    1 
ATOM   6555  N N     . SER B 1 423 ? 45.574  24.114  88.586  1.00 46.17 ? 420 SER B N     1 
ATOM   6556  C CA    . SER B 1 423 ? 45.738  24.221  87.143  1.00 46.87 ? 420 SER B CA    1 
ATOM   6557  C C     . SER B 1 423 ? 44.409  23.996  86.460  1.00 46.87 ? 420 SER B C     1 
ATOM   6558  O O     . SER B 1 423 ? 43.573  23.234  86.940  1.00 46.91 ? 420 SER B O     1 
ATOM   6559  C CB    . SER B 1 423 ? 46.729  23.182  86.620  1.00 47.06 ? 420 SER B CB    1 
ATOM   6560  O OG    . SER B 1 423 ? 46.779  23.224  85.202  1.00 46.58 ? 420 SER B OG    1 
ATOM   6561  N N     . CYS B 1 424 ? 44.208  24.658  85.335  1.00 47.38 ? 421 CYS B N     1 
ATOM   6562  C CA    . CYS B 1 424 ? 42.974  24.473  84.615  1.00 49.03 ? 421 CYS B CA    1 
ATOM   6563  C C     . CYS B 1 424 ? 43.029  23.133  83.885  1.00 48.55 ? 421 CYS B C     1 
ATOM   6564  O O     . CYS B 1 424 ? 42.035  22.715  83.291  1.00 48.59 ? 421 CYS B O     1 
ATOM   6565  C CB    . CYS B 1 424 ? 42.774  25.613  83.633  1.00 50.96 ? 421 CYS B CB    1 
ATOM   6566  S SG    . CYS B 1 424 ? 44.243  25.946  82.684  1.00 57.06 ? 421 CYS B SG    1 
ATOM   6567  N N     . ASP B 1 425 ? 44.188  22.466  83.935  1.00 47.31 ? 422 ASP B N     1 
ATOM   6568  C CA    . ASP B 1 425 ? 44.363  21.156  83.300  1.00 46.59 ? 422 ASP B CA    1 
ATOM   6569  C C     . ASP B 1 425 ? 44.768  20.102  84.321  1.00 46.12 ? 422 ASP B C     1 
ATOM   6570  O O     . ASP B 1 425 ? 44.352  18.951  84.235  1.00 46.06 ? 422 ASP B O     1 
ATOM   6571  C CB    . ASP B 1 425 ? 45.438  21.191  82.205  1.00 46.64 ? 422 ASP B CB    1 
ATOM   6572  C CG    . ASP B 1 425 ? 45.163  22.224  81.136  1.00 47.29 ? 422 ASP B CG    1 
ATOM   6573  O OD1   . ASP B 1 425 ? 43.981  22.488  80.840  1.00 48.57 ? 422 ASP B OD1   1 
ATOM   6574  O OD2   . ASP B 1 425 ? 46.141  22.767  80.581  1.00 48.34 ? 422 ASP B OD2   1 
ATOM   6575  N N     . GLY B 1 426 ? 45.604  20.498  85.277  1.00 47.11 ? 423 GLY B N     1 
ATOM   6576  C CA    . GLY B 1 426 ? 46.054  19.566  86.304  1.00 44.00 ? 423 GLY B CA    1 
ATOM   6577  C C     . GLY B 1 426 ? 44.900  19.061  87.153  1.00 41.96 ? 423 GLY B C     1 
ATOM   6578  O O     . GLY B 1 426 ? 43.743  19.399  86.882  1.00 41.37 ? 423 GLY B O     1 
ATOM   6579  N N     . PRO B 1 427 ? 45.180  18.254  88.190  1.00 40.11 ? 424 PRO B N     1 
ATOM   6580  C CA    . PRO B 1 427 ? 44.162  17.702  89.088  1.00 39.59 ? 424 PRO B CA    1 
ATOM   6581  C C     . PRO B 1 427 ? 43.219  18.780  89.613  1.00 38.37 ? 424 PRO B C     1 
ATOM   6582  O O     . PRO B 1 427 ? 43.642  19.902  89.899  1.00 39.14 ? 424 PRO B O     1 
ATOM   6583  C CB    . PRO B 1 427 ? 44.993  17.079  90.206  1.00 40.00 ? 424 PRO B CB    1 
ATOM   6584  C CG    . PRO B 1 427 ? 46.192  16.614  89.476  1.00 39.94 ? 424 PRO B CG    1 
ATOM   6585  C CD    . PRO B 1 427 ? 46.517  17.799  88.599  1.00 40.13 ? 424 PRO B CD    1 
ATOM   6586  N N     . PHE B 1 428 ? 41.945  18.430  89.745  1.00 35.76 ? 425 PHE B N     1 
ATOM   6587  C CA    . PHE B 1 428 ? 40.943  19.370  90.219  1.00 32.92 ? 425 PHE B CA    1 
ATOM   6588  C C     . PHE B 1 428 ? 40.471  19.084  91.635  1.00 32.70 ? 425 PHE B C     1 
ATOM   6589  O O     . PHE B 1 428 ? 39.742  19.884  92.222  1.00 33.66 ? 425 PHE B O     1 
ATOM   6590  C CB    . PHE B 1 428 ? 39.742  19.344  89.289  1.00 31.51 ? 425 PHE B CB    1 
ATOM   6591  C CG    . PHE B 1 428 ? 40.056  19.741  87.883  1.00 29.96 ? 425 PHE B CG    1 
ATOM   6592  C CD1   . PHE B 1 428 ? 40.444  21.043  87.583  1.00 28.58 ? 425 PHE B CD1   1 
ATOM   6593  C CD2   . PHE B 1 428 ? 39.950  18.816  86.850  1.00 29.13 ? 425 PHE B CD2   1 
ATOM   6594  C CE1   . PHE B 1 428 ? 40.721  21.419  86.281  1.00 27.94 ? 425 PHE B CE1   1 
ATOM   6595  C CE2   . PHE B 1 428 ? 40.227  19.182  85.540  1.00 28.38 ? 425 PHE B CE2   1 
ATOM   6596  C CZ    . PHE B 1 428 ? 40.613  20.488  85.255  1.00 28.84 ? 425 PHE B CZ    1 
ATOM   6597  N N     . LYS B 1 429 ? 40.874  17.946  92.189  1.00 31.56 ? 426 LYS B N     1 
ATOM   6598  C CA    . LYS B 1 429 ? 40.454  17.585  93.535  1.00 31.32 ? 426 LYS B CA    1 
ATOM   6599  C C     . LYS B 1 429 ? 41.595  17.110  94.426  1.00 32.09 ? 426 LYS B C     1 
ATOM   6600  O O     . LYS B 1 429 ? 42.603  16.584  93.952  1.00 31.51 ? 426 LYS B O     1 
ATOM   6601  C CB    . LYS B 1 429 ? 39.387  16.486  93.462  1.00 32.81 ? 426 LYS B CB    1 
ATOM   6602  C CG    . LYS B 1 429 ? 38.111  16.887  92.732  1.00 33.62 ? 426 LYS B CG    1 
ATOM   6603  C CD    . LYS B 1 429 ? 37.179  17.673  93.636  1.00 33.87 ? 426 LYS B CD    1 
ATOM   6604  C CE    . LYS B 1 429 ? 36.514  18.791  92.862  1.00 32.46 ? 426 LYS B CE    1 
ATOM   6605  N NZ    . LYS B 1 429 ? 35.933  18.299  91.601  1.00 32.26 ? 426 LYS B NZ    1 
ATOM   6606  N N     . PRO B 1 430 ? 41.456  17.308  95.744  1.00 33.74 ? 427 PRO B N     1 
ATOM   6607  C CA    . PRO B 1 430 ? 42.510  16.861  96.657  1.00 33.83 ? 427 PRO B CA    1 
ATOM   6608  C C     . PRO B 1 430 ? 42.522  15.350  96.597  1.00 34.60 ? 427 PRO B C     1 
ATOM   6609  O O     . PRO B 1 430 ? 41.509  14.727  96.295  1.00 34.74 ? 427 PRO B O     1 
ATOM   6610  C CB    . PRO B 1 430 ? 42.035  17.370  98.013  1.00 32.98 ? 427 PRO B CB    1 
ATOM   6611  C CG    . PRO B 1 430 ? 40.537  17.358  97.869  1.00 34.60 ? 427 PRO B CG    1 
ATOM   6612  C CD    . PRO B 1 430 ? 40.362  17.955  96.489  1.00 33.66 ? 427 PRO B CD    1 
ATOM   6613  N N     . ASP B 1 431 ? 43.665  14.765  96.897  1.00 36.09 ? 428 ASP B N     1 
ATOM   6614  C CA    . ASP B 1 431 ? 43.817  13.326  96.865  1.00 37.98 ? 428 ASP B CA    1 
ATOM   6615  C C     . ASP B 1 431 ? 42.792  12.551  97.697  1.00 37.23 ? 428 ASP B C     1 
ATOM   6616  O O     . ASP B 1 431 ? 42.429  11.430  97.344  1.00 37.31 ? 428 ASP B O     1 
ATOM   6617  C CB    . ASP B 1 431 ? 45.232  12.966  97.316  1.00 41.28 ? 428 ASP B CB    1 
ATOM   6618  C CG    . ASP B 1 431 ? 45.617  11.568  96.925  1.00 42.21 ? 428 ASP B CG    1 
ATOM   6619  O OD1   . ASP B 1 431 ? 45.463  10.651  97.758  1.00 43.75 ? 428 ASP B OD1   1 
ATOM   6620  O OD2   . ASP B 1 431 ? 46.057  11.390  95.771  1.00 44.92 ? 428 ASP B OD2   1 
ATOM   6621  N N     . HIS B 1 432 ? 42.321  13.130  98.795  1.00 35.65 ? 429 HIS B N     1 
ATOM   6622  C CA    . HIS B 1 432 ? 41.351  12.421  99.622  1.00 35.01 ? 429 HIS B CA    1 
ATOM   6623  C C     . HIS B 1 432 ? 39.897  12.662  99.194  1.00 34.66 ? 429 HIS B C     1 
ATOM   6624  O O     . HIS B 1 432 ? 38.966  12.278  99.902  1.00 34.34 ? 429 HIS B O     1 
ATOM   6625  C CB    . HIS B 1 432 ? 41.529  12.805  101.094 1.00 35.69 ? 429 HIS B CB    1 
ATOM   6626  C CG    . HIS B 1 432 ? 41.433  14.277  101.343 1.00 38.65 ? 429 HIS B CG    1 
ATOM   6627  N ND1   . HIS B 1 432 ? 42.495  15.135  101.151 1.00 39.30 ? 429 HIS B ND1   1 
ATOM   6628  C CD2   . HIS B 1 432 ? 40.383  15.052  101.704 1.00 39.60 ? 429 HIS B CD2   1 
ATOM   6629  C CE1   . HIS B 1 432 ? 42.102  16.375  101.380 1.00 39.91 ? 429 HIS B CE1   1 
ATOM   6630  N NE2   . HIS B 1 432 ? 40.825  16.353  101.716 1.00 40.63 ? 429 HIS B NE2   1 
ATOM   6631  N N     . TYR B 1 433 ? 39.696  13.279  98.034  1.00 33.03 ? 430 TYR B N     1 
ATOM   6632  C CA    . TYR B 1 433 ? 38.340  13.548  97.570  1.00 32.04 ? 430 TYR B CA    1 
ATOM   6633  C C     . TYR B 1 433 ? 37.549  12.254  97.331  1.00 31.92 ? 430 TYR B C     1 
ATOM   6634  O O     . TYR B 1 433 ? 38.046  11.319  96.689  1.00 31.73 ? 430 TYR B O     1 
ATOM   6635  C CB    . TYR B 1 433 ? 38.367  14.375  96.290  1.00 31.32 ? 430 TYR B CB    1 
ATOM   6636  C CG    . TYR B 1 433 ? 37.034  15.001  95.985  1.00 31.65 ? 430 TYR B CG    1 
ATOM   6637  C CD1   . TYR B 1 433 ? 36.579  16.114  96.702  1.00 30.68 ? 430 TYR B CD1   1 
ATOM   6638  C CD2   . TYR B 1 433 ? 36.208  14.465  95.001  1.00 29.83 ? 430 TYR B CD2   1 
ATOM   6639  C CE1   . TYR B 1 433 ? 35.328  16.672  96.437  1.00 31.78 ? 430 TYR B CE1   1 
ATOM   6640  C CE2   . TYR B 1 433 ? 34.967  15.010  94.730  1.00 30.30 ? 430 TYR B CE2   1 
ATOM   6641  C CZ    . TYR B 1 433 ? 34.527  16.109  95.444  1.00 31.00 ? 430 TYR B CZ    1 
ATOM   6642  O OH    . TYR B 1 433 ? 33.297  16.630  95.147  1.00 27.27 ? 430 TYR B OH    1 
ATOM   6643  N N     . ARG B 1 434 ? 36.317  12.209  97.835  1.00 29.27 ? 431 ARG B N     1 
ATOM   6644  C CA    . ARG B 1 434 ? 35.489  11.020  97.700  1.00 27.27 ? 431 ARG B CA    1 
ATOM   6645  C C     . ARG B 1 434 ? 34.448  11.031  96.579  1.00 25.45 ? 431 ARG B C     1 
ATOM   6646  O O     . ARG B 1 434 ? 33.887  9.991   96.235  1.00 26.72 ? 431 ARG B O     1 
ATOM   6647  C CB    . ARG B 1 434 ? 34.815  10.727  99.043  1.00 27.38 ? 431 ARG B CB    1 
ATOM   6648  C CG    . ARG B 1 434 ? 35.824  10.521  100.168 1.00 28.54 ? 431 ARG B CG    1 
ATOM   6649  C CD    . ARG B 1 434 ? 35.248  9.712   101.312 1.00 29.71 ? 431 ARG B CD    1 
ATOM   6650  N NE    . ARG B 1 434 ? 36.254  9.435   102.334 1.00 32.61 ? 431 ARG B NE    1 
ATOM   6651  C CZ    . ARG B 1 434 ? 36.590  10.272  103.314 1.00 32.92 ? 431 ARG B CZ    1 
ATOM   6652  N NH1   . ARG B 1 434 ? 35.994  11.455  103.420 1.00 31.33 ? 431 ARG B NH1   1 
ATOM   6653  N NH2   . ARG B 1 434 ? 37.534  9.930   104.185 1.00 31.33 ? 431 ARG B NH2   1 
ATOM   6654  N N     . TYR B 1 435 ? 34.189  12.197  96.004  1.00 23.95 ? 432 TYR B N     1 
ATOM   6655  C CA    . TYR B 1 435 ? 33.228  12.313  94.911  1.00 22.70 ? 432 TYR B CA    1 
ATOM   6656  C C     . TYR B 1 435 ? 31.837  11.857  95.330  1.00 22.09 ? 432 TYR B C     1 
ATOM   6657  O O     . TYR B 1 435 ? 31.539  11.917  96.538  1.00 23.98 ? 432 TYR B O     1 
ATOM   6658  C CB    . TYR B 1 435 ? 33.695  11.514  93.682  1.00 20.80 ? 432 TYR B CB    1 
ATOM   6659  C CG    . TYR B 1 435 ? 35.041  11.954  93.142  1.00 19.88 ? 432 TYR B CG    1 
ATOM   6660  C CD1   . TYR B 1 435 ? 36.231  11.450  93.681  1.00 19.99 ? 432 TYR B CD1   1 
ATOM   6661  C CD2   . TYR B 1 435 ? 35.129  12.914  92.126  1.00 18.64 ? 432 TYR B CD2   1 
ATOM   6662  C CE1   . TYR B 1 435 ? 37.481  11.893  93.227  1.00 18.24 ? 432 TYR B CE1   1 
ATOM   6663  C CE2   . TYR B 1 435 ? 36.368  13.366  91.661  1.00 19.01 ? 432 TYR B CE2   1 
ATOM   6664  C CZ    . TYR B 1 435 ? 37.540  12.850  92.217  1.00 20.87 ? 432 TYR B CZ    1 
ATOM   6665  O OH    . TYR B 1 435 ? 38.769  13.281  91.763  1.00 22.19 ? 432 TYR B OH    1 
ATOM   6666  O OXT   . TYR B 1 435 ? 31.030  11.484  94.449  1.00 36.16 ? 432 TYR B OXT   1 
ATOM   6667  N N     . SER C 1 5   ? -26.954 51.507  108.243 1.00 84.44 ? 2   SER C N     1 
ATOM   6668  C CA    . SER C 1 5   ? -25.896 51.349  107.204 1.00 84.26 ? 2   SER C CA    1 
ATOM   6669  C C     . SER C 1 5   ? -24.483 51.518  107.778 1.00 83.45 ? 2   SER C C     1 
ATOM   6670  O O     . SER C 1 5   ? -23.938 52.628  107.814 1.00 83.08 ? 2   SER C O     1 
ATOM   6671  C CB    . SER C 1 5   ? -26.122 52.364  106.077 1.00 84.74 ? 2   SER C CB    1 
ATOM   6672  O OG    . SER C 1 5   ? -25.133 52.241  105.070 1.00 85.44 ? 2   SER C OG    1 
ATOM   6673  N N     . ASP C 1 6   ? -23.892 50.410  108.219 1.00 82.08 ? 3   ASP C N     1 
ATOM   6674  C CA    . ASP C 1 6   ? -22.547 50.442  108.778 1.00 81.29 ? 3   ASP C CA    1 
ATOM   6675  C C     . ASP C 1 6   ? -21.684 49.272  108.315 1.00 79.60 ? 3   ASP C C     1 
ATOM   6676  O O     . ASP C 1 6   ? -20.624 49.015  108.889 1.00 79.99 ? 3   ASP C O     1 
ATOM   6677  C CB    . ASP C 1 6   ? -22.605 50.449  110.308 1.00 83.35 ? 3   ASP C CB    1 
ATOM   6678  C CG    . ASP C 1 6   ? -23.200 51.731  110.864 1.00 85.60 ? 3   ASP C CG    1 
ATOM   6679  O OD1   . ASP C 1 6   ? -22.740 52.825  110.463 1.00 87.26 ? 3   ASP C OD1   1 
ATOM   6680  O OD2   . ASP C 1 6   ? -24.120 51.643  111.707 1.00 85.97 ? 3   ASP C OD2   1 
ATOM   6681  N N     . LYS C 1 7   ? -22.129 48.563  107.282 1.00 76.73 ? 4   LYS C N     1 
ATOM   6682  C CA    . LYS C 1 7   ? -21.369 47.423  106.773 1.00 73.78 ? 4   LYS C CA    1 
ATOM   6683  C C     . LYS C 1 7   ? -19.987 47.866  106.292 1.00 71.80 ? 4   LYS C C     1 
ATOM   6684  O O     . LYS C 1 7   ? -19.877 48.695  105.381 1.00 71.68 ? 4   LYS C O     1 
ATOM   6685  C CB    . LYS C 1 7   ? -22.119 46.748  105.620 1.00 73.37 ? 4   LYS C CB    1 
ATOM   6686  C CG    . LYS C 1 7   ? -21.404 45.533  105.050 1.00 71.54 ? 4   LYS C CG    1 
ATOM   6687  C CD    . LYS C 1 7   ? -22.138 44.955  103.853 1.00 70.33 ? 4   LYS C CD    1 
ATOM   6688  C CE    . LYS C 1 7   ? -21.387 43.767  103.270 1.00 69.48 ? 4   LYS C CE    1 
ATOM   6689  N NZ    . LYS C 1 7   ? -22.095 43.164  102.111 1.00 68.98 ? 4   LYS C NZ    1 
ATOM   6690  N N     . LEU C 1 8   ? -18.941 47.310  106.902 1.00 68.64 ? 5   LEU C N     1 
ATOM   6691  C CA    . LEU C 1 8   ? -17.567 47.648  106.537 1.00 65.63 ? 5   LEU C CA    1 
ATOM   6692  C C     . LEU C 1 8   ? -17.302 47.383  105.054 1.00 64.36 ? 5   LEU C C     1 
ATOM   6693  O O     . LEU C 1 8   ? -17.891 46.484  104.459 1.00 63.60 ? 5   LEU C O     1 
ATOM   6694  C CB    . LEU C 1 8   ? -16.575 46.839  107.376 1.00 64.09 ? 5   LEU C CB    1 
ATOM   6695  C CG    . LEU C 1 8   ? -16.513 47.088  108.885 1.00 62.93 ? 5   LEU C CG    1 
ATOM   6696  C CD1   . LEU C 1 8   ? -16.141 48.533  109.160 1.00 63.09 ? 5   LEU C CD1   1 
ATOM   6697  C CD2   . LEU C 1 8   ? -17.848 46.751  109.509 1.00 62.90 ? 5   LEU C CD2   1 
ATOM   6698  N N     . PRO C 1 9   ? -16.411 48.174  104.439 1.00 63.19 ? 6   PRO C N     1 
ATOM   6699  C CA    . PRO C 1 9   ? -16.084 48.000  103.021 1.00 62.14 ? 6   PRO C CA    1 
ATOM   6700  C C     . PRO C 1 9   ? -15.209 46.760  102.842 1.00 61.03 ? 6   PRO C C     1 
ATOM   6701  O O     . PRO C 1 9   ? -15.119 46.183  101.755 1.00 60.89 ? 6   PRO C O     1 
ATOM   6702  C CB    . PRO C 1 9   ? -15.335 49.285  102.691 1.00 62.72 ? 6   PRO C CB    1 
ATOM   6703  C CG    . PRO C 1 9   ? -14.591 49.556  103.971 1.00 62.16 ? 6   PRO C CG    1 
ATOM   6704  C CD    . PRO C 1 9   ? -15.651 49.299  105.021 1.00 62.35 ? 6   PRO C CD    1 
ATOM   6705  N N     . TYR C 1 10  ? -14.567 46.371  103.939 1.00 58.49 ? 7   TYR C N     1 
ATOM   6706  C CA    . TYR C 1 10  ? -13.684 45.224  103.978 1.00 55.69 ? 7   TYR C CA    1 
ATOM   6707  C C     . TYR C 1 10  ? -13.335 44.968  105.441 1.00 54.88 ? 7   TYR C C     1 
ATOM   6708  O O     . TYR C 1 10  ? -13.863 45.631  106.336 1.00 53.31 ? 7   TYR C O     1 
ATOM   6709  C CB    . TYR C 1 10  ? -12.420 45.515  103.159 1.00 55.08 ? 7   TYR C CB    1 
ATOM   6710  C CG    . TYR C 1 10  ? -11.529 46.602  103.729 1.00 53.55 ? 7   TYR C CG    1 
ATOM   6711  C CD1   . TYR C 1 10  ? -10.658 46.332  104.786 1.00 52.85 ? 7   TYR C CD1   1 
ATOM   6712  C CD2   . TYR C 1 10  ? -11.564 47.900  103.221 1.00 52.97 ? 7   TYR C CD2   1 
ATOM   6713  C CE1   . TYR C 1 10  ? -9.844  47.323  105.324 1.00 53.17 ? 7   TYR C CE1   1 
ATOM   6714  C CE2   . TYR C 1 10  ? -10.750 48.904  103.755 1.00 53.78 ? 7   TYR C CE2   1 
ATOM   6715  C CZ    . TYR C 1 10  ? -9.895  48.606  104.807 1.00 53.48 ? 7   TYR C CZ    1 
ATOM   6716  O OH    . TYR C 1 10  ? -9.099  49.590  105.354 1.00 53.24 ? 7   TYR C OH    1 
ATOM   6717  N N     . LYS C 1 11  ? -12.444 44.012  105.681 1.00 54.08 ? 8   LYS C N     1 
ATOM   6718  C CA    . LYS C 1 11  ? -12.043 43.677  107.037 1.00 52.69 ? 8   LYS C CA    1 
ATOM   6719  C C     . LYS C 1 11  ? -10.853 42.732  106.987 1.00 52.19 ? 8   LYS C C     1 
ATOM   6720  O O     . LYS C 1 11  ? -11.017 41.516  106.866 1.00 51.42 ? 8   LYS C O     1 
ATOM   6721  C CB    . LYS C 1 11  ? -13.201 43.006  107.769 1.00 53.85 ? 8   LYS C CB    1 
ATOM   6722  C CG    . LYS C 1 11  ? -13.197 43.185  109.286 1.00 54.76 ? 8   LYS C CG    1 
ATOM   6723  C CD    . LYS C 1 11  ? -11.949 42.630  109.944 1.00 55.05 ? 8   LYS C CD    1 
ATOM   6724  C CE    . LYS C 1 11  ? -12.067 42.673  111.461 1.00 55.12 ? 8   LYS C CE    1 
ATOM   6725  N NZ    . LYS C 1 11  ? -13.214 41.855  111.958 1.00 55.94 ? 8   LYS C NZ    1 
ATOM   6726  N N     . VAL C 1 12  ? -9.658  43.310  107.061 1.00 51.51 ? 9   VAL C N     1 
ATOM   6727  C CA    . VAL C 1 12  ? -8.414  42.551  107.037 1.00 50.27 ? 9   VAL C CA    1 
ATOM   6728  C C     . VAL C 1 12  ? -7.697  42.736  108.360 1.00 49.74 ? 9   VAL C C     1 
ATOM   6729  O O     . VAL C 1 12  ? -8.185  43.431  109.250 1.00 50.36 ? 9   VAL C O     1 
ATOM   6730  C CB    . VAL C 1 12  ? -7.475  43.025  105.901 1.00 49.68 ? 9   VAL C CB    1 
ATOM   6731  C CG1   . VAL C 1 12  ? -8.134  42.788  104.563 1.00 49.58 ? 9   VAL C CG1   1 
ATOM   6732  C CG2   . VAL C 1 12  ? -7.135  44.500  106.071 1.00 47.59 ? 9   VAL C CG2   1 
ATOM   6733  N N     . ALA C 1 13  ? -6.527  42.122  108.480 1.00 49.13 ? 10  ALA C N     1 
ATOM   6734  C CA    . ALA C 1 13  ? -5.744  42.211  109.702 1.00 48.10 ? 10  ALA C CA    1 
ATOM   6735  C C     . ALA C 1 13  ? -4.903  43.478  109.768 1.00 47.30 ? 10  ALA C C     1 
ATOM   6736  O O     . ALA C 1 13  ? -4.687  44.025  110.846 1.00 48.13 ? 10  ALA C O     1 
ATOM   6737  C CB    . ALA C 1 13  ? -4.854  40.992  109.824 1.00 47.57 ? 10  ALA C CB    1 
ATOM   6738  N N     . ASP C 1 14  ? -4.428  43.942  108.618 1.00 46.26 ? 11  ASP C N     1 
ATOM   6739  C CA    . ASP C 1 14  ? -3.594  45.136  108.562 1.00 45.26 ? 11  ASP C CA    1 
ATOM   6740  C C     . ASP C 1 14  ? -3.550  45.647  107.135 1.00 45.84 ? 11  ASP C C     1 
ATOM   6741  O O     . ASP C 1 14  ? -2.863  45.073  106.292 1.00 45.75 ? 11  ASP C O     1 
ATOM   6742  C CB    . ASP C 1 14  ? -2.171  44.805  109.009 1.00 44.40 ? 11  ASP C CB    1 
ATOM   6743  C CG    . ASP C 1 14  ? -1.306  46.047  109.206 1.00 44.44 ? 11  ASP C CG    1 
ATOM   6744  O OD1   . ASP C 1 14  ? -1.301  46.945  108.336 1.00 43.30 ? 11  ASP C OD1   1 
ATOM   6745  O OD2   . ASP C 1 14  ? -0.613  46.115  110.242 1.00 44.02 ? 11  ASP C OD2   1 
ATOM   6746  N N     . ILE C 1 15  ? -4.281  46.726  106.870 1.00 45.95 ? 12  ILE C N     1 
ATOM   6747  C CA    . ILE C 1 15  ? -4.322  47.328  105.542 1.00 45.24 ? 12  ILE C CA    1 
ATOM   6748  C C     . ILE C 1 15  ? -2.904  47.732  105.111 1.00 44.94 ? 12  ILE C C     1 
ATOM   6749  O O     . ILE C 1 15  ? -2.593  47.768  103.927 1.00 45.22 ? 12  ILE C O     1 
ATOM   6750  C CB    . ILE C 1 15  ? -5.248  48.578  105.535 1.00 45.42 ? 12  ILE C CB    1 
ATOM   6751  C CG1   . ILE C 1 15  ? -5.450  49.093  104.109 1.00 45.05 ? 12  ILE C CG1   1 
ATOM   6752  C CG2   . ILE C 1 15  ? -4.641  49.683  106.382 1.00 45.49 ? 12  ILE C CG2   1 
ATOM   6753  C CD1   . ILE C 1 15  ? -6.168  48.120  103.200 1.00 45.25 ? 12  ILE C CD1   1 
ATOM   6754  N N     . GLY C 1 16  ? -2.046  48.025  106.081 1.00 45.04 ? 13  GLY C N     1 
ATOM   6755  C CA    . GLY C 1 16  ? -0.682  48.418  105.773 1.00 46.44 ? 13  GLY C CA    1 
ATOM   6756  C C     . GLY C 1 16  ? 0.109   47.380  104.999 1.00 47.69 ? 13  GLY C C     1 
ATOM   6757  O O     . GLY C 1 16  ? 1.102   47.701  104.345 1.00 48.94 ? 13  GLY C O     1 
ATOM   6758  N N     . LEU C 1 17  ? -0.328  46.128  105.067 1.00 47.64 ? 14  LEU C N     1 
ATOM   6759  C CA    . LEU C 1 17  ? 0.349   45.048  104.362 1.00 47.26 ? 14  LEU C CA    1 
ATOM   6760  C C     . LEU C 1 17  ? 0.056   45.057  102.868 1.00 47.57 ? 14  LEU C C     1 
ATOM   6761  O O     . LEU C 1 17  ? 0.678   44.312  102.112 1.00 48.97 ? 14  LEU C O     1 
ATOM   6762  C CB    . LEU C 1 17  ? -0.066  43.694  104.944 1.00 47.31 ? 14  LEU C CB    1 
ATOM   6763  C CG    . LEU C 1 17  ? 0.629   43.181  106.209 1.00 47.74 ? 14  LEU C CG    1 
ATOM   6764  C CD1   . LEU C 1 17  ? 0.700   44.272  107.257 1.00 48.52 ? 14  LEU C CD1   1 
ATOM   6765  C CD2   . LEU C 1 17  ? -0.125  41.965  106.733 1.00 45.53 ? 14  LEU C CD2   1 
ATOM   6766  N N     . ALA C 1 18  ? -0.883  45.898  102.438 1.00 46.96 ? 15  ALA C N     1 
ATOM   6767  C CA    . ALA C 1 18  ? -1.258  45.965  101.023 1.00 45.93 ? 15  ALA C CA    1 
ATOM   6768  C C     . ALA C 1 18  ? -0.071  46.198  100.104 1.00 44.86 ? 15  ALA C C     1 
ATOM   6769  O O     . ALA C 1 18  ? -0.007  45.627  99.017  1.00 44.99 ? 15  ALA C O     1 
ATOM   6770  C CB    . ALA C 1 18  ? -2.300  47.046  100.802 1.00 45.18 ? 15  ALA C CB    1 
ATOM   6771  N N     . ALA C 1 19  ? 0.865   47.035  100.538 1.00 43.40 ? 16  ALA C N     1 
ATOM   6772  C CA    . ALA C 1 19  ? 2.042   47.336  99.731  1.00 42.17 ? 16  ALA C CA    1 
ATOM   6773  C C     . ALA C 1 19  ? 2.845   46.075  99.437  1.00 42.21 ? 16  ALA C C     1 
ATOM   6774  O O     . ALA C 1 19  ? 3.064   45.727  98.277  1.00 42.33 ? 16  ALA C O     1 
ATOM   6775  C CB    . ALA C 1 19  ? 2.915   48.351  100.438 1.00 41.21 ? 16  ALA C CB    1 
ATOM   6776  N N     . TRP C 1 20  ? 3.284   45.392  100.489 1.00 41.71 ? 17  TRP C N     1 
ATOM   6777  C CA    . TRP C 1 20  ? 4.061   44.170  100.324 1.00 41.53 ? 17  TRP C CA    1 
ATOM   6778  C C     . TRP C 1 20  ? 3.246   43.105  99.605  1.00 40.43 ? 17  TRP C C     1 
ATOM   6779  O O     . TRP C 1 20  ? 3.797   42.244  98.914  1.00 40.52 ? 17  TRP C O     1 
ATOM   6780  C CB    . TRP C 1 20  ? 4.517   43.647  101.688 1.00 42.60 ? 17  TRP C CB    1 
ATOM   6781  C CG    . TRP C 1 20  ? 5.078   42.257  101.653 1.00 43.89 ? 17  TRP C CG    1 
ATOM   6782  C CD1   . TRP C 1 20  ? 5.912   41.730  100.711 1.00 44.20 ? 17  TRP C CD1   1 
ATOM   6783  C CD2   . TRP C 1 20  ? 4.894   41.235  102.639 1.00 44.57 ? 17  TRP C CD2   1 
ATOM   6784  N NE1   . TRP C 1 20  ? 6.263   40.449  101.050 1.00 44.19 ? 17  TRP C NE1   1 
ATOM   6785  C CE2   . TRP C 1 20  ? 5.653   40.120  102.230 1.00 44.66 ? 17  TRP C CE2   1 
ATOM   6786  C CE3   . TRP C 1 20  ? 4.164   41.154  103.832 1.00 45.83 ? 17  TRP C CE3   1 
ATOM   6787  C CZ2   . TRP C 1 20  ? 5.705   38.938  102.974 1.00 45.12 ? 17  TRP C CZ2   1 
ATOM   6788  C CZ3   . TRP C 1 20  ? 4.217   39.975  104.575 1.00 45.27 ? 17  TRP C CZ3   1 
ATOM   6789  C CH2   . TRP C 1 20  ? 4.983   38.886  104.141 1.00 45.08 ? 17  TRP C CH2   1 
ATOM   6790  N N     . GLY C 1 21  ? 1.931   43.173  99.777  1.00 38.41 ? 18  GLY C N     1 
ATOM   6791  C CA    . GLY C 1 21  ? 1.052   42.220  99.139  1.00 37.66 ? 18  GLY C CA    1 
ATOM   6792  C C     . GLY C 1 21  ? 1.001   42.439  97.645  1.00 38.11 ? 18  GLY C C     1 
ATOM   6793  O O     . GLY C 1 21  ? 1.076   41.482  96.868  1.00 39.22 ? 18  GLY C O     1 
ATOM   6794  N N     . ARG C 1 22  ? 0.879   43.695  97.230  1.00 36.96 ? 19  ARG C N     1 
ATOM   6795  C CA    . ARG C 1 22  ? 0.820   43.998  95.808  1.00 36.13 ? 19  ARG C CA    1 
ATOM   6796  C C     . ARG C 1 22  ? 2.075   43.514  95.106  1.00 36.38 ? 19  ARG C C     1 
ATOM   6797  O O     . ARG C 1 22  ? 2.008   43.042  93.972  1.00 36.20 ? 19  ARG C O     1 
ATOM   6798  C CB    . ARG C 1 22  ? 0.652   45.503  95.563  1.00 34.82 ? 19  ARG C CB    1 
ATOM   6799  C CG    . ARG C 1 22  ? 0.574   45.880  94.072  1.00 32.97 ? 19  ARG C CG    1 
ATOM   6800  C CD    . ARG C 1 22  ? -0.507  45.099  93.299  1.00 31.33 ? 19  ARG C CD    1 
ATOM   6801  N NE    . ARG C 1 22  ? -1.869  45.334  93.788  1.00 32.64 ? 19  ARG C NE    1 
ATOM   6802  C CZ    . ARG C 1 22  ? -2.962  44.728  93.318  1.00 34.03 ? 19  ARG C CZ    1 
ATOM   6803  N NH1   . ARG C 1 22  ? -2.870  43.839  92.333  1.00 32.15 ? 19  ARG C NH1   1 
ATOM   6804  N NH2   . ARG C 1 22  ? -4.154  45.004  93.841  1.00 33.53 ? 19  ARG C NH2   1 
ATOM   6805  N N     . LYS C 1 23  ? 3.218   43.632  95.779  1.00 36.58 ? 20  LYS C N     1 
ATOM   6806  C CA    . LYS C 1 23  ? 4.478   43.185  95.190  1.00 37.50 ? 20  LYS C CA    1 
ATOM   6807  C C     . LYS C 1 23  ? 4.417   41.695  94.849  1.00 37.32 ? 20  LYS C C     1 
ATOM   6808  O O     . LYS C 1 23  ? 4.745   41.292  93.730  1.00 37.10 ? 20  LYS C O     1 
ATOM   6809  C CB    . LYS C 1 23  ? 5.635   43.467  96.139  1.00 37.62 ? 20  LYS C CB    1 
ATOM   6810  C CG    . LYS C 1 23  ? 6.053   44.921  96.175  1.00 38.72 ? 20  LYS C CG    1 
ATOM   6811  C CD    . LYS C 1 23  ? 7.226   45.119  97.123  1.00 38.68 ? 20  LYS C CD    1 
ATOM   6812  C CE    . LYS C 1 23  ? 7.761   46.525  97.060  1.00 39.03 ? 20  LYS C CE    1 
ATOM   6813  N NZ    . LYS C 1 23  ? 8.843   46.692  98.054  1.00 39.54 ? 20  LYS C NZ    1 
ATOM   6814  N N     . ALA C 1 24  ? 3.978   40.894  95.818  1.00 36.55 ? 21  ALA C N     1 
ATOM   6815  C CA    . ALA C 1 24  ? 3.849   39.452  95.641  1.00 35.64 ? 21  ALA C CA    1 
ATOM   6816  C C     . ALA C 1 24  ? 2.865   39.140  94.512  1.00 36.01 ? 21  ALA C C     1 
ATOM   6817  O O     . ALA C 1 24  ? 3.031   38.160  93.787  1.00 35.90 ? 21  ALA C O     1 
ATOM   6818  C CB    . ALA C 1 24  ? 3.379   38.805  96.943  1.00 34.15 ? 21  ALA C CB    1 
ATOM   6819  N N     . LEU C 1 25  ? 1.845   39.981  94.361  1.00 36.14 ? 22  LEU C N     1 
ATOM   6820  C CA    . LEU C 1 25  ? 0.864   39.784  93.302  1.00 36.10 ? 22  LEU C CA    1 
ATOM   6821  C C     . LEU C 1 25  ? 1.452   39.993  91.917  1.00 36.64 ? 22  LEU C C     1 
ATOM   6822  O O     . LEU C 1 25  ? 1.039   39.335  90.971  1.00 37.20 ? 22  LEU C O     1 
ATOM   6823  C CB    . LEU C 1 25  ? -0.328  40.720  93.478  1.00 35.87 ? 22  LEU C CB    1 
ATOM   6824  C CG    . LEU C 1 25  ? -1.338  40.281  94.533  1.00 35.09 ? 22  LEU C CG    1 
ATOM   6825  C CD1   . LEU C 1 25  ? -2.433  41.312  94.685  1.00 37.17 ? 22  LEU C CD1   1 
ATOM   6826  C CD2   . LEU C 1 25  ? -1.930  38.958  94.119  1.00 36.68 ? 22  LEU C CD2   1 
ATOM   6827  N N     . ASP C 1 26  ? 2.413   40.900  91.785  1.00 37.55 ? 23  ASP C N     1 
ATOM   6828  C CA    . ASP C 1 26  ? 2.994   41.137  90.467  1.00 38.89 ? 23  ASP C CA    1 
ATOM   6829  C C     . ASP C 1 26  ? 3.862   39.959  90.052  1.00 39.07 ? 23  ASP C C     1 
ATOM   6830  O O     . ASP C 1 26  ? 3.891   39.577  88.876  1.00 38.91 ? 23  ASP C O     1 
ATOM   6831  C CB    . ASP C 1 26  ? 3.845   42.411  90.442  1.00 39.28 ? 23  ASP C CB    1 
ATOM   6832  C CG    . ASP C 1 26  ? 3.085   43.639  90.907  1.00 40.77 ? 23  ASP C CG    1 
ATOM   6833  O OD1   . ASP C 1 26  ? 1.848   43.691  90.731  1.00 40.63 ? 23  ASP C OD1   1 
ATOM   6834  O OD2   . ASP C 1 26  ? 3.744   44.564  91.435  1.00 41.42 ? 23  ASP C OD2   1 
ATOM   6835  N N     . ILE C 1 27  ? 4.570   39.395  91.025  1.00 36.65 ? 24  ILE C N     1 
ATOM   6836  C CA    . ILE C 1 27  ? 5.438   38.266  90.765  1.00 35.06 ? 24  ILE C CA    1 
ATOM   6837  C C     . ILE C 1 27  ? 4.576   37.041  90.457  1.00 34.35 ? 24  ILE C C     1 
ATOM   6838  O O     . ILE C 1 27  ? 4.790   36.344  89.464  1.00 34.46 ? 24  ILE C O     1 
ATOM   6839  C CB    . ILE C 1 27  ? 6.348   37.980  91.981  1.00 35.07 ? 24  ILE C CB    1 
ATOM   6840  C CG1   . ILE C 1 27  ? 7.234   39.197  92.263  1.00 34.39 ? 24  ILE C CG1   1 
ATOM   6841  C CG2   . ILE C 1 27  ? 7.219   36.769  91.715  1.00 33.54 ? 24  ILE C CG2   1 
ATOM   6842  C CD1   . ILE C 1 27  ? 8.100   39.041  93.502  1.00 34.83 ? 24  ILE C CD1   1 
ATOM   6843  N N     . ALA C 1 28  ? 3.586   36.785  91.300  1.00 33.33 ? 25  ALA C N     1 
ATOM   6844  C CA    . ALA C 1 28  ? 2.720   35.638  91.083  1.00 33.88 ? 25  ALA C CA    1 
ATOM   6845  C C     . ALA C 1 28  ? 2.085   35.700  89.687  1.00 34.44 ? 25  ALA C C     1 
ATOM   6846  O O     . ALA C 1 28  ? 2.062   34.706  88.960  1.00 33.52 ? 25  ALA C O     1 
ATOM   6847  C CB    . ALA C 1 28  ? 1.647   35.587  92.159  1.00 31.34 ? 25  ALA C CB    1 
ATOM   6848  N N     . GLU C 1 29  ? 1.578   36.871  89.318  1.00 33.35 ? 26  GLU C N     1 
ATOM   6849  C CA    . GLU C 1 29  ? 0.965   37.056  88.012  1.00 32.30 ? 26  GLU C CA    1 
ATOM   6850  C C     . GLU C 1 29  ? 1.872   36.510  86.906  1.00 29.97 ? 26  GLU C C     1 
ATOM   6851  O O     . GLU C 1 29  ? 1.412   35.791  86.022  1.00 29.95 ? 26  GLU C O     1 
ATOM   6852  C CB    . GLU C 1 29  ? 0.673   38.557  87.762  1.00 32.64 ? 26  GLU C CB    1 
ATOM   6853  C CG    . GLU C 1 29  ? -0.619  39.069  88.402  1.00 35.48 ? 26  GLU C CG    1 
ATOM   6854  C CD    . GLU C 1 29  ? -0.717  40.588  88.407  1.00 37.63 ? 26  GLU C CD    1 
ATOM   6855  O OE1   . GLU C 1 29  ? -0.410  41.204  87.371  1.00 40.21 ? 26  GLU C OE1   1 
ATOM   6856  O OE2   . GLU C 1 29  ? -1.113  41.167  89.445  1.00 37.25 ? 26  GLU C OE2   1 
ATOM   6857  N N     . ASN C 1 30  ? 3.161   36.833  86.966  1.00 28.89 ? 27  ASN C N     1 
ATOM   6858  C CA    . ASN C 1 30  ? 4.095   36.379  85.941  1.00 27.79 ? 27  ASN C CA    1 
ATOM   6859  C C     . ASN C 1 30  ? 4.421   34.896  86.039  1.00 27.79 ? 27  ASN C C     1 
ATOM   6860  O O     . ASN C 1 30  ? 5.434   34.426  85.526  1.00 28.42 ? 27  ASN C O     1 
ATOM   6861  C CB    . ASN C 1 30  ? 5.389   37.177  86.004  1.00 26.64 ? 27  ASN C CB    1 
ATOM   6862  C CG    . ASN C 1 30  ? 6.091   37.217  84.666  1.00 26.64 ? 27  ASN C CG    1 
ATOM   6863  O OD1   . ASN C 1 30  ? 7.320   37.317  84.594  1.00 25.85 ? 27  ASN C OD1   1 
ATOM   6864  N ND2   . ASN C 1 30  ? 5.307   37.145  83.588  1.00 23.22 ? 27  ASN C ND2   1 
ATOM   6865  N N     . GLU C 1 31  ? 3.543   34.168  86.708  1.00 27.64 ? 28  GLU C N     1 
ATOM   6866  C CA    . GLU C 1 31  ? 3.698   32.740  86.892  1.00 28.57 ? 28  GLU C CA    1 
ATOM   6867  C C     . GLU C 1 31  ? 2.379   32.076  86.536  1.00 29.09 ? 28  GLU C C     1 
ATOM   6868  O O     . GLU C 1 31  ? 2.317   30.863  86.357  1.00 30.09 ? 28  GLU C O     1 
ATOM   6869  C CB    . GLU C 1 31  ? 4.060   32.447  88.346  1.00 29.98 ? 28  GLU C CB    1 
ATOM   6870  C CG    . GLU C 1 31  ? 5.546   32.467  88.611  1.00 31.50 ? 28  GLU C CG    1 
ATOM   6871  C CD    . GLU C 1 31  ? 6.175   31.131  88.299  1.00 34.17 ? 28  GLU C CD    1 
ATOM   6872  O OE1   . GLU C 1 31  ? 5.891   30.165  89.047  1.00 36.72 ? 28  GLU C OE1   1 
ATOM   6873  O OE2   . GLU C 1 31  ? 6.931   31.034  87.312  1.00 34.02 ? 28  GLU C OE2   1 
ATOM   6874  N N     . MET C 1 32  ? 1.329   32.887  86.425  1.00 26.76 ? 29  MET C N     1 
ATOM   6875  C CA    . MET C 1 32  ? -0.002  32.389  86.102  1.00 25.87 ? 29  MET C CA    1 
ATOM   6876  C C     . MET C 1 32  ? -0.487  32.844  84.697  1.00 25.41 ? 29  MET C C     1 
ATOM   6877  O O     . MET C 1 32  ? -1.408  33.657  84.568  1.00 23.36 ? 29  MET C O     1 
ATOM   6878  C CB    . MET C 1 32  ? -0.981  32.838  87.204  1.00 26.69 ? 29  MET C CB    1 
ATOM   6879  C CG    . MET C 1 32  ? -0.634  32.339  88.620  1.00 29.06 ? 29  MET C CG    1 
ATOM   6880  S SD    . MET C 1 32  ? -1.861  32.749  89.902  1.00 29.69 ? 29  MET C SD    1 
ATOM   6881  C CE    . MET C 1 32  ? -0.972  33.848  90.845  1.00 25.70 ? 29  MET C CE    1 
ATOM   6882  N N     . PRO C 1 33  ? 0.129   32.301  83.629  1.00 25.22 ? 30  PRO C N     1 
ATOM   6883  C CA    . PRO C 1 33  ? -0.253  32.661  82.258  1.00 25.81 ? 30  PRO C CA    1 
ATOM   6884  C C     . PRO C 1 33  ? -1.726  32.370  81.942  1.00 26.95 ? 30  PRO C C     1 
ATOM   6885  O O     . PRO C 1 33  ? -2.374  33.116  81.218  1.00 22.57 ? 30  PRO C O     1 
ATOM   6886  C CB    . PRO C 1 33  ? 0.704   31.832  81.403  1.00 24.64 ? 30  PRO C CB    1 
ATOM   6887  C CG    . PRO C 1 33  ? 0.946   30.620  82.256  1.00 26.31 ? 30  PRO C CG    1 
ATOM   6888  C CD    . PRO C 1 33  ? 1.146   31.232  83.620  1.00 25.28 ? 30  PRO C CD    1 
ATOM   6889  N N     . GLY C 1 34  ? -2.247  31.279  82.493  1.00 29.58 ? 31  GLY C N     1 
ATOM   6890  C CA    . GLY C 1 34  ? -3.637  30.938  82.263  1.00 31.45 ? 31  GLY C CA    1 
ATOM   6891  C C     . GLY C 1 34  ? -4.533  32.120  82.573  1.00 33.38 ? 31  GLY C C     1 
ATOM   6892  O O     . GLY C 1 34  ? -5.202  32.641  81.685  1.00 34.59 ? 31  GLY C O     1 
ATOM   6893  N N     . LEU C 1 35  ? -4.541  32.554  83.830  1.00 34.99 ? 32  LEU C N     1 
ATOM   6894  C CA    . LEU C 1 35  ? -5.364  33.685  84.251  1.00 36.35 ? 32  LEU C CA    1 
ATOM   6895  C C     . LEU C 1 35  ? -5.097  34.940  83.431  1.00 37.36 ? 32  LEU C C     1 
ATOM   6896  O O     . LEU C 1 35  ? -6.018  35.541  82.882  1.00 36.94 ? 32  LEU C O     1 
ATOM   6897  C CB    . LEU C 1 35  ? -5.134  33.993  85.735  1.00 34.57 ? 32  LEU C CB    1 
ATOM   6898  C CG    . LEU C 1 35  ? -5.648  32.955  86.730  1.00 34.09 ? 32  LEU C CG    1 
ATOM   6899  C CD1   . LEU C 1 35  ? -5.333  33.412  88.143  1.00 34.01 ? 32  LEU C CD1   1 
ATOM   6900  C CD2   . LEU C 1 35  ? -7.155  32.754  86.540  1.00 32.89 ? 32  LEU C CD2   1 
ATOM   6901  N N     . MET C 1 36  ? -3.833  35.337  83.356  1.00 39.80 ? 33  MET C N     1 
ATOM   6902  C CA    . MET C 1 36  ? -3.465  36.524  82.603  1.00 42.27 ? 33  MET C CA    1 
ATOM   6903  C C     . MET C 1 36  ? -3.923  36.413  81.147  1.00 44.33 ? 33  MET C C     1 
ATOM   6904  O O     . MET C 1 36  ? -4.357  37.403  80.558  1.00 45.87 ? 33  MET C O     1 
ATOM   6905  C CB    . MET C 1 36  ? -1.955  36.748  82.691  1.00 40.71 ? 33  MET C CB    1 
ATOM   6906  C CG    . MET C 1 36  ? -1.444  36.891  84.128  1.00 42.12 ? 33  MET C CG    1 
ATOM   6907  S SD    . MET C 1 36  ? -2.340  38.117  85.123  1.00 41.37 ? 33  MET C SD    1 
ATOM   6908  C CE    . MET C 1 36  ? -1.478  39.618  84.661  1.00 41.01 ? 33  MET C CE    1 
ATOM   6909  N N     . ARG C 1 37  ? -3.834  35.216  80.572  1.00 45.62 ? 34  ARG C N     1 
ATOM   6910  C CA    . ARG C 1 37  ? -4.276  34.994  79.198  1.00 47.50 ? 34  ARG C CA    1 
ATOM   6911  C C     . ARG C 1 37  ? -5.796  35.135  79.120  1.00 47.81 ? 34  ARG C C     1 
ATOM   6912  O O     . ARG C 1 37  ? -6.349  35.495  78.079  1.00 47.09 ? 34  ARG C O     1 
ATOM   6913  C CB    . ARG C 1 37  ? -3.876  33.596  78.718  1.00 50.41 ? 34  ARG C CB    1 
ATOM   6914  C CG    . ARG C 1 37  ? -2.631  33.558  77.852  1.00 54.51 ? 34  ARG C CG    1 
ATOM   6915  C CD    . ARG C 1 37  ? -2.844  34.424  76.635  1.00 58.13 ? 34  ARG C CD    1 
ATOM   6916  N NE    . ARG C 1 37  ? -4.148  34.161  76.037  1.00 60.61 ? 34  ARG C NE    1 
ATOM   6917  C CZ    . ARG C 1 37  ? -4.689  34.907  75.082  1.00 63.07 ? 34  ARG C CZ    1 
ATOM   6918  N NH1   . ARG C 1 37  ? -4.033  35.962  74.621  1.00 64.63 ? 34  ARG C NH1   1 
ATOM   6919  N NH2   . ARG C 1 37  ? -5.881  34.597  74.586  1.00 64.47 ? 34  ARG C NH2   1 
ATOM   6920  N N     . MET C 1 38  ? -6.463  34.853  80.233  1.00 47.11 ? 35  MET C N     1 
ATOM   6921  C CA    . MET C 1 38  ? -7.911  34.945  80.303  1.00 47.31 ? 35  MET C CA    1 
ATOM   6922  C C     . MET C 1 38  ? -8.319  36.417  80.365  1.00 47.90 ? 35  MET C C     1 
ATOM   6923  O O     . MET C 1 38  ? -9.405  36.791  79.925  1.00 48.62 ? 35  MET C O     1 
ATOM   6924  C CB    . MET C 1 38  ? -8.427  34.218  81.546  1.00 46.55 ? 35  MET C CB    1 
ATOM   6925  C CG    . MET C 1 38  ? -9.810  33.630  81.392  1.00 47.24 ? 35  MET C CG    1 
ATOM   6926  S SD    . MET C 1 38  ? -9.753  31.978  80.690  1.00 48.82 ? 35  MET C SD    1 
ATOM   6927  C CE    . MET C 1 38  ? -9.371  32.322  78.997  1.00 48.19 ? 35  MET C CE    1 
ATOM   6928  N N     . ARG C 1 39  ? -7.441  37.248  80.919  1.00 47.25 ? 36  ARG C N     1 
ATOM   6929  C CA    . ARG C 1 39  ? -7.708  38.674  81.037  1.00 47.49 ? 36  ARG C CA    1 
ATOM   6930  C C     . ARG C 1 39  ? -7.617  39.366  79.688  1.00 48.90 ? 36  ARG C C     1 
ATOM   6931  O O     . ARG C 1 39  ? -8.581  39.972  79.225  1.00 50.49 ? 36  ARG C O     1 
ATOM   6932  C CB    . ARG C 1 39  ? -6.713  39.338  81.998  1.00 45.49 ? 36  ARG C CB    1 
ATOM   6933  C CG    . ARG C 1 39  ? -6.878  38.946  83.459  1.00 43.18 ? 36  ARG C CG    1 
ATOM   6934  C CD    . ARG C 1 39  ? -5.819  39.614  84.334  1.00 41.07 ? 36  ARG C CD    1 
ATOM   6935  N NE    . ARG C 1 39  ? -5.988  39.296  85.752  1.00 39.15 ? 36  ARG C NE    1 
ATOM   6936  C CZ    . ARG C 1 39  ? -5.264  39.830  86.732  1.00 38.74 ? 36  ARG C CZ    1 
ATOM   6937  N NH1   . ARG C 1 39  ? -4.317  40.712  86.449  1.00 35.59 ? 36  ARG C NH1   1 
ATOM   6938  N NH2   . ARG C 1 39  ? -5.490  39.487  87.999  1.00 38.84 ? 36  ARG C NH2   1 
ATOM   6939  N N     . GLU C 1 40  ? -6.456  39.282  79.054  1.00 49.48 ? 37  GLU C N     1 
ATOM   6940  C CA    . GLU C 1 40  ? -6.261  39.933  77.768  1.00 51.56 ? 37  GLU C CA    1 
ATOM   6941  C C     . GLU C 1 40  ? -7.233  39.445  76.710  1.00 50.70 ? 37  GLU C C     1 
ATOM   6942  O O     . GLU C 1 40  ? -7.542  40.163  75.759  1.00 49.98 ? 37  GLU C O     1 
ATOM   6943  C CB    . GLU C 1 40  ? -4.836  39.717  77.278  1.00 53.55 ? 37  GLU C CB    1 
ATOM   6944  C CG    . GLU C 1 40  ? -4.445  38.269  77.173  1.00 58.32 ? 37  GLU C CG    1 
ATOM   6945  C CD    . GLU C 1 40  ? -3.000  38.106  76.744  1.00 62.03 ? 37  GLU C CD    1 
ATOM   6946  O OE1   . GLU C 1 40  ? -2.694  38.405  75.567  1.00 63.16 ? 37  GLU C OE1   1 
ATOM   6947  O OE2   . GLU C 1 40  ? -2.172  37.688  77.588  1.00 63.61 ? 37  GLU C OE2   1 
ATOM   6948  N N     . ARG C 1 41  ? -7.727  38.229  76.879  1.00 50.59 ? 38  ARG C N     1 
ATOM   6949  C CA    . ARG C 1 41  ? -8.657  37.682  75.911  1.00 51.50 ? 38  ARG C CA    1 
ATOM   6950  C C     . ARG C 1 41  ? -10.108 38.023  76.222  1.00 51.18 ? 38  ARG C C     1 
ATOM   6951  O O     . ARG C 1 41  ? -10.948 38.034  75.327  1.00 52.00 ? 38  ARG C O     1 
ATOM   6952  C CB    . ARG C 1 41  ? -8.480  36.167  75.834  1.00 52.00 ? 38  ARG C CB    1 
ATOM   6953  C CG    . ARG C 1 41  ? -9.507  35.443  74.999  1.00 51.65 ? 38  ARG C CG    1 
ATOM   6954  C CD    . ARG C 1 41  ? -9.243  33.959  75.062  1.00 53.42 ? 38  ARG C CD    1 
ATOM   6955  N NE    . ARG C 1 41  ? -10.309 33.169  74.459  1.00 53.37 ? 38  ARG C NE    1 
ATOM   6956  C CZ    . ARG C 1 41  ? -10.638 33.217  73.175  1.00 52.37 ? 38  ARG C CZ    1 
ATOM   6957  N NH1   . ARG C 1 41  ? -9.979  34.025  72.354  1.00 50.87 ? 38  ARG C NH1   1 
ATOM   6958  N NH2   . ARG C 1 41  ? -11.624 32.453  72.718  1.00 52.66 ? 38  ARG C NH2   1 
ATOM   6959  N N     . TYR C 1 42  ? -10.407 38.314  77.481  1.00 51.40 ? 39  TYR C N     1 
ATOM   6960  C CA    . TYR C 1 42  ? -11.779 38.634  77.857  1.00 52.06 ? 39  TYR C CA    1 
ATOM   6961  C C     . TYR C 1 42  ? -11.936 39.944  78.610  1.00 52.51 ? 39  TYR C C     1 
ATOM   6962  O O     . TYR C 1 42  ? -12.979 40.191  79.215  1.00 53.74 ? 39  TYR C O     1 
ATOM   6963  C CB    . TYR C 1 42  ? -12.373 37.498  78.695  1.00 51.45 ? 39  TYR C CB    1 
ATOM   6964  C CG    . TYR C 1 42  ? -12.564 36.211  77.928  1.00 52.05 ? 39  TYR C CG    1 
ATOM   6965  C CD1   . TYR C 1 42  ? -13.448 36.142  76.851  1.00 51.83 ? 39  TYR C CD1   1 
ATOM   6966  C CD2   . TYR C 1 42  ? -11.850 35.063  78.269  1.00 52.49 ? 39  TYR C CD2   1 
ATOM   6967  C CE1   . TYR C 1 42  ? -13.615 34.958  76.131  1.00 52.33 ? 39  TYR C CE1   1 
ATOM   6968  C CE2   . TYR C 1 42  ? -12.008 33.877  77.559  1.00 52.23 ? 39  TYR C CE2   1 
ATOM   6969  C CZ    . TYR C 1 42  ? -12.890 33.830  76.491  1.00 52.38 ? 39  TYR C CZ    1 
ATOM   6970  O OH    . TYR C 1 42  ? -13.038 32.658  75.783  1.00 52.29 ? 39  TYR C OH    1 
ATOM   6971  N N     . SER C 1 43  ? -10.915 40.789  78.578  1.00 52.66 ? 40  SER C N     1 
ATOM   6972  C CA    . SER C 1 43  ? -11.009 42.057  79.284  1.00 53.17 ? 40  SER C CA    1 
ATOM   6973  C C     . SER C 1 43  ? -11.988 42.988  78.587  1.00 54.10 ? 40  SER C C     1 
ATOM   6974  O O     . SER C 1 43  ? -12.917 43.504  79.211  1.00 54.71 ? 40  SER C O     1 
ATOM   6975  C CB    . SER C 1 43  ? -9.644  42.728  79.374  1.00 52.98 ? 40  SER C CB    1 
ATOM   6976  O OG    . SER C 1 43  ? -9.757  43.966  80.051  1.00 52.14 ? 40  SER C OG    1 
ATOM   6977  N N     . ALA C 1 44  ? -11.781 43.200  77.291  1.00 54.04 ? 41  ALA C N     1 
ATOM   6978  C CA    . ALA C 1 44  ? -12.656 44.078  76.523  1.00 54.54 ? 41  ALA C CA    1 
ATOM   6979  C C     . ALA C 1 44  ? -14.038 43.450  76.363  1.00 54.53 ? 41  ALA C C     1 
ATOM   6980  O O     . ALA C 1 44  ? -15.050 44.144  76.363  1.00 55.66 ? 41  ALA C O     1 
ATOM   6981  C CB    . ALA C 1 44  ? -12.043 44.361  75.154  1.00 53.80 ? 41  ALA C CB    1 
ATOM   6982  N N     . SER C 1 45  ? -14.081 42.130  76.240  1.00 54.64 ? 42  SER C N     1 
ATOM   6983  C CA    . SER C 1 45  ? -15.344 41.429  76.077  1.00 53.72 ? 42  SER C CA    1 
ATOM   6984  C C     . SER C 1 45  ? -16.248 41.564  77.308  1.00 53.04 ? 42  SER C C     1 
ATOM   6985  O O     . SER C 1 45  ? -17.463 41.683  77.172  1.00 53.86 ? 42  SER C O     1 
ATOM   6986  C CB    . SER C 1 45  ? -15.074 39.950  75.770  1.00 54.20 ? 42  SER C CB    1 
ATOM   6987  O OG    . SER C 1 45  ? -16.273 39.251  75.485  1.00 54.37 ? 42  SER C OG    1 
ATOM   6988  N N     . LYS C 1 46  ? -15.658 41.561  78.503  1.00 52.55 ? 43  LYS C N     1 
ATOM   6989  C CA    . LYS C 1 46  ? -16.424 41.668  79.752  1.00 53.16 ? 43  LYS C CA    1 
ATOM   6990  C C     . LYS C 1 46  ? -17.563 40.636  79.823  1.00 53.07 ? 43  LYS C C     1 
ATOM   6991  O O     . LYS C 1 46  ? -18.734 41.002  79.938  1.00 53.70 ? 43  LYS C O     1 
ATOM   6992  C CB    . LYS C 1 46  ? -17.012 43.074  79.902  1.00 52.61 ? 43  LYS C CB    1 
ATOM   6993  C CG    . LYS C 1 46  ? -15.999 44.183  80.171  1.00 53.35 ? 43  LYS C CG    1 
ATOM   6994  C CD    . LYS C 1 46  ? -15.505 44.158  81.608  1.00 53.01 ? 43  LYS C CD    1 
ATOM   6995  C CE    . LYS C 1 46  ? -14.747 45.438  81.977  1.00 53.51 ? 43  LYS C CE    1 
ATOM   6996  N NZ    . LYS C 1 46  ? -13.533 45.694  81.137  1.00 53.13 ? 43  LYS C NZ    1 
ATOM   6997  N N     . PRO C 1 47  ? -17.232 39.333  79.766  1.00 52.53 ? 44  PRO C N     1 
ATOM   6998  C CA    . PRO C 1 47  ? -18.262 38.289  79.823  1.00 51.66 ? 44  PRO C CA    1 
ATOM   6999  C C     . PRO C 1 47  ? -18.999 38.206  81.155  1.00 50.66 ? 44  PRO C C     1 
ATOM   7000  O O     . PRO C 1 47  ? -20.158 37.800  81.206  1.00 50.22 ? 44  PRO C O     1 
ATOM   7001  C CB    . PRO C 1 47  ? -17.473 37.007  79.537  1.00 51.75 ? 44  PRO C CB    1 
ATOM   7002  C CG    . PRO C 1 47  ? -16.319 37.489  78.717  1.00 52.43 ? 44  PRO C CG    1 
ATOM   7003  C CD    . PRO C 1 47  ? -15.920 38.739  79.455  1.00 51.94 ? 44  PRO C CD    1 
ATOM   7004  N N     . LEU C 1 48  ? -18.321 38.577  82.234  1.00 50.19 ? 45  LEU C N     1 
ATOM   7005  C CA    . LEU C 1 48  ? -18.923 38.507  83.560  1.00 49.60 ? 45  LEU C CA    1 
ATOM   7006  C C     . LEU C 1 48  ? -19.598 39.805  83.977  1.00 49.61 ? 45  LEU C C     1 
ATOM   7007  O O     . LEU C 1 48  ? -19.793 40.061  85.169  1.00 48.60 ? 45  LEU C O     1 
ATOM   7008  C CB    . LEU C 1 48  ? -17.869 38.119  84.603  1.00 48.57 ? 45  LEU C CB    1 
ATOM   7009  C CG    . LEU C 1 48  ? -17.096 36.813  84.392  1.00 47.23 ? 45  LEU C CG    1 
ATOM   7010  C CD1   . LEU C 1 48  ? -16.235 36.539  85.618  1.00 45.80 ? 45  LEU C CD1   1 
ATOM   7011  C CD2   . LEU C 1 48  ? -18.064 35.660  84.154  1.00 47.18 ? 45  LEU C CD2   1 
ATOM   7012  N N     . LYS C 1 49  ? -19.955 40.622  82.994  1.00 50.37 ? 46  LYS C N     1 
ATOM   7013  C CA    . LYS C 1 49  ? -20.619 41.882  83.284  1.00 51.81 ? 46  LYS C CA    1 
ATOM   7014  C C     . LYS C 1 49  ? -21.987 41.599  83.906  1.00 51.59 ? 46  LYS C C     1 
ATOM   7015  O O     . LYS C 1 49  ? -22.729 40.743  83.427  1.00 50.44 ? 46  LYS C O     1 
ATOM   7016  C CB    . LYS C 1 49  ? -20.794 42.696  82.002  1.00 53.61 ? 46  LYS C CB    1 
ATOM   7017  C CG    . LYS C 1 49  ? -21.313 44.105  82.240  1.00 56.11 ? 46  LYS C CG    1 
ATOM   7018  C CD    . LYS C 1 49  ? -21.696 44.794  80.938  1.00 56.93 ? 46  LYS C CD    1 
ATOM   7019  C CE    . LYS C 1 49  ? -22.038 46.260  81.176  1.00 57.81 ? 46  LYS C CE    1 
ATOM   7020  N NZ    . LYS C 1 49  ? -20.857 47.049  81.638  1.00 58.05 ? 46  LYS C NZ    1 
ATOM   7021  N N     . GLY C 1 50  ? -22.304 42.305  84.987  1.00 51.82 ? 47  GLY C N     1 
ATOM   7022  C CA    . GLY C 1 50  ? -23.589 42.117  85.641  1.00 51.69 ? 47  GLY C CA    1 
ATOM   7023  C C     . GLY C 1 50  ? -23.579 41.052  86.715  1.00 51.29 ? 47  GLY C C     1 
ATOM   7024  O O     . GLY C 1 50  ? -24.416 41.061  87.626  1.00 51.17 ? 47  GLY C O     1 
ATOM   7025  N N     . ALA C 1 51  ? -22.627 40.130  86.607  1.00 50.83 ? 48  ALA C N     1 
ATOM   7026  C CA    . ALA C 1 51  ? -22.495 39.046  87.569  1.00 49.36 ? 48  ALA C CA    1 
ATOM   7027  C C     . ALA C 1 51  ? -21.916 39.551  88.880  1.00 49.87 ? 48  ALA C C     1 
ATOM   7028  O O     . ALA C 1 51  ? -21.008 40.383  88.898  1.00 50.65 ? 48  ALA C O     1 
ATOM   7029  C CB    . ALA C 1 51  ? -21.617 37.960  87.002  1.00 48.07 ? 48  ALA C CB    1 
ATOM   7030  N N     . ARG C 1 52  ? -22.456 39.049  89.982  1.00 49.98 ? 49  ARG C N     1 
ATOM   7031  C CA    . ARG C 1 52  ? -21.990 39.421  91.309  1.00 50.42 ? 49  ARG C CA    1 
ATOM   7032  C C     . ARG C 1 52  ? -21.560 38.134  92.009  1.00 50.73 ? 49  ARG C C     1 
ATOM   7033  O O     . ARG C 1 52  ? -22.363 37.472  92.676  1.00 51.99 ? 49  ARG C O     1 
ATOM   7034  C CB    . ARG C 1 52  ? -23.118 40.111  92.080  1.00 51.27 ? 49  ARG C CB    1 
ATOM   7035  C CG    . ARG C 1 52  ? -23.608 41.413  91.443  1.00 53.12 ? 49  ARG C CG    1 
ATOM   7036  C CD    . ARG C 1 52  ? -24.495 42.210  92.404  1.00 54.24 ? 49  ARG C CD    1 
ATOM   7037  N NE    . ARG C 1 52  ? -25.812 41.603  92.586  1.00 55.25 ? 49  ARG C NE    1 
ATOM   7038  C CZ    . ARG C 1 52  ? -26.754 41.578  91.647  1.00 54.44 ? 49  ARG C CZ    1 
ATOM   7039  N NH1   . ARG C 1 52  ? -26.524 42.126  90.463  1.00 54.27 ? 49  ARG C NH1   1 
ATOM   7040  N NH2   . ARG C 1 52  ? -27.924 41.009  91.891  1.00 53.43 ? 49  ARG C NH2   1 
ATOM   7041  N N     . ILE C 1 53  ? -20.287 37.781  91.845  1.00 50.07 ? 50  ILE C N     1 
ATOM   7042  C CA    . ILE C 1 53  ? -19.745 36.551  92.422  1.00 48.59 ? 50  ILE C CA    1 
ATOM   7043  C C     . ILE C 1 53  ? -19.331 36.646  93.875  1.00 45.89 ? 50  ILE C C     1 
ATOM   7044  O O     . ILE C 1 53  ? -18.590 37.533  94.274  1.00 44.54 ? 50  ILE C O     1 
ATOM   7045  C CB    . ILE C 1 53  ? -18.523 36.055  91.629  1.00 49.11 ? 50  ILE C CB    1 
ATOM   7046  C CG1   . ILE C 1 53  ? -18.849 36.015  90.140  1.00 49.21 ? 50  ILE C CG1   1 
ATOM   7047  C CG2   . ILE C 1 53  ? -18.128 34.670  92.116  1.00 49.94 ? 50  ILE C CG2   1 
ATOM   7048  C CD1   . ILE C 1 53  ? -17.640 35.795  89.255  1.00 49.56 ? 50  ILE C CD1   1 
ATOM   7049  N N     . ALA C 1 54  ? -19.812 35.700  94.663  1.00 45.84 ? 51  ALA C N     1 
ATOM   7050  C CA    . ALA C 1 54  ? -19.478 35.655  96.073  1.00 45.83 ? 51  ALA C CA    1 
ATOM   7051  C C     . ALA C 1 54  ? -18.653 34.392  96.299  1.00 45.69 ? 51  ALA C C     1 
ATOM   7052  O O     . ALA C 1 54  ? -19.179 33.267  96.276  1.00 45.44 ? 51  ALA C O     1 
ATOM   7053  C CB    . ALA C 1 54  ? -20.748 35.622  96.906  1.00 46.37 ? 51  ALA C CB    1 
ATOM   7054  N N     . GLY C 1 55  ? -17.356 34.589  96.517  1.00 44.69 ? 52  GLY C N     1 
ATOM   7055  C CA    . GLY C 1 55  ? -16.467 33.464  96.727  1.00 43.58 ? 52  GLY C CA    1 
ATOM   7056  C C     . GLY C 1 55  ? -16.068 33.196  98.163  1.00 42.50 ? 52  GLY C C     1 
ATOM   7057  O O     . GLY C 1 55  ? -16.057 34.103  99.004  1.00 42.57 ? 52  GLY C O     1 
ATOM   7058  N N     . CYS C 1 56  ? -15.749 31.933  98.438  1.00 40.76 ? 53  CYS C N     1 
ATOM   7059  C CA    . CYS C 1 56  ? -15.309 31.503  99.763  1.00 41.08 ? 53  CYS C CA    1 
ATOM   7060  C C     . CYS C 1 56  ? -14.090 30.613  99.599  1.00 40.35 ? 53  CYS C C     1 
ATOM   7061  O O     . CYS C 1 56  ? -14.166 29.400  99.749  1.00 40.44 ? 53  CYS C O     1 
ATOM   7062  C CB    . CYS C 1 56  ? -16.410 30.720  100.472 1.00 41.30 ? 53  CYS C CB    1 
ATOM   7063  S SG    . CYS C 1 56  ? -15.965 30.243  102.163 1.00 43.83 ? 53  CYS C SG    1 
ATOM   7064  N N     . LEU C 1 57  ? -12.956 31.221  99.294  1.00 40.21 ? 54  LEU C N     1 
