data_3NKO
# 
_entry.id   3NKO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NKO         
RCSB  RCSB059949   
WWPDB D_1000059949 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3NKM . unspecified 
PDB 3NKN . unspecified 
PDB 3NKP . unspecified 
PDB 3NKQ . unspecified 
PDB 3NKR . unspecified 
# 
_pdbx_database_status.entry_id                        3NKO 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-20 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nishimasu, H.' 1 
'Ishitani, R.'  2 
'Mihara, E.'    3 
'Takagi, J.'    4 
'Aoki, J.'      5 
'Nureki, O.'    6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of autotaxin and insight into GPCR activation by lipid mediators' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            18 
_citation.page_first                205 
_citation.page_last                 212 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21240269 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1998 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nishimasu, H.' 1  ? 
primary 'Okudaira, S.'  2  ? 
primary 'Hama, K.'      3  ? 
primary 'Mihara, E.'    4  ? 
primary 'Dohmae, N.'    5  ? 
primary 'Inoue, A.'     6  ? 
primary 'Ishitani, R.'  7  ? 
primary 'Takagi, J.'    8  ? 
primary 'Aoki, J.'      9  ? 
primary 'Nureki, O.'    10 ? 
# 
_cell.length_a           61.545 
_cell.length_b           94.403 
_cell.length_c           75.243 
_cell.angle_alpha        90.000 
_cell.angle_beta         94.980 
_cell.angle_gamma        90.000 
_cell.entry_id           3NKO 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3NKO 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Ectonucleotide pyrophosphatase/phosphodiesterase family member 2' 95757.430 1   3.1.4.39 ? ? ? 
2  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2   ? ? ? ? 
3  branched    man 
;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1072.964  1   ?        ? ? ? 
4  non-polymer syn 'ZINC ION' 65.409    2   ?        ? ? ? 
5  non-polymer syn 'CALCIUM ION' 40.078    1   ?        ? ? ? 
6  non-polymer syn 'SODIUM ION' 22.990    1   ?        ? ? ? 
7  non-polymer syn 'POTASSIUM ION' 39.098    1   ?        ? ? ? 
8  non-polymer syn '(2R)-2-hydroxy-3-(phosphonooxy)propyl hexadecanoate' 410.483   2   ?        ? ? ? 
9  non-polymer syn 'THIOCYANATE ION' 58.082    2   ?        ? ? ? 
10 non-polymer syn 1,2-ETHANEDIOL 62.068    20  ?        ? ? ? 
11 water       nat water 18.015    730 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ATX, E-NPP 2, Autotaxin, Extracellular lysophospholipase D, LysoPLD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AEWDEGPPTVLSDSPWTNTSGSCKGRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEEN
ACHCSEDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCG
THAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFW
SVSIPHERRILTILQWLSLPDNERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIF
VGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYA
NNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCDL
LGLKPAPNNGTHGSLNHLLRTNTFRPTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKNKLEELNKRLHTKGSTEERHLLYG
RPAVLYRTSYDILYHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQMSYGF
LFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQYVEGS
SIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYR
KTSRSYSEILTLKTYLHTYESEISRENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AEWDEGPPTVLSDSPWTNTSGSCKGRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEEN
ACHCSEDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCG
THAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFW
SVSIPHERRILTILQWLSLPDNERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIF
VGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYA
NNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCDL
LGLKPAPNNGTHGSLNHLLRTNTFRPTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKNKLEELNKRLHTKGSTEERHLLYG
RPAVLYRTSYDILYHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQMSYGF
LFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQYVEGS
SIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYR
KTSRSYSEILTLKTYLHTYESEISRENLYFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLU n 
1 3   TRP n 
1 4   ASP n 
1 5   GLU n 
1 6   GLY n 
1 7   PRO n 
1 8   PRO n 
1 9   THR n 
1 10  VAL n 
1 11  LEU n 
1 12  SER n 
1 13  ASP n 
1 14  SER n 
1 15  PRO n 
1 16  TRP n 
1 17  THR n 
1 18  ASN n 
1 19  THR n 
1 20  SER n 
1 21  GLY n 
1 22  SER n 
1 23  CYS n 
1 24  LYS n 
1 25  GLY n 
1 26  ARG n 
1 27  CYS n 
1 28  PHE n 
1 29  GLU n 
1 30  LEU n 
1 31  GLN n 
1 32  GLU n 
1 33  VAL n 
1 34  GLY n 
1 35  PRO n 
1 36  PRO n 
1 37  ASP n 
1 38  CYS n 
1 39  ARG n 
1 40  CYS n 
1 41  ASP n 
1 42  ASN n 
1 43  LEU n 
1 44  CYS n 
1 45  LYS n 
1 46  SER n 
1 47  TYR n 
1 48  SER n 
1 49  SER n 
1 50  CYS n 
1 51  CYS n 
1 52  HIS n 
1 53  ASP n 
1 54  PHE n 
1 55  ASP n 
1 56  GLU n 
1 57  LEU n 
1 58  CYS n 
1 59  LEU n 
1 60  LYS n 
1 61  THR n 
1 62  ALA n 
1 63  ARG n 
1 64  GLY n 
1 65  TRP n 
1 66  GLU n 
1 67  CYS n 
1 68  THR n 
1 69  LYS n 
1 70  ASP n 
1 71  ARG n 
1 72  CYS n 
1 73  GLY n 
1 74  GLU n 
1 75  VAL n 
1 76  ARG n 
1 77  ASN n 
1 78  GLU n 
1 79  GLU n 
1 80  ASN n 
1 81  ALA n 
1 82  CYS n 
1 83  HIS n 
1 84  CYS n 
1 85  SER n 
1 86  GLU n 
1 87  ASP n 
1 88  CYS n 
1 89  LEU n 
1 90  SER n 
1 91  ARG n 
1 92  GLY n 
1 93  ASP n 
1 94  CYS n 
1 95  CYS n 
1 96  THR n 
1 97  ASN n 
1 98  TYR n 
1 99  GLN n 
1 100 VAL n 
1 101 VAL n 
1 102 CYS n 
1 103 LYS n 
1 104 GLY n 
1 105 GLU n 
1 106 SER n 
1 107 HIS n 
1 108 TRP n 
1 109 VAL n 
1 110 ASP n 
1 111 ASP n 
1 112 ASP n 
1 113 CYS n 
1 114 GLU n 
1 115 GLU n 
1 116 ILE n 
1 117 ARG n 
1 118 VAL n 
1 119 PRO n 
1 120 GLU n 
1 121 CYS n 
1 122 PRO n 
1 123 ALA n 
1 124 GLY n 
1 125 PHE n 
1 126 VAL n 
1 127 ARG n 
1 128 PRO n 
1 129 PRO n 
1 130 LEU n 
1 131 ILE n 
1 132 ILE n 
1 133 PHE n 
1 134 SER n 
1 135 VAL n 
1 136 ASP n 
1 137 GLY n 
1 138 PHE n 
1 139 ARG n 
1 140 ALA n 
1 141 SER n 
1 142 TYR n 
1 143 MET n 
1 144 LYS n 
1 145 LYS n 
1 146 GLY n 
1 147 SER n 
1 148 LYS n 
1 149 VAL n 
1 150 MET n 
1 151 PRO n 
1 152 ASN n 
1 153 ILE n 
1 154 GLU n 
1 155 LYS n 
1 156 LEU n 
1 157 ARG n 
1 158 SER n 
1 159 CYS n 
1 160 GLY n 
1 161 THR n 
1 162 HIS n 
1 163 ALA n 
1 164 PRO n 
1 165 TYR n 
1 166 MET n 
1 167 ARG n 
1 168 PRO n 
1 169 VAL n 
1 170 TYR n 
1 171 PRO n 
1 172 THR n 
1 173 LYS n 
1 174 THR n 
1 175 PHE n 
1 176 PRO n 
1 177 ASN n 
1 178 LEU n 
1 179 TYR n 
1 180 THR n 
1 181 LEU n 
1 182 ALA n 
1 183 THR n 
1 184 GLY n 
1 185 LEU n 
1 186 TYR n 
1 187 PRO n 
1 188 GLU n 
1 189 SER n 
1 190 HIS n 
1 191 GLY n 
1 192 ILE n 
1 193 VAL n 
1 194 GLY n 
1 195 ASN n 
1 196 SER n 
1 197 MET n 
1 198 TYR n 
1 199 ASP n 
1 200 PRO n 
1 201 VAL n 
1 202 PHE n 
1 203 ASP n 
1 204 ALA n 
1 205 THR n 
1 206 PHE n 
1 207 HIS n 
1 208 LEU n 
1 209 ARG n 
1 210 GLY n 
1 211 ARG n 
1 212 GLU n 
1 213 LYS n 
1 214 PHE n 
1 215 ASN n 
1 216 HIS n 
1 217 ARG n 
1 218 TRP n 
1 219 TRP n 
1 220 GLY n 
1 221 GLY n 
1 222 GLN n 
1 223 PRO n 
1 224 LEU n 
1 225 TRP n 
1 226 ILE n 
1 227 THR n 
1 228 ALA n 
1 229 THR n 
1 230 LYS n 
1 231 GLN n 
1 232 GLY n 
1 233 VAL n 
1 234 ARG n 
1 235 ALA n 
1 236 GLY n 
1 237 THR n 
1 238 PHE n 
1 239 PHE n 
1 240 TRP n 
1 241 SER n 
1 242 VAL n 
1 243 SER n 
1 244 ILE n 
1 245 PRO n 
1 246 HIS n 
1 247 GLU n 
1 248 ARG n 
1 249 ARG n 
1 250 ILE n 
1 251 LEU n 
1 252 THR n 
1 253 ILE n 
1 254 LEU n 
1 255 GLN n 
1 256 TRP n 
1 257 LEU n 
1 258 SER n 
1 259 LEU n 
1 260 PRO n 
1 261 ASP n 
1 262 ASN n 
1 263 GLU n 
1 264 ARG n 
1 265 PRO n 
1 266 SER n 
1 267 VAL n 
1 268 TYR n 
1 269 ALA n 
1 270 PHE n 
1 271 TYR n 
1 272 SER n 
1 273 GLU n 
1 274 GLN n 
1 275 PRO n 
1 276 ASP n 
1 277 PHE n 
1 278 SER n 
1 279 GLY n 
1 280 HIS n 
1 281 LYS n 
1 282 TYR n 
1 283 GLY n 
1 284 PRO n 
1 285 PHE n 
1 286 GLY n 
1 287 PRO n 
1 288 GLU n 
1 289 MET n 
1 290 THR n 
1 291 ASN n 
1 292 PRO n 
1 293 LEU n 
1 294 ARG n 
1 295 GLU n 
1 296 ILE n 
1 297 ASP n 
1 298 LYS n 
1 299 THR n 
1 300 VAL n 
1 301 GLY n 
1 302 GLN n 
1 303 LEU n 
1 304 MET n 
1 305 ASP n 
1 306 GLY n 
1 307 LEU n 
1 308 LYS n 
1 309 GLN n 
1 310 LEU n 
1 311 LYS n 
1 312 LEU n 
1 313 HIS n 
1 314 ARG n 
1 315 CYS n 
1 316 VAL n 
1 317 ASN n 
1 318 VAL n 
1 319 ILE n 
1 320 PHE n 
1 321 VAL n 
1 322 GLY n 
1 323 ASP n 
1 324 HIS n 
1 325 GLY n 
1 326 MET n 
1 327 GLU n 
1 328 ASP n 
1 329 VAL n 
1 330 THR n 
1 331 CYS n 
1 332 ASP n 
1 333 ARG n 
1 334 THR n 
1 335 GLU n 
1 336 PHE n 
1 337 LEU n 
1 338 SER n 
1 339 ASN n 
1 340 TYR n 
1 341 LEU n 
1 342 THR n 
1 343 ASN n 
1 344 VAL n 
1 345 ASP n 
1 346 ASP n 
1 347 ILE n 
1 348 THR n 
1 349 LEU n 
1 350 VAL n 
1 351 PRO n 
1 352 GLY n 
1 353 THR n 
1 354 LEU n 
1 355 GLY n 
1 356 ARG n 
1 357 ILE n 
1 358 ARG n 
1 359 PRO n 
1 360 LYS n 
1 361 ILE n 
1 362 PRO n 
1 363 ASN n 
1 364 ASN n 
1 365 LEU n 
1 366 LYS n 
1 367 TYR n 
1 368 ASP n 
1 369 PRO n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 ILE n 
1 374 ALA n 
1 375 ASN n 
1 376 LEU n 
1 377 THR n 
1 378 CYS n 
1 379 LYS n 
1 380 LYS n 
1 381 PRO n 
1 382 ASP n 
1 383 GLN n 
1 384 HIS n 
1 385 PHE n 
1 386 LYS n 
1 387 PRO n 
1 388 TYR n 
1 389 MET n 
1 390 LYS n 
1 391 GLN n 
1 392 HIS n 
1 393 LEU n 
1 394 PRO n 
1 395 LYS n 
1 396 ARG n 
1 397 LEU n 
1 398 HIS n 
1 399 TYR n 
1 400 ALA n 
1 401 ASN n 
1 402 ASN n 
1 403 ARG n 
1 404 ARG n 
1 405 ILE n 
1 406 GLU n 
1 407 ASP n 
1 408 LEU n 
1 409 HIS n 
1 410 LEU n 
1 411 LEU n 
1 412 VAL n 
1 413 GLU n 
1 414 ARG n 
1 415 ARG n 
1 416 TRP n 
1 417 HIS n 
1 418 VAL n 
1 419 ALA n 
1 420 ARG n 
1 421 LYS n 
1 422 PRO n 
1 423 LEU n 
1 424 ASP n 
1 425 VAL n 
1 426 TYR n 
1 427 LYS n 
1 428 LYS n 
1 429 PRO n 
1 430 SER n 
1 431 GLY n 
1 432 LYS n 
1 433 CYS n 
1 434 PHE n 
1 435 PHE n 
1 436 GLN n 
1 437 GLY n 
1 438 ASP n 
1 439 HIS n 
1 440 GLY n 
1 441 PHE n 
1 442 ASP n 
1 443 ASN n 
1 444 LYS n 
1 445 VAL n 
1 446 ASN n 
1 447 SER n 
1 448 MET n 
1 449 GLN n 
1 450 THR n 
1 451 VAL n 
1 452 PHE n 
1 453 VAL n 
1 454 GLY n 
1 455 TYR n 
1 456 GLY n 
1 457 PRO n 
1 458 THR n 
1 459 PHE n 
1 460 LYS n 
1 461 TYR n 
1 462 ARG n 
1 463 THR n 
1 464 LYS n 
1 465 VAL n 
1 466 PRO n 
1 467 PRO n 
1 468 PHE n 
1 469 GLU n 
1 470 ASN n 
1 471 ILE n 
1 472 GLU n 
1 473 LEU n 
1 474 TYR n 
1 475 ASN n 
1 476 VAL n 
1 477 MET n 
1 478 CYS n 
1 479 ASP n 
1 480 LEU n 
1 481 LEU n 
1 482 GLY n 
1 483 LEU n 
1 484 LYS n 
1 485 PRO n 
1 486 ALA n 
1 487 PRO n 
1 488 ASN n 
1 489 ASN n 
1 490 GLY n 
1 491 THR n 
1 492 HIS n 
1 493 GLY n 
1 494 SER n 
1 495 LEU n 
1 496 ASN n 
1 497 HIS n 
1 498 LEU n 
1 499 LEU n 
1 500 ARG n 
1 501 THR n 
1 502 ASN n 
1 503 THR n 
1 504 PHE n 
1 505 ARG n 
1 506 PRO n 
1 507 THR n 
1 508 LEU n 
1 509 PRO n 
1 510 GLU n 
1 511 GLU n 
1 512 VAL n 
1 513 SER n 
1 514 ARG n 
1 515 PRO n 
1 516 ASN n 
1 517 TYR n 
1 518 PRO n 
1 519 GLY n 
1 520 ILE n 
1 521 MET n 
1 522 TYR n 
1 523 LEU n 
1 524 GLN n 
1 525 SER n 
1 526 ASP n 
1 527 PHE n 
1 528 ASP n 
1 529 LEU n 
1 530 GLY n 
1 531 CYS n 
1 532 THR n 
1 533 CYS n 
1 534 ASP n 
1 535 ASP n 
1 536 LYS n 
1 537 ASN n 
1 538 LYS n 
1 539 LEU n 
1 540 GLU n 
1 541 GLU n 
1 542 LEU n 
1 543 ASN n 
1 544 LYS n 
1 545 ARG n 
1 546 LEU n 
1 547 HIS n 
1 548 THR n 
1 549 LYS n 
1 550 GLY n 
1 551 SER n 
1 552 THR n 
1 553 GLU n 
1 554 GLU n 
1 555 ARG n 
1 556 HIS n 
1 557 LEU n 
1 558 LEU n 
1 559 TYR n 
1 560 GLY n 
1 561 ARG n 
1 562 PRO n 
1 563 ALA n 
1 564 VAL n 
1 565 LEU n 
1 566 TYR n 
1 567 ARG n 
1 568 THR n 
1 569 SER n 
1 570 TYR n 
1 571 ASP n 
1 572 ILE n 
1 573 LEU n 
1 574 TYR n 
1 575 HIS n 
1 576 THR n 
1 577 ASP n 
1 578 PHE n 
1 579 GLU n 
1 580 SER n 
1 581 GLY n 
1 582 TYR n 
1 583 SER n 
1 584 GLU n 
1 585 ILE n 
1 586 PHE n 
1 587 LEU n 
1 588 MET n 
1 589 PRO n 
1 590 LEU n 
1 591 TRP n 
1 592 THR n 
1 593 SER n 
1 594 TYR n 
1 595 THR n 
1 596 ILE n 
1 597 SER n 
1 598 LYS n 
1 599 GLN n 
1 600 ALA n 
1 601 GLU n 
1 602 VAL n 
1 603 SER n 
1 604 SER n 
1 605 ILE n 
1 606 PRO n 
1 607 GLU n 
1 608 HIS n 
1 609 LEU n 
1 610 THR n 
1 611 ASN n 
1 612 CYS n 
1 613 VAL n 
1 614 ARG n 
1 615 PRO n 
1 616 ASP n 
1 617 VAL n 
1 618 ARG n 
1 619 VAL n 
1 620 SER n 
1 621 PRO n 
1 622 GLY n 
1 623 PHE n 
1 624 SER n 
1 625 GLN n 
1 626 ASN n 
1 627 CYS n 
1 628 LEU n 
1 629 ALA n 
1 630 TYR n 
1 631 LYS n 
1 632 ASN n 
1 633 ASP n 
1 634 LYS n 
1 635 GLN n 
1 636 MET n 
1 637 SER n 
1 638 TYR n 
1 639 GLY n 
1 640 PHE n 
1 641 LEU n 
1 642 PHE n 
1 643 PRO n 
1 644 PRO n 
1 645 TYR n 
1 646 LEU n 
1 647 SER n 
1 648 SER n 
1 649 SER n 
1 650 PRO n 
1 651 GLU n 
1 652 ALA n 
1 653 LYS n 
1 654 TYR n 
1 655 ASP n 
1 656 ALA n 
1 657 PHE n 
1 658 LEU n 
1 659 VAL n 
1 660 THR n 
1 661 ASN n 
1 662 MET n 
1 663 VAL n 
1 664 PRO n 
1 665 MET n 
1 666 TYR n 
1 667 PRO n 
1 668 ALA n 
1 669 PHE n 
1 670 LYS n 
1 671 ARG n 
1 672 VAL n 
1 673 TRP n 
1 674 THR n 
1 675 TYR n 
1 676 PHE n 
1 677 GLN n 
1 678 ARG n 
1 679 VAL n 
1 680 LEU n 
1 681 VAL n 
1 682 LYS n 
1 683 LYS n 
1 684 TYR n 
1 685 ALA n 
1 686 SER n 
1 687 GLU n 
1 688 ARG n 
1 689 ASN n 
1 690 GLY n 
1 691 VAL n 
1 692 ASN n 
1 693 VAL n 
1 694 ILE n 
1 695 SER n 
1 696 GLY n 
1 697 PRO n 
1 698 ILE n 
1 699 PHE n 
1 700 ASP n 
1 701 TYR n 
1 702 ASN n 
1 703 TYR n 
1 704 ASN n 
1 705 GLY n 
1 706 LEU n 
1 707 ARG n 
1 708 ASP n 
1 709 ILE n 
1 710 GLU n 
1 711 ASP n 
1 712 GLU n 
1 713 ILE n 
1 714 LYS n 
1 715 GLN n 
1 716 TYR n 
1 717 VAL n 
1 718 GLU n 
1 719 GLY n 
1 720 SER n 
1 721 SER n 
1 722 ILE n 
1 723 PRO n 
1 724 VAL n 
1 725 PRO n 
1 726 THR n 
1 727 HIS n 
1 728 TYR n 
1 729 TYR n 
1 730 SER n 
1 731 ILE n 
1 732 ILE n 
1 733 THR n 
1 734 SER n 
1 735 CYS n 
1 736 LEU n 
1 737 ASP n 
1 738 PHE n 
1 739 THR n 
1 740 GLN n 
1 741 PRO n 
1 742 ALA n 
1 743 ASP n 
1 744 LYS n 
1 745 CYS n 
1 746 ASP n 
1 747 GLY n 
1 748 PRO n 
1 749 LEU n 
1 750 SER n 
1 751 VAL n 
1 752 SER n 
1 753 SER n 
1 754 PHE n 
1 755 ILE n 
1 756 LEU n 
1 757 PRO n 
1 758 HIS n 
1 759 ARG n 
1 760 PRO n 
1 761 ASP n 
1 762 ASN n 
1 763 ASP n 
1 764 GLU n 
1 765 SER n 
1 766 CYS n 
1 767 ASN n 
1 768 SER n 
1 769 SER n 
1 770 GLU n 
1 771 ASP n 
1 772 GLU n 
1 773 SER n 
1 774 LYS n 
1 775 TRP n 
1 776 VAL n 
1 777 GLU n 
1 778 GLU n 
1 779 LEU n 
1 780 MET n 
1 781 LYS n 
1 782 MET n 
1 783 HIS n 
1 784 THR n 
1 785 ALA n 
1 786 ARG n 
1 787 VAL n 
1 788 ARG n 
1 789 ASP n 
1 790 ILE n 
1 791 GLU n 
1 792 HIS n 
1 793 LEU n 
1 794 THR n 
1 795 GLY n 
1 796 LEU n 
1 797 ASP n 
1 798 PHE n 
1 799 TYR n 
1 800 ARG n 
1 801 LYS n 
1 802 THR n 
1 803 SER n 
1 804 ARG n 
1 805 SER n 
1 806 TYR n 
1 807 SER n 
1 808 GLU n 
1 809 ILE n 
1 810 LEU n 
1 811 THR n 
1 812 LEU n 
1 813 LYS n 
1 814 THR n 
1 815 TYR n 
1 816 LEU n 
1 817 HIS n 
1 818 THR n 
1 819 TYR n 
1 820 GLU n 
1 821 SER n 
1 822 GLU n 
1 823 ILE n 
1 824 SER n 
1 825 ARG n 
1 826 GLU n 
1 827 ASN n 
1 828 LEU n 
1 829 TYR n 
1 830 PHE n 
1 831 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Enpp2, Npps2, Pdnp2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK293S GnT1-' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCD-CW 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ENPP2_MOUSE 
_struct_ref.pdbx_db_accession          Q9R1E6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AEWDEGPPTVLSDSPWTNTSGSCKGRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEEN
ACHCSEDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCG
THAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFW
SVSIPHERRILTILQWLSLPDNERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIF
VGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIPNNLKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYA
NNRRIEDLHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCDL
LGLKPAPNNGTHGSLNHLLRTNTFRPTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLEELNKRLHTKGSTEERH
LLYGRPAVLYRTSYDILYHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQM
SYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQY
VEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGL
DFYRKTSRSYSEILTLKTYLHTYESEI
;
_struct_ref.pdbx_align_begin           36 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3NKO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 823 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9R1E6 
_struct_ref_seq.db_align_beg                  36 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  862 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       36 
_struct_ref_seq.pdbx_auth_seq_align_end       858 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NKO ?   A ?   ? UNP Q9R1E6 LYS 571 'SEE REMARK 999' ?   1  
1 3NKO ?   A ?   ? UNP Q9R1E6 VAL 572 'SEE REMARK 999' ?   2  
1 3NKO ?   A ?   ? UNP Q9R1E6 GLU 573 'SEE REMARK 999' ?   3  
1 3NKO ?   A ?   ? UNP Q9R1E6 PRO 574 'SEE REMARK 999' ?   4  
1 3NKO SER A 824 ? UNP Q9R1E6 ?   ?   'expression tag' 859 5  
1 3NKO ARG A 825 ? UNP Q9R1E6 ?   ?   'expression tag' 860 6  
1 3NKO GLU A 826 ? UNP Q9R1E6 ?   ?   'expression tag' 861 7  
1 3NKO ASN A 827 ? UNP Q9R1E6 ?   ?   'expression tag' 862 8  
1 3NKO LEU A 828 ? UNP Q9R1E6 ?   ?   'expression tag' 863 9  
1 3NKO TYR A 829 ? UNP Q9R1E6 ?   ?   'expression tag' 864 10 
1 3NKO PHE A 830 ? UNP Q9R1E6 ?   ?   'expression tag' 865 11 
1 3NKO GLN A 831 ? UNP Q9R1E6 ?   ?   'expression tag' 866 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                       ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                                  ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                                         ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE                                              ? 'C3 H7 N O2 S'   121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                                        'ETHYLENE GLYCOL' 'C2 H6 O2'       
62.068  
GLN 'L-peptide linking'           y GLUTAMINE                                             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                 ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                            ? 'C6 H13 N O2'    131.173 
K   non-polymer                   . 'POTASSIUM ION'                                       ? 'K 1'            39.098  
LEU 'L-peptide linking'           y LEUCINE                                               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                                ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                 ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                            ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer                   . 'SODIUM ION'                                          ? 'Na 1'           22.990  
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose              ? 'C8 H15 N O6'    221.208 
NKO non-polymer                   . '(2R)-2-hydroxy-3-(phosphonooxy)propyl hexadecanoate' 
'16:0 LPA, palmitoyl lysophosphatidic acid' 'C19 H39 O7 P'   410.483 
PHE 'L-peptide linking'           y PHENYLALANINE                                         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                               ? 'C5 H9 N O2'     115.130 
SCN non-polymer                   . 'THIOCYANATE ION'                                     ? 'C N S -1'       58.082  
SER 'L-peptide linking'           y SERINE                                                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                                ? 'C5 H11 N O2'    117.146 
ZN  non-polymer                   . 'ZINC ION'                                            ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3NKO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   45.91 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'20-25% PEG 3350, 0.15mM NaCl, 0.5M KSCN, 0.2mM ZnSO4, 1% polyvinylpyrrolidone, vapor diffusion, sitting drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2010-03-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NE3A' 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NE3A 
# 
_reflns.entry_id                     3NKO 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.75 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   85732 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        24.950 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3NKO 
_refine.ls_d_res_high                            1.7500 
_refine.ls_d_res_low                             26.4460 
_refine.pdbx_ls_sigma_F                          0.030 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.4100 
_refine.ls_number_reflns_obs                     85704 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_obs                          0.1862 
_refine.ls_R_factor_R_work                       0.1843 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2238 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  4288 
_refine.ls_number_reflns_R_work                  81416 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               33.5298 
_refine.solvent_model_param_bsol                 60.2370 
_refine.solvent_model_param_ksol                 0.4000 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -2.0760 
_refine.aniso_B[2][2]                            3.5988 
_refine.aniso_B[3][3]                            -1.5228 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.7025 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2300 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3NKM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8625 
_refine.B_iso_max                                73.930 
_refine.B_iso_min                                11.620 
_refine.pdbx_overall_phase_error                 21.6700 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6231 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         254 
_refine_hist.number_atoms_solvent             730 
_refine_hist.number_atoms_total               7215 
_refine_hist.d_res_high                       1.7500 
_refine_hist.d_res_low                        26.4460 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           6704 0.009  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          9063 1.317  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     982  0.085  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1151 0.006  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 2481 19.824 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.7501 1.7700  30 95.0000  2548 . 0.2459 0.2517 . 138 . 2686 . 'X-RAY DIFFRACTION' . 