ATOM   7065  C CA    . LEU C 1 57  ? -11.747 30.449  99.074  1.00 40.96 ? 54  LEU C CA    1 
ATOM   7066  C C     . LEU C 1 57  ? -10.566 31.086  99.786  1.00 41.28 ? 54  LEU C C     1 
ATOM   7067  O O     . LEU C 1 57  ? -10.513 32.306  99.924  1.00 41.83 ? 54  LEU C O     1 
ATOM   7068  C CB    . LEU C 1 57  ? -11.489 30.388  97.575  1.00 41.15 ? 54  LEU C CB    1 
ATOM   7069  C CG    . LEU C 1 57  ? -10.984 29.076  97.010  1.00 40.00 ? 54  LEU C CG    1 
ATOM   7070  C CD1   . LEU C 1 57  ? -10.955 29.208  95.510  1.00 40.82 ? 54  LEU C CD1   1 
ATOM   7071  C CD2   . LEU C 1 57  ? -9.609  28.752  97.565  1.00 40.66 ? 54  LEU C CD2   1 
ATOM   7072  N N     . HIS C 1 58  ? -9.626  30.253  100.234 1.00 41.75 ? 55  HIS C N     1 
ATOM   7073  C CA    . HIS C 1 58  ? -8.419  30.694  100.959 1.00 40.62 ? 55  HIS C CA    1 
ATOM   7074  C C     . HIS C 1 58  ? -7.840  31.988  100.390 1.00 39.78 ? 55  HIS C C     1 
ATOM   7075  O O     . HIS C 1 58  ? -7.361  32.014  99.253  1.00 39.51 ? 55  HIS C O     1 
ATOM   7076  C CB    . HIS C 1 58  ? -7.355  29.586  100.915 1.00 39.45 ? 55  HIS C CB    1 
ATOM   7077  C CG    . HIS C 1 58  ? -7.889  28.223  101.230 1.00 38.12 ? 55  HIS C CG    1 
ATOM   7078  N ND1   . HIS C 1 58  ? -7.819  27.662  102.486 1.00 37.52 ? 55  HIS C ND1   1 
ATOM   7079  C CD2   . HIS C 1 58  ? -8.521  27.316  100.450 1.00 37.40 ? 55  HIS C CD2   1 
ATOM   7080  C CE1   . HIS C 1 58  ? -8.385  26.469  102.466 1.00 36.77 ? 55  HIS C CE1   1 
ATOM   7081  N NE2   . HIS C 1 58  ? -8.820  26.235  101.242 1.00 36.49 ? 55  HIS C NE2   1 
ATOM   7082  N N     . MET C 1 59  ? -7.887  33.055  101.185 1.00 39.09 ? 56  MET C N     1 
ATOM   7083  C CA    . MET C 1 59  ? -7.393  34.354  100.736 1.00 38.41 ? 56  MET C CA    1 
ATOM   7084  C C     . MET C 1 59  ? -5.867  34.354  100.672 1.00 37.56 ? 56  MET C C     1 
ATOM   7085  O O     . MET C 1 59  ? -5.181  34.761  101.617 1.00 37.32 ? 56  MET C O     1 
ATOM   7086  C CB    . MET C 1 59  ? -7.905  35.463  101.667 1.00 38.39 ? 56  MET C CB    1 
ATOM   7087  C CG    . MET C 1 59  ? -7.766  36.883  101.124 1.00 38.48 ? 56  MET C CG    1 
ATOM   7088  S SD    . MET C 1 59  ? -8.455  37.157  99.456  1.00 41.12 ? 56  MET C SD    1 
ATOM   7089  C CE    . MET C 1 59  ? -6.957  37.076  98.444  1.00 39.68 ? 56  MET C CE    1 
ATOM   7090  N N     . THR C 1 60  ? -5.352  33.897  99.534  1.00 35.27 ? 57  THR C N     1 
ATOM   7091  C CA    . THR C 1 60  ? -3.917  33.828  99.316  1.00 33.63 ? 57  THR C CA    1 
ATOM   7092  C C     . THR C 1 60  ? -3.537  34.763  98.169  1.00 33.32 ? 57  THR C C     1 
ATOM   7093  O O     . THR C 1 60  ? -4.400  35.387  97.541  1.00 32.20 ? 57  THR C O     1 
ATOM   7094  C CB    . THR C 1 60  ? -3.469  32.378  98.945  1.00 31.95 ? 57  THR C CB    1 
ATOM   7095  O OG1   . THR C 1 60  ? -3.985  32.038  97.652  1.00 32.64 ? 57  THR C OG1   1 
ATOM   7096  C CG2   . THR C 1 60  ? -3.990  31.364  99.966  1.00 27.79 ? 57  THR C CG2   1 
ATOM   7097  N N     . VAL C 1 61  ? -2.237  34.859  97.911  1.00 33.18 ? 58  VAL C N     1 
ATOM   7098  C CA    . VAL C 1 61  ? -1.742  35.686  96.823  1.00 33.71 ? 58  VAL C CA    1 
ATOM   7099  C C     . VAL C 1 61  ? -2.267  35.086  95.515  1.00 34.60 ? 58  VAL C C     1 
ATOM   7100  O O     . VAL C 1 61  ? -2.519  35.805  94.552  1.00 34.25 ? 58  VAL C O     1 
ATOM   7101  C CB    . VAL C 1 61  ? -0.197  35.702  96.783  1.00 32.35 ? 58  VAL C CB    1 
ATOM   7102  C CG1   . VAL C 1 61  ? 0.289   36.538  95.611  1.00 32.00 ? 58  VAL C CG1   1 
ATOM   7103  C CG2   . VAL C 1 61  ? 0.347   36.250  98.088  1.00 29.90 ? 58  VAL C CG2   1 
ATOM   7104  N N     . GLU C 1 62  ? -2.440  33.767  95.483  1.00 34.31 ? 59  GLU C N     1 
ATOM   7105  C CA    . GLU C 1 62  ? -2.944  33.136  94.266  1.00 35.64 ? 59  GLU C CA    1 
ATOM   7106  C C     . GLU C 1 62  ? -4.433  33.437  94.089  1.00 35.07 ? 59  GLU C C     1 
ATOM   7107  O O     . GLU C 1 62  ? -4.907  33.640  92.973  1.00 35.52 ? 59  GLU C O     1 
ATOM   7108  C CB    . GLU C 1 62  ? -2.724  31.619  94.287  1.00 34.97 ? 59  GLU C CB    1 
ATOM   7109  C CG    . GLU C 1 62  ? -1.281  31.182  94.128  1.00 32.56 ? 59  GLU C CG    1 
ATOM   7110  C CD    . GLU C 1 62  ? -0.403  31.606  95.289  1.00 33.20 ? 59  GLU C CD    1 
ATOM   7111  O OE1   . GLU C 1 62  ? -0.820  31.406  96.451  1.00 30.93 ? 59  GLU C OE1   1 
ATOM   7112  O OE2   . GLU C 1 62  ? 0.711   32.129  95.036  1.00 33.83 ? 59  GLU C OE2   1 
ATOM   7113  N N     . THR C 1 63  ? -5.171  33.469  95.189  1.00 34.06 ? 60  THR C N     1 
ATOM   7114  C CA    . THR C 1 63  ? -6.594  33.753  95.099  1.00 33.83 ? 60  THR C CA    1 
ATOM   7115  C C     . THR C 1 63  ? -6.824  35.200  94.678  1.00 33.75 ? 60  THR C C     1 
ATOM   7116  O O     . THR C 1 63  ? -7.710  35.487  93.878  1.00 33.57 ? 60  THR C O     1 
ATOM   7117  C CB    . THR C 1 63  ? -7.286  33.490  96.441  1.00 33.51 ? 60  THR C CB    1 
ATOM   7118  O OG1   . THR C 1 63  ? -7.379  32.079  96.648  1.00 34.60 ? 60  THR C OG1   1 
ATOM   7119  C CG2   . THR C 1 63  ? -8.668  34.104  96.463  1.00 32.61 ? 60  THR C CG2   1 
ATOM   7120  N N     . ALA C 1 64  ? -6.010  36.099  95.218  1.00 32.57 ? 61  ALA C N     1 
ATOM   7121  C CA    . ALA C 1 64  ? -6.113  37.513  94.905  1.00 31.91 ? 61  ALA C CA    1 
ATOM   7122  C C     . ALA C 1 64  ? -6.029  37.737  93.408  1.00 32.19 ? 61  ALA C C     1 
ATOM   7123  O O     . ALA C 1 64  ? -6.736  38.582  92.843  1.00 33.86 ? 61  ALA C O     1 
ATOM   7124  C CB    . ALA C 1 64  ? -5.000  38.275  95.598  1.00 30.06 ? 61  ALA C CB    1 
ATOM   7125  N N     . VAL C 1 65  ? -5.160  36.977  92.762  1.00 30.20 ? 62  VAL C N     1 
ATOM   7126  C CA    . VAL C 1 65  ? -4.988  37.123  91.332  1.00 29.80 ? 62  VAL C CA    1 
ATOM   7127  C C     . VAL C 1 65  ? -6.229  36.682  90.580  1.00 29.08 ? 62  VAL C C     1 
ATOM   7128  O O     . VAL C 1 65  ? -6.526  37.198  89.509  1.00 28.85 ? 62  VAL C O     1 
ATOM   7129  C CB    . VAL C 1 65  ? -3.789  36.315  90.842  1.00 29.16 ? 62  VAL C CB    1 
ATOM   7130  C CG1   . VAL C 1 65  ? -3.675  36.439  89.329  1.00 29.65 ? 62  VAL C CG1   1 
ATOM   7131  C CG2   . VAL C 1 65  ? -2.519  36.825  91.519  1.00 25.99 ? 62  VAL C CG2   1 
ATOM   7132  N N     . LEU C 1 66  ? -6.939  35.712  91.145  1.00 29.79 ? 63  LEU C N     1 
ATOM   7133  C CA    . LEU C 1 66  ? -8.162  35.182  90.546  1.00 29.69 ? 63  LEU C CA    1 
ATOM   7134  C C     . LEU C 1 66  ? -9.297  36.188  90.733  1.00 29.78 ? 63  LEU C C     1 
ATOM   7135  O O     . LEU C 1 66  ? -10.123 36.370  89.840  1.00 29.04 ? 63  LEU C O     1 
ATOM   7136  C CB    . LEU C 1 66  ? -8.531  33.840  91.204  1.00 28.90 ? 63  LEU C CB    1 
ATOM   7137  C CG    . LEU C 1 66  ? -9.984  33.364  91.064  1.00 29.48 ? 63  LEU C CG    1 
ATOM   7138  C CD1   . LEU C 1 66  ? -10.352 33.198  89.613  1.00 30.39 ? 63  LEU C CD1   1 
ATOM   7139  C CD2   . LEU C 1 66  ? -10.166 32.046  91.804  1.00 31.00 ? 63  LEU C CD2   1 
ATOM   7140  N N     . ILE C 1 67  ? -9.317  36.835  91.900  1.00 29.66 ? 64  ILE C N     1 
ATOM   7141  C CA    . ILE C 1 67  ? -10.323 37.839  92.243  1.00 31.20 ? 64  ILE C CA    1 
ATOM   7142  C C     . ILE C 1 67  ? -10.241 39.044  91.301  1.00 33.52 ? 64  ILE C C     1 
ATOM   7143  O O     . ILE C 1 67  ? -11.265 39.626  90.924  1.00 33.60 ? 64  ILE C O     1 
ATOM   7144  C CB    . ILE C 1 67  ? -10.121 38.346  93.675  1.00 30.19 ? 64  ILE C CB    1 
ATOM   7145  C CG1   . ILE C 1 67  ? -10.279 37.196  94.663  1.00 31.13 ? 64  ILE C CG1   1 
ATOM   7146  C CG2   . ILE C 1 67  ? -11.117 39.435  93.994  1.00 30.27 ? 64  ILE C CG2   1 
ATOM   7147  C CD1   . ILE C 1 67  ? -10.007 37.613  96.087  1.00 29.03 ? 64  ILE C CD1   1 
ATOM   7148  N N     . GLU C 1 68  ? -9.018  39.423  90.936  1.00 32.08 ? 65  GLU C N     1 
ATOM   7149  C CA    . GLU C 1 68  ? -8.829  40.541  90.026  1.00 33.42 ? 65  GLU C CA    1 
ATOM   7150  C C     . GLU C 1 68  ? -9.117  40.102  88.596  1.00 34.40 ? 65  GLU C C     1 
ATOM   7151  O O     . GLU C 1 68  ? -9.487  40.917  87.762  1.00 35.53 ? 65  GLU C O     1 
ATOM   7152  C CB    . GLU C 1 68  ? -7.404  41.110  90.123  1.00 30.72 ? 65  GLU C CB    1 
ATOM   7153  C CG    . GLU C 1 68  ? -7.071  41.594  91.522  1.00 30.57 ? 65  GLU C CG    1 
ATOM   7154  C CD    . GLU C 1 68  ? -5.957  42.622  91.570  1.00 30.36 ? 65  GLU C CD    1 
ATOM   7155  O OE1   . GLU C 1 68  ? -4.845  42.348  91.073  1.00 27.16 ? 65  GLU C OE1   1 
ATOM   7156  O OE2   . GLU C 1 68  ? -6.202  43.712  92.130  1.00 33.10 ? 65  GLU C OE2   1 
ATOM   7157  N N     . THR C 1 69  ? -8.953  38.816  88.310  1.00 35.60 ? 66  THR C N     1 
ATOM   7158  C CA    . THR C 1 69  ? -9.234  38.311  86.970  1.00 37.07 ? 66  THR C CA    1 
ATOM   7159  C C     . THR C 1 69  ? -10.738 38.404  86.741  1.00 37.55 ? 66  THR C C     1 
ATOM   7160  O O     . THR C 1 69  ? -11.198 38.792  85.668  1.00 38.33 ? 66  THR C O     1 
ATOM   7161  C CB    . THR C 1 69  ? -8.790  36.843  86.812  1.00 36.89 ? 66  THR C CB    1 
ATOM   7162  O OG1   . THR C 1 69  ? -7.374  36.753  87.015  1.00 36.39 ? 66  THR C OG1   1 
ATOM   7163  C CG2   . THR C 1 69  ? -9.132  36.324  85.419  1.00 35.86 ? 66  THR C CG2   1 
ATOM   7164  N N     . LEU C 1 70  ? -11.499 38.050  87.767  1.00 37.77 ? 67  LEU C N     1 
ATOM   7165  C CA    . LEU C 1 70  ? -12.941 38.112  87.685  1.00 39.09 ? 67  LEU C CA    1 
ATOM   7166  C C     . LEU C 1 70  ? -13.362 39.572  87.543  1.00 40.98 ? 67  LEU C C     1 
ATOM   7167  O O     . LEU C 1 70  ? -14.252 39.885  86.752  1.00 41.44 ? 67  LEU C O     1 
ATOM   7168  C CB    . LEU C 1 70  ? -13.569 37.504  88.941  1.00 39.66 ? 67  LEU C CB    1 
ATOM   7169  C CG    . LEU C 1 70  ? -13.298 36.015  89.199  1.00 39.86 ? 67  LEU C CG    1 
ATOM   7170  C CD1   . LEU C 1 70  ? -13.775 35.670  90.589  1.00 39.65 ? 67  LEU C CD1   1 
ATOM   7171  C CD2   . LEU C 1 70  ? -13.985 35.142  88.151  1.00 37.46 ? 67  LEU C CD2   1 
ATOM   7172  N N     . VAL C 1 71  ? -12.708 40.459  88.296  1.00 41.50 ? 68  VAL C N     1 
ATOM   7173  C CA    . VAL C 1 71  ? -13.016 41.893  88.263  1.00 41.85 ? 68  VAL C CA    1 
ATOM   7174  C C     . VAL C 1 71  ? -12.643 42.537  86.923  1.00 42.99 ? 68  VAL C C     1 
ATOM   7175  O O     . VAL C 1 71  ? -13.339 43.435  86.434  1.00 42.68 ? 68  VAL C O     1 
ATOM   7176  C CB    . VAL C 1 71  ? -12.292 42.649  89.417  1.00 41.83 ? 68  VAL C CB    1 
ATOM   7177  C CG1   . VAL C 1 71  ? -12.425 44.155  89.233  1.00 39.82 ? 68  VAL C CG1   1 
ATOM   7178  C CG2   . VAL C 1 71  ? -12.880 42.234  90.762  1.00 40.99 ? 68  VAL C CG2   1 
ATOM   7179  N N     . THR C 1 72  ? -11.540 42.078  86.337  1.00 43.42 ? 69  THR C N     1 
ATOM   7180  C CA    . THR C 1 72  ? -11.085 42.591  85.050  1.00 42.79 ? 69  THR C CA    1 
ATOM   7181  C C     . THR C 1 72  ? -12.106 42.197  83.989  1.00 43.80 ? 69  THR C C     1 
ATOM   7182  O O     . THR C 1 72  ? -12.142 42.765  82.894  1.00 44.93 ? 69  THR C O     1 
ATOM   7183  C CB    . THR C 1 72  ? -9.728  41.998  84.653  1.00 42.31 ? 69  THR C CB    1 
ATOM   7184  O OG1   . THR C 1 72  ? -8.762  42.274  85.675  1.00 44.13 ? 69  THR C OG1   1 
ATOM   7185  C CG2   . THR C 1 72  ? -9.254  42.596  83.350  1.00 42.37 ? 69  THR C CG2   1 
ATOM   7186  N N     . LEU C 1 73  ? -12.934 41.213  84.320  1.00 43.96 ? 70  LEU C N     1 
ATOM   7187  C CA    . LEU C 1 73  ? -13.959 40.746  83.401  1.00 45.14 ? 70  LEU C CA    1 
ATOM   7188  C C     . LEU C 1 73  ? -15.330 41.314  83.758  1.00 45.98 ? 70  LEU C C     1 
ATOM   7189  O O     . LEU C 1 73  ? -16.361 40.702  83.488  1.00 45.74 ? 70  LEU C O     1 
ATOM   7190  C CB    . LEU C 1 73  ? -13.991 39.213  83.376  1.00 43.65 ? 70  LEU C CB    1 
ATOM   7191  C CG    . LEU C 1 73  ? -12.986 38.526  82.438  1.00 41.68 ? 70  LEU C CG    1 
ATOM   7192  C CD1   . LEU C 1 73  ? -11.578 39.037  82.684  1.00 39.70 ? 70  LEU C CD1   1 
ATOM   7193  C CD2   . LEU C 1 73  ? -13.052 37.025  82.658  1.00 41.43 ? 70  LEU C CD2   1 
ATOM   7194  N N     . GLY C 1 74  ? -15.322 42.496  84.368  1.00 47.91 ? 71  GLY C N     1 
ATOM   7195  C CA    . GLY C 1 74  ? -16.556 43.173  84.731  1.00 50.09 ? 71  GLY C CA    1 
ATOM   7196  C C     . GLY C 1 74  ? -17.438 42.435  85.708  1.00 51.22 ? 71  GLY C C     1 
ATOM   7197  O O     . GLY C 1 74  ? -18.663 42.471  85.611  1.00 52.99 ? 71  GLY C O     1 
ATOM   7198  N N     . ALA C 1 75  ? -16.819 41.765  86.663  1.00 51.42 ? 72  ALA C N     1 
ATOM   7199  C CA    . ALA C 1 75  ? -17.584 41.036  87.647  1.00 52.35 ? 72  ALA C CA    1 
ATOM   7200  C C     . ALA C 1 75  ? -17.422 41.690  89.011  1.00 52.52 ? 72  ALA C C     1 
ATOM   7201  O O     . ALA C 1 75  ? -16.321 42.069  89.409  1.00 51.70 ? 72  ALA C O     1 
ATOM   7202  C CB    . ALA C 1 75  ? -17.126 39.586  87.690  1.00 52.29 ? 72  ALA C CB    1 
ATOM   7203  N N     . GLU C 1 76  ? -18.538 41.841  89.711  1.00 53.75 ? 73  GLU C N     1 
ATOM   7204  C CA    . GLU C 1 76  ? -18.534 42.436  91.038  1.00 55.52 ? 73  GLU C CA    1 
ATOM   7205  C C     . GLU C 1 76  ? -18.197 41.284  91.973  1.00 55.32 ? 73  GLU C C     1 
ATOM   7206  O O     . GLU C 1 76  ? -18.808 40.219  91.893  1.00 56.41 ? 73  GLU C O     1 
ATOM   7207  C CB    . GLU C 1 76  ? -19.919 42.995  91.360  1.00 57.58 ? 73  GLU C CB    1 
ATOM   7208  C CG    . GLU C 1 76  ? -19.928 44.395  91.948  1.00 60.42 ? 73  GLU C CG    1 
ATOM   7209  C CD    . GLU C 1 76  ? -21.343 44.910  92.172  1.00 63.44 ? 73  GLU C CD    1 
ATOM   7210  O OE1   . GLU C 1 76  ? -22.119 44.226  92.878  1.00 64.77 ? 73  GLU C OE1   1 
ATOM   7211  O OE2   . GLU C 1 76  ? -21.683 45.989  91.637  1.00 64.15 ? 73  GLU C OE2   1 
ATOM   7212  N N     . VAL C 1 77  ? -17.228 41.481  92.857  1.00 54.45 ? 74  VAL C N     1 
ATOM   7213  C CA    . VAL C 1 77  ? -16.838 40.400  93.750  1.00 53.49 ? 74  VAL C CA    1 
ATOM   7214  C C     . VAL C 1 77  ? -16.654 40.777  95.219  1.00 52.63 ? 74  VAL C C     1 
ATOM   7215  O O     . VAL C 1 77  ? -16.176 41.866  95.539  1.00 51.99 ? 74  VAL C O     1 
ATOM   7216  C CB    . VAL C 1 77  ? -15.524 39.750  93.250  1.00 53.03 ? 74  VAL C CB    1 
ATOM   7217  C CG1   . VAL C 1 77  ? -15.217 38.508  94.054  1.00 53.47 ? 74  VAL C CG1   1 
ATOM   7218  C CG2   . VAL C 1 77  ? -15.637 39.414  91.774  1.00 53.74 ? 74  VAL C CG2   1 
ATOM   7219  N N     . GLN C 1 78  ? -17.056 39.860  96.098  1.00 52.04 ? 75  GLN C N     1 
ATOM   7220  C CA    . GLN C 1 78  ? -16.907 40.010  97.550  1.00 50.94 ? 75  GLN C CA    1 
ATOM   7221  C C     . GLN C 1 78  ? -16.287 38.681  97.973  1.00 48.56 ? 75  GLN C C     1 
ATOM   7222  O O     . GLN C 1 78  ? -16.758 37.617  97.560  1.00 48.21 ? 75  GLN C O     1 
ATOM   7223  C CB    . GLN C 1 78  ? -18.262 40.206  98.237  1.00 52.04 ? 75  GLN C CB    1 
ATOM   7224  C CG    . GLN C 1 78  ? -19.151 41.237  97.566  1.00 53.86 ? 75  GLN C CG    1 
ATOM   7225  C CD    . GLN C 1 78  ? -20.097 41.914  98.534  1.00 55.17 ? 75  GLN C CD    1 
ATOM   7226  O OE1   . GLN C 1 78  ? -19.715 42.847  99.241  1.00 54.87 ? 75  GLN C OE1   1 
ATOM   7227  N NE2   . GLN C 1 78  ? -21.340 41.441  98.579  1.00 56.14 ? 75  GLN C NE2   1 
ATOM   7228  N N     . TRP C 1 79  ? -15.244 38.726  98.794  1.00 45.90 ? 76  TRP C N     1 
ATOM   7229  C CA    . TRP C 1 79  ? -14.572 37.489  99.164  1.00 43.81 ? 76  TRP C CA    1 
ATOM   7230  C C     . TRP C 1 79  ? -14.431 37.196  100.644 1.00 43.76 ? 76  TRP C C     1 
ATOM   7231  O O     . TRP C 1 79  ? -14.511 38.088  101.492 1.00 42.96 ? 76  TRP C O     1 
ATOM   7232  C CB    . TRP C 1 79  ? -13.186 37.469  98.524  1.00 42.23 ? 76  TRP C CB    1 
ATOM   7233  C CG    . TRP C 1 79  ? -12.724 36.117  98.074  1.00 40.77 ? 76  TRP C CG    1 
ATOM   7234  C CD1   . TRP C 1 79  ? -11.987 35.211  98.787  1.00 38.67 ? 76  TRP C CD1   1 
ATOM   7235  C CD2   . TRP C 1 79  ? -12.943 35.536  96.788  1.00 39.99 ? 76  TRP C CD2   1 
ATOM   7236  N NE1   . TRP C 1 79  ? -11.733 34.101  98.017  1.00 38.27 ? 76  TRP C NE1   1 
ATOM   7237  C CE2   . TRP C 1 79  ? -12.307 34.274  96.785  1.00 39.10 ? 76  TRP C CE2   1 
ATOM   7238  C CE3   . TRP C 1 79  ? -13.614 35.961  95.633  1.00 40.15 ? 76  TRP C CE3   1 
ATOM   7239  C CZ2   . TRP C 1 79  ? -12.321 33.433  95.668  1.00 39.04 ? 76  TRP C CZ2   1 
ATOM   7240  C CZ3   . TRP C 1 79  ? -13.626 35.125  94.519  1.00 40.97 ? 76  TRP C CZ3   1 
ATOM   7241  C CH2   . TRP C 1 79  ? -12.983 33.874  94.547  1.00 39.75 ? 76  TRP C CH2   1 
ATOM   7242  N N     . SER C 1 80  ? -14.194 35.915  100.918 1.00 43.46 ? 77  SER C N     1 
ATOM   7243  C CA    . SER C 1 80  ? -14.000 35.388  102.261 1.00 41.99 ? 77  SER C CA    1 
ATOM   7244  C C     . SER C 1 80  ? -13.229 34.066  102.158 1.00 41.41 ? 77  SER C C     1 
ATOM   7245  O O     . SER C 1 80  ? -13.448 33.279  101.234 1.00 40.77 ? 77  SER C O     1 
ATOM   7246  C CB    . SER C 1 80  ? -15.349 35.143  102.931 1.00 42.67 ? 77  SER C CB    1 
ATOM   7247  O OG    . SER C 1 80  ? -16.117 34.200  102.201 1.00 43.11 ? 77  SER C OG    1 
ATOM   7248  N N     . SER C 1 81  ? -12.335 33.825  103.112 1.00 41.03 ? 78  SER C N     1 
ATOM   7249  C CA    . SER C 1 81  ? -11.538 32.603  103.129 1.00 40.20 ? 78  SER C CA    1 
ATOM   7250  C C     . SER C 1 81  ? -12.376 31.421  103.618 1.00 40.50 ? 78  SER C C     1 
ATOM   7251  O O     . SER C 1 81  ? -13.237 31.585  104.478 1.00 42.32 ? 78  SER C O     1 
ATOM   7252  C CB    . SER C 1 81  ? -10.336 32.792  104.046 1.00 39.78 ? 78  SER C CB    1 
ATOM   7253  O OG    . SER C 1 81  ? -9.357  31.802  103.805 1.00 38.44 ? 78  SER C OG    1 
ATOM   7254  N N     . CYS C 1 82  ? -12.123 30.230  103.082 1.00 39.40 ? 79  CYS C N     1 
ATOM   7255  C CA    . CYS C 1 82  ? -12.878 29.050  103.491 1.00 37.32 ? 79  CYS C CA    1 
ATOM   7256  C C     . CYS C 1 82  ? -12.195 28.252  104.604 1.00 36.42 ? 79  CYS C C     1 
ATOM   7257  O O     . CYS C 1 82  ? -12.521 27.089  104.834 1.00 36.63 ? 79  CYS C O     1 
ATOM   7258  C CB    . CYS C 1 82  ? -13.122 28.146  102.289 1.00 35.43 ? 79  CYS C CB    1 
ATOM   7259  S SG    . CYS C 1 82  ? -11.610 27.574  101.528 1.00 35.01 ? 79  CYS C SG    1 
ATOM   7260  N N     . ASN C 1 83  ? -11.229 28.870  105.274 1.00 35.01 ? 80  ASN C N     1 
ATOM   7261  C CA    . ASN C 1 83  ? -10.533 28.234  106.384 1.00 33.77 ? 80  ASN C CA    1 
ATOM   7262  C C     . ASN C 1 83  ? -9.886  29.317  107.234 1.00 35.13 ? 80  ASN C C     1 
ATOM   7263  O O     . ASN C 1 83  ? -9.190  30.205  106.731 1.00 35.01 ? 80  ASN C O     1 
ATOM   7264  C CB    . ASN C 1 83  ? -9.484  27.236  105.893 1.00 33.00 ? 80  ASN C CB    1 
ATOM   7265  C CG    . ASN C 1 83  ? -8.823  26.474  107.043 1.00 31.75 ? 80  ASN C CG    1 
ATOM   7266  O OD1   . ASN C 1 83  ? -7.896  26.968  107.686 1.00 29.16 ? 80  ASN C OD1   1 
ATOM   7267  N ND2   . ASN C 1 83  ? -9.318  25.274  107.316 1.00 29.47 ? 80  ASN C ND2   1 
ATOM   7268  N N     . ILE C 1 84  ? -10.114 29.229  108.534 1.00 35.71 ? 81  ILE C N     1 
ATOM   7269  C CA    . ILE C 1 84  ? -9.606  30.223  109.462 1.00 36.68 ? 81  ILE C CA    1 
ATOM   7270  C C     . ILE C 1 84  ? -8.111  30.543  109.452 1.00 37.34 ? 81  ILE C C     1 
ATOM   7271  O O     . ILE C 1 84  ? -7.735  31.665  109.781 1.00 38.64 ? 81  ILE C O     1 
ATOM   7272  C CB    . ILE C 1 84  ? -10.019 29.856  110.898 1.00 37.11 ? 81  ILE C CB    1 
ATOM   7273  C CG1   . ILE C 1 84  ? -9.460  28.483  111.273 1.00 36.49 ? 81  ILE C CG1   1 
ATOM   7274  C CG2   . ILE C 1 84  ? -11.539 29.852  111.010 1.00 36.67 ? 81  ILE C CG2   1 
ATOM   7275  C CD1   . ILE C 1 84  ? -9.739  28.090  112.701 1.00 34.95 ? 81  ILE C CD1   1 
ATOM   7276  N N     . PHE C 1 85  ? -7.264  29.586  109.074 1.00 38.68 ? 82  PHE C N     1 
ATOM   7277  C CA    . PHE C 1 85  ? -5.805  29.799  109.087 1.00 39.00 ? 82  PHE C CA    1 
ATOM   7278  C C     . PHE C 1 85  ? -5.102  29.904  107.734 1.00 38.94 ? 82  PHE C C     1 
ATOM   7279  O O     . PHE C 1 85  ? -3.894  30.120  107.675 1.00 39.16 ? 82  PHE C O     1 
ATOM   7280  C CB    . PHE C 1 85  ? -5.119  28.671  109.862 1.00 40.83 ? 82  PHE C CB    1 
ATOM   7281  C CG    . PHE C 1 85  ? -5.455  28.629  111.328 1.00 42.83 ? 82  PHE C CG    1 
ATOM   7282  C CD1   . PHE C 1 85  ? -5.300  29.763  112.120 1.00 43.37 ? 82  PHE C CD1   1 
ATOM   7283  C CD2   . PHE C 1 85  ? -5.863  27.436  111.926 1.00 41.77 ? 82  PHE C CD2   1 
ATOM   7284  C CE1   . PHE C 1 85  ? -5.541  29.712  113.496 1.00 44.62 ? 82  PHE C CE1   1 
ATOM   7285  C CE2   . PHE C 1 85  ? -6.107  27.374  113.293 1.00 44.59 ? 82  PHE C CE2   1 
ATOM   7286  C CZ    . PHE C 1 85  ? -5.945  28.514  114.083 1.00 44.29 ? 82  PHE C CZ    1 
ATOM   7287  N N     . SER C 1 86  ? -5.848  29.746  106.651 1.00 39.86 ? 83  SER C N     1 
ATOM   7288  C CA    . SER C 1 86  ? -5.251  29.778  105.323 1.00 39.68 ? 83  SER C CA    1 
ATOM   7289  C C     . SER C 1 86  ? -5.006  31.160  104.707 1.00 40.28 ? 83  SER C C     1 
ATOM   7290  O O     . SER C 1 86  ? -4.189  31.285  103.795 1.00 40.53 ? 83  SER C O     1 
ATOM   7291  C CB    . SER C 1 86  ? -6.107  28.948  104.376 1.00 39.23 ? 83  SER C CB    1 
ATOM   7292  O OG    . SER C 1 86  ? -7.407  29.504  104.276 1.00 38.73 ? 83  SER C OG    1 
ATOM   7293  N N     . THR C 1 87  ? -5.697  32.189  105.193 1.00 40.15 ? 84  THR C N     1 
ATOM   7294  C CA    . THR C 1 87  ? -5.536  33.536  104.647 1.00 39.91 ? 84  THR C CA    1 
ATOM   7295  C C     . THR C 1 87  ? -4.119  34.111  104.818 1.00 39.46 ? 84  THR C C     1 
ATOM   7296  O O     . THR C 1 87  ? -3.457  33.881  105.835 1.00 37.86 ? 84  THR C O     1 
ATOM   7297  C CB    . THR C 1 87  ? -6.580  34.526  105.276 1.00 40.33 ? 84  THR C CB    1 
ATOM   7298  O OG1   . THR C 1 87  ? -7.905  34.112  104.917 1.00 40.56 ? 84  THR C OG1   1 
ATOM   7299  C CG2   . THR C 1 87  ? -6.364  35.954  104.762 1.00 38.79 ? 84  THR C CG2   1 
ATOM   7300  N N     . GLN C 1 88  ? -3.659  34.832  103.794 1.00 39.42 ? 85  GLN C N     1 
ATOM   7301  C CA    . GLN C 1 88  ? -2.346  35.483  103.797 1.00 40.00 ? 85  GLN C CA    1 
ATOM   7302  C C     . GLN C 1 88  ? -2.656  36.975  103.917 1.00 41.07 ? 85  GLN C C     1 
ATOM   7303  O O     . GLN C 1 88  ? -3.128  37.600  102.962 1.00 41.39 ? 85  GLN C O     1 
ATOM   7304  C CB    . GLN C 1 88  ? -1.590  35.168  102.495 1.00 40.38 ? 85  GLN C CB    1 
ATOM   7305  C CG    . GLN C 1 88  ? -1.325  33.658  102.298 1.00 41.04 ? 85  GLN C CG    1 
ATOM   7306  C CD    . GLN C 1 88  ? -0.688  33.280  100.957 1.00 41.26 ? 85  GLN C CD    1 
ATOM   7307  O OE1   . GLN C 1 88  ? -0.555  32.096  100.644 1.00 41.10 ? 85  GLN C OE1   1 
ATOM   7308  N NE2   . GLN C 1 88  ? -0.297  34.272  100.171 1.00 40.73 ? 85  GLN C NE2   1 
ATOM   7309  N N     . ASP C 1 89  ? -2.415  37.530  105.104 1.00 40.95 ? 86  ASP C N     1 
ATOM   7310  C CA    . ASP C 1 89  ? -2.703  38.931  105.399 1.00 40.43 ? 86  ASP C CA    1 
ATOM   7311  C C     . ASP C 1 89  ? -2.266  39.981  104.375 1.00 40.65 ? 86  ASP C C     1 
ATOM   7312  O O     . ASP C 1 89  ? -3.054  40.866  104.030 1.00 41.25 ? 86  ASP C O     1 
ATOM   7313  C CB    . ASP C 1 89  ? -2.160  39.288  106.789 1.00 39.89 ? 86  ASP C CB    1 
ATOM   7314  C CG    . ASP C 1 89  ? -2.836  38.495  107.901 1.00 39.85 ? 86  ASP C CG    1 
ATOM   7315  O OD1   . ASP C 1 89  ? -4.026  38.209  107.828 1.00 41.03 ? 86  ASP C OD1   1 
ATOM   7316  O OD2   . ASP C 1 89  ? -2.080  38.150  108.937 1.00 38.94 ? 86  ASP C OD2   1 
ATOM   7317  N N     . HIS C 1 90  ? -1.034  39.901  103.882 1.00 40.18 ? 87  HIS C N     1 
ATOM   7318  C CA    . HIS C 1 90  ? -0.573  40.884  102.899 1.00 39.67 ? 87  HIS C CA    1 
ATOM   7319  C C     . HIS C 1 90  ? -1.372  40.776  101.601 1.00 39.02 ? 87  HIS C C     1 
ATOM   7320  O O     . HIS C 1 90  ? -1.489  41.739  100.847 1.00 39.30 ? 87  HIS C O     1 
ATOM   7321  C CB    . HIS C 1 90  ? 0.916   40.697  102.601 1.00 39.03 ? 87  HIS C CB    1 
ATOM   7322  C CG    . HIS C 1 90  ? 1.252   39.392  101.950 1.00 39.48 ? 87  HIS C CG    1 
ATOM   7323  N ND1   . HIS C 1 90  ? 0.479   38.259  102.101 1.00 39.48 ? 87  HIS C ND1   1 
ATOM   7324  C CD2   . HIS C 1 90  ? 2.319   39.018  101.207 1.00 39.97 ? 87  HIS C CD2   1 
ATOM   7325  C CE1   . HIS C 1 90  ? 1.056   37.245  101.485 1.00 38.94 ? 87  HIS C CE1   1 
ATOM   7326  N NE2   . HIS C 1 90  ? 2.175   37.679  100.934 1.00 41.48 ? 87  HIS C NE2   1 
ATOM   7327  N N     . ALA C 1 91  ? -1.923  39.596  101.342 1.00 38.59 ? 88  ALA C N     1 
ATOM   7328  C CA    . ALA C 1 91  ? -2.705  39.363  100.140 1.00 38.30 ? 88  ALA C CA    1 
ATOM   7329  C C     . ALA C 1 91  ? -4.116  39.930  100.286 1.00 38.78 ? 88  ALA C C     1 
ATOM   7330  O O     . ALA C 1 91  ? -4.690  40.438  99.326  1.00 39.42 ? 88  ALA C O     1 
ATOM   7331  C CB    . ALA C 1 91  ? -2.765  37.874  99.845  1.00 38.03 ? 88  ALA C CB    1 
ATOM   7332  N N     . ALA C 1 92  ? -4.669  39.835  101.492 1.00 38.76 ? 89  ALA C N     1 
ATOM   7333  C CA    . ALA C 1 92  ? -6.004  40.348  101.762 1.00 38.03 ? 89  ALA C CA    1 
ATOM   7334  C C     . ALA C 1 92  ? -5.959  41.871  101.769 1.00 36.96 ? 89  ALA C C     1 
ATOM   7335  O O     . ALA C 1 92  ? -6.908  42.531  101.346 1.00 35.76 ? 89  ALA C O     1 
ATOM   7336  C CB    . ALA C 1 92  ? -6.507  39.833  103.107 1.00 36.51 ? 89  ALA C CB    1 
ATOM   7337  N N     . ALA C 1 93  ? -4.847  42.418  102.249 1.00 36.66 ? 90  ALA C N     1 
ATOM   7338  C CA    . ALA C 1 93  ? -4.672  43.860  102.314 1.00 38.08 ? 90  ALA C CA    1 
ATOM   7339  C C     . ALA C 1 93  ? -4.639  44.421  100.905 1.00 39.19 ? 90  ALA C C     1 
ATOM   7340  O O     . ALA C 1 93  ? -5.332  45.393  100.592 1.00 40.88 ? 90  ALA C O     1 
ATOM   7341  C CB    . ALA C 1 93  ? -3.393  44.203  103.044 1.00 36.71 ? 90  ALA C CB    1 
ATOM   7342  N N     . ALA C 1 94  ? -3.831  43.805  100.055 1.00 38.38 ? 91  ALA C N     1 
ATOM   7343  C CA    . ALA C 1 94  ? -3.737  44.242  98.680  1.00 40.11 ? 91  ALA C CA    1 
ATOM   7344  C C     . ALA C 1 94  ? -5.135  44.314  98.055  1.00 41.58 ? 91  ALA C C     1 
ATOM   7345  O O     . ALA C 1 94  ? -5.501  45.333  97.463  1.00 41.45 ? 91  ALA C O     1 
ATOM   7346  C CB    . ALA C 1 94  ? -2.860  43.289  97.890  1.00 39.92 ? 91  ALA C CB    1 
ATOM   7347  N N     . ILE C 1 95  ? -5.922  43.247  98.199  1.00 42.70 ? 92  ILE C N     1 
ATOM   7348  C CA    . ILE C 1 95  ? -7.269  43.230  97.618  1.00 43.39 ? 92  ILE C CA    1 
ATOM   7349  C C     . ILE C 1 95  ? -8.187  44.226  98.319  1.00 43.79 ? 92  ILE C C     1 
ATOM   7350  O O     . ILE C 1 95  ? -8.995  44.899  97.684  1.00 43.95 ? 92  ILE C O     1 
ATOM   7351  C CB    . ILE C 1 95  ? -7.911  41.811  97.681  1.00 42.91 ? 92  ILE C CB    1 
ATOM   7352  C CG1   . ILE C 1 95  ? -7.065  40.812  96.888  1.00 41.55 ? 92  ILE C CG1   1 
ATOM   7353  C CG2   . ILE C 1 95  ? -9.326  41.846  97.099  1.00 41.06 ? 92  ILE C CG2   1 
ATOM   7354  C CD1   . ILE C 1 95  ? -6.952  41.128  95.398  1.00 42.36 ? 92  ILE C CD1   1 
ATOM   7355  N N     . ALA C 1 96  ? -8.056  44.318  99.635  1.00 44.44 ? 93  ALA C N     1 
ATOM   7356  C CA    . ALA C 1 96  ? -8.879  45.237  100.402 1.00 44.49 ? 93  ALA C CA    1 
ATOM   7357  C C     . ALA C 1 96  ? -8.637  46.659  99.911  1.00 45.03 ? 93  ALA C C     1 
ATOM   7358  O O     . ALA C 1 96  ? -9.547  47.481  99.914  1.00 46.27 ? 93  ALA C O     1 
ATOM   7359  C CB    . ALA C 1 96  ? -8.539  45.125  101.880 1.00 44.09 ? 93  ALA C CB    1 
ATOM   7360  N N     . LYS C 1 97  ? -7.405  46.932  99.485  1.00 44.30 ? 94  LYS C N     1 
ATOM   7361  C CA    . LYS C 1 97  ? -7.018  48.251  98.990  1.00 43.45 ? 94  LYS C CA    1 
ATOM   7362  C C     . LYS C 1 97  ? -7.538  48.479  97.579  1.00 43.80 ? 94  LYS C C     1 
ATOM   7363  O O     . LYS C 1 97  ? -7.832  49.608  97.189  1.00 45.89 ? 94  LYS C O     1 
ATOM   7364  C CB    . LYS C 1 97  ? -5.492  48.390  98.993  1.00 42.83 ? 94  LYS C CB    1 
ATOM   7365  C CG    . LYS C 1 97  ? -4.975  49.766  98.613  1.00 43.11 ? 94  LYS C CG    1 
ATOM   7366  C CD    . LYS C 1 97  ? -5.528  50.838  99.552  1.00 46.34 ? 94  LYS C CD    1 
ATOM   7367  C CE    . LYS C 1 97  ? -4.893  52.205  99.319  1.00 46.17 ? 94  LYS C CE    1 
ATOM   7368  N NZ    . LYS C 1 97  ? -3.447  52.238  99.691  1.00 47.78 ? 94  LYS C NZ    1 
ATOM   7369  N N     . ALA C 1 98  ? -7.649  47.404  96.811  1.00 42.17 ? 95  ALA C N     1 
ATOM   7370  C CA    . ALA C 1 98  ? -8.126  47.507  95.446  1.00 40.69 ? 95  ALA C CA    1 
ATOM   7371  C C     . ALA C 1 98  ? -9.603  47.899  95.404  1.00 41.25 ? 95  ALA C C     1 
ATOM   7372  O O     . ALA C 1 98  ? -10.163 48.103  94.320  1.00 39.54 ? 95  ALA C O     1 
ATOM   7373  C CB    . ALA C 1 98  ? -7.909  46.190  94.721  1.00 40.96 ? 95  ALA C CB    1 
ATOM   7374  N N     . GLY C 1 99  ? -10.221 48.000  96.583  1.00 40.55 ? 96  GLY C N     1 
ATOM   7375  C CA    . GLY C 1 99  ? -11.622 48.379  96.670  1.00 40.82 ? 96  GLY C CA    1 
ATOM   7376  C C     . GLY C 1 99  ? -12.601 47.216  96.602  1.00 40.95 ? 96  GLY C C     1 
ATOM   7377  O O     . GLY C 1 99  ? -13.775 47.388  96.272  1.00 38.51 ? 96  GLY C O     1 
ATOM   7378  N N     . ILE C 1 100 ? -12.121 46.022  96.917  1.00 42.26 ? 97  ILE C N     1 
ATOM   7379  C CA    . ILE C 1 100 ? -12.971 44.846  96.878  1.00 43.83 ? 97  ILE C CA    1 
ATOM   7380  C C     . ILE C 1 100 ? -13.314 44.401  98.287  1.00 44.80 ? 97  ILE C C     1 
ATOM   7381  O O     . ILE C 1 100 ? -12.446 44.320  99.152  1.00 44.96 ? 97  ILE C O     1 
ATOM   7382  C CB    . ILE C 1 100 ? -12.279 43.699  96.137  1.00 43.32 ? 97  ILE C CB    1 
ATOM   7383  C CG1   . ILE C 1 100 ? -12.022 44.120  94.688  1.00 44.41 ? 97  ILE C CG1   1 
ATOM   7384  C CG2   . ILE C 1 100 ? -13.131 42.447  96.207  1.00 42.42 ? 97  ILE C CG2   1 
ATOM   7385  C CD1   . ILE C 1 100 ? -11.205 43.136  93.892  1.00 45.95 ? 97  ILE C CD1   1 
ATOM   7386  N N     . PRO C 1 101 ? -14.599 44.127  98.543  1.00 46.07 ? 98  PRO C N     1 
ATOM   7387  C CA    . PRO C 1 101 ? -15.021 43.690  99.876  1.00 47.15 ? 98  PRO C CA    1 
ATOM   7388  C C     . PRO C 1 101 ? -14.326 42.391  100.298 1.00 47.89 ? 98  PRO C C     1 
ATOM   7389  O O     . PRO C 1 101 ? -14.720 41.300  99.888  1.00 48.70 ? 98  PRO C O     1 
ATOM   7390  C CB    . PRO C 1 101 ? -16.528 43.523  99.720  1.00 46.97 ? 98  PRO C CB    1 
ATOM   7391  C CG    . PRO C 1 101 ? -16.873 44.536  98.661  1.00 46.30 ? 98  PRO C CG    1 
ATOM   7392  C CD    . PRO C 1 101 ? -15.761 44.336  97.662  1.00 45.77 ? 98  PRO C CD    1 
ATOM   7393  N N     . VAL C 1 102 ? -13.287 42.521  101.115 1.00 48.30 ? 99  VAL C N     1 
ATOM   7394  C CA    . VAL C 1 102 ? -12.532 41.371  101.594 1.00 48.92 ? 99  VAL C CA    1 
ATOM   7395  C C     . VAL C 1 102 ? -12.810 41.152  103.073 1.00 48.29 ? 99  VAL C C     1 
ATOM   7396  O O     . VAL C 1 102 ? -12.712 42.088  103.868 1.00 49.44 ? 99  VAL C O     1 
ATOM   7397  C CB    . VAL C 1 102 ? -11.008 41.600  101.440 1.00 49.91 ? 99  VAL C CB    1 
ATOM   7398  C CG1   . VAL C 1 102 ? -10.253 40.313  101.748 1.00 50.89 ? 99  VAL C CG1   1 
ATOM   7399  C CG2   . VAL C 1 102 ? -10.690 42.090  100.044 1.00 50.59 ? 99  VAL C CG2   1 
ATOM   7400  N N     . TYR C 1 103 ? -13.162 39.928  103.451 1.00 46.94 ? 100 TYR C N     1 
ATOM   7401  C CA    . TYR C 1 103 ? -13.399 39.629  104.863 1.00 46.75 ? 100 TYR C CA    1 
ATOM   7402  C C     . TYR C 1 103 ? -12.686 38.340  105.220 1.00 45.84 ? 100 TYR C C     1 
ATOM   7403  O O     . TYR C 1 103 ? -13.261 37.254  105.122 1.00 45.67 ? 100 TYR C O     1 
ATOM   7404  C CB    . TYR C 1 103 ? -14.894 39.501  105.167 1.00 45.90 ? 100 TYR C CB    1 
ATOM   7405  C CG    . TYR C 1 103 ? -15.683 40.712  104.744 1.00 47.23 ? 100 TYR C CG    1 
ATOM   7406  C CD1   . TYR C 1 103 ? -16.192 40.811  103.450 1.00 47.04 ? 100 TYR C CD1   1 
ATOM   7407  C CD2   . TYR C 1 103 ? -15.865 41.792  105.613 1.00 47.06 ? 100 TYR C CD2   1 
ATOM   7408  C CE1   . TYR C 1 103 ? -16.855 41.947  103.026 1.00 47.32 ? 100 TYR C CE1   1 
ATOM   7409  C CE2   . TYR C 1 103 ? -16.528 42.939  105.197 1.00 46.30 ? 100 TYR C CE2   1 
ATOM   7410  C CZ    . TYR C 1 103 ? -17.016 43.008  103.901 1.00 46.75 ? 100 TYR C CZ    1 
ATOM   7411  O OH    . TYR C 1 103 ? -17.640 44.150  103.461 1.00 48.15 ? 100 TYR C OH    1 
ATOM   7412  N N     . ALA C 1 104 ? -11.420 38.470  105.613 1.00 45.42 ? 101 ALA C N     1 
ATOM   7413  C CA    . ALA C 1 104 ? -10.604 37.315  105.976 1.00 45.29 ? 101 ALA C CA    1 
ATOM   7414  C C     . ALA C 1 104 ? -9.266  37.736  106.569 1.00 44.91 ? 101 ALA C C     1 
ATOM   7415  O O     . ALA C 1 104 ? -8.739  38.800  106.240 1.00 44.23 ? 101 ALA C O     1 
ATOM   7416  C CB    . ALA C 1 104 ? -10.369 36.441  104.751 1.00 44.90 ? 101 ALA C CB    1 
ATOM   7417  N N     . TRP C 1 105 ? -8.726  36.898  107.447 1.00 44.24 ? 102 TRP C N     1 
ATOM   7418  C CA    . TRP C 1 105 ? -7.436  37.170  108.065 1.00 44.38 ? 102 TRP C CA    1 
ATOM   7419  C C     . TRP C 1 105 ? -6.948  35.914  108.772 1.00 45.06 ? 102 TRP C C     1 
ATOM   7420  O O     . TRP C 1 105 ? -7.744  35.079  109.193 1.00 44.91 ? 102 TRP C O     1 
ATOM   7421  C CB    . TRP C 1 105 ? -7.542  38.352  109.040 1.00 44.12 ? 102 TRP C CB    1 
ATOM   7422  C CG    . TRP C 1 105 ? -8.485  38.140  110.178 1.00 43.31 ? 102 TRP C CG    1 
ATOM   7423  C CD1   . TRP C 1 105 ? -8.199  37.564  111.384 1.00 42.66 ? 102 TRP C CD1   1 
ATOM   7424  C CD2   . TRP C 1 105 ? -9.874  38.495  110.219 1.00 42.35 ? 102 TRP C CD2   1 
ATOM   7425  N NE1   . TRP C 1 105 ? -9.323  37.541  112.173 1.00 42.77 ? 102 TRP C NE1   1 
ATOM   7426  C CE2   . TRP C 1 105 ? -10.365 38.104  111.484 1.00 42.51 ? 102 TRP C CE2   1 
ATOM   7427  C CE3   . TRP C 1 105 ? -10.752 39.104  109.309 1.00 41.25 ? 102 TRP C CE3   1 
ATOM   7428  C CZ2   . TRP C 1 105 ? -11.694 38.303  111.865 1.00 43.62 ? 102 TRP C CZ2   1 
ATOM   7429  C CZ3   . TRP C 1 105 ? -12.080 39.304  109.687 1.00 41.03 ? 102 TRP C CZ3   1 
ATOM   7430  C CH2   . TRP C 1 105 ? -12.536 38.905  110.953 1.00 43.00 ? 102 TRP C CH2   1 
ATOM   7431  N N     . LYS C 1 106 ? -5.635  35.776  108.888 1.00 45.40 ? 103 LYS C N     1 
ATOM   7432  C CA    . LYS C 1 106 ? -5.060  34.607  109.521 1.00 45.29 ? 103 LYS C CA    1 
ATOM   7433  C C     . LYS C 1 106 ? -5.388  34.599  111.014 1.00 46.82 ? 103 LYS C C     1 
ATOM   7434  O O     . LYS C 1 106 ? -5.108  35.566  111.723 1.00 47.07 ? 103 LYS C O     1 
ATOM   7435  C CB    . LYS C 1 106 ? -3.545  34.604  109.299 1.00 44.67 ? 103 LYS C CB    1 
ATOM   7436  C CG    . LYS C 1 106 ? -2.911  33.227  109.293 1.00 43.59 ? 103 LYS C CG    1 
ATOM   7437  C CD    . LYS C 1 106 ? -1.421  33.321  109.064 1.00 43.75 ? 103 LYS C CD    1 
ATOM   7438  C CE    . LYS C 1 106 ? -0.769  31.955  109.117 1.00 44.79 ? 103 LYS C CE    1 
ATOM   7439  N NZ    . LYS C 1 106 ? -1.327  31.069  108.059 1.00 46.01 ? 103 LYS C NZ    1 
ATOM   7440  N N     . GLY C 1 107 ? -5.998  33.509  111.477 1.00 47.38 ? 104 GLY C N     1 
ATOM   7441  C CA    . GLY C 1 107 ? -6.345  33.391  112.882 1.00 48.15 ? 104 GLY C CA    1 
ATOM   7442  C C     . GLY C 1 107 ? -7.783  33.724  113.248 1.00 49.43 ? 104 GLY C C     1 
ATOM   7443  O O     . GLY C 1 107 ? -8.050  34.183  114.359 1.00 49.31 ? 104 GLY C O     1 
ATOM   7444  N N     . GLU C 1 108 ? -8.713  33.489  112.328 1.00 50.25 ? 105 GLU C N     1 
ATOM   7445  C CA    . GLU C 1 108 ? -10.123 33.770  112.584 1.00 50.84 ? 105 GLU C CA    1 
ATOM   7446  C C     . GLU C 1 108 ? -10.688 32.771  113.591 1.00 52.09 ? 105 GLU C C     1 
ATOM   7447  O O     . GLU C 1 108 ? -10.171 31.667  113.743 1.00 52.86 ? 105 GLU C O     1 
ATOM   7448  C CB    . GLU C 1 108 ? -10.932 33.674  111.292 1.00 49.38 ? 105 GLU C CB    1 
ATOM   7449  C CG    . GLU C 1 108 ? -10.394 34.488  110.145 1.00 47.69 ? 105 GLU C CG    1 
ATOM   7450  C CD    . GLU C 1 108 ? -11.216 34.296  108.900 1.00 46.27 ? 105 GLU C CD    1 
ATOM   7451  O OE1   . GLU C 1 108 ? -11.669 33.161  108.682 1.00 44.88 ? 105 GLU C OE1   1 
ATOM   7452  O OE2   . GLU C 1 108 ? -11.408 35.265  108.139 1.00 47.37 ? 105 GLU C OE2   1 
ATOM   7453  N N     . THR C 1 109 ? -11.753 33.162  114.277 1.00 53.05 ? 106 THR C N     1 
ATOM   7454  C CA    . THR C 1 109 ? -12.386 32.290  115.254 1.00 53.59 ? 106 THR C CA    1 
ATOM   7455  C C     . THR C 1 109 ? -13.633 31.748  114.578 1.00 54.41 ? 106 THR C C     1 
ATOM   7456  O O     . THR C 1 109 ? -14.087 32.307  113.584 1.00 54.42 ? 106 THR C O     1 
ATOM   7457  C CB    . THR C 1 109 ? -12.791 33.072  116.511 1.00 52.45 ? 106 THR C CB    1 
ATOM   7458  O OG1   . THR C 1 109 ? -13.837 33.997  116.183 1.00 52.13 ? 106 THR C OG1   1 
ATOM   7459  C CG2   . THR C 1 109 ? -11.601 33.837  117.057 1.00 50.85 ? 106 THR C CG2   1 
ATOM   7460  N N     . ASP C 1 110 ? -14.182 30.659  115.099 1.00 56.06 ? 107 ASP C N     1 
ATOM   7461  C CA    . ASP C 1 110 ? -15.380 30.088  114.499 1.00 58.40 ? 107 ASP C CA    1 
ATOM   7462  C C     . ASP C 1 110 ? -16.446 31.146  114.281 1.00 58.36 ? 107 ASP C C     1 
ATOM   7463  O O     . ASP C 1 110 ? -17.155 31.127  113.276 1.00 57.26 ? 107 ASP C O     1 
ATOM   7464  C CB    . ASP C 1 110 ? -15.937 28.975  115.380 1.00 61.68 ? 107 ASP C CB    1 
ATOM   7465  C CG    . ASP C 1 110 ? -15.313 27.632  115.073 1.00 64.66 ? 107 ASP C CG    1 
ATOM   7466  O OD1   . ASP C 1 110 ? -14.073 27.497  115.206 1.00 66.30 ? 107 ASP C OD1   1 
ATOM   7467  O OD2   . ASP C 1 110 ? -16.068 26.714  114.689 1.00 66.05 ? 107 ASP C OD2   1 
ATOM   7468  N N     . GLU C 1 111 ? -16.549 32.068  115.231 1.00 58.93 ? 108 GLU C N     1 
ATOM   7469  C CA    . GLU C 1 111 ? -17.523 33.146  115.151 1.00 59.33 ? 108 GLU C CA    1 
ATOM   7470  C C     . GLU C 1 111 ? -17.241 33.970  113.900 1.00 58.23 ? 108 GLU C C     1 
ATOM   7471  O O     . GLU C 1 111 ? -18.040 33.993  112.965 1.00 58.73 ? 108 GLU C O     1 
ATOM   7472  C CB    . GLU C 1 111 ? -17.414 34.046  116.386 1.00 62.34 ? 108 GLU C CB    1 
ATOM   7473  C CG    . GLU C 1 111 ? -16.966 33.315  117.649 1.00 67.20 ? 108 GLU C CG    1 
ATOM   7474  C CD    . GLU C 1 111 ? -18.013 32.355  118.186 1.00 69.19 ? 108 GLU C CD    1 
ATOM   7475  O OE1   . GLU C 1 111 ? -18.872 32.800  118.981 1.00 69.58 ? 108 GLU C OE1   1 
ATOM   7476  O OE2   . GLU C 1 111 ? -17.977 31.160  117.807 1.00 70.69 ? 108 GLU C OE2   1 
ATOM   7477  N N     . GLU C 1 112 ? -16.086 34.632  113.890 1.00 56.67 ? 109 GLU C N     1 
ATOM   7478  C CA    . GLU C 1 112 ? -15.670 35.472  112.773 1.00 54.82 ? 109 GLU C CA    1 
ATOM   7479  C C     . GLU C 1 112 ? -15.782 34.752  111.429 1.00 54.46 ? 109 GLU C C     1 
ATOM   7480  O O     . GLU C 1 112 ? -16.208 35.342  110.434 1.00 55.00 ? 109 GLU C O     1 
ATOM   7481  C CB    . GLU C 1 112 ? -14.227 35.938  112.987 1.00 54.99 ? 109 GLU C CB    1 
ATOM   7482  C CG    . GLU C 1 112 ? -13.929 36.379  114.415 1.00 54.47 ? 109 GLU C CG    1 
ATOM   7483  C CD    . GLU C 1 112 ? -12.464 36.727  114.646 1.00 55.05 ? 109 GLU C CD    1 
ATOM   7484  O OE1   . GLU C 1 112 ? -11.583 35.955  114.207 1.00 54.18 ? 109 GLU C OE1   1 
ATOM   7485  O OE2   . GLU C 1 112 ? -12.192 37.772  115.281 1.00 56.18 ? 109 GLU C OE2   1 
ATOM   7486  N N     . TYR C 1 113 ? -15.410 33.477  111.400 1.00 52.65 ? 110 TYR C N     1 
ATOM   7487  C CA    . TYR C 1 113 ? -15.466 32.711  110.160 1.00 51.11 ? 110 TYR C CA    1 
ATOM   7488  C C     . TYR C 1 113 ? -16.816 32.836  109.474 1.00 49.78 ? 110 TYR C C     1 
ATOM   7489  O O     . TYR C 1 113 ? -16.914 33.357  108.368 1.00 47.23 ? 110 TYR C O     1 
ATOM   7490  C CB    . TYR C 1 113 ? -15.180 31.232  110.420 1.00 50.54 ? 110 TYR C CB    1 
ATOM   7491  C CG    . TYR C 1 113 ? -15.159 30.389  109.157 1.00 51.61 ? 110 TYR C CG    1 
ATOM   7492  C CD1   . TYR C 1 113 ? -14.182 30.586  108.178 1.00 52.29 ? 110 TYR C CD1   1 
ATOM   7493  C CD2   . TYR C 1 113 ? -16.114 29.393  108.939 1.00 51.35 ? 110 TYR C CD2   1 
ATOM   7494  C CE1   . TYR C 1 113 ? -14.156 29.816  107.016 1.00 51.58 ? 110 TYR C CE1   1 
ATOM   7495  C CE2   . TYR C 1 113 ? -16.097 28.618  107.780 1.00 50.87 ? 110 TYR C CE2   1 
ATOM   7496  C CZ    . TYR C 1 113 ? -15.116 28.835  106.824 1.00 51.53 ? 110 TYR C CZ    1 
ATOM   7497  O OH    . TYR C 1 113 ? -15.094 28.071  105.680 1.00 50.30 ? 110 TYR C OH    1 
ATOM   7498  N N     . LEU C 1 114 ? -17.856 32.353  110.141 1.00 50.29 ? 111 LEU C N     1 
ATOM   7499  C CA    . LEU C 1 114 ? -19.201 32.387  109.590 1.00 52.09 ? 111 LEU C CA    1 
ATOM   7500  C C     . LEU C 1 114 ? -19.607 33.816  109.260 1.00 52.10 ? 111 LEU C C     1 
ATOM   7501  O O     . LEU C 1 114 ? -20.264 34.070  108.252 1.00 51.91 ? 111 LEU C O     1 
ATOM   7502  C CB    . LEU C 1 114 ? -20.187 31.772  110.585 1.00 54.11 ? 111 LEU C CB    1 
ATOM   7503  C CG    . LEU C 1 114 ? -21.276 30.840  110.037 1.00 56.18 ? 111 LEU C CG    1 
ATOM   7504  C CD1   . LEU C 1 114 ? -22.163 31.601  109.057 1.00 56.47 ? 111 LEU C CD1   1 
ATOM   7505  C CD2   . LEU C 1 114 ? -20.625 29.620  109.366 1.00 57.41 ? 111 LEU C CD2   1 
ATOM   7506  N N     . TRP C 1 115 ? -19.206 34.749  110.112 1.00 52.09 ? 112 TRP C N     1 
ATOM   7507  C CA    . TRP C 1 115 ? -19.521 36.151  109.897 1.00 53.52 ? 112 TRP C CA    1 
ATOM   7508  C C     . TRP C 1 115 ? -19.053 36.594  108.512 1.00 53.23 ? 112 TRP C C     1 
ATOM   7509  O O     . TRP C 1 115 ? -19.858 37.009  107.678 1.00 53.50 ? 112 TRP C O     1 
ATOM   7510  C CB    . TRP C 1 115 ? -18.834 37.006  110.960 1.00 55.11 ? 112 TRP C CB    1 
ATOM   7511  C CG    . TRP C 1 115 ? -19.026 38.469  110.758 1.00 56.81 ? 112 TRP C CG    1 
ATOM   7512  C CD1   . TRP C 1 115 ? -20.184 39.172  110.911 1.00 56.39 ? 112 TRP C CD1   1 
ATOM   7513  C CD2   . TRP C 1 115 ? -18.025 39.419  110.377 1.00 57.96 ? 112 TRP C CD2   1 
ATOM   7514  N NE1   . TRP C 1 115 ? -19.968 40.504  110.653 1.00 56.70 ? 112 TRP C NE1   1 
ATOM   7515  C CE2   . TRP C 1 115 ? -18.651 40.685  110.323 1.00 57.53 ? 112 TRP C CE2   1 
ATOM   7516  C CE3   . TRP C 1 115 ? -16.658 39.324  110.077 1.00 58.08 ? 112 TRP C CE3   1 
ATOM   7517  C CZ2   . TRP C 1 115 ? -17.957 41.852  109.982 1.00 57.61 ? 112 TRP C CZ2   1 
ATOM   7518  C CZ3   . TRP C 1 115 ? -15.967 40.486  109.736 1.00 58.96 ? 112 TRP C CZ3   1 
ATOM   7519  C CH2   . TRP C 1 115 ? -16.621 41.733  109.692 1.00 58.21 ? 112 TRP C CH2   1 
ATOM   7520  N N     . CYS C 1 116 ? -17.746 36.501  108.280 1.00 52.10 ? 113 CYS C N     1 
ATOM   7521  C CA    . CYS C 1 116 ? -17.159 36.890  107.004 1.00 51.04 ? 113 CYS C CA    1 
ATOM   7522  C C     . CYS C 1 116 ? -17.971 36.358  105.827 1.00 51.16 ? 113 CYS C C     1 
ATOM   7523  O O     . CYS C 1 116 ? -18.347 37.119  104.933 1.00 51.53 ? 113 CYS C O     1 
ATOM   7524  C CB    . CYS C 1 116 ? -15.716 36.374  106.893 1.00 50.50 ? 113 CYS C CB    1 
ATOM   7525  S SG    . CYS C 1 116 ? -14.524 37.056  108.084 1.00 49.81 ? 113 CYS C SG    1 
ATOM   7526  N N     . ILE C 1 117 ? -18.241 35.055  105.829 1.00 50.49 ? 114 ILE C N     1 
ATOM   7527  C CA    . ILE C 1 117 ? -18.999 34.431  104.748 1.00 50.58 ? 114 ILE C CA    1 
ATOM   7528  C C     . ILE C 1 117 ? -20.333 35.136  104.513 1.00 52.05 ? 114 ILE C C     1 
ATOM   7529  O O     . ILE C 1 117 ? -20.835 35.191  103.390 1.00 52.59 ? 114 ILE C O     1 
ATOM   7530  C CB    . ILE C 1 117 ? -19.285 32.944  105.041 1.00 49.50 ? 114 ILE C CB    1 
ATOM   7531  C CG1   . ILE C 1 117 ? -17.967 32.204  105.298 1.00 48.68 ? 114 ILE C CG1   1 
ATOM   7532  C CG2   . ILE C 1 117 ? -20.043 32.323  103.864 1.00 48.86 ? 114 ILE C CG2   1 
ATOM   7533  C CD1   . ILE C 1 117 ? -18.121 30.787  105.834 1.00 46.10 ? 114 ILE C CD1   1 
ATOM   7534  N N     . GLU C 1 118 ? -20.906 35.690  105.573 1.00 52.09 ? 115 GLU C N     1 
ATOM   7535  C CA    . GLU C 1 118 ? -22.185 36.364  105.440 1.00 51.68 ? 115 GLU C CA    1 
ATOM   7536  C C     . GLU C 1 118 ? -22.036 37.815  105.007 1.00 50.84 ? 115 GLU C C     1 
ATOM   7537  O O     . GLU C 1 118 ? -22.989 38.423  104.526 1.00 50.41 ? 115 GLU C O     1 
ATOM   7538  C CB    . GLU C 1 118 ? -22.959 36.258  106.754 1.00 50.73 ? 115 GLU C CB    1 
ATOM   7539  C CG    . GLU C 1 118 ? -23.169 34.813  107.182 1.00 52.30 ? 115 GLU C CG    1 
ATOM   7540  C CD    . GLU C 1 118 ? -24.072 34.653  108.392 1.00 53.47 ? 115 GLU C CD    1 
ATOM   7541  O OE1   . GLU C 1 118 ? -23.843 35.347  109.410 1.00 54.40 ? 115 GLU C OE1   1 
ATOM   7542  O OE2   . GLU C 1 118 ? -25.004 33.819  108.327 1.00 53.52 ? 115 GLU C OE2   1 
ATOM   7543  N N     . GLN C 1 119 ? -20.835 38.363  105.150 1.00 50.80 ? 116 GLN C N     1 
ATOM   7544  C CA    . GLN C 1 119 ? -20.594 39.752  104.775 1.00 52.31 ? 116 GLN C CA    1 
ATOM   7545  C C     . GLN C 1 119 ? -20.359 39.888  103.286 1.00 53.03 ? 116 GLN C C     1 
ATOM   7546  O O     . GLN C 1 119 ? -20.146 40.989  102.780 1.00 53.23 ? 116 GLN C O     1 
ATOM   7547  C CB    . GLN C 1 119 ? -19.383 40.297  105.526 1.00 53.14 ? 116 GLN C CB    1 
ATOM   7548  C CG    . GLN C 1 119 ? -19.456 40.093  107.031 1.00 55.18 ? 116 GLN C CG    1 
ATOM   7549  C CD    . GLN C 1 119 ? -20.628 40.820  107.665 1.00 55.26 ? 116 GLN C CD    1 
ATOM   7550  O OE1   . GLN C 1 119 ? -20.623 42.043  107.792 1.00 54.75 ? 116 GLN C OE1   1 
ATOM   7551  N NE2   . GLN C 1 119 ? -21.646 40.065  108.059 1.00 56.23 ? 116 GLN C NE2   1 
ATOM   7552  N N     . THR C 1 120 ? -20.401 38.760  102.589 1.00 53.81 ? 117 THR C N     1 
ATOM   7553  C CA    . THR C 1 120 ? -20.182 38.737  101.151 1.00 53.89 ? 117 THR C CA    1 
ATOM   7554  C C     . THR C 1 120 ? -21.463 38.442  100.393 1.00 55.53 ? 117 THR C C     1 
ATOM   7555  O O     . THR C 1 120 ? -21.539 38.671  99.186  1.00 56.44 ? 117 THR C O     1 
ATOM   7556  C CB    . THR C 1 120 ? -19.153 37.662  100.773 1.00 52.92 ? 117 THR C CB    1 
ATOM   7557  O OG1   . THR C 1 120 ? -19.516 36.421  101.384 1.00 50.84 ? 117 THR C OG1   1 
ATOM   7558  C CG2   . THR C 1 120 ? -17.763 38.064  101.232 1.00 52.49 ? 117 THR C CG2   1 
ATOM   7559  N N     . LEU C 1 121 ? -22.466 37.935  101.103 1.00 57.26 ? 118 LEU C N     1 
ATOM   7560  C CA    . LEU C 1 121 ? -23.752 37.581  100.502 1.00 59.20 ? 118 LEU C CA    1 
ATOM   7561  C C     . LEU C 1 121 ? -24.447 38.691  99.713  1.00 60.39 ? 118 LEU C C     1 
ATOM   7562  O O     . LEU C 1 121 ? -24.862 38.475  98.570  1.00 59.68 ? 118 LEU C O     1 
ATOM   7563  C CB    . LEU C 1 121 ? -24.702 37.054  101.585 1.00 58.63 ? 118 LEU C CB    1 
ATOM   7564  C CG    . LEU C 1 121 ? -24.366 35.682  102.168 1.00 58.17 ? 118 LEU C CG    1 
ATOM   7565  C CD1   . LEU C 1 121 ? -25.217 35.405  103.398 1.00 57.74 ? 118 LEU C CD1   1 
ATOM   7566  C CD2   . LEU C 1 121 ? -24.589 34.622  101.100 1.00 57.91 ? 118 LEU C CD2   1 
ATOM   7567  N N     . TYR C 1 122 ? -24.584 39.868  100.323 1.00 61.57 ? 119 TYR C N     1 
ATOM   7568  C CA    . TYR C 1 122 ? -25.249 40.985  99.656  1.00 63.46 ? 119 TYR C CA    1 
ATOM   7569  C C     . TYR C 1 122 ? -24.309 42.070  99.144  1.00 63.75 ? 119 TYR C C     1 
ATOM   7570  O O     . TYR C 1 122 ? -23.538 42.659  99.908  1.00 62.66 ? 119 TYR C O     1 
ATOM   7571  C CB    . TYR C 1 122 ? -26.292 41.631  100.584 1.00 64.61 ? 119 TYR C CB    1 
ATOM   7572  C CG    . TYR C 1 122 ? -27.445 40.720  100.964 1.00 65.93 ? 119 TYR C CG    1 
ATOM   7573  C CD1   . TYR C 1 122 ? -27.412 39.972  102.144 1.00 65.95 ? 119 TYR C CD1   1 