1.7700 1.7908  30 99.0000  2672 . 0.2364 0.2619 . 161 . 2833 . 'X-RAY DIFFRACTION' . 
1.7908 1.8127  30 99.0000  2690 . 0.2228 0.2786 . 153 . 2843 . 'X-RAY DIFFRACTION' . 
1.8127 1.8356  30 99.0000  2672 . 0.2205 0.2693 . 130 . 2802 . 'X-RAY DIFFRACTION' . 
1.8356 1.8598  30 99.0000  2681 . 0.2260 0.2729 . 159 . 2840 . 'X-RAY DIFFRACTION' . 
1.8598 1.8852  30 99.0000  2703 . 0.2090 0.2773 . 151 . 2854 . 'X-RAY DIFFRACTION' . 
1.8852 1.9122  30 99.0000  2708 . 0.2124 0.2271 . 140 . 2848 . 'X-RAY DIFFRACTION' . 
1.9122 1.9407  30 99.0000  2689 . 0.2047 0.2829 . 134 . 2823 . 'X-RAY DIFFRACTION' . 
1.9407 1.9710  30 100.0000 2745 . 0.2029 0.2404 . 134 . 2879 . 'X-RAY DIFFRACTION' . 
1.9710 2.0033  30 100.0000 2704 . 0.1909 0.2134 . 125 . 2829 . 'X-RAY DIFFRACTION' . 
2.0033 2.0379  30 99.0000  2728 . 0.1868 0.2327 . 140 . 2868 . 'X-RAY DIFFRACTION' . 
2.0379 2.0749  30 100.0000 2715 . 0.1946 0.2504 . 122 . 2837 . 'X-RAY DIFFRACTION' . 
2.0749 2.1148  30 100.0000 2732 . 0.1950 0.2415 . 142 . 2874 . 'X-RAY DIFFRACTION' . 
2.1148 2.1579  30 100.0000 2729 . 0.1918 0.2453 . 137 . 2866 . 'X-RAY DIFFRACTION' . 
2.1579 2.2048  30 100.0000 2729 . 0.1979 0.2741 . 143 . 2872 . 'X-RAY DIFFRACTION' . 
2.2048 2.2561  30 100.0000 2691 . 0.2021 0.2264 . 150 . 2841 . 'X-RAY DIFFRACTION' . 
2.2561 2.3125  30 100.0000 2719 . 0.1907 0.2483 . 149 . 2868 . 'X-RAY DIFFRACTION' . 
2.3125 2.3750  30 100.0000 2708 . 0.1943 0.2339 . 157 . 2865 . 'X-RAY DIFFRACTION' . 
2.3750 2.4448  30 100.0000 2704 . 0.1966 0.2395 . 153 . 2857 . 'X-RAY DIFFRACTION' . 
2.4448 2.5237  30 100.0000 2728 . 0.2000 0.2736 . 147 . 2875 . 'X-RAY DIFFRACTION' . 
2.5237 2.6138  30 100.0000 2737 . 0.1922 0.2537 . 150 . 2887 . 'X-RAY DIFFRACTION' . 
2.6138 2.7183  30 100.0000 2729 . 0.1893 0.2435 . 133 . 2862 . 'X-RAY DIFFRACTION' . 
2.7183 2.8419  30 100.0000 2706 . 0.1865 0.2149 . 139 . 2845 . 'X-RAY DIFFRACTION' . 
2.8419 2.9916  30 100.0000 2741 . 0.1787 0.2325 . 149 . 2890 . 'X-RAY DIFFRACTION' . 
2.9916 3.1787  30 100.0000 2747 . 0.1791 0.2278 . 139 . 2886 . 'X-RAY DIFFRACTION' . 
3.1787 3.4236  30 100.0000 2748 . 0.1780 0.2113 . 155 . 2903 . 'X-RAY DIFFRACTION' . 
3.4236 3.7673  30 100.0000 2747 . 0.1612 0.2024 . 152 . 2899 . 'X-RAY DIFFRACTION' . 
3.7673 4.3104  30 100.0000 2751 . 0.1465 0.1516 . 128 . 2879 . 'X-RAY DIFFRACTION' . 
4.3104 5.4230  30 100.0000 2745 . 0.1448 0.1766 . 139 . 2884 . 'X-RAY DIFFRACTION' . 
5.4230 26.4490 30 98.0000  2770 . 0.1900 0.2164 . 139 . 2909 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3NKO 
_struct.title                     'Crystal structure of mouse autotaxin in complex with 16:0-LPA' 
_struct.pdbx_descriptor           'Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 (E.C.3.1.4.39)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NKO 
_struct_keywords.text            'lysophospholipase D, autotaxin, Enpp2, lysophosphatidic acid, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 2  ? 
E  N N 4  ? 
F  N N 4  ? 
G  N N 5  ? 
H  N N 6  ? 
I  N N 7  ? 
J  N N 8  ? 
K  N N 8  ? 
L  N N 9  ? 
M  N N 9  ? 
N  N N 10 ? 
O  N N 10 ? 
P  N N 10 ? 
Q  N N 10 ? 
R  N N 10 ? 
S  N N 10 ? 
T  N N 10 ? 
U  N N 10 ? 
V  N N 10 ? 
W  N N 10 ? 
X  N N 10 ? 
Y  N N 10 ? 
Z  N N 10 ? 
AA N N 10 ? 
BA N N 10 ? 
CA N N 10 ? 
DA N N 10 ? 
EA N N 10 ? 
FA N N 10 ? 
GA N N 10 ? 
HA N N 11 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 42  ? TYR A 47  ? ASN A 77  TYR A 82  1 ? 6  
HELX_P HELX_P2  2  ASP A 53  ? LEU A 59  ? ASP A 88  LEU A 94  1 ? 7  
HELX_P HELX_P3  3  THR A 68  ? CYS A 72  ? THR A 103 CYS A 107 5 ? 5  
HELX_P HELX_P4  4  ASP A 87  ? GLY A 92  ? ASP A 122 GLY A 127 1 ? 6  
HELX_P HELX_P5  5  ASN A 97  ? GLY A 104 ? ASN A 132 GLY A 139 1 ? 8  
HELX_P HELX_P6  6  HIS A 107 ? ASP A 111 ? HIS A 142 ASP A 146 5 ? 5  
HELX_P HELX_P7  7  ARG A 139 ? LYS A 144 ? ARG A 174 LYS A 179 5 ? 6  
HELX_P HELX_P8  8  LYS A 145 ? MET A 150 ? LYS A 180 MET A 185 1 ? 6  
HELX_P HELX_P9  9  MET A 150 ? GLY A 160 ? MET A 185 GLY A 195 1 ? 11 
HELX_P HELX_P10 10 LYS A 173 ? GLY A 184 ? LYS A 208 GLY A 219 1 ? 12 
HELX_P HELX_P11 11 TYR A 186 ? GLY A 191 ? TYR A 221 GLY A 226 1 ? 6  
HELX_P HELX_P12 12 ARG A 211 ? TRP A 219 ? ARG A 246 TRP A 254 5 ? 9  
HELX_P HELX_P13 13 PRO A 223 ? GLN A 231 ? PRO A 258 GLN A 266 1 ? 9  
HELX_P HELX_P14 14 PRO A 245 ? SER A 258 ? PRO A 280 SER A 293 1 ? 14 
HELX_P HELX_P15 15 ASP A 276 ? GLY A 283 ? ASP A 311 GLY A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 286 ? GLU A 288 ? GLY A 321 GLU A 323 5 ? 3  
HELX_P HELX_P17 17 MET A 289 ? LEU A 310 ? MET A 324 LEU A 345 1 ? 22 
HELX_P HELX_P18 18 SER A 338 ? TYR A 340 ? SER A 373 TYR A 375 5 ? 3  
HELX_P HELX_P19 19 ASN A 343 ? ASP A 345 ? ASN A 378 ASP A 380 5 ? 3  
HELX_P HELX_P20 20 ASP A 368 ? THR A 377 ? ASP A 403 THR A 412 1 ? 10 
HELX_P HELX_P21 21 GLN A 391 ? LEU A 393 ? GLN A 426 LEU A 428 5 ? 3  
HELX_P HELX_P22 22 PRO A 394 ? HIS A 398 ? PRO A 429 HIS A 433 5 ? 5  
HELX_P HELX_P23 23 VAL A 445 ? GLN A 449 ? VAL A 480 GLN A 484 5 ? 5  
HELX_P HELX_P24 24 GLU A 472 ? LEU A 481 ? GLU A 507 LEU A 516 1 ? 10 
HELX_P HELX_P25 25 LEU A 495 ? LEU A 499 ? LEU A 530 LEU A 534 5 ? 5  
HELX_P HELX_P26 26 LEU A 523 ? PHE A 527 ? LEU A 558 PHE A 562 5 ? 5  
HELX_P HELX_P27 27 THR A 552 ? LEU A 557 ? THR A 587 LEU A 592 1 ? 6  
HELX_P HELX_P28 28 PRO A 606 ? THR A 610 ? PRO A 641 THR A 645 5 ? 5  
HELX_P HELX_P29 29 SER A 620 ? SER A 624 ? SER A 655 SER A 659 5 ? 5  
HELX_P HELX_P30 30 ASN A 626 ? ASP A 633 ? ASN A 661 ASP A 668 1 ? 8  
HELX_P HELX_P31 31 PRO A 643 ? SER A 647 ? PRO A 678 SER A 682 5 ? 5  
HELX_P HELX_P32 32 SER A 649 ? TYR A 654 ? SER A 684 TYR A 689 1 ? 6  
HELX_P HELX_P33 33 ASP A 655 ? LEU A 658 ? ASP A 690 LEU A 693 5 ? 4  
HELX_P HELX_P34 34 TYR A 666 ? VAL A 679 ? TYR A 701 VAL A 714 1 ? 14 
HELX_P HELX_P35 35 VAL A 679 ? ASN A 689 ? VAL A 714 ASN A 724 1 ? 11 
HELX_P HELX_P36 36 ILE A 709 ? ILE A 713 ? ILE A 744 ILE A 748 5 ? 5  
HELX_P HELX_P37 37 PRO A 741 ? CYS A 745 ? PRO A 776 CYS A 780 5 ? 5  
HELX_P HELX_P38 38 ASP A 771 ? LYS A 774 ? ASP A 806 LYS A 809 5 ? 4  
HELX_P HELX_P39 39 TRP A 775 ? HIS A 783 ? TRP A 810 HIS A 818 1 ? 9  
HELX_P HELX_P40 40 ARG A 786 ? GLY A 795 ? ARG A 821 GLY A 830 1 ? 10 
HELX_P HELX_P41 41 SER A 805 ? TYR A 815 ? SER A 840 TYR A 850 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 23  SG  ? ? ? 1_555 A  CYS 40  SG  ? ? A CYS 58   A CYS 75   1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf2  disulf ?    ? A  CYS 27  SG  ? ? ? 1_555 A  CYS 58  SG  ? ? A CYS 62   A CYS 93   1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf3  disulf ?    ? A  CYS 38  SG  ? ? ? 1_555 A  CYS 51  SG  ? ? A CYS 73   A CYS 86   1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf4  disulf ?    ? A  CYS 44  SG  ? ? ? 1_555 A  CYS 50  SG  ? ? A CYS 79   A CYS 85   1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf5  disulf ?    ? A  CYS 67  SG  ? ? ? 1_555 A  CYS 84  SG  ? ? A CYS 102  A CYS 119  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf6  disulf ?    ? A  CYS 72  SG  ? ? ? 1_555 A  CYS 102 SG  ? ? A CYS 107  A CYS 137  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf7  disulf ?    ? A  CYS 82  SG  ? ? ? 1_555 A  CYS 95  SG  ? ? A CYS 117  A CYS 130  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf8  disulf ?    ? A  CYS 88  SG  ? ? ? 1_555 A  CYS 94  SG  ? ? A CYS 123  A CYS 129  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf9  disulf ?    ? A  CYS 113 SG  A ? ? 1_555 A  CYS 159 SG  A ? A CYS 148  A CYS 194  1_555 ? ? ? ? ? ? ? 2.016 ? ? 
disulf10 disulf ?    ? A  CYS 113 SG  B ? ? 1_555 A  CYS 159 SG  B ? A CYS 148  A CYS 194  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf11 disulf ?    ? A  CYS 121 SG  ? ? ? 1_555 A  CYS 315 SG  ? ? A CYS 156  A CYS 350  1_555 ? ? ? ? ? ? ? 2.019 ? ? 
disulf12 disulf ?    ? A  CYS 331 SG  ? ? ? 1_555 A  CYS 433 SG  ? ? A CYS 366  A CYS 468  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf13 disulf ?    ? A  CYS 378 SG  ? ? ? 1_555 A  CYS 766 SG  ? ? A CYS 413  A CYS 801  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf14 disulf ?    ? A  CYS 531 SG  ? ? ? 1_555 A  CYS 627 SG  ? ? A CYS 566  A CYS 662  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf15 disulf ?    ? A  CYS 533 SG  ? ? ? 1_555 A  CYS 612 SG  ? ? A CYS 568  A CYS 647  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf16 disulf ?    ? A  CYS 735 SG  ? ? ? 1_555 A  CYS 745 SG  ? ? A CYS 770  A CYS 780  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale1  covale one  ? A  ASN 18  ND2 ? ? ? 1_555 B  NAG .   C1  ? ? A ASN 53   B NAG 1    1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale2  covale one  ? A  ASN 375 ND2 ? ? ? 1_555 D  NAG .   C1  ? ? A ASN 410  D NAG 1    1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale3  covale one  ? A  ASN 489 ND2 ? ? ? 1_555 C  NAG .   C1  ? ? A ASN 524  C NAG 1    1_555 ? ? ? ? ? ? ? 1.447 ? 
N-Glycosylation 
covale4  covale both ? B  NAG .   O4  ? ? ? 1_555 B  NAG .   C1  ? ? B NAG 1    B NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale5  covale both ? C  NAG .   O4  ? ? ? 1_555 C  NAG .   C1  ? ? C NAG 1    C NAG 2    1_555 ? ? ? ? ? ? ? 1.421 ? ? 
covale6  covale both ? C  NAG .   O4  ? ? ? 1_555 C  BMA .   C1  ? ? C NAG 2    C BMA 3    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale7  covale both ? C  BMA .   O6  ? ? ? 1_555 C  MAN .   C1  ? ? C BMA 3    C MAN 4    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale8  covale both ? C  MAN .   O3  ? ? ? 1_555 C  MAN .   C1  ? ? C MAN 4    C MAN 5    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale9  covale both ? C  MAN .   O2  ? ? ? 1_555 C  MAN .   C1  ? ? C MAN 5    C MAN 6    1_555 ? ? ? ? ? ? ? 1.442 ? ? 
covale10 covale both ? D  NAG .   O4  ? ? ? 1_555 D  NAG .   C1  ? ? D NAG 1    D NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
metalc1  metalc ?    ? A  ASP 136 OD1 ? ? ? 1_555 E  ZN  .   ZN  ? ? A ASP 171  A ZN  1001 1_555 ? ? ? ? ? ? ? 1.912 ? ? 
metalc2  metalc ?    ? A  THR 174 OG1 ? ? ? 1_555 E  ZN  .   ZN  ? ? A THR 209  A ZN  1001 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
metalc3  metalc ?    ? A  ASP 276 OD1 ? ? ? 1_555 F  ZN  .   ZN  ? ? A ASP 311  A ZN  1002 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc4  metalc ?    ? A  ASP 276 OD2 ? ? ? 1_555 F  ZN  .   ZN  ? ? A ASP 311  A ZN  1002 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc5  metalc ?    ? A  HIS 280 NE2 ? ? ? 1_555 F  ZN  .   ZN  ? ? A HIS 315  A ZN  1002 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
metalc6  metalc ?    ? A  ASP 323 OD2 ? ? ? 1_555 E  ZN  .   ZN  ? ? A ASP 358  A ZN  1001 1_555 ? ? ? ? ? ? ? 2.094 ? ? 
metalc7  metalc ?    ? A  HIS 324 NE2 ? ? ? 1_555 E  ZN  .   ZN  ? ? A HIS 359  A ZN  1001 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc8  metalc ?    ? A  HIS 439 NE2 ? ? ? 1_555 F  ZN  .   ZN  ? ? A HIS 474  A ZN  1002 1_555 ? ? ? ? ? ? ? 2.047 ? ? 
metalc9  metalc ?    ? A  TYR 630 O   ? ? ? 1_555 I  K   .   K   ? ? A TYR 665  A K   1005 1_555 ? ? ? ? ? ? ? 3.132 ? ? 
metalc10 metalc ?    ? A  ASP 633 O   ? ? ? 1_555 I  K   .   K   ? ? A ASP 668  A K   1005 1_555 ? ? ? ? ? ? ? 3.009 ? ? 
metalc11 metalc ?    ? A  MET 636 O   ? ? ? 1_555 I  K   .   K   ? ? A MET 671  A K   1005 1_555 ? ? ? ? ? ? ? 3.003 ? ? 
metalc12 metalc ?    ? A  ASP 700 OD1 ? ? ? 1_555 G  CA  .   CA  ? ? A ASP 735  A CA  1003 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc13 metalc ?    ? A  ASN 702 OD1 ? ? ? 1_555 G  CA  .   CA  ? ? A ASN 737  A CA  1003 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc14 metalc ?    ? A  ASN 704 OD1 ? ? ? 1_555 G  CA  .   CA  ? ? A ASN 739  A CA  1003 1_555 ? ? ? ? ? ? ? 2.657 ? ? 
metalc15 metalc ?    ? A  LEU 706 O   ? ? ? 1_555 G  CA  .   CA  ? ? A LEU 741  A CA  1003 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc16 metalc ?    ? A  ASP 708 OD1 ? ? ? 1_555 G  CA  .   CA  ? ? A ASP 743  A CA  1003 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc17 metalc ?    ? A  ASN 762 O   ? ? ? 1_555 H  NA  .   NA  ? ? A ASN 797  A NA  1004 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc18 metalc ?    ? A  SER 765 O   ? ? ? 1_555 H  NA  .   NA  ? ? A SER 800  A NA  1004 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc19 metalc ?    ? A  SER 768 OG  ? ? ? 1_555 H  NA  .   NA  ? ? A SER 803  A NA  1004 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc20 metalc ?    ? HA HOH .   O   ? ? ? 1_555 H  NA  .   NA  ? ? A HOH 922  A NA  1004 1_555 ? ? ? ? ? ? ? 2.930 ? ? 
metalc21 metalc ?    ? F  ZN  .   ZN  ? ? ? 1_555 J  NKO .   OAD ? ? A ZN  1002 A NKO 1006 1_555 ? ? ? ? ? ? ? 1.846 ? ? 
metalc22 metalc ?    ? G  CA  .   CA  ? ? ? 1_555 HA HOH .   O   ? ? A CA  1003 A HOH 1369 1_555 ? ? ? ? ? ? ? 2.660 ? ? 
metalc23 metalc ?    ? H  NA  .   NA  ? ? ? 1_555 HA HOH .   O   ? ? A NA  1004 A HOH 1083 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc24 metalc ?    ? H  NA  .   NA  ? ? ? 1_555 HA HOH .   O   ? ? A NA  1004 A HOH 1182 1_555 ? ? ? ? ? ? ? 2.941 ? ? 
metalc25 metalc ?    ? I  K   .   K   ? ? ? 1_555 HA HOH .   O   ? ? A K   1005 A HOH 1342 1_555 ? ? ? ? ? ? ? 3.499 ? ? 