ATOM   7574  C CD2   . TYR C 1 122 ? -28.553 40.578  100.123 1.00 65.96 ? 119 TYR C CD2   1 
ATOM   7575  C CE1   . TYR C 1 122 ? -28.451 39.104  102.479 1.00 66.46 ? 119 TYR C CE1   1 
ATOM   7576  C CE2   . TYR C 1 122 ? -29.599 39.711  100.447 1.00 66.96 ? 119 TYR C CE2   1 
ATOM   7577  C CZ    . TYR C 1 122 ? -29.540 38.975  101.625 1.00 67.72 ? 119 TYR C CZ    1 
ATOM   7578  O OH    . TYR C 1 122 ? -30.562 38.100  101.940 1.00 68.53 ? 119 TYR C OH    1 
ATOM   7579  N N     . PHE C 1 123 ? -24.382 42.326  97.841  1.00 64.30 ? 120 PHE C N     1 
ATOM   7580  C CA    . PHE C 1 123 ? -23.567 43.363  97.230  1.00 65.53 ? 120 PHE C CA    1 
ATOM   7581  C C     . PHE C 1 123 ? -24.322 44.674  97.429  1.00 66.73 ? 120 PHE C C     1 
ATOM   7582  O O     . PHE C 1 123 ? -25.511 44.674  97.757  1.00 66.20 ? 120 PHE C O     1 
ATOM   7583  C CB    . PHE C 1 123 ? -23.355 43.085  95.736  1.00 64.71 ? 120 PHE C CB    1 
ATOM   7584  C CG    . PHE C 1 123 ? -22.469 41.899  95.451  1.00 64.55 ? 120 PHE C CG    1 
ATOM   7585  C CD1   . PHE C 1 123 ? -22.862 40.610  95.812  1.00 64.33 ? 120 PHE C CD1   1 
ATOM   7586  C CD2   . PHE C 1 123 ? -21.249 42.066  94.797  1.00 64.07 ? 120 PHE C CD2   1 
ATOM   7587  C CE1   . PHE C 1 123 ? -22.057 39.506  95.524  1.00 63.26 ? 120 PHE C CE1   1 
ATOM   7588  C CE2   . PHE C 1 123 ? -20.434 40.962  94.505  1.00 64.01 ? 120 PHE C CE2   1 
ATOM   7589  C CZ    . PHE C 1 123 ? -20.843 39.683  94.870  1.00 62.70 ? 120 PHE C CZ    1 
ATOM   7590  N N     . LYS C 1 124 ? -23.632 45.791  97.238  1.00 68.09 ? 121 LYS C N     1 
ATOM   7591  C CA    . LYS C 1 124 ? -24.251 47.092  97.433  1.00 69.10 ? 121 LYS C CA    1 
ATOM   7592  C C     . LYS C 1 124 ? -25.543 47.237  96.641  1.00 69.23 ? 121 LYS C C     1 
ATOM   7593  O O     . LYS C 1 124 ? -26.375 48.085  96.954  1.00 69.32 ? 121 LYS C O     1 
ATOM   7594  C CB    . LYS C 1 124 ? -23.269 48.209  97.057  1.00 70.20 ? 121 LYS C CB    1 
ATOM   7595  C CG    . LYS C 1 124 ? -23.674 49.587  97.570  1.00 72.11 ? 121 LYS C CG    1 
ATOM   7596  C CD    . LYS C 1 124 ? -22.495 50.553  97.566  1.00 73.09 ? 121 LYS C CD    1 
ATOM   7597  C CE    . LYS C 1 124 ? -22.833 51.859  98.280  1.00 73.45 ? 121 LYS C CE    1 
ATOM   7598  N NZ    . LYS C 1 124 ? -21.688 52.825  98.283  1.00 73.20 ? 121 LYS C NZ    1 
ATOM   7599  N N     . ASP C 1 125 ? -25.716 46.409  95.619  1.00 68.72 ? 122 ASP C N     1 
ATOM   7600  C CA    . ASP C 1 125 ? -26.924 46.477  94.816  1.00 68.37 ? 122 ASP C CA    1 
ATOM   7601  C C     . ASP C 1 125 ? -27.466 45.108  94.428  1.00 68.58 ? 122 ASP C C     1 
ATOM   7602  O O     . ASP C 1 125 ? -27.410 44.719  93.262  1.00 68.95 ? 122 ASP C O     1 
ATOM   7603  C CB    . ASP C 1 125 ? -26.679 47.320  93.558  1.00 69.40 ? 122 ASP C CB    1 
ATOM   7604  C CG    . ASP C 1 125 ? -25.409 46.926  92.824  1.00 70.30 ? 122 ASP C CG    1 
ATOM   7605  O OD1   . ASP C 1 125 ? -24.313 47.079  93.408  1.00 71.04 ? 122 ASP C OD1   1 
ATOM   7606  O OD2   . ASP C 1 125 ? -25.506 46.469  91.665  1.00 69.63 ? 122 ASP C OD2   1 
ATOM   7607  N N     . GLY C 1 126 ? -27.986 44.379  95.414  1.00 67.93 ? 123 GLY C N     1 
ATOM   7608  C CA    . GLY C 1 126 ? -28.556 43.072  95.139  1.00 67.01 ? 123 GLY C CA    1 
ATOM   7609  C C     . GLY C 1 126 ? -27.814 41.872  95.700  1.00 66.43 ? 123 GLY C C     1 
ATOM   7610  O O     . GLY C 1 126 ? -26.634 41.963  96.038  1.00 66.72 ? 123 GLY C O     1 
ATOM   7611  N N     . PRO C 1 127 ? -28.498 40.721  95.819  1.00 65.69 ? 124 PRO C N     1 
ATOM   7612  C CA    . PRO C 1 127 ? -27.901 39.487  96.339  1.00 64.17 ? 124 PRO C CA    1 
ATOM   7613  C C     . PRO C 1 127 ? -26.866 38.948  95.352  1.00 63.29 ? 124 PRO C C     1 
ATOM   7614  O O     . PRO C 1 127 ? -26.698 39.498  94.261  1.00 63.03 ? 124 PRO C O     1 
ATOM   7615  C CB    . PRO C 1 127 ? -29.101 38.547  96.468  1.00 64.44 ? 124 PRO C CB    1 
ATOM   7616  C CG    . PRO C 1 127 ? -30.264 39.480  96.633  1.00 65.11 ? 124 PRO C CG    1 
ATOM   7617  C CD    . PRO C 1 127 ? -29.950 40.556  95.634  1.00 65.08 ? 124 PRO C CD    1 
ATOM   7618  N N     . LEU C 1 128 ? -26.190 37.867  95.735  1.00 61.79 ? 125 LEU C N     1 
ATOM   7619  C CA    . LEU C 1 128 ? -25.174 37.246  94.892  1.00 59.94 ? 125 LEU C CA    1 
ATOM   7620  C C     . LEU C 1 128 ? -25.784 36.597  93.649  1.00 59.24 ? 125 LEU C C     1 
ATOM   7621  O O     . LEU C 1 128 ? -26.947 36.206  93.652  1.00 59.37 ? 125 LEU C O     1 
ATOM   7622  C CB    . LEU C 1 128 ? -24.400 36.187  95.685  1.00 59.46 ? 125 LEU C CB    1 
ATOM   7623  C CG    . LEU C 1 128 ? -25.168 34.983  96.250  1.00 57.87 ? 125 LEU C CG    1 
ATOM   7624  C CD1   . LEU C 1 128 ? -24.196 33.868  96.585  1.00 57.83 ? 125 LEU C CD1   1 
ATOM   7625  C CD2   . LEU C 1 128 ? -25.948 35.386  97.483  1.00 58.02 ? 125 LEU C CD2   1 
ATOM   7626  N N     . ASN C 1 129 ? -24.996 36.485  92.586  1.00 58.01 ? 126 ASN C N     1 
ATOM   7627  C CA    . ASN C 1 129 ? -25.472 35.866  91.357  1.00 56.56 ? 126 ASN C CA    1 
ATOM   7628  C C     . ASN C 1 129 ? -24.879 34.479  91.183  1.00 55.68 ? 126 ASN C C     1 
ATOM   7629  O O     . ASN C 1 129 ? -25.566 33.551  90.760  1.00 55.26 ? 126 ASN C O     1 
ATOM   7630  C CB    . ASN C 1 129 ? -25.098 36.714  90.146  1.00 56.59 ? 126 ASN C CB    1 
ATOM   7631  C CG    . ASN C 1 129 ? -25.871 37.994  90.090  1.00 57.42 ? 126 ASN C CG    1 
ATOM   7632  O OD1   . ASN C 1 129 ? -27.074 38.003  90.329  1.00 59.85 ? 126 ASN C OD1   1 
ATOM   7633  N ND2   . ASN C 1 129 ? -25.195 39.087  89.770  1.00 59.57 ? 126 ASN C ND2   1 
ATOM   7634  N N     . MET C 1 130 ? -23.599 34.354  91.519  1.00 54.06 ? 127 MET C N     1 
ATOM   7635  C CA    . MET C 1 130 ? -22.878 33.096  91.389  1.00 52.36 ? 127 MET C CA    1 
ATOM   7636  C C     . MET C 1 130 ? -22.169 32.721  92.680  1.00 51.16 ? 127 MET C C     1 
ATOM   7637  O O     . MET C 1 130 ? -21.917 33.577  93.540  1.00 50.46 ? 127 MET C O     1 
ATOM   7638  C CB    . MET C 1 130 ? -21.850 33.227  90.272  1.00 53.19 ? 127 MET C CB    1 
ATOM   7639  C CG    . MET C 1 130 ? -22.426 33.841  89.024  1.00 54.01 ? 127 MET C CG    1 
ATOM   7640  S SD    . MET C 1 130 ? -22.760 32.675  87.698  1.00 54.91 ? 127 MET C SD    1 
ATOM   7641  C CE    . MET C 1 130 ? -23.386 31.317  88.576  1.00 54.88 ? 127 MET C CE    1 
ATOM   7642  N N     . ILE C 1 131 ? -21.832 31.440  92.807  1.00 49.20 ? 128 ILE C N     1 
ATOM   7643  C CA    . ILE C 1 131 ? -21.129 30.967  93.994  1.00 48.31 ? 128 ILE C CA    1 
ATOM   7644  C C     . ILE C 1 131 ? -19.810 30.301  93.645  1.00 47.30 ? 128 ILE C C     1 
ATOM   7645  O O     . ILE C 1 131 ? -19.793 29.258  92.994  1.00 48.90 ? 128 ILE C O     1 
ATOM   7646  C CB    . ILE C 1 131 ? -21.966 29.943  94.789  1.00 47.64 ? 128 ILE C CB    1 
ATOM   7647  C CG1   . ILE C 1 131 ? -23.254 30.583  95.283  1.00 47.85 ? 128 ILE C CG1   1 
ATOM   7648  C CG2   . ILE C 1 131 ? -21.179 29.447  95.986  1.00 46.68 ? 128 ILE C CG2   1 
ATOM   7649  C CD1   . ILE C 1 131 ? -24.121 29.621  96.040  1.00 47.66 ? 128 ILE C CD1   1 
ATOM   7650  N N     . LEU C 1 132 ? -18.709 30.912  94.066  1.00 45.77 ? 129 LEU C N     1 
ATOM   7651  C CA    . LEU C 1 132 ? -17.387 30.344  93.830  1.00 43.98 ? 129 LEU C CA    1 
ATOM   7652  C C     . LEU C 1 132 ? -16.974 29.804  95.195  1.00 43.62 ? 129 LEU C C     1 
ATOM   7653  O O     . LEU C 1 132 ? -16.516 30.549  96.057  1.00 42.66 ? 129 LEU C O     1 
ATOM   7654  C CB    . LEU C 1 132 ? -16.428 31.428  93.349  1.00 43.29 ? 129 LEU C CB    1 
ATOM   7655  C CG    . LEU C 1 132 ? -15.102 30.962  92.744  1.00 43.54 ? 129 LEU C CG    1 
ATOM   7656  C CD1   . LEU C 1 132 ? -14.536 32.043  91.824  1.00 43.36 ? 129 LEU C CD1   1 
ATOM   7657  C CD2   . LEU C 1 132 ? -14.128 30.604  93.858  1.00 43.20 ? 129 LEU C CD2   1 
ATOM   7658  N N     . ASP C 1 133 ? -17.156 28.503  95.393  1.00 44.44 ? 130 ASP C N     1 
ATOM   7659  C CA    . ASP C 1 133 ? -16.856 27.889  96.684  1.00 45.52 ? 130 ASP C CA    1 
ATOM   7660  C C     . ASP C 1 133 ? -15.697 26.898  96.653  1.00 45.74 ? 130 ASP C C     1 
ATOM   7661  O O     . ASP C 1 133 ? -15.287 26.441  95.591  1.00 45.76 ? 130 ASP C O     1 
ATOM   7662  C CB    . ASP C 1 133 ? -18.106 27.163  97.195  1.00 45.11 ? 130 ASP C CB    1 
ATOM   7663  C CG    . ASP C 1 133 ? -18.134 27.028  98.700  1.00 44.59 ? 130 ASP C CG    1 
ATOM   7664  O OD1   . ASP C 1 133 ? -17.073 27.174  99.349  1.00 44.11 ? 130 ASP C OD1   1 
ATOM   7665  O OD2   . ASP C 1 133 ? -19.230 26.762  99.231  1.00 44.56 ? 130 ASP C OD2   1 
ATOM   7666  N N     . ASP C 1 134 ? -15.194 26.571  97.841  1.00 45.88 ? 131 ASP C N     1 
ATOM   7667  C CA    . ASP C 1 134 ? -14.109 25.617  98.021  1.00 46.10 ? 131 ASP C CA    1 
ATOM   7668  C C     . ASP C 1 134 ? -14.353 24.921  99.355  1.00 46.76 ? 131 ASP C C     1 
ATOM   7669  O O     . ASP C 1 134 ? -13.928 25.399  100.410 1.00 46.67 ? 131 ASP C O     1 
ATOM   7670  C CB    . ASP C 1 134 ? -12.760 26.330  98.063  1.00 47.39 ? 131 ASP C CB    1 
ATOM   7671  C CG    . ASP C 1 134 ? -11.585 25.360  98.166  1.00 48.57 ? 131 ASP C CG    1 
ATOM   7672  O OD1   . ASP C 1 134 ? -11.798 24.185  98.545  1.00 47.07 ? 131 ASP C OD1   1 
ATOM   7673  O OD2   . ASP C 1 134 ? -10.440 25.777  97.878  1.00 49.21 ? 131 ASP C OD2   1 
ATOM   7674  N N     . GLY C 1 135 ? -15.052 23.794  99.304  1.00 46.93 ? 132 GLY C N     1 
ATOM   7675  C CA    . GLY C 1 135 ? -15.345 23.051  100.516 1.00 46.80 ? 132 GLY C CA    1 
ATOM   7676  C C     . GLY C 1 135 ? -16.835 22.853  100.734 1.00 46.33 ? 132 GLY C C     1 
ATOM   7677  O O     . GLY C 1 135 ? -17.251 21.888  101.362 1.00 48.26 ? 132 GLY C O     1 
ATOM   7678  N N     . GLY C 1 136 ? -17.641 23.771  100.212 1.00 45.92 ? 133 GLY C N     1 
ATOM   7679  C CA    . GLY C 1 136 ? -19.078 23.675  100.367 1.00 43.35 ? 133 GLY C CA    1 
ATOM   7680  C C     . GLY C 1 136 ? -19.611 24.561  101.476 1.00 42.60 ? 133 GLY C C     1 
ATOM   7681  O O     . GLY C 1 136 ? -20.814 24.720  101.609 1.00 43.78 ? 133 GLY C O     1 
ATOM   7682  N N     . ASP C 1 137 ? -18.740 25.153  102.282 1.00 42.32 ? 134 ASP C N     1 
ATOM   7683  C CA    . ASP C 1 137 ? -19.231 25.994  103.365 1.00 43.41 ? 134 ASP C CA    1 
ATOM   7684  C C     . ASP C 1 137 ? -20.197 27.076  102.928 1.00 43.54 ? 134 ASP C C     1 
ATOM   7685  O O     . ASP C 1 137 ? -21.182 27.326  103.612 1.00 44.29 ? 134 ASP C O     1 
ATOM   7686  C CB    . ASP C 1 137 ? -18.085 26.640  104.125 1.00 43.61 ? 134 ASP C CB    1 
ATOM   7687  C CG    . ASP C 1 137 ? -17.275 25.635  104.887 1.00 44.93 ? 134 ASP C CG    1 
ATOM   7688  O OD1   . ASP C 1 137 ? -17.884 24.733  105.505 1.00 43.69 ? 134 ASP C OD1   1 
ATOM   7689  O OD2   . ASP C 1 137 ? -16.033 25.751  104.868 1.00 48.14 ? 134 ASP C OD2   1 
ATOM   7690  N N     . LEU C 1 138 ? -19.918 27.719  101.798 1.00 44.37 ? 135 LEU C N     1 
ATOM   7691  C CA    . LEU C 1 138 ? -20.778 28.783  101.287 1.00 45.58 ? 135 LEU C CA    1 
ATOM   7692  C C     . LEU C 1 138 ? -22.057 28.184  100.711 1.00 47.05 ? 135 LEU C C     1 
ATOM   7693  O O     . LEU C 1 138 ? -23.163 28.622  101.036 1.00 47.27 ? 135 LEU C O     1 
ATOM   7694  C CB    . LEU C 1 138 ? -20.061 29.579  100.186 1.00 44.72 ? 135 LEU C CB    1 
ATOM   7695  C CG    . LEU C 1 138 ? -20.429 31.061  99.991  1.00 44.63 ? 135 LEU C CG    1 
ATOM   7696  C CD1   . LEU C 1 138 ? -19.776 31.601  98.716  1.00 44.73 ? 135 LEU C CD1   1 
ATOM   7697  C CD2   . LEU C 1 138 ? -21.921 31.228  99.911  1.00 43.07 ? 135 LEU C CD2   1 
ATOM   7698  N N     . THR C 1 139 ? -21.890 27.181  99.852  1.00 48.34 ? 136 THR C N     1 
ATOM   7699  C CA    . THR C 1 139 ? -23.017 26.519  99.208  1.00 49.70 ? 136 THR C CA    1 
ATOM   7700  C C     . THR C 1 139 ? -24.036 26.015  100.230 1.00 50.75 ? 136 THR C C     1 
ATOM   7701  O O     . THR C 1 139 ? -25.238 26.203  100.050 1.00 51.01 ? 136 THR C O     1 
ATOM   7702  C CB    . THR C 1 139 ? -22.545 25.333  98.322  1.00 48.90 ? 136 THR C CB    1 
ATOM   7703  O OG1   . THR C 1 139 ? -21.563 25.793  97.385  1.00 50.10 ? 136 THR C OG1   1 
ATOM   7704  C CG2   . THR C 1 139 ? -23.717 24.753  97.541  1.00 49.80 ? 136 THR C CG2   1 
ATOM   7705  N N     . ASN C 1 140 ? -23.553 25.387  101.301 1.00 51.84 ? 137 ASN C N     1 
ATOM   7706  C CA    . ASN C 1 140 ? -24.425 24.858  102.349 1.00 52.66 ? 137 ASN C CA    1 
ATOM   7707  C C     . ASN C 1 140 ? -25.086 25.957  103.172 1.00 53.46 ? 137 ASN C C     1 
ATOM   7708  O O     . ASN C 1 140 ? -26.269 25.866  103.506 1.00 53.83 ? 137 ASN C O     1 
ATOM   7709  C CB    . ASN C 1 140 ? -23.646 23.933  103.291 1.00 51.20 ? 137 ASN C CB    1 
ATOM   7710  C CG    . ASN C 1 140 ? -23.322 22.593  102.662 1.00 51.94 ? 137 ASN C CG    1 
ATOM   7711  O OD1   . ASN C 1 140 ? -24.203 21.915  102.123 1.00 52.93 ? 137 ASN C OD1   1 
ATOM   7712  N ND2   . ASN C 1 140 ? -22.058 22.197  102.737 1.00 50.64 ? 137 ASN C ND2   1 
ATOM   7713  N N     . LEU C 1 141 ? -24.321 26.991  103.508 1.00 54.15 ? 138 LEU C N     1 
ATOM   7714  C CA    . LEU C 1 141 ? -24.858 28.092  104.293 1.00 54.74 ? 138 LEU C CA    1 
ATOM   7715  C C     . LEU C 1 141 ? -26.098 28.660  103.625 1.00 55.41 ? 138 LEU C C     1 
ATOM   7716  O O     . LEU C 1 141 ? -27.122 28.878  104.268 1.00 55.62 ? 138 LEU C O     1 
ATOM   7717  C CB    . LEU C 1 141 ? -23.819 29.198  104.444 1.00 54.36 ? 138 LEU C CB    1 
ATOM   7718  C CG    . LEU C 1 141 ? -24.266 30.460  105.190 1.00 54.45 ? 138 LEU C CG    1 
ATOM   7719  C CD1   . LEU C 1 141 ? -24.636 30.117  106.627 1.00 53.63 ? 138 LEU C CD1   1 
ATOM   7720  C CD2   . LEU C 1 141 ? -23.141 31.489  105.155 1.00 54.35 ? 138 LEU C CD2   1 
ATOM   7721  N N     . ILE C 1 142 ? -25.999 28.895  102.324 1.00 56.05 ? 139 ILE C N     1 
ATOM   7722  C CA    . ILE C 1 142 ? -27.109 29.453  101.574 1.00 56.99 ? 139 ILE C CA    1 
ATOM   7723  C C     . ILE C 1 142 ? -28.296 28.502  101.504 1.00 58.56 ? 139 ILE C C     1 
ATOM   7724  O O     . ILE C 1 142 ? -29.416 28.870  101.879 1.00 58.75 ? 139 ILE C O     1 
ATOM   7725  C CB    . ILE C 1 142 ? -26.668 29.827  100.147 1.00 56.54 ? 139 ILE C CB    1 
ATOM   7726  C CG1   . ILE C 1 142 ? -25.573 30.893  100.220 1.00 54.50 ? 139 ILE C CG1   1 
ATOM   7727  C CG2   . ILE C 1 142 ? -27.860 30.341  99.337  1.00 57.52 ? 139 ILE C CG2   1 
ATOM   7728  C CD1   . ILE C 1 142 ? -25.098 31.376  98.876  1.00 53.68 ? 139 ILE C CD1   1 
ATOM   7729  N N     . HIS C 1 143 ? -28.044 27.282  101.032 1.00 59.34 ? 140 HIS C N     1 
ATOM   7730  C CA    . HIS C 1 143 ? -29.085 26.270  100.890 1.00 59.85 ? 140 HIS C CA    1 
ATOM   7731  C C     . HIS C 1 143 ? -29.928 26.047  102.140 1.00 59.99 ? 140 HIS C C     1 
ATOM   7732  O O     . HIS C 1 143 ? -31.122 25.738  102.036 1.00 59.72 ? 140 HIS C O     1 
ATOM   7733  C CB    . HIS C 1 143 ? -28.484 24.926  100.455 1.00 59.59 ? 140 HIS C CB    1 
ATOM   7734  C CG    . HIS C 1 143 ? -28.256 24.812  98.981  1.00 59.06 ? 140 HIS C CG    1 
ATOM   7735  N ND1   . HIS C 1 143 ? -27.242 25.477  98.328  1.00 59.78 ? 140 HIS C ND1   1 
ATOM   7736  C CD2   . HIS C 1 143 ? -28.929 24.124  98.029  1.00 59.32 ? 140 HIS C CD2   1 
ATOM   7737  C CE1   . HIS C 1 143 ? -27.300 25.204  97.036  1.00 59.96 ? 140 HIS C CE1   1 
ATOM   7738  N NE2   . HIS C 1 143 ? -28.315 24.386  96.828  1.00 59.52 ? 140 HIS C NE2   1 
ATOM   7739  N N     . THR C 1 144 ? -29.321 26.210  103.316 1.00 59.47 ? 141 THR C N     1 
ATOM   7740  C CA    . THR C 1 144 ? -30.045 25.993  104.565 1.00 59.19 ? 141 THR C CA    1 
ATOM   7741  C C     . THR C 1 144 ? -30.598 27.247  105.234 1.00 59.67 ? 141 THR C C     1 
ATOM   7742  O O     . THR C 1 144 ? -31.796 27.327  105.509 1.00 60.98 ? 141 THR C O     1 
ATOM   7743  C CB    . THR C 1 144 ? -29.172 25.247  105.592 1.00 58.75 ? 141 THR C CB    1 
ATOM   7744  O OG1   . THR C 1 144 ? -28.079 26.080  105.992 1.00 60.33 ? 141 THR C OG1   1 
ATOM   7745  C CG2   . THR C 1 144 ? -28.630 23.968  104.986 1.00 57.83 ? 141 THR C CG2   1 
ATOM   7746  N N     . LYS C 1 145 ? -29.737 28.227  105.486 1.00 59.44 ? 142 LYS C N     1 
ATOM   7747  C CA    . LYS C 1 145 ? -30.168 29.451  106.156 1.00 59.15 ? 142 LYS C CA    1 
ATOM   7748  C C     . LYS C 1 145 ? -30.629 30.588  105.254 1.00 57.73 ? 142 LYS C C     1 
ATOM   7749  O O     . LYS C 1 145 ? -31.342 31.480  105.705 1.00 56.57 ? 142 LYS C O     1 
ATOM   7750  C CB    . LYS C 1 145 ? -29.057 29.965  107.069 1.00 60.21 ? 142 LYS C CB    1 
ATOM   7751  C CG    . LYS C 1 145 ? -28.643 28.973  108.130 1.00 63.26 ? 142 LYS C CG    1 
ATOM   7752  C CD    . LYS C 1 145 ? -29.807 28.625  109.047 1.00 63.88 ? 142 LYS C CD    1 
ATOM   7753  C CE    . LYS C 1 145 ? -29.385 27.605  110.096 1.00 64.58 ? 142 LYS C CE    1 
ATOM   7754  N NZ    . LYS C 1 145 ? -28.188 28.045  110.870 1.00 62.84 ? 142 LYS C NZ    1 
ATOM   7755  N N     . TYR C 1 146 ? -30.219 30.571  103.991 1.00 57.08 ? 143 TYR C N     1 
ATOM   7756  C CA    . TYR C 1 146 ? -30.612 31.633  103.066 1.00 56.76 ? 143 TYR C CA    1 
ATOM   7757  C C     . TYR C 1 146 ? -31.193 31.068  101.776 1.00 56.03 ? 143 TYR C C     1 
ATOM   7758  O O     . TYR C 1 146 ? -30.811 31.487  100.684 1.00 56.76 ? 143 TYR C O     1 
ATOM   7759  C CB    . TYR C 1 146 ? -29.414 32.528  102.716 1.00 56.97 ? 143 TYR C CB    1 
ATOM   7760  C CG    . TYR C 1 146 ? -28.753 33.198  103.897 1.00 56.45 ? 143 TYR C CG    1 
ATOM   7761  C CD1   . TYR C 1 146 ? -27.945 32.473  104.773 1.00 56.68 ? 143 TYR C CD1   1 
ATOM   7762  C CD2   . TYR C 1 146 ? -28.938 34.558  104.144 1.00 56.81 ? 143 TYR C CD2   1 
ATOM   7763  C CE1   . TYR C 1 146 ? -27.331 33.086  105.872 1.00 56.30 ? 143 TYR C CE1   1 
ATOM   7764  C CE2   . TYR C 1 146 ? -28.329 35.182  105.241 1.00 57.19 ? 143 TYR C CE2   1 
ATOM   7765  C CZ    . TYR C 1 146 ? -27.529 34.438  106.098 1.00 56.50 ? 143 TYR C CZ    1 
ATOM   7766  O OH    . TYR C 1 146 ? -26.932 35.042  107.177 1.00 55.22 ? 143 TYR C OH    1 
ATOM   7767  N N     . PRO C 1 147 ? -32.142 30.125  101.884 1.00 54.67 ? 144 PRO C N     1 
ATOM   7768  C CA    . PRO C 1 147 ? -32.754 29.522  100.697 1.00 54.24 ? 144 PRO C CA    1 
ATOM   7769  C C     . PRO C 1 147 ? -33.478 30.506  99.779  1.00 54.52 ? 144 PRO C C     1 
ATOM   7770  O O     . PRO C 1 147 ? -33.641 30.246  98.585  1.00 53.80 ? 144 PRO C O     1 
ATOM   7771  C CB    . PRO C 1 147 ? -33.692 28.473  101.293 1.00 53.47 ? 144 PRO C CB    1 
ATOM   7772  C CG    . PRO C 1 147 ? -34.085 29.079  102.600 1.00 52.52 ? 144 PRO C CG    1 
ATOM   7773  C CD    . PRO C 1 147 ? -32.784 29.628  103.114 1.00 54.05 ? 144 PRO C CD    1 
ATOM   7774  N N     . GLN C 1 148 ? -33.897 31.640  100.330 1.00 54.54 ? 145 GLN C N     1 
ATOM   7775  C CA    . GLN C 1 148 ? -34.614 32.639  99.543  1.00 55.48 ? 145 GLN C CA    1 
ATOM   7776  C C     . GLN C 1 148 ? -33.787 33.154  98.360  1.00 55.35 ? 145 GLN C C     1 
ATOM   7777  O O     . GLN C 1 148 ? -34.334 33.626  97.356  1.00 54.51 ? 145 GLN C O     1 
ATOM   7778  C CB    . GLN C 1 148 ? -35.024 33.816  100.439 1.00 56.29 ? 145 GLN C CB    1 
ATOM   7779  C CG    . GLN C 1 148 ? -34.868 33.555  101.932 1.00 57.63 ? 145 GLN C CG    1 
ATOM   7780  C CD    . GLN C 1 148 ? -33.659 34.260  102.518 1.00 59.21 ? 145 GLN C CD    1 
ATOM   7781  O OE1   . GLN C 1 148 ? -33.320 34.083  103.693 1.00 58.59 ? 145 GLN C OE1   1 
ATOM   7782  N NE2   . GLN C 1 148 ? -33.002 35.072  101.699 1.00 60.53 ? 145 GLN C NE2   1 
ATOM   7783  N N     . LEU C 1 149 ? -32.466 33.044  98.490  1.00 54.70 ? 146 LEU C N     1 
ATOM   7784  C CA    . LEU C 1 149 ? -31.530 33.507  97.471  1.00 53.29 ? 146 LEU C CA    1 
ATOM   7785  C C     . LEU C 1 149 ? -31.256 32.454  96.395  1.00 53.13 ? 146 LEU C C     1 
ATOM   7786  O O     . LEU C 1 149 ? -30.752 32.772  95.319  1.00 52.27 ? 146 LEU C O     1 
ATOM   7787  C CB    . LEU C 1 149 ? -30.219 33.914  98.148  1.00 52.25 ? 146 LEU C CB    1 
ATOM   7788  C CG    . LEU C 1 149 ? -30.346 34.794  99.400  1.00 51.44 ? 146 LEU C CG    1 
ATOM   7789  C CD1   . LEU C 1 149 ? -28.979 34.993  100.045 1.00 49.30 ? 146 LEU C CD1   1 
ATOM   7790  C CD2   . LEU C 1 149 ? -30.963 36.133  99.021  1.00 51.85 ? 146 LEU C CD2   1 
ATOM   7791  N N     . LEU C 1 150 ? -31.596 31.200  96.683  1.00 53.78 ? 147 LEU C N     1 
ATOM   7792  C CA    . LEU C 1 150 ? -31.354 30.109  95.742  1.00 54.38 ? 147 LEU C CA    1 
ATOM   7793  C C     . LEU C 1 150 ? -31.736 30.384  94.296  1.00 55.34 ? 147 LEU C C     1 
ATOM   7794  O O     . LEU C 1 150 ? -30.922 30.191  93.396  1.00 56.05 ? 147 LEU C O     1 
ATOM   7795  C CB    . LEU C 1 150 ? -32.041 28.826  96.219  1.00 54.82 ? 147 LEU C CB    1 
ATOM   7796  C CG    . LEU C 1 150 ? -31.217 27.895  97.119  1.00 55.29 ? 147 LEU C CG    1 
ATOM   7797  C CD1   . LEU C 1 150 ? -30.642 28.677  98.284  1.00 54.55 ? 147 LEU C CD1   1 
ATOM   7798  C CD2   . LEU C 1 150 ? -32.089 26.749  97.621  1.00 55.28 ? 147 LEU C CD2   1 
ATOM   7799  N N     . PRO C 1 151 ? -32.975 30.842  94.044  1.00 56.23 ? 148 PRO C N     1 
ATOM   7800  C CA    . PRO C 1 151 ? -33.409 31.124  92.667  1.00 55.90 ? 148 PRO C CA    1 
ATOM   7801  C C     . PRO C 1 151 ? -32.693 32.307  92.024  1.00 56.15 ? 148 PRO C C     1 
ATOM   7802  O O     . PRO C 1 151 ? -32.811 32.530  90.819  1.00 55.59 ? 148 PRO C O     1 
ATOM   7803  C CB    . PRO C 1 151 ? -34.903 31.369  92.825  1.00 56.10 ? 148 PRO C CB    1 
ATOM   7804  C CG    . PRO C 1 151 ? -34.981 32.013  94.170  1.00 57.02 ? 148 PRO C CG    1 
ATOM   7805  C CD    . PRO C 1 151 ? -34.054 31.149  95.001  1.00 56.25 ? 148 PRO C CD    1 
ATOM   7806  N N     . GLY C 1 152 ? -31.945 33.051  92.835  1.00 56.48 ? 149 GLY C N     1 
ATOM   7807  C CA    . GLY C 1 152 ? -31.219 34.201  92.327  1.00 56.56 ? 149 GLY C CA    1 
ATOM   7808  C C     . GLY C 1 152 ? -29.763 33.917  91.996  1.00 56.55 ? 149 GLY C C     1 
ATOM   7809  O O     . GLY C 1 152 ? -29.023 34.833  91.628  1.00 57.03 ? 149 GLY C O     1 
ATOM   7810  N N     . ILE C 1 153 ? -29.355 32.653  92.117  1.00 55.15 ? 150 ILE C N     1 
ATOM   7811  C CA    . ILE C 1 153 ? -27.977 32.234  91.843  1.00 53.64 ? 150 ILE C CA    1 
ATOM   7812  C C     . ILE C 1 153 ? -27.902 31.388  90.565  1.00 53.05 ? 150 ILE C C     1 
ATOM   7813  O O     . ILE C 1 153 ? -28.386 30.256  90.535  1.00 54.00 ? 150 ILE C O     1 
ATOM   7814  C CB    . ILE C 1 153 ? -27.426 31.416  93.026  1.00 53.20 ? 150 ILE C CB    1 
ATOM   7815  C CG1   . ILE C 1 153 ? -27.574 32.228  94.320  1.00 51.19 ? 150 ILE C CG1   1 
ATOM   7816  C CG2   . ILE C 1 153 ? -25.969 31.028  92.762  1.00 54.01 ? 150 ILE C CG2   1 
ATOM   7817  C CD1   . ILE C 1 153 ? -27.252 31.466  95.588  1.00 49.95 ? 150 ILE C CD1   1 
ATOM   7818  N N     . ARG C 1 154 ? -27.275 31.923  89.522  1.00 51.65 ? 151 ARG C N     1 
ATOM   7819  C CA    . ARG C 1 154 ? -27.192 31.223  88.242  1.00 51.31 ? 151 ARG C CA    1 
ATOM   7820  C C     . ARG C 1 154 ? -26.298 29.967  88.210  1.00 50.62 ? 151 ARG C C     1 
ATOM   7821  O O     . ARG C 1 154 ? -26.262 29.250  87.203  1.00 51.23 ? 151 ARG C O     1 
ATOM   7822  C CB    . ARG C 1 154 ? -26.749 32.212  87.155  1.00 51.50 ? 151 ARG C CB    1 
ATOM   7823  C CG    . ARG C 1 154 ? -27.202 31.838  85.751  1.00 55.25 ? 151 ARG C CG    1 
ATOM   7824  C CD    . ARG C 1 154 ? -26.490 32.674  84.694  1.00 58.35 ? 151 ARG C CD    1 
ATOM   7825  N NE    . ARG C 1 154 ? -26.745 34.110  84.812  1.00 60.33 ? 151 ARG C NE    1 
ATOM   7826  C CZ    . ARG C 1 154 ? -27.879 34.710  84.461  1.00 59.68 ? 151 ARG C CZ    1 
ATOM   7827  N NH1   . ARG C 1 154 ? -28.886 34.008  83.962  1.00 61.51 ? 151 ARG C NH1   1 
ATOM   7828  N NH2   . ARG C 1 154 ? -28.003 36.020  84.603  1.00 60.22 ? 151 ARG C NH2   1 
ATOM   7829  N N     . GLY C 1 155 ? -25.584 29.698  89.298  1.00 49.16 ? 152 GLY C N     1 
ATOM   7830  C CA    . GLY C 1 155 ? -24.722 28.530  89.332  1.00 48.01 ? 152 GLY C CA    1 
ATOM   7831  C C     . GLY C 1 155 ? -23.610 28.571  90.371  1.00 46.66 ? 152 GLY C C     1 
ATOM   7832  O O     . GLY C 1 155 ? -23.305 29.618  90.945  1.00 46.98 ? 152 GLY C O     1 
ATOM   7833  N N     . ILE C 1 156 ? -23.000 27.411  90.604  1.00 44.78 ? 153 ILE C N     1 
ATOM   7834  C CA    . ILE C 1 156 ? -21.924 27.279  91.573  1.00 42.74 ? 153 ILE C CA    1 
ATOM   7835  C C     . ILE C 1 156 ? -20.742 26.565  90.940  1.00 42.27 ? 153 ILE C C     1 
ATOM   7836  O O     . ILE C 1 156 ? -20.919 25.729  90.064  1.00 41.67 ? 153 ILE C O     1 
ATOM   7837  C CB    . ILE C 1 156 ? -22.359 26.438  92.772  1.00 42.06 ? 153 ILE C CB    1 
ATOM   7838  C CG1   . ILE C 1 156 ? -23.742 26.877  93.247  1.00 41.70 ? 153 ILE C CG1   1 
ATOM   7839  C CG2   . ILE C 1 156 ? -21.342 26.566  93.889  1.00 42.27 ? 153 ILE C CG2   1 
ATOM   7840  C CD1   . ILE C 1 156 ? -24.362 25.920  94.234  1.00 41.22 ? 153 ILE C CD1   1 
ATOM   7841  N N     . SER C 1 157 ? -19.537 26.891  91.393  1.00 42.71 ? 154 SER C N     1 
ATOM   7842  C CA    . SER C 1 157 ? -18.329 26.244  90.891  1.00 41.44 ? 154 SER C CA    1 
ATOM   7843  C C     . SER C 1 157 ? -17.496 25.787  92.089  1.00 41.43 ? 154 SER C C     1 
ATOM   7844  O O     . SER C 1 157 ? -16.949 26.620  92.813  1.00 42.33 ? 154 SER C O     1 
ATOM   7845  C CB    . SER C 1 157 ? -17.529 27.213  90.026  1.00 41.25 ? 154 SER C CB    1 
ATOM   7846  O OG    . SER C 1 157 ? -17.154 28.370  90.753  1.00 41.45 ? 154 SER C OG    1 
ATOM   7847  N N     . GLU C 1 158 ? -17.419 24.471  92.302  1.00 41.09 ? 155 GLU C N     1 
ATOM   7848  C CA    . GLU C 1 158 ? -16.669 23.894  93.421  1.00 40.39 ? 155 GLU C CA    1 
ATOM   7849  C C     . GLU C 1 158 ? -15.189 23.679  93.094  1.00 39.60 ? 155 GLU C C     1 
ATOM   7850  O O     . GLU C 1 158 ? -14.835 23.128  92.046  1.00 37.59 ? 155 GLU C O     1 
ATOM   7851  C CB    . GLU C 1 158 ? -17.280 22.548  93.850  1.00 41.92 ? 155 GLU C CB    1 
ATOM   7852  C CG    . GLU C 1 158 ? -17.592 22.419  95.345  1.00 41.51 ? 155 GLU C CG    1 
ATOM   7853  C CD    . GLU C 1 158 ? -16.514 23.012  96.239  1.00 41.68 ? 155 GLU C CD    1 
ATOM   7854  O OE1   . GLU C 1 158 ? -15.333 22.614  96.110  1.00 41.22 ? 155 GLU C OE1   1 
ATOM   7855  O OE2   . GLU C 1 158 ? -16.858 23.881  97.075  1.00 40.26 ? 155 GLU C OE2   1 
ATOM   7856  N N     . GLU C 1 159 ? -14.342 24.080  94.036  1.00 37.77 ? 156 GLU C N     1 
ATOM   7857  C CA    . GLU C 1 159 ? -12.896 23.990  93.896  1.00 38.05 ? 156 GLU C CA    1 
ATOM   7858  C C     . GLU C 1 159 ? -12.247 22.659  94.277  1.00 38.07 ? 156 GLU C C     1 
ATOM   7859  O O     . GLU C 1 159 ? -11.434 22.122  93.530  1.00 37.42 ? 156 GLU C O     1 
ATOM   7860  C CB    . GLU C 1 159 ? -12.244 25.090  94.735  1.00 38.31 ? 156 GLU C CB    1 
ATOM   7861  C CG    . GLU C 1 159 ? -10.734 25.022  94.795  1.00 37.50 ? 156 GLU C CG    1 
ATOM   7862  C CD    . GLU C 1 159 ? -10.098 25.456  93.506  1.00 38.84 ? 156 GLU C CD    1 
ATOM   7863  O OE1   . GLU C 1 159 ? -10.485 26.523  92.991  1.00 42.14 ? 156 GLU C OE1   1 
ATOM   7864  O OE2   . GLU C 1 159 ? -9.213  24.746  93.005  1.00 40.98 ? 156 GLU C OE2   1 
ATOM   7865  N N     . THR C 1 160 ? -12.600 22.121  95.435  1.00 37.06 ? 157 THR C N     1 
ATOM   7866  C CA    . THR C 1 160 ? -11.956 20.902  95.874  1.00 35.78 ? 157 THR C CA    1 
ATOM   7867  C C     . THR C 1 160 ? -12.778 19.610  95.900  1.00 36.02 ? 157 THR C C     1 
ATOM   7868  O O     . THR C 1 160 ? -13.999 19.611  95.738  1.00 34.59 ? 157 THR C O     1 
ATOM   7869  C CB    . THR C 1 160 ? -11.325 21.122  97.253  1.00 35.14 ? 157 THR C CB    1 
ATOM   7870  O OG1   . THR C 1 160 ? -10.391 20.068  97.520  1.00 37.17 ? 157 THR C OG1   1 
ATOM   7871  C CG2   . THR C 1 160 ? -12.390 21.152  98.333  1.00 32.94 ? 157 THR C CG2   1 
ATOM   7872  N N     . THR C 1 161 ? -12.067 18.505  96.103  1.00 36.16 ? 158 THR C N     1 
ATOM   7873  C CA    . THR C 1 161 ? -12.656 17.174  96.137  1.00 36.90 ? 158 THR C CA    1 
ATOM   7874  C C     . THR C 1 161 ? -13.756 17.015  97.187  1.00 35.79 ? 158 THR C C     1 
ATOM   7875  O O     . THR C 1 161 ? -14.809 16.450  96.907  1.00 33.83 ? 158 THR C O     1 
ATOM   7876  C CB    . THR C 1 161 ? -11.547 16.122  96.360  1.00 36.15 ? 158 THR C CB    1 
ATOM   7877  O OG1   . THR C 1 161 ? -10.526 16.322  95.378  1.00 36.69 ? 158 THR C OG1   1 
ATOM   7878  C CG2   . THR C 1 161 ? -12.092 14.708  96.228  1.00 34.38 ? 158 THR C CG2   1 
ATOM   7879  N N     . THR C 1 162 ? -13.518 17.521  98.388  1.00 35.50 ? 159 THR C N     1 
ATOM   7880  C CA    . THR C 1 162 ? -14.522 17.415  99.429  1.00 37.42 ? 159 THR C CA    1 
ATOM   7881  C C     . THR C 1 162 ? -15.796 18.178  99.045  1.00 39.75 ? 159 THR C C     1 
ATOM   7882  O O     . THR C 1 162 ? -16.900 17.627  99.129  1.00 39.96 ? 159 THR C O     1 
ATOM   7883  C CB    . THR C 1 162 ? -13.964 17.923  100.768 1.00 36.94 ? 159 THR C CB    1 
ATOM   7884  O OG1   . THR C 1 162 ? -13.093 16.923  101.317 1.00 34.40 ? 159 THR C OG1   1 
ATOM   7885  C CG2   . THR C 1 162 ? -15.083 18.220  101.751 1.00 36.92 ? 159 THR C CG2   1 
ATOM   7886  N N     . GLY C 1 163 ? -15.637 19.427  98.605  1.00 41.10 ? 160 GLY C N     1 
ATOM   7887  C CA    . GLY C 1 163 ? -16.780 20.230  98.200  1.00 41.21 ? 160 GLY C CA    1 
ATOM   7888  C C     . GLY C 1 163 ? -17.609 19.582  97.101  1.00 42.18 ? 160 GLY C C     1 
ATOM   7889  O O     . GLY C 1 163 ? -18.840 19.556  97.168  1.00 42.46 ? 160 GLY C O     1 
ATOM   7890  N N     . VAL C 1 164 ? -16.933 19.061  96.083  1.00 42.95 ? 161 VAL C N     1 
ATOM   7891  C CA    . VAL C 1 164 ? -17.602 18.408  94.968  1.00 44.20 ? 161 VAL C CA    1 
ATOM   7892  C C     . VAL C 1 164 ? -18.275 17.114  95.431  1.00 46.50 ? 161 VAL C C     1 
ATOM   7893  O O     . VAL C 1 164 ? -19.319 16.717  94.913  1.00 46.29 ? 161 VAL C O     1 
ATOM   7894  C CB    . VAL C 1 164 ? -16.595 18.106  93.844  1.00 43.95 ? 161 VAL C CB    1 
ATOM   7895  C CG1   . VAL C 1 164 ? -17.229 17.242  92.782  1.00 43.91 ? 161 VAL C CG1   1 
ATOM   7896  C CG2   . VAL C 1 164 ? -16.116 19.406  93.231  1.00 44.30 ? 161 VAL C CG2   1 
ATOM   7897  N N     . HIS C 1 165 ? -17.674 16.460  96.416  1.00 49.20 ? 162 HIS C N     1 
ATOM   7898  C CA    . HIS C 1 165 ? -18.217 15.226  96.973  1.00 51.19 ? 162 HIS C CA    1 
ATOM   7899  C C     . HIS C 1 165 ? -19.565 15.580  97.612  1.00 50.91 ? 162 HIS C C     1 
ATOM   7900  O O     . HIS C 1 165 ? -20.544 14.846  97.472  1.00 49.82 ? 162 HIS C O     1 
ATOM   7901  C CB    . HIS C 1 165 ? -17.243 14.678  98.027  1.00 55.62 ? 162 HIS C CB    1 
ATOM   7902  C CG    . HIS C 1 165 ? -17.462 13.237  98.377  1.00 60.81 ? 162 HIS C CG    1 
ATOM   7903  N ND1   . HIS C 1 165 ? -18.581 12.796  99.052  1.00 62.96 ? 162 HIS C ND1   1 
ATOM   7904  C CD2   . HIS C 1 165 ? -16.698 12.139  98.153  1.00 62.30 ? 162 HIS C CD2   1 
ATOM   7905  C CE1   . HIS C 1 165 ? -18.495 11.489  99.231  1.00 63.32 ? 162 HIS C CE1   1 
ATOM   7906  N NE2   . HIS C 1 165 ? -17.363 11.066  98.696  1.00 62.49 ? 162 HIS C NE2   1 
ATOM   7907  N N     . ASN C 1 166 ? -19.596 16.725  98.296  1.00 50.77 ? 163 ASN C N     1 
ATOM   7908  C CA    . ASN C 1 166 ? -20.797 17.231  98.966  1.00 49.36 ? 163 ASN C CA    1 
ATOM   7909  C C     . ASN C 1 166 ? -21.904 17.555  97.972  1.00 47.03 ? 163 ASN C C     1 
ATOM   7910  O O     . ASN C 1 166 ? -23.060 17.228  98.202  1.00 46.99 ? 163 ASN C O     1 
ATOM   7911  C CB    . ASN C 1 166 ? -20.464 18.490  99.783  1.00 51.31 ? 163 ASN C CB    1 
ATOM   7912  C CG    . ASN C 1 166 ? -21.707 19.203  100.317 1.00 51.29 ? 163 ASN C CG    1 
ATOM   7913  O OD1   . ASN C 1 166 ? -22.466 18.651  101.112 1.00 50.75 ? 163 ASN C OD1   1 
ATOM   7914  N ND2   . ASN C 1 166 ? -21.907 20.445  99.881  1.00 52.64 ? 163 ASN C ND2   1 
ATOM   7915  N N     . LEU C 1 167 ? -21.551 18.204  96.869  1.00 45.58 ? 164 LEU C N     1 
ATOM   7916  C CA    . LEU C 1 167 ? -22.543 18.554  95.862  1.00 45.43 ? 164 LEU C CA    1 
ATOM   7917  C C     . LEU C 1 167 ? -23.298 17.314  95.403  1.00 46.41 ? 164 LEU C C     1 
ATOM   7918  O O     . LEU C 1 167 ? -24.520 17.267  95.473  1.00 48.10 ? 164 LEU C O     1 
ATOM   7919  C CB    . LEU C 1 167 ? -21.877 19.232  94.666  1.00 43.20 ? 164 LEU C CB    1 
ATOM   7920  C CG    . LEU C 1 167 ? -21.337 20.647  94.899  1.00 41.72 ? 164 LEU C CG    1 
ATOM   7921  C CD1   . LEU C 1 167 ? -20.613 21.109  93.655  1.00 40.94 ? 164 LEU C CD1   1 
ATOM   7922  C CD2   . LEU C 1 167 ? -22.476 21.597  95.225  1.00 40.34 ? 164 LEU C CD2   1 
ATOM   7923  N N     . TYR C 1 168 ? -22.571 16.308  94.933  1.00 47.54 ? 165 TYR C N     1 
ATOM   7924  C CA    . TYR C 1 168 ? -23.196 15.072  94.478  1.00 47.69 ? 165 TYR C CA    1 
ATOM   7925  C C     . TYR C 1 168 ? -24.186 14.555  95.513  1.00 48.85 ? 165 TYR C C     1 
ATOM   7926  O O     . TYR C 1 168 ? -25.315 14.197  95.175  1.00 49.05 ? 165 TYR C O     1 
ATOM   7927  C CB    . TYR C 1 168 ? -22.132 14.014  94.201  1.00 45.51 ? 165 TYR C CB    1 
ATOM   7928  C CG    . TYR C 1 168 ? -21.346 14.270  92.940  1.00 45.02 ? 165 TYR C CG    1 
ATOM   7929  C CD1   . TYR C 1 168 ? -21.905 14.039  91.683  1.00 45.06 ? 165 TYR C CD1   1 
ATOM   7930  C CD2   . TYR C 1 168 ? -20.041 14.761  93.000  1.00 46.02 ? 165 TYR C CD2   1 
ATOM   7931  C CE1   . TYR C 1 168 ? -21.183 14.293  90.519  1.00 46.29 ? 165 TYR C CE1   1 
ATOM   7932  C CE2   . TYR C 1 168 ? -19.313 15.019  91.845  1.00 45.67 ? 165 TYR C CE2   1 
ATOM   7933  C CZ    . TYR C 1 168 ? -19.887 14.786  90.611  1.00 46.26 ? 165 TYR C CZ    1 
ATOM   7934  O OH    . TYR C 1 168 ? -19.169 15.064  89.475  1.00 47.77 ? 165 TYR C OH    1 
ATOM   7935  N N     . LYS C 1 169 ? -23.756 14.521  96.772  1.00 50.73 ? 166 LYS C N     1 
ATOM   7936  C CA    . LYS C 1 169 ? -24.602 14.057  97.871  1.00 52.25 ? 166 LYS C CA    1 
ATOM   7937  C C     . LYS C 1 169 ? -25.924 14.839  97.896  1.00 53.47 ? 166 LYS C C     1 
ATOM   7938  O O     . LYS C 1 169 ? -27.000 14.257  98.024  1.00 53.04 ? 166 LYS C O     1 
ATOM   7939  C CB    . LYS C 1 169 ? -23.847 14.209  99.198  1.00 51.15 ? 166 LYS C CB    1 
ATOM   7940  C CG    . LYS C 1 169 ? -24.655 13.886  100.443 1.00 50.51 ? 166 LYS C CG    1 
ATOM   7941  C CD    . LYS C 1 169 ? -23.823 14.035  101.713 1.00 50.57 ? 166 LYS C CD    1 
ATOM   7942  C CE    . LYS C 1 169 ? -24.708 14.115  102.957 1.00 51.26 ? 166 LYS C CE    1 
ATOM   7943  N NZ    . LYS C 1 169 ? -25.581 12.918  103.160 1.00 52.66 ? 166 LYS C NZ    1 
ATOM   7944  N N     . MET C 1 170 ? -25.836 16.159  97.760  1.00 55.65 ? 167 MET C N     1 
ATOM   7945  C CA    . MET C 1 170 ? -27.020 17.017  97.751  1.00 57.08 ? 167 MET C CA    1 
ATOM   7946  C C     . MET C 1 170 ? -27.905 16.729  96.536  1.00 57.74 ? 167 MET C C     1 
ATOM   7947  O O     . MET C 1 170 ? -29.123 16.618  96.667  1.00 57.51 ? 167 MET C O     1 
ATOM   7948  C CB    . MET C 1 170 ? -26.603 18.491  97.751  1.00 57.75 ? 167 MET C CB    1 
ATOM   7949  C CG    . MET C 1 170 ? -25.919 18.944  99.034  1.00 59.33 ? 167 MET C CG    1 
ATOM   7950  S SD    . MET C 1 170 ? -25.294 20.628  98.937  1.00 61.71 ? 167 MET C SD    1 
ATOM   7951  C CE    . MET C 1 170 ? -26.789 21.552  99.230  1.00 61.51 ? 167 MET C CE    1 
ATOM   7952  N N     . MET C 1 171 ? -27.290 16.609  95.359  1.00 58.68 ? 168 MET C N     1 
ATOM   7953  C CA    . MET C 1 171 ? -28.030 16.336  94.125  1.00 59.52 ? 168 MET C CA    1 
ATOM   7954  C C     . MET C 1 171 ? -28.760 14.998  94.215  1.00 59.80 ? 168 MET C C     1 
ATOM   7955  O O     . MET C 1 171 ? -29.916 14.881  93.804  1.00 59.08 ? 168 MET C O     1 
ATOM   7956  C CB    . MET C 1 171 ? -27.081 16.318  92.924  1.00 60.28 ? 168 MET C CB    1 
ATOM   7957  C CG    . MET C 1 171 ? -27.772 16.176  91.564  1.00 61.53 ? 168 MET C CG    1 
ATOM   7958  S SD    . MET C 1 171 ? -28.702 17.645  91.061  1.00 62.82 ? 168 MET C SD    1 
ATOM   7959  C CE    . MET C 1 171 ? -30.293 17.327  91.829  1.00 64.89 ? 168 MET C CE    1 
ATOM   7960  N N     . ALA C 1 172 ? -28.074 13.992  94.749  1.00 58.59 ? 169 ALA C N     1 
ATOM   7961  C CA    . ALA C 1 172 ? -28.656 12.668  94.906  1.00 58.27 ? 169 ALA C CA    1 
ATOM   7962  C C     . ALA C 1 172 ? -29.953 12.794  95.695  1.00 58.29 ? 169 ALA C C     1 
ATOM   7963  O O     . ALA C 1 172 ? -30.999 12.308  95.274  1.00 58.88 ? 169 ALA C O     1 
ATOM   7964  C CB    . ALA C 1 172 ? -27.685 11.751  95.641  1.00 57.45 ? 169 ALA C CB    1 
ATOM   7965  N N     . ASN C 1 173 ? -29.873 13.461  96.840  1.00 59.03 ? 170 ASN C N     1 
ATOM   7966  C CA    . ASN C 1 173 ? -31.033 13.672  97.696  1.00 59.91 ? 170 ASN C CA    1 
ATOM   7967  C C     . ASN C 1 173 ? -31.916 14.781  97.137  1.00 60.30 ? 170 ASN C C     1 
ATOM   7968  O O     . ASN C 1 173 ? -32.943 15.121  97.720  1.00 61.08 ? 170 ASN C O     1 
ATOM   7969  C CB    . ASN C 1 173 ? -30.571 14.035  99.104  1.00 59.74 ? 170 ASN C CB    1 
ATOM   7970  C CG    . ASN C 1 173 ? -29.820 12.907  99.769  1.00 60.49 ? 170 ASN C CG    1 
ATOM   7971  O OD1   . ASN C 1 173 ? -29.224 12.066  99.093  1.00 59.83 ? 170 ASN C OD1   1 
ATOM   7972  N ND2   . ASN C 1 173 ? -29.835 12.883  101.099 1.00 60.80 ? 170 ASN C ND2   1 
ATOM   7973  N N     . GLY C 1 174 ? -31.504 15.340  96.004  1.00 60.64 ? 171 GLY C N     1 
ATOM   7974  C CA    . GLY C 1 174 ? -32.263 16.403  95.375  1.00 59.82 ? 171 GLY C CA    1 
ATOM   7975  C C     . GLY C 1 174 ? -32.334 17.668  96.202  1.00 59.99 ? 171 GLY C C     1 
ATOM   7976  O O     . GLY C 1 174 ? -33.209 18.504  95.983  1.00 60.83 ? 171 GLY C O     1 
ATOM   7977  N N     . ILE C 1 175 ? -31.416 17.812  97.153  1.00 60.24 ? 172 ILE C N     1 
ATOM   7978  C CA    . ILE C 1 175 ? -31.378 18.988  98.018  1.00 59.64 ? 172 ILE C CA    1 
ATOM   7979  C C     . ILE C 1 175 ? -30.674 20.154  97.318  1.00 59.31 ? 172 ILE C C     1 
ATOM   7980  O O     . ILE C 1 175 ? -30.733 21.297  97.776  1.00 58.97 ? 172 ILE C O     1 
ATOM   7981  C CB    . ILE C 1 175 ? -30.647 18.674  99.343  1.00 59.91 ? 172 ILE C CB    1 
ATOM   7982  C CG1   . ILE C 1 175 ? -31.244 17.415  99.976  1.00 60.71 ? 172 ILE C CG1   1 
ATOM   7983  C CG2   . ILE C 1 175 ? -30.773 19.845  100.303 1.00 59.40 ? 172 ILE C CG2   1 
ATOM   7984  C CD1   . ILE C 1 175 ? -30.523 16.947  101.230 1.00 60.45 ? 172 ILE C CD1   1 
ATOM   7985  N N     . LEU C 1 176 ? -30.013 19.859  96.202  1.00 58.93 ? 173 LEU C N     1 
ATOM   7986  C CA    . LEU C 1 176 ? -29.307 20.880  95.437  1.00 58.88 ? 173 LEU C CA    1 
ATOM   7987  C C     . LEU C 1 176 ? -30.294 21.583  94.504  1.00 57.91 ? 173 LEU C C     1 
ATOM   7988  O O     . LEU C 1 176 ? -30.841 20.964  93.591  1.00 57.67 ? 173 LEU C O     1 
ATOM   7989  C CB    . LEU C 1 176 ? -28.167 20.236  94.638  1.00 59.11 ? 173 LEU C CB    1 
ATOM   7990  C CG    . LEU C 1 176 ? -27.244 21.101  93.767  1.00 59.08 ? 173 LEU C CG    1 
ATOM   7991  C CD1   . LEU C 1 176 ? -27.910 21.386  92.430  1.00 59.73 ? 173 LEU C CD1   1 
ATOM   7992  C CD2   . LEU C 1 176 ? -26.882 22.386  94.501  1.00 58.18 ? 173 LEU C CD2   1 
ATOM   7993  N N     . LYS C 1 177 ? -30.502 22.879  94.745  1.00 57.58 ? 174 LYS C N     1 
ATOM   7994  C CA    . LYS C 1 177 ? -31.442 23.702  93.974  1.00 57.11 ? 174 LYS C CA    1 
ATOM   7995  C C     . LYS C 1 177 ? -30.842 24.567  92.866  1.00 56.25 ? 174 LYS C C     1 
ATOM   7996  O O     . LYS C 1 177 ? -31.555 25.012  91.966  1.00 56.44 ? 174 LYS C O     1 
ATOM   7997  C CB    . LYS C 1 177 ? -32.235 24.597  94.928  1.00 55.98 ? 174 LYS C CB    1 
ATOM   7998  C CG    . LYS C 1 177 ? -33.235 23.843  95.792  1.00 57.63 ? 174 LYS C CG    1 
ATOM   7999  C CD    . LYS C 1 177 ? -34.461 23.443  94.966  1.00 59.64 ? 174 LYS C CD    1 
ATOM   8000  C CE    . LYS C 1 177 ? -35.136 22.166  95.480  1.00 59.70 ? 174 LYS C CE    1 
ATOM   8001  N NZ    . LYS C 1 177 ? -34.383 20.911  95.154  1.00 58.16 ? 174 LYS C NZ    1 
ATOM   8002  N N     . VAL C 1 178 ? -29.539 24.814  92.928  1.00 55.54 ? 175 VAL C N     1 
ATOM   8003  C CA    . VAL C 1 178 ? -28.886 25.638  91.915  1.00 54.36 ? 175 VAL C CA    1 
ATOM   8004  C C     . VAL C 1 178 ? -27.799 24.863  91.176  1.00 52.93 ? 175 VAL C C     1 
ATOM   8005  O O     . VAL C 1 178 ? -27.068 24.075  91.779  1.00 53.89 ? 175 VAL C O     1 
ATOM   8006  C CB    . VAL C 1 178 ? -28.287 26.921  92.562  1.00 53.75 ? 175 VAL C CB    1 
ATOM   8007  C CG1   . VAL C 1 178 ? -27.699 26.589  93.913  1.00 53.34 ? 175 VAL C CG1   1 
ATOM   8008  C CG2   . VAL C 1 178 ? -27.226 27.522  91.663  1.00 52.93 ? 175 VAL C CG2   1 
ATOM   8009  N N     . PRO C 1 179 ? -27.684 25.070  89.853  1.00 51.06 ? 176 PRO C N     1 
ATOM   8010  C CA    . PRO C 1 179 ? -26.680 24.389  89.026  1.00 49.88 ? 176 PRO C CA    1 
ATOM   8011  C C     . PRO C 1 179 ? -25.266 24.505  89.615  1.00 49.32 ? 176 PRO C C     1 
ATOM   8012  O O     . PRO C 1 179 ? -24.982 25.418  90.391  1.00 48.96 ? 176 PRO C O     1 
ATOM   8013  C CB    . PRO C 1 179 ? -26.795 25.108  87.686  1.00 49.93 ? 176 PRO C CB    1 
ATOM   8014  C CG    . PRO C 1 179 ? -28.239 25.498  87.642  1.00 50.37 ? 176 PRO C CG    1 
ATOM   8015  C CD    . PRO C 1 179 ? -28.486 26.000  89.040  1.00 50.46 ? 176 PRO C CD    1 
ATOM   8016  N N     . ALA C 1 180 ? -24.386 23.573  89.249  1.00 48.30 ? 177 ALA C N     1 
ATOM   8017  C CA    . ALA C 1 180 ? -23.004 23.582  89.733  1.00 46.06 ? 177 ALA C CA    1 
ATOM   8018  C C     . ALA C 1 180 ? -22.041 22.932  88.739  1.00 45.11 ? 177 ALA C C     1 
ATOM   8019  O O     . ALA C 1 180 ? -22.391 21.973  88.045  1.00 44.47 ? 177 ALA C O     1 
ATOM   8020  C CB    . ALA C 1 180 ? -22.906 22.882  91.092  1.00 45.46 ? 177 ALA C CB    1 
ATOM   8021  N N     . ILE C 1 181 ? -20.829 23.481  88.666  1.00 44.07 ? 178 ILE C N     1 
ATOM   8022  C CA    . ILE C 1 181 ? -19.782 22.979  87.781  1.00 41.86 ? 178 ILE C CA    1 
ATOM   8023  C C     . ILE C 1 181 ? -18.640 22.399  88.609  1.00 39.92 ? 178 ILE C C     1 
ATOM   8024  O O     . ILE C 1 181 ? -18.035 23.084  89.436  1.00 38.14 ? 178 ILE C O     1 
ATOM   8025  C CB    . ILE C 1 181 ? -19.241 24.103  86.852  1.00 42.44 ? 178 ILE C CB    1 
ATOM   8026  C CG1   . ILE C 1 181 ? -20.224 24.323  85.700  1.00 43.06 ? 178 ILE C CG1   1 
ATOM   8027  C CG2   . ILE C 1 181 ? -17.859 23.742  86.314  1.00 40.24 ? 178 ILE C CG2   1 
ATOM   8028  C CD1   . ILE C 1 181 ? -19.744 25.299  84.643  1.00 45.86 ? 178 ILE C CD1   1 
ATOM   8029  N N     . ASN C 1 182 ? -18.363 21.123  88.380  1.00 38.41 ? 179 ASN C N     1 
ATOM   8030  C CA    . ASN C 1 182 ? -17.304 20.428  89.100  1.00 37.29 ? 179 ASN C CA    1 
ATOM   8031  C C     . ASN C 1 182 ? -15.948 20.879  88.546  1.00 35.93 ? 179 ASN C C     1 
ATOM   8032  O O     . ASN C 1 182 ? -15.534 20.446  87.463  1.00 36.56 ? 179 ASN C O     1 
ATOM   8033  C CB    . ASN C 1 182 ? -17.478 18.919  88.918  1.00 36.60 ? 179 ASN C CB    1 
ATOM   8034  C CG    . ASN C 1 182 ? -16.545 18.117  89.791  1.00 37.02 ? 179 ASN C CG    1 
ATOM   8035  O OD1   . ASN C 1 182 ? -15.586 18.655  90.352  1.00 35.04 ? 179 ASN C OD1   1 
ATOM   8036  N ND2   . ASN C 1 182 ? -16.809 16.817  89.904  1.00 34.67 ? 179 ASN C ND2   1 
ATOM   8037  N N     . VAL C 1 183 ? -15.264 21.757  89.277  1.00 33.55 ? 180 VAL C N     1 
ATOM   8038  C CA    . VAL C 1 183 ? -13.965 22.261  88.833  1.00 30.83 ? 180 VAL C CA    1 
ATOM   8039  C C     . VAL C 1 183 ? -12.819 21.357  89.264  1.00 30.46 ? 180 VAL C C     1 
ATOM   8040  O O     . VAL C 1 183 ? -11.895 21.109  88.493  1.00 29.56 ? 180 VAL C O     1 
ATOM   8041  C CB    . VAL C 1 183 ? -13.715 23.695  89.355  1.00 29.52 ? 180 VAL C CB    1 
ATOM   8042  C CG1   . VAL C 1 183 ? -12.367 24.196  88.898  1.00 27.09 ? 180 VAL C CG1   1 
ATOM   8043  C CG2   . VAL C 1 183 ? -14.814 24.621  88.847  1.00 29.72 ? 180 VAL C CG2   1 
ATOM   8044  N N     . ASN C 1 184 ? -12.888 20.860  90.491  1.00 30.28 ? 181 ASN C N     1 
ATOM   8045  C CA    . ASN C 1 184 ? -11.861 19.980  91.010  1.00 31.26 ? 181 ASN C CA    1 
ATOM   8046  C C     . ASN C 1 184 ? -11.588 18.794  90.103  1.00 32.73 ? 181 ASN C C     1 
ATOM   8047  O O     . ASN C 1 184 ? -10.435 18.430  89.874  1.00 31.60 ? 181 ASN C O     1 
ATOM   8048  C CB    . ASN C 1 184 ? -12.257 19.433  92.381  1.00 30.21 ? 181 ASN C CB    1 
ATOM   8049  C CG    . ASN C 1 184 ? -11.295 18.351  92.862  1.00 29.64 ? 181 ASN C CG    1 
ATOM   8050  O OD1   . ASN C 1 184 ? -11.459 17.167  92.558  1.00 25.75 ? 181 ASN C OD1   1 
ATOM   8051  N ND2   . ASN C 1 184 ? -10.256 18.768  93.580  1.00 26.98 ? 181 ASN C ND2   1 
ATOM   8052  N N     . ASP C 1 185 ? -12.656 18.192  89.589  1.00 34.63 ? 182 ASP C N     1 
ATOM   8053  C CA    . ASP C 1 185 ? -12.517 17.026  88.728  1.00 35.98 ? 182 ASP C CA    1 
ATOM   8054  C C     . ASP C 1 185 ? -12.218 17.274  87.274  1.00 35.78 ? 182 ASP C C     1 
ATOM   8055  O O     . ASP C 1 185 ? -12.521 16.442  86.422  1.00 35.91 ? 182 ASP C O     1 
ATOM   8056  C CB    . ASP C 1 185 ? -13.737 16.135  88.851  1.00 37.71 ? 182 ASP C CB    1 
ATOM   8057  C CG    . ASP C 1 185 ? -13.777 15.426  90.168  1.00 41.05 ? 182 ASP C CG    1 
ATOM   8058  O OD1   . ASP C 1 185 ? -12.775 14.757  90.498  1.00 40.83 ? 182 ASP C OD1   1 
ATOM   8059  O OD2   . ASP C 1 185 ? -14.798 15.545  90.874  1.00 44.75 ? 182 ASP C OD2   1 
ATOM   8060  N N     . SER C 1 186 ? -11.636 18.432  86.997  1.00 35.68 ? 183 SER C N     1 
ATOM   8061  C CA    . SER C 1 186 ? -11.219 18.777  85.650  1.00 35.16 ? 183 SER C CA    1 
ATOM   8062  C C     . SER C 1 186 ? -9.801  18.235  85.634  1.00 35.19 ? 183 SER C C     1 
ATOM   8063  O O     . SER C 1 186 ? -9.016  18.549  86.519  1.00 37.66 ? 183 SER C O     1 
ATOM   8064  C CB    . SER C 1 186 ? -11.162 20.295  85.457  1.00 36.03 ? 183 SER C CB    1 
ATOM   8065  O OG    . SER C 1 186 ? -12.416 20.853  85.108  1.00 37.64 ? 183 SER C OG    1 
ATOM   8066  N N     . VAL C 1 187 ? -9.470  17.414  84.651  1.00 34.39 ? 184 VAL C N     1 
ATOM   8067  C CA    . VAL C 1 187 ? -8.133  16.842  84.559  1.00 31.95 ? 184 VAL C CA    1 
ATOM   8068  C C     . VAL C 1 187 ? -7.019  17.824  84.925  1.00 30.23 ? 184 VAL C C     1 
ATOM   8069  O O     . VAL C 1 187 ? -6.182  17.525  85.777  1.00 30.18 ? 184 VAL C O     1 
ATOM   8070  C CB    . VAL C 1 187 ? -7.885  16.322  83.143  1.00 32.45 ? 184 VAL C CB    1 
ATOM   8071  C CG1   . VAL C 1 187 ? -6.520  15.650  83.056  1.00 34.01 ? 184 VAL C CG1   1 
ATOM   8072  C CG2   . VAL C 1 187 ? -8.994  15.350  82.765  1.00 32.18 ? 184 VAL C CG2   1 
ATOM   8073  N N     . THR C 1 188 ? -7.019  18.998  84.298  1.00 29.05 ? 185 THR C N     1 
ATOM   8074  C CA    . THR C 1 188 ? -5.988  20.007  84.549  1.00 26.75 ? 185 THR C CA    1 
ATOM   8075  C C     . THR C 1 188 ? -6.027  20.600  85.946  1.00 26.36 ? 185 THR C C     1 
ATOM   8076  O O     . THR C 1 188 ? -5.337  21.570  86.245  1.00 25.94 ? 185 THR C O     1 
ATOM   8077  C CB    . THR C 1 188 ? -6.073  21.149  83.528  1.00 25.13 ? 185 THR C CB    1 
ATOM   8078  O OG1   . THR C 1 188 ? -7.386  21.708  83.541  1.00 22.19 ? 185 THR C OG1   1 
ATOM   8079  C CG2   . THR C 1 188 ? -5.763  20.616  82.135  1.00 25.51 ? 185 THR C CG2   1 
ATOM   8080  N N     . LYS C 1 189 ? -6.825  19.993  86.808  1.00 26.38 ? 186 LYS C N     1 
ATOM   8081  C CA    . LYS C 1 189 ? -6.955  20.451  88.174  1.00 26.83 ? 186 LYS C CA    1 
ATOM   8082  C C     . LYS C 1 189 ? -6.563  19.336  89.137  1.00 28.51 ? 186 LYS C C     1 
ATOM   8083  O O     . LYS C 1 189 ? -5.492  19.355  89.729  1.00 30.41 ? 186 LYS C O     1 
ATOM   8084  C CB    . LYS C 1 189 ? -8.396  20.868  88.443  1.00 23.79 ? 186 LYS C CB    1 
ATOM   8085  C CG    . LYS C 1 189 ? -8.568  21.706  89.700  1.00 23.22 ? 186 LYS C CG    1 
ATOM   8086  C CD    . LYS C 1 189 ? -8.323  20.933  90.979  1.00 18.88 ? 186 LYS C CD    1 
ATOM   8087  C CE    . LYS C 1 189 ? -8.366  21.870  92.152  1.00 16.10 ? 186 LYS C CE    1 
ATOM   8088  N NZ    . LYS C 1 189 ? -8.388  21.152  93.447  1.00 16.58 ? 186 LYS C NZ    1 
ATOM   8089  N N     . SER C 1 190 ? -7.457  18.373  89.290  1.00 29.09 ? 187 SER C N     1 
ATOM   8090  C CA    . SER C 1 190 ? -7.258  17.245  90.167  1.00 29.34 ? 187 SER C CA    1 
ATOM   8091  C C     . SER C 1 190 ? -5.894  16.590  89.971  1.00 30.28 ? 187 SER C C     1 
ATOM   8092  O O     . SER C 1 190 ? -5.166  16.366  90.931  1.00 30.41 ? 187 SER C O     1 
ATOM   8093  C CB    . SER C 1 190 ? -8.360  16.220  89.905  1.00 32.20 ? 187 SER C CB    1 
ATOM   8094  O OG    . SER C 1 190 ? -8.428  15.917  88.519  1.00 31.02 ? 187 SER C OG    1 
ATOM   8095  N N     . LYS C 1 191 ? -5.566  16.280  88.718  1.00 30.29 ? 188 LYS C N     1 
ATOM   8096  C CA    . LYS C 1 191 ? -4.301  15.635  88.371  1.00 28.74 ? 188 LYS C CA    1 
ATOM   8097  C C     . LYS C 1 191 ? -3.104  16.578  88.358  1.00 28.13 ? 188 LYS C C     1 
ATOM   8098  O O     . LYS C 1 191 ? -2.014  16.196  87.928  1.00 28.07 ? 188 LYS C O     1 
ATOM   8099  C CB    . LYS C 1 191 ? -4.417  14.943  87.013  1.00 30.19 ? 188 LYS C CB    1 
ATOM   8100  C CG    . LYS C 1 191 ? -5.461  13.822  86.949  1.00 34.53 ? 188 LYS C CG    1 
ATOM   8101  C CD    . LYS C 1 191 ? -5.177  12.694  87.942  1.00 37.07 ? 188 LYS C CD    1 
ATOM   8102  C CE    . LYS C 1 191 ? -3.859  11.953  87.640  1.00 38.13 ? 188 LYS C CE    1 
ATOM   8103  N NZ    . LYS C 1 191 ? -3.446  11.069  88.785  1.00 38.73 ? 188 LYS C NZ    1 
ATOM   8104  N N     . PHE C 1 192 ? -3.304  17.811  88.812  1.00 25.73 ? 189 PHE C N     1 
ATOM   8105  C CA    . PHE C 1 192 ? -2.209  18.769  88.852  1.00 25.87 ? 189 PHE C CA    1 
ATOM   8106  C C     . PHE C 1 192 ? -2.160  19.467  90.202  1.00 25.94 ? 189 PHE C C     1 
ATOM   8107  O O     . PHE C 1 192 ? -1.175  19.348  90.929  1.00 27.40 ? 189 PHE C O     1 
ATOM   8108  C CB    . PHE C 1 192 ? -2.333  19.795  87.712  1.00 24.88 ? 189 PHE C CB    1 
ATOM   8109  C CG    . PHE C 1 192 ? -2.127  19.205  86.337  1.00 24.74 ? 189 PHE C CG    1 
ATOM   8110  C CD1   . PHE C 1 192 ? -3.154  18.522  85.695  1.00 23.45 ? 189 PHE C CD1   1 
ATOM   8111  C CD2   . PHE C 1 192 ? -0.889  19.302  85.700  1.00 23.27 ? 189 PHE C CD2   1 
ATOM   8112  C CE1   . PHE C 1 192 ? -2.961  17.948  84.445  1.00 22.65 ? 189 PHE C CE1   1 
ATOM   8113  C CE2   . PHE C 1 192 ? -0.682  18.733  84.453  1.00 23.52 ? 189 PHE C CE2   1 
ATOM   8114  C CZ    . PHE C 1 192 ? -1.721  18.052  83.821  1.00 23.60 ? 189 PHE C CZ    1 
ATOM   8115  N N     . ASP C 1 193 ? -3.222  20.193  90.532  1.00 25.80 ? 190 ASP C N     1 
ATOM   8116  C CA    . ASP C 1 193 ? -3.346  20.903  91.801  1.00 26.56 ? 190 ASP C CA    1 
ATOM   8117  C C     . ASP C 1 193 ? -3.210  19.901  92.945  1.00 27.05 ? 190 ASP C C     1 
ATOM   8118  O O     . ASP C 1 193 ? -2.323  20.017  93.788  1.00 26.05 ? 190 ASP C O     1 
ATOM   8119  C CB    . ASP C 1 193 ? -4.727  21.582  91.857  1.00 28.19 ? 190 ASP C CB    1 
ATOM   8120  C CG    . ASP C 1 193 ? -5.036  22.264  93.206  1.00 28.59 ? 190 ASP C CG    1 
ATOM   8121  O OD1   . ASP C 1 193 ? -4.842  21.666  94.294  1.00 27.10 ? 190 ASP C OD1   1 
ATOM   8122  O OD2   . ASP C 1 193 ? -5.520  23.416  93.157  1.00 29.82 ? 190 ASP C OD2   1 
ATOM   8123  N N     . ASN C 1 194 ? -4.079  18.896  92.953  1.00 27.43 ? 191 ASN C N     1 
ATOM   8124  C CA    . ASN C 1 194 ? -4.044  17.909  94.029  1.00 29.66 ? 191 ASN C CA    1 
ATOM   8125  C C     . ASN C 1 194 ? -2.721  17.148  94.130  1.00 28.98 ? 191 ASN C C     1 
ATOM   8126  O O     . ASN C 1 194 ? -2.220  16.912  95.235  1.00 27.80 ? 191 ASN C O     1 
ATOM   8127  C CB    . ASN C 1 194 ? -5.194  16.903  93.882  1.00 29.88 ? 191 ASN C CB    1 
ATOM   8128  C CG    . ASN C 1 194 ? -6.566  17.571  93.783  1.00 31.93 ? 191 ASN C CG    1 
ATOM   8129  O OD1   . ASN C 1 194 ? -7.592  16.929  94.030  1.00 33.32 ? 191 ASN C OD1   1 
ATOM   8130  N ND2   . ASN C 1 194 ? -6.592  18.852  93.412  1.00 29.78 ? 191 ASN C ND2   1 
ATOM   8131  N N     . LEU C 1 195 ? -2.172  16.777  92.973  1.00 28.21 ? 192 LEU C N     1 
ATOM   8132  C CA    . LEU C 1 195 ? -0.923  16.015  92.886  1.00 28.08 ? 192 LEU C CA    1 
ATOM   8133  C C     . LEU C 1 195 ? 0.350   16.867  93.021  1.00 27.89 ? 192 LEU C C     1 
ATOM   8134  O O     . LEU C 1 195 ? 0.920   16.954  94.109  1.00 28.18 ? 192 LEU C O     1 
ATOM   8135  C CB    . LEU C 1 195 ? -0.901  15.234  91.565  1.00 28.45 ? 192 LEU C CB    1 
ATOM   8136  C CG    . LEU C 1 195 ? 0.271   14.270  91.324  1.00 28.36 ? 192 LEU C CG    1 
ATOM   8137  C CD1   . LEU C 1 195 ? 0.234   13.126  92.313  1.00 23.24 ? 192 LEU C CD1   1 
ATOM   8138  C CD2   . LEU C 1 195 ? 0.201   13.740  89.893  1.00 28.01 ? 192 LEU C CD2   1 
ATOM   8139  N N     . TYR C 1 196 ? 0.789   17.499  91.930  1.00 26.80 ? 193 TYR C N     1 
ATOM   8140  C CA    . TYR C 1 196 ? 2.003   18.323  91.945  1.00 25.15 ? 193 TYR C CA    1 
ATOM   8141  C C     . TYR C 1 196 ? 1.964   19.483  92.954  1.00 24.66 ? 193 TYR C C     1 
ATOM   8142  O O     . TYR C 1 196 ? 3.006   19.925  93.436  1.00 25.27 ? 193 TYR C O     1 
ATOM   8143  C CB    . TYR C 1 196 ? 2.291   18.869  90.540  1.00 25.20 ? 193 TYR C CB    1 
ATOM   8144  C CG    . TYR C 1 196 ? 2.289   17.806  89.459  1.00 26.45 ? 193 TYR C CG    1 
ATOM   8145  C CD1   . TYR C 1 196 ? 3.090   16.659  89.570  1.00 27.19 ? 193 TYR C CD1   1 
ATOM   8146  C CD2   . TYR C 1 196 ? 1.476   17.930  88.333  1.00 26.23 ? 193 TYR C CD2   1 
ATOM   8147  C CE1   . TYR C 1 196 ? 3.074   15.667  88.582  1.00 26.15 ? 193 TYR C CE1   1 
ATOM   8148  C CE2   . TYR C 1 196 ? 1.454   16.940  87.339  1.00 26.24 ? 193 TYR C CE2   1 
ATOM   8149  C CZ    . TYR C 1 196 ? 2.255   15.817  87.472  1.00 25.77 ? 193 TYR C CZ    1 
ATOM   8150  O OH    . TYR C 1 196 ? 2.250   14.863  86.484  1.00 26.97 ? 193 TYR C OH    1 
ATOM   8151  N N     . GLY C 1 197 ? 0.772   19.966  93.274  1.00 22.66 ? 194 GLY C N     1 
ATOM   8152  C CA    . GLY C 1 197 ? 0.654   21.040  94.233  1.00 24.14 ? 194 GLY C CA    1 
ATOM   8153  C C     . GLY C 1 197 ? 1.053   20.591  95.629  1.00 24.62 ? 194 GLY C C     1 
ATOM   8154  O O     . GLY C 1 197 ? 1.943   21.163  96.241  1.00 24.35 ? 194 GLY C O     1 
ATOM   8155  N N     . CYS C 1 198 ? 0.401   19.558  96.145  1.00 26.22 ? 195 CYS C N     1 
ATOM   8156  C CA    . CYS C 1 198 ? 0.744   19.079  97.478  1.00 29.53 ? 195 CYS C CA    1 
ATOM   8157  C C     . CYS C 1 198 ? 2.174   18.569  97.552  1.00 29.61 ? 195 CYS C C     1 
ATOM   8158  O O     . CYS C 1 198 ? 2.791   18.580  98.613  1.00 30.36 ? 195 CYS C O     1 
ATOM   8159  C CB    . CYS C 1 198 ? -0.185  17.951  97.908  1.00 28.79 ? 195 CYS C CB    1 
ATOM   8160  S SG    . CYS C 1 198 ? -1.876  18.455  98.135  1.00 31.91 ? 195 CYS C SG    1 
ATOM   8161  N N     . ARG C 1 199 ? 2.692   18.112  96.422  1.00 28.59 ? 196 ARG C N     1 
ATOM   8162  C CA    . ARG C 1 199 ? 4.029   17.566  96.388  1.00 28.09 ? 196 ARG C CA    1 
ATOM   8163  C C     . ARG C 1 199 ? 5.059   18.611  96.766  1.00 30.15 ? 196 ARG C C     1 
ATOM   8164  O O     . ARG C 1 199 ? 6.178   18.279  97.163  1.00 32.15 ? 196 ARG C O     1 
ATOM   8165  C CB    . ARG C 1 199 ? 4.318   17.027  95.001  1.00 26.54 ? 196 ARG C CB    1 
ATOM   8166  C CG    . ARG C 1 199 ? 5.610   16.296  94.894  1.00 23.27 ? 196 ARG C CG    1 
ATOM   8167  C CD    . ARG C 1 199 ? 5.687   15.589  93.564  1.00 23.68 ? 196 ARG C CD    1 
ATOM   8168  N NE    . ARG C 1 199 ? 5.914   16.518  92.461  1.00 22.66 ? 196 ARG C NE    1 
ATOM   8169  C CZ    . ARG C 1 199 ? 6.130   16.133  91.208  1.00 22.36 ? 196 ARG C CZ    1 
ATOM   8170  N NH1   . ARG C 1 199 ? 6.143   14.846  90.905  1.00 18.20 ? 196 ARG C NH1   1 
ATOM   8171  N NH2   . ARG C 1 199 ? 6.348   17.034  90.262  1.00 24.96 ? 196 ARG C NH2   1 
ATOM   8172  N N     . GLU C 1 200 ? 4.687   19.877  96.652  1.00 29.24 ? 197 GLU C N     1 
ATOM   8173  C CA    . GLU C 1 200 ? 5.631   20.922  96.985  1.00 29.16 ? 197 GLU C CA    1 
ATOM   8174  C C     . GLU C 1 200 ? 5.234   21.739  98.203  1.00 27.87 ? 197 GLU C C     1 
ATOM   8175  O O     . GLU C 1 200 ? 6.094   22.318  98.863  1.00 28.90 ? 197 GLU C O     1 
ATOM   8176  C CB    . GLU C 1 200 ? 5.846   21.840  95.771  1.00 28.74 ? 197 GLU C CB    1 
ATOM   8177  C CG    . GLU C 1 200 ? 6.664   21.190  94.672  1.00 28.95 ? 197 GLU C CG    1 
ATOM   8178  C CD    . GLU C 1 200 ? 6.891   22.111  93.487  1.00 30.36 ? 197 GLU C CD    1 
ATOM   8179  O OE1   . GLU C 1 200 ? 7.168   23.306  93.713  1.00 30.83 ? 197 GLU C OE1   1 
ATOM   8180  O OE2   . GLU C 1 200 ? 6.803   21.634  92.331  1.00 29.48 ? 197 GLU C OE2   1 
ATOM   8181  N N     . SER C 1 201 ? 3.945   21.764  98.525  1.00 26.43 ? 198 SER C N     1 
ATOM   8182  C CA    . SER C 1 201 ? 3.476   22.536  99.676  1.00 26.96 ? 198 SER C CA    1 
ATOM   8183  C C     . SER C 1 201 ? 3.512   21.783  101.020 1.00 24.98 ? 198 SER C C     1 
ATOM   8184  O O     . SER C 1 201 ? 3.803   22.381  102.047 1.00 24.92 ? 198 SER C O     1 
ATOM   8185  C CB    . SER C 1 201 ? 2.062   23.079  99.409  1.00 26.06 ? 198 SER C CB    1 
ATOM   8186  O OG    . SER C 1 201 ? 1.125   22.031  99.265  1.00 27.98 ? 198 SER C OG    1 
ATOM   8187  N N     . LEU C 1 202 ? 3.231   20.481  101.013 1.00 24.45 ? 199 LEU C N     1 
ATOM   8188  C CA    . LEU C 1 202 ? 3.250   19.667  102.241 1.00 24.68 ? 199 LEU C CA    1 
ATOM   8189  C C     . LEU C 1 202 ? 4.536   19.817  103.034 1.00 24.17 ? 199 LEU C C     1 
ATOM   8190  O O     . LEU C 1 202 ? 4.533   20.243  104.190 1.00 23.50 ? 199 LEU C O     1 
ATOM   8191  C CB    . LEU C 1 202 ? 3.084   18.185  101.914 1.00 24.55 ? 199 LEU C CB    1 
ATOM   8192  C CG    . LEU C 1 202 ? 3.333   17.244  103.099 1.00 26.69 ? 199 LEU C CG    1 
ATOM   8193  C CD1   . LEU C 1 202 ? 2.202   17.361  104.109 1.00 23.03 ? 199 LEU C CD1   1 
ATOM   8194  C CD2   . LEU C 1 202 ? 3.457   15.812  102.593 1.00 27.60 ? 199 LEU C CD2   1 
ATOM   8195  N N     . ILE C 1 203 ? 5.636   19.426  102.407 1.00 24.71 ? 200 ILE C N     1 
ATOM   8196  C CA    . ILE C 1 203 ? 6.932   19.517  103.042 1.00 25.69 ? 200 ILE C CA    1 
ATOM   8197  C C     . ILE C 1 203 ? 7.141   20.962  103.442 1.00 25.52 ? 200 ILE C C     1 
ATOM   8198  O O     . ILE C 1 203 ? 7.700   21.261  104.504 1.00 26.05 ? 200 ILE C O     1 
ATOM   8199  C CB    . ILE C 1 203 ? 8.032   19.095  102.083 1.00 27.90 ? 200 ILE C CB    1 
ATOM   8200  C CG1   . ILE C 1 203 ? 7.819   17.638  101.676 1.00 30.66 ? 200 ILE C CG1   1 
ATOM   8201  C CG2   . ILE C 1 203 ? 9.393   19.264  102.738 1.00 29.99 ? 200 ILE C CG2   1 
ATOM   8202  C CD1   . ILE C 1 203 ? 8.007   16.661  102.816 1.00 31.30 ? 200 ILE C CD1   1 
ATOM   8203  N N     . ASP C 1 204 ? 6.668   21.869  102.599 1.00 24.11 ? 201 ASP C N     1 
ATOM   8204  C CA    . ASP C 1 204 ? 6.837   23.275  102.886 1.00 25.88 ? 201 ASP C CA    1 
ATOM   8205  C C     . ASP C 1 204 ? 6.192   23.614  104.230 1.00 25.39 ? 201 ASP C C     1 
ATOM   8206  O O     . ASP C 1 204 ? 6.836   24.190  105.095 1.00 24.96 ? 201 ASP C O     1 
ATOM   8207  C CB    . ASP C 1 204 ? 6.247   24.130  101.761 1.00 26.52 ? 201 ASP C CB    1 
ATOM   8208  C CG    . ASP C 1 204 ? 6.815   25.536  101.750 1.00 28.66 ? 201 ASP C CG    1 
ATOM   8209  O OD1   . ASP C 1 204 ? 7.946   25.705  102.253 1.00 30.05 ? 201 ASP C OD1   1 
ATOM   8210  O OD2   . ASP C 1 204 ? 6.147   26.463  101.232 1.00 29.54 ? 201 ASP C OD2   1 
ATOM   8211  N N     . GLY C 1 205 ? 4.933   23.237  104.415 1.00 25.24 ? 202 GLY C N     1 
ATOM   8212  C CA    . GLY C 1 205 ? 4.271   23.521  105.672 1.00 26.09 ? 202 GLY C CA    1 
ATOM   8213  C C     . GLY C 1 205 ? 4.899   22.840  106.877 1.00 26.18 ? 202 GLY C C     1 
ATOM   8214  O O     . GLY C 1 205 ? 4.887   23.378  107.976 1.00 27.86 ? 202 GLY C O     1 
ATOM   8215  N N     . ILE C 1 206 ? 5.441   21.648  106.681 1.00 26.43 ? 203 ILE C N     1 
ATOM   8216  C CA    . ILE C 1 206 ? 6.066   20.919  107.774 1.00 25.74 ? 203 ILE C CA    1 
ATOM   8217  C C     . ILE C 1 206 ? 7.415   21.529  108.087 1.00 26.01 ? 203 ILE C C     1 
ATOM   8218  O O     . ILE C 1 206 ? 7.806   21.646  109.251 1.00 26.65 ? 203 ILE C O     1 
ATOM   8219  C CB    . ILE C 1 206 ? 6.305   19.442  107.400 1.00 25.17 ? 203 ILE C CB    1 
ATOM   8220  C CG1   . ILE C 1 206 ? 4.980   18.756  107.051 1.00 22.74 ? 203 ILE C CG1   1 
ATOM   8221  C CG2   . ILE C 1 206 ? 7.025   18.734  108.543 1.00 24.66 ? 203 ILE C CG2   1 
ATOM   8222  C CD1   . ILE C 1 206 ? 5.150   17.343  106.529 1.00 21.63 ? 203 ILE C CD1   1 
ATOM   8223  N N     . LYS C 1 207 ? 8.128   21.898  107.032 1.00 26.51 ? 204 LYS C N     1 
ATOM   8224  C CA    . LYS C 1 207 ? 9.454   22.473  107.172 1.00 27.65 ? 204 LYS C CA    1 
ATOM   8225  C C     . LYS C 1 207 ? 9.464   23.810  107.885 1.00 28.30 ? 204 LYS C C     1 
ATOM   8226  O O     . LYS C 1 207 ? 10.324  24.057  108.737 1.00 27.39 ? 204 LYS C O     1 
ATOM   8227  C CB    . LYS C 1 207 ? 10.102  22.636  105.799 1.00 28.22 ? 204 LYS C CB    1 
ATOM   8228  C CG    . LYS C 1 207 ? 10.754  21.385  105.255 1.00 28.44 ? 204 LYS C CG    1 
ATOM   8229  C CD    . LYS C 1 207 ? 12.035  21.102  105.989 1.00 28.61 ? 204 LYS C CD    1 
ATOM   8230  C CE    . LYS C 1 207 ? 12.783  19.955  105.381 1.00 27.19 ? 204 LYS C CE    1 
ATOM   8231  N NZ    . LYS C 1 207 ? 13.846  19.613  106.337 1.00 28.99 ? 204 LYS C NZ    1 
ATOM   8232  N N     . ARG C 1 208 ? 8.523   24.676  107.522 1.00 28.32 ? 205 ARG C N     1 
ATOM   8233  C CA    . ARG C 1 208 ? 8.434   25.997  108.128 1.00 28.47 ? 205 ARG C CA    1 
ATOM   8234  C C     . ARG C 1 208 ? 7.985   25.905  109.579 1.00 29.02 ? 205 ARG C C     1 
ATOM   8235  O O     . ARG C 1 208 ? 8.416   26.691  110.418 1.00 27.08 ? 205 ARG C O     1 
ATOM   8236  C CB    . ARG C 1 208 ? 7.462   26.881  107.347 1.00 29.36 ? 205 ARG C CB    1 
ATOM   8237  C CG    . ARG C 1 208 ? 7.900   27.184  105.911 1.00 29.68 ? 205 ARG C CG    1 
ATOM   8238  C CD    . ARG C 1 208 ? 7.041   28.268  105.282 1.00 25.93 ? 205 ARG C CD    1 
ATOM   8239  N NE    . ARG C 1 208 ? 7.172   28.294  103.830 1.00 26.90 ? 205 ARG C NE    1 
ATOM   8240  C CZ    . ARG C 1 208 ? 6.859   29.343  103.079 1.00 26.48 ? 205 ARG C CZ    1 
ATOM   8241  N NH1   . ARG C 1 208 ? 6.406   30.451  103.640 1.00 27.21 ? 205 ARG C NH1   1 
ATOM   8242  N NH2   . ARG C 1 208 ? 6.983   29.286  101.766 1.00 27.11 ? 205 ARG C NH2   1 
ATOM   8243  N N     . ALA C 1 209 ? 7.131   24.930  109.867 1.00 28.77 ? 206 ALA C N     1 
ATOM   8244  C CA    . ALA C 1 209 ? 6.605   24.745  111.215 1.00 30.02 ? 206 ALA C CA    1 
ATOM   8245  C C     . ALA C 1 209 ? 7.535   24.009  112.177 1.00 30.96 ? 206 ALA C C     1 
ATOM   8246  O O     . ALA C 1 209 ? 7.592   24.348  113.361 1.00 30.46 ? 206 ALA C O     1 
ATOM   8247  C CB    . ALA C 1 209 ? 5.277   24.011  111.151 1.00 28.81 ? 206 ALA C CB    1 
ATOM   8248  N N     . THR C 1 210 ? 8.256   23.007  111.673 1.00 30.58 ? 207 THR C N     1 
ATOM   8249  C CA    . THR C 1 210 ? 9.138   22.203  112.520 1.00 29.35 ? 207 THR C CA    1 
ATOM   8250  C C     . THR C 1 210 ? 10.600  22.130  112.112 1.00 30.44 ? 207 THR C C     1 
ATOM   8251  O O     . THR C 1 210 ? 11.443  21.778  112.927 1.00 31.64 ? 207 THR C O     1 
ATOM   8252  C CB    . THR C 1 210 ? 8.670   20.747  112.581 1.00 29.29 ? 207 THR C CB    1 
ATOM   8253  O OG1   . THR C 1 210 ? 8.813   20.164  111.277 1.00 30.08 ? 207 THR C OG1   1 
ATOM   8254  C CG2   . THR C 1 210 ? 7.218   20.656  113.020 1.00 27.62 ? 207 THR C CG2   1 
ATOM   8255  N N     . ASP C 1 211 ? 10.898  22.414  110.850 1.00 31.85 ? 208 ASP C N     1 
ATOM   8256  C CA    . ASP C 1 211 ? 12.273  22.342  110.352 1.00 30.76 ? 208 ASP C CA    1 
ATOM   8257  C C     . ASP C 1 211 ? 12.863  20.949  110.481 1.00 30.31 ? 208 ASP C C     1 
ATOM   8258  O O     . ASP C 1 211 ? 14.068  20.759  110.298 1.00 29.67 ? 208 ASP C O     1 
ATOM   8259  C CB    . ASP C 1 211 ? 13.169  23.314  111.107 1.00 30.97 ? 208 ASP C CB    1 
ATOM   8260  C CG    . ASP C 1 211 ? 13.129  24.700  110.530 1.00 32.66 ? 208 ASP C CG    1 
ATOM   8261  O OD1   . ASP C 1 211 ? 13.663  24.897  109.416 1.00 30.86 ? 208 ASP C OD1   1 
ATOM   8262  O OD2   . ASP C 1 211 ? 12.555  25.590  111.193 1.00 34.70 ? 208 ASP C OD2   1 
ATOM   8263  N N     . VAL C 1 212 ? 12.018  19.981  110.812 1.00 30.53 ? 209 VAL C N     1 
ATOM   8264  C CA    . VAL C 1 212 ? 12.459  18.600  110.975 1.00 30.89 ? 209 VAL C CA    1 
ATOM   8265  C C     . VAL C 1 212 ? 13.050  18.063  109.677 1.00 31.42 ? 209 VAL C C     1 
ATOM   8266  O O     . VAL C 1 212 ? 12.661  18.499  108.585 1.00 31.75 ? 209 VAL C O     1 
ATOM   8267  C CB    . VAL C 1 212 ? 11.278  17.714  111.371 1.00 30.98 ? 209 VAL C CB    1 
ATOM   8268  C CG1   . VAL C 1 212 ? 10.299  17.655  110.224 1.00 30.69 ? 209 VAL C CG1   1 
ATOM   8269  C CG2   . VAL C 1 212 ? 11.760  16.320  111.746 1.00 32.68 ? 209 VAL C CG2   1 
ATOM   8270  N N     . MET C 1 213 ? 13.986  17.122  109.792 1.00 30.81 ? 210 MET C N     1 
ATOM   8271  C CA    . MET C 1 213 ? 14.595  16.522  108.613 1.00 30.72 ? 210 MET C CA    1 
ATOM   8272  C C     . MET C 1 213 ? 13.747  15.355  108.147 1.00 31.12 ? 210 MET C C     1 
ATOM   8273  O O     . MET C 1 213 ? 13.246  14.574  108.956 1.00 32.54 ? 210 MET C O     1 
ATOM   8274  C CB    . MET C 1 213 ? 16.014  16.043  108.908 1.00 32.99 ? 210 MET C CB    1 
ATOM   8275  C CG    . MET C 1 213 ? 16.676  15.354  107.728 1.00 33.79 ? 210 MET C CG    1 
ATOM   8276  S SD    . MET C 1 213 ? 18.475  15.393  107.767 1.00 38.86 ? 210 MET C SD    1 
ATOM   8277  C CE    . MET C 1 213 ? 18.799  16.329  106.320 1.00 33.53 ? 210 MET C CE    1 
ATOM   8278  N N     . ILE C 1 214 ? 13.586  15.236  106.837 1.00 31.00 ? 211 ILE C N     1 
ATOM   8279  C CA    . ILE C 1 214 ? 12.785  14.160  106.270 1.00 32.50 ? 211 ILE C CA    1 
ATOM   8280  C C     . ILE C 1 214 ? 13.640  12.923  105.999 1.00 32.70 ? 211 ILE C C     1 
ATOM   8281  O O     . ILE C 1 214 ? 13.163  11.788  106.063 1.00 31.49 ? 211 ILE C O     1 
ATOM   8282  C CB    . ILE C 1 214 ? 12.116  14.618  104.940 1.00 32.46 ? 211 ILE C CB    1 
ATOM   8283  C CG1   . ILE C 1 214 ? 11.391  15.946  105.150 1.00 31.03 ? 211 ILE C CG1   1 
ATOM   8284  C CG2   . ILE C 1 214 ? 11.118  13.590  104.471 1.00 29.84 ? 211 ILE C CG2   1 
ATOM   8285  C CD1   . ILE C 1 214 ? 10.295  15.881  106.194 1.00 30.02 ? 211 ILE C CD1   1 
ATOM   8286  N N     . ALA C 1 215 ? 14.913  13.154  105.706 1.00 32.62 ? 212 ALA C N     1 
ATOM   8287  C CA    . ALA C 1 215 ? 15.821  12.062  105.404 1.00 33.09 ? 212 ALA C CA    1 
ATOM   8288  C C     . ALA C 1 215 ? 16.059  11.132  106.587 1.00 33.43 ? 212 ALA C C     1 
ATOM   8289  O O     . ALA C 1 215 ? 16.655  11.527  107.590 1.00 35.88 ? 212 ALA C O     1 
ATOM   8290  C CB    . ALA C 1 215 ? 17.141  12.617  104.905 1.00 30.16 ? 212 ALA C CB    1 
ATOM   8291  N N     . GLY C 1 216 ? 15.598  9.891   106.464 1.00 32.47 ? 213 GLY C N     1 
ATOM   8292  C CA    . GLY C 1 216 ? 15.806  8.928   107.528 1.00 31.30 ? 213 GLY C CA    1 
ATOM   8293  C C     . GLY C 1 216 ? 14.566  8.592   108.324 1.00 30.57 ? 213 GLY C C     1 
ATOM   8294  O O     . GLY C 1 216 ? 14.452  7.496   108.865 1.00 32.01 ? 213 GLY C O     1 
ATOM   8295  N N     . LYS C 1 217 ? 13.631  9.528   108.397 1.00 28.66 ? 214 LYS C N     1 
ATOM   8296  C CA    . LYS C 1 217 ? 12.408  9.312   109.146 1.00 27.14 ? 214 LYS C CA    1 
ATOM   8297  C C     . LYS C 1 217 ? 11.435  8.400   108.411 1.00 27.12 ? 214 LYS C C     1 
ATOM   8298  O O     . LYS C 1 217 ? 11.540  8.216   107.201 1.00 28.62 ? 214 LYS C O     1 
ATOM   8299  C CB    . LYS C 1 217 ? 11.741  10.654  109.412 1.00 27.00 ? 214 LYS C CB    1 
ATOM   8300  C CG    . LYS C 1 217 ? 12.679  11.670  110.014 1.00 28.00 ? 214 LYS C CG    1 
ATOM   8301  C CD    . LYS C 1 217 ? 12.639  11.616  111.521 1.00 28.24 ? 214 LYS C CD    1 
ATOM   8302  C CE    . LYS C 1 217 ? 13.699  12.519  112.091 1.00 29.98 ? 214 LYS C CE    1 
ATOM   8303  N NZ    . LYS C 1 217 ? 13.650  13.842  111.421 1.00 29.32 ? 214 LYS C NZ    1 
ATOM   8304  N N     . VAL C 1 218 ? 10.492  7.829   109.152 1.00 25.57 ? 215 VAL C N     1 
ATOM   8305  C CA    . VAL C 1 218 ? 9.464   6.969   108.588 1.00 24.85 ? 215 VAL C CA    1 
ATOM   8306  C C     . VAL C 1 218 ? 8.210   7.822   108.534 1.00 25.64 ? 215 VAL C C     1 
ATOM   8307  O O     . VAL C 1 218 ? 7.819   8.409   109.536 1.00 27.47 ? 215 VAL C O     1 
ATOM   8308  C CB    . VAL C 1 218 ? 9.188   5.735   109.497 1.00 22.29 ? 215 VAL C CB    1 
ATOM   8309  C CG1   . VAL C 1 218 ? 7.834   5.138   109.188 1.00 19.53 ? 215 VAL C CG1   1 
ATOM   8310  C CG2   . VAL C 1 218 ? 10.262  4.688   109.282 1.00 21.41 ? 215 VAL C CG2   1 
ATOM   8311  N N     . ALA C 1 219 ? 7.569   7.907   107.377 1.00 26.87 ? 216 ALA C N     1 
ATOM   8312  C CA    . ALA C 1 219 ? 6.355   8.723   107.285 1.00 27.67 ? 216 ALA C CA    1 
ATOM   8313  C C     . ALA C 1 219 ? 5.147   7.898   106.866 1.00 27.10 ? 216 ALA C C     1 
ATOM   8314  O O     . ALA C 1 219 ? 5.237   7.054   105.970 1.00 27.61 ? 216 ALA C O     1 
ATOM   8315  C CB    . ALA C 1 219 ? 6.562   9.885   106.317 1.00 26.54 ? 216 ALA C CB    1 
ATOM   8316  N N     . VAL C 1 220 ? 4.020   8.159   107.525 1.00 25.37 ? 217 VAL C N     1 
ATOM   8317  C CA    . VAL C 1 220 ? 2.776   7.453   107.255 1.00 23.75 ? 217 VAL C CA    1 
ATOM   8318  C C     . VAL C 1 220 ? 1.812   8.402   106.552 1.00 23.45 ? 217 VAL C C     1 
ATOM   8319  O O     . VAL C 1 220 ? 1.550   9.512   107.028 1.00 23.87 ? 217 VAL C O     1 
ATOM   8320  C CB    . VAL C 1 220 ? 2.149   6.926   108.579 1.00 22.95 ? 217 VAL C CB    1 
ATOM   8321  C CG1   . VAL C 1 220 ? 0.855   6.181   108.304 1.00 22.48 ? 217 VAL C CG1   1 
ATOM   8322  C CG2   . VAL C 1 220 ? 3.137   6.007   109.282 1.00 24.68 ? 217 VAL C CG2   1 
ATOM   8323  N N     . VAL C 1 221 ? 1.302   7.972   105.406 1.00 21.58 ? 218 VAL C N     1 
ATOM   8324  C CA    . VAL C 1 221 ? 0.375   8.795   104.657 1.00 22.18 ? 218 VAL C CA    1 
ATOM   8325  C C     . VAL C 1 221 ? -0.957  8.065   104.532 1.00 22.15 ? 218 VAL C C     1 
ATOM   8326  O O     . VAL C 1 221 ? -1.076  7.049   103.839 1.00 21.70 ? 218 VAL C O     1 
ATOM   8327  C CB    . VAL C 1 221 ? 0.953   9.142   103.263 1.00 22.77 ? 218 VAL C CB    1 
ATOM   8328  C CG1   . VAL C 1 221 ? 0.028   10.058  102.530 1.00 24.36 ? 218 VAL C CG1   1 
ATOM   8329  C CG2   . VAL C 1 221 ? 2.310   9.807   103.416 1.00 22.09 ? 218 VAL C CG2   1 
ATOM   8330  N N     . ALA C 1 222 ? -1.953  8.570   105.252 1.00 21.88 ? 219 ALA C N     1 
ATOM   8331  C CA    . ALA C 1 222 ? -3.275  7.973   105.245 1.00 21.76 ? 219 ALA C CA    1 
ATOM   8332  C C     . ALA C 1 222 ? -3.913  8.356   103.933 1.00 21.99 ? 219 ALA C C     1 
ATOM   8333  O O     . ALA C 1 222 ? -3.998  9.545   103.593 1.00 21.40 ? 219 ALA C O     1 
ATOM   8334  C CB    . ALA C 1 222 ? -4.102  8.494   106.428 1.00 19.54 ? 219 ALA C CB    1 
ATOM   8335  N N     . GLY C 1 223 ? -4.338  7.336   103.188 1.00 22.35 ? 220 GLY C N     1 
ATOM   8336  C CA    . GLY C 1 223 ? -4.961  7.550   101.887 1.00 22.64 ? 220 GLY C CA    1 
ATOM   8337  C C     . GLY C 1 223 ? -3.935  7.697   100.777 1.00 22.18 ? 220 GLY C C     1 
ATOM   8338  O O     . GLY C 1 223 ? -2.858  8.261   100.985 1.00 21.55 ? 220 GLY C O     1 
ATOM   8339  N N     . TYR C 1 224 ? -4.260  7.194   99.590  1.00 23.71 ? 221 TYR C N     1 
ATOM   8340  C CA    . TYR C 1 224 ? -3.337  7.285   98.453  1.00 23.75 ? 221 TYR C CA    1 
ATOM   8341  C C     . TYR C 1 224 ? -4.050  7.778   97.188  1.00 23.55 ? 221 TYR C C     1 
ATOM   8342  O O     . TYR C 1 224 ? -3.912  7.211   96.103  1.00 23.21 ? 221 TYR C O     1 
ATOM   8343  C CB    . TYR C 1 224 ? -2.668  5.918   98.203  1.00 21.70 ? 221 TYR C CB    1 
ATOM   8344  C CG    . TYR C 1 224 ? -1.457  6.003   97.302  1.00 23.36 ? 221 TYR C CG    1 
ATOM   8345  C CD1   . TYR C 1 224 ? -0.283  6.638   97.723  1.00 20.40 ? 221 TYR C CD1   1 
ATOM   8346  C CD2   . TYR C 1 224 ? -1.502  5.498   96.003  1.00 24.64 ? 221 TYR C CD2   1 
ATOM   8347  C CE1   . TYR C 1 224 ? 0.805   6.771   96.868  1.00 22.31 ? 221 TYR C CE1   1 
ATOM   8348  C CE2   . TYR C 1 224 ? -0.423  5.627   95.140  1.00 24.14 ? 221 TYR C CE2   1 
ATOM   8349  C CZ    . TYR C 1 224 ? 0.726   6.264   95.574  1.00 23.86 ? 221 TYR C CZ    1 
ATOM   8350  O OH    . TYR C 1 224 ? 1.779   6.399   94.701  1.00 24.83 ? 221 TYR C OH    1 
ATOM   8351  N N     . GLY C 1 225 ? -4.829  8.840   97.344  1.00 24.64 ? 222 GLY C N     1 
ATOM   8352  C CA    . GLY C 1 225 ? -5.539  9.406   96.214  1.00 25.69 ? 222 GLY C CA    1 
ATOM   8353  C C     . GLY C 1 225 ? -4.603  10.332  95.475  1.00 26.39 ? 222 GLY C C     1 
ATOM   8354  O O     . GLY C 1 225 ? -3.400  10.088  95.428  1.00 28.22 ? 222 GLY C O     1 
ATOM   8355  N N     . ASP C 1 226 ? -5.140  11.398  94.901  1.00 25.89 ? 223 ASP C N     1 
ATOM   8356  C CA    . ASP C 1 226 ? -4.306  12.335  94.173  1.00 24.90 ? 223 ASP C CA    1 
ATOM   8357  C C     . ASP C 1 226 ? -3.426  13.164  95.114  1.00 24.83 ? 223 ASP C C     1 
ATOM   8358  O O     . ASP C 1 226 ? -2.276  13.460  94.794  1.00 25.06 ? 223 ASP C O     1 
ATOM   8359  C CB    . ASP C 1 226 ? -5.185  13.208  93.276  1.00 24.31 ? 223 ASP C CB    1 
ATOM   8360  C CG    . ASP C 1 226 ? -5.698  12.441  92.057  1.00 23.45 ? 223 ASP C CG    1 
ATOM   8361  O OD1   . ASP C 1 226 ? -4.860  11.872  91.329  1.00 23.67 ? 223 ASP C OD1   1 
ATOM   8362  O OD2   . ASP C 1 226 ? -6.925  12.404  91.824  1.00 22.72 ? 223 ASP C OD2   1 
ATOM   8363  N N     . VAL C 1 227 ? -3.952  13.504  96.286  1.00 24.21 ? 224 VAL C N     1 
ATOM   8364  C CA    . VAL C 1 227 ? -3.199  14.273  97.269  1.00 23.83 ? 224 VAL C CA    1 
ATOM   8365  C C     . VAL C 1 227 ? -2.183  13.395  97.985  1.00 23.29 ? 224 VAL C C     1 
ATOM   8366  O O     . VAL C 1 227 ? -1.076  13.832  98.303  1.00 23.07 ? 224 VAL C O     1 
ATOM   8367  C CB    . VAL C 1 227 ? -4.113  14.866  98.326  1.00 26.33 ? 224 VAL C CB    1 
ATOM   8368  C CG1   . VAL C 1 227 ? -3.279  15.562  99.394  1.00 28.00 ? 224 VAL C CG1   1 
ATOM   8369  C CG2   . VAL C 1 227 ? -5.080  15.838  97.675  1.00 25.05 ? 224 VAL C CG2   1 
ATOM   8370  N N     . GLY C 1 228 ? -2.578  12.161  98.267  1.00 22.80 ? 225 GLY C N     1 
ATOM   8371  C CA    . GLY C 1 228 ? -1.675  11.250  98.929  1.00 22.27 ? 225 GLY C CA    1 
ATOM   8372  C C     . GLY C 1 228 ? -0.536  10.906  97.991  1.00 23.07 ? 225 GLY C C     1 
ATOM   8373  O O     . GLY C 1 228 ? 0.622   10.836  98.411  1.00 24.96 ? 225 GLY C O     1 
ATOM   8374  N N     . LYS C 1 229 ? -0.858  10.697  96.715  1.00 21.58 ? 226 LYS C N     1 
ATOM   8375  C CA    . LYS C 1 229 ? 0.154   10.357  95.715  1.00 21.12 ? 226 LYS C CA    1 
ATOM   8376  C C     . LYS C 1 229 ? 1.266   11.401  95.678  1.00 20.36 ? 226 LYS C C     1 
ATOM   8377  O O     . LYS C 1 229 ? 2.450   11.067  95.627  1.00 19.20 ? 226 LYS C O     1 
ATOM   8378  C CB    . LYS C 1 229 ? -0.480  10.234  94.320  1.00 20.03 ? 226 LYS C CB    1 
ATOM   8379  C CG    . LYS C 1 229 ? -1.302  8.962   94.104  1.00 18.47 ? 226 LYS C CG    1 
ATOM   8380  C CD    . LYS C 1 229 ? -1.845  8.896   92.684  1.00 17.80 ? 226 LYS C CD    1 
ATOM   8381  C CE    . LYS C 1 229 ? -2.482  7.543   92.356  1.00 15.33 ? 226 LYS C CE    1 
ATOM   8382  N NZ    . LYS C 1 229 ? -3.601  7.157   93.268  1.00 19.65 ? 226 LYS C NZ    1 
ATOM   8383  N N     . GLY C 1 230 ? 0.871   12.667  95.701  1.00 20.29 ? 227 GLY C N     1 
ATOM   8384  C CA    . GLY C 1 230 ? 1.839   13.743  95.682  1.00 21.46 ? 227 GLY C CA    1 
ATOM   8385  C C     . GLY C 1 230 ? 2.592   13.858  96.995  1.00 23.64 ? 227 GLY C C     1 
ATOM   8386  O O     . GLY C 1 230 ? 3.794   14.141  96.993  1.00 22.61 ? 227 GLY C O     1 
ATOM   8387  N N     . CYS C 1 231 ? 1.899   13.640  98.113  1.00 22.90 ? 228 CYS C N     1 
ATOM   8388  C CA    . CYS C 1 231 ? 2.543   13.733  99.415  1.00 25.41 ? 228 CYS C CA    1 
ATOM   8389  C C     . CYS C 1 231 ? 3.579   12.642  99.634  1.00 25.89 ? 228 CYS C C     1 
ATOM   8390  O O     . CYS C 1 231 ? 4.663   12.895  100.170 1.00 27.54 ? 228 CYS C O     1 
ATOM   8391  C CB    . CYS C 1 231 ? 1.511   13.670  100.530 1.00 25.40 ? 228 CYS C CB    1 
ATOM   8392  S SG    . CYS C 1 231 ? 0.510   15.145  100.658 1.00 26.90 ? 228 CYS C SG    1 
ATOM   8393  N N     . ALA C 1 232 ? 3.238   11.430  99.216  1.00 25.68 ? 229 ALA C N     1 
ATOM   8394  C CA    . ALA C 1 232 ? 4.122   10.291  99.368  1.00 25.25 ? 229 ALA C CA    1 
ATOM   8395  C C     . ALA C 1 232 ? 5.431   10.506  98.629  1.00 25.53 ? 229 ALA C C     1 
ATOM   8396  O O     . ALA C 1 232 ? 6.509   10.251  99.160  1.00 25.00 ? 229 ALA C O     1 
ATOM   8397  C CB    . ALA C 1 232 ? 3.445   9.043   98.851  1.00 25.70 ? 229 ALA C CB    1 
ATOM   8398  N N     . GLN C 1 233 ? 5.322   10.988  97.397  1.00 25.30 ? 230 GLN C N     1 
ATOM   8399  C CA    . GLN C 1 233 ? 6.486   11.217  96.558  1.00 24.98 ? 230 GLN C CA    1 
ATOM   8400  C C     . GLN C 1 233 ? 7.367   12.320  97.140  1.00 23.57 ? 230 GLN C C     1 
ATOM   8401  O O     . GLN C 1 233 ? 8.597   12.185  97.200  1.00 21.92 ? 230 GLN C O     1 
ATOM   8402  C CB    . GLN C 1 233 ? 6.027   11.550  95.145  1.00 27.04 ? 230 GLN C CB    1 
ATOM   8403  C CG    . GLN C 1 233 ? 7.138   11.694  94.131  1.00 33.78 ? 230 GLN C CG    1 
ATOM   8404  C CD    . GLN C 1 233 ? 6.610   11.695  92.697  1.00 38.13 ? 230 GLN C CD    1 
ATOM   8405  O OE1   . GLN C 1 233 ? 5.699   12.469  92.339  1.00 36.44 ? 230 GLN C OE1   1 
ATOM   8406  N NE2   . GLN C 1 233 ? 7.180   10.815  91.866  1.00 40.16 ? 230 GLN C NE2   1 
ATOM   8407  N N     . ALA C 1 234 ? 6.741   13.407  97.577  1.00 22.42 ? 231 ALA C N     1 
ATOM   8408  C CA    . ALA C 1 234 ? 7.485   14.500  98.167  1.00 21.66 ? 231 ALA C CA    1 
ATOM   8409  C C     . ALA C 1 234 ? 8.332   13.913  99.302  1.00 22.04 ? 231 ALA C C     1 
ATOM   8410  O O     . ALA C 1 234 ? 9.558   14.022  99.293  1.00 21.27 ? 231 ALA C O     1 
ATOM   8411  C CB    . ALA C 1 234 ? 6.543   15.544  98.706  1.00 19.49 ? 231 ALA C CB    1 
ATOM   8412  N N     . LEU C 1 235 ? 7.678   13.265  100.262 1.00 21.72 ? 232 LEU C N     1 
ATOM   8413  C CA    . LEU C 1 235 ? 8.393   12.667  101.383 1.00 22.14 ? 232 LEU C CA    1 
ATOM   8414  C C     . LEU C 1 235 ? 9.505   11.728  100.911 1.00 23.46 ? 232 LEU C C     1 
ATOM   8415  O O     . LEU C 1 235 ? 10.659  11.867  101.324 1.00 23.09 ? 232 LEU C O     1 
ATOM   8416  C CB    . LEU C 1 235 ? 7.408   11.935  102.292 1.00 21.51 ? 232 LEU C CB    1 
ATOM   8417  C CG    . LEU C 1 235 ? 6.428   12.870  103.021 1.00 18.31 ? 232 LEU C CG    1 
ATOM   8418  C CD1   . LEU C 1 235 ? 5.219   12.082  103.519 1.00 14.69 ? 232 LEU C CD1   1 
ATOM   8419  C CD2   . LEU C 1 235 ? 7.150   13.579  104.169 1.00 16.62 ? 232 LEU C CD2   1 
ATOM   8420  N N     . ARG C 1 236 ? 9.155   10.802  100.019 1.00 27.22 ? 233 ARG C N     1 
ATOM   8421  C CA    . ARG C 1 236 ? 10.089  9.822   99.453  1.00 29.13 ? 233 ARG C CA    1 
ATOM   8422  C C     . ARG C 1 236 ? 11.328  10.452  98.813  1.00 29.98 ? 233 ARG C C     1 
ATOM   8423  O O     . ARG C 1 236 ? 12.456  9.965   99.010  1.00 30.81 ? 233 ARG C O     1 
ATOM   8424  C CB    . ARG C 1 236 ? 9.378   8.952   98.409  1.00 31.67 ? 233 ARG C CB    1 
ATOM   8425  C CG    . ARG C 1 236 ? 10.295  7.943   97.725  1.00 36.90 ? 233 ARG C CG    1 
ATOM   8426  C CD    . ARG C 1 236 ? 9.561   7.049   96.741  1.00 42.65 ? 233 ARG C CD    1 
ATOM   8427  N NE    . ARG C 1 236 ? 8.857   7.820   95.722  1.00 48.62 ? 233 ARG C NE    1 
ATOM   8428  C CZ    . ARG C 1 236 ? 8.250   7.287   94.665  1.00 53.20 ? 233 ARG C CZ    1 
ATOM   8429  N NH1   . ARG C 1 236 ? 8.262   5.971   94.482  1.00 54.26 ? 233 ARG C NH1   1 
ATOM   8430  N NH2   . ARG C 1 236 ? 7.622   8.073   93.790  1.00 54.65 ? 233 ARG C NH2   1 
ATOM   8431  N N     . GLY C 1 237 ? 11.110  11.522  98.048  1.00 28.03 ? 234 GLY C N     1 
ATOM   8432  C CA    . GLY C 1 237 ? 12.195  12.215  97.383  1.00 26.35 ? 234 GLY C CA    1 
ATOM   8433  C C     . GLY C 1 237 ? 13.220  12.775  98.349  1.00 27.78 ? 234 GLY C C     1 
ATOM   8434  O O     . GLY C 1 237 ? 14.398  12.924  98.015  1.00 27.10 ? 234 GLY C O     1 
ATOM   8435  N N     . PHE C 1 238 ? 12.786  13.091  99.561  1.00 28.61 ? 235 PHE C N     1 
ATOM   8436  C CA    . PHE C 1 238 ? 13.717  13.620  100.535 1.00 29.72 ? 235 PHE C CA    1 
ATOM   8437  C C     . PHE C 1 238 ? 14.432  12.549  101.356 1.00 29.07 ? 235 PHE C C     1 
ATOM   8438  O O     . PHE C 1 238 ? 15.157  12.869  102.288 1.00 29.72 ? 235 PHE C O     1 
ATOM   8439  C CB    . PHE C 1 238 ? 13.015  14.609  101.441 1.00 31.12 ? 235 PHE C CB    1 
ATOM   8440  C CG    . PHE C 1 238 ? 12.815  15.942  100.811 1.00 33.01 ? 235 PHE C CG    1 
ATOM   8441  C CD1   . PHE C 1 238 ? 13.899  16.762  100.540 1.00 34.31 ? 235 PHE C CD1   1 
ATOM   8442  C CD2   . PHE C 1 238 ? 11.540  16.392  100.503 1.00 36.32 ? 235 PHE C CD2   1 
ATOM   8443  C CE1   . PHE C 1 238 ? 13.723  18.015  99.976  1.00 35.25 ? 235 PHE C CE1   1 
ATOM   8444  C CE2   . PHE C 1 238 ? 11.346  17.642  99.940  1.00 36.73 ? 235 PHE C CE2   1 
ATOM   8445  C CZ    . PHE C 1 238 ? 12.442  18.460  99.677  1.00 37.55 ? 235 PHE C CZ    1 
ATOM   8446  N N     . GLY C 1 239 ? 14.227  11.281  101.015 1.00 27.94 ? 236 GLY C N     1 
ATOM   8447  C CA    . GLY C 1 239 ? 14.909  10.224  101.733 1.00 27.24 ? 236 GLY C CA    1 
ATOM   8448  C C     . GLY C 1 239 ? 14.167  9.609   102.894 1.00 27.91 ? 236 GLY C C     1 
ATOM   8449  O O     . GLY C 1 239 ? 14.771  8.957   103.753 1.00 28.91 ? 236 GLY C O     1 
ATOM   8450  N N     . ALA C 1 240 ? 12.856  9.808   102.931 1.00 27.85 ? 237 ALA C N     1 
ATOM   8451  C CA    . ALA C 1 240 ? 12.052  9.245   104.005 1.00 26.75 ? 237 ALA C CA    1 
ATOM   8452  C C     . ALA C 1 240 ? 11.348  7.995   103.520 1.00 26.19 ? 237 ALA C C     1 
ATOM   8453  O O     . ALA C 1 240 ? 10.922  7.933   102.362 1.00 26.95 ? 237 ALA C O     1 
ATOM   8454  C CB    . ALA C 1 240 ? 11.035  10.252  104.472 1.00 25.49 ? 237 ALA C CB    1 
ATOM   8455  N N     . ARG C 1 241 ? 11.245  7.000   104.407 1.00 26.19 ? 238 ARG C N     1 
ATOM   8456  C CA    . ARG C 1 241 ? 10.555  5.737   104.112 1.00 25.31 ? 238 ARG C CA    1 
ATOM   8457  C C     . ARG C 1 241 ? 9.076   5.971   104.368 1.00 26.38 ? 238 ARG C C     1 
ATOM   8458  O O     . ARG C 1 241 ? 8.649   6.195   105.510 1.00 27.82 ? 238 ARG C O     1 
ATOM   8459  C CB    . ARG C 1 241 ? 11.059  4.590   104.997 1.00 25.06 ? 238 ARG C CB    1 
ATOM   8460  C CG    . ARG C 1 241 ? 10.309  3.265   104.777 1.00 24.88 ? 238 ARG C CG    1 
ATOM   8461  C CD    . ARG C 1 241 ? 11.217  2.050   104.965 1.00 21.47 ? 238 ARG C CD    1 
ATOM   8462  N NE    . ARG C 1 241 ? 11.743  1.998   106.319 1.00 22.29 ? 238 ARG C NE    1 
ATOM   8463  C CZ    . ARG C 1 241 ? 11.101  1.472   107.355 1.00 22.87 ? 238 ARG C CZ    1 
ATOM   8464  N NH1   . ARG C 1 241 ? 9.898   0.930   107.192 1.00 22.67 ? 238 ARG C NH1   1 
ATOM   8465  N NH2   . ARG C 1 241 ? 11.656  1.523   108.560 1.00 22.72 ? 238 ARG C NH2   1 
ATOM   8466  N N     . VAL C 1 242 ? 8.300   5.913   103.293 1.00 24.32 ? 239 VAL C N     1 
ATOM   8467  C CA    . VAL C 1 242 ? 6.876   6.158   103.354 1.00 21.78 ? 239 VAL C CA    1 
ATOM   8468  C C     . VAL C 1 242 ? 6.026   4.900   103.430 1.00 21.14 ? 239 VAL C C     1 
ATOM   8469  O O     . VAL C 1 242 ? 6.269   3.934   102.707 1.00 20.98 ? 239 VAL C O     1 
ATOM   8470  C CB    . VAL C 1 242 ? 6.446   6.963   102.117 1.00 21.26 ? 239 VAL C CB    1 
ATOM   8471  C CG1   . VAL C 1 242 ? 4.992   7.349   102.213 1.00 20.06 ? 239 VAL C CG1   1 
ATOM   8472  C CG2   . VAL C 1 242 ? 7.325   8.181   101.987 1.00 20.57 ? 239 VAL C CG2   1 
ATOM   8473  N N     . ILE C 1 243 ? 5.022   4.930   104.303 1.00 19.69 ? 240 ILE C N     1 
ATOM   8474  C CA    . ILE C 1 243 ? 4.086   3.822   104.464 1.00 19.98 ? 240 ILE C CA    1 
ATOM   8475  C C     . ILE C 1 243 ? 2.675   4.385   104.210 1.00 21.96 ? 240 ILE C C     1 
ATOM   8476  O O     . ILE C 1 243 ? 2.337   5.466   104.694 1.00 22.48 ? 240 ILE C O     1 
ATOM   8477  C CB    . ILE C 1 243 ? 4.172   3.220   105.874 1.00 19.71 ? 240 ILE C CB    1 
ATOM   8478  C CG1   . ILE C 1 243 ? 5.553   2.594   106.078 1.00 17.92 ? 240 ILE C CG1   1 
ATOM   8479  C CG2   . ILE C 1 243 ? 3.090   2.148   106.045 1.00 19.87 ? 240 ILE C CG2   1 
ATOM   8480  C CD1   . ILE C 1 243 ? 5.861   2.255   107.507 1.00 20.80 ? 240 ILE C CD1   1 
ATOM   8481  N N     . ILE C 1 244 ? 1.864   3.656   103.447 1.00 21.75 ? 241 ILE C N     1 
ATOM   8482  C CA    . ILE C 1 244 ? 0.518   4.108   103.091 1.00 22.89 ? 241 ILE C CA    1 
ATOM   8483  C C     . ILE C 1 244 ? -0.633  3.259   103.617 1.00 24.73 ? 241 ILE C C     1 
ATOM   8484  O O     . ILE C 1 244 ? -0.542  2.038   103.702 1.00 26.83 ? 241 ILE C O     1 
ATOM   8485  C CB    . ILE C 1 244 ? 0.365   4.189   101.536 1.00 21.41 ? 241 ILE C CB    1 
ATOM   8486  C CG1   . ILE C 1 244 ? 1.062   5.447   101.008 1.00 19.13 ? 241 ILE C CG1   1 
ATOM   8487  C CG2   . ILE C 1 244 ? -1.109  4.169   101.136 1.00 20.78 ? 241 ILE C CG2   1 
ATOM   8488  C CD1   . ILE C 1 244 ? 2.563   5.363   101.018 1.00 13.19 ? 241 ILE C CD1   1 
ATOM   8489  N N     . THR C 1 245 ? -1.730  3.913   103.960 1.00 24.86 ? 242 THR C N     1 
ATOM   8490  C CA    . THR C 1 245 ? -2.895  3.200   104.436 1.00 25.96 ? 242 THR C CA    1 
ATOM   8491  C C     . THR C 1 245 ? -3.952  3.466   103.383 1.00 26.62 ? 242 THR C C     1 
ATOM   8492  O O     . THR C 1 245 ? -3.934  4.509   102.736 1.00 27.31 ? 242 THR C O     1 
ATOM   8493  C CB    . THR C 1 245 ? -3.357  3.744   105.779 1.00 26.98 ? 242 THR C CB    1 
ATOM   8494  O OG1   . THR C 1 245 ? -3.866  5.071   105.596 1.00 28.36 ? 242 THR C OG1   1 
ATOM   8495  C CG2   . THR C 1 245 ? -2.179  3.783   106.756 1.00 25.50 ? 242 THR C CG2   1 
ATOM   8496  N N     . GLU C 1 246 ? -4.865  2.530   103.184 1.00 28.38 ? 243 GLU C N     1 
ATOM   8497  C CA    . GLU C 1 246 ? -5.890  2.729   102.170 1.00 28.42 ? 243 GLU C CA    1 
ATOM   8498  C C     . GLU C 1 246 ? -7.024  1.746   102.352 1.00 30.28 ? 243 GLU C C     1 
ATOM   8499  O O     . GLU C 1 246 ? -6.858  0.684   102.961 1.00 29.28 ? 243 GLU C O     1 
ATOM   8500  C CB    . GLU C 1 246 ? -5.288  2.552   100.769 1.00 27.63 ? 243 GLU C CB    1 
ATOM   8501  C CG    . GLU C 1 246 ? -5.085  3.844   99.972  1.00 25.65 ? 243 GLU C CG    1 
ATOM   8502  C CD    . GLU C 1 246 ? -6.390  4.432   99.441  1.00 25.90 ? 243 GLU C CD    1 
ATOM   8503  O OE1   . GLU C 1 246 ? -7.472  3.831   99.663  1.00 22.01 ? 243 GLU C OE1   1 
ATOM   8504  O OE2   . GLU C 1 246 ? -6.324  5.505   98.797  1.00 24.57 ? 243 GLU C OE2   1 
ATOM   8505  N N     . ILE C 1 247 ? -8.182  2.118   101.819 1.00 31.70 ? 244 ILE C N     1 
ATOM   8506  C CA    . ILE C 1 247 ? -9.371  1.278   101.885 1.00 30.86 ? 244 ILE C CA    1 
ATOM   8507  C C     . ILE C 1 247 ? -9.720  0.800   100.481 1.00 29.87 ? 244 ILE C C     1 
ATOM   8508  O O     . ILE C 1 247 ? -10.399 -0.209  100.317 1.00 32.21 ? 244 ILE C O     1 
ATOM   8509  C CB    . ILE C 1 247 ? -10.585 2.051   102.458 1.00 32.43 ? 244 ILE C CB    1 
ATOM   8510  C CG1   . ILE C 1 247 ? -10.901 3.266   101.582 1.00 31.56 ? 244 ILE C CG1   1 
ATOM   8511  C CG2   . ILE C 1 247 ? -10.308 2.486   103.890 1.00 30.62 ? 244 ILE C CG2   1 
ATOM   8512  C CD1   . ILE C 1 247 ? -12.199 3.950   101.944 1.00 32.20 ? 244 ILE C CD1   1 
ATOM   8513  N N     . ASP C 1 248 ? -9.258  1.532   99.468  1.00 28.47 ? 245 ASP C N     1 
ATOM   8514  C CA    . ASP C 1 248 ? -9.533  1.181   98.079  1.00 26.98 ? 245 ASP C CA    1 
ATOM   8515  C C     . ASP C 1 248 ? -8.466  0.189   97.624  1.00 27.79 ? 245 ASP C C     1 
ATOM   8516  O O     . ASP C 1 248 ? -7.261  0.439   97.733  1.00 27.70 ? 245 ASP C O     1 
ATOM   8517  C CB    . ASP C 1 248 ? -9.525  2.445   97.188  1.00 26.11 ? 245 ASP C CB    1 
ATOM   8518  C CG    . ASP C 1 248 ? -10.123 2.203   95.791  1.00 26.84 ? 245 ASP C CG    1 
ATOM   8519  O OD1   . ASP C 1 248 ? -9.632  1.325   95.053  1.00 27.09 ? 245 ASP C OD1   1 
ATOM   8520  O OD2   . ASP C 1 248 ? -11.091 2.903   95.418  1.00 31.56 ? 245 ASP C OD2   1 
ATOM   8521  N N     . PRO C 1 249 ? -8.902  -0.975  97.137  1.00 27.73 ? 246 PRO C N     1 
ATOM   8522  C CA    . PRO C 1 249 ? -7.956  -1.992  96.672  1.00 27.62 ? 246 PRO C CA    1 
ATOM   8523  C C     . PRO C 1 249 ? -7.078  -1.469  95.528  1.00 27.63 ? 246 PRO C C     1 
ATOM   8524  O O     . PRO C 1 249 ? -5.861  -1.706  95.499  1.00 28.27 ? 246 PRO C O     1 
ATOM   8525  C CB    . PRO C 1 249 ? -8.864  -3.136  96.223  1.00 27.78 ? 246 PRO C CB    1 
ATOM   8526  C CG    . PRO C 1 249 ? -10.111 -2.953  97.064  1.00 27.98 ? 246 PRO C CG    1 
ATOM   8527  C CD    . PRO C 1 249 ? -10.292 -1.464  97.120  1.00 25.96 ? 246 PRO C CD    1 
ATOM   8528  N N     . ILE C 1 250 ? -7.685  -0.755  94.586  1.00 25.38 ? 247 ILE C N     1 
ATOM   8529  C CA    . ILE C 1 250 ? -6.923  -0.243  93.458  1.00 25.21 ? 247 ILE C CA    1 
ATOM   8530  C C     . ILE C 1 250 ? -5.835  0.724   93.942  1.00 28.00 ? 247 ILE C C     1 
ATOM   8531  O O     . ILE C 1 250 ? -4.635  0.493   93.746  1.00 28.30 ? 247 ILE C O     1 
ATOM   8532  C CB    . ILE C 1 250 ? -7.847  0.447   92.446  1.00 21.77 ? 247 ILE C CB    1 
ATOM   8533  C CG1   . ILE C 1 250 ? -8.881  -0.569  91.936  1.00 22.69 ? 247 ILE C CG1   1 
ATOM   8534  C CG2   . ILE C 1 250 ? -7.027  1.025   91.316  1.00 20.24 ? 247 ILE C CG2   1 
ATOM   8535  C CD1   . ILE C 1 250 ? -10.115 0.020   91.241  1.00 19.24 ? 247 ILE C CD1   1 
ATOM   8536  N N     . ASN C 1 251 ? -6.261  1.803   94.581  1.00 27.30 ? 248 ASN C N     1 
ATOM   8537  C CA    . ASN C 1 251 ? -5.343  2.788   95.110  1.00 27.09 ? 248 ASN C CA    1 
ATOM   8538  C C     . ASN C 1 251 ? -4.215  2.086   95.856  1.00 26.62 ? 248 ASN C C     1 
ATOM   8539  O O     . ASN C 1 251 ? -3.039  2.397   95.644  1.00 27.75 ? 248 ASN C O     1 
ATOM   8540  C CB    . ASN C 1 251 ? -6.106  3.738   96.028  1.00 28.81 ? 248 ASN C CB    1 
ATOM   8541  C CG    . ASN C 1 251 ? -6.855  4.808   95.256  1.00 30.90 ? 248 ASN C CG    1 
ATOM   8542  O OD1   . ASN C 1 251 ? -6.323  5.902   95.026  1.00 34.10 ? 248 ASN C OD1   1 
ATOM   8543  N ND2   . ASN C 1 251 ? -8.080  4.497   94.830  1.00 28.42 ? 248 ASN C ND2   1 
ATOM   8544  N N     . ALA C 1 252 ? -4.573  1.117   96.698  1.00 25.02 ? 249 ALA C N     1 
ATOM   8545  C CA    . ALA C 1 252 ? -3.584  0.366   97.472  1.00 23.91 ? 249 ALA C CA    1 
ATOM   8546  C C     . ALA C 1 252 ? -2.637  -0.429  96.569  1.00 22.91 ? 249 ALA C C     1 
ATOM   8547  O O     . ALA C 1 252 ? -1.430  -0.489  96.816  1.00 20.06 ? 249 ALA C O     1 
ATOM   8548  C CB    . ALA C 1 252 ? -4.278  -0.566  98.457  1.00 25.09 ? 249 ALA C CB    1 
ATOM   8549  N N     . LEU C 1 253 ? -3.176  -1.034  95.518  1.00 22.39 ? 250 LEU C N     1 
ATOM   8550  C CA    . LEU C 1 253 ? -2.330  -1.785  94.599  1.00 23.73 ? 250 LEU C CA    1 
ATOM   8551  C C     . LEU C 1 253 ? -1.388  -0.819  93.858  1.00 24.60 ? 250 LEU C C     1 
ATOM   8552  O O     . LEU C 1 253 ? -0.319  -1.218  93.398  1.00 27.67 ? 250 LEU C O     1 
ATOM   8553  C CB    . LEU C 1 253 ? -3.193  -2.557  93.599  1.00 24.88 ? 250 LEU C CB    1 
ATOM   8554  C CG    . LEU C 1 253 ? -2.447  -3.511  92.665  1.00 24.86 ? 250 LEU C CG    1 
ATOM   8555  C CD1   . LEU C 1 253 ? -1.732  -4.579  93.484  1.00 24.39 ? 250 LEU C CD1   1 
ATOM   8556  C CD2   . LEU C 1 253 ? -3.434  -4.143  91.699  1.00 24.11 ? 250 LEU C CD2   1 
ATOM   8557  N N     . GLN C 1 254 ? -1.783  0.447   93.754  1.00 22.31 ? 251 GLN C N     1 
ATOM   8558  C CA    . GLN C 1 254 ? -0.974  1.461   93.090  1.00 21.70 ? 251 GLN C CA    1 
ATOM   8559  C C     . GLN C 1 254 ? 0.261   1.824   93.932  1.00 20.94 ? 251 GLN C C     1 
ATOM   8560  O O     . GLN C 1 254 ? 1.366   1.916   93.415  1.00 19.45 ? 251 GLN C O     1 
ATOM   8561  C CB    . GLN C 1 254 ? -1.795  2.744   92.856  1.00 22.29 ? 251 GLN C CB    1 
ATOM   8562  C CG    . GLN C 1 254 ? -2.549  2.833   91.537  1.00 20.43 ? 251 GLN C CG    1 
ATOM   8563  C CD    . GLN C 1 254 ? -3.401  4.091   91.459  1.00 21.13 ? 251 GLN C CD    1 
ATOM   8564  O OE1   . GLN C 1 254 ? -3.578  4.675   90.396  1.00 19.96 ? 251 GLN C OE1   1 
ATOM   8565  N NE2   . GLN C 1 254 ? -3.940  4.505   92.595  1.00 20.88 ? 251 GLN C NE2   1 
ATOM   8566  N N     . ALA C 1 255 ? 0.047   2.046   95.225  1.00 20.61 ? 252 ALA C N     1 
ATOM   8567  C CA    . ALA C 1 255 ? 1.123   2.401   96.132  1.00 21.28 ? 252 ALA C CA    1 
ATOM   8568  C C     . ALA C 1 255 ? 2.129   1.255   96.280  1.00 21.52 ? 252 ALA C C     1 
ATOM   8569  O O     . ALA C 1 255 ? 3.332   1.495   96.413  1.00 20.52 ? 252 ALA C O     1 
ATOM   8570  C CB    . ALA C 1 255 ? 0.542   2.804   97.511  1.00 18.25 ? 252 ALA C CB    1 
ATOM   8571  N N     . ALA C 1 256 ? 1.638   0.019   96.251  1.00 20.90 ? 253 ALA C N     1 
ATOM   8572  C CA    . ALA C 1 256 ? 2.526   -1.124  96.367  1.00 23.22 ? 253 ALA C CA    1 
ATOM   8573  C C     . ALA C 1 256 ? 3.419   -1.203  95.125  1.00 25.62 ? 253 ALA C C     1 
ATOM   8574  O O     . ALA C 1 256 ? 4.633   -1.397  95.232  1.00 25.33 ? 253 ALA C O     1 
ATOM   8575  C CB    . ALA C 1 256 ? 1.720   -2.413  96.523  1.00 24.83 ? 253 ALA C CB    1 
ATOM   8576  N N     . MET C 1 257 ? 2.821   -1.045  93.947  1.00 27.93 ? 254 MET C N     1 
ATOM   8577  C CA    . MET C 1 257 ? 3.581   -1.100  92.703  1.00 29.11 ? 254 MET C CA    1 
ATOM   8578  C C     . MET C 1 257 ? 4.607   0.020   92.636  1.00 28.88 ? 254 MET C C     1 
ATOM   8579  O O     . MET C 1 257 ? 5.487   0.013   91.777  1.00 28.98 ? 254 MET C O     1 
ATOM   8580  C CB    . MET C 1 257 ? 2.647   -0.989  91.495  1.00 31.56 ? 254 MET C CB    1 
ATOM   8581  C CG    . MET C 1 257 ? 1.639   -2.095  91.401  1.00 35.53 ? 254 MET C CG    1 
ATOM   8582  S SD    . MET C 1 257 ? 2.444   -3.692  91.367  1.00 41.48 ? 254 MET C SD    1 
ATOM   8583  C CE    . MET C 1 257 ? 2.892   -3.765  89.658  1.00 39.90 ? 254 MET C CE    1 
ATOM   8584  N N     . GLU C 1 258 ? 4.488   0.994   93.531  1.00 27.33 ? 255 GLU C N     1 
ATOM   8585  C CA    . GLU C 1 258 ? 5.427   2.102   93.532  1.00 28.36 ? 255 GLU C CA    1 
ATOM   8586  C C     . GLU C 1 258 ? 6.501   1.960   94.609  1.00 29.16 ? 255 GLU C C     1 
ATOM   8587  O O     . GLU C 1 258 ? 7.239   2.904   94.879  1.00 28.61 ? 255 GLU C O     1 
ATOM   8588  C CB    . GLU C 1 258 ? 4.678   3.426   93.691  1.00 29.44 ? 255 GLU C CB    1 
ATOM   8589  C CG    . GLU C 1 258 ? 3.712   3.742   92.546  1.00 32.13 ? 255 GLU C CG    1 
ATOM   8590  C CD    . GLU C 1 258 ? 4.410   4.170   91.260  1.00 33.85 ? 255 GLU C CD    1 
ATOM   8591  O OE1   . GLU C 1 258 ? 5.600   3.835   91.080  1.00 35.06 ? 255 GLU C OE1   1 
ATOM   8592  O OE2   . GLU C 1 258 ? 3.758   4.834   90.421  1.00 35.68 ? 255 GLU C OE2   1 
ATOM   8593  N N     . GLY C 1 259 ? 6.581   0.781   95.224  1.00 30.13 ? 256 GLY C N     1 