metalc26 metalc ?    ? I  K   .   K   ? ? ? 1_555 HA HOH .   O   ? ? A K   1005 A HOH 1343 1_555 ? ? ? ? ? ? ? 3.405 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 35  A . ? PRO 70  A PRO 36  A ? PRO 71  A 1 5.92  
2 TYR 170 A . ? TYR 205 A PRO 171 A ? PRO 206 A 1 -6.44 
3 GLN 274 A . ? GLN 309 A PRO 275 A ? PRO 310 A 1 6.84  
4 GLY 550 A . ? GLY 585 A SER 551 A ? SER 586 A 1 1.00  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 7 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
H 6 7 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 267 ? PRO A 275 ? VAL A 302 PRO A 310 
A 2 LEU A 130 ? ASP A 136 ? LEU A 165 ASP A 171 
A 3 ASN A 317 ? GLY A 322 ? ASN A 352 GLY A 357 
A 4 PHE A 452 ? TYR A 455 ? PHE A 487 TYR A 490 
A 5 THR A 161 ? HIS A 162 ? THR A 196 HIS A 197 
A 6 THR A 463 ? LYS A 464 ? THR A 498 LYS A 499 
B 1 MET A 166 ? ARG A 167 ? MET A 201 ARG A 202 
B 2 PHE A 468 ? GLU A 469 ? PHE A 503 GLU A 504 
C 1 SER A 196 ? ASP A 199 ? SER A 231 ASP A 234 
C 2 ALA A 204 ? HIS A 207 ? ALA A 239 HIS A 242 
D 1 GLU A 327 ? ASP A 328 ? GLU A 362 ASP A 363 
D 2 GLY A 437 ? ASP A 438 ? GLY A 472 ASP A 473 
E 1 THR A 334 ? PHE A 336 ? THR A 369 PHE A 371 
E 2 HIS A 417 ? ALA A 419 ? HIS A 452 ALA A 454 
F 1 ILE A 347 ? VAL A 350 ? ILE A 382 VAL A 385 
F 2 LEU A 354 ? PRO A 359 ? LEU A 389 PRO A 394 
F 3 LEU A 408 ? VAL A 412 ? LEU A 443 VAL A 447 
F 4 PHE A 385 ? MET A 389 ? PHE A 420 MET A 424 
G 1 ALA A 563 ? VAL A 564 ? ALA A 598 VAL A 599 
G 2 LEU A 796 ? ASP A 797 ? LEU A 831 ASP A 832 
H 1 TYR A 570 ? TYR A 574 ? TYR A 605 TYR A 609 
H 2 GLU A 579 ? SER A 583 ? GLU A 614 SER A 618 
H 3 MET A 588 ? ILE A 596 ? MET A 623 ILE A 631 
H 4 VAL A 691 ? ILE A 698 ? VAL A 726 ILE A 733 
H 5 HIS A 727 ? CYS A 735 ? HIS A 762 CYS A 770 
H 6 LEU A 749 ? PRO A 757 ? LEU A 784 PRO A 792 
H 7 THR A 784 ? ALA A 785 ? THR A 819 ALA A 820 
I 1 SER A 637 ? PHE A 640 ? SER A 672 PHE A 675 
I 2 MET A 662 ? MET A 665 ? MET A 697 MET A 700 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 270 ? O PHE A 305 N ILE A 132 ? N ILE A 167 
A 2 3 N PHE A 133 ? N PHE A 168 O ILE A 319 ? O ILE A 354 
A 3 4 N VAL A 318 ? N VAL A 353 O TYR A 455 ? O TYR A 490 
A 4 5 O GLY A 454 ? O GLY A 489 N THR A 161 ? N THR A 196 
A 5 6 N HIS A 162 ? N HIS A 197 O THR A 463 ? O THR A 498 
B 1 2 N ARG A 167 ? N ARG A 202 O PHE A 468 ? O PHE A 503 
C 1 2 N MET A 197 ? N MET A 232 O PHE A 206 ? O PHE A 241 
D 1 2 N GLU A 327 ? N GLU A 362 O ASP A 438 ? O ASP A 473 
E 1 2 N GLU A 335 ? N GLU A 370 O HIS A 417 ? O HIS A 452 
F 1 2 N THR A 348 ? N THR A 383 O ARG A 358 ? O ARG A 393 
F 2 3 N GLY A 355 ? N GLY A 390 O LEU A 410 ? O LEU A 445 
F 3 4 O HIS A 409 ? O HIS A 444 N TYR A 388 ? N TYR A 423 
G 1 2 N ALA A 563 ? N ALA A 598 O ASP A 797 ? O ASP A 832 
H 1 2 N ASP A 571 ? N ASP A 606 O TYR A 582 ? O TYR A 617 
H 2 3 N GLU A 579 ? N GLU A 614 O SER A 593 ? O SER A 628 
H 3 4 N TYR A 594 ? N TYR A 629 O VAL A 693 ? O VAL A 728 
H 4 5 N ASN A 692 ? N ASN A 727 O THR A 733 ? O THR A 768 
H 5 6 N ILE A 732 ? N ILE A 767 O SER A 752 ? O SER A 787 
H 6 7 N SER A 753 ? N SER A 788 O ALA A 785 ? O ALA A 820 
I 1 2 N GLY A 639 ? N GLY A 674 O VAL A 663 ? O VAL A 698 
# 
_atom_sites.entry_id                    3NKO 
_atom_sites.fract_transf_matrix[1][1]   0.016248 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001416 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010593 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013341 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
K  
N  
NA 
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TRP A  1  16  ? 3.232   59.254 27.127  1.00 69.09 ? 51   TRP A N   1 
ATOM   2    C  CA  . TRP A  1  16  ? 3.154   58.512 28.382  1.00 69.57 ? 51   TRP A CA  1 
ATOM   3    C  C   . TRP A  1  16  ? 2.217   57.310 28.281  1.00 66.61 ? 51   TRP A C   1 
ATOM   4    O  O   . TRP A  1  16  ? 1.144   57.390 27.683  1.00 66.52 ? 51   TRP A O   1 
ATOM   5    C  CB  . TRP A  1  16  ? 2.710   59.430 29.527  1.00 67.89 ? 51   TRP A CB  1 
ATOM   6    C  CG  . TRP A  1  16  ? 2.435   58.706 30.828  1.00 64.79 ? 51   TRP A CG  1 
ATOM   7    C  CD1 . TRP A  1  16  ? 3.359   58.195 31.696  1.00 63.73 ? 51   TRP A CD1 1 
ATOM   8    C  CD2 . TRP A  1  16  ? 1.151   58.432 31.407  1.00 64.21 ? 51   TRP A CD2 1 
ATOM   9    N  NE1 . TRP A  1  16  ? 2.731   57.615 32.773  1.00 62.82 ? 51   TRP A NE1 1 
ATOM   10   C  CE2 . TRP A  1  16  ? 1.376   57.747 32.622  1.00 63.87 ? 51   TRP A CE2 1 
ATOM   11   C  CE3 . TRP A  1  16  ? -0.168  58.697 31.016  1.00 64.19 ? 51   TRP A CE3 1 
ATOM   12   C  CZ2 . TRP A  1  16  ? 0.333   57.323 33.447  1.00 61.01 ? 51   TRP A CZ2 1 
ATOM   13   C  CZ3 . TRP A  1  16  ? -1.205  58.273 31.837  1.00 63.69 ? 51   TRP A CZ3 1 
ATOM   14   C  CH2 . TRP A  1  16  ? -0.947  57.594 33.040  1.00 61.82 ? 51   TRP A CH2 1 
ATOM   15   N  N   . THR A  1  17  ? 2.635   56.198 28.876  1.00 64.82 ? 52   THR A N   1 
ATOM   16   C  CA  . THR A  1  17  ? 1.824   54.986 28.909  1.00 65.94 ? 52   THR A CA  1 
ATOM   17   C  C   . THR A  1  17  ? 1.297   54.703 30.320  1.00 63.25 ? 52   THR A C   1 
ATOM   18   O  O   . THR A  1  17  ? 2.072   54.565 31.273  1.00 62.74 ? 52   THR A O   1 
ATOM   19   C  CB  . THR A  1  17  ? 2.612   53.758 28.368  1.00 65.06 ? 52   THR A CB  1 
ATOM   20   O  OG1 . THR A  1  17  ? 2.442   53.665 26.944  1.00 65.41 ? 52   THR A OG1 1 
ATOM   21   C  CG2 . THR A  1  17  ? 2.132   52.457 29.024  1.00 58.81 ? 52   THR A CG2 1 
ATOM   22   N  N   . ASN A  1  18  ? -0.025  54.623 30.443  1.00 61.84 ? 53   ASN A N   1 
ATOM   23   C  CA  . ASN A  1  18  ? -0.660  54.323 31.723  1.00 60.94 ? 53   ASN A CA  1 
ATOM   24   C  C   . ASN A  1  18  ? -0.482  52.855 32.084  1.00 57.92 ? 53   ASN A C   1 
ATOM   25   O  O   . ASN A  1  18  ? -1.318  52.013 31.760  1.00 57.80 ? 53   ASN A O   1 
ATOM   26   C  CB  . ASN A  1  18  ? -2.149  54.695 31.694  1.00 61.78 ? 53   ASN A CB  1 
ATOM   27   C  CG  . ASN A  1  18  ? -2.818  54.565 33.060  1.00 60.87 ? 53   ASN A CG  1 
ATOM   28   O  OD1 . ASN A  1  18  ? -2.265  53.968 33.987  1.00 59.54 ? 53   ASN A OD1 1 
ATOM   29   N  ND2 . ASN A  1  18  ? -4.022  55.123 33.183  1.00 61.48 ? 53   ASN A ND2 1 
ATOM   30   N  N   . THR A  1  19  ? 0.615   52.561 32.767  1.00 56.24 ? 54   THR A N   1 
ATOM   31   C  CA  . THR A  1  19  ? 0.965   51.195 33.116  1.00 56.45 ? 54   THR A CA  1 
ATOM   32   C  C   . THR A  1  19  ? 0.072   50.607 34.207  1.00 54.74 ? 54   THR A C   1 
ATOM   33   O  O   . THR A  1  19  ? 0.282   49.477 34.651  1.00 52.00 ? 54   THR A O   1 
ATOM   34   C  CB  . THR A  1  19  ? 2.431   51.120 33.562  1.00 56.10 ? 54   THR A CB  1 
ATOM   35   O  OG1 . THR A  1  19  ? 2.627   49.959 34.374  1.00 59.45 ? 54   THR A OG1 1 
ATOM   36   C  CG2 . THR A  1  19  ? 2.798   52.357 34.365  1.00 55.97 ? 54   THR A CG2 1 
ATOM   37   N  N   . SER A  1  20  ? -0.938  51.362 34.628  1.00 57.15 ? 55   SER A N   1 
ATOM   38   C  CA  . SER A  1  20  ? -1.775  50.927 35.745  1.00 56.38 ? 55   SER A CA  1 
ATOM   39   C  C   . SER A  1  20  ? -2.904  49.991 35.321  1.00 53.54 ? 55   SER A C   1 
ATOM   40   O  O   . SER A  1  20  ? -3.502  49.302 36.156  1.00 49.61 ? 55   SER A O   1 
ATOM   41   C  CB  . SER A  1  20  ? -2.318  52.133 36.522  1.00 60.71 ? 55   SER A CB  1 
ATOM   42   O  OG  . SER A  1  20  ? -1.272  52.792 37.223  1.00 59.39 ? 55   SER A OG  1 
ATOM   43   N  N   . GLY A  1  21  ? -3.191  49.966 34.023  1.00 54.29 ? 56   GLY A N   1 
ATOM   44   C  CA  . GLY A  1  21  ? -4.164  49.034 33.479  1.00 50.70 ? 56   GLY A CA  1 
ATOM   45   C  C   . GLY A  1  21  ? -3.765  47.590 33.759  1.00 47.22 ? 56   GLY A C   1 
ATOM   46   O  O   . GLY A  1  21  ? -2.702  47.327 34.327  1.00 45.91 ? 56   GLY A O   1 
ATOM   47   N  N   . SER A  1  22  ? -4.618  46.652 33.360  1.00 42.15 ? 57   SER A N   1 
ATOM   48   C  CA  . SER A  1  22  ? -4.363  45.240 33.606  1.00 43.55 ? 57   SER A CA  1 
ATOM   49   C  C   . SER A  1  22  ? -4.352  44.425 32.305  1.00 42.64 ? 57   SER A C   1 
ATOM   50   O  O   . SER A  1  22  ? -5.088  44.726 31.361  1.00 41.37 ? 57   SER A O   1 
ATOM   51   C  CB  . SER A  1  22  ? -5.403  44.679 34.570  1.00 44.81 ? 57   SER A CB  1 
ATOM   52   O  OG  . SER A  1  22  ? -5.263  43.277 34.711  1.00 44.62 ? 57   SER A OG  1 
ATOM   53   N  N   . CYS A  1  23  ? -3.501  43.404 32.257  1.00 42.78 ? 58   CYS A N   1 
ATOM   54   C  CA  . CYS A  1  23  ? -3.480  42.485 31.121  1.00 45.74 ? 58   CYS A CA  1 
ATOM   55   C  C   . CYS A  1  23  ? -4.453  41.332 31.334  1.00 43.84 ? 58   CYS A C   1 
ATOM   56   O  O   . CYS A  1  23  ? -4.338  40.291 30.692  1.00 43.07 ? 58   CYS A O   1 
ATOM   57   C  CB  . CYS A  1  23  ? -2.062  41.951 30.854  1.00 39.29 ? 58   CYS A CB  1 
ATOM   58   S  SG  . CYS A  1  23  ? -1.025  43.126 29.994  1.00 37.82 ? 58   CYS A SG  1 
ATOM   59   N  N   . LYS A  1  24  ? -5.412  41.519 32.235  1.00 44.06 ? 59   LYS A N   1 
ATOM   60   C  CA  . LYS A  1  24  ? -6.421  40.492 32.478  1.00 45.73 ? 59   LYS A CA  1 
ATOM   61   C  C   . LYS A  1  24  ? -7.227  40.238 31.211  1.00 45.32 ? 59   LYS A C   1 
ATOM   62   O  O   . LYS A  1  24  ? -7.775  41.167 30.620  1.00 47.24 ? 59   LYS A O   1 
ATOM   63   C  CB  . LYS A  1  24  ? -7.349  40.903 33.625  1.00 46.01 ? 59   LYS A CB  1 
ATOM   64   N  N   . GLY A  1  25  ? -7.287  38.976 30.798  1.00 45.28 ? 60   GLY A N   1 
ATOM   65   C  CA  . GLY A  1  25  ? -7.962  38.588 29.575  1.00 44.87 ? 60   GLY A CA  1 
ATOM   66   C  C   . GLY A  1  25  ? -7.382  39.191 28.302  1.00 45.13 ? 60   GLY A C   1 
ATOM   67   O  O   . GLY A  1  25  ? -8.074  39.265 27.285  1.00 45.71 ? 60   GLY A O   1 
ATOM   68   N  N   . ARG A  1  26  ? -6.116  39.608 28.346  1.00 43.58 ? 61   ARG A N   1 
ATOM   69   C  CA  . ARG A  1  26  ? -5.505  40.331 27.230  1.00 43.61 ? 61   ARG A CA  1 
ATOM   70   C  C   . ARG A  1  26  ? -4.138  39.788 26.809  1.00 39.97 ? 61   ARG A C   1 
ATOM   71   O  O   . ARG A  1  26  ? -3.537  40.295 25.868  1.00 38.72 ? 61   ARG A O   1 
ATOM   72   C  CB  . ARG A  1  26  ? -5.338  41.810 27.584  1.00 43.08 ? 61   ARG A CB  1 
ATOM   73   C  CG  . ARG A  1  26  ? -6.610  42.612 27.619  1.00 47.45 ? 61   ARG A CG  1 
ATOM   74   C  CD  . ARG A  1  26  ? -6.327  44.042 28.059  1.00 44.34 ? 61   ARG A CD  1 
ATOM   75   N  NE  . ARG A  1  26  ? -5.457  44.756 27.129  1.00 45.92 ? 61   ARG A NE  1 
ATOM   76   C  CZ  . ARG A  1  26  ? -4.774  45.855 27.442  1.00 46.55 ? 61   ARG A CZ  1 
ATOM   77   N  NH1 . ARG A  1  26  ? -4.858  46.359 28.668  1.00 45.44 ? 61   ARG A NH1 1 
ATOM   78   N  NH2 . ARG A  1  26  ? -4.000  46.443 26.536  1.00 44.02 ? 61   ARG A NH2 1 
ATOM   79   N  N   . CYS A  1  27  ? -3.638  38.781 27.517  1.00 37.77 ? 62   CYS A N   1 
ATOM   80   C  CA  . CYS A  1  27  ? -2.289  38.276 27.256  1.00 39.65 ? 62   CYS A CA  1 
ATOM   81   C  C   . CYS A  1  27  ? -2.026  37.967 25.778  1.00 39.39 ? 62   CYS A C   1 
ATOM   82   O  O   . CYS A  1  27  ? -2.786  37.238 25.138  1.00 39.14 ? 62   CYS A O   1 
ATOM   83   C  CB  . CYS A  1  27  ? -2.002  37.049 28.111  1.00 38.57 ? 62   CYS A CB  1 
ATOM   84   S  SG  . CYS A  1  27  ? -1.765  37.424 29.860  1.00 43.73 ? 62   CYS A SG  1 
ATOM   85   N  N   . PHE A  1  28  ? -0.946  38.536 25.252  1.00 37.22 ? 63   PHE A N   1 
ATOM   86   C  CA  . PHE A  1  28  ? -0.590  38.380 23.852  1.00 37.08 ? 63   PHE A CA  1 
ATOM   87   C  C   . PHE A  1  28  ? -1.778  38.640 22.941  1.00 39.33 ? 63   PHE A C   1 
ATOM   88   O  O   . PHE A  1  28  ? -2.037  37.893 22.003  1.00 35.89 ? 63   PHE A O   1 
ATOM   89   C  CB  . PHE A  1  28  ? -0.002  36.990 23.616  1.00 36.92 ? 63   PHE A CB  1 
ATOM   90   C  CG  . PHE A  1  28  ? 1.291   36.777 24.329  1.00 36.71 ? 63   PHE A CG  1 
ATOM   91   C  CD1 . PHE A  1  28  ? 1.339   36.042 25.493  1.00 34.50 ? 63   PHE A CD1 1 
ATOM   92   C  CD2 . PHE A  1  28  ? 2.454   37.358 23.855  1.00 38.18 ? 63   PHE A CD2 1 
ATOM   93   C  CE1 . PHE A  1  28  ? 2.532   35.869 26.169  1.00 38.51 ? 63   PHE A CE1 1 
ATOM   94   C  CE2 . PHE A  1  28  ? 3.656   37.190 24.530  1.00 40.32 ? 63   PHE A CE2 1 
ATOM   95   C  CZ  . PHE A  1  28  ? 3.694   36.442 25.684  1.00 34.69 ? 63   PHE A CZ  1 
ATOM   96   N  N   . GLU A  1  29  ? -2.500  39.714 23.228  1.00 37.60 ? 64   GLU A N   1 
ATOM   97   C  CA  . GLU A  1  29  ? -3.590  40.140 22.374  1.00 41.44 ? 64   GLU A CA  1 
ATOM   98   C  C   . GLU A  1  29  ? -3.008  40.595 21.046  1.00 42.27 ? 64   GLU A C   1 
ATOM   99   O  O   . GLU A  1  29  ? -1.854  41.023 20.983  1.00 41.04 ? 64   GLU A O   1 
ATOM   100  C  CB  . GLU A  1  29  ? -4.361  41.289 23.036  1.00 43.74 ? 64   GLU A CB  1 
ATOM   101  C  CG  . GLU A  1  29  ? -3.565  42.583 23.160  1.00 46.42 ? 64   GLU A CG  1 
ATOM   102  C  CD  . GLU A  1  29  ? -4.265  43.629 24.025  1.00 48.66 ? 64   GLU A CD  1 
ATOM   103  O  OE1 . GLU A  1  29  ? -5.417  43.404 24.450  1.00 49.22 ? 64   GLU A OE1 1 
ATOM   104  O  OE2 . GLU A  1  29  ? -3.660  44.684 24.278  1.00 51.52 ? 64   GLU A OE2 1 
ATOM   105  N  N   . LEU A  1  30  ? -3.801  40.493 19.983  1.00 40.01 ? 65   LEU A N   1 
ATOM   106  C  CA  . LEU A  1  30  ? -3.325  40.828 18.644  1.00 43.94 ? 65   LEU A CA  1 
ATOM   107  C  C   . LEU A  1  30  ? -3.705  42.252 18.229  1.00 46.72 ? 65   LEU A C   1 
ATOM   108  O  O   . LEU A  1  30  ? -3.068  42.858 17.366  1.00 47.83 ? 65   LEU A O   1 
ATOM   109  C  CB  . LEU A  1  30  ? -3.852  39.799 17.641  1.00 42.15 ? 65   LEU A CB  1 
ATOM   110  C  CG  . LEU A  1  30  ? -3.367  38.377 17.960  1.00 39.35 ? 65   LEU A CG  1 
ATOM   111  C  CD1 . LEU A  1  30  ? -4.233  37.299 17.292  1.00 34.91 ? 65   LEU A CD1 1 
ATOM   112  C  CD2 . LEU A  1  30  ? -1.886  38.232 17.573  1.00 36.83 ? 65   LEU A CD2 1 
ATOM   113  N  N   . GLN A  1  31  ? -4.744  42.776 18.865  1.00 52.16 ? 66   GLN A N   1 
ATOM   114  C  CA  . GLN A  1  31  ? -5.206  44.141 18.641  1.00 57.92 ? 66   GLN A CA  1 
ATOM   115  C  C   . GLN A  1  31  ? -4.092  45.159 18.880  1.00 59.55 ? 66   GLN A C   1 
ATOM   116  O  O   . GLN A  1  31  ? -3.286  45.006 19.803  1.00 53.98 ? 66   GLN A O   1 
ATOM   117  C  CB  . GLN A  1  31  ? -6.363  44.434 19.593  1.00 56.48 ? 66   GLN A CB  1 
ATOM   118  C  CG  . GLN A  1  31  ? -5.973  44.241 21.043  1.00 58.10 ? 66   GLN A CG  1 
ATOM   119  C  CD  . GLN A  1  31  ? -7.167  44.116 21.962  1.00 61.88 ? 66   GLN A CD  1 
ATOM   120  O  OE1 . GLN A  1  31  ? -8.015  45.010 22.023  1.00 65.09 ? 66   GLN A OE1 1 
ATOM   121  N  NE2 . GLN A  1  31  ? -7.241  42.999 22.687  1.00 55.80 ? 66   GLN A NE2 1 
ATOM   122  N  N   . GLU A  1  32  ? -4.053  46.198 18.048  1.00 62.56 ? 67   GLU A N   1 
ATOM   123  C  CA  . GLU A  1  32  ? -3.089  47.284 18.216  1.00 63.10 ? 67   GLU A CA  1 
ATOM   124  C  C   . GLU A  1  32  ? -3.499  48.178 19.388  1.00 64.94 ? 67   GLU A C   1 
ATOM   125  O  O   . GLU A  1  32  ? -4.666  48.558 19.507  1.00 65.23 ? 67   GLU A O   1 
ATOM   126  C  CB  . GLU A  1  32  ? -2.985  48.113 16.932  1.00 66.00 ? 67   GLU A CB  1 
ATOM   127  N  N   . VAL A  1  33  ? -2.541  48.504 20.253  1.00 62.54 ? 68   VAL A N   1 
ATOM   128  C  CA  . VAL A  1  33  ? -2.822  49.310 21.439  1.00 62.93 ? 68   VAL A CA  1 
ATOM   129  C  C   . VAL A  1  33  ? -1.739  50.352 21.685  1.00 65.86 ? 68   VAL A C   1 
ATOM   130  O  O   . VAL A  1  33  ? -0.615  50.015 22.064  1.00 63.81 ? 68   VAL A O   1 
ATOM   131  C  CB  . VAL A  1  33  ? -2.958  48.436 22.697  1.00 60.62 ? 68   VAL A CB  1 
ATOM   132  C  CG1 . VAL A  1  33  ? -3.045  49.306 23.944  1.00 58.53 ? 68   VAL A CG1 1 
ATOM   133  C  CG2 . VAL A  1  33  ? -4.173  47.522 22.578  1.00 60.27 ? 68   VAL A CG2 1 
ATOM   134  N  N   . GLY A  1  34  ? -2.085  51.618 21.470  1.00 68.14 ? 69   GLY A N   1 
ATOM   135  C  CA  . GLY A  1  34  ? -1.140  52.710 21.629  1.00 69.41 ? 69   GLY A CA  1 