ATOM   8594  C CA    . GLY C 1 259 ? 7.581   0.535   96.250  1.00 28.98 ? 256 GLY C CA    1 
ATOM   8595  C C     . GLY C 1 259 ? 7.197   1.014   97.638  1.00 29.22 ? 256 GLY C C     1 
ATOM   8596  O O     . GLY C 1 259 ? 8.051   1.171   98.515  1.00 28.76 ? 256 GLY C O     1 
ATOM   8597  N N     . TYR C 1 260 ? 5.907   1.242   97.852  1.00 29.04 ? 257 TYR C N     1 
ATOM   8598  C CA    . TYR C 1 260 ? 5.433   1.698   99.155  1.00 28.75 ? 257 TYR C CA    1 
ATOM   8599  C C     . TYR C 1 260 ? 4.870   0.519   99.941  1.00 27.50 ? 257 TYR C C     1 
ATOM   8600  O O     . TYR C 1 260 ? 4.297   -0.412  99.369  1.00 26.13 ? 257 TYR C O     1 
ATOM   8601  C CB    . TYR C 1 260 ? 4.322   2.748   99.000  1.00 28.48 ? 257 TYR C CB    1 
ATOM   8602  C CG    . TYR C 1 260 ? 4.760   4.075   98.418  1.00 29.32 ? 257 TYR C CG    1 
ATOM   8603  C CD1   . TYR C 1 260 ? 5.650   4.906   99.101  1.00 29.01 ? 257 TYR C CD1   1 
ATOM   8604  C CD2   . TYR C 1 260 ? 4.254   4.516   97.193  1.00 28.29 ? 257 TYR C CD2   1 
ATOM   8605  C CE1   . TYR C 1 260 ? 6.021   6.145   98.578  1.00 29.26 ? 257 TYR C CE1   1 
ATOM   8606  C CE2   . TYR C 1 260 ? 4.619   5.745   96.667  1.00 29.16 ? 257 TYR C CE2   1 
ATOM   8607  C CZ    . TYR C 1 260 ? 5.499   6.554   97.359  1.00 29.32 ? 257 TYR C CZ    1 
ATOM   8608  O OH    . TYR C 1 260 ? 5.855   7.764   96.824  1.00 31.17 ? 257 TYR C OH    1 
ATOM   8609  N N     . GLU C 1 261 ? 5.052   0.556   101.254 1.00 27.60 ? 258 GLU C N     1 
ATOM   8610  C CA    . GLU C 1 261 ? 4.500   -0.487  102.091 1.00 27.48 ? 258 GLU C CA    1 
ATOM   8611  C C     . GLU C 1 261 ? 3.106   0.019   102.433 1.00 30.38 ? 258 GLU C C     1 
ATOM   8612  O O     . GLU C 1 261 ? 2.932   1.206   102.721 1.00 32.04 ? 258 GLU C O     1 
ATOM   8613  C CB    . GLU C 1 261 ? 5.297   -0.656  103.366 1.00 25.07 ? 258 GLU C CB    1 
ATOM   8614  C CG    . GLU C 1 261 ? 4.637   -1.634  104.312 1.00 22.93 ? 258 GLU C CG    1 
ATOM   8615  C CD    . GLU C 1 261 ? 5.423   -1.850  105.590 1.00 21.91 ? 258 GLU C CD    1 
ATOM   8616  O OE1   . GLU C 1 261 ? 6.580   -1.378  105.669 1.00 15.79 ? 258 GLU C OE1   1 
ATOM   8617  O OE2   . GLU C 1 261 ? 4.868   -2.498  106.515 1.00 22.36 ? 258 GLU C OE2   1 
ATOM   8618  N N     . VAL C 1 262 ? 2.119   -0.870  102.391 1.00 31.36 ? 259 VAL C N     1 
ATOM   8619  C CA    . VAL C 1 262 ? 0.751   -0.495  102.699 1.00 31.00 ? 259 VAL C CA    1 
ATOM   8620  C C     . VAL C 1 262 ? 0.191   -1.319  103.857 1.00 32.65 ? 259 VAL C C     1 
ATOM   8621  O O     . VAL C 1 262 ? 0.142   -2.547  103.776 1.00 35.90 ? 259 VAL C O     1 
ATOM   8622  C CB    . VAL C 1 262 ? -0.186  -0.700  101.474 1.00 30.75 ? 259 VAL C CB    1 
ATOM   8623  C CG1   . VAL C 1 262 ? -1.596  -0.251  101.821 1.00 29.56 ? 259 VAL C CG1   1 
ATOM   8624  C CG2   . VAL C 1 262 ? 0.332   0.071   100.262 1.00 29.68 ? 259 VAL C CG2   1 
ATOM   8625  N N     . THR C 1 263 ? -0.210  -0.654  104.939 1.00 31.10 ? 260 THR C N     1 
ATOM   8626  C CA    . THR C 1 263 ? -0.826  -1.336  106.070 1.00 31.36 ? 260 THR C CA    1 
ATOM   8627  C C     . THR C 1 263 ? -1.834  -0.421  106.716 1.00 32.63 ? 260 THR C C     1 
ATOM   8628  O O     . THR C 1 263 ? -2.126  0.661   106.203 1.00 32.91 ? 260 THR C O     1 
ATOM   8629  C CB    . THR C 1 263 ? 0.163   -1.776  107.165 1.00 29.63 ? 260 THR C CB    1 
ATOM   8630  O OG1   . THR C 1 263 ? 1.088   -0.721  107.441 1.00 32.38 ? 260 THR C OG1   1 
ATOM   8631  C CG2   . THR C 1 263 ? 0.881   -3.017  106.753 1.00 32.63 ? 260 THR C CG2   1 
ATOM   8632  N N     . THR C 1 264 ? -2.368  -0.873  107.845 1.00 32.15 ? 261 THR C N     1 
ATOM   8633  C CA    . THR C 1 264 ? -3.359  -0.125  108.592 1.00 29.82 ? 261 THR C CA    1 
ATOM   8634  C C     . THR C 1 264 ? -2.696  0.902   109.499 1.00 29.55 ? 261 THR C C     1 
ATOM   8635  O O     . THR C 1 264 ? -1.500  0.829   109.771 1.00 27.24 ? 261 THR C O     1 
ATOM   8636  C CB    . THR C 1 264 ? -4.200  -1.074  109.448 1.00 31.87 ? 261 THR C CB    1 
ATOM   8637  O OG1   . THR C 1 264 ? -3.350  -1.732  110.401 1.00 32.59 ? 261 THR C OG1   1 
ATOM   8638  C CG2   . THR C 1 264 ? -4.866  -2.127  108.567 1.00 31.60 ? 261 THR C CG2   1 
ATOM   8639  N N     . MET C 1 265 ? -3.488  1.853   109.976 1.00 31.67 ? 262 MET C N     1 
ATOM   8640  C CA    . MET C 1 265 ? -2.986  2.893   110.860 1.00 32.63 ? 262 MET C CA    1 
ATOM   8641  C C     . MET C 1 265 ? -2.593  2.267   112.190 1.00 34.24 ? 262 MET C C     1 
ATOM   8642  O O     . MET C 1 265 ? -1.612  2.680   112.811 1.00 33.87 ? 262 MET C O     1 
ATOM   8643  C CB    . MET C 1 265 ? -4.056  3.971   111.069 1.00 32.36 ? 262 MET C CB    1 
ATOM   8644  C CG    . MET C 1 265 ? -3.616  5.175   111.915 1.00 31.34 ? 262 MET C CG    1 
ATOM   8645  S SD    . MET C 1 265 ? -2.333  6.255   111.197 1.00 33.56 ? 262 MET C SD    1 
ATOM   8646  C CE    . MET C 1 265 ? -0.855  5.575   111.904 1.00 32.80 ? 262 MET C CE    1 
ATOM   8647  N N     . ASP C 1 266 ? -3.355  1.258   112.609 1.00 37.26 ? 263 ASP C N     1 
ATOM   8648  C CA    . ASP C 1 266 ? -3.103  0.560   113.869 1.00 40.16 ? 263 ASP C CA    1 
ATOM   8649  C C     . ASP C 1 266 ? -1.681  0.050   114.006 1.00 42.24 ? 263 ASP C C     1 
ATOM   8650  O O     . ASP C 1 266 ? -1.145  -0.030  115.119 1.00 42.53 ? 263 ASP C O     1 
ATOM   8651  C CB    . ASP C 1 266 ? -4.053  -0.622  114.032 1.00 38.08 ? 263 ASP C CB    1 
ATOM   8652  C CG    . ASP C 1 266 ? -5.485  -0.192  114.194 1.00 39.25 ? 263 ASP C CG    1 
ATOM   8653  O OD1   . ASP C 1 266 ? -5.716  0.844   114.848 1.00 38.43 ? 263 ASP C OD1   1 
ATOM   8654  O OD2   . ASP C 1 266 ? -6.381  -0.898  113.680 1.00 41.44 ? 263 ASP C OD2   1 
ATOM   8655  N N     . GLU C 1 267 ? -1.076  -0.298  112.875 1.00 43.40 ? 264 GLU C N     1 
ATOM   8656  C CA    . GLU C 1 267 ? 0.283   -0.808  112.887 1.00 44.69 ? 264 GLU C CA    1 
ATOM   8657  C C     . GLU C 1 267 ? 1.289   0.271   112.548 1.00 42.84 ? 264 GLU C C     1 
ATOM   8658  O O     . GLU C 1 267 ? 2.395   0.287   113.091 1.00 43.12 ? 264 GLU C O     1 
ATOM   8659  C CB    . GLU C 1 267 ? 0.428   -1.957  111.894 1.00 48.64 ? 264 GLU C CB    1 
ATOM   8660  C CG    . GLU C 1 267 ? -0.681  -2.982  111.980 1.00 54.54 ? 264 GLU C CG    1 
ATOM   8661  C CD    . GLU C 1 267 ? -0.330  -4.277  111.267 1.00 59.48 ? 264 GLU C CD    1 
ATOM   8662  O OE1   . GLU C 1 267 ? 0.289   -4.218  110.171 1.00 61.90 ? 264 GLU C OE1   1 
ATOM   8663  O OE2   . GLU C 1 267 ? -0.676  -5.353  111.804 1.00 61.16 ? 264 GLU C OE2   1 
ATOM   8664  N N     . ALA C 1 268 ? 0.913   1.174   111.651 1.00 41.55 ? 265 ALA C N     1 
ATOM   8665  C CA    . ALA C 1 268 ? 1.829   2.231   111.255 1.00 41.33 ? 265 ALA C CA    1 
ATOM   8666  C C     . ALA C 1 268 ? 2.054   3.255   112.366 1.00 40.64 ? 265 ALA C C     1 
ATOM   8667  O O     . ALA C 1 268 ? 3.099   3.895   112.427 1.00 39.58 ? 265 ALA C O     1 
ATOM   8668  C CB    . ALA C 1 268 ? 1.320   2.921   109.991 1.00 41.52 ? 265 ALA C CB    1 
ATOM   8669  N N     . CYS C 1 269 ? 1.078   3.408   113.253 1.00 41.54 ? 266 CYS C N     1 
ATOM   8670  C CA    . CYS C 1 269 ? 1.215   4.373   114.340 1.00 42.50 ? 266 CYS C CA    1 
ATOM   8671  C C     . CYS C 1 269 ? 2.386   4.078   115.265 1.00 42.54 ? 266 CYS C C     1 
ATOM   8672  O O     . CYS C 1 269 ? 2.843   4.963   115.992 1.00 42.62 ? 266 CYS C O     1 
ATOM   8673  C CB    . CYS C 1 269 ? -0.076  4.452   115.148 1.00 43.20 ? 266 CYS C CB    1 
ATOM   8674  S SG    . CYS C 1 269 ? -0.709  2.860   115.699 1.00 47.70 ? 266 CYS C SG    1 
ATOM   8675  N N     . GLN C 1 270 ? 2.885   2.845   115.224 1.00 41.89 ? 267 GLN C N     1 
ATOM   8676  C CA    . GLN C 1 270 ? 4.007   2.462   116.075 1.00 42.37 ? 267 GLN C CA    1 
ATOM   8677  C C     . GLN C 1 270 ? 5.339   2.712   115.384 1.00 42.48 ? 267 GLN C C     1 
ATOM   8678  O O     . GLN C 1 270 ? 6.397   2.636   116.021 1.00 42.46 ? 267 GLN C O     1 
ATOM   8679  C CB    . GLN C 1 270 ? 3.920   0.985   116.442 1.00 43.46 ? 267 GLN C CB    1 
ATOM   8680  C CG    . GLN C 1 270 ? 2.510   0.457   116.517 1.00 47.24 ? 267 GLN C CG    1 
ATOM   8681  C CD    . GLN C 1 270 ? 2.467   -1.034  116.741 1.00 48.60 ? 267 GLN C CD    1 
ATOM   8682  O OE1   . GLN C 1 270 ? 1.447   -1.679  116.490 1.00 50.68 ? 267 GLN C OE1   1 
ATOM   8683  N NE2   . GLN C 1 270 ? 3.575   -1.596  117.224 1.00 49.58 ? 267 GLN C NE2   1 
ATOM   8684  N N     . GLU C 1 271 ? 5.287   3.003   114.085 1.00 41.37 ? 268 GLU C N     1 
ATOM   8685  C CA    . GLU C 1 271 ? 6.500   3.244   113.304 1.00 41.00 ? 268 GLU C CA    1 
ATOM   8686  C C     . GLU C 1 271 ? 6.712   4.697   112.907 1.00 40.25 ? 268 GLU C C     1 
ATOM   8687  O O     . GLU C 1 271 ? 7.837   5.210   112.947 1.00 39.88 ? 268 GLU C O     1 
ATOM   8688  C CB    . GLU C 1 271 ? 6.496   2.374   112.043 1.00 40.76 ? 268 GLU C CB    1 
ATOM   8689  C CG    . GLU C 1 271 ? 6.896   0.931   112.297 1.00 42.36 ? 268 GLU C CG    1 
ATOM   8690  C CD    . GLU C 1 271 ? 6.643   0.009   111.108 1.00 43.05 ? 268 GLU C CD    1 
ATOM   8691  O OE1   . GLU C 1 271 ? 5.458   -0.272  110.804 1.00 42.53 ? 268 GLU C OE1   1 
ATOM   8692  O OE2   . GLU C 1 271 ? 7.629   -0.434  110.482 1.00 43.36 ? 268 GLU C OE2   1 
ATOM   8693  N N     . GLY C 1 272 ? 5.623   5.356   112.534 1.00 38.66 ? 269 GLY C N     1 
ATOM   8694  C CA    . GLY C 1 272 ? 5.700   6.735   112.096 1.00 38.64 ? 269 GLY C CA    1 
ATOM   8695  C C     . GLY C 1 272 ? 6.422   7.765   112.948 1.00 38.13 ? 269 GLY C C     1 
ATOM   8696  O O     . GLY C 1 272 ? 6.333   7.764   114.175 1.00 39.19 ? 269 GLY C O     1 
ATOM   8697  N N     . ASN C 1 273 ? 7.145   8.651   112.263 1.00 37.57 ? 270 ASN C N     1 
ATOM   8698  C CA    . ASN C 1 273 ? 7.882   9.752   112.876 1.00 34.52 ? 270 ASN C CA    1 
ATOM   8699  C C     . ASN C 1 273 ? 7.235   11.011  112.318 1.00 34.18 ? 270 ASN C C     1 
ATOM   8700  O O     . ASN C 1 273 ? 7.457   12.118  112.803 1.00 36.13 ? 270 ASN C O     1 
ATOM   8701  C CB    . ASN C 1 273 ? 9.348   9.715   112.466 1.00 34.12 ? 270 ASN C CB    1 
ATOM   8702  C CG    . ASN C 1 273 ? 10.072  8.493   112.993 1.00 35.95 ? 270 ASN C CG    1 
ATOM   8703  O OD1   . ASN C 1 273 ? 10.251  8.333   114.202 1.00 34.08 ? 270 ASN C OD1   1 
ATOM   8704  N ND2   . ASN C 1 273 ? 10.496  7.619   112.082 1.00 35.77 ? 270 ASN C ND2   1 
ATOM   8705  N N     . ILE C 1 274 ? 6.434   10.818  111.278 1.00 31.57 ? 271 ILE C N     1 
ATOM   8706  C CA    . ILE C 1 274 ? 5.719   11.899  110.617 1.00 29.54 ? 271 ILE C CA    1 
ATOM   8707  C C     . ILE C 1 274 ? 4.420   11.305  110.099 1.00 29.97 ? 271 ILE C C     1 
ATOM   8708  O O     . ILE C 1 274 ? 4.433   10.252  109.460 1.00 31.14 ? 271 ILE C O     1 
ATOM   8709  C CB    . ILE C 1 274 ? 6.494   12.443  109.403 1.00 27.80 ? 271 ILE C CB    1 
ATOM   8710  C CG1   . ILE C 1 274 ? 7.805   13.087  109.855 1.00 26.49 ? 271 ILE C CG1   1 
ATOM   8711  C CG2   . ILE C 1 274 ? 5.636   13.433  108.645 1.00 24.41 ? 271 ILE C CG2   1 
ATOM   8712  C CD1   . ILE C 1 274 ? 8.627   13.632  108.702 1.00 26.64 ? 271 ILE C CD1   1 
ATOM   8713  N N     . PHE C 1 275 ? 3.303   11.966  110.369 1.00 28.60 ? 272 PHE C N     1 
ATOM   8714  C CA    . PHE C 1 275 ? 2.021   11.471  109.909 1.00 28.62 ? 272 PHE C CA    1 
ATOM   8715  C C     . PHE C 1 275 ? 1.311   12.538  109.111 1.00 29.23 ? 272 PHE C C     1 
ATOM   8716  O O     . PHE C 1 275 ? 1.270   13.698  109.516 1.00 29.84 ? 272 PHE C O     1 
ATOM   8717  C CB    . PHE C 1 275 ? 1.131   11.086  111.086 1.00 31.77 ? 272 PHE C CB    1 
ATOM   8718  C CG    . PHE C 1 275 ? 1.632   9.919   111.864 1.00 32.71 ? 272 PHE C CG    1 
ATOM   8719  C CD1   . PHE C 1 275 ? 2.647   10.071  112.799 1.00 32.93 ? 272 PHE C CD1   1 
ATOM   8720  C CD2   . PHE C 1 275 ? 1.109   8.652   111.639 1.00 33.90 ? 272 PHE C CD2   1 
ATOM   8721  C CE1   . PHE C 1 275 ? 3.144   8.976   113.498 1.00 33.31 ? 272 PHE C CE1   1 
ATOM   8722  C CE2   . PHE C 1 275 ? 1.599   7.547   112.334 1.00 33.57 ? 272 PHE C CE2   1 
ATOM   8723  C CZ    . PHE C 1 275 ? 2.617   7.711   113.265 1.00 33.63 ? 272 PHE C CZ    1 
ATOM   8724  N N     . VAL C 1 276 ? 0.736   12.138  107.982 1.00 29.56 ? 273 VAL C N     1 
ATOM   8725  C CA    . VAL C 1 276 ? -0.005  13.059  107.132 1.00 28.04 ? 273 VAL C CA    1 
ATOM   8726  C C     . VAL C 1 276 ? -1.290  12.388  106.645 1.00 28.39 ? 273 VAL C C     1 
ATOM   8727  O O     . VAL C 1 276 ? -1.253  11.338  106.013 1.00 27.41 ? 273 VAL C O     1 
ATOM   8728  C CB    . VAL C 1 276 ? 0.831   13.499  105.919 1.00 27.11 ? 273 VAL C CB    1 
ATOM   8729  C CG1   . VAL C 1 276 ? 0.101   14.592  105.164 1.00 25.43 ? 273 VAL C CG1   1 
ATOM   8730  C CG2   . VAL C 1 276 ? 2.196   13.974  106.372 1.00 26.17 ? 273 VAL C CG2   1 
ATOM   8731  N N     . THR C 1 277 ? -2.424  13.003  106.950 1.00 29.32 ? 274 THR C N     1 
ATOM   8732  C CA    . THR C 1 277 ? -3.721  12.470  106.555 1.00 30.79 ? 274 THR C CA    1 
ATOM   8733  C C     . THR C 1 277 ? -4.223  13.166  105.291 1.00 32.04 ? 274 THR C C     1 
ATOM   8734  O O     . THR C 1 277 ? -4.381  14.389  105.282 1.00 31.73 ? 274 THR C O     1 
ATOM   8735  C CB    . THR C 1 277 ? -4.743  12.697  107.675 1.00 32.41 ? 274 THR C CB    1 
ATOM   8736  O OG1   . THR C 1 277 ? -4.814  14.098  107.966 1.00 32.29 ? 274 THR C OG1   1 
ATOM   8737  C CG2   . THR C 1 277 ? -4.321  11.956  108.936 1.00 31.10 ? 274 THR C CG2   1 
ATOM   8738  N N     . THR C 1 278 ? -4.477  12.387  104.236 1.00 32.72 ? 275 THR C N     1 
ATOM   8739  C CA    . THR C 1 278 ? -4.955  12.917  102.947 1.00 33.29 ? 275 THR C CA    1 
ATOM   8740  C C     . THR C 1 278 ? -6.331  12.351  102.615 1.00 35.99 ? 275 THR C C     1 
ATOM   8741  O O     . THR C 1 278 ? -6.699  12.199  101.443 1.00 36.37 ? 275 THR C O     1 
ATOM   8742  C CB    . THR C 1 278 ? -4.032  12.516  101.789 1.00 31.94 ? 275 THR C CB    1 
ATOM   8743  O OG1   . THR C 1 278 ? -4.227  11.129  101.492 1.00 29.64 ? 275 THR C OG1   1 
ATOM   8744  C CG2   . THR C 1 278 ? -2.578  12.752  102.150 1.00 32.52 ? 275 THR C CG2   1 
ATOM   8745  N N     . THR C 1 279 ? -7.091  12.040  103.654 1.00 38.18 ? 276 THR C N     1 
ATOM   8746  C CA    . THR C 1 279 ? -8.416  11.468  103.484 1.00 39.93 ? 276 THR C CA    1 
ATOM   8747  C C     . THR C 1 279 ? -9.534  12.477  103.707 1.00 41.72 ? 276 THR C C     1 
ATOM   8748  O O     . THR C 1 279 ? -9.440  13.349  104.573 1.00 42.29 ? 276 THR C O     1 
ATOM   8749  C CB    . THR C 1 279 ? -8.621  10.332  104.475 1.00 39.66 ? 276 THR C CB    1 
ATOM   8750  O OG1   . THR C 1 279 ? -7.658  9.300   104.233 1.00 37.90 ? 276 THR C OG1   1 
ATOM   8751  C CG2   . THR C 1 279 ? -10.001 9.777   104.340 1.00 41.66 ? 276 THR C CG2   1 
ATOM   8752  N N     . GLY C 1 280 ? -10.597 12.376  102.925 1.00 41.97 ? 277 GLY C N     1 
ATOM   8753  C CA    . GLY C 1 280 ? -11.694 13.300  103.137 1.00 42.79 ? 277 GLY C CA    1 
ATOM   8754  C C     . GLY C 1 280 ? -12.648 12.675  104.132 1.00 42.82 ? 277 GLY C C     1 
ATOM   8755  O O     . GLY C 1 280 ? -13.821 13.039  104.194 1.00 44.63 ? 277 GLY C O     1 
ATOM   8756  N N     . CYS C 1 281 ? -12.129 11.727  104.907 1.00 41.52 ? 278 CYS C N     1 
ATOM   8757  C CA    . CYS C 1 281 ? -12.912 10.991  105.885 1.00 40.88 ? 278 CYS C CA    1 
ATOM   8758  C C     . CYS C 1 281 ? -12.472 11.243  107.320 1.00 40.49 ? 278 CYS C C     1 
ATOM   8759  O O     . CYS C 1 281 ? -11.321 11.585  107.577 1.00 39.83 ? 278 CYS C O     1 
ATOM   8760  C CB    . CYS C 1 281 ? -12.839 9.492   105.553 1.00 41.85 ? 278 CYS C CB    1 
ATOM   8761  S SG    . CYS C 1 281 ? -13.021 8.350   106.930 1.00 44.74 ? 278 CYS C SG    1 
ATOM   8762  N N     . ILE C 1 282 ? -13.414 11.073  108.245 1.00 40.98 ? 279 ILE C N     1 
ATOM   8763  C CA    . ILE C 1 282 ? -13.186 11.274  109.676 1.00 41.08 ? 279 ILE C CA    1 
ATOM   8764  C C     . ILE C 1 282 ? -12.478 10.109  110.346 1.00 39.37 ? 279 ILE C C     1 
ATOM   8765  O O     . ILE C 1 282 ? -12.307 9.044   109.759 1.00 37.30 ? 279 ILE C O     1 
ATOM   8766  C CB    . ILE C 1 282 ? -14.522 11.487  110.453 1.00 42.81 ? 279 ILE C CB    1 
ATOM   8767  C CG1   . ILE C 1 282 ? -15.456 10.296  110.229 1.00 43.49 ? 279 ILE C CG1   1 
ATOM   8768  C CG2   . ILE C 1 282 ? -15.228 12.763  109.985 1.00 44.59 ? 279 ILE C CG2   1 
ATOM   8769  C CD1   . ILE C 1 282 ? -16.775 10.424  110.948 1.00 46.86 ? 279 ILE C CD1   1 
ATOM   8770  N N     . ASP C 1 283 ? -12.082 10.342  111.593 1.00 39.50 ? 280 ASP C N     1 
ATOM   8771  C CA    . ASP C 1 283 ? -11.410 9.353   112.427 1.00 39.98 ? 280 ASP C CA    1 
ATOM   8772  C C     . ASP C 1 283 ? -10.256 8.614   111.763 1.00 39.22 ? 280 ASP C C     1 
ATOM   8773  O O     . ASP C 1 283 ? -10.384 7.446   111.402 1.00 40.37 ? 280 ASP C O     1 
ATOM   8774  C CB    . ASP C 1 283 ? -12.431 8.338   112.944 1.00 41.13 ? 280 ASP C CB    1 
ATOM   8775  C CG    . ASP C 1 283 ? -13.445 8.959   113.896 1.00 43.84 ? 280 ASP C CG    1 
ATOM   8776  O OD1   . ASP C 1 283 ? -13.033 9.488   114.955 1.00 42.53 ? 280 ASP C OD1   1 
ATOM   8777  O OD2   . ASP C 1 283 ? -14.657 8.912   113.586 1.00 46.09 ? 280 ASP C OD2   1 
ATOM   8778  N N     . ILE C 1 284 ? -9.121  9.286   111.614 1.00 37.16 ? 281 ILE C N     1 
ATOM   8779  C CA    . ILE C 1 284 ? -7.960  8.654   111.004 1.00 35.17 ? 281 ILE C CA    1 
ATOM   8780  C C     . ILE C 1 284 ? -6.891  8.401   112.063 1.00 34.49 ? 281 ILE C C     1 
ATOM   8781  O O     . ILE C 1 284 ? -6.369  7.294   112.187 1.00 32.50 ? 281 ILE C O     1 
ATOM   8782  C CB    . ILE C 1 284 ? -7.376  9.529   109.890 1.00 34.52 ? 281 ILE C CB    1 
ATOM   8783  C CG1   . ILE C 1 284 ? -8.439  9.773   108.816 1.00 32.64 ? 281 ILE C CG1   1 
ATOM   8784  C CG2   . ILE C 1 284 ? -6.149  8.860   109.298 1.00 34.32 ? 281 ILE C CG2   1 
ATOM   8785  C CD1   . ILE C 1 284 ? -8.992  8.513   108.190 1.00 31.44 ? 281 ILE C CD1   1 
ATOM   8786  N N     . ILE C 1 285 ? -6.576  9.445   112.820 1.00 34.47 ? 282 ILE C N     1 
ATOM   8787  C CA    . ILE C 1 285 ? -5.593  9.362   113.892 1.00 35.51 ? 282 ILE C CA    1 
ATOM   8788  C C     . ILE C 1 285 ? -6.364  9.515   115.189 1.00 36.04 ? 282 ILE C C     1 
ATOM   8789  O O     . ILE C 1 285 ? -6.990  10.558  115.402 1.00 38.48 ? 282 ILE C O     1 
ATOM   8790  C CB    . ILE C 1 285 ? -4.587  10.511  113.836 1.00 35.25 ? 282 ILE C CB    1 
ATOM   8791  C CG1   . ILE C 1 285 ? -3.941  10.578  112.455 1.00 35.01 ? 282 ILE C CG1   1 
ATOM   8792  C CG2   . ILE C 1 285 ? -3.531  10.320  114.911 1.00 34.23 ? 282 ILE C CG2   1 
ATOM   8793  C CD1   . ILE C 1 285 ? -3.020  9.436   112.176 1.00 35.59 ? 282 ILE C CD1   1 
ATOM   8794  N N     . LEU C 1 286 ? -6.324  8.493   116.042 1.00 35.26 ? 283 LEU C N     1 
ATOM   8795  C CA    . LEU C 1 286 ? -7.025  8.515   117.323 1.00 34.62 ? 283 LEU C CA    1 
ATOM   8796  C C     . LEU C 1 286 ? -6.072  8.333   118.505 1.00 35.52 ? 283 LEU C C     1 
ATOM   8797  O O     . LEU C 1 286 ? -4.874  8.100   118.322 1.00 35.51 ? 283 LEU C O     1 
ATOM   8798  C CB    . LEU C 1 286 ? -8.084  7.409   117.372 1.00 35.40 ? 283 LEU C CB    1 
ATOM   8799  C CG    . LEU C 1 286 ? -9.282  7.427   116.415 1.00 35.01 ? 283 LEU C CG    1 
ATOM   8800  C CD1   . LEU C 1 286 ? -9.933  8.786   116.455 1.00 34.22 ? 283 LEU C CD1   1 
ATOM   8801  C CD2   . LEU C 1 286 ? -8.834  7.110   115.002 1.00 37.29 ? 283 LEU C CD2   1 
ATOM   8802  N N     . GLY C 1 287 ? -6.612  8.432   119.718 1.00 35.26 ? 284 GLY C N     1 
ATOM   8803  C CA    . GLY C 1 287 ? -5.800  8.269   120.909 1.00 34.26 ? 284 GLY C CA    1 
ATOM   8804  C C     . GLY C 1 287 ? -5.055  6.947   120.905 1.00 34.62 ? 284 GLY C C     1 
ATOM   8805  O O     . GLY C 1 287 ? -3.915  6.864   121.373 1.00 34.23 ? 284 GLY C O     1 
ATOM   8806  N N     . ARG C 1 288 ? -5.710  5.918   120.372 1.00 34.58 ? 285 ARG C N     1 
ATOM   8807  C CA    . ARG C 1 288 ? -5.139  4.577   120.267 1.00 33.93 ? 285 ARG C CA    1 
ATOM   8808  C C     . ARG C 1 288 ? -3.803  4.656   119.546 1.00 34.00 ? 285 ARG C C     1 
ATOM   8809  O O     . ARG C 1 288 ? -2.842  3.961   119.886 1.00 32.81 ? 285 ARG C O     1 
ATOM   8810  C CB    . ARG C 1 288 ? -6.079  3.690   119.465 1.00 34.36 ? 285 ARG C CB    1 
ATOM   8811  C CG    . ARG C 1 288 ? -7.484  3.642   120.014 1.00 37.75 ? 285 ARG C CG    1 
ATOM   8812  C CD    . ARG C 1 288 ? -8.473  3.567   118.879 1.00 37.77 ? 285 ARG C CD    1 
ATOM   8813  N NE    . ARG C 1 288 ? -8.049  2.595   117.881 1.00 36.70 ? 285 ARG C NE    1 
ATOM   8814  C CZ    . ARG C 1 288 ? -8.622  2.464   116.694 1.00 36.50 ? 285 ARG C CZ    1 
ATOM   8815  N NH1   . ARG C 1 288 ? -9.639  3.240   116.360 1.00 37.16 ? 285 ARG C NH1   1 
ATOM   8816  N NH2   . ARG C 1 288 ? -8.175  1.566   115.840 1.00 36.26 ? 285 ARG C NH2   1 
ATOM   8817  N N     . HIS C 1 289 ? -3.776  5.514   118.534 1.00 34.32 ? 286 HIS C N     1 
ATOM   8818  C CA    . HIS C 1 289 ? -2.601  5.739   117.720 1.00 34.42 ? 286 HIS C CA    1 
ATOM   8819  C C     . HIS C 1 289 ? -1.611  6.661   118.446 1.00 35.61 ? 286 HIS C C     1 
ATOM   8820  O O     . HIS C 1 289 ? -0.430  6.336   118.569 1.00 36.82 ? 286 HIS C O     1 
ATOM   8821  C CB    . HIS C 1 289 ? -3.036  6.330   116.374 1.00 32.45 ? 286 HIS C CB    1 
ATOM   8822  C CG    . HIS C 1 289 ? -4.050  5.493   115.649 1.00 30.57 ? 286 HIS C CG    1 
ATOM   8823  N ND1   . HIS C 1 289 ? -5.239  6.005   115.179 1.00 30.13 ? 286 HIS C ND1   1 
ATOM   8824  C CD2   . HIS C 1 289 ? -4.044  4.184   115.299 1.00 30.15 ? 286 HIS C CD2   1 
ATOM   8825  C CE1   . HIS C 1 289 ? -5.920  5.050   114.570 1.00 29.10 ? 286 HIS C CE1   1 
ATOM   8826  N NE2   . HIS C 1 289 ? -5.217  3.934   114.628 1.00 27.42 ? 286 HIS C NE2   1 
ATOM   8827  N N     . PHE C 1 290 ? -2.087  7.799   118.942 1.00 36.90 ? 287 PHE C N     1 
ATOM   8828  C CA    . PHE C 1 290 ? -1.212  8.726   119.654 1.00 38.09 ? 287 PHE C CA    1 
ATOM   8829  C C     . PHE C 1 290 ? -0.444  8.051   120.811 1.00 40.28 ? 287 PHE C C     1 
ATOM   8830  O O     . PHE C 1 290 ? 0.719   8.377   121.071 1.00 40.32 ? 287 PHE C O     1 
ATOM   8831  C CB    . PHE C 1 290 ? -2.023  9.906   120.203 1.00 37.34 ? 287 PHE C CB    1 
ATOM   8832  C CG    . PHE C 1 290 ? -2.450  10.908  119.162 1.00 35.45 ? 287 PHE C CG    1 
ATOM   8833  C CD1   . PHE C 1 290 ? -1.503  11.594  118.412 1.00 34.75 ? 287 PHE C CD1   1 
ATOM   8834  C CD2   . PHE C 1 290 ? -3.798  11.210  118.979 1.00 34.75 ? 287 PHE C CD2   1 
ATOM   8835  C CE1   . PHE C 1 290 ? -1.891  12.576  117.495 1.00 35.59 ? 287 PHE C CE1   1 
ATOM   8836  C CE2   . PHE C 1 290 ? -4.201  12.187  118.066 1.00 33.17 ? 287 PHE C CE2   1 
ATOM   8837  C CZ    . PHE C 1 290 ? -3.245  12.874  117.322 1.00 34.56 ? 287 PHE C CZ    1 
ATOM   8838  N N     . GLU C 1 291 ? -1.088  7.119   121.509 1.00 40.90 ? 288 GLU C N     1 
ATOM   8839  C CA    . GLU C 1 291 ? -0.433  6.437   122.620 1.00 41.92 ? 288 GLU C CA    1 
ATOM   8840  C C     . GLU C 1 291 ? 0.673   5.490   122.172 1.00 41.11 ? 288 GLU C C     1 
ATOM   8841  O O     . GLU C 1 291 ? 1.621   5.238   122.926 1.00 39.96 ? 288 GLU C O     1 
ATOM   8842  C CB    . GLU C 1 291 ? -1.464  5.679   123.457 1.00 44.98 ? 288 GLU C CB    1 
ATOM   8843  C CG    . GLU C 1 291 ? -2.294  6.590   124.354 1.00 49.24 ? 288 GLU C CG    1 
ATOM   8844  C CD    . GLU C 1 291 ? -3.531  5.904   124.913 1.00 51.82 ? 288 GLU C CD    1 
ATOM   8845  O OE1   . GLU C 1 291 ? -4.439  5.567   124.116 1.00 51.63 ? 288 GLU C OE1   1 
ATOM   8846  O OE2   . GLU C 1 291 ? -3.591  5.700   126.147 1.00 52.67 ? 288 GLU C OE2   1 
ATOM   8847  N N     . GLN C 1 292 ? 0.560   4.979   120.945 1.00 40.17 ? 289 GLN C N     1 
ATOM   8848  C CA    . GLN C 1 292 ? 1.561   4.062   120.403 1.00 38.82 ? 289 GLN C CA    1 
ATOM   8849  C C     . GLN C 1 292 ? 2.692   4.796   119.688 1.00 39.10 ? 289 GLN C C     1 
ATOM   8850  O O     . GLN C 1 292 ? 3.818   4.312   119.641 1.00 41.12 ? 289 GLN C O     1 
ATOM   8851  C CB    . GLN C 1 292 ? 0.910   3.066   119.441 1.00 38.06 ? 289 GLN C CB    1 
ATOM   8852  C CG    . GLN C 1 292 ? -0.250  2.292   120.052 1.00 38.53 ? 289 GLN C CG    1 
ATOM   8853  C CD    . GLN C 1 292 ? -0.795  1.177   119.150 1.00 38.70 ? 289 GLN C CD    1 
ATOM   8854  O OE1   . GLN C 1 292 ? -0.071  0.245   118.794 1.00 40.25 ? 289 GLN C OE1   1 
ATOM   8855  N NE2   . GLN C 1 292 ? -2.076  1.268   118.788 1.00 33.62 ? 289 GLN C NE2   1 
ATOM   8856  N N     . MET C 1 293 ? 2.406   5.974   119.146 1.00 37.92 ? 290 MET C N     1 
ATOM   8857  C CA    . MET C 1 293 ? 3.424   6.738   118.422 1.00 37.60 ? 290 MET C CA    1 
ATOM   8858  C C     . MET C 1 293 ? 4.764   6.888   119.133 1.00 37.65 ? 290 MET C C     1 
ATOM   8859  O O     . MET C 1 293 ? 4.895   6.566   120.319 1.00 38.29 ? 290 MET C O     1 
ATOM   8860  C CB    . MET C 1 293 ? 2.881   8.114   118.046 1.00 34.62 ? 290 MET C CB    1 
ATOM   8861  C CG    . MET C 1 293 ? 1.891   8.051   116.903 1.00 33.59 ? 290 MET C CG    1 
ATOM   8862  S SD    . MET C 1 293 ? 1.238   9.654   116.479 1.00 35.56 ? 290 MET C SD    1 
ATOM   8863  C CE    . MET C 1 293 ? -0.344  9.203   115.787 1.00 30.80 ? 290 MET C CE    1 
ATOM   8864  N N     . LYS C 1 294 ? 5.757   7.379   118.394 1.00 37.40 ? 291 LYS C N     1 
ATOM   8865  C CA    . LYS C 1 294 ? 7.100   7.566   118.927 1.00 37.88 ? 291 LYS C CA    1 
ATOM   8866  C C     . LYS C 1 294 ? 7.304   8.982   119.450 1.00 38.75 ? 291 LYS C C     1 
ATOM   8867  O O     . LYS C 1 294 ? 6.609   9.917   119.037 1.00 40.23 ? 291 LYS C O     1 
ATOM   8868  C CB    . LYS C 1 294 ? 8.127   7.252   117.839 1.00 37.81 ? 291 LYS C CB    1 
ATOM   8869  C CG    . LYS C 1 294 ? 7.789   5.988   117.070 1.00 39.46 ? 291 LYS C CG    1 
ATOM   8870  C CD    . LYS C 1 294 ? 8.937   5.545   116.201 1.00 41.70 ? 291 LYS C CD    1 
ATOM   8871  C CE    . LYS C 1 294 ? 10.049  4.985   117.040 1.00 42.28 ? 291 LYS C CE    1 
ATOM   8872  N NZ    . LYS C 1 294 ? 9.553   3.803   117.802 1.00 46.05 ? 291 LYS C NZ    1 
ATOM   8873  N N     . ASP C 1 295 ? 8.264   9.141   120.353 1.00 36.82 ? 292 ASP C N     1 
ATOM   8874  C CA    . ASP C 1 295 ? 8.544   10.441  120.941 1.00 35.09 ? 292 ASP C CA    1 
ATOM   8875  C C     . ASP C 1 295 ? 8.813   11.531  119.907 1.00 34.40 ? 292 ASP C C     1 
ATOM   8876  O O     . ASP C 1 295 ? 9.699   11.401  119.078 1.00 32.74 ? 292 ASP C O     1 
ATOM   8877  C CB    . ASP C 1 295 ? 9.729   10.331  121.893 1.00 35.56 ? 292 ASP C CB    1 
ATOM   8878  C CG    . ASP C 1 295 ? 10.018  11.626  122.593 1.00 35.80 ? 292 ASP C CG    1 
ATOM   8879  O OD1   . ASP C 1 295 ? 9.043   12.288  123.000 1.00 38.02 ? 292 ASP C OD1   1 
ATOM   8880  O OD2   . ASP C 1 295 ? 11.204  11.979  122.744 1.00 35.51 ? 292 ASP C OD2   1 
ATOM   8881  N N     . ASP C 1 296 ? 8.047   12.616  119.989 1.00 35.19 ? 293 ASP C N     1 
ATOM   8882  C CA    . ASP C 1 296 ? 8.158   13.754  119.072 1.00 34.93 ? 293 ASP C CA    1 
ATOM   8883  C C     . ASP C 1 296 ? 7.762   13.420  117.634 1.00 35.17 ? 293 ASP C C     1 
ATOM   8884  O O     . ASP C 1 296 ? 8.376   13.897  116.676 1.00 35.33 ? 293 ASP C O     1 
ATOM   8885  C CB    . ASP C 1 296 ? 9.569   14.359  119.110 1.00 34.54 ? 293 ASP C CB    1 
ATOM   8886  C CG    . ASP C 1 296 ? 9.653   15.599  120.014 1.00 35.54 ? 293 ASP C CG    1 
ATOM   8887  O OD1   . ASP C 1 296 ? 8.581   16.159  120.335 1.00 34.79 ? 293 ASP C OD1   1 
ATOM   8888  O OD2   . ASP C 1 296 ? 10.783  16.023  120.382 1.00 32.93 ? 293 ASP C OD2   1 
ATOM   8889  N N     . ALA C 1 297 ? 6.725   12.597  117.496 1.00 35.19 ? 294 ALA C N     1 
ATOM   8890  C CA    . ALA C 1 297 ? 6.202   12.206  116.192 1.00 34.54 ? 294 ALA C CA    1 
ATOM   8891  C C     . ALA C 1 297 ? 5.375   13.376  115.677 1.00 35.10 ? 294 ALA C C     1 
ATOM   8892  O O     . ALA C 1 297 ? 4.489   13.869  116.382 1.00 35.97 ? 294 ALA C O     1 
ATOM   8893  C CB    . ALA C 1 297 ? 5.312   10.969  116.328 1.00 34.55 ? 294 ALA C CB    1 
ATOM   8894  N N     . ILE C 1 298 ? 5.653   13.820  114.455 1.00 33.35 ? 295 ILE C N     1 
ATOM   8895  C CA    . ILE C 1 298 ? 4.922   14.944  113.893 1.00 30.91 ? 295 ILE C CA    1 
ATOM   8896  C C     . ILE C 1 298 ? 3.599   14.511  113.265 1.00 31.09 ? 295 ILE C C     1 
ATOM   8897  O O     . ILE C 1 298 ? 3.559   13.609  112.432 1.00 30.11 ? 295 ILE C O     1 
ATOM   8898  C CB    . ILE C 1 298 ? 5.765   15.678  112.844 1.00 29.90 ? 295 ILE C CB    1 
ATOM   8899  C CG1   . ILE C 1 298 ? 7.106   16.102  113.453 1.00 29.25 ? 295 ILE C CG1   1 
ATOM   8900  C CG2   . ILE C 1 298 ? 5.007   16.886  112.340 1.00 29.31 ? 295 ILE C CG2   1 
ATOM   8901  C CD1   . ILE C 1 298 ? 8.062   16.738  112.458 1.00 26.87 ? 295 ILE C CD1   1 
ATOM   8902  N N     . VAL C 1 299 ? 2.516   15.173  113.659 1.00 30.88 ? 296 VAL C N     1 
ATOM   8903  C CA    . VAL C 1 299 ? 1.192   14.856  113.142 1.00 31.19 ? 296 VAL C CA    1 
ATOM   8904  C C     . VAL C 1 299 ? 0.557   16.080  112.485 1.00 30.87 ? 296 VAL C C     1 
ATOM   8905  O O     . VAL C 1 299 ? 0.588   17.180  113.034 1.00 29.86 ? 296 VAL C O     1 
ATOM   8906  C CB    . VAL C 1 299 ? 0.262   14.355  114.297 1.00 32.38 ? 296 VAL C CB    1 
ATOM   8907  C CG1   . VAL C 1 299 ? -1.141  14.079  113.775 1.00 31.31 ? 296 VAL C CG1   1 
ATOM   8908  C CG2   . VAL C 1 299 ? 0.856   13.090  114.927 1.00 32.34 ? 296 VAL C CG2   1 
ATOM   8909  N N     . CYS C 1 300 ? -0.003  15.886  111.298 1.00 30.87 ? 297 CYS C N     1 
ATOM   8910  C CA    . CYS C 1 300 ? -0.663  16.975  110.587 1.00 31.78 ? 297 CYS C CA    1 
ATOM   8911  C C     . CYS C 1 300 ? -1.644  16.412  109.562 1.00 30.95 ? 297 CYS C C     1 
ATOM   8912  O O     . CYS C 1 300 ? -1.597  15.233  109.227 1.00 30.58 ? 297 CYS C O     1 
ATOM   8913  C CB    . CYS C 1 300 ? 0.357   17.900  109.905 1.00 28.88 ? 297 CYS C CB    1 
ATOM   8914  S SG    . CYS C 1 300 ? 1.293   17.144  108.579 1.00 31.37 ? 297 CYS C SG    1 
ATOM   8915  N N     . ASN C 1 301 ? -2.543  17.269  109.096 1.00 31.33 ? 298 ASN C N     1 
ATOM   8916  C CA    . ASN C 1 301 ? -3.564  16.903  108.130 1.00 31.90 ? 298 ASN C CA    1 
ATOM   8917  C C     . ASN C 1 301 ? -3.498  17.911  106.985 1.00 32.52 ? 298 ASN C C     1 
ATOM   8918  O O     . ASN C 1 301 ? -3.195  19.088  107.201 1.00 33.33 ? 298 ASN C O     1 
ATOM   8919  C CB    . ASN C 1 301 ? -4.942  16.950  108.799 1.00 32.09 ? 298 ASN C CB    1 
ATOM   8920  C CG    . ASN C 1 301 ? -6.083  17.017  107.796 1.00 34.47 ? 298 ASN C CG    1 
ATOM   8921  O OD1   . ASN C 1 301 ? -6.331  16.074  107.044 1.00 32.02 ? 298 ASN C OD1   1 
ATOM   8922  N ND2   . ASN C 1 301 ? -6.777  18.156  107.773 1.00 36.29 ? 298 ASN C ND2   1 
ATOM   8923  N N     . ILE C 1 302 ? -3.788  17.449  105.772 1.00 30.73 ? 299 ILE C N     1 
ATOM   8924  C CA    . ILE C 1 302 ? -3.740  18.303  104.593 1.00 28.27 ? 299 ILE C CA    1 
ATOM   8925  C C     . ILE C 1 302 ? -5.079  18.246  103.845 1.00 28.75 ? 299 ILE C C     1 
ATOM   8926  O O     . ILE C 1 302 ? -5.232  18.840  102.780 1.00 28.06 ? 299 ILE C O     1 
ATOM   8927  C CB    . ILE C 1 302 ? -2.537  17.868  103.658 1.00 27.51 ? 299 ILE C CB    1 
ATOM   8928  C CG1   . ILE C 1 302 ? -2.206  18.978  102.657 1.00 27.22 ? 299 ILE C CG1   1 
ATOM   8929  C CG2   . ILE C 1 302 ? -2.867  16.583  102.905 1.00 24.72 ? 299 ILE C CG2   1 
ATOM   8930  C CD1   . ILE C 1 302 ? -0.891  18.751  101.901 1.00 23.97 ? 299 ILE C CD1   1 
ATOM   8931  N N     . GLY C 1 303 ? -6.049  17.538  104.424 1.00 28.88 ? 300 GLY C N     1 
ATOM   8932  C CA    . GLY C 1 303 ? -7.375  17.420  103.822 1.00 30.15 ? 300 GLY C CA    1 
ATOM   8933  C C     . GLY C 1 303 ? -8.156  18.708  104.024 1.00 31.93 ? 300 GLY C C     1 
ATOM   8934  O O     . GLY C 1 303 ? -7.786  19.520  104.875 1.00 31.01 ? 300 GLY C O     1 
ATOM   8935  N N     . HIS C 1 304 ? -9.239  18.916  103.284 1.00 32.79 ? 301 HIS C N     1 
ATOM   8936  C CA    . HIS C 1 304 ? -9.955  20.180  103.438 1.00 34.95 ? 301 HIS C CA    1 
ATOM   8937  C C     . HIS C 1 304 ? -10.396 20.534  104.854 1.00 36.28 ? 301 HIS C C     1 
ATOM   8938  O O     . HIS C 1 304 ? -10.002 21.568  105.389 1.00 37.92 ? 301 HIS C O     1 
ATOM   8939  C CB    . HIS C 1 304 ? -11.168 20.239  102.521 1.00 35.09 ? 301 HIS C CB    1 
ATOM   8940  C CG    . HIS C 1 304 ? -11.875 21.557  102.564 1.00 35.13 ? 301 HIS C CG    1 
ATOM   8941  N ND1   . HIS C 1 304 ? -11.291 22.732  102.136 1.00 33.04 ? 301 HIS C ND1   1 
ATOM   8942  C CD2   . HIS C 1 304 ? -13.117 21.888  102.987 1.00 34.99 ? 301 HIS C CD2   1 
ATOM   8943  C CE1   . HIS C 1 304 ? -12.144 23.727  102.288 1.00 33.13 ? 301 HIS C CE1   1 
ATOM   8944  N NE2   . HIS C 1 304 ? -13.260 23.243  102.802 1.00 36.37 ? 301 HIS C NE2   1 
ATOM   8945  N N     . PHE C 1 305 ? -11.229 19.684  105.444 1.00 37.92 ? 302 PHE C N     1 
ATOM   8946  C CA    . PHE C 1 305 ? -11.744 19.900  106.795 1.00 37.67 ? 302 PHE C CA    1 
ATOM   8947  C C     . PHE C 1 305 ? -10.861 19.229  107.831 1.00 38.52 ? 302 PHE C C     1 
ATOM   8948  O O     . PHE C 1 305 ? -10.252 18.198  107.546 1.00 39.84 ? 302 PHE C O     1 
ATOM   8949  C CB    . PHE C 1 305 ? -13.158 19.329  106.908 1.00 37.27 ? 302 PHE C CB    1 
ATOM   8950  C CG    . PHE C 1 305 ? -14.201 20.137  106.189 1.00 35.24 ? 302 PHE C CG    1 
ATOM   8951  C CD1   . PHE C 1 305 ? -14.434 21.460  106.548 1.00 34.58 ? 302 PHE C CD1   1 
ATOM   8952  C CD2   . PHE C 1 305 ? -14.987 19.563  105.196 1.00 32.43 ? 302 PHE C CD2   1 
ATOM   8953  C CE1   . PHE C 1 305 ? -15.436 22.199  105.932 1.00 33.01 ? 302 PHE C CE1   1 
ATOM   8954  C CE2   . PHE C 1 305 ? -15.988 20.293  104.577 1.00 32.43 ? 302 PHE C CE2   1 
ATOM   8955  C CZ    . PHE C 1 305 ? -16.215 21.614  104.947 1.00 31.82 ? 302 PHE C CZ    1 
ATOM   8956  N N     . ASP C 1 306 ? -10.801 19.806  109.029 1.00 38.14 ? 303 ASP C N     1 
ATOM   8957  C CA    . ASP C 1 306 ? -9.993  19.249  110.107 1.00 38.53 ? 303 ASP C CA    1 
ATOM   8958  C C     . ASP C 1 306 ? -10.739 18.138  110.835 1.00 38.47 ? 303 ASP C C     1 
ATOM   8959  O O     . ASP C 1 306 ? -10.949 18.196  112.045 1.00 39.37 ? 303 ASP C O     1 
ATOM   8960  C CB    . ASP C 1 306 ? -9.592  20.340  111.106 1.00 39.14 ? 303 ASP C CB    1 
ATOM   8961  C CG    . ASP C 1 306 ? -10.785 21.147  111.613 1.00 39.77 ? 303 ASP C CG    1 
ATOM   8962  O OD1   . ASP C 1 306 ? -10.827 21.439  112.834 1.00 37.48 ? 303 ASP C OD1   1 
ATOM   8963  O OD2   . ASP C 1 306 ? -11.668 21.498  110.789 1.00 39.32 ? 303 ASP C OD2   1 
ATOM   8964  N N     . VAL C 1 307 ? -11.111 17.110  110.086 1.00 38.64 ? 304 VAL C N     1 
ATOM   8965  C CA    . VAL C 1 307 ? -11.845 15.985  110.639 1.00 39.14 ? 304 VAL C CA    1 
ATOM   8966  C C     . VAL C 1 307 ? -11.099 14.651  110.565 1.00 40.10 ? 304 VAL C C     1 
ATOM   8967  O O     . VAL C 1 307 ? -11.722 13.595  110.656 1.00 38.93 ? 304 VAL C O     1 
ATOM   8968  C CB    . VAL C 1 307 ? -13.189 15.832  109.917 1.00 38.89 ? 304 VAL C CB    1 
ATOM   8969  C CG1   . VAL C 1 307 ? -14.023 17.085  110.117 1.00 38.06 ? 304 VAL C CG1   1 
ATOM   8970  C CG2   . VAL C 1 307 ? -12.953 15.591  108.430 1.00 38.11 ? 304 VAL C CG2   1 
ATOM   8971  N N     . GLU C 1 308 ? -9.776  14.700  110.411 1.00 41.45 ? 305 GLU C N     1 
ATOM   8972  C CA    . GLU C 1 308 ? -8.973  13.482  110.315 1.00 42.24 ? 305 GLU C CA    1 
ATOM   8973  C C     . GLU C 1 308 ? -8.144  13.173  111.557 1.00 42.53 ? 305 GLU C C     1 
ATOM   8974  O O     . GLU C 1 308 ? -7.927  12.007  111.891 1.00 41.92 ? 305 GLU C O     1 
ATOM   8975  C CB    . GLU C 1 308 ? -8.044  13.555  109.108 1.00 42.06 ? 305 GLU C CB    1 
ATOM   8976  C CG    . GLU C 1 308 ? -8.764  13.685  107.788 1.00 42.93 ? 305 GLU C CG    1 
ATOM   8977  C CD    . GLU C 1 308 ? -7.859  13.382  106.607 1.00 43.18 ? 305 GLU C CD    1 
ATOM   8978  O OE1   . GLU C 1 308 ? -7.386  12.228  106.498 1.00 42.72 ? 305 GLU C OE1   1 
ATOM   8979  O OE2   . GLU C 1 308 ? -7.621  14.295  105.788 1.00 42.57 ? 305 GLU C OE2   1 
ATOM   8980  N N     . ILE C 1 309 ? -7.664  14.209  112.233 1.00 42.85 ? 306 ILE C N     1 
ATOM   8981  C CA    . ILE C 1 309 ? -6.868  13.993  113.431 1.00 45.60 ? 306 ILE C CA    1 
ATOM   8982  C C     . ILE C 1 309 ? -7.620  14.422  114.684 1.00 46.99 ? 306 ILE C C     1 
ATOM   8983  O O     . ILE C 1 309 ? -7.943  15.597  114.846 1.00 47.96 ? 306 ILE C O     1 
ATOM   8984  C CB    . ILE C 1 309 ? -5.564  14.770  113.368 1.00 46.42 ? 306 ILE C CB    1 
ATOM   8985  C CG1   . ILE C 1 309 ? -4.806  14.385  112.093 1.00 48.35 ? 306 ILE C CG1   1 
ATOM   8986  C CG2   . ILE C 1 309 ? -4.748  14.498  114.634 1.00 45.63 ? 306 ILE C CG2   1 
ATOM   8987  C CD1   . ILE C 1 309 ? -3.654  15.303  111.751 1.00 48.02 ? 306 ILE C CD1   1 
ATOM   8988  N N     . ASP C 1 310 ? -7.889  13.471  115.576 1.00 48.01 ? 307 ASP C N     1 
ATOM   8989  C CA    . ASP C 1 310 ? -8.610  13.774  116.807 1.00 48.27 ? 307 ASP C CA    1 
ATOM   8990  C C     . ASP C 1 310 ? -7.781  14.617  117.776 1.00 47.77 ? 307 ASP C C     1 
ATOM   8991  O O     . ASP C 1 310 ? -7.175  14.095  118.710 1.00 46.95 ? 307 ASP C O     1 
ATOM   8992  C CB    . ASP C 1 310 ? -9.047  12.480  117.490 1.00 49.27 ? 307 ASP C CB    1 
ATOM   8993  C CG    . ASP C 1 310 ? -9.964  12.731  118.671 1.00 52.08 ? 307 ASP C CG    1 
ATOM   8994  O OD1   . ASP C 1 310 ? -10.856 13.598  118.547 1.00 52.34 ? 307 ASP C OD1   1 
ATOM   8995  O OD2   . ASP C 1 310 ? -9.802  12.057  119.714 1.00 52.88 ? 307 ASP C OD2   1 
ATOM   8996  N N     . VAL C 1 311 ? -7.764  15.926  117.543 1.00 47.97 ? 308 VAL C N     1 
ATOM   8997  C CA    . VAL C 1 311 ? -7.015  16.861  118.382 1.00 47.48 ? 308 VAL C CA    1 
ATOM   8998  C C     . VAL C 1 311 ? -7.658  17.009  119.760 1.00 47.00 ? 308 VAL C C     1 
ATOM   8999  O O     . VAL C 1 311 ? -6.981  17.301  120.752 1.00 44.48 ? 308 VAL C O     1 
ATOM   9000  C CB    . VAL C 1 311 ? -6.952  18.238  117.716 1.00 46.87 ? 308 VAL C CB    1 
ATOM   9001  C CG1   . VAL C 1 311 ? -6.207  19.212  118.603 1.00 47.67 ? 308 VAL C CG1   1 
ATOM   9002  C CG2   . VAL C 1 311 ? -6.288  18.116  116.361 1.00 47.55 ? 308 VAL C CG2   1 
ATOM   9003  N N     . LYS C 1 312 ? -8.974  16.817  119.798 1.00 46.97 ? 309 LYS C N     1 
ATOM   9004  C CA    . LYS C 1 312 ? -9.739  16.905  121.033 1.00 46.84 ? 309 LYS C CA    1 
ATOM   9005  C C     . LYS C 1 312 ? -9.117  15.956  122.050 1.00 45.74 ? 309 LYS C C     1 
ATOM   9006  O O     . LYS C 1 312 ? -8.900  16.324  123.203 1.00 45.55 ? 309 LYS C O     1 
ATOM   9007  C CB    . LYS C 1 312 ? -11.199 16.522  120.778 1.00 48.85 ? 309 LYS C CB    1 
ATOM   9008  C CG    . LYS C 1 312 ? -11.980 17.514  119.922 1.00 49.85 ? 309 LYS C CG    1 
ATOM   9009  C CD    . LYS C 1 312 ? -12.359 18.757  120.723 1.00 51.45 ? 309 LYS C CD    1 
ATOM   9010  C CE    . LYS C 1 312 ? -13.015 19.831  119.854 1.00 50.51 ? 309 LYS C CE    1 
ATOM   9011  N NZ    . LYS C 1 312 ? -12.048 20.512  118.945 1.00 50.99 ? 309 LYS C NZ    1 
ATOM   9012  N N     . TRP C 1 313 ? -8.809  14.739  121.609 1.00 44.42 ? 310 TRP C N     1 
ATOM   9013  C CA    . TRP C 1 313 ? -8.194  13.751  122.486 1.00 43.39 ? 310 TRP C CA    1 
ATOM   9014  C C     . TRP C 1 313 ? -6.893  14.256  123.082 1.00 45.44 ? 310 TRP C C     1 
ATOM   9015  O O     . TRP C 1 313 ? -6.645  14.086  124.277 1.00 46.47 ? 310 TRP C O     1 
ATOM   9016  C CB    . TRP C 1 313 ? -7.888  12.470  121.738 1.00 40.83 ? 310 TRP C CB    1 
ATOM   9017  C CG    . TRP C 1 313 ? -7.415  11.395  122.643 1.00 38.14 ? 310 TRP C CG    1 
ATOM   9018  C CD1   . TRP C 1 313 ? -8.186  10.462  123.269 1.00 36.06 ? 310 TRP C CD1   1 
ATOM   9019  C CD2   . TRP C 1 313 ? -6.065  11.134  123.039 1.00 37.37 ? 310 TRP C CD2   1 
ATOM   9020  N NE1   . TRP C 1 313 ? -7.402  9.632   124.027 1.00 35.70 ? 310 TRP C NE1   1 
ATOM   9021  C CE2   . TRP C 1 313 ? -6.094  10.020  123.906 1.00 37.00 ? 310 TRP C CE2   1 
ATOM   9022  C CE3   . TRP C 1 313 ? -4.832  11.732  122.747 1.00 38.60 ? 310 TRP C CE3   1 
ATOM   9023  C CZ2   . TRP C 1 313 ? -4.937  9.486   124.486 1.00 37.48 ? 310 TRP C CZ2   1 
ATOM   9024  C CZ3   . TRP C 1 313 ? -3.673  11.200  123.328 1.00 39.25 ? 310 TRP C CZ3   1 
ATOM   9025  C CH2   . TRP C 1 313 ? -3.740  10.087  124.187 1.00 38.72 ? 310 TRP C CH2   1 
ATOM   9026  N N     . LEU C 1 314 ? -6.049  14.848  122.240 1.00 46.09 ? 311 LEU C N     1 
ATOM   9027  C CA    . LEU C 1 314 ? -4.770  15.372  122.703 1.00 47.04 ? 311 LEU C CA    1 
ATOM   9028  C C     . LEU C 1 314 ? -4.971  16.440  123.777 1.00 47.81 ? 311 LEU C C     1 
ATOM   9029  O O     . LEU C 1 314 ? -4.232  16.484  124.766 1.00 47.21 ? 311 LEU C O     1 
ATOM   9030  C CB    . LEU C 1 314 ? -3.963  15.951  121.534 1.00 46.55 ? 311 LEU C CB    1 
ATOM   9031  C CG    . LEU C 1 314 ? -3.286  14.971  120.567 1.00 46.61 ? 311 LEU C CG    1 
ATOM   9032  C CD1   . LEU C 1 314 ? -2.589  15.762  119.464 1.00 47.48 ? 311 LEU C CD1   1 
ATOM   9033  C CD2   . LEU C 1 314 ? -2.269  14.111  121.310 1.00 46.17 ? 311 LEU C CD2   1 
ATOM   9034  N N     . ASN C 1 315 ? -5.977  17.290  123.589 1.00 48.50 ? 312 ASN C N     1 
ATOM   9035  C CA    . ASN C 1 315 ? -6.257  18.349  124.551 1.00 49.29 ? 312 ASN C CA    1 
ATOM   9036  C C     . ASN C 1 315 ? -6.783  17.807  125.871 1.00 50.52 ? 312 ASN C C     1 
ATOM   9037  O O     . ASN C 1 315 ? -6.371  18.257  126.939 1.00 50.71 ? 312 ASN C O     1 
ATOM   9038  C CB    . ASN C 1 315 ? -7.267  19.330  123.974 1.00 49.01 ? 312 ASN C CB    1 
ATOM   9039  C CG    . ASN C 1 315 ? -6.721  20.084  122.789 1.00 49.26 ? 312 ASN C CG    1 
ATOM   9040  O OD1   . ASN C 1 315 ? -5.667  20.715  122.875 1.00 49.03 ? 312 ASN C OD1   1 
ATOM   9041  N ND2   . ASN C 1 315 ? -7.435  20.028  121.673 1.00 48.64 ? 312 ASN C ND2   1 
ATOM   9042  N N     . GLU C 1 316 ? -7.687  16.834  125.787 1.00 51.29 ? 313 GLU C N     1 
ATOM   9043  C CA    . GLU C 1 316 ? -8.289  16.224  126.975 1.00 52.64 ? 313 GLU C CA    1 
ATOM   9044  C C     . GLU C 1 316 ? -7.517  15.012  127.490 1.00 52.59 ? 313 GLU C C     1 
ATOM   9045  O O     . GLU C 1 316 ? -8.103  14.162  128.154 1.00 54.71 ? 313 GLU C O     1 
ATOM   9046  C CB    . GLU C 1 316 ? -9.728  15.783  126.671 1.00 51.64 ? 313 GLU C CB    1 
ATOM   9047  C CG    . GLU C 1 316 ? -10.608 16.887  126.123 1.00 54.72 ? 313 GLU C CG    1 
ATOM   9048  C CD    . GLU C 1 316 ? -12.003 16.414  125.718 1.00 57.27 ? 313 GLU C CD    1 
ATOM   9049  O OE1   . GLU C 1 316 ? -12.119 15.424  124.955 1.00 58.54 ? 313 GLU C OE1   1 
ATOM   9050  O OE2   . GLU C 1 316 ? -12.989 17.045  126.158 1.00 59.14 ? 313 GLU C OE2   1 
ATOM   9051  N N     . ASN C 1 317 ? -6.219  14.916  127.209 1.00 51.26 ? 314 ASN C N     1 
ATOM   9052  C CA    . ASN C 1 317 ? -5.470  13.744  127.654 1.00 50.04 ? 314 ASN C CA    1 
ATOM   9053  C C     . ASN C 1 317 ? -3.995  13.970  127.925 1.00 50.09 ? 314 ASN C C     1 
ATOM   9054  O O     . ASN C 1 317 ? -3.400  13.299  128.770 1.00 50.05 ? 314 ASN C O     1 
ATOM   9055  C CB    . ASN C 1 317 ? -5.630  12.619  126.629 1.00 49.23 ? 314 ASN C CB    1 
ATOM   9056  C CG    . ASN C 1 317 ? -6.994  11.961  126.698 1.00 49.18 ? 314 ASN C CG    1 
ATOM   9057  O OD1   . ASN C 1 317 ? -7.264  11.166  127.601 1.00 49.13 ? 314 ASN C OD1   1 
ATOM   9058  N ND2   . ASN C 1 317 ? -7.868  12.299  125.751 1.00 47.95 ? 314 ASN C ND2   1 
ATOM   9059  N N     . ALA C 1 318 ? -3.394  14.902  127.202 1.00 50.32 ? 315 ALA C N     1 
ATOM   9060  C CA    . ALA C 1 318 ? -1.986  15.181  127.405 1.00 51.30 ? 315 ALA C CA    1 
ATOM   9061  C C     . ALA C 1 318 ? -1.752  15.749  128.805 1.00 52.42 ? 315 ALA C C     1 
ATOM   9062  O O     . ALA C 1 318 ? -2.546  16.548  129.306 1.00 52.26 ? 315 ALA C O     1 
ATOM   9063  C CB    . ALA C 1 318 ? -1.492  16.157  126.348 1.00 51.40 ? 315 ALA C CB    1 
ATOM   9064  N N     . VAL C 1 319 ? -0.662  15.323  129.436 1.00 54.10 ? 316 VAL C N     1 
ATOM   9065  C CA    . VAL C 1 319 ? -0.308  15.793  130.769 1.00 54.47 ? 316 VAL C CA    1 
ATOM   9066  C C     . VAL C 1 319 ? -0.051  17.298  130.712 1.00 55.77 ? 316 VAL C C     1 
ATOM   9067  O O     . VAL C 1 319 ? -0.209  18.005  131.710 1.00 56.44 ? 316 VAL C O     1 
ATOM   9068  C CB    . VAL C 1 319 ? 0.956   15.092  131.286 1.00 54.11 ? 316 VAL C CB    1 
ATOM   9069  C CG1   . VAL C 1 319 ? 1.255   15.542  132.704 1.00 55.43 ? 316 VAL C CG1   1 
ATOM   9070  C CG2   . VAL C 1 319 ? 0.776   13.588  131.231 1.00 54.83 ? 316 VAL C CG2   1 
ATOM   9071  N N     . GLU C 1 320 ? 0.353   17.774  129.537 1.00 56.34 ? 317 GLU C N     1 
ATOM   9072  C CA    . GLU C 1 320 ? 0.621   19.192  129.315 1.00 56.84 ? 317 GLU C CA    1 
ATOM   9073  C C     . GLU C 1 320 ? 0.622   19.517  127.823 1.00 54.94 ? 317 GLU C C     1 
ATOM   9074  O O     . GLU C 1 320 ? 0.840   18.649  126.989 1.00 54.20 ? 317 GLU C O     1 
ATOM   9075  C CB    . GLU C 1 320 ? 1.965   19.592  129.935 1.00 57.90 ? 317 GLU C CB    1 
ATOM   9076  C CG    . GLU C 1 320 ? 3.143   18.815  129.412 1.00 61.50 ? 317 GLU C CG    1 
ATOM   9077  C CD    . GLU C 1 320 ? 4.455   19.270  130.028 1.00 64.52 ? 317 GLU C CD    1 
ATOM   9078  O OE1   . GLU C 1 320 ? 4.776   20.476  129.915 1.00 64.40 ? 317 GLU C OE1   1 
ATOM   9079  O OE2   . GLU C 1 320 ? 5.161   18.420  130.627 1.00 65.65 ? 317 GLU C OE2   1 
ATOM   9080  N N     . LYS C 1 321 ? 0.368   20.774  127.491 1.00 53.81 ? 318 LYS C N     1 
ATOM   9081  C CA    . LYS C 1 321 ? 0.343   21.200  126.099 1.00 52.71 ? 318 LYS C CA    1 
ATOM   9082  C C     . LYS C 1 321 ? 1.005   22.560  125.953 1.00 52.41 ? 318 LYS C C     1 
ATOM   9083  O O     . LYS C 1 321 ? 0.465   23.573  126.392 1.00 52.87 ? 318 LYS C O     1 
ATOM   9084  C CB    . LYS C 1 321 ? -1.101  21.285  125.598 1.00 51.30 ? 318 LYS C CB    1 
ATOM   9085  C CG    . LYS C 1 321 ? -1.266  21.979  124.252 1.00 48.60 ? 318 LYS C CG    1 
ATOM   9086  C CD    . LYS C 1 321 ? -2.736  22.277  123.989 1.00 48.48 ? 318 LYS C CD    1 
ATOM   9087  C CE    . LYS C 1 321 ? -2.925  23.082  122.727 1.00 47.29 ? 318 LYS C CE    1 
ATOM   9088  N NZ    . LYS C 1 321 ? -2.100  24.318  122.767 1.00 48.76 ? 318 LYS C NZ    1 
ATOM   9089  N N     . VAL C 1 322 ? 2.178   22.584  125.337 1.00 52.41 ? 319 VAL C N     1 
ATOM   9090  C CA    . VAL C 1 322 ? 2.887   23.839  125.132 1.00 52.26 ? 319 VAL C CA    1 
ATOM   9091  C C     . VAL C 1 322 ? 2.750   24.283  123.684 1.00 52.46 ? 319 VAL C C     1 
ATOM   9092  O O     . VAL C 1 322 ? 2.469   23.477  122.791 1.00 53.01 ? 319 VAL C O     1 
ATOM   9093  C CB    . VAL C 1 322 ? 4.393   23.713  125.452 1.00 51.96 ? 319 VAL C CB    1 
ATOM   9094  C CG1   . VAL C 1 322 ? 4.592   23.253  126.890 1.00 51.92 ? 319 VAL C CG1   1 
ATOM   9095  C CG2   . VAL C 1 322 ? 5.041   22.742  124.487 1.00 53.34 ? 319 VAL C CG2   1 
ATOM   9096  N N     . ASN C 1 323 ? 2.949   25.573  123.458 1.00 51.24 ? 320 ASN C N     1 
ATOM   9097  C CA    . ASN C 1 323 ? 2.865   26.129  122.120 1.00 48.62 ? 320 ASN C CA    1 
ATOM   9098  C C     . ASN C 1 323 ? 4.240   26.675  121.758 1.00 47.31 ? 320 ASN C C     1 
ATOM   9099  O O     . ASN C 1 323 ? 4.726   27.602  122.404 1.00 48.15 ? 320 ASN C O     1 
ATOM   9100  C CB    . ASN C 1 323 ? 1.809   27.229  122.088 1.00 47.89 ? 320 ASN C CB    1 
ATOM   9101  C CG    . ASN C 1 323 ? 1.785   27.969  120.781 1.00 48.44 ? 320 ASN C CG    1 
ATOM   9102  O OD1   . ASN C 1 323 ? 2.342   29.063  120.661 1.00 47.98 ? 320 ASN C OD1   1 
ATOM   9103  N ND2   . ASN C 1 323 ? 1.142   27.379  119.784 1.00 49.20 ? 320 ASN C ND2   1 