ATOM   136  C  C   . GLY A  1  34  ? -1.423  53.558 22.855  1.00 69.50 ? 69   GLY A C   1 
ATOM   137  O  O   . GLY A  1  34  ? -2.508  53.473 23.434  1.00 67.51 ? 69   GLY A O   1 
ATOM   138  N  N   . PRO A  1  35  ? -0.442  54.381 23.262  1.00 70.55 ? 70   PRO A N   1 
ATOM   139  C  CA  . PRO A  1  35  ? -0.614  55.273 24.412  1.00 70.12 ? 70   PRO A CA  1 
ATOM   140  C  C   . PRO A  1  35  ? -1.937  56.033 24.343  1.00 71.01 ? 70   PRO A C   1 
ATOM   141  O  O   . PRO A  1  35  ? -2.419  56.345 23.248  1.00 71.71 ? 70   PRO A O   1 
ATOM   142  C  CB  . PRO A  1  35  ? 0.570   56.229 24.283  1.00 69.04 ? 70   PRO A CB  1 
ATOM   143  C  CG  . PRO A  1  35  ? 1.630   55.396 23.648  1.00 71.32 ? 70   PRO A CG  1 
ATOM   144  C  CD  . PRO A  1  35  ? 0.905   54.494 22.676  1.00 71.95 ? 70   PRO A CD  1 
ATOM   145  N  N   . PRO A  1  36  ? -2.518  56.332 25.512  1.00 69.26 ? 71   PRO A N   1 
ATOM   146  C  CA  . PRO A  1  36  ? -1.873  56.072 26.802  1.00 68.64 ? 71   PRO A CA  1 
ATOM   147  C  C   . PRO A  1  36  ? -2.165  54.676 27.380  1.00 66.25 ? 71   PRO A C   1 
ATOM   148  O  O   . PRO A  1  36  ? -1.703  54.358 28.477  1.00 63.12 ? 71   PRO A O   1 
ATOM   149  C  CB  . PRO A  1  36  ? -2.471  57.162 27.699  1.00 67.68 ? 71   PRO A CB  1 
ATOM   150  C  CG  . PRO A  1  36  ? -3.809  57.533 27.036  1.00 67.94 ? 71   PRO A CG  1 
ATOM   151  C  CD  . PRO A  1  36  ? -3.879  56.863 25.685  1.00 68.31 ? 71   PRO A CD  1 
ATOM   152  N  N   . ASP A  1  37  ? -2.911  53.855 26.648  1.00 65.71 ? 72   ASP A N   1 
ATOM   153  C  CA  . ASP A  1  37  ? -3.245  52.511 27.108  1.00 62.56 ? 72   ASP A CA  1 
ATOM   154  C  C   . ASP A  1  37  ? -1.998  51.627 27.173  1.00 60.16 ? 72   ASP A C   1 
ATOM   155  O  O   . ASP A  1  37  ? -1.154  51.670 26.275  1.00 60.14 ? 72   ASP A O   1 
ATOM   156  C  CB  . ASP A  1  37  ? -4.282  51.879 26.178  1.00 66.05 ? 72   ASP A CB  1 
ATOM   157  C  CG  . ASP A  1  37  ? -5.444  52.810 25.883  1.00 69.65 ? 72   ASP A CG  1 
ATOM   158  O  OD1 . ASP A  1  37  ? -5.635  53.777 26.649  1.00 73.93 ? 72   ASP A OD1 1 
ATOM   159  O  OD2 . ASP A  1  37  ? -6.165  52.577 24.886  1.00 69.28 ? 72   ASP A OD2 1 
ATOM   160  N  N   . CYS A  1  38  ? -1.888  50.830 28.234  1.00 54.04 ? 73   CYS A N   1 
ATOM   161  C  CA  . CYS A  1  38  ? -0.758  49.918 28.404  1.00 51.34 ? 73   CYS A CA  1 
ATOM   162  C  C   . CYS A  1  38  ? -0.973  48.612 27.627  1.00 50.24 ? 73   CYS A C   1 
ATOM   163  O  O   . CYS A  1  38  ? -2.105  48.233 27.331  1.00 45.88 ? 73   CYS A O   1 
ATOM   164  C  CB  . CYS A  1  38  ? -0.515  49.621 29.886  1.00 50.44 ? 73   CYS A CB  1 
ATOM   165  S  SG  . CYS A  1  38  ? -1.852  48.726 30.701  1.00 50.73 ? 73   CYS A SG  1 
ATOM   166  N  N   . ARG A  1  39  ? 0.118   47.921 27.313  1.00 48.23 ? 74   ARG A N   1 
ATOM   167  C  CA  . ARG A  1  39  ? 0.056   46.802 26.371  1.00 47.49 ? 74   ARG A CA  1 
ATOM   168  C  C   . ARG A  1  39  ? 0.312   45.438 27.000  1.00 43.70 ? 74   ARG A C   1 
ATOM   169  O  O   . ARG A  1  39  ? 0.786   45.341 28.130  1.00 41.84 ? 74   ARG A O   1 
ATOM   170  C  CB  . ARG A  1  39  ? 1.029   47.055 25.229  1.00 48.37 ? 74   ARG A CB  1 
ATOM   171  C  CG  . ARG A  1  39  ? 0.775   48.377 24.530  1.00 53.47 ? 74   ARG A CG  1 
ATOM   172  C  CD  . ARG A  1  39  ? 1.985   48.796 23.749  1.00 54.63 ? 74   ARG A CD  1 
ATOM   173  N  NE  . ARG A  1  39  ? 2.467   47.682 22.948  1.00 55.46 ? 74   ARG A NE  1 
ATOM   174  C  CZ  . ARG A  1  39  ? 3.580   47.704 22.230  1.00 56.00 ? 74   ARG A CZ  1 
ATOM   175  N  NH1 . ARG A  1  39  ? 4.345   48.788 22.212  1.00 56.36 ? 74   ARG A NH1 1 
ATOM   176  N  NH2 . ARG A  1  39  ? 3.926   46.634 21.532  1.00 55.32 ? 74   ARG A NH2 1 
ATOM   177  N  N   . CYS A  1  40  ? -0.017  44.383 26.259  1.00 43.41 ? 75   CYS A N   1 
ATOM   178  C  CA  . CYS A  1  40  ? 0.162   43.020 26.744  1.00 41.46 ? 75   CYS A CA  1 
ATOM   179  C  C   . CYS A  1  40  ? 0.713   42.073 25.668  1.00 40.31 ? 75   CYS A C   1 
ATOM   180  O  O   . CYS A  1  40  ? 0.536   40.864 25.751  1.00 37.76 ? 75   CYS A O   1 
ATOM   181  C  CB  . CYS A  1  40  ? -1.157  42.489 27.293  1.00 41.90 ? 75   CYS A CB  1 
ATOM   182  S  SG  . CYS A  1  40  ? -2.026  43.716 28.328  1.00 39.90 ? 75   CYS A SG  1 
ATOM   183  N  N   . ASP A  1  41  ? 1.413   42.631 24.688  1.00 44.07 ? 76   ASP A N   1 
ATOM   184  C  CA  . ASP A  1  41  ? 1.962   41.844 23.583  1.00 43.26 ? 76   ASP A CA  1 
ATOM   185  C  C   . ASP A  1  41  ? 3.479   41.682 23.710  1.00 46.47 ? 76   ASP A C   1 
ATOM   186  O  O   . ASP A  1  41  ? 4.052   41.959 24.756  1.00 49.66 ? 76   ASP A O   1 
ATOM   187  C  CB  . ASP A  1  41  ? 1.655   42.555 22.283  1.00 40.12 ? 76   ASP A CB  1 
ATOM   188  C  CG  . ASP A  1  41  ? 2.312   43.913 22.213  1.00 46.79 ? 76   ASP A CG  1 
ATOM   189  O  OD1 . ASP A  1  41  ? 1.702   44.894 22.678  1.00 51.66 ? 76   ASP A OD1 1 
ATOM   190  O  OD2 . ASP A  1  41  ? 3.447   44.001 21.707  1.00 48.39 ? 76   ASP A OD2 1 
ATOM   191  N  N   . ASN A  1  42  ? 4.133   41.262 22.627  1.00 49.75 ? 77   ASN A N   1 
ATOM   192  C  CA  . ASN A  1  42  ? 5.587   41.076 22.616  1.00 42.08 ? 77   ASN A CA  1 
ATOM   193  C  C   . ASN A  1  42  ? 6.423   42.338 22.697  1.00 47.95 ? 77   ASN A C   1 
ATOM   194  O  O   . ASN A  1  42  ? 7.390   42.425 23.461  1.00 54.45 ? 77   ASN A O   1 
ATOM   195  C  CB  . ASN A  1  42  ? 6.004   40.317 21.362  1.00 46.94 ? 77   ASN A CB  1 
ATOM   196  C  CG  . ASN A  1  42  ? 6.099   38.846 21.601  1.00 45.19 ? 77   ASN A CG  1 
ATOM   197  O  OD1 . ASN A  1  42  ? 7.154   38.341 22.007  1.00 44.89 ? 77   ASN A OD1 1 
ATOM   198  N  ND2 . ASN A  1  42  ? 4.993   38.139 21.378  1.00 41.05 ? 77   ASN A ND2 1 
ATOM   199  N  N   . LEU A  1  43  ? 6.070   43.311 21.878  1.00 48.20 ? 78   LEU A N   1 
ATOM   200  C  CA  . LEU A  1  43  ? 6.823   44.543 21.835  1.00 54.77 ? 78   LEU A CA  1 
ATOM   201  C  C   . LEU A  1  43  ? 6.691   45.340 23.136  1.00 53.05 ? 78   LEU A C   1 
ATOM   202  O  O   . LEU A  1  43  ? 7.393   46.328 23.329  1.00 55.53 ? 78   LEU A O   1 
ATOM   203  C  CB  . LEU A  1  43  ? 6.383   45.383 20.629  1.00 52.57 ? 78   LEU A CB  1 
ATOM   204  N  N   . CYS A  1  44  ? 5.814   44.913 24.039  1.00 51.99 ? 79   CYS A N   1 
ATOM   205  C  CA  . CYS A  1  44  ? 5.489   45.776 25.169  1.00 52.19 ? 79   CYS A CA  1 
ATOM   206  C  C   . CYS A  1  44  ? 6.702   46.042 26.055  1.00 53.05 ? 79   CYS A C   1 
ATOM   207  O  O   . CYS A  1  44  ? 6.978   47.194 26.398  1.00 55.58 ? 79   CYS A O   1 
ATOM   208  C  CB  . CYS A  1  44  ? 4.251   45.293 25.958  1.00 48.60 ? 79   CYS A CB  1 
ATOM   209  S  SG  . CYS A  1  44  ? 4.466   43.935 27.109  1.00 43.05 ? 79   CYS A SG  1 
ATOM   210  N  N   . LYS A  1  45  ? 7.446   44.992 26.392  1.00 53.28 ? 80   LYS A N   1 
ATOM   211  C  CA  . LYS A  1  45  ? 8.625   45.152 27.240  1.00 56.67 ? 80   LYS A CA  1 
ATOM   212  C  C   . LYS A  1  45  ? 9.602   46.112 26.588  1.00 56.92 ? 80   LYS A C   1 
ATOM   213  O  O   . LYS A  1  45  ? 10.110  47.035 27.225  1.00 61.18 ? 80   LYS A O   1 
ATOM   214  C  CB  . LYS A  1  45  ? 9.305   43.806 27.500  1.00 55.24 ? 80   LYS A CB  1 
ATOM   215  C  CG  . LYS A  1  45  ? 8.338   42.634 27.602  1.00 55.83 ? 80   LYS A CG  1 
ATOM   216  C  CD  . LYS A  1  45  ? 8.755   41.647 28.686  1.00 52.30 ? 80   LYS A CD  1 
ATOM   217  C  CE  . LYS A  1  45  ? 8.675   42.288 30.063  1.00 53.74 ? 80   LYS A CE  1 
ATOM   218  N  NZ  . LYS A  1  45  ? 9.385   41.479 31.095  1.00 51.38 ? 80   LYS A NZ  1 
ATOM   219  N  N   . SER A  1  46  ? 9.841   45.899 25.300  1.00 57.34 ? 81   SER A N   1 
ATOM   220  C  CA  . SER A  1  46  ? 10.810  46.681 24.547  1.00 53.62 ? 81   SER A CA  1 
ATOM   221  C  C   . SER A  1  46  ? 10.451  48.163 24.535  1.00 56.44 ? 81   SER A C   1 
ATOM   222  O  O   . SER A  1  46  ? 11.314  49.020 24.338  1.00 54.64 ? 81   SER A O   1 
ATOM   223  C  CB  . SER A  1  46  ? 10.906  46.133 23.119  1.00 53.16 ? 81   SER A CB  1 
ATOM   224  O  OG  . SER A  1  46  ? 10.904  44.710 23.141  1.00 52.54 ? 81   SER A OG  1 
ATOM   225  N  N   . TYR A  1  47  ? 9.177   48.466 24.770  1.00 56.43 ? 82   TYR A N   1 
ATOM   226  C  CA  . TYR A  1  47  ? 8.709   49.847 24.731  1.00 56.25 ? 82   TYR A CA  1 
ATOM   227  C  C   . TYR A  1  47  ? 8.357   50.406 26.109  1.00 59.75 ? 82   TYR A C   1 
ATOM   228  O  O   . TYR A  1  47  ? 7.802   51.504 26.210  1.00 59.22 ? 82   TYR A O   1 
ATOM   229  C  CB  . TYR A  1  47  ? 7.486   49.972 23.820  1.00 57.26 ? 82   TYR A CB  1 
ATOM   230  C  CG  . TYR A  1  47  ? 7.769   49.753 22.357  1.00 53.18 ? 82   TYR A CG  1 
ATOM   231  C  CD1 . TYR A  1  47  ? 7.729   48.480 21.808  1.00 56.23 ? 82   TYR A CD1 1 
ATOM   232  C  CD2 . TYR A  1  47  ? 8.062   50.819 21.520  1.00 53.08 ? 82   TYR A CD2 1 
ATOM   233  C  CE1 . TYR A  1  47  ? 7.984   48.270 20.467  1.00 54.03 ? 82   TYR A CE1 1 
ATOM   234  C  CE2 . TYR A  1  47  ? 8.324   50.621 20.177  1.00 50.47 ? 82   TYR A CE2 1 
ATOM   235  C  CZ  . TYR A  1  47  ? 8.279   49.345 19.653  1.00 51.02 ? 82   TYR A CZ  1 
ATOM   236  O  OH  . TYR A  1  47  ? 8.532   49.139 18.311  1.00 52.56 ? 82   TYR A OH  1 
ATOM   237  N  N   . SER A  1  48  ? 8.668   49.657 27.163  1.00 58.59 ? 83   SER A N   1 
ATOM   238  C  CA  . SER A  1  48  ? 8.284   50.069 28.509  1.00 62.13 ? 83   SER A CA  1 
ATOM   239  C  C   . SER A  1  48  ? 6.815   50.486 28.512  1.00 60.97 ? 83   SER A C   1 
ATOM   240  O  O   . SER A  1  48  ? 6.477   51.622 28.864  1.00 60.79 ? 83   SER A O   1 
ATOM   241  C  CB  . SER A  1  48  ? 9.163   51.230 28.990  1.00 64.23 ? 83   SER A CB  1 
ATOM   242  O  OG  . SER A  1  48  ? 10.493  50.805 29.244  1.00 59.29 ? 83   SER A OG  1 
ATOM   243  N  N   . SER A  1  49  ? 5.946   49.570 28.101  1.00 56.18 ? 84   SER A N   1 
ATOM   244  C  CA  . SER A  1  49  ? 4.532   49.884 27.974  1.00 52.93 ? 84   SER A CA  1 
ATOM   245  C  C   . SER A  1  49  ? 3.660   48.735 28.442  1.00 48.40 ? 84   SER A C   1 
ATOM   246  O  O   . SER A  1  49  ? 2.440   48.794 28.312  1.00 48.45 ? 84   SER A O   1 
ATOM   247  C  CB  . SER A  1  49  ? 4.192   50.216 26.524  1.00 56.02 ? 84   SER A CB  1 
ATOM   248  O  OG  . SER A  1  49  ? 4.360   49.069 25.710  1.00 51.08 ? 84   SER A OG  1 
ATOM   249  N  N   . CYS A  1  50  ? 4.280   47.690 28.977  1.00 45.52 ? 85   CYS A N   1 
ATOM   250  C  CA  . CYS A  1  50  ? 3.525   46.561 29.501  1.00 45.13 ? 85   CYS A CA  1 
ATOM   251  C  C   . CYS A  1  50  ? 2.681   47.030 30.677  1.00 50.54 ? 85   CYS A C   1 
ATOM   252  O  O   . CYS A  1  50  ? 3.089   47.921 31.428  1.00 50.39 ? 85   CYS A O   1 
ATOM   253  C  CB  . CYS A  1  50  ? 4.452   45.446 29.976  1.00 46.36 ? 85   CYS A CB  1 
ATOM   254  S  SG  . CYS A  1  50  ? 5.489   44.675 28.703  1.00 49.95 ? 85   CYS A SG  1 
ATOM   255  N  N   . CYS A  1  51  ? 1.508   46.428 30.840  1.00 46.53 ? 86   CYS A N   1 
ATOM   256  C  CA  . CYS A  1  51  ? 0.698   46.681 32.020  1.00 48.30 ? 86   CYS A CA  1 
ATOM   257  C  C   . CYS A  1  51  ? 1.428   46.096 33.229  1.00 48.25 ? 86   CYS A C   1 
ATOM   258  O  O   . CYS A  1  51  ? 2.302   45.246 33.083  1.00 47.81 ? 86   CYS A O   1 
ATOM   259  C  CB  . CYS A  1  51  ? -0.693  46.071 31.857  1.00 43.31 ? 86   CYS A CB  1 
ATOM   260  S  SG  . CYS A  1  51  ? -1.640  46.708 30.444  1.00 47.12 ? 86   CYS A SG  1 
ATOM   261  N  N   . HIS A  1  52  ? 1.079   46.557 34.424  1.00 48.77 ? 87   HIS A N   1 
ATOM   262  C  CA  . HIS A  1  52  ? 1.830   46.199 35.628  1.00 47.25 ? 87   HIS A CA  1 
ATOM   263  C  C   . HIS A  1  52  ? 1.756   44.710 35.943  1.00 47.80 ? 87   HIS A C   1 
ATOM   264  O  O   . HIS A  1  52  ? 2.555   44.187 36.722  1.00 47.09 ? 87   HIS A O   1 
ATOM   265  C  CB  . HIS A  1  52  ? 1.300   46.982 36.832  1.00 49.43 ? 87   HIS A CB  1 
ATOM   266  C  CG  . HIS A  1  52  ? -0.064  46.549 37.261  1.00 44.89 ? 87   HIS A CG  1 
ATOM   267  N  ND1 . HIS A  1  52  ? -1.214  47.106 36.746  1.00 49.75 ? 87   HIS A ND1 1 
ATOM   268  C  CD2 . HIS A  1  52  ? -0.464  45.579 38.116  1.00 46.98 ? 87   HIS A CD2 1 
ATOM   269  C  CE1 . HIS A  1  52  ? -2.266  46.517 37.289  1.00 49.14 ? 87   HIS A CE1 1 
ATOM   270  N  NE2 . HIS A  1  52  ? -1.837  45.584 38.120  1.00 44.35 ? 87   HIS A NE2 1 
ATOM   271  N  N   . ASP A  1  53  ? 0.785   44.024 35.358  1.00 44.10 ? 88   ASP A N   1 
ATOM   272  C  CA  . ASP A  1  53  ? 0.628   42.606 35.638  1.00 45.42 ? 88   ASP A CA  1 
ATOM   273  C  C   . ASP A  1  53  ? 0.901   41.746 34.407  1.00 42.59 ? 88   ASP A C   1 
ATOM   274  O  O   . ASP A  1  53  ? 0.503   40.583 34.358  1.00 41.68 ? 88   ASP A O   1 
ATOM   275  C  CB  . ASP A  1  53  ? -0.758  42.311 36.213  1.00 47.68 ? 88   ASP A CB  1 
ATOM   276  C  CG  . ASP A  1  53  ? -1.881  42.838 35.341  1.00 46.65 ? 88   ASP A CG  1 
ATOM   277  O  OD1 . ASP A  1  53  ? -1.601  43.357 34.237  1.00 45.02 ? 88   ASP A OD1 1 
ATOM   278  O  OD2 . ASP A  1  53  ? -3.050  42.726 35.763  1.00 46.23 ? 88   ASP A OD2 1 
ATOM   279  N  N   . PHE A  1  54  ? 1.593   42.320 33.421  1.00 43.53 ? 89   PHE A N   1 
ATOM   280  C  CA  . PHE A  1  54  ? 1.987   41.548 32.243  1.00 41.28 ? 89   PHE A CA  1 
ATOM   281  C  C   . PHE A  1  54  ? 2.817   40.328 32.620  1.00 40.99 ? 89   PHE A C   1 
ATOM   282  O  O   . PHE A  1  54  ? 2.437   39.198 32.330  1.00 42.15 ? 89   PHE A O   1 
ATOM   283  C  CB  . PHE A  1  54  ? 2.765   42.390 31.231  1.00 41.04 ? 89   PHE A CB  1 
ATOM   284  C  CG  . PHE A  1  54  ? 3.264   41.590 30.059  1.00 43.65 ? 89   PHE A CG  1 
ATOM   285  C  CD1 . PHE A  1  54  ? 2.373   41.091 29.117  1.00 39.23 ? 89   PHE A CD1 1 
ATOM   286  C  CD2 . PHE A  1  54  ? 4.613   41.309 29.914  1.00 43.01 ? 89   PHE A CD2 1 
ATOM   287  C  CE1 . PHE A  1  54  ? 2.823   40.343 28.042  1.00 41.28 ? 89   PHE A CE1 1 
ATOM   288  C  CE2 . PHE A  1  54  ? 5.069   40.565 28.840  1.00 43.85 ? 89   PHE A CE2 1 
ATOM   289  C  CZ  . PHE A  1  54  ? 4.178   40.082 27.905  1.00 41.48 ? 89   PHE A CZ  1 
ATOM   290  N  N   . ASP A  1  55  ? 3.962   40.557 33.258  1.00 41.90 ? 90   ASP A N   1 
ATOM   291  C  CA  . ASP A  1  55  ? 4.840   39.448 33.625  1.00 44.03 ? 90   ASP A CA  1 
ATOM   292  C  C   . ASP A  1  55  ? 4.090   38.411 34.459  1.00 41.68 ? 90   ASP A C   1 
ATOM   293  O  O   . ASP A  1  55  ? 4.217   37.214 34.229  1.00 44.38 ? 90   ASP A O   1 
ATOM   294  C  CB  . ASP A  1  55  ? 6.117   39.949 34.338  1.00 44.25 ? 90   ASP A CB  1 
ATOM   295  C  CG  . ASP A  1  55  ? 7.081   40.691 33.383  1.00 46.08 ? 90   ASP A CG  1 
ATOM   296  O  OD1 . ASP A  1  55  ? 7.987   40.041 32.825  1.00 47.41 ? 90   ASP A OD1 1 
ATOM   297  O  OD2 . ASP A  1  55  ? 6.941   41.922 33.187  1.00 47.08 ? 90   ASP A OD2 1 
ATOM   298  N  N   . GLU A  1  56  ? 3.280   38.880 35.404  1.00 44.61 ? 91   GLU A N   1 
ATOM   299  C  CA  . GLU A  1  56  ? 2.530   38.000 36.301  1.00 45.18 ? 91   GLU A CA  1 
ATOM   300  C  C   . GLU A  1  56  ? 1.422   37.198 35.612  1.00 44.00 ? 91   GLU A C   1 
ATOM   301  O  O   . GLU A  1  56  ? 1.277   35.996 35.842  1.00 44.13 ? 91   GLU A O   1 
ATOM   302  C  CB  . GLU A  1  56  ? 1.924   38.819 37.447  1.00 49.11 ? 91   GLU A CB  1 
ATOM   303  C  CG  . GLU A  1  56  ? 1.033   38.018 38.383  1.00 52.65 ? 91   GLU A CG  1 
ATOM   304  C  CD  . GLU A  1  56  ? 0.368   38.883 39.448  1.00 58.39 ? 91   GLU A CD  1 
ATOM   305  O  OE1 . GLU A  1  56  ? 0.859   40.008 39.707  1.00 59.61 ? 91   GLU A OE1 1 
ATOM   306  O  OE2 . GLU A  1  56  ? -0.646  38.434 40.025  1.00 57.67 ? 91   GLU A OE2 1 
ATOM   307  N  N   . LEU A  1  57  ? 0.621   37.866 34.788  1.00 45.11 ? 92   LEU A N   1 
ATOM   308  C  CA  . LEU A  1  57  ? -0.505  37.195 34.134  1.00 43.66 ? 92   LEU A CA  1 