ATOM   9104  N N     . ILE C 1 324 ? 4.881   26.085  120.749 1.00 45.47 ? 321 ILE C N     1 
ATOM   9105  C CA    . ILE C 1 324 ? 6.207   26.543  120.340 1.00 43.97 ? 321 ILE C CA    1 
ATOM   9106  C C     . ILE C 1 324 ? 6.076   27.864  119.605 1.00 42.66 ? 321 ILE C C     1 
ATOM   9107  O O     . ILE C 1 324 ? 6.920   28.747  119.749 1.00 42.98 ? 321 ILE C O     1 
ATOM   9108  C CB    . ILE C 1 324 ? 6.916   25.532  119.415 1.00 43.01 ? 321 ILE C CB    1 
ATOM   9109  C CG1   . ILE C 1 324 ? 6.950   24.157  120.069 1.00 42.57 ? 321 ILE C CG1   1 
ATOM   9110  C CG2   . ILE C 1 324 ? 8.333   25.999  119.134 1.00 41.79 ? 321 ILE C CG2   1 
ATOM   9111  C CD1   . ILE C 1 324 ? 5.649   23.429  119.971 1.00 44.95 ? 321 ILE C CD1   1 
ATOM   9112  N N     . LYS C 1 325 ? 5.016   27.970  118.807 1.00 41.85 ? 322 LYS C N     1 
ATOM   9113  C CA    . LYS C 1 325 ? 4.696   29.174  118.042 1.00 40.49 ? 322 LYS C CA    1 
ATOM   9114  C C     . LYS C 1 325 ? 3.332   28.955  117.406 1.00 39.03 ? 322 LYS C C     1 
ATOM   9115  O O     . LYS C 1 325 ? 2.757   27.876  117.534 1.00 38.20 ? 322 LYS C O     1 
ATOM   9116  C CB    . LYS C 1 325 ? 5.757   29.452  116.972 1.00 39.42 ? 322 LYS C CB    1 
ATOM   9117  C CG    . LYS C 1 325 ? 5.777   28.483  115.833 1.00 38.63 ? 322 LYS C CG    1 
ATOM   9118  C CD    . LYS C 1 325 ? 6.981   28.738  114.959 1.00 36.09 ? 322 LYS C CD    1 
ATOM   9119  C CE    . LYS C 1 325 ? 7.033   27.766  113.810 1.00 34.49 ? 322 LYS C CE    1 
ATOM   9120  N NZ    . LYS C 1 325 ? 8.414   27.709  113.275 1.00 33.69 ? 322 LYS C NZ    1 
ATOM   9121  N N     . PRO C 1 326 ? 2.783   29.972  116.727 1.00 39.18 ? 323 PRO C N     1 
ATOM   9122  C CA    . PRO C 1 326 ? 1.466   29.789  116.107 1.00 40.06 ? 323 PRO C CA    1 
ATOM   9123  C C     . PRO C 1 326 ? 1.363   28.567  115.183 1.00 41.31 ? 323 PRO C C     1 
ATOM   9124  O O     . PRO C 1 326 ? 2.240   28.317  114.350 1.00 41.07 ? 323 PRO C O     1 
ATOM   9125  C CB    . PRO C 1 326 ? 1.229   31.123  115.390 1.00 38.81 ? 323 PRO C CB    1 
ATOM   9126  C CG    . PRO C 1 326 ? 2.619   31.655  115.161 1.00 39.16 ? 323 PRO C CG    1 
ATOM   9127  C CD    . PRO C 1 326 ? 3.323   31.310  116.435 1.00 37.74 ? 323 PRO C CD    1 
ATOM   9128  N N     . GLN C 1 327 ? 0.280   27.811  115.348 1.00 42.07 ? 324 GLN C N     1 
ATOM   9129  C CA    . GLN C 1 327 ? 0.023   26.605  114.566 1.00 42.67 ? 324 GLN C CA    1 
ATOM   9130  C C     . GLN C 1 327 ? 0.975   25.457  114.870 1.00 43.24 ? 324 GLN C C     1 
ATOM   9131  O O     . GLN C 1 327 ? 1.049   24.483  114.115 1.00 43.38 ? 324 GLN C O     1 
ATOM   9132  C CB    . GLN C 1 327 ? 0.053   26.907  113.066 1.00 42.81 ? 324 GLN C CB    1 
ATOM   9133  C CG    . GLN C 1 327 ? -1.208  27.562  112.565 1.00 43.12 ? 324 GLN C CG    1 
ATOM   9134  C CD    . GLN C 1 327 ? -1.362  28.969  113.092 1.00 44.00 ? 324 GLN C CD    1 
ATOM   9135  O OE1   . GLN C 1 327 ? -0.576  29.852  112.754 1.00 45.07 ? 324 GLN C OE1   1 
ATOM   9136  N NE2   . GLN C 1 327 ? -2.371  29.187  113.931 1.00 44.66 ? 324 GLN C NE2   1 
ATOM   9137  N N     . VAL C 1 328 ? 1.695   25.554  115.980 1.00 43.18 ? 325 VAL C N     1 
ATOM   9138  C CA    . VAL C 1 328 ? 2.615   24.488  116.347 1.00 44.13 ? 325 VAL C CA    1 
ATOM   9139  C C     . VAL C 1 328 ? 2.512   24.179  117.831 1.00 45.40 ? 325 VAL C C     1 
ATOM   9140  O O     . VAL C 1 328 ? 3.014   24.932  118.673 1.00 46.56 ? 325 VAL C O     1 
ATOM   9141  C CB    . VAL C 1 328 ? 4.075   24.859  116.012 1.00 42.92 ? 325 VAL C CB    1 
ATOM   9142  C CG1   . VAL C 1 328 ? 4.975   23.642  116.211 1.00 41.64 ? 325 VAL C CG1   1 
ATOM   9143  C CG2   . VAL C 1 328 ? 4.169   25.363  114.580 1.00 41.54 ? 325 VAL C CG2   1 
ATOM   9144  N N     . ASP C 1 329 ? 1.863   23.064  118.147 1.00 45.85 ? 326 ASP C N     1 
ATOM   9145  C CA    . ASP C 1 329 ? 1.678   22.652  119.533 1.00 46.62 ? 326 ASP C CA    1 
ATOM   9146  C C     . ASP C 1 329 ? 2.428   21.359  119.851 1.00 47.37 ? 326 ASP C C     1 
ATOM   9147  O O     . ASP C 1 329 ? 2.405   20.407  119.063 1.00 47.02 ? 326 ASP C O     1 
ATOM   9148  C CB    . ASP C 1 329 ? 0.186   22.463  119.817 1.00 46.85 ? 326 ASP C CB    1 
ATOM   9149  C CG    . ASP C 1 329 ? -0.594  23.760  119.729 1.00 47.90 ? 326 ASP C CG    1 
ATOM   9150  O OD1   . ASP C 1 329 ? -1.765  23.719  119.296 1.00 48.27 ? 326 ASP C OD1   1 
ATOM   9151  O OD2   . ASP C 1 329 ? -0.042  24.817  120.103 1.00 48.18 ? 326 ASP C OD2   1 
ATOM   9152  N N     . ARG C 1 330 ? 3.085   21.323  121.009 1.00 46.75 ? 327 ARG C N     1 
ATOM   9153  C CA    . ARG C 1 330 ? 3.829   20.137  121.412 1.00 46.52 ? 327 ARG C CA    1 
ATOM   9154  C C     . ARG C 1 330 ? 3.277   19.528  122.710 1.00 47.75 ? 327 ARG C C     1 
ATOM   9155  O O     . ARG C 1 330 ? 3.668   19.923  123.815 1.00 48.40 ? 327 ARG C O     1 
ATOM   9156  C CB    . ARG C 1 330 ? 5.313   20.482  121.577 1.00 44.08 ? 327 ARG C CB    1 
ATOM   9157  C CG    . ARG C 1 330 ? 6.229   19.271  121.695 1.00 43.33 ? 327 ARG C CG    1 
ATOM   9158  C CD    . ARG C 1 330 ? 7.656   19.678  122.003 1.00 44.30 ? 327 ARG C CD    1 
ATOM   9159  N NE    . ARG C 1 330 ? 8.562   18.534  122.121 1.00 45.80 ? 327 ARG C NE    1 
ATOM   9160  C CZ    . ARG C 1 330 ? 9.763   18.589  122.696 1.00 47.32 ? 327 ARG C CZ    1 
ATOM   9161  N NH1   . ARG C 1 330 ? 10.205  19.733  123.210 1.00 46.49 ? 327 ARG C NH1   1 
ATOM   9162  N NH2   . ARG C 1 330 ? 10.527  17.503  122.756 1.00 47.06 ? 327 ARG C NH2   1 
ATOM   9163  N N     . TYR C 1 331 ? 2.373   18.561  122.572 1.00 47.94 ? 328 TYR C N     1 
ATOM   9164  C CA    . TYR C 1 331 ? 1.779   17.907  123.730 1.00 48.56 ? 328 TYR C CA    1 
ATOM   9165  C C     . TYR C 1 331 ? 2.687   16.820  124.315 1.00 48.94 ? 328 TYR C C     1 
ATOM   9166  O O     . TYR C 1 331 ? 3.500   16.226  123.612 1.00 49.07 ? 328 TYR C O     1 
ATOM   9167  C CB    . TYR C 1 331 ? 0.442   17.251  123.373 1.00 47.88 ? 328 TYR C CB    1 
ATOM   9168  C CG    . TYR C 1 331 ? -0.577  18.138  122.703 1.00 48.64 ? 328 TYR C CG    1 
ATOM   9169  C CD1   . TYR C 1 331 ? -0.397  18.575  121.388 1.00 48.84 ? 328 TYR C CD1   1 
ATOM   9170  C CD2   . TYR C 1 331 ? -1.769  18.472  123.353 1.00 47.90 ? 328 TYR C CD2   1 
ATOM   9171  C CE1   . TYR C 1 331 ? -1.386  19.315  120.732 1.00 47.93 ? 328 TYR C CE1   1 
ATOM   9172  C CE2   . TYR C 1 331 ? -2.761  19.210  122.709 1.00 47.86 ? 328 TYR C CE2   1 
ATOM   9173  C CZ    . TYR C 1 331 ? -2.563  19.625  121.400 1.00 47.70 ? 328 TYR C CZ    1 
ATOM   9174  O OH    . TYR C 1 331 ? -3.539  20.340  120.757 1.00 47.80 ? 328 TYR C OH    1 
ATOM   9175  N N     . ARG C 1 332 ? 2.525   16.577  125.612 1.00 49.73 ? 329 ARG C N     1 
ATOM   9176  C CA    . ARG C 1 332 ? 3.275   15.563  126.340 1.00 49.06 ? 329 ARG C CA    1 
ATOM   9177  C C     . ARG C 1 332 ? 2.232   14.607  126.885 1.00 47.35 ? 329 ARG C C     1 
ATOM   9178  O O     . ARG C 1 332 ? 1.331   15.020  127.609 1.00 45.43 ? 329 ARG C O     1 
ATOM   9179  C CB    . ARG C 1 332 ? 4.030   16.178  127.510 1.00 51.41 ? 329 ARG C CB    1 
ATOM   9180  C CG    . ARG C 1 332 ? 5.039   15.239  128.134 1.00 55.22 ? 329 ARG C CG    1 
ATOM   9181  C CD    . ARG C 1 332 ? 5.504   15.728  129.497 1.00 58.77 ? 329 ARG C CD    1 
ATOM   9182  N NE    . ARG C 1 332 ? 6.878   15.309  129.748 1.00 61.45 ? 329 ARG C NE    1 
ATOM   9183  C CZ    . ARG C 1 332 ? 7.942   15.885  129.193 1.00 62.82 ? 329 ARG C CZ    1 
ATOM   9184  N NH1   . ARG C 1 332 ? 7.788   16.911  128.359 1.00 61.26 ? 329 ARG C NH1   1 
ATOM   9185  N NH2   . ARG C 1 332 ? 9.161   15.431  129.465 1.00 62.97 ? 329 ARG C NH2   1 
ATOM   9186  N N     . LEU C 1 333 ? 2.345   13.334  126.532 1.00 46.58 ? 330 LEU C N     1 
ATOM   9187  C CA    . LEU C 1 333 ? 1.383   12.344  126.992 1.00 45.93 ? 330 LEU C CA    1 
ATOM   9188  C C     . LEU C 1 333 ? 1.820   11.732  128.313 1.00 47.02 ? 330 LEU C C     1 
ATOM   9189  O O     . LEU C 1 333 ? 2.918   12.000  128.806 1.00 46.68 ? 330 LEU C O     1 
ATOM   9190  C CB    . LEU C 1 333 ? 1.212   11.255  125.934 1.00 44.78 ? 330 LEU C CB    1 
ATOM   9191  C CG    . LEU C 1 333 ? 0.888   11.765  124.526 1.00 43.63 ? 330 LEU C CG    1 
ATOM   9192  C CD1   . LEU C 1 333 ? 0.724   10.581  123.580 1.00 43.33 ? 330 LEU C CD1   1 
ATOM   9193  C CD2   . LEU C 1 333 ? -0.379  12.608  124.562 1.00 43.35 ? 330 LEU C CD2   1 
ATOM   9194  N N     . LYS C 1 334 ? 0.951   10.904  128.882 1.00 48.90 ? 331 LYS C N     1 
ATOM   9195  C CA    . LYS C 1 334 ? 1.232   10.251  130.157 1.00 49.46 ? 331 LYS C CA    1 
ATOM   9196  C C     . LYS C 1 334 ? 2.443   9.330   130.088 1.00 49.03 ? 331 LYS C C     1 
ATOM   9197  O O     . LYS C 1 334 ? 3.198   9.220   131.056 1.00 48.64 ? 331 LYS C O     1 
ATOM   9198  C CB    . LYS C 1 334 ? 0.004   9.466   130.617 1.00 50.00 ? 331 LYS C CB    1 
ATOM   9199  C CG    . LYS C 1 334 ? -1.236  10.330  130.838 1.00 51.75 ? 331 LYS C CG    1 
ATOM   9200  C CD    . LYS C 1 334 ? -2.415  9.500   131.325 1.00 52.17 ? 331 LYS C CD    1 
ATOM   9201  C CE    . LYS C 1 334 ? -3.532  10.371  131.881 1.00 52.54 ? 331 LYS C CE    1 
ATOM   9202  N NZ    . LYS C 1 334 ? -4.132  11.290  130.872 1.00 52.32 ? 331 LYS C NZ    1 
ATOM   9203  N N     . ASN C 1 335 ? 2.622   8.673   128.942 1.00 48.94 ? 332 ASN C N     1 
ATOM   9204  C CA    . ASN C 1 335 ? 3.738   7.750   128.742 1.00 49.25 ? 332 ASN C CA    1 
ATOM   9205  C C     . ASN C 1 335 ? 5.091   8.449   128.688 1.00 49.35 ? 332 ASN C C     1 
ATOM   9206  O O     . ASN C 1 335 ? 6.116   7.817   128.445 1.00 49.71 ? 332 ASN C O     1 
ATOM   9207  C CB    . ASN C 1 335 ? 3.537   6.911   127.463 1.00 49.30 ? 332 ASN C CB    1 
ATOM   9208  C CG    . ASN C 1 335 ? 3.227   7.759   126.230 1.00 50.97 ? 332 ASN C CG    1 
ATOM   9209  O OD1   . ASN C 1 335 ? 3.880   8.774   125.965 1.00 50.64 ? 332 ASN C OD1   1 
ATOM   9210  N ND2   . ASN C 1 335 ? 2.232   7.327   125.458 1.00 50.69 ? 332 ASN C ND2   1 
ATOM   9211  N N     . GLY C 1 336 ? 5.098   9.757   128.915 1.00 49.72 ? 333 GLY C N     1 
ATOM   9212  C CA    . GLY C 1 336 ? 6.355   10.486  128.899 1.00 48.75 ? 333 GLY C CA    1 
ATOM   9213  C C     . GLY C 1 336 ? 6.787   10.936  127.519 1.00 48.18 ? 333 GLY C C     1 
ATOM   9214  O O     . GLY C 1 336 ? 7.724   11.719  127.390 1.00 48.02 ? 333 GLY C O     1 
ATOM   9215  N N     . ARG C 1 337 ? 6.114   10.445  126.484 1.00 48.51 ? 334 ARG C N     1 
ATOM   9216  C CA    . ARG C 1 337 ? 6.449   10.824  125.115 1.00 48.85 ? 334 ARG C CA    1 
ATOM   9217  C C     . ARG C 1 337 ? 5.670   12.065  124.680 1.00 49.19 ? 334 ARG C C     1 
ATOM   9218  O O     . ARG C 1 337 ? 4.587   12.352  125.202 1.00 48.90 ? 334 ARG C O     1 
ATOM   9219  C CB    . ARG C 1 337 ? 6.171   9.667   124.142 1.00 48.17 ? 334 ARG C CB    1 
ATOM   9220  C CG    . ARG C 1 337 ? 7.194   8.527   124.189 1.00 48.08 ? 334 ARG C CG    1 
ATOM   9221  C CD    . ARG C 1 337 ? 7.083   7.645   122.946 1.00 48.77 ? 334 ARG C CD    1 
ATOM   9222  N NE    . ARG C 1 337 ? 5.769   7.016   122.870 1.00 49.20 ? 334 ARG C NE    1 
ATOM   9223  C CZ    . ARG C 1 337 ? 5.388   6.013   123.653 1.00 49.91 ? 334 ARG C CZ    1 
ATOM   9224  N NH1   . ARG C 1 337 ? 6.232   5.528   124.555 1.00 49.86 ? 334 ARG C NH1   1 
ATOM   9225  N NH2   . ARG C 1 337 ? 4.156   5.523   123.565 1.00 48.40 ? 334 ARG C NH2   1 
ATOM   9226  N N     . ARG C 1 338 ? 6.228   12.798  123.721 1.00 48.62 ? 335 ARG C N     1 
ATOM   9227  C CA    . ARG C 1 338 ? 5.599   14.013  123.218 1.00 47.77 ? 335 ARG C CA    1 
ATOM   9228  C C     . ARG C 1 338 ? 5.039   13.858  121.812 1.00 46.88 ? 335 ARG C C     1 
ATOM   9229  O O     . ARG C 1 338 ? 5.431   12.958  121.076 1.00 48.37 ? 335 ARG C O     1 
ATOM   9230  C CB    . ARG C 1 338 ? 6.602   15.164  123.252 1.00 48.71 ? 335 ARG C CB    1 
ATOM   9231  C CG    . ARG C 1 338 ? 6.962   15.632  124.659 1.00 48.75 ? 335 ARG C CG    1 
ATOM   9232  C CD    . ARG C 1 338 ? 7.655   14.538  125.446 1.00 48.47 ? 335 ARG C CD    1 
ATOM   9233  N NE    . ARG C 1 338 ? 8.959   14.208  124.881 1.00 48.67 ? 335 ARG C NE    1 
ATOM   9234  C CZ    . ARG C 1 338 ? 10.048  14.952  125.033 1.00 48.59 ? 335 ARG C CZ    1 
ATOM   9235  N NH1   . ARG C 1 338 ? 9.987   16.070  125.743 1.00 48.26 ? 335 ARG C NH1   1 
ATOM   9236  N NH2   . ARG C 1 338 ? 11.191  14.588  124.465 1.00 46.75 ? 335 ARG C NH2   1 
ATOM   9237  N N     . ILE C 1 339 ? 4.105   14.736  121.452 1.00 45.85 ? 336 ILE C N     1 
ATOM   9238  C CA    . ILE C 1 339 ? 3.480   14.722  120.128 1.00 44.44 ? 336 ILE C CA    1 
ATOM   9239  C C     . ILE C 1 339 ? 3.479   16.140  119.572 1.00 42.80 ? 336 ILE C C     1 
ATOM   9240  O O     . ILE C 1 339 ? 3.202   17.090  120.300 1.00 43.39 ? 336 ILE C O     1 
ATOM   9241  C CB    . ILE C 1 339 ? 2.003   14.227  120.193 1.00 44.45 ? 336 ILE C CB    1 
ATOM   9242  C CG1   . ILE C 1 339 ? 1.935   12.773  120.676 1.00 44.48 ? 336 ILE C CG1   1 
ATOM   9243  C CG2   . ILE C 1 339 ? 1.352   14.364  118.824 1.00 44.33 ? 336 ILE C CG2   1 
ATOM   9244  C CD1   . ILE C 1 339 ? 2.454   11.752  119.689 1.00 43.68 ? 336 ILE C CD1   1 
ATOM   9245  N N     . ILE C 1 340 ? 3.793   16.297  118.291 1.00 41.72 ? 337 ILE C N     1 
ATOM   9246  C CA    . ILE C 1 340 ? 3.793   17.632  117.691 1.00 41.15 ? 337 ILE C CA    1 
ATOM   9247  C C     . ILE C 1 340 ? 2.635   17.795  116.709 1.00 40.42 ? 337 ILE C C     1 
ATOM   9248  O O     . ILE C 1 340 ? 2.609   17.146  115.672 1.00 41.12 ? 337 ILE C O     1 
ATOM   9249  C CB    . ILE C 1 340 ? 5.127   17.919  116.978 1.00 39.28 ? 337 ILE C CB    1 
ATOM   9250  C CG1   . ILE C 1 340 ? 6.276   17.772  117.970 1.00 38.09 ? 337 ILE C CG1   1 
ATOM   9251  C CG2   . ILE C 1 340 ? 5.125   19.327  116.417 1.00 38.67 ? 337 ILE C CG2   1 
ATOM   9252  C CD1   . ILE C 1 340 ? 7.628   18.026  117.372 1.00 38.82 ? 337 ILE C CD1   1 
ATOM   9253  N N     . LEU C 1 341 ? 1.680   18.660  117.049 1.00 40.55 ? 338 LEU C N     1 
ATOM   9254  C CA    . LEU C 1 341 ? 0.507   18.899  116.204 1.00 41.96 ? 338 LEU C CA    1 
ATOM   9255  C C     . LEU C 1 341 ? 0.657   20.173  115.377 1.00 42.23 ? 338 LEU C C     1 
ATOM   9256  O O     . LEU C 1 341 ? 1.042   21.208  115.903 1.00 44.83 ? 338 LEU C O     1 
ATOM   9257  C CB    . LEU C 1 341 ? -0.752  19.001  117.077 1.00 42.03 ? 338 LEU C CB    1 
ATOM   9258  C CG    . LEU C 1 341 ? -2.075  18.559  116.443 1.00 41.19 ? 338 LEU C CG    1 
ATOM   9259  C CD1   . LEU C 1 341 ? -2.462  19.482  115.302 1.00 42.05 ? 338 LEU C CD1   1 
ATOM   9260  C CD2   . LEU C 1 341 ? -1.918  17.134  115.942 1.00 39.59 ? 338 LEU C CD2   1 
ATOM   9261  N N     . LEU C 1 342 ? 0.336   20.105  114.090 1.00 42.21 ? 339 LEU C N     1 
ATOM   9262  C CA    . LEU C 1 342 ? 0.474   21.271  113.224 1.00 42.65 ? 339 LEU C CA    1 
ATOM   9263  C C     . LEU C 1 342 ? -0.860  21.866  112.753 1.00 42.70 ? 339 LEU C C     1 
ATOM   9264  O O     . LEU C 1 342 ? -1.765  21.140  112.346 1.00 42.53 ? 339 LEU C O     1 
ATOM   9265  C CB    . LEU C 1 342 ? 1.335   20.914  112.004 1.00 42.29 ? 339 LEU C CB    1 
ATOM   9266  C CG    . LEU C 1 342 ? 2.744   20.343  112.235 1.00 42.44 ? 339 LEU C CG    1 
ATOM   9267  C CD1   . LEU C 1 342 ? 3.399   20.060  110.885 1.00 41.35 ? 339 LEU C CD1   1 
ATOM   9268  C CD2   . LEU C 1 342 ? 3.591   21.310  113.034 1.00 41.64 ? 339 LEU C CD2   1 
ATOM   9269  N N     . ALA C 1 343 ? -0.966  23.194  112.816 1.00 42.60 ? 340 ALA C N     1 
ATOM   9270  C CA    . ALA C 1 343 ? -2.171  23.914  112.398 1.00 42.65 ? 340 ALA C CA    1 
ATOM   9271  C C     . ALA C 1 343 ? -3.461  23.437  113.094 1.00 41.96 ? 340 ALA C C     1 
ATOM   9272  O O     . ALA C 1 343 ? -4.563  23.567  112.547 1.00 40.06 ? 340 ALA C O     1 
ATOM   9273  C CB    . ALA C 1 343 ? -2.327  23.826  110.867 1.00 41.88 ? 340 ALA C CB    1 
ATOM   9274  N N     . GLU C 1 344 ? -3.311  22.908  114.308 1.00 41.47 ? 341 GLU C N     1 
ATOM   9275  C CA    . GLU C 1 344 ? -4.436  22.404  115.092 1.00 41.28 ? 341 GLU C CA    1 
ATOM   9276  C C     . GLU C 1 344 ? -5.335  21.487  114.271 1.00 40.33 ? 341 GLU C C     1 
ATOM   9277  O O     . GLU C 1 344 ? -6.554  21.505  114.418 1.00 38.83 ? 341 GLU C O     1 
ATOM   9278  C CB    . GLU C 1 344 ? -5.266  23.564  115.658 1.00 43.44 ? 341 GLU C CB    1 
ATOM   9279  C CG    . GLU C 1 344 ? -4.584  24.322  116.794 1.00 45.81 ? 341 GLU C CG    1 
ATOM   9280  C CD    . GLU C 1 344 ? -5.379  25.526  117.291 1.00 47.18 ? 341 GLU C CD    1 
ATOM   9281  O OE1   . GLU C 1 344 ? -4.947  26.136  118.296 1.00 47.20 ? 341 GLU C OE1   1 
ATOM   9282  O OE2   . GLU C 1 344 ? -6.419  25.867  116.686 1.00 46.27 ? 341 GLU C OE2   1 
ATOM   9283  N N     . GLY C 1 345 ? -4.729  20.690  113.398 1.00 39.34 ? 342 GLY C N     1 
ATOM   9284  C CA    . GLY C 1 345 ? -5.507  19.776  112.587 1.00 38.99 ? 342 GLY C CA    1 
ATOM   9285  C C     . GLY C 1 345 ? -5.957  20.313  111.243 1.00 39.35 ? 342 GLY C C     1 
ATOM   9286  O O     . GLY C 1 345 ? -6.422  19.540  110.398 1.00 39.86 ? 342 GLY C O     1 
ATOM   9287  N N     . ARG C 1 346 ? -5.842  21.626  111.044 1.00 39.24 ? 343 ARG C N     1 
ATOM   9288  C CA    . ARG C 1 346 ? -6.234  22.248  109.778 1.00 38.91 ? 343 ARG C CA    1 
ATOM   9289  C C     . ARG C 1 346 ? -5.179  21.946  108.719 1.00 37.02 ? 343 ARG C C     1 
ATOM   9290  O O     . ARG C 1 346 ? -4.020  21.685  109.058 1.00 36.72 ? 343 ARG C O     1 
ATOM   9291  C CB    . ARG C 1 346 ? -6.369  23.768  109.926 1.00 39.93 ? 343 ARG C CB    1 
ATOM   9292  C CG    . ARG C 1 346 ? -7.717  24.246  110.424 1.00 43.67 ? 343 ARG C CG    1 
ATOM   9293  C CD    . ARG C 1 346 ? -7.970  23.917  111.879 1.00 45.96 ? 343 ARG C CD    1 
ATOM   9294  N NE    . ARG C 1 346 ? -9.292  24.393  112.290 1.00 48.72 ? 343 ARG C NE    1 
ATOM   9295  C CZ    . ARG C 1 346 ? -9.795  24.284  113.519 1.00 49.01 ? 343 ARG C CZ    1 
ATOM   9296  N NH1   . ARG C 1 346 ? -9.090  23.710  114.490 1.00 47.68 ? 343 ARG C NH1   1 
ATOM   9297  N NH2   . ARG C 1 346 ? -11.011 24.756  113.774 1.00 48.57 ? 343 ARG C NH2   1 
ATOM   9298  N N     . LEU C 1 347 ? -5.585  21.991  107.449 1.00 35.01 ? 344 LEU C N     1 
ATOM   9299  C CA    . LEU C 1 347 ? -4.687  21.713  106.337 1.00 33.87 ? 344 LEU C CA    1 
ATOM   9300  C C     . LEU C 1 347 ? -3.351  22.421  106.545 1.00 33.82 ? 344 LEU C C     1 
ATOM   9301  O O     . LEU C 1 347 ? -3.266  23.653  106.543 1.00 35.89 ? 344 LEU C O     1 
ATOM   9302  C CB    . LEU C 1 347 ? -5.334  22.126  105.012 1.00 34.67 ? 344 LEU C CB    1 
ATOM   9303  C CG    . LEU C 1 347 ? -5.641  23.581  104.647 1.00 35.49 ? 344 LEU C CG    1 
ATOM   9304  C CD1   . LEU C 1 347 ? -6.251  23.598  103.240 1.00 34.23 ? 344 LEU C CD1   1 
ATOM   9305  C CD2   . LEU C 1 347 ? -6.596  24.208  105.656 1.00 36.27 ? 344 LEU C CD2   1 
ATOM   9306  N N     . VAL C 1 348 ? -2.308  21.616  106.713 1.00 31.32 ? 345 VAL C N     1 
ATOM   9307  C CA    . VAL C 1 348 ? -0.972  22.111  106.985 1.00 29.29 ? 345 VAL C CA    1 
ATOM   9308  C C     . VAL C 1 348 ? -0.303  22.990  105.921 1.00 30.19 ? 345 VAL C C     1 
ATOM   9309  O O     . VAL C 1 348 ? 0.382   23.956  106.270 1.00 29.14 ? 345 VAL C O     1 
ATOM   9310  C CB    . VAL C 1 348 ? -0.036  20.916  107.361 1.00 28.52 ? 345 VAL C CB    1 
ATOM   9311  C CG1   . VAL C 1 348 ? 0.082   19.942  106.193 1.00 27.97 ? 345 VAL C CG1   1 
ATOM   9312  C CG2   . VAL C 1 348 ? 1.320   21.421  107.813 1.00 27.71 ? 345 VAL C CG2   1 
ATOM   9313  N N     . ASN C 1 349 ? -0.482  22.684  104.637 1.00 30.25 ? 346 ASN C N     1 
ATOM   9314  C CA    . ASN C 1 349 ? 0.182   23.496  103.615 1.00 31.24 ? 346 ASN C CA    1 
ATOM   9315  C C     . ASN C 1 349 ? -0.163  24.971  103.719 1.00 31.55 ? 346 ASN C C     1 
ATOM   9316  O O     . ASN C 1 349 ? 0.718   25.833  103.725 1.00 30.62 ? 346 ASN C O     1 
ATOM   9317  C CB    . ASN C 1 349 ? -0.121  22.993  102.199 1.00 29.94 ? 346 ASN C CB    1 
ATOM   9318  C CG    . ASN C 1 349 ? -1.608  22.930  101.887 1.00 31.08 ? 346 ASN C CG    1 
ATOM   9319  O OD1   . ASN C 1 349 ? -1.990  22.838  100.721 1.00 31.57 ? 346 ASN C OD1   1 
ATOM   9320  N ND2   . ASN C 1 349 ? -2.448  22.963  102.917 1.00 30.88 ? 346 ASN C ND2   1 
ATOM   9321  N N     . LEU C 1 350 ? -1.452  25.251  103.826 1.00 32.51 ? 347 LEU C N     1 
ATOM   9322  C CA    . LEU C 1 350 ? -1.931  26.610  103.923 1.00 31.76 ? 347 LEU C CA    1 
ATOM   9323  C C     . LEU C 1 350 ? -1.841  27.149  105.330 1.00 32.45 ? 347 LEU C C     1 
ATOM   9324  O O     . LEU C 1 350 ? -1.676  28.352  105.527 1.00 33.67 ? 347 LEU C O     1 
ATOM   9325  C CB    . LEU C 1 350 ? -3.371  26.668  103.451 1.00 34.04 ? 347 LEU C CB    1 
ATOM   9326  C CG    . LEU C 1 350 ? -3.531  26.715  101.939 1.00 34.87 ? 347 LEU C CG    1 
ATOM   9327  C CD1   . LEU C 1 350 ? -4.939  26.294  101.579 1.00 36.78 ? 347 LEU C CD1   1 
ATOM   9328  C CD2   . LEU C 1 350 ? -3.228  28.127  101.439 1.00 34.65 ? 347 LEU C CD2   1 
ATOM   9329  N N     . GLY C 1 351 ? -1.949  26.261  106.311 1.00 31.90 ? 348 GLY C N     1 
ATOM   9330  C CA    . GLY C 1 351 ? -1.896  26.691  107.692 1.00 30.55 ? 348 GLY C CA    1 
ATOM   9331  C C     . GLY C 1 351 ? -0.512  27.025  108.194 1.00 31.05 ? 348 GLY C C     1 
ATOM   9332  O O     . GLY C 1 351 ? -0.342  27.936  109.007 1.00 31.63 ? 348 GLY C O     1 
ATOM   9333  N N     . CYS C 1 352 ? 0.486   26.291  107.722 1.00 30.99 ? 349 CYS C N     1 
ATOM   9334  C CA    . CYS C 1 352 ? 1.857   26.514  108.160 1.00 31.76 ? 349 CYS C CA    1 
ATOM   9335  C C     . CYS C 1 352 ? 2.756   27.065  107.062 1.00 31.72 ? 349 CYS C C     1 
ATOM   9336  O O     . CYS C 1 352 ? 3.888   27.471  107.325 1.00 33.80 ? 349 CYS C O     1 
ATOM   9337  C CB    . CYS C 1 352 ? 2.449   25.208  108.712 1.00 31.23 ? 349 CYS C CB    1 
ATOM   9338  S SG    . CYS C 1 352 ? 1.641   24.616  110.226 1.00 34.89 ? 349 CYS C SG    1 
ATOM   9339  N N     . ALA C 1 353 ? 2.262   27.075  105.831 1.00 31.13 ? 350 ALA C N     1 
ATOM   9340  C CA    . ALA C 1 353 ? 3.051   27.581  104.723 1.00 29.23 ? 350 ALA C CA    1 
ATOM   9341  C C     . ALA C 1 353 ? 2.238   28.549  103.877 1.00 28.99 ? 350 ALA C C     1 
ATOM   9342  O O     . ALA C 1 353 ? 1.448   29.331  104.404 1.00 28.84 ? 350 ALA C O     1 
ATOM   9343  C CB    . ALA C 1 353 ? 3.571   26.427  103.876 1.00 27.54 ? 350 ALA C CB    1 
ATOM   9344  N N     . MET C 1 354 ? 2.425   28.494  102.566 1.00 28.41 ? 351 MET C N     1 
ATOM   9345  C CA    . MET C 1 354 ? 1.724   29.400  101.673 1.00 28.88 ? 351 MET C CA    1 
ATOM   9346  C C     . MET C 1 354 ? 0.889   28.702  100.623 1.00 28.17 ? 351 MET C C     1 
ATOM   9347  O O     . MET C 1 354 ? 0.499   29.307  99.628  1.00 27.49 ? 351 MET C O     1 
ATOM   9348  C CB    . MET C 1 354 ? 2.736   30.316  100.990 1.00 28.56 ? 351 MET C CB    1 
ATOM   9349  C CG    . MET C 1 354 ? 3.409   31.296  101.931 1.00 32.29 ? 351 MET C CG    1 
ATOM   9350  S SD    . MET C 1 354 ? 2.309   32.638  102.441 1.00 33.89 ? 351 MET C SD    1 
ATOM   9351  C CE    . MET C 1 354 ? 2.635   33.879  101.152 1.00 32.76 ? 351 MET C CE    1 
ATOM   9352  N N     . GLY C 1 355 ? 0.618   27.424  100.839 1.00 27.94 ? 352 GLY C N     1 
ATOM   9353  C CA    . GLY C 1 355 ? -0.186  26.689  99.881  1.00 28.52 ? 352 GLY C CA    1 
ATOM   9354  C C     . GLY C 1 355 ? 0.562   26.409  98.597  1.00 28.56 ? 352 GLY C C     1 
ATOM   9355  O O     . GLY C 1 355 ? 1.760   26.687  98.482  1.00 29.23 ? 352 GLY C O     1 
ATOM   9356  N N     . HIS C 1 356 ? -0.152  25.851  97.629  1.00 26.18 ? 353 HIS C N     1 
ATOM   9357  C CA    . HIS C 1 356 ? 0.436   25.514  96.343  1.00 27.09 ? 353 HIS C CA    1 
ATOM   9358  C C     . HIS C 1 356 ? 1.064   26.727  95.661  1.00 26.35 ? 353 HIS C C     1 
ATOM   9359  O O     . HIS C 1 356 ? 0.604   27.857  95.828  1.00 25.53 ? 353 HIS C O     1 
ATOM   9360  C CB    . HIS C 1 356 ? -0.631  24.883  95.441  1.00 27.24 ? 353 HIS C CB    1 
ATOM   9361  C CG    . HIS C 1 356 ? -1.150  23.576  95.954  1.00 29.08 ? 353 HIS C CG    1 
ATOM   9362  N ND1   . HIS C 1 356 ? -2.222  22.922  95.387  1.00 30.83 ? 353 HIS C ND1   1 
ATOM   9363  C CD2   . HIS C 1 356 ? -0.748  22.803  96.991  1.00 31.03 ? 353 HIS C CD2   1 
ATOM   9364  C CE1   . HIS C 1 356 ? -2.461  21.804  96.049  1.00 28.59 ? 353 HIS C CE1   1 
ATOM   9365  N NE2   . HIS C 1 356 ? -1.579  21.708  97.027  1.00 30.61 ? 353 HIS C NE2   1 
ATOM   9366  N N     . PRO C 1 357 ? 2.155   26.512  94.910  1.00 26.60 ? 354 PRO C N     1 
ATOM   9367  C CA    . PRO C 1 357 ? 2.785   27.646  94.236  1.00 26.21 ? 354 PRO C CA    1 
ATOM   9368  C C     . PRO C 1 357 ? 1.819   28.255  93.240  1.00 24.88 ? 354 PRO C C     1 
ATOM   9369  O O     . PRO C 1 357 ? 0.840   27.630  92.842  1.00 23.34 ? 354 PRO C O     1 
ATOM   9370  C CB    . PRO C 1 357 ? 3.999   27.009  93.567  1.00 27.86 ? 354 PRO C CB    1 
ATOM   9371  C CG    . PRO C 1 357 ? 4.393   25.960  94.557  1.00 28.59 ? 354 PRO C CG    1 
ATOM   9372  C CD    . PRO C 1 357 ? 3.041   25.333  94.867  1.00 27.76 ? 354 PRO C CD    1 
ATOM   9373  N N     . SER C 1 358 ? 2.111   29.482  92.841  1.00 25.10 ? 355 SER C N     1 
ATOM   9374  C CA    . SER C 1 358 ? 1.267   30.206  91.898  1.00 25.89 ? 355 SER C CA    1 
ATOM   9375  C C     . SER C 1 358 ? 1.062   29.532  90.531  1.00 24.79 ? 355 SER C C     1 
ATOM   9376  O O     . SER C 1 358 ? -0.053  29.508  90.028  1.00 25.23 ? 355 SER C O     1 
ATOM   9377  C CB    . SER C 1 358 ? 1.817   31.626  91.714  1.00 24.72 ? 355 SER C CB    1 
ATOM   9378  O OG    . SER C 1 358 ? 3.229   31.613  91.624  1.00 27.21 ? 355 SER C OG    1 
ATOM   9379  N N     . PHE C 1 359 ? 2.118   28.983  89.937  1.00 24.78 ? 356 PHE C N     1 
ATOM   9380  C CA    . PHE C 1 359 ? 1.994   28.346  88.621  1.00 26.00 ? 356 PHE C CA    1 
ATOM   9381  C C     . PHE C 1 359 ? 0.924   27.249  88.566  1.00 27.43 ? 356 PHE C C     1 
ATOM   9382  O O     . PHE C 1 359 ? 0.038   27.272  87.710  1.00 26.79 ? 356 PHE C O     1 
ATOM   9383  C CB    . PHE C 1 359 ? 3.335   27.751  88.184  1.00 25.79 ? 356 PHE C CB    1 
ATOM   9384  C CG    . PHE C 1 359 ? 3.324   27.204  86.791  1.00 25.87 ? 356 PHE C CG    1 
ATOM   9385  C CD1   . PHE C 1 359 ? 3.417   28.055  85.693  1.00 26.53 ? 356 PHE C CD1   1 
ATOM   9386  C CD2   . PHE C 1 359 ? 3.193   25.837  86.569  1.00 26.55 ? 356 PHE C CD2   1 
ATOM   9387  C CE1   . PHE C 1 359 ? 3.381   27.560  84.397  1.00 23.79 ? 356 PHE C CE1   1 
ATOM   9388  C CE2   . PHE C 1 359 ? 3.155   25.326  85.269  1.00 27.88 ? 356 PHE C CE2   1 
ATOM   9389  C CZ    . PHE C 1 359 ? 3.250   26.195  84.180  1.00 26.28 ? 356 PHE C CZ    1 
ATOM   9390  N N     . VAL C 1 360 ? 1.008   26.284  89.474  1.00 26.66 ? 357 VAL C N     1 
ATOM   9391  C CA    . VAL C 1 360 ? 0.035   25.208  89.479  1.00 26.76 ? 357 VAL C CA    1 
ATOM   9392  C C     . VAL C 1 360 ? -1.398  25.709  89.723  1.00 26.93 ? 357 VAL C C     1 
ATOM   9393  O O     . VAL C 1 360 ? -2.325  25.294  89.023  1.00 26.50 ? 357 VAL C O     1 
ATOM   9394  C CB    . VAL C 1 360 ? 0.399   24.139  90.528  1.00 26.14 ? 357 VAL C CB    1 
ATOM   9395  C CG1   . VAL C 1 360 ? 0.335   24.724  91.920  1.00 25.36 ? 357 VAL C CG1   1 
ATOM   9396  C CG2   . VAL C 1 360 ? -0.516  22.951  90.385  1.00 23.55 ? 357 VAL C CG2   1 
ATOM   9397  N N     . MET C 1 361 ? -1.568  26.606  90.698  1.00 25.76 ? 358 MET C N     1 
ATOM   9398  C CA    . MET C 1 361 ? -2.878  27.163  91.038  1.00 25.24 ? 358 MET C CA    1 
ATOM   9399  C C     . MET C 1 361 ? -3.549  27.872  89.856  1.00 25.65 ? 358 MET C C     1 
ATOM   9400  O O     . MET C 1 361 ? -4.777  27.956  89.787  1.00 24.83 ? 358 MET C O     1 
ATOM   9401  C CB    . MET C 1 361 ? -2.759  28.123  92.234  1.00 24.90 ? 358 MET C CB    1 
ATOM   9402  C CG    . MET C 1 361 ? -2.651  27.430  93.597  1.00 23.69 ? 358 MET C CG    1 
ATOM   9403  S SD    . MET C 1 361 ? -3.869  26.079  93.822  1.00 26.73 ? 358 MET C SD    1 
ATOM   9404  C CE    . MET C 1 361 ? -5.453  26.985  93.944  1.00 20.87 ? 358 MET C CE    1 
ATOM   9405  N N     . SER C 1 362 ? -2.732  28.366  88.932  1.00 24.97 ? 359 SER C N     1 
ATOM   9406  C CA    . SER C 1 362 ? -3.222  29.022  87.735  1.00 26.55 ? 359 SER C CA    1 
ATOM   9407  C C     . SER C 1 362 ? -4.129  28.033  87.011  1.00 26.81 ? 359 SER C C     1 
ATOM   9408  O O     . SER C 1 362 ? -5.165  28.405  86.470  1.00 26.99 ? 359 SER C O     1 
ATOM   9409  C CB    . SER C 1 362 ? -2.046  29.404  86.815  1.00 27.40 ? 359 SER C CB    1 
ATOM   9410  O OG    . SER C 1 362 ? -2.497  30.055  85.640  1.00 24.72 ? 359 SER C OG    1 
ATOM   9411  N N     . ASN C 1 363 ? -3.726  26.768  87.003  1.00 27.61 ? 360 ASN C N     1 
ATOM   9412  C CA    . ASN C 1 363 ? -4.506  25.724  86.358  1.00 28.58 ? 360 ASN C CA    1 
ATOM   9413  C C     . ASN C 1 363 ? -5.910  25.647  86.902  1.00 28.80 ? 360 ASN C C     1 
ATOM   9414  O O     . ASN C 1 363 ? -6.887  25.807  86.164  1.00 28.43 ? 360 ASN C O     1 
ATOM   9415  C CB    . ASN C 1 363 ? -3.833  24.372  86.547  1.00 29.99 ? 360 ASN C CB    1 
ATOM   9416  C CG    . ASN C 1 363 ? -3.055  23.943  85.331  1.00 32.34 ? 360 ASN C CG    1 
ATOM   9417  O OD1   . ASN C 1 363 ? -2.564  24.781  84.570  1.00 31.53 ? 360 ASN C OD1   1 
ATOM   9418  N ND2   . ASN C 1 363 ? -2.928  22.628  85.139  1.00 32.51 ? 360 ASN C ND2   1 
ATOM   9419  N N     . SER C 1 364 ? -6.002  25.385  88.202  1.00 30.58 ? 361 SER C N     1 
ATOM   9420  C CA    . SER C 1 364 ? -7.293  25.264  88.869  1.00 33.13 ? 361 SER C CA    1 
ATOM   9421  C C     . SER C 1 364 ? -8.106  26.563  88.832  1.00 33.63 ? 361 SER C C     1 
ATOM   9422  O O     . SER C 1 364 ? -9.330  26.527  88.653  1.00 35.43 ? 361 SER C O     1 
ATOM   9423  C CB    . SER C 1 364 ? -7.098  24.788  90.310  1.00 31.80 ? 361 SER C CB    1 
ATOM   9424  O OG    . SER C 1 364 ? -6.032  25.484  90.923  1.00 36.69 ? 361 SER C OG    1 
ATOM   9425  N N     . PHE C 1 365 ? -7.442  27.704  88.994  1.00 31.78 ? 362 PHE C N     1 
ATOM   9426  C CA    . PHE C 1 365 ? -8.147  28.974  88.963  1.00 31.46 ? 362 PHE C CA    1 
ATOM   9427  C C     . PHE C 1 365 ? -8.609  29.358  87.567  1.00 32.82 ? 362 PHE C C     1 
ATOM   9428  O O     . PHE C 1 365 ? -9.612  30.051  87.410  1.00 32.95 ? 362 PHE C O     1 
ATOM   9429  C CB    . PHE C 1 365 ? -7.286  30.078  89.576  1.00 29.86 ? 362 PHE C CB    1 
ATOM   9430  C CG    . PHE C 1 365 ? -7.238  30.025  91.081  1.00 29.81 ? 362 PHE C CG    1 
ATOM   9431  C CD1   . PHE C 1 365 ? -8.005  29.090  91.781  1.00 28.65 ? 362 PHE C CD1   1 
ATOM   9432  C CD2   . PHE C 1 365 ? -6.439  30.904  91.800  1.00 28.57 ? 362 PHE C CD2   1 
ATOM   9433  C CE1   . PHE C 1 365 ? -7.972  29.036  93.163  1.00 27.72 ? 362 PHE C CE1   1 
ATOM   9434  C CE2   . PHE C 1 365 ? -6.399  30.857  93.186  1.00 28.91 ? 362 PHE C CE2   1 
ATOM   9435  C CZ    . PHE C 1 365 ? -7.168  29.921  93.870  1.00 28.82 ? 362 PHE C CZ    1 
ATOM   9436  N N     . THR C 1 366 ? -7.891  28.908  86.547  1.00 33.32 ? 363 THR C N     1 
ATOM   9437  C CA    . THR C 1 366 ? -8.315  29.201  85.187  1.00 34.67 ? 363 THR C CA    1 
ATOM   9438  C C     . THR C 1 366 ? -9.593  28.396  84.898  1.00 37.41 ? 363 THR C C     1 
ATOM   9439  O O     . THR C 1 366 ? -10.479 28.860  84.172  1.00 37.95 ? 363 THR C O     1 
ATOM   9440  C CB    . THR C 1 366 ? -7.223  28.834  84.174  1.00 33.64 ? 363 THR C CB    1 
ATOM   9441  O OG1   . THR C 1 366 ? -6.153  29.785  84.270  1.00 35.13 ? 363 THR C OG1   1 
ATOM   9442  C CG2   . THR C 1 366 ? -7.773  28.825  82.761  1.00 32.74 ? 363 THR C CG2   1 
ATOM   9443  N N     . ASN C 1 367 ? -9.678  27.193  85.475  1.00 38.42 ? 364 ASN C N     1 
ATOM   9444  C CA    . ASN C 1 367 ? -10.846 26.314  85.318  1.00 39.38 ? 364 ASN C CA    1 
ATOM   9445  C C     . ASN C 1 367 ? -12.022 26.950  86.050  1.00 39.86 ? 364 ASN C C     1 
ATOM   9446  O O     . ASN C 1 367 ? -13.188 26.801  85.657  1.00 38.89 ? 364 ASN C O     1 
ATOM   9447  C CB    . ASN C 1 367 ? -10.579 24.935  85.934  1.00 38.19 ? 364 ASN C CB    1 
ATOM   9448  C CG    . ASN C 1 367 ? -9.922  23.978  84.970  1.00 39.81 ? 364 ASN C CG    1 
ATOM   9449  O OD1   . ASN C 1 367 ? -10.534 23.559  83.987  1.00 40.93 ? 364 ASN C OD1   1 
ATOM   9450  N ND2   . ASN C 1 367 ? -8.671  23.616  85.248  1.00 38.73 ? 364 ASN C ND2   1 
ATOM   9451  N N     . GLN C 1 368 ? -11.680 27.640  87.134  1.00 39.93 ? 365 GLN C N     1 
ATOM   9452  C CA    . GLN C 1 368 ? -12.638 28.330  87.972  1.00 39.93 ? 365 GLN C CA    1 
ATOM   9453  C C     . GLN C 1 368 ? -13.208 29.488  87.156  1.00 39.43 ? 365 GLN C C     1 
ATOM   9454  O O     . GLN C 1 368 ? -14.414 29.708  87.132  1.00 39.43 ? 365 GLN C O     1 
ATOM   9455  C CB    . GLN C 1 368 ? -11.935 28.859  89.220  1.00 42.26 ? 365 GLN C CB    1 
ATOM   9456  C CG    . GLN C 1 368 ? -12.852 29.126  90.393  1.00 46.00 ? 365 GLN C CG    1 
ATOM   9457  C CD    . GLN C 1 368 ? -13.314 27.856  91.068  1.00 47.58 ? 365 GLN C CD    1 
ATOM   9458  O OE1   . GLN C 1 368 ? -13.687 26.900  90.407  1.00 50.14 ? 365 GLN C OE1   1 
ATOM   9459  N NE2   . GLN C 1 368 ? -13.291 27.843  92.396  1.00 48.24 ? 365 GLN C NE2   1 
ATOM   9460  N N     . VAL C 1 369 ? -12.342 30.225  86.471  1.00 39.71 ? 366 VAL C N     1 
ATOM   9461  C CA    . VAL C 1 369 ? -12.808 31.349  85.670  1.00 40.35 ? 366 VAL C CA    1 
ATOM   9462  C C     . VAL C 1 369 ? -13.676 30.879  84.502  1.00 40.99 ? 366 VAL C C     1 
ATOM   9463  O O     . VAL C 1 369 ? -14.725 31.466  84.242  1.00 41.81 ? 366 VAL C O     1 
ATOM   9464  C CB    . VAL C 1 369 ? -11.628 32.207  85.130  1.00 39.47 ? 366 VAL C CB    1 
ATOM   9465  C CG1   . VAL C 1 369 ? -12.161 33.372  84.321  1.00 39.08 ? 366 VAL C CG1   1 
ATOM   9466  C CG2   . VAL C 1 369 ? -10.796 32.733  86.282  1.00 38.70 ? 366 VAL C CG2   1 
ATOM   9467  N N     . MET C 1 370 ? -13.250 29.825  83.807  1.00 40.69 ? 367 MET C N     1 
ATOM   9468  C CA    . MET C 1 370 ? -14.023 29.296  82.684  1.00 41.12 ? 367 MET C CA    1 
ATOM   9469  C C     . MET C 1 370 ? -15.392 28.801  83.175  1.00 41.38 ? 367 MET C C     1 
ATOM   9470  O O     . MET C 1 370 ? -16.378 28.829  82.434  1.00 39.87 ? 367 MET C O     1 
ATOM   9471  C CB    . MET C 1 370 ? -13.280 28.137  82.005  1.00 41.75 ? 367 MET C CB    1 
ATOM   9472  C CG    . MET C 1 370 ? -11.911 28.482  81.436  1.00 43.01 ? 367 MET C CG    1 
ATOM   9473  S SD    . MET C 1 370 ? -11.075 27.000  80.777  1.00 44.55 ? 367 MET C SD    1 
ATOM   9474  C CE    . MET C 1 370 ? -10.740 27.491  79.054  1.00 43.79 ? 367 MET C CE    1 
ATOM   9475  N N     . ALA C 1 371 ? -15.438 28.348  84.426  1.00 41.19 ? 368 ALA C N     1 
ATOM   9476  C CA    . ALA C 1 371 ? -16.672 27.855  85.023  1.00 41.43 ? 368 ALA C CA    1 
ATOM   9477  C C     . ALA C 1 371 ? -17.653 29.006  85.243  1.00 42.04 ? 368 ALA C C     1 
ATOM   9478  O O     . ALA C 1 371 ? -18.824 28.907  84.883  1.00 42.90 ? 368 ALA C O     1 
ATOM   9479  C CB    . ALA C 1 371 ? -16.378 27.162  86.347  1.00 39.77 ? 368 ALA C CB    1 
ATOM   9480  N N     . GLN C 1 372 ? -17.175 30.095  85.839  1.00 42.20 ? 369 GLN C N     1 
ATOM   9481  C CA    . GLN C 1 372 ? -18.031 31.246  86.085  1.00 42.45 ? 369 GLN C CA    1 
ATOM   9482  C C     . GLN C 1 372 ? -18.575 31.756  84.757  1.00 42.24 ? 369 GLN C C     1 
ATOM   9483  O O     . GLN C 1 372 ? -19.786 31.857  84.569  1.00 42.62 ? 369 GLN C O     1 
ATOM   9484  C CB    . GLN C 1 372 ? -17.247 32.350  86.793  1.00 43.08 ? 369 GLN C CB    1 
ATOM   9485  C CG    . GLN C 1 372 ? -16.821 32.000  88.214  1.00 45.16 ? 369 GLN C CG    1 
ATOM   9486  C CD    . GLN C 1 372 ? -18.000 31.827  89.159  1.00 46.73 ? 369 GLN C CD    1 
ATOM   9487  O OE1   . GLN C 1 372 ? -18.852 32.711  89.279  1.00 46.10 ? 369 GLN C OE1   1 
ATOM   9488  N NE2   . GLN C 1 372 ? -18.048 30.685  89.845  1.00 46.54 ? 369 GLN C NE2   1 
ATOM   9489  N N     . ILE C 1 373 ? -17.668 32.056  83.833  1.00 42.06 ? 370 ILE C N     1 
ATOM   9490  C CA    . ILE C 1 373 ? -18.034 32.539  82.504  1.00 40.38 ? 370 ILE C CA    1 
ATOM   9491  C C     . ILE C 1 373 ? -19.018 31.606  81.807  1.00 41.43 ? 370 ILE C C     1 
ATOM   9492  O O     . ILE C 1 373 ? -19.926 32.049  81.115  1.00 40.70 ? 370 ILE C O     1 
ATOM   9493  C CB    . ILE C 1 373 ? -16.809 32.645  81.604  1.00 37.54 ? 370 ILE C CB    1 
ATOM   9494  C CG1   . ILE C 1 373 ? -15.830 33.664  82.169  1.00 37.46 ? 370 ILE C CG1   1 
ATOM   9495  C CG2   . ILE C 1 373 ? -17.235 33.003  80.188  1.00 38.69 ? 370 ILE C CG2   1 
ATOM   9496  C CD1   . ILE C 1 373 ? -14.536 33.740  81.396  1.00 36.79 ? 370 ILE C CD1   1 
ATOM   9497  N N     . GLU C 1 374 ? -18.813 30.307  81.985  1.00 44.91 ? 371 GLU C N     1 
ATOM   9498  C CA    . GLU C 1 374 ? -19.647 29.278  81.354  1.00 47.33 ? 371 GLU C CA    1 
ATOM   9499  C C     . GLU C 1 374 ? -21.017 29.227  82.013  1.00 49.35 ? 371 GLU C C     1 
ATOM   9500  O O     . GLU C 1 374 ? -22.058 29.294  81.352  1.00 48.97 ? 371 GLU C O     1 
ATOM   9501  C CB    . GLU C 1 374 ? -18.952 27.918  81.491  1.00 46.52 ? 371 GLU C CB    1 
ATOM   9502  C CG    . GLU C 1 374 ? -19.413 26.831  80.544  1.00 46.34 ? 371 GLU C CG    1 
ATOM   9503  C CD    . GLU C 1 374 ? -19.190 27.172  79.081  1.00 46.80 ? 371 GLU C CD    1 
ATOM   9504  O OE1   . GLU C 1 374 ? -18.243 27.923  78.768  1.00 43.86 ? 371 GLU C OE1   1 
ATOM   9505  O OE2   . GLU C 1 374 ? -19.962 26.664  78.238  1.00 47.76 ? 371 GLU C OE2   1 
ATOM   9506  N N     . LEU C 1 375 ? -20.998 29.116  83.334  1.00 51.45 ? 372 LEU C N     1 
ATOM   9507  C CA    . LEU C 1 375 ? -22.211 29.030  84.124  1.00 53.10 ? 372 LEU C CA    1 
ATOM   9508  C C     . LEU C 1 375 ? -22.993 30.349  84.143  1.00 54.54 ? 372 LEU C C     1 
ATOM   9509  O O     . LEU C 1 375 ? -24.129 30.393  84.613  1.00 56.62 ? 372 LEU C O     1 
ATOM   9510  C CB    . LEU C 1 375 ? -21.838 28.605  85.543  1.00 51.61 ? 372 LEU C CB    1 
ATOM   9511  C CG    . LEU C 1 375 ? -22.754 27.613  86.253  1.00 51.94 ? 372 LEU C CG    1 
ATOM   9512  C CD1   . LEU C 1 375 ? -23.084 26.450  85.338  1.00 52.13 ? 372 LEU C CD1   1 
ATOM   9513  C CD2   . LEU C 1 375 ? -22.059 27.125  87.509  1.00 51.65 ? 372 LEU C CD2   1 
ATOM   9514  N N     . TRP C 1 376 ? -22.392 31.416  83.623  1.00 54.82 ? 373 TRP C N     1 
ATOM   9515  C CA    . TRP C 1 376 ? -23.041 32.724  83.604  1.00 54.66 ? 373 TRP C CA    1 
ATOM   9516  C C     . TRP C 1 376 ? -23.609 33.124  82.245  1.00 54.05 ? 373 TRP C C     1 
ATOM   9517  O O     . TRP C 1 376 ? -24.752 33.558  82.152  1.00 54.66 ? 373 TRP C O     1 
ATOM   9518  C CB    . TRP C 1 376 ? -22.058 33.791  84.086  1.00 56.10 ? 373 TRP C CB    1 
ATOM   9519  C CG    . TRP C 1 376 ? -22.618 35.178  84.074  1.00 57.81 ? 373 TRP C CG    1 
ATOM   9520  C CD1   . TRP C 1 376 ? -22.353 36.162  83.163  1.00 57.38 ? 373 TRP C CD1   1 
ATOM   9521  C CD2   . TRP C 1 376 ? -23.563 35.729  84.999  1.00 58.50 ? 373 TRP C CD2   1 
ATOM   9522  N NE1   . TRP C 1 376 ? -23.077 37.292  83.464  1.00 57.99 ? 373 TRP C NE1   1 
ATOM   9523  C CE2   . TRP C 1 376 ? -23.829 37.053  84.586  1.00 58.68 ? 373 TRP C CE2   1 
ATOM   9524  C CE3   . TRP C 1 376 ? -24.213 35.231  86.136  1.00 58.32 ? 373 TRP C CE3   1 
ATOM   9525  C CZ2   . TRP C 1 376 ? -24.720 37.888  85.271  1.00 59.28 ? 373 TRP C CZ2   1 
ATOM   9526  C CZ3   . TRP C 1 376 ? -25.099 36.062  86.817  1.00 59.76 ? 373 TRP C CZ3   1 
ATOM   9527  C CH2   . TRP C 1 376 ? -25.343 37.376  86.380  1.00 59.49 ? 373 TRP C CH2   1 
ATOM   9528  N N     . THR C 1 377 ? -22.806 32.974  81.197  1.00 53.45 ? 374 THR C N     1 
ATOM   9529  C CA    . THR C 1 377 ? -23.224 33.320  79.845  1.00 53.51 ? 374 THR C CA    1 
ATOM   9530  C C     . THR C 1 377 ? -24.001 32.203  79.147  1.00 54.06 ? 374 THR C C     1 
ATOM   9531  O O     . THR C 1 377 ? -24.784 32.460  78.235  1.00 53.41 ? 374 THR C O     1 
ATOM   9532  C CB    . THR C 1 377 ? -22.008 33.686  78.950  1.00 53.97 ? 374 THR C CB    1 
ATOM   9533  O OG1   . THR C 1 377 ? -21.091 32.583  78.907  1.00 54.03 ? 374 THR C OG1   1 
ATOM   9534  C CG2   . THR C 1 377 ? -21.292 34.917  79.487  1.00 53.72 ? 374 THR C CG2   1 
ATOM   9535  N N     . HIS C 1 378 ? -23.796 30.964  79.574  1.00 54.67 ? 375 HIS C N     1 
ATOM   9536  C CA    . HIS C 1 378 ? -24.484 29.842  78.946  1.00 56.49 ? 375 HIS C CA    1 
ATOM   9537  C C     . HIS C 1 378 ? -25.305 29.036  79.950  1.00 58.64 ? 375 HIS C C     1 
ATOM   9538  O O     . HIS C 1 378 ? -25.221 27.805  79.995  1.00 57.83 ? 375 HIS C O     1 
ATOM   9539  C CB    . HIS C 1 378 ? -23.462 28.930  78.275  1.00 55.87 ? 375 HIS C CB    1 
ATOM   9540  C CG    . HIS C 1 378 ? -22.607 29.623  77.262  1.00 55.81 ? 375 HIS C CG    1 
ATOM   9541  N ND1   . HIS C 1 378 ? -21.346 29.178  76.925  1.00 56.62 ? 375 HIS C ND1   1 
ATOM   9542  C CD2   . HIS C 1 378 ? -22.842 30.703  76.480  1.00 56.79 ? 375 HIS C CD2   1 
ATOM   9543  C CE1   . HIS C 1 378 ? -20.843 29.950  75.979  1.00 57.05 ? 375 HIS C CE1   1 
ATOM   9544  N NE2   . HIS C 1 378 ? -21.732 30.885  75.690  1.00 56.67 ? 375 HIS C NE2   1 
ATOM   9545  N N     . PRO C 1 379 ? -26.127 29.722  80.759  1.00 60.70 ? 376 PRO C N     1 
ATOM   9546  C CA    . PRO C 1 379 ? -26.950 29.034  81.755  1.00 62.12 ? 376 PRO C CA    1 
ATOM   9547  C C     . PRO C 1 379 ? -27.942 28.095  81.085  1.00 64.04 ? 376 PRO C C     1 
ATOM   9548  O O     . PRO C 1 379 ? -28.324 27.066  81.647  1.00 64.15 ? 376 PRO C O     1 
ATOM   9549  C CB    . PRO C 1 379 ? -27.631 30.186  82.484  1.00 61.90 ? 376 PRO C CB    1 
ATOM   9550  C CG    . PRO C 1 379 ? -27.824 31.185  81.385  1.00 61.64 ? 376 PRO C CG    1 
ATOM   9551  C CD    . PRO C 1 379 ? -26.500 31.146  80.662  1.00 60.69 ? 376 PRO C CD    1 
ATOM   9552  N N     . ASP C 1 380 ? -28.352 28.463  79.874  1.00 65.88 ? 377 ASP C N     1 
ATOM   9553  C CA    . ASP C 1 380 ? -29.292 27.660  79.106  1.00 67.77 ? 377 ASP C CA    1 
ATOM   9554  C C     . ASP C 1 380 ? -28.531 26.492  78.500  1.00 67.73 ? 377 ASP C C     1 
ATOM   9555  O O     . ASP C 1 380 ? -28.680 26.174  77.318  1.00 67.97 ? 377 ASP C O     1 
ATOM   9556  C CB    . ASP C 1 380 ? -29.931 28.497  77.993  1.00 70.55 ? 377 ASP C CB    1 
ATOM   9557  C CG    . ASP C 1 380 ? -30.610 29.758  78.518  1.00 72.50 ? 377 ASP C CG    1 
ATOM   9558  O OD1   . ASP C 1 380 ? -29.894 30.671  78.987  1.00 73.81 ? 377 ASP C OD1   1 
ATOM   9559  O OD2   . ASP C 1 380 ? -31.859 29.834  78.464  1.00 73.24 ? 377 ASP C OD2   1 
ATOM   9560  N N     . LYS C 1 381 ? -27.694 25.866  79.316  1.00 66.65 ? 378 LYS C N     1 
ATOM   9561  C CA    . LYS C 1 381 ? -26.915 24.731  78.858  1.00 65.67 ? 378 LYS C CA    1 
ATOM   9562  C C     . LYS C 1 381 ? -26.471 23.938  80.077  1.00 64.08 ? 378 LYS C C     1 
ATOM   9563  O O     . LYS C 1 381 ? -25.889 22.866  79.958  1.00 63.54 ? 378 LYS C O     1 
ATOM   9564  C CB    . LYS C 1 381 ? -25.700 25.205  78.041  1.00 65.68 ? 378 LYS C CB    1 
ATOM   9565  C CG    . LYS C 1 381 ? -25.158 24.145  77.081  1.00 66.32 ? 378 LYS C CG    1 
ATOM   9566  C CD    . LYS C 1 381 ? -24.091 24.697  76.139  1.00 67.16 ? 378 LYS C CD    1 
ATOM   9567  C CE    . LYS C 1 381 ? -22.833 25.122  76.884  1.00 67.08 ? 378 LYS C CE    1 
ATOM   9568  N NZ    . LYS C 1 381 ? -21.781 25.595  75.943  1.00 66.77 ? 378 LYS C NZ    1 
ATOM   9569  N N     . TYR C 1 382 ? -26.759 24.467  81.258  1.00 62.24 ? 379 TYR C N     1 
ATOM   9570  C CA    . TYR C 1 382 ? -26.389 23.774  82.479  1.00 61.94 ? 379 TYR C CA    1 
ATOM   9571  C C     . TYR C 1 382 ? -27.569 23.645  83.427  1.00 62.05 ? 379 TYR C C     1 
ATOM   9572  O O     . TYR C 1 382 ? -27.832 24.540  84.230  1.00 62.16 ? 379 TYR C O     1 
ATOM   9573  C CB    . TYR C 1 382 ? -25.238 24.497  83.187  1.00 61.61 ? 379 TYR C CB    1 
ATOM   9574  C CG    . TYR C 1 382 ? -23.905 24.393  82.475  1.00 59.93 ? 379 TYR C CG    1 
ATOM   9575  C CD1   . TYR C 1 382 ? -23.573 25.263  81.439  1.00 58.14 ? 379 TYR C CD1   1 
ATOM   9576  C CD2   . TYR C 1 382 ? -22.980 23.413  82.837  1.00 58.86 ? 379 TYR C CD2   1 
ATOM   9577  C CE1   . TYR C 1 382 ? -22.356 25.164  80.783  1.00 57.78 ? 379 TYR C CE1   1 
ATOM   9578  C CE2   . TYR C 1 382 ? -21.761 23.305  82.185  1.00 58.18 ? 379 TYR C CE2   1 
ATOM   9579  C CZ    . TYR C 1 382 ? -21.454 24.183  81.159  1.00 57.89 ? 379 TYR C CZ    1 
ATOM   9580  O OH    . TYR C 1 382 ? -20.248 24.081  80.504  1.00 58.16 ? 379 TYR C OH    1 
ATOM   9581  N N     . PRO C 1 383 ? -28.302 22.524  83.344  1.00 62.04 ? 380 PRO C N     1 
ATOM   9582  C CA    . PRO C 1 383 ? -29.457 22.300  84.215  1.00 61.29 ? 380 PRO C CA    1 
ATOM   9583  C C     . PRO C 1 383 ? -29.027 22.267  85.673  1.00 60.50 ? 380 PRO C C     1 
ATOM   9584  O O     . PRO C 1 383 ? -27.863 22.510  85.992  1.00 60.59 ? 380 PRO C O     1 
ATOM   9585  C CB    . PRO C 1 383 ? -29.986 20.950  83.744  1.00 61.16 ? 380 PRO C CB    1 
ATOM   9586  C CG    . PRO C 1 383 ? -29.625 20.939  82.294  1.00 61.79 ? 380 PRO C CG    1 
ATOM   9587  C CD    . PRO C 1 383 ? -28.209 21.461  82.329  1.00 62.17 ? 380 PRO C CD    1 
ATOM   9588  N N     . VAL C 1 384 ? -29.970 21.969  86.556  1.00 59.75 ? 381 VAL C N     1 
ATOM   9589  C CA    . VAL C 1 384 ? -29.665 21.897  87.971  1.00 58.58 ? 381 VAL C CA    1 
ATOM   9590  C C     . VAL C 1 384 ? -28.949 20.577  88.220  1.00 57.81 ? 381 VAL C C     1 
ATOM   9591  O O     . VAL C 1 384 ? -29.515 19.501  88.057  1.00 58.21 ? 381 VAL C O     1 
ATOM   9592  C CB    . VAL C 1 384 ? -30.949 21.973  88.825  1.00 59.07 ? 381 VAL C CB    1 
ATOM   9593  C CG1   . VAL C 1 384 ? -30.600 21.886  90.311  1.00 58.30 ? 381 VAL C CG1   1 
ATOM   9594  C CG2   . VAL C 1 384 ? -31.692 23.271  88.522  1.00 57.93 ? 381 VAL C CG2   1 
ATOM   9595  N N     . GLY C 1 385 ? -27.686 20.671  88.598  1.00 57.14 ? 382 GLY C N     1 
ATOM   9596  C CA    . GLY C 1 385 ? -26.906 19.482  88.853  1.00 55.33 ? 382 GLY C CA    1 
ATOM   9597  C C     . GLY C 1 385 ? -25.449 19.820  88.648  1.00 54.51 ? 382 GLY C C     1 
ATOM   9598  O O     . GLY C 1 385 ? -25.123 20.915  88.172  1.00 54.58 ? 382 GLY C O     1 
ATOM   9599  N N     . VAL C 1 386 ? -24.572 18.890  89.005  1.00 52.98 ? 383 VAL C N     1 
ATOM   9600  C CA    . VAL C 1 386 ? -23.143 19.111  88.853  1.00 50.67 ? 383 VAL C CA    1 
ATOM   9601  C C     . VAL C 1 386 ? -22.661 18.606  87.498  1.00 48.69 ? 383 VAL C C     1 
ATOM   9602  O O     . VAL C 1 386 ? -23.001 17.491  87.089  1.00 47.34 ? 383 VAL C O     1 
ATOM   9603  C CB    . VAL C 1 386 ? -22.378 18.408  89.972  1.00 51.95 ? 383 VAL C CB    1 
ATOM   9604  C CG1   . VAL C 1 386 ? -22.877 16.984  90.104  1.00 52.85 ? 383 VAL C CG1   1 
ATOM   9605  C CG2   . VAL C 1 386 ? -20.881 18.438  89.682  1.00 54.47 ? 383 VAL C CG2   1 
ATOM   9606  N N     . HIS C 1 387 ? -21.881 19.445  86.810  1.00 47.08 ? 384 HIS C N     1 
ATOM   9607  C CA    . HIS C 1 387 ? -21.323 19.131  85.490  1.00 45.52 ? 384 HIS C CA    1 
ATOM   9608  C C     . HIS C 1 387 ? -19.813 19.388  85.424  1.00 43.89 ? 384 HIS C C     1 
ATOM   9609  O O     . HIS C 1 387 ? -19.224 19.967  86.340  1.00 42.31 ? 384 HIS C O     1 
ATOM   9610  C CB    . HIS C 1 387 ? -22.002 19.979  84.403  1.00 46.33 ? 384 HIS C CB    1 
ATOM   9611  C CG    . HIS C 1 387 ? -23.495 19.967  84.466  1.00 46.99 ? 384 HIS C CG    1 
ATOM   9612  N ND1   . HIS C 1 387 ? -24.207 20.737  85.360  1.00 47.93 ? 384 HIS C ND1   1 
ATOM   9613  C CD2   . HIS C 1 387 ? -24.410 19.252  83.772  1.00 46.67 ? 384 HIS C CD2   1 