ATOM   309  C  C   . LEU A  1  57  ? -0.119  36.444 32.860  1.00 44.58 ? 92   LEU A C   1 
ATOM   310  O  O   . LEU A  1  57  ? -0.697  35.409 32.550  1.00 44.32 ? 92   LEU A O   1 
ATOM   311  C  CB  . LEU A  1  57  ? -1.633  38.190 33.830  1.00 46.58 ? 92   LEU A CB  1 
ATOM   312  C  CG  . LEU A  1  57  ? -2.331  38.809 35.047  1.00 46.82 ? 92   LEU A CG  1 
ATOM   313  C  CD1 . LEU A  1  57  ? -3.443  39.758 34.620  1.00 46.73 ? 92   LEU A CD1 1 
ATOM   314  C  CD2 . LEU A  1  57  ? -2.869  37.722 35.966  1.00 48.84 ? 92   LEU A CD2 1 
ATOM   315  N  N   . CYS A  1  58  ? 0.868   36.953 32.132  1.00 44.26 ? 93   CYS A N   1 
ATOM   316  C  CA  . CYS A  1  58  ? 1.130   36.465 30.781  1.00 40.79 ? 93   CYS A CA  1 
ATOM   317  C  C   . CYS A  1  58  ? 2.365   35.587 30.635  1.00 42.42 ? 93   CYS A C   1 
ATOM   318  O  O   . CYS A  1  58  ? 2.548   34.928 29.598  1.00 38.56 ? 93   CYS A O   1 
ATOM   319  C  CB  . CYS A  1  58  ? 1.241   37.646 29.831  1.00 38.83 ? 93   CYS A CB  1 
ATOM   320  S  SG  . CYS A  1  58  ? -0.192  38.709 29.942  1.00 40.36 ? 93   CYS A SG  1 
ATOM   321  N  N   . LEU A  1  59  ? 3.218   35.585 31.653  1.00 40.15 ? 94   LEU A N   1 
ATOM   322  C  CA  . LEU A  1  59  ? 4.467   34.842 31.573  1.00 41.50 ? 94   LEU A CA  1 
ATOM   323  C  C   . LEU A  1  59  ? 4.583   33.821 32.692  1.00 39.60 ? 94   LEU A C   1 
ATOM   324  O  O   . LEU A  1  59  ? 5.636   33.685 33.306  1.00 42.19 ? 94   LEU A O   1 
ATOM   325  C  CB  . LEU A  1  59  ? 5.663   35.786 31.607  1.00 40.95 ? 94   LEU A CB  1 
ATOM   326  C  CG  . LEU A  1  59  ? 5.763   36.784 30.454  1.00 39.64 ? 94   LEU A CG  1 
ATOM   327  C  CD1 . LEU A  1  59  ? 6.963   37.703 30.659  1.00 42.25 ? 94   LEU A CD1 1 
ATOM   328  C  CD2 . LEU A  1  59  ? 5.826   36.055 29.090  1.00 40.62 ? 94   LEU A CD2 1 
ATOM   329  N  N   . LYS A  1  60  ? 3.498   33.105 32.953  1.00 37.54 ? 95   LYS A N   1 
ATOM   330  C  CA  . LYS A  1  60  ? 3.516   32.048 33.961  1.00 43.24 ? 95   LYS A CA  1 
ATOM   331  C  C   . LYS A  1  60  ? 4.535   30.952 33.647  1.00 40.10 ? 95   LYS A C   1 
ATOM   332  O  O   . LYS A  1  60  ? 4.730   30.588 32.483  1.00 40.35 ? 95   LYS A O   1 
ATOM   333  C  CB  . LYS A  1  60  ? 2.124   31.438 34.110  1.00 45.17 ? 95   LYS A CB  1 
ATOM   334  C  CG  . LYS A  1  60  ? 1.080   32.446 34.552  1.00 44.10 ? 95   LYS A CG  1 
ATOM   335  C  CD  . LYS A  1  60  ? -0.302  31.843 34.590  1.00 48.95 ? 95   LYS A CD  1 
ATOM   336  C  CE  . LYS A  1  60  ? -1.304  32.871 35.121  1.00 55.77 ? 95   LYS A CE  1 
ATOM   337  N  NZ  . LYS A  1  60  ? -0.867  33.472 36.424  1.00 55.36 ? 95   LYS A NZ  1 
ATOM   338  N  N   . THR A  1  61  ? 5.165   30.416 34.694  1.00 42.19 ? 96   THR A N   1 
ATOM   339  C  CA  . THR A  1  61  ? 6.185   29.374 34.545  1.00 38.42 ? 96   THR A CA  1 
ATOM   340  C  C   . THR A  1  61  ? 5.905   28.149 35.415  1.00 39.68 ? 96   THR A C   1 
ATOM   341  O  O   . THR A  1  61  ? 6.514   27.089 35.236  1.00 38.61 ? 96   THR A O   1 
ATOM   342  C  CB  . THR A  1  61  ? 7.568   29.907 34.935  1.00 40.93 ? 96   THR A CB  1 
ATOM   343  O  OG1 . THR A  1  61  ? 7.508   30.433 36.267  1.00 45.56 ? 96   THR A OG1 1 
ATOM   344  C  CG2 . THR A  1  61  ? 7.996   31.018 33.992  1.00 40.37 ? 96   THR A CG2 1 
ATOM   345  N  N   . ALA A  1  62  ? 4.976   28.300 36.357  1.00 46.68 ? 97   ALA A N   1 
ATOM   346  C  CA  . ALA A  1  62  ? 4.673   27.259 37.343  1.00 42.39 ? 97   ALA A CA  1 
ATOM   347  C  C   . ALA A  1  62  ? 4.503   25.856 36.767  1.00 40.69 ? 97   ALA A C   1 
ATOM   348  O  O   . ALA A  1  62  ? 3.687   25.629 35.872  1.00 41.25 ? 97   ALA A O   1 
ATOM   349  C  CB  . ALA A  1  62  ? 3.443   27.648 38.163  1.00 44.28 ? 97   ALA A CB  1 
ATOM   350  N  N   . ARG A  1  63  ? 5.289   24.921 37.297  1.00 43.49 ? 98   ARG A N   1 
ATOM   351  C  CA  . ARG A  1  63  ? 5.201   23.505 36.936  1.00 39.53 ? 98   ARG A CA  1 
ATOM   352  C  C   . ARG A  1  63  ? 5.832   23.140 35.581  1.00 41.31 ? 98   ARG A C   1 
ATOM   353  O  O   . ARG A  1  63  ? 5.775   21.989 35.147  1.00 40.28 ? 98   ARG A O   1 
ATOM   354  C  CB  . ARG A  1  63  ? 3.754   22.995 37.035  1.00 42.66 ? 98   ARG A CB  1 
ATOM   355  C  CG  . ARG A  1  63  ? 3.120   23.203 38.423  1.00 44.60 ? 98   ARG A CG  1 
ATOM   356  C  CD  . ARG A  1  63  ? 2.004   22.197 38.715  1.00 47.13 ? 98   ARG A CD  1 
ATOM   357  N  NE  . ARG A  1  63  ? 2.532   20.841 38.893  1.00 49.27 ? 98   ARG A NE  1 
ATOM   358  C  CZ  . ARG A  1  63  ? 1.793   19.778 39.206  1.00 53.92 ? 98   ARG A CZ  1 
ATOM   359  N  NH1 . ARG A  1  63  ? 0.483   19.901 39.389  1.00 56.74 ? 98   ARG A NH1 1 
ATOM   360  N  NH2 . ARG A  1  63  ? 2.365   18.587 39.340  1.00 53.03 ? 98   ARG A NH2 1 
ATOM   361  N  N   . GLY A  1  64  ? 6.450   24.110 34.920  1.00 41.65 ? 99   GLY A N   1 
ATOM   362  C  CA  . GLY A  1  64  ? 7.149   23.804 33.686  1.00 35.29 ? 99   GLY A CA  1 
ATOM   363  C  C   . GLY A  1  64  ? 6.234   23.551 32.501  1.00 33.95 ? 99   GLY A C   1 
ATOM   364  O  O   . GLY A  1  64  ? 5.057   23.912 32.523  1.00 38.20 ? 99   GLY A O   1 
ATOM   365  N  N   . TRP A  1  65  ? 6.772   22.903 31.472  1.00 35.05 ? 100  TRP A N   1 
ATOM   366  C  CA  . TRP A  1  65  ? 6.144   22.896 30.149  1.00 32.99 ? 100  TRP A CA  1 
ATOM   367  C  C   . TRP A  1  65  ? 5.553   21.561 29.718  1.00 33.52 ? 100  TRP A C   1 
ATOM   368  O  O   . TRP A  1  65  ? 5.030   21.425 28.610  1.00 33.63 ? 100  TRP A O   1 
ATOM   369  C  CB  . TRP A  1  65  ? 7.161   23.391 29.121  1.00 30.22 ? 100  TRP A CB  1 
ATOM   370  C  CG  . TRP A  1  65  ? 7.821   24.640 29.573  1.00 28.55 ? 100  TRP A CG  1 
ATOM   371  C  CD1 . TRP A  1  65  ? 9.087   24.766 30.070  1.00 31.31 ? 100  TRP A CD1 1 
ATOM   372  C  CD2 . TRP A  1  65  ? 7.241   25.949 29.614  1.00 28.78 ? 100  TRP A CD2 1 
ATOM   373  N  NE1 . TRP A  1  65  ? 9.340   26.079 30.395  1.00 33.68 ? 100  TRP A NE1 1 
ATOM   374  C  CE2 . TRP A  1  65  ? 8.219   26.824 30.127  1.00 31.47 ? 100  TRP A CE2 1 
ATOM   375  C  CE3 . TRP A  1  65  ? 6.000   26.471 29.238  1.00 31.96 ? 100  TRP A CE3 1 
ATOM   376  C  CZ2 . TRP A  1  65  ? 7.991   28.191 30.281  1.00 32.31 ? 100  TRP A CZ2 1 
ATOM   377  C  CZ3 . TRP A  1  65  ? 5.777   27.830 29.388  1.00 29.18 ? 100  TRP A CZ3 1 
ATOM   378  C  CH2 . TRP A  1  65  ? 6.764   28.671 29.906  1.00 31.69 ? 100  TRP A CH2 1 
ATOM   379  N  N   . GLU A  1  66  ? 5.612   20.576 30.604  1.00 39.13 ? 101  GLU A N   1 
ATOM   380  C  CA  . GLU A  1  66  ? 5.166   19.236 30.255  1.00 34.61 ? 101  GLU A CA  1 
ATOM   381  C  C   . GLU A  1  66  ? 4.172   18.668 31.251  1.00 39.27 ? 101  GLU A C   1 
ATOM   382  O  O   . GLU A  1  66  ? 4.331   18.825 32.468  1.00 41.75 ? 101  GLU A O   1 
ATOM   383  C  CB  . GLU A  1  66  ? 6.368   18.292 30.160  1.00 38.96 ? 101  GLU A CB  1 
ATOM   384  C  CG  . GLU A  1  66  ? 7.365   18.705 29.095  1.00 40.35 ? 101  GLU A CG  1 
ATOM   385  C  CD  . GLU A  1  66  ? 8.665   17.939 29.176  1.00 44.49 ? 101  GLU A CD  1 
ATOM   386  O  OE1 . GLU A  1  66  ? 8.901   17.254 30.194  1.00 48.61 ? 101  GLU A OE1 1 
ATOM   387  O  OE2 . GLU A  1  66  ? 9.456   18.032 28.217  1.00 42.66 ? 101  GLU A OE2 1 
ATOM   388  N  N   . CYS A  1  67  ? 3.144   18.014 30.723  1.00 36.04 ? 102  CYS A N   1 
ATOM   389  C  CA  . CYS A  1  67  ? 2.263   17.207 31.554  1.00 41.97 ? 102  CYS A CA  1 
ATOM   390  C  C   . CYS A  1  67  ? 3.017   15.982 32.046  1.00 42.49 ? 102  CYS A C   1 
ATOM   391  O  O   . CYS A  1  67  ? 3.838   15.421 31.321  1.00 40.15 ? 102  CYS A O   1 
ATOM   392  C  CB  . CYS A  1  67  ? 1.037   16.760 30.759  1.00 39.14 ? 102  CYS A CB  1 
ATOM   393  S  SG  . CYS A  1  67  ? -0.152  18.076 30.463  1.00 40.57 ? 102  CYS A SG  1 
ATOM   394  N  N   . THR A  1  68  ? 2.741   15.589 33.285  1.00 44.06 ? 103  THR A N   1 
ATOM   395  C  CA  . THR A  1  68  ? 3.186   14.310 33.835  1.00 46.65 ? 103  THR A CA  1 
ATOM   396  C  C   . THR A  1  68  ? 1.938   13.499 34.177  1.00 52.07 ? 103  THR A C   1 
ATOM   397  O  O   . THR A  1  68  ? 0.870   14.075 34.401  1.00 48.77 ? 103  THR A O   1 
ATOM   398  C  CB  . THR A  1  68  ? 4.025   14.500 35.113  1.00 48.78 ? 103  THR A CB  1 
ATOM   399  O  OG1 . THR A  1  68  ? 3.359   15.419 35.992  1.00 46.61 ? 103  THR A OG1 1 
ATOM   400  C  CG2 . THR A  1  68  ? 5.399   15.048 34.775  1.00 49.55 ? 103  THR A CG2 1 
ATOM   401  N  N   . LYS A  1  69  ? 2.056   12.173 34.211  1.00 52.99 ? 104  LYS A N   1 
ATOM   402  C  CA  . LYS A  1  69  ? 0.896   11.325 34.514  1.00 53.08 ? 104  LYS A CA  1 
ATOM   403  C  C   . LYS A  1  69  ? 0.119   11.825 35.740  1.00 53.73 ? 104  LYS A C   1 
ATOM   404  O  O   . LYS A  1  69  ? -1.115  11.814 35.753  1.00 51.69 ? 104  LYS A O   1 
ATOM   405  C  CB  . LYS A  1  69  ? 1.320   9.865  34.705  1.00 54.13 ? 104  LYS A CB  1 
ATOM   406  N  N   . ASP A  1  70  ? 0.842   12.289 36.754  1.00 54.90 ? 105  ASP A N   1 
ATOM   407  C  CA  . ASP A  1  70  ? 0.221   12.710 38.007  1.00 54.53 ? 105  ASP A CA  1 
ATOM   408  C  C   . ASP A  1  70  ? -0.540  14.021 37.884  1.00 55.86 ? 105  ASP A C   1 
ATOM   409  O  O   . ASP A  1  70  ? -1.038  14.539 38.884  1.00 55.80 ? 105  ASP A O   1 
ATOM   410  C  CB  . ASP A  1  70  ? 1.270   12.849 39.110  1.00 56.85 ? 105  ASP A CB  1 
ATOM   411  C  CG  . ASP A  1  70  ? 2.113   14.099 38.957  1.00 58.15 ? 105  ASP A CG  1 
ATOM   412  O  OD1 . ASP A  1  70  ? 1.759   15.137 39.560  1.00 59.11 ? 105  ASP A OD1 1 
ATOM   413  O  OD2 . ASP A  1  70  ? 3.129   14.044 38.230  1.00 58.26 ? 105  ASP A OD2 1 
ATOM   414  N  N   . ARG A  1  71  ? -0.621  14.562 36.669  1.00 52.22 ? 106  ARG A N   1 
ATOM   415  C  CA  . ARG A  1  71  ? -1.349  15.808 36.433  1.00 47.74 ? 106  ARG A CA  1 
ATOM   416  C  C   . ARG A  1  71  ? -2.589  15.596 35.578  1.00 46.01 ? 106  ARG A C   1 
ATOM   417  O  O   . ARG A  1  71  ? -3.412  16.498 35.435  1.00 49.54 ? 106  ARG A O   1 
ATOM   418  C  CB  . ARG A  1  71  ? -0.451  16.843 35.750  1.00 46.70 ? 106  ARG A CB  1 
ATOM   419  C  CG  . ARG A  1  71  ? 0.613   17.447 36.641  1.00 49.58 ? 106  ARG A CG  1 
ATOM   420  C  CD  . ARG A  1  71  ? 1.287   18.631 35.946  1.00 46.03 ? 106  ARG A CD  1 
ATOM   421  N  NE  . ARG A  1  71  ? 0.333   19.685 35.603  1.00 45.87 ? 106  ARG A NE  1 
ATOM   422  C  CZ  . ARG A  1  71  ? 0.643   20.779 34.912  1.00 46.20 ? 106  ARG A CZ  1 
ATOM   423  N  NH1 . ARG A  1  71  ? 1.887   20.967 34.480  1.00 40.28 ? 106  ARG A NH1 1 
ATOM   424  N  NH2 . ARG A  1  71  ? -0.292  21.685 34.651  1.00 43.29 ? 106  ARG A NH2 1 
ATOM   425  N  N   . CYS A  1  72  ? -2.716  14.412 34.993  1.00 46.57 ? 107  CYS A N   1 
ATOM   426  C  CA  . CYS A  1  72  ? -3.810  14.156 34.069  1.00 47.06 ? 107  CYS A CA  1 
ATOM   427  C  C   . CYS A  1  72  ? -5.158  14.342 34.759  1.00 49.99 ? 107  CYS A C   1 
ATOM   428  O  O   . CYS A  1  72  ? -5.359  13.891 35.887  1.00 47.67 ? 107  CYS A O   1 
ATOM   429  C  CB  . CYS A  1  72  ? -3.692  12.754 33.468  1.00 47.41 ? 107  CYS A CB  1 
ATOM   430  S  SG  . CYS A  1  72  ? -2.244  12.531 32.395  1.00 50.07 ? 107  CYS A SG  1 
ATOM   431  N  N   . GLY A  1  73  ? -6.072  15.025 34.082  1.00 51.13 ? 108  GLY A N   1 
ATOM   432  C  CA  . GLY A  1  73  ? -7.391  15.287 34.636  1.00 53.54 ? 108  GLY A CA  1 
ATOM   433  C  C   . GLY A  1  73  ? -7.356  16.054 35.945  1.00 55.71 ? 108  GLY A C   1 
ATOM   434  O  O   . GLY A  1  73  ? -8.288  15.980 36.746  1.00 60.79 ? 108  GLY A O   1 
ATOM   435  N  N   . GLU A  1  74  ? -6.271  16.783 36.175  1.00 52.48 ? 109  GLU A N   1 
ATOM   436  C  CA  . GLU A  1  74  ? -6.165  17.650 37.335  1.00 50.93 ? 109  GLU A CA  1 
ATOM   437  C  C   . GLU A  1  74  ? -7.298  18.671 37.306  1.00 53.25 ? 109  GLU A C   1 
ATOM   438  O  O   . GLU A  1  74  ? -7.999  18.808 36.301  1.00 52.82 ? 109  GLU A O   1 
ATOM   439  C  CB  . GLU A  1  74  ? -4.822  18.381 37.314  1.00 50.45 ? 109  GLU A CB  1 
ATOM   440  C  CG  . GLU A  1  74  ? -4.688  19.298 36.113  1.00 49.93 ? 109  GLU A CG  1 
ATOM   441  C  CD  . GLU A  1  74  ? -3.328  19.939 35.981  1.00 47.98 ? 109  GLU A CD  1 
ATOM   442  O  OE1 . GLU A  1  74  ? -2.412  19.598 36.760  1.00 47.47 ? 109  GLU A OE1 1 
ATOM   443  O  OE2 . GLU A  1  74  ? -3.178  20.790 35.075  1.00 48.70 ? 109  GLU A OE2 1 
ATOM   444  N  N   . VAL A  1  75  ? -7.485  19.382 38.412  1.00 55.92 ? 110  VAL A N   1 
ATOM   445  C  CA  . VAL A  1  75  ? -8.350  20.552 38.399  1.00 57.52 ? 110  VAL A CA  1 
ATOM   446  C  C   . VAL A  1  75  ? -7.518  21.768 38.005  1.00 55.15 ? 110  VAL A C   1 
ATOM   447  O  O   . VAL A  1  75  ? -6.432  22.001 38.550  1.00 52.73 ? 110  VAL A O   1 
ATOM   448  C  CB  . VAL A  1  75  ? -9.054  20.789 39.761  1.00 59.01 ? 110  VAL A CB  1 
ATOM   449  C  CG1 . VAL A  1  75  ? -9.376  22.266 39.961  1.00 53.40 ? 110  VAL A CG1 1 
ATOM   450  C  CG2 . VAL A  1  75  ? -10.316 19.943 39.856  1.00 59.85 ? 110  VAL A CG2 1 
ATOM   451  N  N   . ARG A  1  76  ? -8.046  22.527 37.051  1.00 55.53 ? 111  ARG A N   1 
ATOM   452  C  CA  . ARG A  1  76  ? -7.372  23.688 36.484  1.00 54.88 ? 111  ARG A CA  1 
ATOM   453  C  C   . ARG A  1  76  ? -6.876  24.705 37.514  1.00 56.26 ? 111  ARG A C   1 
ATOM   454  O  O   . ARG A  1  76  ? -7.671  25.338 38.210  1.00 57.37 ? 111  ARG A O   1 
ATOM   455  C  CB  . ARG A  1  76  ? -8.301  24.374 35.480  1.00 54.53 ? 111  ARG A CB  1 
ATOM   456  C  CG  . ARG A  1  76  ? -7.773  25.682 34.922  1.00 55.57 ? 111  ARG A CG  1 
ATOM   457  C  CD  . ARG A  1  76  ? -8.742  26.254 33.905  1.00 56.91 ? 111  ARG A CD  1 
ATOM   458  N  NE  . ARG A  1  76  ? -8.132  26.421 32.590  1.00 58.07 ? 111  ARG A NE  1 
ATOM   459  C  CZ  . ARG A  1  76  ? -7.860  25.417 31.764  1.00 55.91 ? 111  ARG A CZ  1 
ATOM   460  N  NH1 . ARG A  1  76  ? -8.128  24.175 32.119  1.00 58.65 ? 111  ARG A NH1 1 
ATOM   461  N  NH2 . ARG A  1  76  ? -7.317  25.653 30.587  1.00 52.31 ? 111  ARG A NH2 1 
ATOM   462  N  N   . ASN A  1  77  ? -5.556  24.856 37.603  1.00 53.31 ? 112  ASN A N   1 
ATOM   463  C  CA  . ASN A  1  77  ? -4.957  25.950 38.359  1.00 50.59 ? 112  ASN A CA  1 
ATOM   464  C  C   . ASN A  1  77  ? -4.406  26.985 37.383  1.00 53.92 ? 112  ASN A C   1 
ATOM   465  O  O   . ASN A  1  77  ? -3.488  26.698 36.609  1.00 50.45 ? 112  ASN A O   1 
ATOM   466  C  CB  . ASN A  1  77  ? -3.856  25.439 39.288  1.00 48.99 ? 112  ASN A CB  1 
ATOM   467  C  CG  . ASN A  1  77  ? -3.307  26.525 40.204  1.00 53.37 ? 112  ASN A CG  1 
ATOM   468  O  OD1 . ASN A  1  77  ? -3.538  27.716 39.990  1.00 53.58 ? 112  ASN A OD1 1 
ATOM   469  N  ND2 . ASN A  1  77  ? -2.570  26.112 41.235  1.00 53.70 ? 112  ASN A ND2 1 
ATOM   470  N  N   . GLU A  1  78  ? -4.979  28.183 37.418  1.00 52.58 ? 113  GLU A N   1 
ATOM   471  C  CA  . GLU A  1  78  ? -4.625  29.236 36.476  1.00 52.82 ? 113  GLU A CA  1 
ATOM   472  C  C   . GLU A  1  78  ? -3.217  29.783 36.705  1.00 53.12 ? 113  GLU A C   1 
ATOM   473  O  O   . GLU A  1  78  ? -2.781  30.689 36.000  1.00 53.18 ? 113  GLU A O   1 
ATOM   474  C  CB  . GLU A  1  78  ? -5.651  30.371 36.543  1.00 55.72 ? 113  GLU A CB  1 
ATOM   475  C  CG  . GLU A  1  78  ? -7.094  29.935 36.272  1.00 58.14 ? 113  GLU A CG  1 
ATOM   476  C  CD  . GLU A  1  78  ? -7.357  29.580 34.811  1.00 62.32 ? 113  GLU A CD  1 
ATOM   477  O  OE1 . GLU A  1  78  ? -6.391  29.496 34.013  1.00 58.93 ? 113  GLU A OE1 1 
ATOM   478  O  OE2 . GLU A  1  78  ? -8.543  29.380 34.461  1.00 62.23 ? 113  GLU A OE2 1 
ATOM   479  N  N   . GLU A  1  79  ? -2.507  29.232 37.682  1.00 49.44 ? 114  GLU A N   1 
ATOM   480  C  CA  . GLU A  1  79  ? -1.160  29.696 37.987  1.00 51.30 ? 114  GLU A CA  1 
ATOM   481  C  C   . GLU A  1  79  ? -0.128  28.927 37.157  1.00 46.23 ? 114  GLU A C   1 
ATOM   482  O  O   . GLU A  1  79  ? 1.000   29.380 36.960  1.00 47.43 ? 114  GLU A O   1 