ATOM   9614  C CE1   . HIS C 1 387 ? -25.497 20.495  85.219  1.00 48.12 ? 384 HIS C CE1   1 
ATOM   9615  N NE2   . HIS C 1 387 ? -25.647 19.596  84.262  1.00 48.43 ? 384 HIS C NE2   1 
ATOM   9616  N N     . PHE C 1 388 ? -19.205 18.961  84.319  1.00 42.96 ? 385 PHE C N     1 
ATOM   9617  C CA    . PHE C 1 388 ? -17.771 19.138  84.073  1.00 42.29 ? 385 PHE C CA    1 
ATOM   9618  C C     . PHE C 1 388 ? -17.616 20.074  82.887  1.00 42.24 ? 385 PHE C C     1 
ATOM   9619  O O     . PHE C 1 388 ? -18.547 20.221  82.097  1.00 41.71 ? 385 PHE C O     1 
ATOM   9620  C CB    . PHE C 1 388 ? -17.113 17.806  83.697  1.00 41.39 ? 385 PHE C CB    1 
ATOM   9621  C CG    . PHE C 1 388 ? -17.337 16.711  84.694  1.00 41.31 ? 385 PHE C CG    1 
ATOM   9622  C CD1   . PHE C 1 388 ? -16.856 16.830  85.992  1.00 41.46 ? 385 PHE C CD1   1 
ATOM   9623  C CD2   . PHE C 1 388 ? -18.025 15.557  84.337  1.00 39.84 ? 385 PHE C CD2   1 
ATOM   9624  C CE1   . PHE C 1 388 ? -17.056 15.814  86.917  1.00 41.68 ? 385 PHE C CE1   1 
ATOM   9625  C CE2   . PHE C 1 388 ? -18.231 14.538  85.254  1.00 38.49 ? 385 PHE C CE2   1 
ATOM   9626  C CZ    . PHE C 1 388 ? -17.747 14.665  86.545  1.00 39.67 ? 385 PHE C CZ    1 
ATOM   9627  N N     . LEU C 1 389 ? -16.448 20.698  82.754  1.00 41.85 ? 386 LEU C N     1 
ATOM   9628  C CA    . LEU C 1 389 ? -16.194 21.583  81.621  1.00 41.69 ? 386 LEU C CA    1 
ATOM   9629  C C     . LEU C 1 389 ? -15.873 20.692  80.426  1.00 41.66 ? 386 LEU C C     1 
ATOM   9630  O O     . LEU C 1 389 ? -15.391 19.569  80.590  1.00 42.89 ? 386 LEU C O     1 
ATOM   9631  C CB    . LEU C 1 389 ? -15.005 22.518  81.890  1.00 42.84 ? 386 LEU C CB    1 
ATOM   9632  C CG    . LEU C 1 389 ? -15.118 23.645  82.921  1.00 44.71 ? 386 LEU C CG    1 
ATOM   9633  C CD1   . LEU C 1 389 ? -16.316 24.547  82.609  1.00 44.44 ? 386 LEU C CD1   1 
ATOM   9634  C CD2   . LEU C 1 389 ? -15.258 23.040  84.303  1.00 46.77 ? 386 LEU C CD2   1 
ATOM   9635  N N     . PRO C 1 390 ? -16.140 21.172  79.205  1.00 40.95 ? 387 PRO C N     1 
ATOM   9636  C CA    . PRO C 1 390 ? -15.843 20.345  78.035  1.00 39.97 ? 387 PRO C CA    1 
ATOM   9637  C C     . PRO C 1 390 ? -14.339 20.075  77.975  1.00 38.76 ? 387 PRO C C     1 
ATOM   9638  O O     . PRO C 1 390 ? -13.540 20.950  78.297  1.00 38.14 ? 387 PRO C O     1 
ATOM   9639  C CB    . PRO C 1 390 ? -16.331 21.208  76.873  1.00 41.24 ? 387 PRO C CB    1 
ATOM   9640  C CG    . PRO C 1 390 ? -17.444 22.021  77.501  1.00 42.17 ? 387 PRO C CG    1 
ATOM   9641  C CD    . PRO C 1 390 ? -16.819 22.415  78.811  1.00 41.55 ? 387 PRO C CD    1 
ATOM   9642  N N     . LYS C 1 391 ? -13.956 18.867  77.572  1.00 37.65 ? 388 LYS C N     1 
ATOM   9643  C CA    . LYS C 1 391 ? -12.547 18.515  77.493  1.00 37.03 ? 388 LYS C CA    1 
ATOM   9644  C C     . LYS C 1 391 ? -11.787 19.521  76.627  1.00 37.73 ? 388 LYS C C     1 
ATOM   9645  O O     . LYS C 1 391 ? -10.570 19.668  76.747  1.00 39.30 ? 388 LYS C O     1 
ATOM   9646  C CB    . LYS C 1 391 ? -12.378 17.092  76.944  1.00 35.47 ? 388 LYS C CB    1 
ATOM   9647  C CG    . LYS C 1 391 ? -10.940 16.562  77.018  1.00 31.32 ? 388 LYS C CG    1 
ATOM   9648  C CD    . LYS C 1 391 ? -10.808 15.109  76.520  1.00 31.29 ? 388 LYS C CD    1 
ATOM   9649  C CE    . LYS C 1 391 ? -11.462 14.098  77.469  1.00 29.03 ? 388 LYS C CE    1 
ATOM   9650  N NZ    . LYS C 1 391 ? -10.924 14.146  78.856  1.00 28.94 ? 388 LYS C NZ    1 
ATOM   9651  N N     . LYS C 1 392 ? -12.502 20.230  75.766  1.00 37.06 ? 389 LYS C N     1 
ATOM   9652  C CA    . LYS C 1 392 ? -11.857 21.214  74.910  1.00 37.54 ? 389 LYS C CA    1 
ATOM   9653  C C     . LYS C 1 392 ? -11.306 22.347  75.779  1.00 36.19 ? 389 LYS C C     1 
ATOM   9654  O O     . LYS C 1 392 ? -10.219 22.869  75.527  1.00 36.28 ? 389 LYS C O     1 
ATOM   9655  C CB    . LYS C 1 392 ? -12.863 21.768  73.905  1.00 39.70 ? 389 LYS C CB    1 
ATOM   9656  C CG    . LYS C 1 392 ? -12.231 22.513  72.749  1.00 42.59 ? 389 LYS C CG    1 
ATOM   9657  C CD    . LYS C 1 392 ? -12.054 21.596  71.547  1.00 43.92 ? 389 LYS C CD    1 
ATOM   9658  C CE    . LYS C 1 392 ? -11.644 22.383  70.315  1.00 43.89 ? 389 LYS C CE    1 
ATOM   9659  N NZ    . LYS C 1 392 ? -11.634 21.522  69.103  1.00 44.41 ? 389 LYS C NZ    1 
ATOM   9660  N N     . LEU C 1 393 ? -12.071 22.715  76.803  1.00 34.66 ? 390 LEU C N     1 
ATOM   9661  C CA    . LEU C 1 393 ? -11.682 23.760  77.740  1.00 34.12 ? 390 LEU C CA    1 
ATOM   9662  C C     . LEU C 1 393 ? -10.608 23.225  78.681  1.00 34.83 ? 390 LEU C C     1 
ATOM   9663  O O     . LEU C 1 393 ? -9.619  23.916  78.962  1.00 34.59 ? 390 LEU C O     1 
ATOM   9664  C CB    . LEU C 1 393 ? -12.890 24.214  78.566  1.00 33.31 ? 390 LEU C CB    1 
ATOM   9665  C CG    . LEU C 1 393 ? -14.055 24.863  77.818  1.00 34.26 ? 390 LEU C CG    1 
ATOM   9666  C CD1   . LEU C 1 393 ? -15.149 25.189  78.805  1.00 35.98 ? 390 LEU C CD1   1 
ATOM   9667  C CD2   . LEU C 1 393 ? -13.582 26.126  77.104  1.00 34.47 ? 390 LEU C CD2   1 
ATOM   9668  N N     . ASP C 1 394 ? -10.814 22.002  79.170  1.00 33.83 ? 391 ASP C N     1 
ATOM   9669  C CA    . ASP C 1 394 ? -9.865  21.370  80.076  1.00 34.52 ? 391 ASP C CA    1 
ATOM   9670  C C     . ASP C 1 394 ? -8.511  21.362  79.377  1.00 35.74 ? 391 ASP C C     1 
ATOM   9671  O O     . ASP C 1 394 ? -7.486  21.712  79.966  1.00 36.09 ? 391 ASP C O     1 
ATOM   9672  C CB    . ASP C 1 394 ? -10.288 19.927  80.378  1.00 35.53 ? 391 ASP C CB    1 
ATOM   9673  C CG    . ASP C 1 394 ? -9.810  19.444  81.745  1.00 34.88 ? 391 ASP C CG    1 
ATOM   9674  O OD1   . ASP C 1 394 ? -8.703  19.836  82.179  1.00 34.72 ? 391 ASP C OD1   1 
ATOM   9675  O OD2   . ASP C 1 394 ? -10.541 18.659  82.382  1.00 34.90 ? 391 ASP C OD2   1 
ATOM   9676  N N     . GLU C 1 395 ? -8.521  20.956  78.112  1.00 35.32 ? 392 GLU C N     1 
ATOM   9677  C CA    . GLU C 1 395 ? -7.311  20.925  77.311  1.00 35.74 ? 392 GLU C CA    1 
ATOM   9678  C C     . GLU C 1 395 ? -6.772  22.333  77.118  1.00 35.97 ? 392 GLU C C     1 
ATOM   9679  O O     . GLU C 1 395 ? -5.563  22.542  77.069  1.00 34.68 ? 392 GLU C O     1 
ATOM   9680  C CB    . GLU C 1 395 ? -7.594  20.314  75.944  1.00 36.40 ? 392 GLU C CB    1 
ATOM   9681  C CG    . GLU C 1 395 ? -7.769  18.819  75.966  1.00 39.04 ? 392 GLU C CG    1 
ATOM   9682  C CD    . GLU C 1 395 ? -8.092  18.259  74.595  1.00 40.21 ? 392 GLU C CD    1 
ATOM   9683  O OE1   . GLU C 1 395 ? -7.594  18.814  73.585  1.00 40.50 ? 392 GLU C OE1   1 
ATOM   9684  O OE2   . GLU C 1 395 ? -8.834  17.260  74.528  1.00 41.11 ? 392 GLU C OE2   1 
ATOM   9685  N N     . ALA C 1 396 ? -7.679  23.296  77.008  1.00 36.57 ? 393 ALA C N     1 
ATOM   9686  C CA    . ALA C 1 396 ? -7.280  24.683  76.812  1.00 37.74 ? 393 ALA C CA    1 
ATOM   9687  C C     . ALA C 1 396 ? -6.491  25.222  77.999  1.00 37.34 ? 393 ALA C C     1 
ATOM   9688  O O     . ALA C 1 396 ? -5.547  26.005  77.820  1.00 37.24 ? 393 ALA C O     1 
ATOM   9689  C CB    . ALA C 1 396 ? -8.506  25.554  76.562  1.00 38.23 ? 393 ALA C CB    1 
ATOM   9690  N N     . VAL C 1 397 ? -6.871  24.800  79.204  1.00 36.75 ? 394 VAL C N     1 
ATOM   9691  C CA    . VAL C 1 397 ? -6.199  25.261  80.419  1.00 37.20 ? 394 VAL C CA    1 
ATOM   9692  C C     . VAL C 1 397 ? -4.741  24.808  80.434  1.00 38.25 ? 394 VAL C C     1 
ATOM   9693  O O     . VAL C 1 397 ? -3.858  25.502  80.952  1.00 38.34 ? 394 VAL C O     1 
ATOM   9694  C CB    . VAL C 1 397 ? -6.912  24.731  81.685  1.00 35.91 ? 394 VAL C CB    1 
ATOM   9695  C CG1   . VAL C 1 397 ? -6.241  25.271  82.932  1.00 35.37 ? 394 VAL C CG1   1 
ATOM   9696  C CG2   . VAL C 1 397 ? -8.367  25.140  81.662  1.00 34.33 ? 394 VAL C CG2   1 
ATOM   9697  N N     . ALA C 1 398 ? -4.496  23.642  79.847  1.00 38.07 ? 395 ALA C N     1 
ATOM   9698  C CA    . ALA C 1 398 ? -3.157  23.073  79.784  1.00 36.63 ? 395 ALA C CA    1 
ATOM   9699  C C     . ALA C 1 398 ? -2.271  23.831  78.804  1.00 35.12 ? 395 ALA C C     1 
ATOM   9700  O O     . ALA C 1 398 ? -1.182  24.290  79.158  1.00 34.51 ? 395 ALA C O     1 
ATOM   9701  C CB    . ALA C 1 398 ? -3.242  21.614  79.377  1.00 35.90 ? 395 ALA C CB    1 
ATOM   9702  N N     . GLU C 1 399 ? -2.742  23.951  77.566  1.00 34.54 ? 396 GLU C N     1 
ATOM   9703  C CA    . GLU C 1 399 ? -1.978  24.641  76.533  1.00 34.05 ? 396 GLU C CA    1 
ATOM   9704  C C     . GLU C 1 399 ? -1.620  26.063  76.923  1.00 31.11 ? 396 GLU C C     1 
ATOM   9705  O O     . GLU C 1 399 ? -0.548  26.546  76.595  1.00 29.89 ? 396 GLU C O     1 
ATOM   9706  C CB    . GLU C 1 399 ? -2.740  24.672  75.209  1.00 34.69 ? 396 GLU C CB    1 
ATOM   9707  C CG    . GLU C 1 399 ? -2.062  25.561  74.186  1.00 40.25 ? 396 GLU C CG    1 
ATOM   9708  C CD    . GLU C 1 399 ? -2.447  25.228  72.767  1.00 43.72 ? 396 GLU C CD    1 
ATOM   9709  O OE1   . GLU C 1 399 ? -2.175  24.095  72.332  1.00 45.11 ? 396 GLU C OE1   1 
ATOM   9710  O OE2   . GLU C 1 399 ? -3.016  26.108  72.081  1.00 47.84 ? 396 GLU C OE2   1 
ATOM   9711  N N     . ALA C 1 400 ? -2.527  26.734  77.615  1.00 29.57 ? 397 ALA C N     1 
ATOM   9712  C CA    . ALA C 1 400 ? -2.270  28.102  78.021  1.00 28.67 ? 397 ALA C CA    1 
ATOM   9713  C C     . ALA C 1 400 ? -1.021  28.235  78.895  1.00 28.10 ? 397 ALA C C     1 
ATOM   9714  O O     . ALA C 1 400 ? -0.464  29.326  79.001  1.00 26.81 ? 397 ALA C O     1 
ATOM   9715  C CB    . ALA C 1 400 ? -3.487  28.658  78.746  1.00 27.21 ? 397 ALA C CB    1 
ATOM   9716  N N     . HIS C 1 401 ? -0.586  27.121  79.493  1.00 28.55 ? 398 HIS C N     1 
ATOM   9717  C CA    . HIS C 1 401 ? 0.586   27.085  80.377  1.00 29.10 ? 398 HIS C CA    1 
ATOM   9718  C C     . HIS C 1 401 ? 1.868   26.524  79.762  1.00 29.91 ? 398 HIS C C     1 
ATOM   9719  O O     . HIS C 1 401 ? 2.953   26.635  80.348  1.00 30.37 ? 398 HIS C O     1 
ATOM   9720  C CB    . HIS C 1 401 ? 0.264   26.282  81.641  1.00 29.71 ? 398 HIS C CB    1 
ATOM   9721  C CG    . HIS C 1 401 ? -0.736  26.946  82.535  1.00 29.69 ? 398 HIS C CG    1 
ATOM   9722  N ND1   . HIS C 1 401 ? -2.074  27.031  82.220  1.00 30.18 ? 398 HIS C ND1   1 
ATOM   9723  C CD2   . HIS C 1 401 ? -0.577  27.619  83.701  1.00 29.06 ? 398 HIS C CD2   1 
ATOM   9724  C CE1   . HIS C 1 401 ? -2.696  27.734  83.153  1.00 29.62 ? 398 HIS C CE1   1 
ATOM   9725  N NE2   . HIS C 1 401 ? -1.810  28.102  84.061  1.00 27.89 ? 398 HIS C NE2   1 
ATOM   9726  N N     . LEU C 1 402 ? 1.742   25.917  78.588  1.00 30.90 ? 399 LEU C N     1 
ATOM   9727  C CA    . LEU C 1 402 ? 2.891   25.338  77.901  1.00 30.40 ? 399 LEU C CA    1 
ATOM   9728  C C     . LEU C 1 402 ? 3.961   26.377  77.573  1.00 31.47 ? 399 LEU C C     1 
ATOM   9729  O O     . LEU C 1 402 ? 5.164   26.097  77.684  1.00 32.61 ? 399 LEU C O     1 
ATOM   9730  C CB    . LEU C 1 402 ? 2.430   24.639  76.624  1.00 29.71 ? 399 LEU C CB    1 
ATOM   9731  C CG    . LEU C 1 402 ? 2.096   23.148  76.748  1.00 31.15 ? 399 LEU C CG    1 
ATOM   9732  C CD1   . LEU C 1 402 ? 1.298   22.875  78.015  1.00 29.19 ? 399 LEU C CD1   1 
ATOM   9733  C CD2   . LEU C 1 402 ? 1.346   22.703  75.500  1.00 29.70 ? 399 LEU C CD2   1 
ATOM   9734  N N     . GLY C 1 403 ? 3.518   27.571  77.180  1.00 29.83 ? 400 GLY C N     1 
ATOM   9735  C CA    . GLY C 1 403 ? 4.434   28.642  76.824  1.00 26.92 ? 400 GLY C CA    1 
ATOM   9736  C C     . GLY C 1 403 ? 5.514   28.914  77.856  1.00 27.15 ? 400 GLY C C     1 
ATOM   9737  O O     . GLY C 1 403 ? 6.700   28.761  77.576  1.00 28.04 ? 400 GLY C O     1 
ATOM   9738  N N     . LYS C 1 404 ? 5.092   29.326  79.047  1.00 26.54 ? 401 LYS C N     1 
ATOM   9739  C CA    . LYS C 1 404 ? 5.979   29.632  80.163  1.00 25.81 ? 401 LYS C CA    1 
ATOM   9740  C C     . LYS C 1 404 ? 7.105   28.588  80.303  1.00 27.05 ? 401 LYS C C     1 
ATOM   9741  O O     . LYS C 1 404 ? 8.285   28.928  80.334  1.00 28.52 ? 401 LYS C O     1 
ATOM   9742  C CB    . LYS C 1 404 ? 5.136   29.683  81.440  1.00 24.21 ? 401 LYS C CB    1 
ATOM   9743  C CG    . LYS C 1 404 ? 5.858   30.145  82.688  1.00 23.83 ? 401 LYS C CG    1 
ATOM   9744  C CD    . LYS C 1 404 ? 6.242   31.603  82.613  1.00 21.27 ? 401 LYS C CD    1 
ATOM   9745  C CE    . LYS C 1 404 ? 6.938   32.035  83.877  1.00 22.04 ? 401 LYS C CE    1 
ATOM   9746  N NZ    . LYS C 1 404 ? 7.382   33.445  83.777  1.00 24.52 ? 401 LYS C NZ    1 
ATOM   9747  N N     . LEU C 1 405 ? 6.729   27.317  80.373  1.00 27.43 ? 402 LEU C N     1 
ATOM   9748  C CA    . LEU C 1 405 ? 7.683   26.224  80.512  1.00 29.61 ? 402 LEU C CA    1 
ATOM   9749  C C     . LEU C 1 405 ? 8.426   25.969  79.206  1.00 31.89 ? 402 LEU C C     1 
ATOM   9750  O O     . LEU C 1 405 ? 9.265   25.066  79.118  1.00 30.31 ? 402 LEU C O     1 
ATOM   9751  C CB    . LEU C 1 405 ? 6.953   24.946  80.934  1.00 28.59 ? 402 LEU C CB    1 
ATOM   9752  C CG    . LEU C 1 405 ? 5.912   25.171  82.023  1.00 26.51 ? 402 LEU C CG    1 
ATOM   9753  C CD1   . LEU C 1 405 ? 5.291   23.848  82.412  1.00 29.37 ? 402 LEU C CD1   1 
ATOM   9754  C CD2   . LEU C 1 405 ? 6.560   25.831  83.218  1.00 26.08 ? 402 LEU C CD2   1 
ATOM   9755  N N     . ASN C 1 406 ? 8.097   26.764  78.192  1.00 34.12 ? 403 ASN C N     1 
ATOM   9756  C CA    . ASN C 1 406 ? 8.731   26.664  76.882  1.00 34.50 ? 403 ASN C CA    1 
ATOM   9757  C C     . ASN C 1 406 ? 8.548   25.282  76.259  1.00 32.05 ? 403 ASN C C     1 
ATOM   9758  O O     . ASN C 1 406 ? 9.457   24.725  75.660  1.00 30.37 ? 403 ASN C O     1 
ATOM   9759  C CB    . ASN C 1 406 ? 10.223  27.002  77.003  1.00 38.52 ? 403 ASN C CB    1 
ATOM   9760  C CG    . ASN C 1 406 ? 10.846  27.334  75.665  1.00 43.47 ? 403 ASN C CG    1 
ATOM   9761  O OD1   . ASN C 1 406 ? 10.378  28.234  74.950  1.00 46.92 ? 403 ASN C OD1   1 
ATOM   9762  N ND2   . ASN C 1 406 ? 11.894  26.609  75.307  1.00 44.56 ? 403 ASN C ND2   1 
ATOM   9763  N N     . VAL C 1 407 ? 7.349   24.743  76.404  1.00 31.99 ? 404 VAL C N     1 
ATOM   9764  C CA    . VAL C 1 407 ? 7.020   23.441  75.859  1.00 31.36 ? 404 VAL C CA    1 
ATOM   9765  C C     . VAL C 1 407 ? 6.572   23.543  74.406  1.00 31.79 ? 404 VAL C C     1 
ATOM   9766  O O     . VAL C 1 407 ? 5.666   24.302  74.081  1.00 32.66 ? 404 VAL C O     1 
ATOM   9767  C CB    . VAL C 1 407 ? 5.902   22.784  76.686  1.00 31.83 ? 404 VAL C CB    1 
ATOM   9768  C CG1   . VAL C 1 407 ? 5.375   21.559  75.975  1.00 32.43 ? 404 VAL C CG1   1 
ATOM   9769  C CG2   . VAL C 1 407 ? 6.441   22.395  78.060  1.00 32.32 ? 404 VAL C CG2   1 
ATOM   9770  N N     . LYS C 1 408 ? 7.216   22.786  73.526  1.00 32.20 ? 405 LYS C N     1 
ATOM   9771  C CA    . LYS C 1 408 ? 6.853   22.800  72.116  1.00 32.26 ? 405 LYS C CA    1 
ATOM   9772  C C     . LYS C 1 408 ? 5.985   21.585  71.779  1.00 31.42 ? 405 LYS C C     1 
ATOM   9773  O O     . LYS C 1 408 ? 6.477   20.473  71.597  1.00 32.32 ? 405 LYS C O     1 
ATOM   9774  C CB    . LYS C 1 408 ? 8.114   22.854  71.249  1.00 32.64 ? 405 LYS C CB    1 
ATOM   9775  C CG    . LYS C 1 408 ? 8.749   24.246  71.234  1.00 37.12 ? 405 LYS C CG    1 
ATOM   9776  C CD    . LYS C 1 408 ? 10.225  24.248  70.831  1.00 39.26 ? 405 LYS C CD    1 
ATOM   9777  C CE    . LYS C 1 408 ? 11.108  23.703  71.955  1.00 40.82 ? 405 LYS C CE    1 
ATOM   9778  N NZ    . LYS C 1 408 ? 12.515  23.426  71.494  1.00 41.69 ? 405 LYS C NZ    1 
ATOM   9779  N N     . LEU C 1 409 ? 4.678   21.813  71.714  1.00 31.15 ? 406 LEU C N     1 
ATOM   9780  C CA    . LEU C 1 409 ? 3.710   20.763  71.422  1.00 31.46 ? 406 LEU C CA    1 
ATOM   9781  C C     . LEU C 1 409 ? 3.770   20.326  69.956  1.00 32.12 ? 406 LEU C C     1 
ATOM   9782  O O     . LEU C 1 409 ? 4.155   21.105  69.083  1.00 33.64 ? 406 LEU C O     1 
ATOM   9783  C CB    . LEU C 1 409 ? 2.301   21.263  71.762  1.00 31.03 ? 406 LEU C CB    1 
ATOM   9784  C CG    . LEU C 1 409 ? 1.194   20.228  71.986  1.00 30.12 ? 406 LEU C CG    1 
ATOM   9785  C CD1   . LEU C 1 409 ? 1.594   19.296  73.118  1.00 30.36 ? 406 LEU C CD1   1 
ATOM   9786  C CD2   . LEU C 1 409 ? -0.105  20.932  72.333  1.00 27.95 ? 406 LEU C CD2   1 
ATOM   9787  N N     . THR C 1 410 ? 3.407   19.076  69.681  1.00 32.53 ? 407 THR C N     1 
ATOM   9788  C CA    . THR C 1 410 ? 3.423   18.589  68.306  1.00 33.07 ? 407 THR C CA    1 
ATOM   9789  C C     . THR C 1 410 ? 2.028   18.669  67.703  1.00 34.07 ? 407 THR C C     1 
ATOM   9790  O O     . THR C 1 410 ? 1.020   18.463  68.394  1.00 34.87 ? 407 THR C O     1 
ATOM   9791  C CB    . THR C 1 410 ? 3.926   17.118  68.193  1.00 31.70 ? 407 THR C CB    1 
ATOM   9792  O OG1   . THR C 1 410 ? 5.297   17.042  68.614  1.00 33.32 ? 407 THR C OG1   1 
ATOM   9793  C CG2   . THR C 1 410 ? 3.845   16.632  66.746  1.00 28.53 ? 407 THR C CG2   1 
ATOM   9794  N N     . LYS C 1 411 ? 1.976   19.000  66.415  1.00 34.79 ? 408 LYS C N     1 
ATOM   9795  C CA    . LYS C 1 411 ? 0.714   19.103  65.701  1.00 35.38 ? 408 LYS C CA    1 
ATOM   9796  C C     . LYS C 1 411 ? 0.507   17.916  64.772  1.00 35.04 ? 408 LYS C C     1 
ATOM   9797  O O     . LYS C 1 411 ? 1.359   17.583  63.940  1.00 33.37 ? 408 LYS C O     1 
ATOM   9798  C CB    . LYS C 1 411 ? 0.649   20.408  64.902  1.00 37.72 ? 408 LYS C CB    1 
ATOM   9799  C CG    . LYS C 1 411 ? -0.281  21.469  65.500  1.00 40.28 ? 408 LYS C CG    1 
ATOM   9800  C CD    . LYS C 1 411 ? -1.738  21.009  65.462  1.00 42.33 ? 408 LYS C CD    1 
ATOM   9801  C CE    . LYS C 1 411 ? -2.723  22.146  65.739  1.00 43.82 ? 408 LYS C CE    1 
ATOM   9802  N NZ    . LYS C 1 411 ? -2.626  22.732  67.103  1.00 45.26 ? 408 LYS C NZ    1 
ATOM   9803  N N     . LEU C 1 412 ? -0.641  17.276  64.946  1.00 35.31 ? 409 LEU C N     1 
ATOM   9804  C CA    . LEU C 1 412 ? -1.043  16.130  64.149  1.00 34.14 ? 409 LEU C CA    1 
ATOM   9805  C C     . LEU C 1 412 ? -1.102  16.543  62.684  1.00 34.94 ? 409 LEU C C     1 
ATOM   9806  O O     . LEU C 1 412 ? -1.635  17.612  62.370  1.00 35.11 ? 409 LEU C O     1 
ATOM   9807  C CB    . LEU C 1 412 ? -2.427  15.686  64.611  1.00 32.30 ? 409 LEU C CB    1 
ATOM   9808  C CG    . LEU C 1 412 ? -2.565  14.373  65.377  1.00 32.29 ? 409 LEU C CG    1 
ATOM   9809  C CD1   . LEU C 1 412 ? -1.239  13.951  65.963  1.00 34.64 ? 409 LEU C CD1   1 
ATOM   9810  C CD2   . LEU C 1 412 ? -3.626  14.533  66.448  1.00 30.75 ? 409 LEU C CD2   1 
ATOM   9811  N N     . THR C 1 413 ? -0.556  15.723  61.785  1.00 35.48 ? 410 THR C N     1 
ATOM   9812  C CA    . THR C 1 413 ? -0.613  16.058  60.365  1.00 34.77 ? 410 THR C CA    1 
ATOM   9813  C C     . THR C 1 413 ? -1.990  15.655  59.896  1.00 36.67 ? 410 THR C C     1 
ATOM   9814  O O     . THR C 1 413 ? -2.724  14.987  60.623  1.00 36.87 ? 410 THR C O     1 
ATOM   9815  C CB    . THR C 1 413 ? 0.403   15.289  59.517  1.00 31.36 ? 410 THR C CB    1 
ATOM   9816  O OG1   . THR C 1 413 ? 0.046   13.905  59.476  1.00 33.45 ? 410 THR C OG1   1 
ATOM   9817  C CG2   . THR C 1 413 ? 1.779   15.445  60.086  1.00 30.75 ? 410 THR C CG2   1 
ATOM   9818  N N     . GLU C 1 414 ? -2.344  16.055  58.682  1.00 38.41 ? 411 GLU C N     1 
ATOM   9819  C CA    . GLU C 1 414 ? -3.650  15.720  58.153  1.00 39.60 ? 411 GLU C CA    1 
ATOM   9820  C C     . GLU C 1 414 ? -3.844  14.214  58.113  1.00 38.76 ? 411 GLU C C     1 
ATOM   9821  O O     . GLU C 1 414 ? -4.901  13.708  58.493  1.00 38.08 ? 411 GLU C O     1 
ATOM   9822  C CB    . GLU C 1 414 ? -3.821  16.312  56.751  1.00 43.24 ? 411 GLU C CB    1 
ATOM   9823  C CG    . GLU C 1 414 ? -5.211  16.131  56.192  1.00 45.95 ? 411 GLU C CG    1 
ATOM   9824  C CD    . GLU C 1 414 ? -6.263  16.456  57.227  1.00 49.01 ? 411 GLU C CD    1 
ATOM   9825  O OE1   . GLU C 1 414 ? -6.088  17.480  57.929  1.00 50.81 ? 411 GLU C OE1   1 
ATOM   9826  O OE2   . GLU C 1 414 ? -7.252  15.695  57.345  1.00 49.49 ? 411 GLU C OE2   1 
ATOM   9827  N N     . LYS C 1 415 ? -2.818  13.496  57.665  1.00 38.12 ? 412 LYS C N     1 
ATOM   9828  C CA    . LYS C 1 415 ? -2.913  12.045  57.579  1.00 39.04 ? 412 LYS C CA    1 
ATOM   9829  C C     . LYS C 1 415 ? -3.099  11.424  58.962  1.00 38.14 ? 412 LYS C C     1 
ATOM   9830  O O     . LYS C 1 415 ? -3.931  10.533  59.140  1.00 38.61 ? 412 LYS C O     1 
ATOM   9831  C CB    . LYS C 1 415 ? -1.665  11.465  56.907  1.00 40.86 ? 412 LYS C CB    1 
ATOM   9832  C CG    . LYS C 1 415 ? -1.786  9.978   56.549  1.00 42.76 ? 412 LYS C CG    1 
ATOM   9833  C CD    . LYS C 1 415 ? -0.452  9.395   56.058  1.00 43.24 ? 412 LYS C CD    1 
ATOM   9834  C CE    . LYS C 1 415 ? -0.592  7.907   55.721  1.00 44.45 ? 412 LYS C CE    1 
ATOM   9835  N NZ    . LYS C 1 415 ? 0.725   7.229   55.489  1.00 45.88 ? 412 LYS C NZ    1 
ATOM   9836  N N     . GLN C 1 416 ? -2.331  11.903  59.939  1.00 36.84 ? 413 GLN C N     1 
ATOM   9837  C CA    . GLN C 1 416 ? -2.418  11.388  61.308  1.00 36.74 ? 413 GLN C CA    1 
ATOM   9838  C C     . GLN C 1 416 ? -3.774  11.642  61.952  1.00 35.71 ? 413 GLN C C     1 
ATOM   9839  O O     . GLN C 1 416 ? -4.346  10.743  62.572  1.00 34.65 ? 413 GLN C O     1 
ATOM   9840  C CB    . GLN C 1 416 ? -1.301  11.983  62.178  1.00 35.67 ? 413 GLN C CB    1 
ATOM   9841  C CG    . GLN C 1 416 ? 0.005   11.185  62.107  1.00 34.76 ? 413 GLN C CG    1 
ATOM   9842  C CD    . GLN C 1 416 ? 1.221   11.957  62.600  1.00 35.56 ? 413 GLN C CD    1 
ATOM   9843  O OE1   . GLN C 1 416 ? 2.294   11.381  62.786  1.00 35.37 ? 413 GLN C OE1   1 
ATOM   9844  N NE2   . GLN C 1 416 ? 1.064   13.263  62.799  1.00 34.86 ? 413 GLN C NE2   1 
ATOM   9845  N N     . ALA C 1 417 ? -4.292  12.855  61.799  1.00 35.15 ? 414 ALA C N     1 
ATOM   9846  C CA    . ALA C 1 417 ? -5.588  13.191  62.367  1.00 37.76 ? 414 ALA C CA    1 
ATOM   9847  C C     . ALA C 1 417 ? -6.658  12.261  61.800  1.00 39.66 ? 414 ALA C C     1 
ATOM   9848  O O     . ALA C 1 417 ? -7.655  11.958  62.459  1.00 39.65 ? 414 ALA C O     1 
ATOM   9849  C CB    . ALA C 1 417 ? -5.936  14.634  62.054  1.00 38.52 ? 414 ALA C CB    1 
ATOM   9850  N N     . GLN C 1 418 ? -6.450  11.812  60.568  1.00 41.47 ? 415 GLN C N     1 
ATOM   9851  C CA    . GLN C 1 418 ? -7.392  10.907  59.942  1.00 42.83 ? 415 GLN C CA    1 
ATOM   9852  C C     . GLN C 1 418 ? -7.187  9.511   60.495  1.00 41.87 ? 415 GLN C C     1 
ATOM   9853  O O     . GLN C 1 418 ? -8.139  8.863   60.934  1.00 41.68 ? 415 GLN C O     1 
ATOM   9854  C CB    . GLN C 1 418 ? -7.200  10.900  58.428  1.00 45.65 ? 415 GLN C CB    1 
ATOM   9855  C CG    . GLN C 1 418 ? -7.633  12.190  57.758  1.00 49.92 ? 415 GLN C CG    1 
ATOM   9856  C CD    . GLN C 1 418 ? -7.193  12.261  56.313  1.00 52.27 ? 415 GLN C CD    1 
ATOM   9857  O OE1   . GLN C 1 418 ? -7.347  13.294  55.660  1.00 54.19 ? 415 GLN C OE1   1 
ATOM   9858  N NE2   . GLN C 1 418 ? -6.639  11.162  55.804  1.00 53.26 ? 415 GLN C NE2   1 
ATOM   9859  N N     . TYR C 1 419 ? -5.939  9.053   60.478  1.00 41.11 ? 416 TYR C N     1 
ATOM   9860  C CA    . TYR C 1 419 ? -5.626  7.727   60.984  1.00 40.63 ? 416 TYR C CA    1 
ATOM   9861  C C     . TYR C 1 419 ? -6.208  7.525   62.389  1.00 40.60 ? 416 TYR C C     1 
ATOM   9862  O O     . TYR C 1 419 ? -6.806  6.489   62.673  1.00 41.30 ? 416 TYR C O     1 
ATOM   9863  C CB    . TYR C 1 419 ? -4.117  7.518   61.007  1.00 41.64 ? 416 TYR C CB    1 
ATOM   9864  C CG    . TYR C 1 419 ? -3.708  6.093   61.303  1.00 42.80 ? 416 TYR C CG    1 
ATOM   9865  C CD1   . TYR C 1 419 ? -3.706  5.125   60.300  1.00 42.65 ? 416 TYR C CD1   1 
ATOM   9866  C CD2   . TYR C 1 419 ? -3.342  5.708   62.589  1.00 42.15 ? 416 TYR C CD2   1 
ATOM   9867  C CE1   . TYR C 1 419 ? -3.346  3.810   60.571  1.00 43.74 ? 416 TYR C CE1   1 
ATOM   9868  C CE2   . TYR C 1 419 ? -2.983  4.398   62.872  1.00 43.01 ? 416 TYR C CE2   1 
ATOM   9869  C CZ    . TYR C 1 419 ? -2.986  3.451   61.861  1.00 43.88 ? 416 TYR C CZ    1 
ATOM   9870  O OH    . TYR C 1 419 ? -2.623  2.147   62.139  1.00 43.46 ? 416 TYR C OH    1 
ATOM   9871  N N     . LEU C 1 420 ? -6.038  8.520   63.258  1.00 39.27 ? 417 LEU C N     1 
ATOM   9872  C CA    . LEU C 1 420 ? -6.547  8.456   64.627  1.00 38.41 ? 417 LEU C CA    1 
ATOM   9873  C C     . LEU C 1 420 ? -8.009  8.839   64.731  1.00 38.98 ? 417 LEU C C     1 
ATOM   9874  O O     . LEU C 1 420 ? -8.633  8.655   65.779  1.00 38.13 ? 417 LEU C O     1 
ATOM   9875  C CB    . LEU C 1 420 ? -5.741  9.375   65.537  1.00 37.82 ? 417 LEU C CB    1 
ATOM   9876  C CG    . LEU C 1 420 ? -4.282  8.971   65.734  1.00 37.07 ? 417 LEU C CG    1 
ATOM   9877  C CD1   . LEU C 1 420 ? -3.544  10.054  66.508  1.00 36.21 ? 417 LEU C CD1   1 
ATOM   9878  C CD2   . LEU C 1 420 ? -4.224  7.646   66.458  1.00 34.78 ? 417 LEU C CD2   1 
ATOM   9879  N N     . GLY C 1 421 ? -8.552  9.387   63.649  1.00 39.95 ? 418 GLY C N     1 
ATOM   9880  C CA    . GLY C 1 421 ? -9.949  9.785   63.647  1.00 39.20 ? 418 GLY C CA    1 
ATOM   9881  C C     . GLY C 1 421 ? -10.258 10.843  64.689  1.00 39.19 ? 418 GLY C C     1 
ATOM   9882  O O     . GLY C 1 421 ? -11.128 10.662  65.542  1.00 37.79 ? 418 GLY C O     1 
ATOM   9883  N N     . MET C 1 422 ? -9.548  11.958  64.628  1.00 38.60 ? 419 MET C N     1 
ATOM   9884  C CA    . MET C 1 422 ? -9.782  13.021  65.587  1.00 39.35 ? 419 MET C CA    1 
ATOM   9885  C C     . MET C 1 422 ? -9.216  14.298  64.999  1.00 39.70 ? 419 MET C C     1 
ATOM   9886  O O     . MET C 1 422 ? -8.313  14.248  64.162  1.00 39.58 ? 419 MET C O     1 
ATOM   9887  C CB    . MET C 1 422 ? -9.088  12.693  66.905  1.00 39.76 ? 419 MET C CB    1 
ATOM   9888  C CG    . MET C 1 422 ? -7.585  12.520  66.760  1.00 41.21 ? 419 MET C CG    1 
ATOM   9889  S SD    . MET C 1 422 ? -6.713  12.395  68.329  1.00 42.75 ? 419 MET C SD    1 
ATOM   9890  C CE    . MET C 1 422 ? -6.719  10.615  68.595  1.00 37.45 ? 419 MET C CE    1 
ATOM   9891  N N     . SER C 1 423 ? -9.751  15.437  65.430  1.00 40.34 ? 420 SER C N     1 
ATOM   9892  C CA    . SER C 1 423 ? -9.286  16.725  64.930  1.00 42.46 ? 420 SER C CA    1 
ATOM   9893  C C     . SER C 1 423 ? -7.935  17.106  65.506  1.00 44.57 ? 420 SER C C     1 
ATOM   9894  O O     . SER C 1 423 ? -7.684  16.907  66.692  1.00 44.95 ? 420 SER C O     1 
ATOM   9895  C CB    . SER C 1 423 ? -10.274 17.830  65.266  1.00 41.04 ? 420 SER C CB    1 
ATOM   9896  O OG    . SER C 1 423 ? -9.722  19.088  64.913  1.00 40.77 ? 420 SER C OG    1 
ATOM   9897  N N     . CYS C 1 424 ? -7.074  17.672  64.668  1.00 45.59 ? 421 CYS C N     1 
ATOM   9898  C CA    . CYS C 1 424 ? -5.761  18.089  65.128  1.00 47.74 ? 421 CYS C CA    1 
ATOM   9899  C C     . CYS C 1 424 ? -5.887  19.234  66.136  1.00 48.60 ? 421 CYS C C     1 
ATOM   9900  O O     . CYS C 1 424 ? -4.883  19.778  66.599  1.00 48.10 ? 421 CYS C O     1 
ATOM   9901  C CB    . CYS C 1 424 ? -4.904  18.521  63.940  1.00 48.18 ? 421 CYS C CB    1 
ATOM   9902  S SG    . CYS C 1 424 ? -5.675  19.773  62.915  1.00 50.25 ? 421 CYS C SG    1 
ATOM   9903  N N     . ASP C 1 425 ? -7.124  19.600  66.464  1.00 48.84 ? 422 ASP C N     1 
ATOM   9904  C CA    . ASP C 1 425 ? -7.376  20.666  67.428  1.00 49.74 ? 422 ASP C CA    1 
ATOM   9905  C C     . ASP C 1 425 ? -8.449  20.210  68.407  1.00 49.37 ? 422 ASP C C     1 
ATOM   9906  O O     . ASP C 1 425 ? -8.436  20.595  69.577  1.00 49.01 ? 422 ASP C O     1 
ATOM   9907  C CB    . ASP C 1 425 ? -7.866  21.942  66.735  1.00 52.61 ? 422 ASP C CB    1 
ATOM   9908  C CG    . ASP C 1 425 ? -6.878  22.490  65.718  1.00 54.81 ? 422 ASP C CG    1 
ATOM   9909  O OD1   . ASP C 1 425 ? -5.673  22.599  66.032  1.00 58.11 ? 422 ASP C OD1   1 
ATOM   9910  O OD2   . ASP C 1 425 ? -7.319  22.831  64.601  1.00 55.40 ? 422 ASP C OD2   1 
ATOM   9911  N N     . GLY C 1 426 ? -9.382  19.401  67.901  1.00 49.15 ? 423 GLY C N     1 
ATOM   9912  C CA    . GLY C 1 426 ? -10.482 18.886  68.702  1.00 46.79 ? 423 GLY C CA    1 
ATOM   9913  C C     . GLY C 1 426 ? -9.973  18.030  69.835  1.00 45.92 ? 423 GLY C C     1 
ATOM   9914  O O     . GLY C 1 426 ? -8.769  17.787  69.903  1.00 47.02 ? 423 GLY C O     1 
ATOM   9915  N N     . PRO C 1 427 ? -10.850 17.546  70.736  1.00 44.96 ? 424 PRO C N     1 
ATOM   9916  C CA    . PRO C 1 427 ? -10.443 16.710  71.872  1.00 43.80 ? 424 PRO C CA    1 
ATOM   9917  C C     . PRO C 1 427 ? -9.496  15.593  71.451  1.00 43.13 ? 424 PRO C C     1 
ATOM   9918  O O     . PRO C 1 427 ? -9.647  15.011  70.367  1.00 43.47 ? 424 PRO C O     1 
ATOM   9919  C CB    . PRO C 1 427 ? -11.767 16.188  72.406  1.00 44.22 ? 424 PRO C CB    1 
ATOM   9920  C CG    . PRO C 1 427 ? -12.679 17.348  72.149  1.00 45.64 ? 424 PRO C CG    1 
ATOM   9921  C CD    . PRO C 1 427 ? -12.312 17.702  70.721  1.00 45.32 ? 424 PRO C CD    1 
ATOM   9922  N N     . PHE C 1 428 ? -8.519  15.294  72.304  1.00 40.51 ? 425 PHE C N     1 
ATOM   9923  C CA    . PHE C 1 428 ? -7.547  14.260  71.992  1.00 39.36 ? 425 PHE C CA    1 
ATOM   9924  C C     . PHE C 1 428 ? -7.801  12.957  72.736  1.00 39.74 ? 425 PHE C C     1 
ATOM   9925  O O     . PHE C 1 428 ? -7.287  11.905  72.349  1.00 40.03 ? 425 PHE C O     1 
ATOM   9926  C CB    . PHE C 1 428 ? -6.137  14.771  72.293  1.00 37.67 ? 425 PHE C CB    1 
ATOM   9927  C CG    . PHE C 1 428 ? -5.694  15.889  71.397  1.00 33.24 ? 425 PHE C CG    1 
ATOM   9928  C CD1   . PHE C 1 428 ? -5.496  15.670  70.038  1.00 32.69 ? 425 PHE C CD1   1 
ATOM   9929  C CD2   . PHE C 1 428 ? -5.480  17.159  71.908  1.00 32.47 ? 425 PHE C CD2   1 
ATOM   9930  C CE1   . PHE C 1 428 ? -5.094  16.711  69.200  1.00 32.01 ? 425 PHE C CE1   1 
ATOM   9931  C CE2   . PHE C 1 428 ? -5.076  18.206  71.078  1.00 31.52 ? 425 PHE C CE2   1 
ATOM   9932  C CZ    . PHE C 1 428 ? -4.883  17.981  69.722  1.00 30.72 ? 425 PHE C CZ    1 
ATOM   9933  N N     . LYS C 1 429 ? -8.602  13.023  73.795  1.00 39.82 ? 426 LYS C N     1 
ATOM   9934  C CA    . LYS C 1 429 ? -8.915  11.836  74.592  1.00 39.58 ? 426 LYS C CA    1 
ATOM   9935  C C     . LYS C 1 429 ? -10.428 11.650  74.790  1.00 38.51 ? 426 LYS C C     1 
ATOM   9936  O O     . LYS C 1 429 ? -11.183 12.620  74.784  1.00 40.20 ? 426 LYS C O     1 
ATOM   9937  C CB    . LYS C 1 429 ? -8.223  11.933  75.962  1.00 37.73 ? 426 LYS C CB    1 
ATOM   9938  C CG    . LYS C 1 429 ? -6.703  12.088  75.894  1.00 37.09 ? 426 LYS C CG    1 
ATOM   9939  C CD    . LYS C 1 429 ? -6.027  10.873  75.287  1.00 33.23 ? 426 LYS C CD    1 
ATOM   9940  C CE    . LYS C 1 429 ? -4.500  10.965  75.378  1.00 32.53 ? 426 LYS C CE    1 
ATOM   9941  N NZ    . LYS C 1 429 ? -3.938  12.080  74.584  1.00 32.86 ? 426 LYS C NZ    1 
ATOM   9942  N N     . PRO C 1 430 ? -10.886 10.392  74.943  1.00 37.41 ? 427 PRO C N     1 
ATOM   9943  C CA    . PRO C 1 430 ? -12.307 10.082  75.152  1.00 36.61 ? 427 PRO C CA    1 
ATOM   9944  C C     . PRO C 1 430 ? -12.736 10.596  76.518  1.00 36.70 ? 427 PRO C C     1 
ATOM   9945  O O     . PRO C 1 430 ? -11.896 10.881  77.361  1.00 38.48 ? 427 PRO C O     1 
ATOM   9946  C CB    . PRO C 1 430 ? -12.343 8.562   75.125  1.00 36.21 ? 427 PRO C CB    1 
ATOM   9947  C CG    . PRO C 1 430 ? -11.210 8.205   74.245  1.00 37.50 ? 427 PRO C CG    1 
ATOM   9948  C CD    . PRO C 1 430 ? -10.124 9.160   74.678  1.00 36.11 ? 427 PRO C CD    1 
ATOM   9949  N N     . ASP C 1 431 ? -14.035 10.707  76.753  1.00 37.29 ? 428 ASP C N     1 
ATOM   9950  C CA    . ASP C 1 431 ? -14.506 11.189  78.045  1.00 38.06 ? 428 ASP C CA    1 
ATOM   9951  C C     . ASP C 1 431 ? -14.063 10.321  79.213  1.00 37.29 ? 428 ASP C C     1 
ATOM   9952  O O     . ASP C 1 431 ? -13.990 10.804  80.343  1.00 37.24 ? 428 ASP C O     1 
ATOM   9953  C CB    . ASP C 1 431 ? -16.033 11.288  78.068  1.00 40.77 ? 428 ASP C CB    1 
ATOM   9954  C CG    . ASP C 1 431 ? -16.561 12.362  77.143  1.00 44.05 ? 428 ASP C CG    1 
ATOM   9955  O OD1   . ASP C 1 431 ? -15.912 13.437  77.058  1.00 44.44 ? 428 ASP C OD1   1 
ATOM   9956  O OD2   . ASP C 1 431 ? -17.620 12.129  76.512  1.00 43.39 ? 428 ASP C OD2   1 
ATOM   9957  N N     . HIS C 1 432 ? -13.768 9.050   78.948  1.00 35.02 ? 429 HIS C N     1 
ATOM   9958  C CA    . HIS C 1 432 ? -13.354 8.138   80.013  1.00 33.57 ? 429 HIS C CA    1 
ATOM   9959  C C     . HIS C 1 432 ? -11.840 8.082   80.268  1.00 31.56 ? 429 HIS C C     1 
ATOM   9960  O O     . HIS C 1 432 ? -11.390 7.366   81.163  1.00 29.14 ? 429 HIS C O     1 
ATOM   9961  C CB    . HIS C 1 432 ? -13.866 6.711   79.734  1.00 32.13 ? 429 HIS C CB    1 
ATOM   9962  C CG    . HIS C 1 432 ? -13.226 6.054   78.550  1.00 30.22 ? 429 HIS C CG    1 
ATOM   9963  N ND1   . HIS C 1 432 ? -13.558 6.370   77.251  1.00 31.03 ? 429 HIS C ND1   1 
ATOM   9964  C CD2   . HIS C 1 432 ? -12.256 5.114   78.470  1.00 30.87 ? 429 HIS C CD2   1 
ATOM   9965  C CE1   . HIS C 1 432 ? -12.819 5.652   76.422  1.00 30.47 ? 429 HIS C CE1   1 
ATOM   9966  N NE2   . HIS C 1 432 ? -12.020 4.883   77.136  1.00 30.30 ? 429 HIS C NE2   1 
ATOM   9967  N N     . TYR C 1 433 ? -11.061 8.834   79.495  1.00 30.44 ? 430 TYR C N     1 
ATOM   9968  C CA    . TYR C 1 433 ? -9.606  8.819   79.658  1.00 30.01 ? 430 TYR C CA    1 
ATOM   9969  C C     . TYR C 1 433 ? -9.211  9.197   81.083  1.00 29.80 ? 430 TYR C C     1 
ATOM   9970  O O     . TYR C 1 433 ? -9.803  10.104  81.679  1.00 29.28 ? 430 TYR C O     1 
ATOM   9971  C CB    . TYR C 1 433 ? -8.945  9.771   78.661  1.00 28.92 ? 430 TYR C CB    1 
ATOM   9972  C CG    . TYR C 1 433 ? -7.502  9.419   78.399  1.00 29.18 ? 430 TYR C CG    1 
ATOM   9973  C CD1   . TYR C 1 433 ? -7.162  8.223   77.778  1.00 29.09 ? 430 TYR C CD1   1 
ATOM   9974  C CD2   . TYR C 1 433 ? -6.468  10.268  78.801  1.00 29.81 ? 430 TYR C CD2   1 
ATOM   9975  C CE1   . TYR C 1 433 ? -5.832  7.878   77.561  1.00 28.47 ? 430 TYR C CE1   1 
ATOM   9976  C CE2   . TYR C 1 433 ? -5.132  9.931   78.590  1.00 26.49 ? 430 TYR C CE2   1 
ATOM   9977  C CZ    . TYR C 1 433 ? -4.825  8.736   77.970  1.00 27.58 ? 430 TYR C CZ    1 
ATOM   9978  O OH    . TYR C 1 433 ? -3.512  8.394   77.749  1.00 28.71 ? 430 TYR C OH    1 
ATOM   9979  N N     . ARG C 1 434 ? -8.204  8.512   81.625  1.00 30.08 ? 431 ARG C N     1 
ATOM   9980  C CA    . ARG C 1 434 ? -7.767  8.782   83.000  1.00 31.66 ? 431 ARG C CA    1 
ATOM   9981  C C     . ARG C 1 434 ? -6.427  9.492   83.131  1.00 30.85 ? 431 ARG C C     1 
ATOM   9982  O O     . ARG C 1 434 ? -5.972  9.765   84.245  1.00 30.75 ? 431 ARG C O     1 
ATOM   9983  C CB    . ARG C 1 434 ? -7.725  7.482   83.816  1.00 30.55 ? 431 ARG C CB    1 
ATOM   9984  C CG    . ARG C 1 434 ? -9.074  6.793   83.938  1.00 31.24 ? 431 ARG C CG    1 
ATOM   9985  C CD    . ARG C 1 434 ? -9.086  5.758   85.051  1.00 30.78 ? 431 ARG C CD    1 
ATOM   9986  N NE    . ARG C 1 434 ? -10.432 5.242   85.293  1.00 30.21 ? 431 ARG C NE    1 
ATOM   9987  C CZ    . ARG C 1 434 ? -10.995 4.260   84.598  1.00 30.30 ? 431 ARG C CZ    1 
ATOM   9988  N NH1   . ARG C 1 434 ? -10.328 3.673   83.614  1.00 30.40 ? 431 ARG C NH1   1 
ATOM   9989  N NH2   . ARG C 1 434 ? -12.232 3.870   84.886  1.00 32.91 ? 431 ARG C NH2   1 
ATOM   9990  N N     . TYR C 1 435 ? -5.792  9.784   82.001  1.00 31.80 ? 432 TYR C N     1 
ATOM   9991  C CA    . TYR C 1 435 ? -4.497  10.467  82.018  1.00 33.60 ? 432 TYR C CA    1 
ATOM   9992  C C     . TYR C 1 435 ? -3.568  9.874   83.092  1.00 34.70 ? 432 TYR C C     1 
ATOM   9993  O O     . TYR C 1 435 ? -3.640  8.645   83.336  1.00 34.66 ? 432 TYR C O     1 
ATOM   9994  C CB    . TYR C 1 435 ? -4.688  11.978  82.259  1.00 31.93 ? 432 TYR C CB    1 
ATOM   9995  C CG    . TYR C 1 435 ? -5.511  12.695  81.196  1.00 29.35 ? 432 TYR C CG    1 
ATOM   9996  C CD1   . TYR C 1 435 ? -6.903  12.565  81.145  1.00 28.43 ? 432 TYR C CD1   1 
ATOM   9997  C CD2   . TYR C 1 435 ? -4.891  13.489  80.235  1.00 27.64 ? 432 TYR C CD2   1 
ATOM   9998  C CE1   . TYR C 1 435 ? -7.649  13.211  80.156  1.00 29.51 ? 432 TYR C CE1   1 
ATOM   9999  C CE2   . TYR C 1 435 ? -5.621  14.136  79.249  1.00 27.06 ? 432 TYR C CE2   1 
ATOM   10000 C CZ    . TYR C 1 435 ? -6.997  13.995  79.206  1.00 29.62 ? 432 TYR C CZ    1 
ATOM   10001 O OH    . TYR C 1 435 ? -7.705  14.609  78.189  1.00 27.60 ? 432 TYR C OH    1 
ATOM   10002 O OXT   . TYR C 1 435 ? -2.739  10.624  83.655  1.00 36.16 ? 432 TYR C OXT   1 
ATOM   10003 N N     . ASP D 1 6   ? -6.574  -33.343 55.925  1.00 62.92 ? 3   ASP D N     1 
ATOM   10004 C CA    . ASP D 1 6   ? -7.331  -32.912 57.136  1.00 62.35 ? 3   ASP D CA    1 
ATOM   10005 C C     . ASP D 1 6   ? -6.700  -31.718 57.832  1.00 61.18 ? 3   ASP D C     1 
ATOM   10006 O O     . ASP D 1 6   ? -5.649  -31.223 57.420  1.00 62.34 ? 3   ASP D O     1 
ATOM   10007 C CB    . ASP D 1 6   ? -7.428  -34.061 58.135  1.00 64.36 ? 3   ASP D CB    1 
ATOM   10008 C CG    . ASP D 1 6   ? -8.221  -35.222 57.598  1.00 66.25 ? 3   ASP D CG    1 
ATOM   10009 O OD1   . ASP D 1 6   ? -9.310  -34.979 57.035  1.00 67.28 ? 3   ASP D OD1   1 
ATOM   10010 O OD2   . ASP D 1 6   ? -7.760  -36.373 57.744  1.00 67.70 ? 3   ASP D OD2   1 
ATOM   10011 N N     . LYS D 1 7   ? -7.351  -31.260 58.897  1.00 58.35 ? 4   LYS D N     1 
ATOM   10012 C CA    . LYS D 1 7   ? -6.859  -30.123 59.662  1.00 54.70 ? 4   LYS D CA    1 
ATOM   10013 C C     . LYS D 1 7   ? -5.810  -30.576 60.665  1.00 53.04 ? 4   LYS D C     1 
ATOM   10014 O O     . LYS D 1 7   ? -5.738  -31.757 61.011  1.00 53.28 ? 4   LYS D O     1 
ATOM   10015 C CB    . LYS D 1 7   ? -8.010  -29.451 60.403  1.00 54.16 ? 4   LYS D CB    1 
ATOM   10016 C CG    . LYS D 1 7   ? -7.643  -28.143 61.070  1.00 52.94 ? 4   LYS D CG    1 
ATOM   10017 C CD    . LYS D 1 7   ? -8.875  -27.519 61.684  1.00 52.97 ? 4   LYS D CD    1 
ATOM   10018 C CE    . LYS D 1 7   ? -8.578  -26.164 62.281  1.00 52.87 ? 4   LYS D CE    1 
ATOM   10019 N NZ    . LYS D 1 7   ? -9.812  -25.558 62.837  1.00 52.87 ? 4   LYS D NZ    1 
ATOM   10020 N N     . LEU D 1 8   ? -5.005  -29.627 61.131  1.00 50.44 ? 5   LEU D N     1 
ATOM   10021 C CA    . LEU D 1 8   ? -3.957  -29.903 62.107  1.00 46.38 ? 5   LEU D CA    1 
ATOM   10022 C C     . LEU D 1 8   ? -4.482  -29.643 63.521  1.00 44.44 ? 5   LEU D C     1 
ATOM   10023 O O     . LEU D 1 8   ? -5.232  -28.699 63.743  1.00 43.31 ? 5   LEU D O     1 
ATOM   10024 C CB    . LEU D 1 8   ? -2.757  -28.999 61.836  1.00 45.51 ? 5   LEU D CB    1 
ATOM   10025 C CG    . LEU D 1 8   ? -2.055  -29.145 60.488  1.00 44.99 ? 5   LEU D CG    1 
ATOM   10026 C CD1   . LEU D 1 8   ? -1.166  -27.944 60.249  1.00 45.96 ? 5   LEU D CD1   1 
ATOM   10027 C CD2   . LEU D 1 8   ? -1.234  -30.417 60.466  1.00 45.75 ? 5   LEU D CD2   1 
ATOM   10028 N N     . PRO D 1 9   ? -4.097  -30.486 64.492  1.00 43.32 ? 6   PRO D N     1 
ATOM   10029 C CA    . PRO D 1 9   ? -4.552  -30.307 65.878  1.00 42.43 ? 6   PRO D CA    1 
ATOM   10030 C C     . PRO D 1 9   ? -3.952  -29.041 66.494  1.00 41.23 ? 6   PRO D C     1 
ATOM   10031 O O     . PRO D 1 9   ? -4.496  -28.483 67.455  1.00 40.54 ? 6   PRO D O     1 
ATOM   10032 C CB    . PRO D 1 9   ? -4.064  -31.581 66.568  1.00 42.57 ? 6   PRO D CB    1 
ATOM   10033 C CG    . PRO D 1 9   ? -2.796  -31.888 65.831  1.00 42.95 ? 6   PRO D CG    1 
ATOM   10034 C CD    . PRO D 1 9   ? -3.180  -31.636 64.380  1.00 42.90 ? 6   PRO D CD    1 
ATOM   10035 N N     . TYR D 1 10  ? -2.829  -28.609 65.920  1.00 39.33 ? 7   TYR D N     1 
ATOM   10036 C CA    . TYR D 1 10  ? -2.115  -27.419 66.352  1.00 38.17 ? 7   TYR D CA    1 
ATOM   10037 C C     . TYR D 1 10  ? -0.993  -27.133 65.361  1.00 36.62 ? 7   TYR D C     1 
ATOM   10038 O O     . TYR D 1 10  ? -0.936  -27.748 64.301  1.00 34.71 ? 7   TYR D O     1 
ATOM   10039 C CB    . TYR D 1 10  ? -1.554  -27.628 67.765  1.00 41.04 ? 7   TYR D CB    1 
ATOM   10040 C CG    . TYR D 1 10  ? -0.588  -28.784 67.912  1.00 42.22 ? 7   TYR D CG    1 
ATOM   10041 C CD1   . TYR D 1 10  ? 0.729   -28.679 67.464  1.00 43.32 ? 7   TYR D CD1   1 
ATOM   10042 C CD2   . TYR D 1 10  ? -0.988  -29.980 68.509  1.00 43.17 ? 7   TYR D CD2   1 
ATOM   10043 C CE1   . TYR D 1 10  ? 1.623   -29.735 67.607  1.00 44.59 ? 7   TYR D CE1   1 
ATOM   10044 C CE2   . TYR D 1 10  ? -0.101  -31.047 68.657  1.00 43.50 ? 7   TYR D CE2   1 
ATOM   10045 C CZ    . TYR D 1 10  ? 1.201   -30.916 68.203  1.00 44.70 ? 7   TYR D CZ    1 
ATOM   10046 O OH    . TYR D 1 10  ? 2.085   -31.964 68.332  1.00 46.25 ? 7   TYR D OH    1 
ATOM   10047 N N     . LYS D 1 11  ? -0.107  -26.200 65.701  1.00 36.57 ? 8   LYS D N     1 
ATOM   10048 C CA    . LYS D 1 11  ? 1.008   -25.848 64.821  1.00 36.97 ? 8   LYS D CA    1 
ATOM   10049 C C     . LYS D 1 11  ? 2.042   -24.999 65.560  1.00 38.08 ? 8   LYS D C     1 
ATOM   10050 O O     . LYS D 1 11  ? 1.998   -23.768 65.526  1.00 39.61 ? 8   LYS D O     1 
ATOM   10051 C CB    . LYS D 1 11  ? 0.493   -25.083 63.607  1.00 37.02 ? 8   LYS D CB    1 
ATOM   10052 C CG    . LYS D 1 11  ? 1.117   -25.502 62.285  1.00 38.51 ? 8   LYS D CG    1 
ATOM   10053 C CD    . LYS D 1 11  ? 2.609   -25.305 62.280  1.00 40.10 ? 8   LYS D CD    1 
ATOM   10054 C CE    . LYS D 1 11  ? 3.195   -25.564 60.906  1.00 39.69 ? 8   LYS D CE    1 
ATOM   10055 N NZ    . LYS D 1 11  ? 2.709   -24.566 59.911  1.00 40.93 ? 8   LYS D NZ    1 
ATOM   10056 N N     . VAL D 1 12  ? 2.978   -25.657 66.234  1.00 37.59 ? 9   VAL D N     1 
ATOM   10057 C CA    . VAL D 1 12  ? 4.007   -24.946 66.975  1.00 34.99 ? 9   VAL D CA    1 
ATOM   10058 C C     . VAL D 1 12  ? 5.373   -25.168 66.342  1.00 35.45 ? 9   VAL D C     1 
ATOM   10059 O O     . VAL D 1 12  ? 5.519   -25.967 65.421  1.00 35.36 ? 9   VAL D O     1 
ATOM   10060 C CB    . VAL D 1 12  ? 4.039   -25.407 68.452  1.00 34.72 ? 9   VAL D CB    1 
ATOM   10061 C CG1   . VAL D 1 12  ? 2.710   -25.062 69.135  1.00 30.51 ? 9   VAL D CG1   1 
ATOM   10062 C CG2   . VAL D 1 12  ? 4.329   -26.907 68.526  1.00 32.31 ? 9   VAL D CG2   1 
ATOM   10063 N N     . ALA D 1 13  ? 6.370   -24.445 66.839  1.00 36.44 ? 10  ALA D N     1 
ATOM   10064 C CA    . ALA D 1 13  ? 7.734   -24.538 66.325  1.00 34.84 ? 10  ALA D CA    1 
ATOM   10065 C C     . ALA D 1 13  ? 8.418   -25.826 66.732  1.00 34.39 ? 10  ALA D C     1 
ATOM   10066 O O     . ALA D 1 13  ? 9.140   -26.425 65.945  1.00 34.83 ? 10  ALA D O     1 
ATOM   10067 C CB    . ALA D 1 13  ? 8.545   -23.354 66.809  1.00 35.50 ? 10  ALA D CB    1 
ATOM   10068 N N     . ASP D 1 14  ? 8.200   -26.245 67.971  1.00 35.59 ? 11  ASP D N     1 
ATOM   10069 C CA    . ASP D 1 14  ? 8.811   -27.468 68.474  1.00 35.34 ? 11  ASP D CA    1 
ATOM   10070 C C     . ASP D 1 14  ? 8.046   -27.984 69.688  1.00 34.68 ? 11  ASP D C     1 
ATOM   10071 O O     . ASP D 1 14  ? 8.204   -27.464 70.792  1.00 34.39 ? 11  ASP D O     1 
ATOM   10072 C CB    . ASP D 1 14  ? 10.262  -27.207 68.872  1.00 37.47 ? 11  ASP D CB    1 
ATOM   10073 C CG    . ASP D 1 14  ? 11.053  -28.494 69.063  1.00 40.88 ? 11  ASP D CG    1 
ATOM   10074 O OD1   . ASP D 1 14  ? 10.471  -29.488 69.556  1.00 42.92 ? 11  ASP D OD1   1 
ATOM   10075 O OD2   . ASP D 1 14  ? 12.258  -28.512 68.727  1.00 41.77 ? 11  ASP D OD2   1 
ATOM   10076 N N     . ILE D 1 15  ? 7.227   -29.011 69.475  1.00 34.47 ? 12  ILE D N     1 
ATOM   10077 C CA    . ILE D 1 15  ? 6.430   -29.617 70.544  1.00 33.19 ? 12  ILE D CA    1 
ATOM   10078 C C     . ILE D 1 15  ? 7.343   -30.056 71.687  1.00 32.18 ? 12  ILE D C     1 
ATOM   10079 O O     . ILE D 1 15  ? 6.906   -30.173 72.836  1.00 29.44 ? 12  ILE D O     1 
ATOM   10080 C CB    . ILE D 1 15  ? 5.642   -30.860 70.023  1.00 34.78 ? 12  ILE D CB    1 
ATOM   10081 C CG1   . ILE D 1 15  ? 4.699   -31.388 71.110  1.00 34.72 ? 12  ILE D CG1   1 
ATOM   10082 C CG2   . ILE D 1 15  ? 6.615   -31.976 69.621  1.00 33.52 ? 12  ILE D CG2   1 
ATOM   10083 C CD1   . ILE D 1 15  ? 3.591   -30.419 71.483  1.00 37.06 ? 12  ILE D CD1   1 
ATOM   10084 N N     . GLY D 1 16  ? 8.611   -30.289 71.348  1.00 31.50 ? 13  GLY D N     1 
ATOM   10085 C CA    . GLY D 1 16  ? 9.600   -30.716 72.321  1.00 33.00 ? 13  GLY D CA    1 
ATOM   10086 C C     . GLY D 1 16  ? 9.866   -29.723 73.440  1.00 34.40 ? 13  GLY D C     1 
ATOM   10087 O O     . GLY D 1 16  ? 10.431  -30.087 74.479  1.00 35.28 ? 13  GLY D O     1 
ATOM   10088 N N     . LEU D 1 17  ? 9.462   -28.472 73.235  1.00 33.37 ? 14  LEU D N     1 
ATOM   10089 C CA    . LEU D 1 17  ? 9.655   -27.431 74.231  1.00 33.18 ? 14  LEU D CA    1 
ATOM   10090 C C     . LEU D 1 17  ? 8.619   -27.464 75.349  1.00 34.05 ? 14  LEU D C     1 
ATOM   10091 O O     . LEU D 1 17  ? 8.739   -26.718 76.320  1.00 34.00 ? 14  LEU D O     1 
ATOM   10092 C CB    . LEU D 1 17  ? 9.616   -26.060 73.563  1.00 34.02 ? 14  LEU D CB    1 
ATOM   10093 C CG    . LEU D 1 17  ? 10.885  -25.594 72.855  1.00 35.35 ? 14  LEU D CG    1 
ATOM   10094 C CD1   . LEU D 1 17  ? 11.420  -26.692 71.967  1.00 36.83 ? 14  LEU D CD1   1 
ATOM   10095 C CD2   . LEU D 1 17  ? 10.583  -24.347 72.048  1.00 35.02 ? 14  LEU D CD2   1 
ATOM   10096 N N     . ALA D 1 18  ? 7.613   -28.328 75.209  1.00 34.85 ? 15  ALA D N     1 
ATOM   10097 C CA    . ALA D 1 18  ? 6.525   -28.453 76.188  1.00 34.08 ? 15  ALA D CA    1 
ATOM   10098 C C     . ALA D 1 18  ? 6.997   -28.660 77.624  1.00 34.51 ? 15  ALA D C     1 
ATOM   10099 O O     . ALA D 1 18  ? 6.364   -28.177 78.568  1.00 34.89 ? 15  ALA D O     1 
ATOM   10100 C CB    . ALA D 1 18  ? 5.578   -29.592 75.784  1.00 30.44 ? 15  ALA D CB    1 
ATOM   10101 N N     . ALA D 1 19  ? 8.100   -29.387 77.782  1.00 33.34 ? 16  ALA D N     1 
ATOM   10102 C CA    . ALA D 1 19  ? 8.660   -29.668 79.102  1.00 32.07 ? 16  ALA D CA    1 
ATOM   10103 C C     . ALA D 1 19  ? 9.071   -28.381 79.806  1.00 31.04 ? 16  ALA D C     1 
ATOM   10104 O O     . ALA D 1 19  ? 8.626   -28.083 80.920  1.00 29.60 ? 16  ALA D O     1 
ATOM   10105 C CB    . ALA D 1 19  ? 9.864   -30.577 78.965  1.00 31.20 ? 16  ALA D CB    1 
ATOM   10106 N N     . TRP D 1 20  ? 9.938   -27.630 79.140  1.00 30.18 ? 17  TRP D N     1 
ATOM   10107 C CA    . TRP D 1 20  ? 10.444  -26.382 79.674  1.00 30.04 ? 17  TRP D CA    1 
ATOM   10108 C C     . TRP D 1 20  ? 9.326   -25.366 79.823  1.00 30.89 ? 17  TRP D C     1 
ATOM   10109 O O     . TRP D 1 20  ? 9.234   -24.662 80.845  1.00 29.83 ? 17  TRP D O     1 
ATOM   10110 C CB    . TRP D 1 20  ? 11.538  -25.847 78.756  1.00 29.84 ? 17  TRP D CB    1 
ATOM   10111 C CG    . TRP D 1 20  ? 11.983  -24.464 79.079  1.00 32.39 ? 17  TRP D CG    1 
ATOM   10112 C CD1   . TRP D 1 20  ? 12.093  -23.902 80.319  1.00 32.94 ? 17  TRP D CD1   1 
ATOM   10113 C CD2   . TRP D 1 20  ? 12.428  -23.473 78.148  1.00 31.75 ? 17  TRP D CD2   1 
ATOM   10114 N NE1   . TRP D 1 20  ? 12.581  -22.623 80.216  1.00 33.64 ? 17  TRP D NE1   1 
ATOM   10115 C CE2   . TRP D 1 20  ? 12.795  -22.336 78.893  1.00 33.46 ? 17  TRP D CE2   1 
ATOM   10116 C CE3   . TRP D 1 20  ? 12.556  -23.437 76.752  1.00 30.88 ? 17  TRP D CE3   1 
ATOM   10117 C CZ2   . TRP D 1 20  ? 13.281  -21.174 78.289  1.00 33.35 ? 17  TRP D CZ2   1 
ATOM   10118 C CZ3   . TRP D 1 20  ? 13.040  -22.284 76.153  1.00 29.13 ? 17  TRP D CZ3   1 
ATOM   10119 C CH2   . TRP D 1 20  ? 13.396  -21.170 76.919  1.00 30.73 ? 17  TRP D CH2   1 
ATOM   10120 N N     . GLY D 1 21  ? 8.475   -25.302 78.803  1.00 28.82 ? 18  GLY D N     1 
ATOM   10121 C CA    . GLY D 1 21  ? 7.367   -24.377 78.820  1.00 26.33 ? 18  GLY D CA    1 
ATOM   10122 C C     . GLY D 1 21  ? 6.467   -24.615 80.009  1.00 27.73 ? 18  GLY D C     1 