ATOM   483  C  CB  . GLU A  1  79  ? -0.875  29.531 39.483  1.00 54.24 ? 114  GLU A CB  1 
ATOM   484  C  CG  . GLU A  1  79  ? 0.188   30.471 40.031  1.00 58.60 ? 114  GLU A CG  1 
ATOM   485  C  CD  . GLU A  1  79  ? -0.204  31.941 39.918  1.00 64.00 ? 114  GLU A CD  1 
ATOM   486  O  OE1 . GLU A  1  79  ? -1.410  32.247 40.046  1.00 65.81 ? 114  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A  1  79  ? 0.694   32.790 39.706  1.00 65.43 ? 114  GLU A OE2 1 
ATOM   488  N  N   . ASN A  1  80  ? -0.526  27.758 36.678  1.00 43.64 ? 115  ASN A N   1 
ATOM   489  C  CA  . ASN A  1  80  ? 0.368   26.889 35.927  1.00 44.64 ? 115  ASN A CA  1 
ATOM   490  C  C   . ASN A  1  80  ? 0.685   27.426 34.534  1.00 42.16 ? 115  ASN A C   1 
ATOM   491  O  O   . ASN A  1  80  ? -0.119  28.156 33.940  1.00 36.65 ? 115  ASN A O   1 
ATOM   492  C  CB  . ASN A  1  80  ? -0.226  25.483 35.825  1.00 41.76 ? 115  ASN A CB  1 
ATOM   493  C  CG  . ASN A  1  80  ? -0.171  24.741 37.138  1.00 44.32 ? 115  ASN A CG  1 
ATOM   494  O  OD1 . ASN A  1  80  ? 0.765   24.920 37.914  1.00 43.55 ? 115  ASN A OD1 1 
ATOM   495  N  ND2 . ASN A  1  80  ? -1.173  23.903 37.396  1.00 45.02 ? 115  ASN A ND2 1 
ATOM   496  N  N   . ALA A  1  81  ? 1.865   27.060 34.030  1.00 37.44 ? 116  ALA A N   1 
ATOM   497  C  CA  . ALA A  1  81  ? 2.332   27.499 32.715  1.00 38.16 ? 116  ALA A CA  1 
ATOM   498  C  C   . ALA A  1  81  ? 1.460   26.972 31.582  1.00 35.64 ? 116  ALA A C   1 
ATOM   499  O  O   . ALA A  1  81  ? 1.148   27.699 30.639  1.00 34.76 ? 116  ALA A O   1 
ATOM   500  C  CB  . ALA A  1  81  ? 3.794   27.086 32.508  1.00 34.75 ? 116  ALA A CB  1 
ATOM   501  N  N   . CYS A  1  82  ? 1.082   25.703 31.679  1.00 34.07 ? 117  CYS A N   1 
ATOM   502  C  CA  . CYS A  1  82  ? 0.160   25.071 30.746  1.00 34.83 ? 117  CYS A CA  1 
ATOM   503  C  C   . CYS A  1  82  ? -0.628  24.024 31.527  1.00 38.70 ? 117  CYS A C   1 
ATOM   504  O  O   . CYS A  1  82  ? -0.305  23.728 32.678  1.00 37.80 ? 117  CYS A O   1 
ATOM   505  C  CB  . CYS A  1  82  ? 0.893   24.425 29.562  1.00 32.62 ? 117  CYS A CB  1 
ATOM   506  S  SG  . CYS A  1  82  ? 2.313   23.360 30.004  1.00 34.11 ? 117  CYS A SG  1 
ATOM   507  N  N   . HIS A  1  83  ? -1.639  23.448 30.899  1.00 38.91 ? 118  HIS A N   1 
ATOM   508  C  CA  . HIS A  1  83  ? -2.621  22.677 31.648  1.00 40.59 ? 118  HIS A CA  1 
ATOM   509  C  C   . HIS A  1  83  ? -2.768  21.235 31.180  1.00 40.94 ? 118  HIS A C   1 
ATOM   510  O  O   . HIS A  1  83  ? -2.437  20.888 30.042  1.00 35.86 ? 118  HIS A O   1 
ATOM   511  C  CB  . HIS A  1  83  ? -3.960  23.431 31.655  1.00 41.47 ? 118  HIS A CB  1 
ATOM   512  C  CG  . HIS A  1  83  ? -3.821  24.860 32.085  1.00 40.52 ? 118  HIS A CG  1 
ATOM   513  N  ND1 . HIS A  1  83  ? -3.922  25.256 33.401  1.00 43.44 ? 118  HIS A ND1 1 
ATOM   514  C  CD2 . HIS A  1  83  ? -3.519  25.976 31.381  1.00 41.36 ? 118  HIS A CD2 1 
ATOM   515  C  CE1 . HIS A  1  83  ? -3.718  26.559 33.487  1.00 41.53 ? 118  HIS A CE1 1 
ATOM   516  N  NE2 . HIS A  1  83  ? -3.471  27.021 32.275  1.00 42.77 ? 118  HIS A NE2 1 
ATOM   517  N  N   . CYS A  1  84  ? -3.254  20.396 32.089  1.00 41.81 ? 119  CYS A N   1 
ATOM   518  C  CA  . CYS A  1  84  ? -3.422  18.972 31.836  1.00 44.00 ? 119  CYS A CA  1 
ATOM   519  C  C   . CYS A  1  84  ? -4.801  18.555 32.324  1.00 48.03 ? 119  CYS A C   1 
ATOM   520  O  O   . CYS A  1  84  ? -5.114  17.367 32.426  1.00 47.46 ? 119  CYS A O   1 
ATOM   521  C  CB  . CYS A  1  84  ? -2.344  18.177 32.564  1.00 42.91 ? 119  CYS A CB  1 
ATOM   522  S  SG  . CYS A  1  84  ? -0.679  18.836 32.292  1.00 43.13 ? 119  CYS A SG  1 
ATOM   523  N  N   . SER A  1  85  ? -5.611  19.563 32.624  1.00 47.31 ? 120  SER A N   1 
ATOM   524  C  CA  . SER A  1  85  ? -6.994  19.372 33.034  1.00 52.30 ? 120  SER A CA  1 
ATOM   525  C  C   . SER A  1  85  ? -7.864  19.021 31.837  1.00 51.49 ? 120  SER A C   1 
ATOM   526  O  O   . SER A  1  85  ? -7.529  19.335 30.692  1.00 49.85 ? 120  SER A O   1 
ATOM   527  C  CB  . SER A  1  85  ? -7.523  20.643 33.693  1.00 51.44 ? 120  SER A CB  1 
ATOM   528  O  OG  . SER A  1  85  ? -7.479  21.732 32.788  1.00 52.91 ? 120  SER A OG  1 
ATOM   529  N  N   . GLU A  1  86  ? -8.995  18.383 32.120  1.00 54.28 ? 121  GLU A N   1 
ATOM   530  C  CA  . GLU A  1  86  ? -9.890  17.848 31.096  1.00 53.77 ? 121  GLU A CA  1 
ATOM   531  C  C   . GLU A  1  86  ? -10.409 18.894 30.096  1.00 51.53 ? 121  GLU A C   1 
ATOM   532  O  O   . GLU A  1  86  ? -10.728 18.560 28.954  1.00 51.86 ? 121  GLU A O   1 
ATOM   533  C  CB  . GLU A  1  86  ? -11.060 17.112 31.766  1.00 56.26 ? 121  GLU A CB  1 
ATOM   534  C  CG  . GLU A  1  86  ? -11.972 16.364 30.809  1.00 57.69 ? 121  GLU A CG  1 
ATOM   535  C  CD  . GLU A  1  86  ? -11.331 15.109 30.243  1.00 60.06 ? 121  GLU A CD  1 
ATOM   536  O  OE1 . GLU A  1  86  ? -10.488 14.496 30.937  1.00 59.31 ? 121  GLU A OE1 1 
ATOM   537  O  OE2 . GLU A  1  86  ? -11.684 14.731 29.106  1.00 58.24 ? 121  GLU A OE2 1 
ATOM   538  N  N   . ASP A  1  87  ? -10.476 20.154 30.516  1.00 51.68 ? 122  ASP A N   1 
ATOM   539  C  CA  . ASP A  1  87  ? -10.978 21.231 29.655  1.00 52.91 ? 122  ASP A CA  1 
ATOM   540  C  C   . ASP A  1  87  ? -9.897  21.966 28.844  1.00 52.98 ? 122  ASP A C   1 
ATOM   541  O  O   . ASP A  1  87  ? -10.205 22.901 28.094  1.00 51.82 ? 122  ASP A O   1 
ATOM   542  C  CB  . ASP A  1  87  ? -11.720 22.263 30.502  1.00 54.03 ? 122  ASP A CB  1 
ATOM   543  C  CG  . ASP A  1  87  ? -10.830 22.874 31.562  1.00 57.38 ? 122  ASP A CG  1 
ATOM   544  O  OD1 . ASP A  1  87  ? -9.630  22.522 31.581  1.00 56.45 ? 122  ASP A OD1 1 
ATOM   545  O  OD2 . ASP A  1  87  ? -11.316 23.692 32.372  1.00 59.00 ? 122  ASP A OD2 1 
ATOM   546  N  N   . CYS A  1  88  ? -8.635  21.570 28.998  1.00 52.76 ? 123  CYS A N   1 
ATOM   547  C  CA  . CYS A  1  88  ? -7.554  22.342 28.393  1.00 46.98 ? 123  CYS A CA  1 
ATOM   548  C  C   . CYS A  1  88  ? -7.687  22.438 26.876  1.00 48.49 ? 123  CYS A C   1 
ATOM   549  O  O   . CYS A  1  88  ? -7.363  23.466 26.280  1.00 48.53 ? 123  CYS A O   1 
ATOM   550  C  CB  . CYS A  1  88  ? -6.166  21.825 28.814  1.00 45.20 ? 123  CYS A CB  1 
ATOM   551  S  SG  . CYS A  1  88  ? -5.654  20.207 28.161  1.00 40.87 ? 123  CYS A SG  1 
ATOM   552  N  N   . LEU A  1  89  ? -8.188  21.374 26.261  1.00 49.08 ? 124  LEU A N   1 
ATOM   553  C  CA  . LEU A  1  89  ? -8.304  21.302 24.808  1.00 50.90 ? 124  LEU A CA  1 
ATOM   554  C  C   . LEU A  1  89  ? -9.187  22.409 24.240  1.00 52.47 ? 124  LEU A C   1 
ATOM   555  O  O   . LEU A  1  89  ? -8.731  23.226 23.449  1.00 54.75 ? 124  LEU A O   1 
ATOM   556  C  CB  . LEU A  1  89  ? -8.832  19.931 24.387  1.00 51.13 ? 124  LEU A CB  1 
ATOM   557  C  CG  . LEU A  1  89  ? -8.159  19.272 23.179  1.00 54.37 ? 124  LEU A CG  1 
ATOM   558  C  CD1 . LEU A  1  89  ? -6.647  19.152 23.381  1.00 49.23 ? 124  LEU A CD1 1 
ATOM   559  C  CD2 . LEU A  1  89  ? -8.766  17.901 22.900  1.00 54.82 ? 124  LEU A CD2 1 
ATOM   560  N  N   . SER A  1  90  ? -10.450 22.443 24.647  1.00 56.21 ? 125  SER A N   1 
ATOM   561  C  CA  . SER A  1  90  ? -11.367 23.461 24.140  1.00 57.62 ? 125  SER A CA  1 
ATOM   562  C  C   . SER A  1  90  ? -10.918 24.877 24.526  1.00 58.21 ? 125  SER A C   1 
ATOM   563  O  O   . SER A  1  90  ? -11.261 25.850 23.849  1.00 61.94 ? 125  SER A O   1 
ATOM   564  C  CB  . SER A  1  90  ? -12.811 23.184 24.582  1.00 58.98 ? 125  SER A CB  1 
ATOM   565  O  OG  . SER A  1  90  ? -12.877 22.794 25.942  1.00 58.23 ? 125  SER A OG  1 
ATOM   566  N  N   . ARG A  1  91  ? -10.135 24.989 25.597  1.00 55.79 ? 126  ARG A N   1 
ATOM   567  C  CA  . ARG A  1  91  ? -9.567  26.281 25.989  1.00 55.21 ? 126  ARG A CA  1 
ATOM   568  C  C   . ARG A  1  91  ? -8.272  26.593 25.245  1.00 52.07 ? 126  ARG A C   1 
ATOM   569  O  O   . ARG A  1  91  ? -7.774  27.718 25.293  1.00 51.05 ? 126  ARG A O   1 
ATOM   570  C  CB  . ARG A  1  91  ? -9.327  26.331 27.494  1.00 53.06 ? 126  ARG A CB  1 
ATOM   571  C  CG  . ARG A  1  91  ? -10.596 26.176 28.303  1.00 55.53 ? 126  ARG A CG  1 
ATOM   572  C  CD  . ARG A  1  91  ? -10.268 26.059 29.764  1.00 58.34 ? 126  ARG A CD  1 
ATOM   573  N  NE  . ARG A  1  91  ? -9.656  27.285 30.262  1.00 62.47 ? 126  ARG A NE  1 
ATOM   574  C  CZ  . ARG A  1  91  ? -10.241 28.109 31.125  1.00 63.21 ? 126  ARG A CZ  1 
ATOM   575  N  NH1 . ARG A  1  91  ? -11.453 27.825 31.592  1.00 61.10 ? 126  ARG A NH1 1 
ATOM   576  N  NH2 . ARG A  1  91  ? -9.610  29.205 31.527  1.00 60.94 ? 126  ARG A NH2 1 
ATOM   577  N  N   . GLY A  1  92  ? -7.728  25.585 24.574  1.00 50.47 ? 127  GLY A N   1 
ATOM   578  C  CA  . GLY A  1  92  ? -6.546  25.754 23.747  1.00 51.36 ? 127  GLY A CA  1 
ATOM   579  C  C   . GLY A  1  92  ? -5.233  26.003 24.476  1.00 48.18 ? 127  GLY A C   1 
ATOM   580  O  O   . GLY A  1  92  ? -4.313  26.585 23.896  1.00 49.10 ? 127  GLY A O   1 
ATOM   581  N  N   . ASP A  1  93  ? -5.124  25.548 25.724  1.00 43.92 ? 128  ASP A N   1 
ATOM   582  C  CA  . ASP A  1  93  ? -3.926  25.819 26.517  1.00 43.60 ? 128  ASP A CA  1 
ATOM   583  C  C   . ASP A  1  93  ? -3.369  24.599 27.255  1.00 36.18 ? 128  ASP A C   1 
ATOM   584  O  O   . ASP A  1  93  ? -2.780  24.741 28.323  1.00 37.68 ? 128  ASP A O   1 
ATOM   585  C  CB  . ASP A  1  93  ? -4.193  26.944 27.518  1.00 46.49 ? 128  ASP A CB  1 
ATOM   586  C  CG  . ASP A  1  93  ? -5.262  26.575 28.533  1.00 49.10 ? 128  ASP A CG  1 
ATOM   587  O  OD1 . ASP A  1  93  ? -5.846  25.473 28.398  1.00 46.34 ? 128  ASP A OD1 1 
ATOM   588  O  OD2 . ASP A  1  93  ? -5.517  27.384 29.460  1.00 48.99 ? 128  ASP A OD2 1 
ATOM   589  N  N   . CYS A  1  94  ? -3.556  23.414 26.681  1.00 35.42 ? 129  CYS A N   1 
ATOM   590  C  CA  . CYS A  1  94  ? -2.896  22.215 27.178  1.00 35.08 ? 129  CYS A CA  1 
ATOM   591  C  C   . CYS A  1  94  ? -1.390  22.350 26.988  1.00 35.47 ? 129  CYS A C   1 
ATOM   592  O  O   . CYS A  1  94  ? -0.942  23.027 26.064  1.00 34.41 ? 129  CYS A O   1 
ATOM   593  C  CB  . CYS A  1  94  ? -3.332  20.990 26.379  1.00 37.99 ? 129  CYS A CB  1 
ATOM   594  S  SG  . CYS A  1  94  ? -5.106  20.659 26.248  1.00 44.71 ? 129  CYS A SG  1 
ATOM   595  N  N   . CYS A  1  95  ? -0.612  21.685 27.840  1.00 34.05 ? 130  CYS A N   1 
ATOM   596  C  CA  . CYS A  1  95  ? 0.799   21.438 27.523  1.00 30.20 ? 130  CYS A CA  1 
ATOM   597  C  C   . CYS A  1  95  ? 0.811   20.620 26.241  1.00 33.08 ? 130  CYS A C   1 
ATOM   598  O  O   . CYS A  1  95  ? -0.110  19.842 25.989  1.00 30.92 ? 130  CYS A O   1 
ATOM   599  C  CB  . CYS A  1  95  ? 1.490   20.679 28.657  1.00 33.33 ? 130  CYS A CB  1 
ATOM   600  S  SG  . CYS A  1  95  ? 1.450   21.525 30.239  1.00 35.50 ? 130  CYS A SG  1 
ATOM   601  N  N   . THR A  1  96  ? 1.826   20.804 25.398  1.00 30.78 ? 131  THR A N   1 
ATOM   602  C  CA  . THR A  1  96  ? 1.803   20.167 24.085  1.00 29.95 ? 131  THR A CA  1 
ATOM   603  C  C   . THR A  1  96  ? 1.815   18.643 24.135  1.00 29.34 ? 131  THR A C   1 
ATOM   604  O  O   . THR A  1  96  ? 1.449   17.999 23.160  1.00 32.27 ? 131  THR A O   1 
ATOM   605  C  CB  . THR A  1  96  ? 2.972   20.636 23.164  1.00 25.94 ? 131  THR A CB  1 
ATOM   606  O  OG1 . THR A  1  96  ? 4.228   20.267 23.754  1.00 27.50 ? 131  THR A OG1 1 
ATOM   607  C  CG2 . THR A  1  96  ? 2.927   22.152 23.010  1.00 26.71 ? 131  THR A CG2 1 
ATOM   608  N  N   . ASN A  1  97  ? 2.253   18.075 25.253  1.00 31.61 ? 132  ASN A N   1 
ATOM   609  C  CA  . ASN A  1  97  ? 2.367   16.623 25.346  1.00 33.80 ? 132  ASN A CA  1 
ATOM   610  C  C   . ASN A  1  97  ? 1.170   16.019 26.071  1.00 37.98 ? 132  ASN A C   1 
ATOM   611  O  O   . ASN A  1  97  ? 1.183   14.840 26.441  1.00 36.67 ? 132  ASN A O   1 
ATOM   612  C  CB  . ASN A  1  97  ? 3.661   16.213 26.052  1.00 34.48 ? 132  ASN A CB  1 
ATOM   613  C  CG  . ASN A  1  97  ? 3.612   16.473 27.535  1.00 35.63 ? 132  ASN A CG  1 
ATOM   614  O  OD1 . ASN A  1  97  ? 2.861   17.332 27.992  1.00 34.92 ? 132  ASN A OD1 1 
ATOM   615  N  ND2 . ASN A  1  97  ? 4.416   15.743 28.300  1.00 36.25 ? 132  ASN A ND2 1 
ATOM   616  N  N   . TYR A  1  98  ? 0.137   16.833 26.268  1.00 33.80 ? 133  TYR A N   1 
ATOM   617  C  CA  . TYR A  1  98  ? -1.016  16.416 27.066  1.00 36.80 ? 133  TYR A CA  1 
ATOM   618  C  C   . TYR A  1  98  ? -1.630  15.098 26.603  1.00 38.78 ? 133  TYR A C   1 
ATOM   619  O  O   . TYR A  1  98  ? -1.788  14.167 27.389  1.00 40.87 ? 133  TYR A O   1 
ATOM   620  C  CB  . TYR A  1  98  ? -2.063  17.526 27.108  1.00 36.01 ? 133  TYR A CB  1 
ATOM   621  C  CG  . TYR A  1  98  ? -3.409  17.075 27.632  1.00 37.77 ? 133  TYR A CG  1 
ATOM   622  C  CD1 . TYR A  1  98  ? -3.573  16.686 28.956  1.00 41.61 ? 133  TYR A CD1 1 
ATOM   623  C  CD2 . TYR A  1  98  ? -4.511  17.044 26.798  1.00 38.90 ? 133  TYR A CD2 1 
ATOM   624  C  CE1 . TYR A  1  98  ? -4.820  16.274 29.429  1.00 43.39 ? 133  TYR A CE1 1 
ATOM   625  C  CE2 . TYR A  1  98  ? -5.747  16.638 27.252  1.00 44.57 ? 133  TYR A CE2 1 
ATOM   626  C  CZ  . TYR A  1  98  ? -5.902  16.256 28.564  1.00 45.97 ? 133  TYR A CZ  1 
ATOM   627  O  OH  . TYR A  1  98  ? -7.150  15.848 28.989  1.00 50.80 ? 133  TYR A OH  1 
ATOM   628  N  N   . GLN A  1  99  ? -1.956  15.005 25.325  1.00 39.65 ? 134  GLN A N   1 
ATOM   629  C  CA  . GLN A  1  99  ? -2.594  13.806 24.817  1.00 37.98 ? 134  GLN A CA  1 
ATOM   630  C  C   . GLN A  1  99  ? -1.698  12.582 24.869  1.00 42.57 ? 134  GLN A C   1 
ATOM   631  O  O   . GLN A  1  99  ? -2.173  11.484 25.138  1.00 41.89 ? 134  GLN A O   1 
ATOM   632  C  CB  . GLN A  1  99  ? -3.126  14.020 23.406  1.00 41.83 ? 134  GLN A CB  1 
ATOM   633  C  CG  . GLN A  1  99  ? -4.305  14.953 23.372  1.00 42.94 ? 134  GLN A CG  1 
ATOM   634  C  CD  . GLN A  1  99  ? -4.920  15.041 22.005  1.00 48.06 ? 134  GLN A CD  1 
ATOM   635  O  OE1 . GLN A  1  99  ? -6.067  15.465 21.856  1.00 50.54 ? 134  GLN A OE1 1 
ATOM   636  N  NE2 . GLN A  1  99  ? -4.163  14.629 20.988  1.00 47.94 ? 134  GLN A NE2 1 
ATOM   637  N  N   . VAL A  1  100 ? -0.404  12.755 24.614  1.00 40.06 ? 135  VAL A N   1 
ATOM   638  C  CA  . VAL A  1  100 ? 0.485   11.603 24.663  1.00 41.65 ? 135  VAL A CA  1 
ATOM   639  C  C   . VAL A  1  100 ? 0.486   11.032 26.076  1.00 42.29 ? 135  VAL A C   1 
ATOM   640  O  O   . VAL A  1  100 ? 0.344   9.824  26.276  1.00 43.47 ? 135  VAL A O   1 
ATOM   641  C  CB  . VAL A  1  100 ? 1.937   11.943 24.225  1.00 36.83 ? 135  VAL A CB  1 
ATOM   642  C  CG1 . VAL A  1  100 ? 2.839   10.697 24.349  1.00 36.20 ? 135  VAL A CG1 1 
ATOM   643  C  CG2 . VAL A  1  100 ? 1.952   12.475 22.811  1.00 36.73 ? 135  VAL A CG2 1 
ATOM   644  N  N   . VAL A  1  101 ? 0.621   11.914 27.056  1.00 40.11 ? 136  VAL A N   1 
ATOM   645  C  CA  . VAL A  1  101 ? 0.763   11.487 28.435  1.00 42.78 ? 136  VAL A CA  1 
ATOM   646  C  C   . VAL A  1  101 ? -0.573  11.098 29.064  1.00 46.68 ? 136  VAL A C   1 
ATOM   647  O  O   . VAL A  1  101 ? -0.656  10.099 29.779  1.00 46.22 ? 136  VAL A O   1 
ATOM   648  C  CB  . VAL A  1  101 ? 1.450   12.572 29.279  1.00 42.52 ? 136  VAL A CB  1 
ATOM   649  C  CG1 . VAL A  1  101 ? 1.105   12.414 30.769  1.00 43.97 ? 136  VAL A CG1 1 
ATOM   650  C  CG2 . VAL A  1  101 ? 2.964   12.543 29.042  1.00 38.43 ? 136  VAL A CG2 1 
ATOM   651  N  N   . CYS A  1  102 ? -1.614  11.871 28.764  1.00 45.46 ? 137  CYS A N   1 
ATOM   652  C  CA  . CYS A  1  102 ? -2.900  11.750 29.442  1.00 44.40 ? 137  CYS A CA  1 
ATOM   653  C  C   . CYS A  1  102 ? -3.955  10.959 28.674  1.00 48.07 ? 137  CYS A C   1 
ATOM   654  O  O   . CYS A  1  102 ? -4.922  10.479 29.271  1.00 49.44 ? 137  CYS A O   1 
ATOM   655  C  CB  . CYS A  1  102 ? -3.454  13.143 29.779  1.00 42.01 ? 137  CYS A CB  1 
ATOM   656  S  SG  . CYS A  1  102 ? -2.497  14.032 31.031  1.00 46.88 ? 137  CYS A SG  1 
ATOM   657  N  N   . LYS A  1  103 ? -3.784  10.819 27.362  1.00 43.68 ? 138  LYS A N   1 
ATOM   658  C  CA  . LYS A  1  103 ? -4.803  10.175 26.539  1.00 43.07 ? 138  LYS A CA  1 
ATOM   659  C  C   . LYS A  1  103 ? -4.270  9.067  25.641  1.00 43.60 ? 138  LYS A C   1 
ATOM   660  O  O   . LYS A  1  103 ? -4.967  8.620  24.732  1.00 45.99 ? 138  LYS A O   1 
ATOM   661  C  CB  . LYS A  1  103 ? -5.537  11.203 25.676  1.00 43.13 ? 138  LYS A CB  1 
ATOM   662  C  CG  . LYS A  1  103 ? -6.250  12.290 26.457  1.00 48.00 ? 138  LYS A CG  1 
ATOM   663  C  CD  . LYS A  1  103 ? -7.401  11.744 27.296  1.00 48.40 ? 138  LYS A CD  1 
ATOM   664  C  CE  . LYS A  1  103 ? -7.908  12.818 28.250  1.00 52.86 ? 138  LYS A CE  1 
ATOM   665  N  NZ  . LYS A  1  103 ? -8.925  12.295 29.213  1.00 58.73 ? 138  LYS A NZ  1 
ATOM   666  N  N   . GLY A  1  104 ? -3.034  8.639  25.875  1.00 46.08 ? 139  GLY A N   1 
ATOM   667  C  CA  . GLY A  1  104 ? -2.459  7.536  25.120  1.00 44.64 ? 139  GLY A CA  1 
ATOM   668  C  C   . GLY A  1  104 ? -2.098  7.799  23.662  1.00 47.10 ? 139  GLY A C   1 
ATOM   669  O  O   . GLY A  1  104 ? -1.825  6.864  22.910  1.00 46.65 ? 139  GLY A O   1 
ATOM   670  N  N   . GLU A  1  105 ? -2.076  9.061  23.255  1.00 45.98 ? 140  GLU A N   1 
ATOM   671  C  CA  . GLU A  1  105 ? -1.696  9.387  21.881  1.00 45.29 ? 140  GLU A CA  1 
ATOM   672  C  C   . GLU A  1  105 ? -0.195  9.242  21.628  1.00 40.51 ? 140  GLU A C   1 
ATOM   673  O  O   . GLU A  1  105 ? 0.596   9.093  22.556  1.00 41.21 ? 140  GLU A O   1 
ATOM   674  C  CB  . GLU A  1  105 ? -2.157  10.794 21.514  1.00 44.98 ? 140  GLU A CB  1 
ATOM   675  C  CG  . GLU A  1  105 ? -3.411  10.814 20.683  1.00 45.36 ? 140  GLU A CG  1 
ATOM   676  C  CD  . GLU A  1  105 ? -3.213  10.196 19.306  1.00 54.08 ? 140  GLU A CD  1 
ATOM   677  O  OE1 . GLU A  1  105 ? -2.073  9.759  18.984  1.00 47.09 ? 140  GLU A OE1 1 
ATOM   678  O  OE2 . GLU A  1  105 ? -4.206  10.154 18.541  1.00 52.75 ? 140  GLU A OE2 1 
ATOM   679  N  N   . SER A  1  106 ? 0.190   9.277  20.360  1.00 39.70 ? 141  SER A N   1 
ATOM   680  C  CA  . SER A  1  106 ? 1.601   9.213  19.992  1.00 39.74 ? 141  SER A CA  1 
ATOM   681  C  C   . SER A  1  106 ? 2.147   10.617 19.695  1.00 37.28 ? 141  SER A C   1 
ATOM   682  O  O   . SER A  1  106 ? 1.418   11.475 19.195  1.00 36.22 ? 141  SER A O   1 
ATOM   683  C  CB  . SER A  1  106 ? 1.772   8.327  18.767  1.00 36.95 ? 141  SER A CB  1 
ATOM   684  O  OG  . SER A  1  106 ? 0.876   8.714  17.740  1.00 40.84 ? 141  SER A OG  1 
ATOM   685  N  N   . HIS A  1  107 ? 3.415   10.851 20.020  1.00 35.09 ? 142  HIS A N   1 
ATOM   686  C  CA  . HIS A  1  107 ? 4.113   12.046 19.538  1.00 33.01 ? 142  HIS A CA  1 
ATOM   687  C  C   . HIS A  1  107 ? 4.059   12.051 18.017  1.00 31.88 ? 142  HIS A C   1 
ATOM   688  O  O   . HIS A  1  107 ? 4.161   11.003 17.391  1.00 35.24 ? 142  HIS A O   1 
ATOM   689  C  CB  . HIS A  1  107 ? 5.580   12.008 19.947  1.00 30.21 ? 142  HIS A CB  1 
ATOM   690  C  CG  . HIS A  1  107 ? 5.816   12.206 21.406  1.00 32.89 ? 142  HIS A CG  1 
ATOM   691  N  ND1 . HIS A  1  107 ? 5.687   13.432 22.021  1.00 31.31 ? 142  HIS A ND1 1 
ATOM   692  C  CD2 . HIS A  1  107 ? 6.209   11.340 22.369  1.00 30.55 ? 142  HIS A CD2 1 
ATOM   693  C  CE1 . HIS A  1  107 ? 5.978   13.311 23.303  1.00 35.19 ? 142  HIS A CE1 1 
ATOM   694  N  NE2 . HIS A  1  107 ? 6.308   12.054 23.538  1.00 32.85 ? 142  HIS A NE2 1 
ATOM   695  N  N   . TRP A  1  108 ? 3.927   13.231 17.412  1.00 27.89 ? 143  TRP A N   1 
ATOM   696  C  CA  . TRP A  1  108 ? 3.912   13.343 15.960  1.00 29.46 ? 143  TRP A CA  1 
ATOM   697  C  C   . TRP A  1  108 ? 5.122   12.671 15.292  1.00 28.37 ? 143  TRP A C   1 
ATOM   698  O  O   . TRP A  1  108 ? 5.010   12.078 14.206  1.00 30.98 ? 143  TRP A O   1 
ATOM   699  C  CB  . TRP A  1  108 ? 3.845   14.828 15.567  1.00 27.39 ? 143  TRP A CB  1 
ATOM   700  C  CG  . TRP A  1  108 ? 4.009   15.105 14.122  1.00 27.30 ? 143  TRP A CG  1 
ATOM   701  C  CD1 . TRP A  1  108 ? 3.035   15.128 13.167  1.00 23.83 ? 143  TRP A CD1 1 
ATOM   702  C  CD2 . TRP A  1  108 ? 5.229   15.457 13.464  1.00 22.82 ? 143  TRP A CD2 1 
ATOM   703  N  NE1 . TRP A  1  108 ? 3.580   15.454 11.953  1.00 25.71 ? 143  TRP A NE1 1 
ATOM   704  C  CE2 . TRP A  1  108 ? 4.927   15.658 12.110  1.00 25.06 ? 143  TRP A CE2 1 
ATOM   705  C  CE3 . TRP A  1  108 ? 6.554   15.617 13.901  1.00 23.84 ? 143  TRP A CE3 1 
ATOM   706  C  CZ2 . TRP A  1  108 ? 5.893   16.021 11.176  1.00 24.91 ? 143  TRP A CZ2 1 
ATOM   707  C  CZ3 . TRP A  1  108 ? 7.518   15.961 12.970  1.00 22.40 ? 143  TRP A CZ3 1 
ATOM   708  C  CH2 . TRP A  1  108 ? 7.188   16.155 11.630  1.00 19.92 ? 143  TRP A CH2 1 
ATOM   709  N  N   . VAL A  1  109 ? 6.274   12.754 15.938  1.00 25.44 ? 144  VAL A N   1 
ATOM   710  C  CA  . VAL A  1  109 ? 7.501   12.297 15.297  1.00 29.68 ? 144  VAL A CA  1 
ATOM   711  C  C   . VAL A  1  109 ? 7.480   10.780 15.196  1.00 36.22 ? 144  VAL A C   1 
ATOM   712  O  O   . VAL A  1  109 ? 8.151   10.203 14.348  1.00 33.88 ? 144  VAL A O   1 
ATOM   713  C  CB  . VAL A  1  109 ? 8.765   12.769 16.029  1.00 30.67 ? 144  VAL A CB  1 
ATOM   714  C  CG1 . VAL A  1  109 ? 8.868   12.123 17.403  1.00 29.30 ? 144  VAL A CG1 1 
ATOM   715  C  CG2 . VAL A  1  109 ? 10.017  12.485 15.173  1.00 28.27 ? 144  VAL A CG2 1 
ATOM   716  N  N   . ASP A  1  110 ? 6.684   10.139 16.043  1.00 32.58 ? 145  ASP A N   1 
ATOM   717  C  CA  . ASP A  1  110 ? 6.643   8.677  16.057  1.00 36.35 ? 145  ASP A CA  1 
ATOM   718  C  C   . ASP A  1  110 ? 5.671   8.114  15.015  1.00 38.72 ? 145  ASP A C   1 
ATOM   719  O  O   . ASP A  1  110 ? 5.652   6.911  14.748  1.00 42.02 ? 145  ASP A O   1 
ATOM   720  C  CB  . ASP A  1  110 ? 6.373   8.176  17.485  1.00 34.60 ? 145  ASP A CB  1 
ATOM   721  C  CG  . ASP A  1  110 ? 7.573   8.394  18.404  1.00 35.35 ? 145  ASP A CG  1 
ATOM   722  O  OD1 . ASP A  1  110 ? 8.724   8.190  17.941  1.00 38.27 ? 145  ASP A OD1 1 
ATOM   723  O  OD2 . ASP A  1  110 ? 7.386   8.798  19.562  1.00 39.78 ? 145  ASP A OD2 1 
ATOM   724  N  N   . ASP A  1  111 ? 4.890   8.999  14.404  1.00 33.91 ? 146  ASP A N   1 
ATOM   725  C  CA  . ASP A  1  111 ? 3.940   8.606  13.375  1.00 37.40 ? 146  ASP A CA  1 
ATOM   726  C  C   . ASP A  1  111 ? 4.588   8.520  12.010  1.00 40.28 ? 146  ASP A C   1 
ATOM   727  O  O   . ASP A  1  111 ? 5.401   9.368  11.631  1.00 36.92 ? 146  ASP A O   1 
ATOM   728  C  CB  . ASP A  1  111 ? 2.766   9.581  13.308  1.00 36.26 ? 146  ASP A CB  1 
ATOM   729  C  CG  . ASP A  1  111 ? 1.969   9.618  14.594  1.00 37.92 ? 146  ASP A CG  1 
ATOM   730  O  OD1 . ASP A  1  111 ? 2.038   8.634  15.364  1.00 38.05 ? 146  ASP A OD1 1 
ATOM   731  O  OD2 . ASP A  1  111 ? 1.284   10.637 14.839  1.00 40.08 ? 146  ASP A OD2 1 
ATOM   732  N  N   . ASP A  1  112 ? 4.217   7.484  11.275  1.00 36.71 ? 147  ASP A N   1 
ATOM   733  C  CA  . ASP A  1  112 ? 4.655   7.317  9.904   1.00 37.64 ? 147  ASP A CA  1 
ATOM   734  C  C   . ASP A  1  112 ? 4.344   8.536  9.068   1.00 38.94 ? 147  ASP A C   1 
ATOM   735  O  O   . ASP A  1  112 ? 3.303   9.178  9.231   1.00 36.64 ? 147  ASP A O   1 
ATOM   736  C  CB  . ASP A  1  112 ? 3.935   6.134  9.270   1.00 42.31 ? 147  ASP A CB  1 
ATOM   737  C  CG  . ASP A  1  112 ? 4.536   4.807  9.664   1.00 48.64 ? 147  ASP A CG  1 
ATOM   738  O  OD1 . ASP A  1  112 ? 3.988   3.772  9.221   1.00 53.07 ? 147  ASP A OD1 1 
ATOM   739  O  OD2 . ASP A  1  112 ? 5.553   4.800  10.400  1.00 45.86 ? 147  ASP A OD2 1 
ATOM   740  N  N   . CYS A  1  113 ? 5.254   8.848  8.157   1.00 37.27 ? 148  CYS A N   1 
ATOM   741  C  CA  A CYS A  1  113 ? 4.995   9.897  7.185   0.50 35.36 ? 148  CYS A CA  1 
ATOM   742  C  CA  B CYS A  1  113 ? 5.033   9.893  7.171   0.50 35.36 ? 148  CYS A CA  1 
ATOM   743  C  C   . CYS A  1  113 ? 3.911   9.473  6.223   1.00 40.57 ? 148  CYS A C   1 
ATOM   744  O  O   . CYS A  1  113 ? 3.873   8.330  5.774   1.00 39.24 ? 148  CYS A O   1 
ATOM   745  C  CB  A CYS A  1  113 ? 6.259   10.241 6.418   0.50 35.92 ? 148  CYS A CB  1 
ATOM   746  C  CB  B CYS A  1  113 ? 6.332   10.150 6.402   0.50 35.92 ? 148  CYS A CB  1 
ATOM   747  S  SG  A CYS A  1  113 ? 7.454   11.012 7.466   0.50 37.22 ? 148  CYS A SG  1 
ATOM   748  S  SG  B CYS A  1  113 ? 6.188   11.168 4.919   0.50 33.59 ? 148  CYS A SG  1 
ATOM   749  N  N   . GLU A  1  114 ? 3.011   10.398 5.921   1.00 35.96 ? 149  GLU A N   1 
ATOM   750  C  CA  . GLU A  1  114 ? 1.959   10.139 4.961   1.00 38.22 ? 149  GLU A CA  1 
ATOM   751  C  C   . GLU A  1  114 ? 1.734   11.370 4.103   1.00 39.54 ? 149  GLU A C   1 
ATOM   752  O  O   . GLU A  1  114 ? 1.577   12.482 4.623   1.00 37.72 ? 149  GLU A O   1 
ATOM   753  C  CB  . GLU A  1  114 ? 0.657   9.775  5.674   1.00 40.74 ? 149  GLU A CB  1 
ATOM   754  C  CG  . GLU A  1  114 ? -0.483  9.533  4.707   1.00 44.35 ? 149  GLU A CG  1 
ATOM   755  C  CD  . GLU A  1  114 ? -1.831  9.383  5.396   1.00 55.02 ? 149  GLU A CD  1 
ATOM   756  O  OE1 . GLU A  1  114 ? -2.839  9.182  4.677   1.00 57.18 ? 149  GLU A OE1 1 
ATOM   757  O  OE2 . GLU A  1  114 ? -1.885  9.474  6.649   1.00 54.41 ? 149  GLU A OE2 1 
ATOM   758  N  N   . GLU A  1  115 ? 1.692   11.175 2.793   1.00 36.30 ? 150  GLU A N   1 
ATOM   759  C  CA  . GLU A  1  115 ? 1.477   12.286 1.882   1.00 36.16 ? 150  GLU A CA  1 
ATOM   760  C  C   . GLU A  1  115 ? 0.231   13.099 2.255   1.00 40.43 ? 150  GLU A C   1 
ATOM   761  O  O   . GLU A  1  115 ? -0.841  12.541 2.499   1.00 37.50 ? 150  GLU A O   1 
ATOM   762  C  CB  . GLU A  1  115 ? 1.375   11.791 0.440   1.00 38.14 ? 150  GLU A CB  1 
ATOM   763  C  CG  . GLU A  1  115 ? 1.259   12.916 -0.576  1.00 39.40 ? 150  GLU A CG  1 
ATOM   764  C  CD  . GLU A  1  115 ? 1.339   12.436 -2.010  1.00 44.84 ? 150  GLU A CD  1 
ATOM   765  O  OE1 . GLU A  1  115 ? 1.094   11.234 -2.260  1.00 47.64 ? 150  GLU A OE1 1 
ATOM   766  O  OE2 . GLU A  1  115 ? 1.648   13.268 -2.890  1.00 43.09 ? 150  GLU A OE2 1 
ATOM   767  N  N   . ILE A  1  116 ? 0.370   14.420 2.309   1.00 34.72 ? 151  ILE A N   1 
ATOM   768  C  CA  . ILE A  1  116 ? -0.788  15.280 2.537   1.00 33.79 ? 151  ILE A CA  1 
ATOM   769  C  C   . ILE A  1  116 ? -1.182  15.877 1.204   1.00 34.87 ? 151  ILE A C   1 
ATOM   770  O  O   . ILE A  1  116 ? -0.593  16.860 0.754   1.00 33.19 ? 151  ILE A O   1 
ATOM   771  C  CB  . ILE A  1  116 ? -0.483  16.426 3.539   1.00 32.40 ? 151  ILE A CB  1 
ATOM   772  C  CG1 . ILE A  1  116 ? 0.148   15.882 4.818   1.00 33.96 ? 151  ILE A CG1 1 
ATOM   773  C  CG2 . ILE A  1  116 ? -1.754  17.193 3.874   1.00 30.91 ? 151  ILE A CG2 1 
ATOM   774  C  CD1 . ILE A  1  116 ? 0.958   16.925 5.597   1.00 31.38 ? 151  ILE A CD1 1 
ATOM   775  N  N   . ARG A  1  117 ? -2.188  15.287 0.563   1.00 35.98 ? 152  ARG A N   1 
ATOM   776  C  CA  . ARG A  1  117 ? -2.497  15.623 -0.820  1.00 36.32 ? 152  ARG A CA  1 
ATOM   777  C  C   . ARG A  1  117 ? -3.380  16.875 -0.968  1.00 34.24 ? 152  ARG A C   1 
ATOM   778  O  O   . ARG A  1  117 ? -3.360  17.537 -1.993  1.00 37.32 ? 152  ARG A O   1 
ATOM   779  C  CB  . ARG A  1  117 ? -3.087  14.399 -1.544  1.00 40.73 ? 152  ARG A CB  1 
ATOM   780  C  CG  . ARG A  1  117 ? -2.432  14.123 -2.888  1.00 45.73 ? 152  ARG A CG  1 
ATOM   781  C  CD  . ARG A  1  117 ? -2.885  12.812 -3.508  1.00 49.99 ? 152  ARG A CD  1 
ATOM   782  N  NE  . ARG A  1  117 ? -2.270  11.672 -2.845  1.00 51.66 ? 152  ARG A NE  1 
ATOM   783  C  CZ  . ARG A  1  117 ? -2.886  10.910 -1.948  1.00 57.58 ? 152  ARG A CZ  1 
ATOM   784  N  NH1 . ARG A  1  117 ? -4.150  11.160 -1.628  1.00 59.04 ? 152  ARG A NH1 1 
ATOM   785  N  NH2 . ARG A  1  117 ? -2.243  9.891  -1.382  1.00 57.93 ? 152  ARG A NH2 1 
ATOM   786  N  N   . VAL A  1  118 ? -4.141  17.192 0.071   1.00 37.37 ? 153  VAL A N   1 
ATOM   787  C  CA  . VAL A  1  118 ? -4.939  18.412 0.115   1.00 35.64 ? 153  VAL A CA  1 
ATOM   788  C  C   . VAL A  1  118 ? -5.037  18.775 1.583   1.00 32.65 ? 153  VAL A C   1 
ATOM   789  O  O   . VAL A  1  118 ? -4.913  17.897 2.435   1.00 35.78 ? 153  VAL A O   1 
ATOM   790  C  CB  . VAL A  1  118 ? -6.369  18.180 -0.414  1.00 37.19 ? 153  VAL A CB  1 
ATOM   791  C  CG1 . VAL A  1  118 ? -6.350  17.761 -1.863  1.00 36.11 ? 153  VAL A CG1 1 
ATOM   792  C  CG2 . VAL A  1  118 ? -7.086  17.141 0.436   1.00 37.80 ? 153  VAL A CG2 1 
ATOM   793  N  N   . PRO A  1  119 ? -5.272  20.057 1.906   1.00 28.06 ? 154  PRO A N   1 
ATOM   794  C  CA  . PRO A  1  119 ? -5.277  20.347 3.344   1.00 33.14 ? 154  PRO A CA  1 
ATOM   795  C  C   . PRO A  1  119 ? -6.405  19.619 4.068   1.00 33.36 ? 154  PRO A C   1 
ATOM   796  O  O   . PRO A  1  119 ? -7.528  19.548 3.568   1.00 35.19 ? 154  PRO A O   1 
ATOM   797  C  CB  . PRO A  1  119 ? -5.510  21.867 3.405   1.00 30.18 ? 154  PRO A CB  1 
ATOM   798  C  CG  . PRO A  1  119 ? -5.208  22.369 2.044   1.00 32.86 ? 154  PRO A CG  1 
ATOM   799  C  CD  . PRO A  1  119 ? -5.513  21.260 1.096   1.00 31.58 ? 154  PRO A CD  1 
ATOM   800  N  N   . GLU A  1  120 ? -6.097  19.074 5.236   1.00 31.65 ? 155  GLU A N   1 
ATOM   801  C  CA  . GLU A  1  120 ? -7.118  18.478 6.084   1.00 34.12 ? 155  GLU A CA  1 
ATOM   802  C  C   . GLU A  1  120 ? -7.299  19.377 7.287   1.00 31.61 ? 155  GLU A C   1 
ATOM   803  O  O   . GLU A  1  120 ? -6.655  19.189 8.314   1.00 30.67 ? 155  GLU A O   1 
ATOM   804  C  CB  . GLU A  1  120 ? -6.706  17.081 6.535   1.00 36.82 ? 155  GLU A CB  1 
ATOM   805  C  CG  . GLU A  1  120 ? -6.550  16.100 5.398   1.00 37.87 ? 155  GLU A CG  1 
ATOM   806  C  CD  . GLU A  1  120 ? -5.968  14.770 5.855   1.00 38.83 ? 155  GLU A CD  1 
ATOM   807  O  OE1 . GLU A  1  120 ? -5.966  14.496 7.076   1.00 41.73 ? 155  GLU A OE1 1 
ATOM   808  O  OE2 . GLU A  1  120 ? -5.503  14.007 4.991   1.00 40.74 ? 155  GLU A OE2 1 
ATOM   809  N  N   . CYS A  1  121 ? -8.186  20.359 7.147   1.00 30.88 ? 156  CYS A N   1 
ATOM   810  C  CA  . CYS A  1  121 ? -8.327  21.396 8.157   1.00 31.81 ? 156  CYS A CA  1 
ATOM   811  C  C   . CYS A  1  121 ? -9.702  21.320 8.814   1.00 38.03 ? 156  CYS A C   1 
ATOM   812  O  O   . CYS A  1  121 ? -10.673 20.886 8.187   1.00 37.01 ? 156  CYS A O   1 
ATOM   813  C  CB  . CYS A  1  121 ? -8.126  22.779 7.524   1.00 34.09 ? 156  CYS A CB  1 
ATOM   814  S  SG  . CYS A  1  121 ? -6.440  23.144 6.943   1.00 35.27 ? 156  CYS A SG  1 
ATOM   815  N  N   . PRO A  1  122 ? -9.784  21.750 10.078  1.00 33.97 ? 157  PRO A N   1 
ATOM   816  C  CA  . PRO A  1  122 ? -11.027 21.708 10.844  1.00 35.77 ? 157  PRO A CA  1 
ATOM   817  C  C   . PRO A  1  122 ? -12.025 22.666 10.242  1.00 37.41 ? 157  PRO A C   1 
ATOM   818  O  O   . PRO A  1  122 ? -11.663 23.493 9.400   1.00 34.03 ? 157  PRO A O   1 
ATOM   819  C  CB  . PRO A  1  122 ? -10.608 22.209 12.228  1.00 37.48 ? 157  PRO A CB  1 
ATOM   820  C  CG  . PRO A  1  122 ? -9.109  22.084 12.254  1.00 34.47 ? 157  PRO A CG  1 
ATOM   821  C  CD  . PRO A  1  122 ? -8.681  22.328 10.858  1.00 33.37 ? 157  PRO A CD  1 
ATOM   822  N  N   . ALA A  1  123 ? -13.276 22.543 10.668  1.00 38.49 ? 158  ALA A N   1 
ATOM   823  C  CA  . ALA A  1  123 ? -14.322 23.438 10.218  1.00 43.64 ? 158  ALA A CA  1 
ATOM   824  C  C   . ALA A  1  123 ? -13.917 24.868 10.549  1.00 36.34 ? 158  ALA A C   1 
ATOM   825  O  O   . ALA A  1  123 ? -13.454 25.133 11.653  1.00 39.06 ? 158  ALA A O   1 
ATOM   826  C  CB  . ALA A  1  123 ? -15.632 23.088 10.923  1.00 46.10 ? 158  ALA A CB  1 
ATOM   827  N  N   . GLY A  1  124 ? -14.099 25.786 9.611   1.00 37.49 ? 159  GLY A N   1 
ATOM   828  C  CA  . GLY A  1  124 ? -13.799 27.180 9.884   1.00 38.26 ? 159  GLY A CA  1 
ATOM   829  C  C   . GLY A  1  124 ? -12.476 27.646 9.303   1.00 39.51 ? 159  GLY A C   1 
ATOM   830  O  O   . GLY A  1  124 ? -12.241 28.848 9.165   1.00 39.33 ? 159  GLY A O   1 