ATOM   10123 O O     . GLY D 1 21  ? 5.995   -23.664 80.635  1.00 28.13 ? 18  GLY D O     1 
ATOM   10124 N N     . ARG D 1 22  ? 6.226   -25.877 80.343  1.00 27.45 ? 19  ARG D N     1 
ATOM   10125 C CA    . ARG D 1 22  ? 5.353   -26.188 81.468  1.00 27.90 ? 19  ARG D CA    1 
ATOM   10126 C C     . ARG D 1 22  ? 5.986   -25.738 82.778  1.00 28.36 ? 19  ARG D C     1 
ATOM   10127 O O     . ARG D 1 22  ? 5.301   -25.243 83.676  1.00 26.82 ? 19  ARG D O     1 
ATOM   10128 C CB    . ARG D 1 22  ? 5.038   -27.691 81.499  1.00 26.78 ? 19  ARG D CB    1 
ATOM   10129 C CG    . ARG D 1 22  ? 4.158   -28.118 82.661  1.00 28.13 ? 19  ARG D CG    1 
ATOM   10130 C CD    . ARG D 1 22  ? 2.859   -27.312 82.759  1.00 28.63 ? 19  ARG D CD    1 
ATOM   10131 N NE    . ARG D 1 22  ? 2.020   -27.434 81.569  1.00 28.03 ? 19  ARG D NE    1 
ATOM   10132 C CZ    . ARG D 1 22  ? 0.768   -26.987 81.473  1.00 29.40 ? 19  ARG D CZ    1 
ATOM   10133 N NH1   . ARG D 1 22  ? 0.185   -26.383 82.503  1.00 26.95 ? 19  ARG D NH1   1 
ATOM   10134 N NH2   . ARG D 1 22  ? 0.102   -27.125 80.331  1.00 29.69 ? 19  ARG D NH2   1 
ATOM   10135 N N     . LYS D 1 23  ? 7.298   -25.924 82.882  1.00 30.14 ? 20  LYS D N     1 
ATOM   10136 C CA    . LYS D 1 23  ? 8.038   -25.493 84.062  1.00 31.45 ? 20  LYS D CA    1 
ATOM   10137 C C     . LYS D 1 23  ? 7.808   -23.980 84.221  1.00 30.96 ? 20  LYS D C     1 
ATOM   10138 O O     . LYS D 1 23  ? 7.653   -23.480 85.333  1.00 31.26 ? 20  LYS D O     1 
ATOM   10139 C CB    . LYS D 1 23  ? 9.540   -25.761 83.884  1.00 32.41 ? 20  LYS D CB    1 
ATOM   10140 C CG    . LYS D 1 23  ? 9.929   -27.213 83.713  1.00 35.62 ? 20  LYS D CG    1 
ATOM   10141 C CD    . LYS D 1 23  ? 10.199  -27.914 85.039  1.00 39.27 ? 20  LYS D CD    1 
ATOM   10142 C CE    . LYS D 1 23  ? 8.935   -28.065 85.915  1.00 42.67 ? 20  LYS D CE    1 
ATOM   10143 N NZ    . LYS D 1 23  ? 7.850   -28.974 85.382  1.00 39.48 ? 20  LYS D NZ    1 
ATOM   10144 N N     . ALA D 1 24  ? 7.783   -23.255 83.105  1.00 30.02 ? 21  ALA D N     1 
ATOM   10145 C CA    . ALA D 1 24  ? 7.583   -21.810 83.166  1.00 30.11 ? 21  ALA D CA    1 
ATOM   10146 C C     . ALA D 1 24  ? 6.151   -21.456 83.562  1.00 29.66 ? 21  ALA D C     1 
ATOM   10147 O O     . ALA D 1 24  ? 5.927   -20.485 84.281  1.00 29.03 ? 21  ALA D O     1 
ATOM   10148 C CB    . ALA D 1 24  ? 7.951   -21.163 81.825  1.00 29.00 ? 21  ALA D CB    1 
ATOM   10149 N N     . LEU D 1 25  ? 5.182   -22.241 83.097  1.00 30.96 ? 22  LEU D N     1 
ATOM   10150 C CA    . LEU D 1 25  ? 3.790   -21.992 83.453  1.00 31.23 ? 22  LEU D CA    1 
ATOM   10151 C C     . LEU D 1 25  ? 3.611   -22.221 84.946  1.00 32.74 ? 22  LEU D C     1 
ATOM   10152 O O     . LEU D 1 25  ? 2.838   -21.517 85.589  1.00 34.51 ? 22  LEU D O     1 
ATOM   10153 C CB    . LEU D 1 25  ? 2.841   -22.904 82.677  1.00 31.80 ? 22  LEU D CB    1 
ATOM   10154 C CG    . LEU D 1 25  ? 2.878   -22.799 81.147  1.00 31.68 ? 22  LEU D CG    1 
ATOM   10155 C CD1   . LEU D 1 25  ? 1.732   -23.572 80.541  1.00 32.03 ? 22  LEU D CD1   1 
ATOM   10156 C CD2   . LEU D 1 25  ? 2.786   -21.353 80.738  1.00 33.60 ? 22  LEU D CD2   1 
ATOM   10157 N N     . ASP D 1 26  ? 4.325   -23.193 85.509  1.00 32.55 ? 23  ASP D N     1 
ATOM   10158 C CA    . ASP D 1 26  ? 4.208   -23.451 86.942  1.00 33.15 ? 23  ASP D CA    1 
ATOM   10159 C C     . ASP D 1 26  ? 4.686   -22.227 87.734  1.00 33.03 ? 23  ASP D C     1 
ATOM   10160 O O     . ASP D 1 26  ? 4.075   -21.846 88.742  1.00 32.48 ? 23  ASP D O     1 
ATOM   10161 C CB    . ASP D 1 26  ? 5.031   -24.681 87.368  1.00 35.69 ? 23  ASP D CB    1 
ATOM   10162 C CG    . ASP D 1 26  ? 4.523   -25.986 86.756  1.00 36.48 ? 23  ASP D CG    1 
ATOM   10163 O OD1   . ASP D 1 26  ? 3.294   -26.201 86.718  1.00 38.21 ? 23  ASP D OD1   1 
ATOM   10164 O OD2   . ASP D 1 26  ? 5.364   -26.808 86.329  1.00 37.29 ? 23  ASP D OD2   1 
ATOM   10165 N N     . ILE D 1 27  ? 5.774   -21.613 87.274  1.00 30.70 ? 24  ILE D N     1 
ATOM   10166 C CA    . ILE D 1 27  ? 6.318   -20.442 87.947  1.00 29.94 ? 24  ILE D CA    1 
ATOM   10167 C C     . ILE D 1 27  ? 5.393   -19.230 87.775  1.00 30.63 ? 24  ILE D C     1 
ATOM   10168 O O     . ILE D 1 27  ? 5.127   -18.496 88.732  1.00 31.27 ? 24  ILE D O     1 
ATOM   10169 C CB    . ILE D 1 27  ? 7.723   -20.116 87.409  1.00 28.44 ? 24  ILE D CB    1 
ATOM   10170 C CG1   . ILE D 1 27  ? 8.696   -21.226 87.814  1.00 28.70 ? 24  ILE D CG1   1 
ATOM   10171 C CG2   . ILE D 1 27  ? 8.192   -18.778 87.932  1.00 27.08 ? 24  ILE D CG2   1 
ATOM   10172 C CD1   . ILE D 1 27  ? 10.098  -21.063 87.230  1.00 27.47 ? 24  ILE D CD1   1 
ATOM   10173 N N     . ALA D 1 28  ? 4.896   -19.026 86.560  1.00 30.80 ? 25  ALA D N     1 
ATOM   10174 C CA    . ALA D 1 28  ? 4.008   -17.903 86.303  1.00 31.18 ? 25  ALA D CA    1 
ATOM   10175 C C     . ALA D 1 28  ? 2.709   -18.026 87.113  1.00 31.35 ? 25  ALA D C     1 
ATOM   10176 O O     . ALA D 1 28  ? 2.175   -17.028 87.598  1.00 29.83 ? 25  ALA D O     1 
ATOM   10177 C CB    . ALA D 1 28  ? 3.700   -17.810 84.812  1.00 32.05 ? 25  ALA D CB    1 
ATOM   10178 N N     . GLU D 1 29  ? 2.207   -19.248 87.268  1.00 30.25 ? 26  GLU D N     1 
ATOM   10179 C CA    . GLU D 1 29  ? 0.982   -19.466 88.033  1.00 30.08 ? 26  GLU D CA    1 
ATOM   10180 C C     . GLU D 1 29  ? 1.062   -18.910 89.454  1.00 29.78 ? 26  GLU D C     1 
ATOM   10181 O O     . GLU D 1 29  ? 0.125   -18.260 89.926  1.00 29.08 ? 26  GLU D O     1 
ATOM   10182 C CB    . GLU D 1 29  ? 0.640   -20.964 88.096  1.00 29.74 ? 26  GLU D CB    1 
ATOM   10183 C CG    . GLU D 1 29  ? -0.020  -21.495 86.837  1.00 33.61 ? 26  GLU D CG    1 
ATOM   10184 C CD    . GLU D 1 29  ? -0.201  -22.999 86.851  1.00 35.59 ? 26  GLU D CD    1 
ATOM   10185 O OE1   . GLU D 1 29  ? -0.843  -23.520 87.784  1.00 38.20 ? 26  GLU D OE1   1 
ATOM   10186 O OE2   . GLU D 1 29  ? 0.296   -23.665 85.918  1.00 36.66 ? 26  GLU D OE2   1 
ATOM   10187 N N     . ASN D 1 30  ? 2.184   -19.166 90.127  1.00 29.20 ? 27  ASN D N     1 
ATOM   10188 C CA    . ASN D 1 30  ? 2.375   -18.723 91.503  1.00 28.84 ? 27  ASN D CA    1 
ATOM   10189 C C     . ASN D 1 30  ? 2.542   -17.213 91.590  1.00 30.30 ? 27  ASN D C     1 
ATOM   10190 O O     . ASN D 1 30  ? 2.482   -16.622 92.670  1.00 31.89 ? 27  ASN D O     1 
ATOM   10191 C CB    . ASN D 1 30  ? 3.585   -19.422 92.124  1.00 26.69 ? 27  ASN D CB    1 
ATOM   10192 C CG    . ASN D 1 30  ? 3.557   -19.385 93.634  1.00 25.79 ? 27  ASN D CG    1 
ATOM   10193 O OD1   . ASN D 1 30  ? 4.558   -19.649 94.291  1.00 24.83 ? 27  ASN D OD1   1 
ATOM   10194 N ND2   . ASN D 1 30  ? 2.401   -19.065 94.194  1.00 25.09 ? 27  ASN D ND2   1 
ATOM   10195 N N     . GLU D 1 31  ? 2.766   -16.593 90.438  1.00 30.14 ? 28  GLU D N     1 
ATOM   10196 C CA    . GLU D 1 31  ? 2.908   -15.150 90.364  1.00 28.13 ? 28  GLU D CA    1 
ATOM   10197 C C     . GLU D 1 31  ? 1.613   -14.493 89.874  1.00 26.68 ? 28  GLU D C     1 
ATOM   10198 O O     . GLU D 1 31  ? 1.502   -13.285 89.907  1.00 29.25 ? 28  GLU D O     1 
ATOM   10199 C CB    . GLU D 1 31  ? 4.064   -14.776 89.433  1.00 28.58 ? 28  GLU D CB    1 
ATOM   10200 C CG    . GLU D 1 31  ? 5.414   -14.678 90.126  1.00 28.56 ? 28  GLU D CG    1 
ATOM   10201 C CD    . GLU D 1 31  ? 5.539   -13.410 90.936  1.00 30.83 ? 28  GLU D CD    1 
ATOM   10202 O OE1   . GLU D 1 31  ? 5.697   -12.332 90.320  1.00 34.17 ? 28  GLU D OE1   1 
ATOM   10203 O OE2   . GLU D 1 31  ? 5.463   -13.481 92.183  1.00 33.24 ? 28  GLU D OE2   1 
ATOM   10204 N N     . MET D 1 32  ? 0.632   -15.279 89.435  1.00 25.25 ? 29  MET D N     1 
ATOM   10205 C CA    . MET D 1 32  ? -0.634  -14.723 88.944  1.00 25.39 ? 29  MET D CA    1 
ATOM   10206 C C     . MET D 1 32  ? -1.841  -15.157 89.794  1.00 25.37 ? 29  MET D C     1 
ATOM   10207 O O     . MET D 1 32  ? -2.754  -15.832 89.307  1.00 22.28 ? 29  MET D O     1 
ATOM   10208 C CB    . MET D 1 32  ? -0.852  -15.140 87.483  1.00 25.91 ? 29  MET D CB    1 
ATOM   10209 C CG    . MET D 1 32  ? 0.309   -14.782 86.555  1.00 25.45 ? 29  MET D CG    1 
ATOM   10210 S SD    . MET D 1 32  ? 0.249   -15.560 84.924  1.00 26.84 ? 29  MET D SD    1 
ATOM   10211 C CE    . MET D 1 32  ? -0.822  -14.396 84.013  1.00 25.84 ? 29  MET D CE    1 
ATOM   10212 N N     . PRO D 1 33  ? -1.872  -14.734 91.074  1.00 27.42 ? 30  PRO D N     1 
ATOM   10213 C CA    . PRO D 1 33  ? -2.963  -15.085 91.991  1.00 28.52 ? 30  PRO D CA    1 
ATOM   10214 C C     . PRO D 1 33  ? -4.361  -14.733 91.500  1.00 30.49 ? 30  PRO D C     1 
ATOM   10215 O O     . PRO D 1 33  ? -5.338  -15.398 91.855  1.00 30.77 ? 30  PRO D O     1 
ATOM   10216 C CB    . PRO D 1 33  ? -2.586  -14.351 93.274  1.00 27.77 ? 30  PRO D CB    1 
ATOM   10217 C CG    . PRO D 1 33  ? -1.829  -13.158 92.772  1.00 29.41 ? 30  PRO D CG    1 
ATOM   10218 C CD    . PRO D 1 33  ? -0.966  -13.748 91.697  1.00 27.84 ? 30  PRO D CD    1 
ATOM   10219 N N     . GLY D 1 34  ? -4.466  -13.683 90.692  1.00 31.47 ? 31  GLY D N     1 
ATOM   10220 C CA    . GLY D 1 34  ? -5.766  -13.297 90.178  1.00 30.64 ? 31  GLY D CA    1 
ATOM   10221 C C     . GLY D 1 34  ? -6.360  -14.435 89.374  1.00 31.12 ? 31  GLY D C     1 
ATOM   10222 O O     . GLY D 1 34  ? -7.453  -14.903 89.667  1.00 29.98 ? 31  GLY D O     1 
ATOM   10223 N N     . LEU D 1 35  ? -5.626  -14.903 88.370  1.00 33.14 ? 32  LEU D N     1 
ATOM   10224 C CA    . LEU D 1 35  ? -6.104  -15.989 87.520  1.00 34.86 ? 32  LEU D CA    1 
ATOM   10225 C C     . LEU D 1 35  ? -6.311  -17.286 88.279  1.00 35.96 ? 32  LEU D C     1 
ATOM   10226 O O     . LEU D 1 35  ? -7.174  -18.076 87.927  1.00 37.99 ? 32  LEU D O     1 
ATOM   10227 C CB    . LEU D 1 35  ? -5.136  -16.230 86.359  1.00 34.28 ? 32  LEU D CB    1 
ATOM   10228 C CG    . LEU D 1 35  ? -5.118  -15.163 85.263  1.00 34.71 ? 32  LEU D CG    1 
ATOM   10229 C CD1   . LEU D 1 35  ? -4.165  -15.580 84.142  1.00 34.02 ? 32  LEU D CD1   1 
ATOM   10230 C CD2   . LEU D 1 35  ? -6.527  -14.960 84.724  1.00 31.62 ? 32  LEU D CD2   1 
ATOM   10231 N N     . MET D 1 36  ? -5.518  -17.515 89.317  1.00 38.38 ? 33  MET D N     1 
ATOM   10232 C CA    . MET D 1 36  ? -5.647  -18.748 90.087  1.00 39.21 ? 33  MET D CA    1 
ATOM   10233 C C     . MET D 1 36  ? -6.837  -18.674 91.033  1.00 40.85 ? 33  MET D C     1 
ATOM   10234 O O     . MET D 1 36  ? -7.538  -19.661 91.242  1.00 41.22 ? 33  MET D O     1 
ATOM   10235 C CB    . MET D 1 36  ? -4.357  -19.018 90.859  1.00 37.56 ? 33  MET D CB    1 
ATOM   10236 C CG    . MET D 1 36  ? -3.135  -19.169 89.963  1.00 39.33 ? 33  MET D CG    1 
ATOM   10237 S SD    . MET D 1 36  ? -3.371  -20.432 88.680  1.00 39.06 ? 33  MET D SD    1 
ATOM   10238 C CE    . MET D 1 36  ? -3.323  -21.920 89.682  1.00 39.24 ? 33  MET D CE    1 
ATOM   10239 N N     . ARG D 1 37  ? -7.067  -17.495 91.598  1.00 42.93 ? 34  ARG D N     1 
ATOM   10240 C CA    . ARG D 1 37  ? -8.177  -17.278 92.511  1.00 44.16 ? 34  ARG D CA    1 
ATOM   10241 C C     . ARG D 1 37  ? -9.462  -17.399 91.695  1.00 44.49 ? 34  ARG D C     1 
ATOM   10242 O O     . ARG D 1 37  ? -10.516 -17.753 92.214  1.00 44.80 ? 34  ARG D O     1 
ATOM   10243 C CB    . ARG D 1 37  ? -8.060  -15.885 93.125  1.00 46.75 ? 34  ARG D CB    1 
ATOM   10244 C CG    . ARG D 1 37  ? -8.226  -15.820 94.636  1.00 49.66 ? 34  ARG D CG    1 
ATOM   10245 C CD    . ARG D 1 37  ? -9.647  -15.452 95.027  1.00 52.70 ? 34  ARG D CD    1 
ATOM   10246 N NE    . ARG D 1 37  ? -10.592 -16.543 94.802  1.00 55.35 ? 34  ARG D NE    1 
ATOM   10247 C CZ    . ARG D 1 37  ? -10.581 -17.696 95.466  1.00 57.14 ? 34  ARG D CZ    1 
ATOM   10248 N NH1   . ARG D 1 37  ? -9.665  -17.920 96.406  1.00 57.44 ? 34  ARG D NH1   1 
ATOM   10249 N NH2   . ARG D 1 37  ? -11.497 -18.621 95.199  1.00 56.71 ? 34  ARG D NH2   1 
ATOM   10250 N N     . MET D 1 38  ? -9.360  -17.118 90.402  1.00 45.19 ? 35  MET D N     1 
ATOM   10251 C CA    . MET D 1 38  ? -10.506 -17.192 89.506  1.00 46.78 ? 35  MET D CA    1 
ATOM   10252 C C     . MET D 1 38  ? -10.779 -18.662 89.175  1.00 48.55 ? 35  MET D C     1 
ATOM   10253 O O     . MET D 1 38  ? -11.927 -19.077 89.007  1.00 48.17 ? 35  MET D O     1 
ATOM   10254 C CB    . MET D 1 38  ? -10.214 -16.409 88.222  1.00 45.91 ? 35  MET D CB    1 
ATOM   10255 C CG    . MET D 1 38  ? -11.440 -16.086 87.388  1.00 47.96 ? 35  MET D CG    1 
ATOM   10256 S SD    . MET D 1 38  ? -12.030 -14.391 87.635  1.00 46.74 ? 35  MET D SD    1 
ATOM   10257 C CE    . MET D 1 38  ? -12.177 -14.329 89.430  1.00 42.91 ? 35  MET D CE    1 
ATOM   10258 N N     . ARG D 1 39  ? -9.711  -19.447 89.084  1.00 49.68 ? 36  ARG D N     1 
ATOM   10259 C CA    . ARG D 1 39  ? -9.829  -20.866 88.790  1.00 50.90 ? 36  ARG D CA    1 
ATOM   10260 C C     . ARG D 1 39  ? -10.580 -21.582 89.898  1.00 53.47 ? 36  ARG D C     1 
ATOM   10261 O O     . ARG D 1 39  ? -11.714 -22.013 89.715  1.00 55.10 ? 36  ARG D O     1 
ATOM   10262 C CB    . ARG D 1 39  ? -8.449  -21.515 88.653  1.00 48.43 ? 36  ARG D CB    1 
ATOM   10263 C CG    . ARG D 1 39  ? -7.740  -21.226 87.354  1.00 46.21 ? 36  ARG D CG    1 
ATOM   10264 C CD    . ARG D 1 39  ? -6.417  -21.956 87.309  1.00 43.50 ? 36  ARG D CD    1 
ATOM   10265 N NE    . ARG D 1 39  ? -5.708  -21.744 86.052  1.00 42.08 ? 36  ARG D NE    1 
ATOM   10266 C CZ    . ARG D 1 39  ? -4.626  -22.424 85.693  1.00 41.77 ? 36  ARG D CZ    1 
ATOM   10267 N NH1   . ARG D 1 39  ? -4.139  -23.355 86.503  1.00 40.42 ? 36  ARG D NH1   1 
ATOM   10268 N NH2   . ARG D 1 39  ? -4.038  -22.180 84.525  1.00 41.42 ? 36  ARG D NH2   1 
ATOM   10269 N N     . GLU D 1 40  ? -9.942  -21.696 91.056  1.00 55.64 ? 37  GLU D N     1 
ATOM   10270 C CA    . GLU D 1 40  ? -10.534 -22.393 92.185  1.00 58.20 ? 37  GLU D CA    1 
ATOM   10271 C C     . GLU D 1 40  ? -11.955 -21.969 92.514  1.00 58.87 ? 37  GLU D C     1 
ATOM   10272 O O     . GLU D 1 40  ? -12.737 -22.774 93.023  1.00 60.65 ? 37  GLU D O     1 
ATOM   10273 C CB    . GLU D 1 40  ? -9.655  -22.230 93.423  1.00 60.40 ? 37  GLU D CB    1 
ATOM   10274 C CG    . GLU D 1 40  ? -9.589  -20.821 93.955  1.00 63.73 ? 37  GLU D CG    1 
ATOM   10275 C CD    . GLU D 1 40  ? -8.587  -20.689 95.085  1.00 66.78 ? 37  GLU D CD    1 
ATOM   10276 O OE1   . GLU D 1 40  ? -7.366  -20.684 94.800  1.00 67.91 ? 37  GLU D OE1   1 
ATOM   10277 O OE2   . GLU D 1 40  ? -9.022  -20.603 96.258  1.00 68.36 ? 37  GLU D OE2   1 
ATOM   10278 N N     . ARG D 1 41  ? -12.305 -20.722 92.226  1.00 58.19 ? 38  ARG D N     1 
ATOM   10279 C CA    . ARG D 1 41  ? -13.651 -20.269 92.528  1.00 58.07 ? 38  ARG D CA    1 
ATOM   10280 C C     . ARG D 1 41  ? -14.681 -20.671 91.479  1.00 57.49 ? 38  ARG D C     1 
ATOM   10281 O O     . ARG D 1 41  ? -15.734 -21.208 91.812  1.00 57.48 ? 38  ARG D O     1 
ATOM   10282 C CB    . ARG D 1 41  ? -13.672 -18.755 92.720  1.00 59.07 ? 38  ARG D CB    1 
ATOM   10283 C CG    . ARG D 1 41  ? -15.065 -18.187 92.887  1.00 61.10 ? 38  ARG D CG    1 
ATOM   10284 C CD    . ARG D 1 41  ? -15.033 -16.772 93.423  1.00 63.89 ? 38  ARG D CD    1 
ATOM   10285 N NE    . ARG D 1 41  ? -16.355 -16.150 93.371  1.00 66.25 ? 38  ARG D NE    1 
ATOM   10286 C CZ    . ARG D 1 41  ? -16.651 -14.969 93.907  1.00 67.01 ? 38  ARG D CZ    1 
ATOM   10287 N NH1   . ARG D 1 41  ? -15.716 -14.273 94.544  1.00 66.44 ? 38  ARG D NH1   1 
ATOM   10288 N NH2   . ARG D 1 41  ? -17.882 -14.483 93.800  1.00 66.60 ? 38  ARG D NH2   1 
ATOM   10289 N N     . TYR D 1 42  ? -14.375 -20.422 90.212  1.00 57.57 ? 39  TYR D N     1 
ATOM   10290 C CA    . TYR D 1 42  ? -15.297 -20.745 89.128  1.00 58.00 ? 39  TYR D CA    1 
ATOM   10291 C C     . TYR D 1 42  ? -14.947 -22.015 88.378  1.00 58.02 ? 39  TYR D C     1 
ATOM   10292 O O     . TYR D 1 42  ? -15.230 -22.129 87.186  1.00 59.57 ? 39  TYR D O     1 
ATOM   10293 C CB    . TYR D 1 42  ? -15.361 -19.587 88.136  1.00 57.59 ? 39  TYR D CB    1 
ATOM   10294 C CG    . TYR D 1 42  ? -15.822 -18.307 88.772  1.00 59.61 ? 39  TYR D CG    1 
ATOM   10295 C CD1   . TYR D 1 42  ? -17.139 -18.158 89.201  1.00 59.51 ? 39  TYR D CD1   1 
ATOM   10296 C CD2   . TYR D 1 42  ? -14.928 -17.260 88.997  1.00 60.44 ? 39  TYR D CD2   1 
ATOM   10297 C CE1   . TYR D 1 42  ? -17.557 -17.002 89.845  1.00 60.94 ? 39  TYR D CE1   1 
ATOM   10298 C CE2   . TYR D 1 42  ? -15.334 -16.096 89.641  1.00 61.17 ? 39  TYR D CE2   1 
ATOM   10299 C CZ    . TYR D 1 42  ? -16.650 -15.975 90.064  1.00 61.75 ? 39  TYR D CZ    1 
ATOM   10300 O OH    . TYR D 1 42  ? -17.059 -14.836 90.716  1.00 63.08 ? 39  TYR D OH    1 
ATOM   10301 N N     . SER D 1 43  ? -14.338 -22.968 89.070  1.00 57.11 ? 40  SER D N     1 
ATOM   10302 C CA    . SER D 1 43  ? -13.963 -24.223 88.440  1.00 56.92 ? 40  SER D CA    1 
ATOM   10303 C C     . SER D 1 43  ? -15.078 -25.244 88.610  1.00 56.72 ? 40  SER D C     1 
ATOM   10304 O O     . SER D 1 43  ? -15.515 -25.870 87.646  1.00 56.18 ? 40  SER D O     1 
ATOM   10305 C CB    . SER D 1 43  ? -12.674 -24.762 89.062  1.00 57.09 ? 40  SER D CB    1 
ATOM   10306 O OG    . SER D 1 43  ? -12.315 -26.009 88.494  1.00 55.95 ? 40  SER D OG    1 
ATOM   10307 N N     . ALA D 1 44  ? -15.540 -25.397 89.846  1.00 56.77 ? 41  ALA D N     1 
ATOM   10308 C CA    . ALA D 1 44  ? -16.595 -26.352 90.154  1.00 56.64 ? 41  ALA D CA    1 
ATOM   10309 C C     . ALA D 1 44  ? -17.939 -25.970 89.540  1.00 56.24 ? 41  ALA D C     1 
ATOM   10310 O O     . ALA D 1 44  ? -18.903 -26.729 89.631  1.00 57.48 ? 41  ALA D O     1 
ATOM   10311 C CB    . ALA D 1 44  ? -16.732 -26.495 91.663  1.00 56.20 ? 41  ALA D CB    1 
ATOM   10312 N N     . SER D 1 45  ? -17.995 -24.803 88.905  1.00 54.90 ? 42  SER D N     1 
ATOM   10313 C CA    . SER D 1 45  ? -19.229 -24.320 88.298  1.00 52.37 ? 42  SER D CA    1 
ATOM   10314 C C     . SER D 1 45  ? -19.186 -24.259 86.783  1.00 51.97 ? 42  SER D C     1 
ATOM   10315 O O     . SER D 1 45  ? -20.227 -24.330 86.127  1.00 52.82 ? 42  SER D O     1 
ATOM   10316 C CB    . SER D 1 45  ? -19.559 -22.935 88.834  1.00 52.46 ? 42  SER D CB    1 
ATOM   10317 O OG    . SER D 1 45  ? -19.652 -22.959 90.244  1.00 52.65 ? 42  SER D OG    1 
ATOM   10318 N N     . LYS D 1 46  ? -17.987 -24.118 86.228  1.00 51.33 ? 43  LYS D N     1 
ATOM   10319 C CA    . LYS D 1 46  ? -17.810 -24.034 84.776  1.00 50.38 ? 43  LYS D CA    1 
ATOM   10320 C C     . LYS D 1 46  ? -18.781 -23.018 84.142  1.00 48.90 ? 43  LYS D C     1 
ATOM   10321 O O     . LYS D 1 46  ? -19.585 -23.375 83.283  1.00 47.88 ? 43  LYS D O     1 
ATOM   10322 C CB    . LYS D 1 46  ? -18.032 -25.404 84.117  1.00 49.18 ? 43  LYS D CB    1 
ATOM   10323 C CG    . LYS D 1 46  ? -17.236 -26.552 84.720  1.00 49.78 ? 43  LYS D CG    1 
ATOM   10324 C CD    . LYS D 1 46  ? -15.730 -26.400 84.559  1.00 50.42 ? 43  LYS D CD    1 
ATOM   10325 C CE    . LYS D 1 46  ? -15.009 -27.626 85.145  1.00 51.59 ? 43  LYS D CE    1 
ATOM   10326 N NZ    . LYS D 1 46  ? -13.518 -27.559 85.090  1.00 50.86 ? 43  LYS D NZ    1 
ATOM   10327 N N     . PRO D 1 47  ? -18.706 -21.741 84.556  1.00 47.68 ? 44  PRO D N     1 
ATOM   10328 C CA    . PRO D 1 47  ? -19.594 -20.716 84.002  1.00 46.61 ? 44  PRO D CA    1 
ATOM   10329 C C     . PRO D 1 47  ? -19.426 -20.510 82.498  1.00 45.62 ? 44  PRO D C     1 
ATOM   10330 O O     . PRO D 1 47  ? -20.305 -19.960 81.835  1.00 45.00 ? 44  PRO D O     1 
ATOM   10331 C CB    . PRO D 1 47  ? -19.219 -19.467 84.803  1.00 47.11 ? 44  PRO D CB    1 
ATOM   10332 C CG    . PRO D 1 47  ? -17.764 -19.679 85.094  1.00 47.88 ? 44  PRO D CG    1 
ATOM   10333 C CD    . PRO D 1 47  ? -17.728 -21.141 85.485  1.00 48.61 ? 44  PRO D CD    1 
ATOM   10334 N N     . LEU D 1 48  ? -18.298 -20.954 81.957  1.00 45.59 ? 45  LEU D N     1 
ATOM   10335 C CA    . LEU D 1 48  ? -18.040 -20.793 80.529  1.00 45.39 ? 45  LEU D CA    1 
ATOM   10336 C C     . LEU D 1 48  ? -18.351 -22.070 79.756  1.00 45.20 ? 45  LEU D C     1 
ATOM   10337 O O     . LEU D 1 48  ? -17.930 -22.238 78.608  1.00 44.00 ? 45  LEU D O     1 
ATOM   10338 C CB    . LEU D 1 48  ? -16.584 -20.371 80.286  1.00 45.37 ? 45  LEU D CB    1 
ATOM   10339 C CG    . LEU D 1 48  ? -16.090 -19.019 80.834  1.00 46.09 ? 45  LEU D CG    1 
ATOM   10340 C CD1   . LEU D 1 48  ? -14.596 -18.890 80.565  1.00 44.63 ? 45  LEU D CD1   1 
ATOM   10341 C CD2   . LEU D 1 48  ? -16.851 -17.858 80.189  1.00 44.49 ? 45  LEU D CD2   1 
ATOM   10342 N N     . LYS D 1 49  ? -19.096 -22.969 80.390  1.00 45.92 ? 46  LYS D N     1 
ATOM   10343 C CA    . LYS D 1 49  ? -19.466 -24.217 79.739  1.00 47.27 ? 46  LYS D CA    1 
ATOM   10344 C C     . LYS D 1 49  ? -20.308 -23.895 78.501  1.00 46.79 ? 46  LYS D C     1 
ATOM   10345 O O     . LYS D 1 49  ? -21.269 -23.115 78.566  1.00 45.94 ? 46  LYS D O     1 
ATOM   10346 C CB    . LYS D 1 49  ? -20.247 -25.108 80.708  1.00 49.17 ? 46  LYS D CB    1 
ATOM   10347 C CG    . LYS D 1 49  ? -20.373 -26.555 80.235  1.00 51.69 ? 46  LYS D CG    1 
ATOM   10348 C CD    . LYS D 1 49  ? -21.046 -27.452 81.269  1.00 52.50 ? 46  LYS D CD    1 
ATOM   10349 C CE    . LYS D 1 49  ? -22.539 -27.189 81.375  1.00 53.60 ? 46  LYS D CE    1 
ATOM   10350 N NZ    . LYS D 1 49  ? -23.281 -27.558 80.132  1.00 54.71 ? 46  LYS D NZ    1 
ATOM   10351 N N     . GLY D 1 50  ? -19.921 -24.480 77.370  1.00 46.06 ? 47  GLY D N     1 
ATOM   10352 C CA    . GLY D 1 50  ? -20.634 -24.246 76.126  1.00 45.18 ? 47  GLY D CA    1 
ATOM   10353 C C     . GLY D 1 50  ? -19.972 -23.159 75.301  1.00 44.26 ? 47  GLY D C     1 
ATOM   10354 O O     . GLY D 1 50  ? -20.222 -23.020 74.102  1.00 43.36 ? 47  GLY D O     1 
ATOM   10355 N N     . ALA D 1 51  ? -19.119 -22.377 75.947  1.00 43.04 ? 48  ALA D N     1 
ATOM   10356 C CA    . ALA D 1 51  ? -18.430 -21.312 75.246  1.00 42.11 ? 48  ALA D CA    1 
ATOM   10357 C C     . ALA D 1 51  ? -17.329 -21.893 74.367  1.00 41.06 ? 48  ALA D C     1 
ATOM   10358 O O     . ALA D 1 51  ? -16.635 -22.827 74.760  1.00 40.84 ? 48  ALA D O     1 
ATOM   10359 C CB    . ALA D 1 51  ? -17.844 -20.325 76.248  1.00 41.78 ? 48  ALA D CB    1 
ATOM   10360 N N     . ARG D 1 52  ? -17.195 -21.364 73.160  1.00 40.90 ? 49  ARG D N     1 
ATOM   10361 C CA    . ARG D 1 52  ? -16.151 -21.805 72.248  1.00 40.91 ? 49  ARG D CA    1 
ATOM   10362 C C     . ARG D 1 52  ? -15.331 -20.564 71.954  1.00 41.75 ? 49  ARG D C     1 
ATOM   10363 O O     . ARG D 1 52  ? -15.503 -19.919 70.917  1.00 43.56 ? 49  ARG D O     1 
ATOM   10364 C CB    . ARG D 1 52  ? -16.753 -22.371 70.959  1.00 41.01 ? 49  ARG D CB    1 
ATOM   10365 C CG    . ARG D 1 52  ? -17.354 -23.757 71.126  1.00 42.46 ? 49  ARG D CG    1 
ATOM   10366 C CD    . ARG D 1 52  ? -17.603 -24.406 69.781  1.00 45.24 ? 49  ARG D CD    1 
ATOM   10367 N NE    . ARG D 1 52  ? -18.660 -23.706 69.066  1.00 45.56 ? 49  ARG D NE    1 
ATOM   10368 C CZ    . ARG D 1 52  ? -19.911 -23.647 69.496  1.00 45.79 ? 49  ARG D CZ    1 
ATOM   10369 N NH1   . ARG D 1 52  ? -20.245 -24.258 70.626  1.00 46.09 ? 49  ARG D NH1   1 
ATOM   10370 N NH2   . ARG D 1 52  ? -20.813 -22.950 68.823  1.00 47.51 ? 49  ARG D NH2   1 
ATOM   10371 N N     . ILE D 1 53  ? -14.449 -20.228 72.892  1.00 41.06 ? 50  ILE D N     1 
ATOM   10372 C CA    . ILE D 1 53  ? -13.608 -19.040 72.788  1.00 40.36 ? 50  ILE D CA    1 
ATOM   10373 C C     . ILE D 1 53  ? -12.451 -19.161 71.810  1.00 39.64 ? 50  ILE D C     1 
ATOM   10374 O O     . ILE D 1 53  ? -11.671 -20.104 71.858  1.00 41.53 ? 50  ILE D O     1 
ATOM   10375 C CB    . ILE D 1 53  ? -13.009 -18.647 74.157  1.00 39.18 ? 50  ILE D CB    1 
ATOM   10376 C CG1   . ILE D 1 53  ? -14.116 -18.533 75.208  1.00 38.21 ? 50  ILE D CG1   1 
ATOM   10377 C CG2   . ILE D 1 53  ? -12.264 -17.325 74.019  1.00 39.24 ? 50  ILE D CG2   1 
ATOM   10378 C CD1   . ILE D 1 53  ? -13.608 -18.457 76.641  1.00 34.72 ? 50  ILE D CD1   1 
ATOM   10379 N N     . ALA D 1 54  ? -12.346 -18.183 70.925  1.00 38.99 ? 51  ALA D N     1 
ATOM   10380 C CA    . ALA D 1 54  ? -11.277 -18.155 69.950  1.00 37.96 ? 51  ALA D CA    1 
ATOM   10381 C C     . ALA D 1 54  ? -10.509 -16.881 70.250  1.00 37.93 ? 51  ALA D C     1 
ATOM   10382 O O     . ALA D 1 54  ? -10.989 -15.771 69.980  1.00 39.47 ? 51  ALA D O     1 
ATOM   10383 C CB    . ALA D 1 54  ? -11.848 -18.114 68.557  1.00 37.87 ? 51  ALA D CB    1 
ATOM   10384 N N     . GLY D 1 55  ? -9.320  -17.041 70.819  1.00 35.95 ? 52  GLY D N     1 
ATOM   10385 C CA    . GLY D 1 55  ? -8.524  -15.886 71.170  1.00 32.93 ? 52  GLY D CA    1 
ATOM   10386 C C     . GLY D 1 55  ? -7.361  -15.596 70.251  1.00 31.31 ? 52  GLY D C     1 
ATOM   10387 O O     . GLY D 1 55  ? -6.797  -16.496 69.630  1.00 30.88 ? 52  GLY D O     1 
ATOM   10388 N N     . CYS D 1 56  ? -7.015  -14.316 70.164  1.00 29.98 ? 53  CYS D N     1 
ATOM   10389 C CA    . CYS D 1 56  ? -5.898  -13.858 69.351  1.00 30.15 ? 53  CYS D CA    1 
ATOM   10390 C C     . CYS D 1 56  ? -5.055  -12.931 70.211  1.00 29.24 ? 53  CYS D C     1 
ATOM   10391 O O     . CYS D 1 56  ? -5.294  -11.726 70.268  1.00 28.19 ? 53  CYS D O     1 
ATOM   10392 C CB    . CYS D 1 56  ? -6.385  -13.100 68.120  1.00 30.58 ? 53  CYS D CB    1 
ATOM   10393 S SG    . CYS D 1 56  ? -5.026  -12.556 67.038  1.00 36.36 ? 53  CYS D SG    1 
ATOM   10394 N N     . LEU D 1 57  ? -4.067  -13.496 70.887  1.00 28.71 ? 54  LEU D N     1 
ATOM   10395 C CA    . LEU D 1 57  ? -3.223  -12.701 71.755  1.00 28.79 ? 54  LEU D CA    1 
ATOM   10396 C C     . LEU D 1 57  ? -1.828  -13.318 71.795  1.00 29.26 ? 54  LEU D C     1 
ATOM   10397 O O     . LEU D 1 57  ? -1.680  -14.534 71.682  1.00 30.81 ? 54  LEU D O     1 
ATOM   10398 C CB    . LEU D 1 57  ? -3.846  -12.676 73.150  1.00 28.64 ? 54  LEU D CB    1 
ATOM   10399 C CG    . LEU D 1 57  ? -3.584  -11.477 74.056  1.00 29.78 ? 54  LEU D CG    1 
ATOM   10400 C CD1   . LEU D 1 57  ? -4.488  -11.591 75.269  1.00 28.89 ? 54  LEU D CD1   1 
ATOM   10401 C CD2   . LEU D 1 57  ? -2.114  -11.415 74.470  1.00 31.04 ? 54  LEU D CD2   1 
ATOM   10402 N N     . HIS D 1 58  ? -0.812  -12.474 71.949  1.00 28.17 ? 55  HIS D N     1 
ATOM   10403 C CA    . HIS D 1 58  ? 0.580   -12.922 72.003  1.00 25.85 ? 55  HIS D CA    1 
ATOM   10404 C C     . HIS D 1 58  ? 0.704   -14.247 72.762  1.00 24.14 ? 55  HIS D C     1 
ATOM   10405 O O     . HIS D 1 58  ? 0.462   -14.294 73.965  1.00 25.53 ? 55  HIS D O     1 
ATOM   10406 C CB    . HIS D 1 58  ? 1.429   -11.842 72.685  1.00 24.89 ? 55  HIS D CB    1 
ATOM   10407 C CG    . HIS D 1 58  ? 1.155   -10.451 72.190  1.00 23.58 ? 55  HIS D CG    1 
ATOM   10408 N ND1   . HIS D 1 58  ? 1.740   -9.929  71.054  1.00 22.14 ? 55  HIS D ND1   1 
ATOM   10409 C CD2   . HIS D 1 58  ? 0.361   -9.472  72.690  1.00 21.84 ? 55  HIS D CD2   1 
ATOM   10410 C CE1   . HIS D 1 58  ? 1.321   -8.685  70.884  1.00 22.25 ? 55  HIS D CE1   1 
ATOM   10411 N NE2   . HIS D 1 58  ? 0.484   -8.383  71.862  1.00 18.83 ? 55  HIS D NE2   1 
ATOM   10412 N N     . MET D 1 59  ? 1.071   -15.317 72.063  1.00 22.30 ? 56  MET D N     1 
ATOM   10413 C CA    . MET D 1 59  ? 1.195   -16.628 72.694  1.00 23.97 ? 56  MET D CA    1 
ATOM   10414 C C     . MET D 1 59  ? 2.422   -16.702 73.603  1.00 23.92 ? 56  MET D C     1 
ATOM   10415 O O     . MET D 1 59  ? 3.494   -17.150 73.188  1.00 25.18 ? 56  MET D O     1 
ATOM   10416 C CB    . MET D 1 59  ? 1.277   -17.729 71.634  1.00 24.04 ? 56  MET D CB    1 
ATOM   10417 C CG    . MET D 1 59  ? 1.255   -19.129 72.218  1.00 25.43 ? 56  MET D CG    1 
ATOM   10418 S SD    . MET D 1 59  ? -0.214  -19.403 73.233  1.00 31.92 ? 56  MET D SD    1 
ATOM   10419 C CE    . MET D 1 59  ? 0.486   -19.509 74.911  1.00 28.78 ? 56  MET D CE    1 
ATOM   10420 N N     . THR D 1 60  ? 2.243   -16.286 74.851  1.00 22.16 ? 57  THR D N     1 
ATOM   10421 C CA    . THR D 1 60  ? 3.327   -16.249 75.819  1.00 21.52 ? 57  THR D CA    1 
ATOM   10422 C C     . THR D 1 60  ? 2.997   -17.120 77.042  1.00 23.91 ? 57  THR D C     1 
ATOM   10423 O O     . THR D 1 60  ? 1.926   -17.730 77.120  1.00 22.91 ? 57  THR D O     1 
ATOM   10424 C CB    . THR D 1 60  ? 3.554   -14.795 76.295  1.00 19.47 ? 57  THR D CB    1 
ATOM   10425 O OG1   . THR D 1 60  ? 2.430   -14.389 77.075  1.00 20.49 ? 57  THR D OG1   1 
ATOM   10426 C CG2   . THR D 1 60  ? 3.678   -13.838 75.103  1.00 16.58 ? 57  THR D CG2   1 
ATOM   10427 N N     . VAL D 1 61  ? 3.929   -17.181 77.989  1.00 24.58 ? 58  VAL D N     1 
ATOM   10428 C CA    . VAL D 1 61  ? 3.716   -17.941 79.209  1.00 25.19 ? 58  VAL D CA    1 
ATOM   10429 C C     . VAL D 1 61  ? 2.503   -17.353 79.944  1.00 27.18 ? 58  VAL D C     1 
ATOM   10430 O O     . VAL D 1 61  ? 1.653   -18.094 80.453  1.00 26.10 ? 58  VAL D O     1 
ATOM   10431 C CB    . VAL D 1 61  ? 4.962   -17.867 80.130  1.00 24.09 ? 58  VAL D CB    1 
ATOM   10432 C CG1   . VAL D 1 61  ? 4.699   -18.577 81.454  1.00 21.53 ? 58  VAL D CG1   1 
ATOM   10433 C CG2   . VAL D 1 61  ? 6.151   -18.466 79.420  1.00 19.75 ? 58  VAL D CG2   1 
ATOM   10434 N N     . GLU D 1 62  ? 2.413   -16.025 79.992  1.00 26.93 ? 59  GLU D N     1 
ATOM   10435 C CA    . GLU D 1 62  ? 1.282   -15.404 80.677  1.00 29.92 ? 59  GLU D CA    1 
ATOM   10436 C C     . GLU D 1 62  ? -0.038  -15.780 80.007  1.00 30.19 ? 59  GLU D C     1 
ATOM   10437 O O     . GLU D 1 62  ? -1.007  -16.129 80.686  1.00 31.32 ? 59  GLU D O     1 
ATOM   10438 C CB    . GLU D 1 62  ? 1.420   -13.878 80.712  1.00 28.68 ? 59  GLU D CB    1 
ATOM   10439 C CG    . GLU D 1 62  ? 2.530   -13.376 81.596  1.00 29.90 ? 59  GLU D CG    1 
ATOM   10440 C CD    . GLU D 1 62  ? 3.891   -13.882 81.178  1.00 29.62 ? 59  GLU D CD    1 
ATOM   10441 O OE1   . GLU D 1 62  ? 4.162   -13.912 79.963  1.00 30.45 ? 59  GLU D OE1   1 
ATOM   10442 O OE2   . GLU D 1 62  ? 4.699   -14.235 82.062  1.00 31.33 ? 59  GLU D OE2   1 
ATOM   10443 N N     . THR D 1 63  ? -0.066  -15.714 78.679  1.00 29.54 ? 60  THR D N     1 
ATOM   10444 C CA    . THR D 1 63  ? -1.270  -16.044 77.930  1.00 30.62 ? 60  THR D CA    1 
ATOM   10445 C C     . THR D 1 63  ? -1.645  -17.506 78.147  1.00 30.36 ? 60  THR D C     1 
ATOM   10446 O O     . THR D 1 63  ? -2.823  -17.847 78.214  1.00 30.14 ? 60  THR D O     1 
ATOM   10447 C CB    . THR D 1 63  ? -1.075  -15.807 76.415  1.00 32.74 ? 60  THR D CB    1 
ATOM   10448 O OG1   . THR D 1 63  ? -0.688  -14.447 76.193  1.00 34.28 ? 60  THR D OG1   1 
ATOM   10449 C CG2   . THR D 1 63  ? -2.374  -16.084 75.664  1.00 34.06 ? 60  THR D CG2   1 
ATOM   10450 N N     . ALA D 1 64  ? -0.632  -18.363 78.253  1.00 28.59 ? 61  ALA D N     1 
ATOM   10451 C CA    . ALA D 1 64  ? -0.853  -19.783 78.478  1.00 27.12 ? 61  ALA D CA    1 
ATOM   10452 C C     . ALA D 1 64  ? -1.621  -20.010 79.771  1.00 26.16 ? 61  ALA D C     1 
ATOM   10453 O O     . ALA D 1 64  ? -2.478  -20.889 79.839  1.00 27.32 ? 61  ALA D O     1 
ATOM   10454 C CB    . ALA D 1 64  ? 0.479   -20.524 78.529  1.00 27.24 ? 61  ALA D CB    1 
ATOM   10455 N N     . VAL D 1 65  ? -1.321  -19.225 80.801  1.00 25.21 ? 62  VAL D N     1 
ATOM   10456 C CA    . VAL D 1 65  ? -2.016  -19.388 82.073  1.00 26.71 ? 62  VAL D CA    1 
ATOM   10457 C C     . VAL D 1 65  ? -3.471  -18.942 81.961  1.00 28.36 ? 62  VAL D C     1 
ATOM   10458 O O     . VAL D 1 65  ? -4.357  -19.483 82.629  1.00 28.45 ? 62  VAL D O     1 
ATOM   10459 C CB    . VAL D 1 65  ? -1.295  -18.624 83.197  1.00 25.31 ? 62  VAL D CB    1 
ATOM   10460 C CG1   . VAL D 1 65  ? -2.158  -18.567 84.438  1.00 23.60 ? 62  VAL D CG1   1 
ATOM   10461 C CG2   . VAL D 1 65  ? 0.022   -19.322 83.511  1.00 24.96 ? 62  VAL D CG2   1 
ATOM   10462 N N     . LEU D 1 66  ? -3.702  -17.955 81.106  1.00 28.75 ? 63  LEU D N     1 
ATOM   10463 C CA    . LEU D 1 66  ? -5.037  -17.445 80.864  1.00 30.68 ? 63  LEU D CA    1 
ATOM   10464 C C     . LEU D 1 66  ? -5.824  -18.513 80.093  1.00 31.27 ? 63  LEU D C     1 
ATOM   10465 O O     . LEU D 1 66  ? -6.938  -18.879 80.479  1.00 30.76 ? 63  LEU D O     1 
ATOM   10466 C CB    . LEU D 1 66  ? -4.960  -16.151 80.042  1.00 30.56 ? 63  LEU D CB    1 
ATOM   10467 C CG    . LEU D 1 66  ? -6.265  -15.750 79.355  1.00 32.58 ? 63  LEU D CG    1 
ATOM   10468 C CD1   . LEU D 1 66  ? -7.332  -15.579 80.410  1.00 31.16 ? 63  LEU D CD1   1 
ATOM   10469 C CD2   . LEU D 1 66  ? -6.080  -14.467 78.537  1.00 33.40 ? 63  LEU D CD2   1 
ATOM   10470 N N     . ILE D 1 67  ? -5.228  -19.020 79.015  1.00 30.31 ? 64  ILE D N     1 
ATOM   10471 C CA    . ILE D 1 67  ? -5.875  -20.044 78.204  1.00 30.66 ? 64  ILE D CA    1 
ATOM   10472 C C     . ILE D 1 67  ? -6.327  -21.244 79.042  1.00 31.45 ? 64  ILE D C     1 
ATOM   10473 O O     . ILE D 1 67  ? -7.457  -21.712 78.887  1.00 31.14 ? 64  ILE D O     1 
ATOM   10474 C CB    . ILE D 1 67  ? -4.955  -20.535 77.084  1.00 29.83 ? 64  ILE D CB    1 
ATOM   10475 C CG1   . ILE D 1 67  ? -4.579  -19.362 76.187  1.00 28.86 ? 64  ILE D CG1   1 
ATOM   10476 C CG2   . ILE D 1 67  ? -5.668  -21.598 76.253  1.00 30.91 ? 64  ILE D CG2   1 
ATOM   10477 C CD1   . ILE D 1 67  ? -3.635  -19.734 75.079  1.00 30.21 ? 64  ILE D CD1   1 
ATOM   10478 N N     . GLU D 1 68  ? -5.459  -21.739 79.924  1.00 30.74 ? 65  GLU D N     1 
ATOM   10479 C CA    . GLU D 1 68  ? -5.839  -22.870 80.770  1.00 32.43 ? 65  GLU D CA    1 
ATOM   10480 C C     . GLU D 1 68  ? -6.889  -22.472 81.810  1.00 33.47 ? 65  GLU D C     1 
ATOM   10481 O O     . GLU D 1 68  ? -7.681  -23.304 82.233  1.00 35.76 ? 65  GLU D O     1 
ATOM   10482 C CB    . GLU D 1 68  ? -4.617  -23.491 81.462  1.00 30.62 ? 65  GLU D CB    1 
ATOM   10483 C CG    . GLU D 1 68  ? -3.649  -24.143 80.491  1.00 31.85 ? 65  GLU D CG    1 
ATOM   10484 C CD    . GLU D 1 68  ? -2.674  -25.099 81.154  1.00 32.07 ? 65  GLU D CD    1 
ATOM   10485 O OE1   . GLU D 1 68  ? -2.045  -24.716 82.163  1.00 32.60 ? 65  GLU D OE1   1 
ATOM   10486 O OE2   . GLU D 1 68  ? -2.530  -26.236 80.646  1.00 31.93 ? 65  GLU D OE2   1 
ATOM   10487 N N     . THR D 1 69  ? -6.907  -21.204 82.212  1.00 33.54 ? 66  THR D N     1 
ATOM   10488 C CA    . THR D 1 69  ? -7.893  -20.741 83.181  1.00 33.33 ? 66  THR D CA    1 
ATOM   10489 C C     . THR D 1 69  ? -9.292  -20.784 82.542  1.00 33.37 ? 66  THR D C     1 
ATOM   10490 O O     . THR D 1 69  ? -10.255 -21.245 83.154  1.00 33.36 ? 66  THR D O     1 
ATOM   10491 C CB    . THR D 1 69  ? -7.573  -19.305 83.657  1.00 33.62 ? 66  THR D CB    1 
ATOM   10492 O OG1   . THR D 1 69  ? -6.289  -19.301 84.311  1.00 35.01 ? 66  THR D OG1   1 
ATOM   10493 C CG2   . THR D 1 69  ? -8.628  -18.812 84.636  1.00 30.06 ? 66  THR D CG2   1 
ATOM   10494 N N     . LEU D 1 70  ? -9.403  -20.308 81.308  1.00 33.29 ? 67  LEU D N     1 
ATOM   10495 C CA    . LEU D 1 70  ? -10.673 -20.341 80.603  1.00 33.67 ? 67  LEU D CA    1 
ATOM   10496 C C     . LEU D 1 70  ? -11.136 -21.791 80.519  1.00 34.99 ? 67  LEU D C     1 
ATOM   10497 O O     . LEU D 1 70  ? -12.303 -22.098 80.770  1.00 36.14 ? 67  LEU D O     1 
ATOM   10498 C CB    . LEU D 1 70  ? -10.511 -19.784 79.187  1.00 31.93 ? 67  LEU D CB    1 
ATOM   10499 C CG    . LEU D 1 70  ? -10.107 -18.316 79.066  1.00 31.17 ? 67  LEU D CG    1 
ATOM   10500 C CD1   . LEU D 1 70  ? -9.707  -18.058 77.640  1.00 29.73 ? 67  LEU D CD1   1 
ATOM   10501 C CD2   . LEU D 1 70  ? -11.241 -17.392 79.513  1.00 26.56 ? 67  LEU D CD2   1 
ATOM   10502 N N     . VAL D 1 71  ? -10.210 -22.681 80.172  1.00 34.76 ? 68  VAL D N     1 
ATOM   10503 C CA    . VAL D 1 71  ? -10.522 -24.098 80.067  1.00 34.41 ? 68  VAL D CA    1 
ATOM   10504 C C     . VAL D 1 71  ? -10.981 -24.658 81.411  1.00 36.15 ? 68  VAL D C     1 
ATOM   10505 O O     . VAL D 1 71  ? -11.986 -25.377 81.476  1.00 36.42 ? 68  VAL D O     1 
ATOM   10506 C CB    . VAL D 1 71  ? -9.305  -24.905 79.563  1.00 31.63 ? 68  VAL D CB    1 
ATOM   10507 C CG1   . VAL D 1 71  ? -9.585  -26.392 79.652  1.00 29.90 ? 68  VAL D CG1   1 
ATOM   10508 C CG2   . VAL D 1 71  ? -9.005  -24.529 78.138  1.00 29.28 ? 68  VAL D CG2   1 
ATOM   10509 N N     . THR D 1 72  ? -10.247 -24.326 82.476  1.00 36.05 ? 69  THR D N     1 
ATOM   10510 C CA    . THR D 1 72  ? -10.584 -24.789 83.825  1.00 36.91 ? 69  THR D CA    1 
ATOM   10511 C C     . THR D 1 72  ? -12.029 -24.418 84.144  1.00 37.77 ? 69  THR D C     1 
ATOM   10512 O O     . THR D 1 72  ? -12.667 -25.038 85.006  1.00 38.48 ? 69  THR D O     1 
ATOM   10513 C CB    . THR D 1 72  ? -9.681  -24.141 84.923  1.00 37.62 ? 69  THR D CB    1 
ATOM   10514 O OG1   . THR D 1 72  ? -8.300  -24.447 84.681  1.00 38.50 ? 69  THR D OG1   1 
ATOM   10515 C CG2   . THR D 1 72  ? -10.070 -24.663 86.300  1.00 36.13 ? 69  THR D CG2   1 
ATOM   10516 N N     . LEU D 1 73  ? -12.531 -23.394 83.454  1.00 37.10 ? 70  LEU D N     1 
ATOM   10517 C CA    . LEU D 1 73  ? -13.895 -22.916 83.643  1.00 37.11 ? 70  LEU D CA    1 
ATOM   10518 C C     . LEU D 1 73  ? -14.861 -23.497 82.603  1.00 38.09 ? 70  LEU D C     1 
ATOM   10519 O O     . LEU D 1 73  ? -15.845 -22.866 82.232  1.00 38.91 ? 70  LEU D O     1 
ATOM   10520 C CB    . LEU D 1 73  ? -13.921 -21.373 83.602  1.00 35.14 ? 70  LEU D CB    1 
ATOM   10521 C CG    . LEU D 1 73  ? -13.594 -20.592 84.892  1.00 32.94 ? 70  LEU D CG    1 
ATOM   10522 C CD1   . LEU D 1 73  ? -12.318 -21.119 85.507  1.00 31.40 ? 70  LEU D CD1   1 
ATOM   10523 C CD2   . LEU D 1 73  ? -13.466 -19.097 84.597  1.00 28.40 ? 70  LEU D CD2   1 
ATOM   10524 N N     . GLY D 1 74  ? -14.574 -24.704 82.129  1.00 38.61 ? 71  GLY D N     1 
ATOM   10525 C CA    . GLY D 1 74  ? -15.454 -25.341 81.164  1.00 38.44 ? 71  GLY D CA    1 
ATOM   10526 C C     . GLY D 1 74  ? -15.441 -24.759 79.766  1.00 38.13 ? 71  GLY D C     1 
ATOM   10527 O O     . GLY D 1 74  ? -16.191 -25.204 78.898  1.00 37.03 ? 71  GLY D O     1 
ATOM   10528 N N     . ALA D 1 75  ? -14.594 -23.768 79.526  1.00 38.16 ? 72  ALA D N     1 
ATOM   10529 C CA    . ALA D 1 75  ? -14.542 -23.180 78.197  1.00 39.63 ? 72  ALA D CA    1 
ATOM   10530 C C     . ALA D 1 75  ? -13.685 -24.008 77.240  1.00 41.04 ? 72  ALA D C     1 
ATOM   10531 O O     . ALA D 1 75  ? -12.702 -24.639 77.638  1.00 39.99 ? 72  ALA D O     1 
ATOM   10532 C CB    . ALA D 1 75  ? -14.023 -21.746 78.275  1.00 38.35 ? 72  ALA D CB    1 
ATOM   10533 N N     . GLU D 1 76  ? -14.082 -23.999 75.972  1.00 42.51 ? 73  GLU D N     1 
ATOM   10534 C CA    . GLU D 1 76  ? -13.385 -24.719 74.911  1.00 43.45 ? 73  GLU D CA    1 
ATOM   10535 C C     . GLU D 1 76  ? -12.583 -23.635 74.218  1.00 42.52 ? 73  GLU D C     1 
ATOM   10536 O O     . GLU D 1 76  ? -13.134 -22.590 73.880  1.00 44.21 ? 73  GLU D O     1 
ATOM   10537 C CB    . GLU D 1 76  ? -14.419 -25.316 73.969  1.00 45.57 ? 73  GLU D CB    1 
ATOM   10538 C CG    . GLU D 1 76  ? -13.925 -26.341 72.990  1.00 48.55 ? 73  GLU D CG    1 
ATOM   10539 C CD    . GLU D 1 76  ? -15.059 -27.259 72.575  1.00 51.19 ? 73  GLU D CD    1 
ATOM   10540 O OE1   . GLU D 1 76  ? -15.353 -28.208 73.336  1.00 52.73 ? 73  GLU D OE1   1 
ATOM   10541 O OE2   . GLU D 1 76  ? -15.673 -27.021 71.509  1.00 52.98 ? 73  GLU D OE2   1 
ATOM   10542 N N     . VAL D 1 77  ? -11.293 -23.864 73.994  1.00 41.72 ? 74  VAL D N     1 
ATOM   10543 C CA    . VAL D 1 77  ? -10.469 -22.820 73.380  1.00 39.83 ? 74  VAL D CA    1 
ATOM   10544 C C     . VAL D 1 77  ? -9.583  -23.218 72.204  1.00 39.46 ? 74  VAL D C     1 
ATOM   10545 O O     . VAL D 1 77  ? -9.138  -24.361 72.103  1.00 38.17 ? 74  VAL D O     1 
ATOM   10546 C CB    . VAL D 1 77  ? -9.559  -22.188 74.451  1.00 39.43 ? 74  VAL D CB    1 
ATOM   10547 C CG1   . VAL D 1 77  ? -8.917  -20.927 73.912  1.00 38.70 ? 74  VAL D CG1   1 
ATOM   10548 C CG2   . VAL D 1 77  ? -10.355 -21.923 75.722  1.00 38.46 ? 74  VAL D CG2   1 
ATOM   10549 N N     . GLN D 1 78  ? -9.338  -22.244 71.326  1.00 39.85 ? 75  GLN D N     1 
ATOM   10550 C CA    . GLN D 1 78  ? -8.460  -22.385 70.148  1.00 40.89 ? 75  GLN D CA    1 
ATOM   10551 C C     . GLN D 1 78  ? -7.717  -21.049 70.062  1.00 39.17 ? 75  GLN D C     1 
ATOM   10552 O O     . GLN D 1 78  ? -8.342  -19.994 69.960  1.00 39.57 ? 75  GLN D O     1 
ATOM   10553 C CB    . GLN D 1 78  ? -9.267  -22.655 68.858  1.00 41.64 ? 75  GLN D CB    1 
ATOM   10554 C CG    . GLN D 1 78  ? -9.921  -24.049 68.813  1.00 44.97 ? 75  GLN D CG    1 
ATOM   10555 C CD    . GLN D 1 78  ? -10.541 -24.415 67.455  1.00 47.26 ? 75  GLN D CD    1 
ATOM   10556 O OE1   . GLN D 1 78  ? -10.800 -25.601 67.180  1.00 45.39 ? 75  GLN D OE1   1 
ATOM   10557 N NE2   . GLN D 1 78  ? -10.788 -23.405 66.608  1.00 48.04 ? 75  GLN D NE2   1 
ATOM   10558 N N     . TRP D 1 79  ? -6.387  -21.089 70.098  1.00 38.22 ? 76  TRP D N     1 
ATOM   10559 C CA    . TRP D 1 79  ? -5.605  -19.848 70.107  1.00 37.23 ? 76  TRP D CA    1 
ATOM   10560 C C     . TRP D 1 79  ? -4.614  -19.563 68.989  1.00 36.89 ? 76  TRP D C     1 
ATOM   10561 O O     . TRP D 1 79  ? -4.177  -20.462 68.266  1.00 37.66 ? 76  TRP D O     1 
ATOM   10562 C CB    . TRP D 1 79  ? -4.861  -19.766 71.428  1.00 36.59 ? 76  TRP D CB    1 
ATOM   10563 C CG    . TRP D 1 79  ? -4.750  -18.404 71.989  1.00 34.31 ? 76  TRP D CG    1 
ATOM   10564 C CD1   . TRP D 1 79  ? -3.776  -17.483 71.732  1.00 34.15 ? 76  TRP D CD1   1 
ATOM   10565 C CD2   . TRP D 1 79  ? -5.604  -17.830 72.979  1.00 33.45 ? 76  TRP D CD2   1 
ATOM   10566 N NE1   . TRP D 1 79  ? -3.967  -16.368 72.514  1.00 33.51 ? 76  TRP D NE1   1 
ATOM   10567 C CE2   . TRP D 1 79  ? -5.083  -16.555 73.290  1.00 32.65 ? 76  TRP D CE2   1 
ATOM   10568 C CE3   . TRP D 1 79  ? -6.758  -18.272 73.639  1.00 32.72 ? 76  TRP D CE3   1 
ATOM   10569 C CZ2   . TRP D 1 79  ? -5.675  -15.715 74.236  1.00 29.72 ? 76  TRP D CZ2   1 
ATOM   10570 C CZ3   . TRP D 1 79  ? -7.348  -17.438 74.579  1.00 31.15 ? 76  TRP D CZ3   1 
ATOM   10571 C CH2   . TRP D 1 79  ? -6.803  -16.173 74.868  1.00 31.23 ? 76  TRP D CH2   1 
ATOM   10572 N N     . SER D 1 80  ? -4.260  -18.285 68.873  1.00 36.08 ? 77  SER D N     1 
ATOM   10573 C CA    . SER D 1 80  ? -3.288  -17.805 67.891  1.00 35.51 ? 77  SER D CA    1 
ATOM   10574 C C     . SER D 1 80  ? -2.650  -16.532 68.446  1.00 35.11 ? 77  SER D C     1 
ATOM   10575 O O     . SER D 1 80  ? -3.227  -15.855 69.292  1.00 35.22 ? 77  SER D O     1 
ATOM   10576 C CB    . SER D 1 80  ? -3.953  -17.498 66.546  1.00 34.46 ? 77  SER D CB    1 
ATOM   10577 O OG    . SER D 1 80  ? -4.688  -16.287 66.601  1.00 35.38 ? 77  SER D OG    1 
ATOM   10578 N N     . SER D 1 81  ? -1.462  -16.201 67.965  1.00 35.05 ? 78  SER D N     1 
ATOM   10579 C CA    . SER D 1 81  ? -0.791  -15.009 68.448  1.00 34.83 ? 78  SER D CA    1 
ATOM   10580 C C     . SER D 1 81  ? -1.171  -13.793 67.608  1.00 34.19 ? 78  SER D C     1 
ATOM   10581 O O     . SER D 1 81  ? -1.278  -13.885 66.382  1.00 35.92 ? 78  SER D O     1 
ATOM   10582 C CB    . SER D 1 81  ? 0.723   -15.220 68.422  1.00 36.13 ? 78  SER D CB    1 
ATOM   10583 O OG    . SER D 1 81  ? 1.372   -14.302 69.280  1.00 38.60 ? 78  SER D OG    1 
ATOM   10584 N N     . CYS D 1 82  ? -1.388  -12.658 68.274  1.00 32.23 ? 79  CYS D N     1 
ATOM   10585 C CA    . CYS D 1 82  ? -1.751  -11.417 67.596  1.00 29.17 ? 79  CYS D CA    1 
ATOM   10586 C C     . CYS D 1 82  ? -0.532  -10.630 67.124  1.00 29.07 ? 79  CYS D C     1 
ATOM   10587 O O     . CYS D 1 82  ? -0.572  -9.406  67.035  1.00 28.18 ? 79  CYS D O     1 
ATOM   10588 C CB    . CYS D 1 82  ? -2.610  -10.526 68.500  1.00 27.61 ? 79  CYS D CB    1 
ATOM   10589 S SG    . CYS D 1 82  ? -1.763  -9.787  69.922  1.00 26.89 ? 79  CYS D SG    1 
ATOM   10590 N N     . ASN D 1 83  ? 0.554   -11.337 66.836  1.00 28.88 ? 80  ASN D N     1 
ATOM   10591 C CA    . ASN D 1 83  ? 1.768   -10.704 66.340  1.00 28.35 ? 80  ASN D CA    1 
ATOM   10592 C C     . ASN D 1 83  ? 2.755   -11.789 65.941  1.00 29.94 ? 80  ASN D C     1 
ATOM   10593 O O     . ASN D 1 83  ? 2.927   -12.780 66.651  1.00 30.79 ? 80  ASN D O     1 
ATOM   10594 C CB    . ASN D 1 83  ? 2.379   -9.773  67.388  1.00 26.79 ? 80  ASN D CB    1 
ATOM   10595 C CG    . ASN D 1 83  ? 3.590   -9.013  66.856  1.00 25.28 ? 80  ASN D CG    1 
ATOM   10596 O OD1   . ASN D 1 83  ? 4.701   -9.555  66.784  1.00 24.24 ? 80  ASN D OD1   1 
ATOM   10597 N ND2   . ASN D 1 83  ? 3.379   -7.761  66.471  1.00 20.51 ? 80  ASN D ND2   1 
ATOM   10598 N N     . ILE D 1 84  ? 3.388   -11.591 64.792  1.00 30.45 ? 81  ILE D N     1 
ATOM   10599 C CA    . ILE D 1 84  ? 4.332   -12.545 64.234  1.00 31.01 ? 81  ILE D CA    1 
ATOM   10600 C C     . ILE D 1 84  ? 5.637   -12.744 64.998  1.00 31.70 ? 81  ILE D C     1 
ATOM   10601 O O     . ILE D 1 84  ? 6.375   -13.689 64.705  1.00 33.22 ? 81  ILE D O     1 
ATOM   10602 C CB    . ILE D 1 84  ? 4.703   -12.152 62.770  1.00 31.87 ? 81  ILE D CB    1 
ATOM   10603 C CG1   . ILE D 1 84  ? 5.385   -10.783 62.747  1.00 31.06 ? 81  ILE D CG1   1 
ATOM   10604 C CG2   . ILE D 1 84  ? 3.459   -12.112 61.904  1.00 32.12 ? 81  ILE D CG2   1 
ATOM   10605 C CD1   . ILE D 1 84  ? 5.988   -10.422 61.403  1.00 30.25 ? 81  ILE D CD1   1 
ATOM   10606 N N     . PHE D 1 85  ? 5.932   -11.871 65.959  1.00 30.72 ? 82  PHE D N     1 
ATOM   10607 C CA    . PHE D 1 85  ? 7.182   -11.986 66.717  1.00 30.10 ? 82  PHE D CA    1 
ATOM   10608 C C     . PHE D 1 85  ? 7.037   -12.154 68.225  1.00 28.04 ? 82  PHE D C     1 
ATOM   10609 O O     . PHE D 1 85  ? 8.023   -12.348 68.919  1.00 26.60 ? 82  PHE D O     1 
ATOM   10610 C CB    . PHE D 1 85  ? 8.062   -10.756 66.479  1.00 31.28 ? 82  PHE D CB    1 
ATOM   10611 C CG    . PHE D 1 85  ? 8.574   -10.626 65.076  1.00 33.06 ? 82  PHE D CG    1 
ATOM   10612 C CD1   . PHE D 1 85  ? 9.144   -11.716 64.427  1.00 32.81 ? 82  PHE D CD1   1 
ATOM   10613 C CD2   . PHE D 1 85  ? 8.520   -9.398  64.415  1.00 34.05 ? 82  PHE D CD2   1 
ATOM   10614 C CE1   . PHE D 1 85  ? 9.656   -11.588 63.139  1.00 33.00 ? 82  PHE D CE1   1 
ATOM   10615 C CE2   . PHE D 1 85  ? 9.027   -9.262  63.131  1.00 34.03 ? 82  PHE D CE2   1 
ATOM   10616 C CZ    . PHE D 1 85  ? 9.597   -10.358 62.492  1.00 32.86 ? 82  PHE D CZ    1 
ATOM   10617 N N     . SER D 1 86  ? 5.814   -12.068 68.728  1.00 27.31 ? 83  SER D N     1 
ATOM   10618 C CA    . SER D 1 86  ? 5.581   -12.140 70.165  1.00 26.43 ? 83  SER D CA    1 
ATOM   10619 C C     . SER D 1 86  ? 5.396   -13.523 70.794  1.00 26.55 ? 83  SER D C     1 
ATOM   10620 O O     . SER D 1 86  ? 5.364   -13.640 72.016  1.00 26.67 ? 83  SER D O     1 
ATOM   10621 C CB    . SER D 1 86  ? 4.387   -11.263 70.515  1.00 26.96 ? 83  SER D CB    1 
ATOM   10622 O OG    . SER D 1 86  ? 3.229   -11.692 69.814  1.00 27.89 ? 83  SER D OG    1 
ATOM   10623 N N     . THR D 1 87  ? 5.284   -14.567 69.982  1.00 26.08 ? 84  THR D N     1 
ATOM   10624 C CA    . THR D 1 87  ? 5.082   -15.902 70.523  1.00 27.09 ? 84  THR D CA    1 
ATOM   10625 C C     . THR D 1 87  ? 6.303   -16.457 71.295  1.00 27.37 ? 84  THR D C     1 
ATOM   10626 O O     . THR D 1 87  ? 7.456   -16.165 70.963  1.00 26.23 ? 84  THR D O     1 
ATOM   10627 C CB    . THR D 1 87  ? 4.687   -16.889 69.388  1.00 28.64 ? 84  THR D CB    1 
ATOM   10628 O OG1   . THR D 1 87  ? 3.468   -16.455 68.777  1.00 30.13 ? 84  THR D OG1   1 
ATOM   10629 C CG2   . THR D 1 87  ? 4.472   -18.295 69.943  1.00 28.48 ? 84  THR D CG2   1 
ATOM   10630 N N     . GLN D 1 88  ? 6.033   -17.231 72.347  1.00 27.29 ? 85  GLN D N     1 
ATOM   10631 C CA    . GLN D 1 88  ? 7.079   -17.864 73.151  1.00 27.86 ? 85  GLN D CA    1 
ATOM   10632 C C     . GLN D 1 88  ? 6.873   -19.356 72.937  1.00 29.16 ? 85  GLN D C     1 
ATOM