ATOM   831  N  N   . PHE A  1  125 ? -11.611 26.701 8.947   1.00 36.36 ? 160  PHE A N   1 
ATOM   832  C  CA  . PHE A  1  125 ? -10.349 27.048 8.286   1.00 38.59 ? 160  PHE A CA  1 
ATOM   833  C  C   . PHE A  1  125 ? -10.531 27.141 6.762   1.00 38.32 ? 160  PHE A C   1 
ATOM   834  O  O   . PHE A  1  125 ? -10.844 26.160 6.096   1.00 43.37 ? 160  PHE A O   1 
ATOM   835  C  CB  . PHE A  1  125 ? -9.245  26.043 8.634   1.00 33.42 ? 160  PHE A CB  1 
ATOM   836  C  CG  . PHE A  1  125 ? -8.652  26.228 10.011  1.00 36.05 ? 160  PHE A CG  1 
ATOM   837  C  CD1 . PHE A  1  125 ? -7.362  26.715 10.163  1.00 34.49 ? 160  PHE A CD1 1 
ATOM   838  C  CD2 . PHE A  1  125 ? -9.369  25.892 11.146  1.00 30.32 ? 160  PHE A CD2 1 
ATOM   839  C  CE1 . PHE A  1  125 ? -6.816  26.875 11.427  1.00 33.23 ? 160  PHE A CE1 1 
ATOM   840  C  CE2 . PHE A  1  125 ? -8.842  26.044 12.400  1.00 32.90 ? 160  PHE A CE2 1 
ATOM   841  C  CZ  . PHE A  1  125 ? -7.549  26.542 12.554  1.00 33.07 ? 160  PHE A CZ  1 
ATOM   842  N  N   . VAL A  1  126 ? -10.308 28.327 6.216   1.00 36.68 ? 161  VAL A N   1 
ATOM   843  C  CA  . VAL A  1  126 ? -10.614 28.587 4.825   1.00 39.81 ? 161  VAL A CA  1 
ATOM   844  C  C   . VAL A  1  126 ? -9.382  28.319 3.959   1.00 42.45 ? 161  VAL A C   1 
ATOM   845  O  O   . VAL A  1  126 ? -9.501  27.953 2.798   1.00 42.62 ? 161  VAL A O   1 
ATOM   846  C  CB  . VAL A  1  126 ? -11.086 30.049 4.639   1.00 42.45 ? 161  VAL A CB  1 
ATOM   847  C  CG1 . VAL A  1  126 ? -12.000 30.159 3.453   1.00 44.30 ? 161  VAL A CG1 1 
ATOM   848  C  CG2 . VAL A  1  126 ? -11.806 30.562 5.912   1.00 41.82 ? 161  VAL A CG2 1 
ATOM   849  N  N   . ARG A  1  127 ? -8.199  28.506 4.543   1.00 35.42 ? 162  ARG A N   1 
ATOM   850  C  CA  . ARG A  1  127 ? -6.931  28.247 3.866   1.00 35.18 ? 162  ARG A CA  1 
ATOM   851  C  C   . ARG A  1  127 ? -5.941  27.685 4.876   1.00 24.87 ? 162  ARG A C   1 
ATOM   852  O  O   . ARG A  1  127 ? -6.100  27.872 6.073   1.00 25.76 ? 162  ARG A O   1 
ATOM   853  C  CB  . ARG A  1  127 ? -6.362  29.539 3.270   1.00 36.52 ? 162  ARG A CB  1 
ATOM   854  N  N   . PRO A  1  128 ? -4.926  26.959 4.394   1.00 28.05 ? 163  PRO A N   1 
ATOM   855  C  CA  . PRO A  1  128 ? -3.933  26.420 5.331   1.00 25.36 ? 163  PRO A CA  1 
ATOM   856  C  C   . PRO A  1  128 ? -3.108  27.552 5.959   1.00 21.18 ? 163  PRO A C   1 
ATOM   857  O  O   . PRO A  1  128 ? -2.569  28.340 5.205   1.00 25.02 ? 163  PRO A O   1 
ATOM   858  C  CB  . PRO A  1  128 ? -3.027  25.569 4.431   1.00 26.34 ? 163  PRO A CB  1 
ATOM   859  C  CG  . PRO A  1  128 ? -3.333  26.006 2.990   1.00 31.73 ? 163  PRO A CG  1 
ATOM   860  C  CD  . PRO A  1  128 ? -4.745  26.484 3.010   1.00 27.29 ? 163  PRO A CD  1 
ATOM   861  N  N   . PRO A  1  129 ? -3.060  27.643 7.289   1.00 24.38 ? 164  PRO A N   1 
ATOM   862  C  CA  . PRO A  1  129 ? -2.175  28.646 7.907   1.00 23.96 ? 164  PRO A CA  1 
ATOM   863  C  C   . PRO A  1  129 ? -0.715  28.380 7.531   1.00 26.12 ? 164  PRO A C   1 
ATOM   864  O  O   . PRO A  1  129 ? -0.364  27.235 7.196   1.00 22.61 ? 164  PRO A O   1 
ATOM   865  C  CB  . PRO A  1  129 ? -2.357  28.400 9.402   1.00 23.77 ? 164  PRO A CB  1 
ATOM   866  C  CG  . PRO A  1  129 ? -3.731  27.749 9.519   1.00 26.61 ? 164  PRO A CG  1 
ATOM   867  C  CD  . PRO A  1  129 ? -3.841  26.895 8.291   1.00 25.92 ? 164  PRO A CD  1 
ATOM   868  N  N   . LEU A  1  130 ? 0.120   29.419 7.601   1.00 21.69 ? 165  LEU A N   1 
ATOM   869  C  CA  . LEU A  1  130 ? 1.564   29.270 7.369   1.00 21.21 ? 165  LEU A CA  1 
ATOM   870  C  C   . LEU A  1  130 ? 2.285   29.558 8.679   1.00 18.68 ? 165  LEU A C   1 
ATOM   871  O  O   . LEU A  1  130 ? 2.021   30.559 9.325   1.00 18.59 ? 165  LEU A O   1 
ATOM   872  C  CB  . LEU A  1  130 ? 2.048   30.264 6.322   1.00 19.66 ? 165  LEU A CB  1 
ATOM   873  C  CG  . LEU A  1  130 ? 3.563   30.349 6.095   1.00 20.66 ? 165  LEU A CG  1 
ATOM   874  C  CD1 . LEU A  1  130 ? 4.123   28.979 5.639   1.00 19.54 ? 165  LEU A CD1 1 
ATOM   875  C  CD2 . LEU A  1  130 ? 3.880   31.428 5.074   1.00 21.27 ? 165  LEU A CD2 1 
ATOM   876  N  N   . ILE A  1  131 ? 3.192   28.672 9.073   1.00 19.52 ? 166  ILE A N   1 
ATOM   877  C  CA  . ILE A  1  131 ? 4.007   28.896 10.261  1.00 17.41 ? 166  ILE A CA  1 
ATOM   878  C  C   . ILE A  1  131 ? 5.457   28.912 9.791   1.00 22.55 ? 166  ILE A C   1 
ATOM   879  O  O   . ILE A  1  131 ? 5.909   27.976 9.127   1.00 19.36 ? 166  ILE A O   1 
ATOM   880  C  CB  . ILE A  1  131 ? 3.816   27.787 11.298  1.00 17.26 ? 166  ILE A CB  1 
ATOM   881  C  CG1 . ILE A  1  131 ? 2.334   27.689 11.710  1.00 20.58 ? 166  ILE A CG1 1 
ATOM   882  C  CG2 . ILE A  1  131 ? 4.749   28.011 12.491  1.00 21.39 ? 166  ILE A CG2 1 
ATOM   883  C  CD1 . ILE A  1  131 ? 2.110   26.749 12.882  1.00 25.73 ? 166  ILE A CD1 1 
ATOM   884  N  N   . ILE A  1  132 ? 6.148   30.012 10.053  1.00 16.12 ? 167  ILE A N   1 
ATOM   885  C  CA  . ILE A  1  132 ? 7.553   30.129 9.670   1.00 19.98 ? 167  ILE A CA  1 
ATOM   886  C  C   . ILE A  1  132 ? 8.354   29.890 10.942  1.00 19.67 ? 167  ILE A C   1 
ATOM   887  O  O   . ILE A  1  132 ? 8.230   30.640 11.898  1.00 23.16 ? 167  ILE A O   1 
ATOM   888  C  CB  . ILE A  1  132 ? 7.855   31.540 9.094   1.00 18.83 ? 167  ILE A CB  1 
ATOM   889  C  CG1 . ILE A  1  132 ? 6.916   31.847 7.914   1.00 19.69 ? 167  ILE A CG1 1 
ATOM   890  C  CG2 . ILE A  1  132 ? 9.342   31.652 8.694   1.00 18.02 ? 167  ILE A CG2 1 
ATOM   891  C  CD1 . ILE A  1  132 ? 6.538   33.348 7.754   1.00 22.62 ? 167  ILE A CD1 1 
ATOM   892  N  N   . PHE A  1  133 ? 9.164   28.828 10.960  1.00 18.81 ? 168  PHE A N   1 
ATOM   893  C  CA  . PHE A  1  133 ? 9.977   28.467 12.114  1.00 18.33 ? 168  PHE A CA  1 
ATOM   894  C  C   . PHE A  1  133 ? 11.422  28.844 11.745  1.00 18.79 ? 168  PHE A C   1 
ATOM   895  O  O   . PHE A  1  133 ? 12.076  28.119 11.010  1.00 18.00 ? 168  PHE A O   1 
ATOM   896  C  CB  . PHE A  1  133 ? 9.861   26.937 12.368  1.00 18.13 ? 168  PHE A CB  1 
ATOM   897  C  CG  . PHE A  1  133 ? 10.373  26.485 13.699  1.00 18.06 ? 168  PHE A CG  1 
ATOM   898  C  CD1 . PHE A  1  133 ? 11.756  26.402 13.951  1.00 17.49 ? 168  PHE A CD1 1 
ATOM   899  C  CD2 . PHE A  1  133 ? 9.489   26.137 14.720  1.00 19.23 ? 168  PHE A CD2 1 
ATOM   900  C  CE1 . PHE A  1  133 ? 12.232  25.977 15.183  1.00 18.13 ? 168  PHE A CE1 1 
ATOM   901  C  CE2 . PHE A  1  133 ? 9.954   25.716 15.953  1.00 22.07 ? 168  PHE A CE2 1 
ATOM   902  C  CZ  . PHE A  1  133 ? 11.329  25.628 16.201  1.00 20.51 ? 168  PHE A CZ  1 
ATOM   903  N  N   . SER A  1  134 ? 11.904  29.996 12.209  1.00 18.92 ? 169  SER A N   1 
ATOM   904  C  CA  A SER A  1  134 ? 13.252  30.458 11.882  0.50 18.24 ? 169  SER A CA  1 
ATOM   905  C  CA  B SER A  1  134 ? 13.252  30.425 11.863  0.50 18.24 ? 169  SER A CA  1 
ATOM   906  C  C   . SER A  1  134 ? 14.253  30.057 12.961  1.00 15.59 ? 169  SER A C   1 
ATOM   907  O  O   . SER A  1  134 ? 13.990  30.191 14.150  1.00 18.40 ? 169  SER A O   1 
ATOM   908  C  CB  A SER A  1  134 ? 13.295  31.987 11.725  0.50 19.59 ? 169  SER A CB  1 
ATOM   909  C  CB  B SER A  1  134 ? 13.298  31.935 11.589  0.50 19.58 ? 169  SER A CB  1 
ATOM   910  O  OG  A SER A  1  134 ? 12.351  32.435 10.780  0.50 24.91 ? 169  SER A OG  1 
ATOM   911  O  OG  B SER A  1  134 ? 12.866  32.651 12.728  0.50 16.43 ? 169  SER A OG  1 
ATOM   912  N  N   . VAL A  1  135 ? 15.419  29.594 12.534  1.00 15.76 ? 170  VAL A N   1 
ATOM   913  C  CA  . VAL A  1  135 ? 16.460  29.249 13.454  1.00 15.91 ? 170  VAL A CA  1 
ATOM   914  C  C   . VAL A  1  135 ? 17.713  30.068 13.090  1.00 16.76 ? 170  VAL A C   1 
ATOM   915  O  O   . VAL A  1  135 ? 18.074  30.218 11.915  1.00 19.28 ? 170  VAL A O   1 
ATOM   916  C  CB  . VAL A  1  135 ? 16.745  27.726 13.399  1.00 17.56 ? 170  VAL A CB  1 
ATOM   917  C  CG1 . VAL A  1  135 ? 15.696  26.955 14.230  1.00 18.18 ? 170  VAL A CG1 1 
ATOM   918  C  CG2 . VAL A  1  135 ? 16.769  27.230 11.979  1.00 18.29 ? 170  VAL A CG2 1 
ATOM   919  N  N   . ASP A  1  136 ? 18.377  30.596 14.099  1.00 15.56 ? 171  ASP A N   1 
ATOM   920  C  CA  . ASP A  1  136 ? 19.517  31.483 13.855  1.00 15.25 ? 171  ASP A CA  1 
ATOM   921  C  C   . ASP A  1  136 ? 20.804  30.666 13.761  1.00 16.47 ? 171  ASP A C   1 
ATOM   922  O  O   . ASP A  1  136 ? 21.055  29.825 14.616  1.00 19.05 ? 171  ASP A O   1 
ATOM   923  C  CB  . ASP A  1  136 ? 19.626  32.481 15.010  1.00 18.79 ? 171  ASP A CB  1 
ATOM   924  C  CG  . ASP A  1  136 ? 20.381  33.727 14.612  1.00 19.10 ? 171  ASP A CG  1 
ATOM   925  O  OD1 . ASP A  1  136 ? 21.484  33.574 14.065  1.00 16.37 ? 171  ASP A OD1 1 
ATOM   926  O  OD2 . ASP A  1  136 ? 19.860  34.851 14.808  1.00 19.72 ? 171  ASP A OD2 1 
ATOM   927  N  N   . GLY A  1  137 ? 21.597  30.910 12.717  1.00 15.53 ? 172  GLY A N   1 
ATOM   928  C  CA  . GLY A  1  137 ? 22.925  30.310 12.601  1.00 16.17 ? 172  GLY A CA  1 
ATOM   929  C  C   . GLY A  1  137 ? 22.891  28.810 12.349  1.00 17.91 ? 172  GLY A C   1 
ATOM   930  O  O   . GLY A  1  137 ? 23.852  28.108 12.671  1.00 17.85 ? 172  GLY A O   1 
ATOM   931  N  N   . PHE A  1  138 ? 21.781  28.334 11.798  1.00 18.29 ? 173  PHE A N   1 
ATOM   932  C  CA  . PHE A  1  138 ? 21.622  26.920 11.422  1.00 19.20 ? 173  PHE A CA  1 
ATOM   933  C  C   . PHE A  1  138 ? 22.340  26.620 10.111  1.00 17.86 ? 173  PHE A C   1 
ATOM   934  O  O   . PHE A  1  138 ? 21.819  26.818 9.009   1.00 18.79 ? 173  PHE A O   1 
ATOM   935  C  CB  . PHE A  1  138 ? 20.146  26.551 11.317  1.00 18.23 ? 173  PHE A CB  1 
ATOM   936  C  CG  . PHE A  1  138 ? 19.864  25.073 11.552  1.00 20.24 ? 173  PHE A CG  1 
ATOM   937  C  CD1 . PHE A  1  138 ? 20.197  24.127 10.585  1.00 20.65 ? 173  PHE A CD1 1 
ATOM   938  C  CD2 . PHE A  1  138 ? 19.271  24.654 12.737  1.00 20.92 ? 173  PHE A CD2 1 
ATOM   939  C  CE1 . PHE A  1  138 ? 19.931  22.751 10.804  1.00 21.94 ? 173  PHE A CE1 1 
ATOM   940  C  CE2 . PHE A  1  138 ? 19.012  23.295 12.958  1.00 20.58 ? 173  PHE A CE2 1 
ATOM   941  C  CZ  . PHE A  1  138 ? 19.323  22.367 11.978  1.00 20.82 ? 173  PHE A CZ  1 
ATOM   942  N  N   . ARG A  1  139 ? 23.570  26.146 10.249  1.00 18.07 ? 174  ARG A N   1 
ATOM   943  C  CA  . ARG A  1  139 ? 24.365  25.751 9.104   1.00 20.36 ? 174  ARG A CA  1 
ATOM   944  C  C   . ARG A  1  139 ? 23.732  24.584 8.357   1.00 20.45 ? 174  ARG A C   1 
ATOM   945  O  O   . ARG A  1  139 ? 23.240  23.642 8.967   1.00 22.27 ? 174  ARG A O   1 
ATOM   946  C  CB  . ARG A  1  139 ? 25.763  25.350 9.576   1.00 22.51 ? 174  ARG A CB  1 
ATOM   947  C  CG  . ARG A  1  139 ? 26.729  25.282 8.435   1.00 25.77 ? 174  ARG A CG  1 
ATOM   948  C  CD  . ARG A  1  139 ? 28.078  24.940 8.982   1.00 27.23 ? 174  ARG A CD  1 
ATOM   949  N  NE  . ARG A  1  139 ? 28.889  24.284 7.981   1.00 26.92 ? 174  ARG A NE  1 
ATOM   950  C  CZ  . ARG A  1  139 ? 30.205  24.381 7.940   1.00 22.13 ? 174  ARG A CZ  1 
ATOM   951  N  NH1 . ARG A  1  139 ? 30.835  25.126 8.847   1.00 23.35 ? 174  ARG A NH1 1 
ATOM   952  N  NH2 . ARG A  1  139 ? 30.880  23.735 6.998   1.00 29.39 ? 174  ARG A NH2 1 
ATOM   953  N  N   . ALA A  1  140 ? 23.732  24.662 7.036   1.00 19.87 ? 175  ALA A N   1 
ATOM   954  C  CA  . ALA A  1  140 ? 23.074  23.663 6.202   1.00 19.77 ? 175  ALA A CA  1 
ATOM   955  C  C   . ALA A  1  140 ? 23.565  22.264 6.561   1.00 23.37 ? 175  ALA A C   1 
ATOM   956  O  O   . ALA A  1  140 ? 22.779  21.318 6.655   1.00 23.97 ? 175  ALA A O   1 
ATOM   957  C  CB  . ALA A  1  140 ? 23.304  23.952 4.724   1.00 20.70 ? 175  ALA A CB  1 
ATOM   958  N  N   . SER A  1  141 ? 24.865  22.140 6.800   1.00 22.44 ? 176  SER A N   1 
ATOM   959  C  CA  . SER A  1  141 ? 25.444  20.815 7.033   1.00 23.12 ? 176  SER A CA  1 
ATOM   960  C  C   . SER A  1  141 ? 25.020  20.213 8.379   1.00 25.66 ? 176  SER A C   1 
ATOM   961  O  O   . SER A  1  141 ? 25.216  19.023 8.608   1.00 30.48 ? 176  SER A O   1 
ATOM   962  C  CB  . SER A  1  141 ? 26.977  20.862 6.914   1.00 26.12 ? 176  SER A CB  1 
ATOM   963  O  OG  . SER A  1  141 ? 27.523  21.737 7.878   1.00 27.46 ? 176  SER A OG  1 
ATOM   964  N  N   . TYR A  1  142 ? 24.423  21.008 9.267   1.00 22.93 ? 177  TYR A N   1 
ATOM   965  C  CA  . TYR A  1  142 ? 23.961  20.426 10.535  1.00 24.90 ? 177  TYR A CA  1 
ATOM   966  C  C   . TYR A  1  142 ? 22.880  19.386 10.294  1.00 26.33 ? 177  TYR A C   1 
ATOM   967  O  O   . TYR A  1  142 ? 22.668  18.504 11.137  1.00 27.46 ? 177  TYR A O   1 
ATOM   968  C  CB  . TYR A  1  142 ? 23.354  21.465 11.477  1.00 19.94 ? 177  TYR A CB  1 
ATOM   969  C  CG  . TYR A  1  142 ? 24.311  22.456 12.083  1.00 21.28 ? 177  TYR A CG  1 
ATOM   970  C  CD1 . TYR A  1  142 ? 25.693  22.202 12.176  1.00 23.63 ? 177  TYR A CD1 1 
ATOM   971  C  CD2 . TYR A  1  142 ? 23.834  23.660 12.574  1.00 19.26 ? 177  TYR A CD2 1 
ATOM   972  C  CE1 . TYR A  1  142 ? 26.554  23.135 12.747  1.00 22.60 ? 177  TYR A CE1 1 
ATOM   973  C  CE2 . TYR A  1  142 ? 24.678  24.596 13.137  1.00 19.97 ? 177  TYR A CE2 1 
ATOM   974  C  CZ  . TYR A  1  142 ? 26.031  24.334 13.229  1.00 22.90 ? 177  TYR A CZ  1 
ATOM   975  O  OH  . TYR A  1  142 ? 26.829  25.281 13.809  1.00 21.24 ? 177  TYR A OH  1 
ATOM   976  N  N   . MET A  1  143 ? 22.169  19.509 9.179   1.00 24.02 ? 178  MET A N   1 
ATOM   977  C  CA  . MET A  1  143 ? 21.078  18.583 8.881   1.00 28.49 ? 178  MET A CA  1 
ATOM   978  C  C   . MET A  1  143 ? 21.594  17.165 8.747   1.00 31.17 ? 178  MET A C   1 
ATOM   979  O  O   . MET A  1  143 ? 20.856  16.196 8.964   1.00 32.73 ? 178  MET A O   1 
ATOM   980  C  CB  . MET A  1  143 ? 20.345  18.985 7.603   1.00 27.20 ? 178  MET A CB  1 
ATOM   981  C  CG  . MET A  1  143 ? 19.632  20.314 7.717   1.00 31.51 ? 178  MET A CG  1 
ATOM   982  S  SD  . MET A  1  143 ? 18.227  20.218 8.862   1.00 35.36 ? 178  MET A SD  1 
ATOM   983  C  CE  . MET A  1  143 ? 16.872  20.075 7.700   1.00 31.68 ? 178  MET A CE  1 
ATOM   984  N  N   . LYS A  1  144 ? 22.857  17.040 8.365   1.00 29.70 ? 179  LYS A N   1 
ATOM   985  C  CA  . LYS A  1  144 ? 23.471  15.721 8.237   1.00 35.17 ? 179  LYS A CA  1 
ATOM   986  C  C   . LYS A  1  144 ? 23.453  14.931 9.541   1.00 37.22 ? 179  LYS A C   1 
ATOM   987  O  O   . LYS A  1  144 ? 23.634  13.713 9.530   1.00 39.21 ? 179  LYS A O   1 
ATOM   988  C  CB  . LYS A  1  144 ? 24.891  15.825 7.670   1.00 36.86 ? 179  LYS A CB  1 
ATOM   989  C  CG  . LYS A  1  144 ? 24.922  16.364 6.239   1.00 37.55 ? 179  LYS A CG  1 
ATOM   990  C  CD  . LYS A  1  144 ? 26.179  15.936 5.484   1.00 48.99 ? 179  LYS A CD  1 
ATOM   991  C  CE  . LYS A  1  144 ? 27.439  16.579 6.063   1.00 51.96 ? 179  LYS A CE  1 
ATOM   992  N  NZ  . LYS A  1  144 ? 28.659  16.316 5.230   1.00 56.73 ? 179  LYS A NZ  1 
ATOM   993  N  N   . LYS A  1  145 ? 23.222  15.610 10.664  1.00 32.09 ? 180  LYS A N   1 
ATOM   994  C  CA  . LYS A  1  145 ? 23.139  14.929 11.955  1.00 35.16 ? 180  LYS A CA  1 
ATOM   995  C  C   . LYS A  1  145 ? 21.891  14.042 12.017  1.00 38.57 ? 180  LYS A C   1 
ATOM   996  O  O   . LYS A  1  145 ? 21.849  13.052 12.755  1.00 40.27 ? 180  LYS A O   1 
ATOM   997  C  CB  . LYS A  1  145 ? 23.178  15.941 13.102  1.00 31.69 ? 180  LYS A CB  1 
ATOM   998  C  CG  . LYS A  1  145 ? 24.481  16.773 13.107  1.00 35.50 ? 180  LYS A CG  1 
ATOM   999  C  CD  . LYS A  1  145 ? 24.540  17.705 14.313  1.00 35.22 ? 180  LYS A CD  1 
ATOM   1000 C  CE  . LYS A  1  145 ? 25.766  18.623 14.281  1.00 34.90 ? 180  LYS A CE  1 
ATOM   1001 N  NZ  . LYS A  1  145 ? 27.019  17.873 14.538  1.00 37.46 ? 180  LYS A NZ  1 
ATOM   1002 N  N   . GLY A  1  146 ? 20.879  14.396 11.235  1.00 34.35 ? 181  GLY A N   1 
ATOM   1003 C  CA  . GLY A  1  146 ? 19.755  13.502 11.005  1.00 36.45 ? 181  GLY A CA  1 
ATOM   1004 C  C   . GLY A  1  146 ? 18.957  13.168 12.247  1.00 36.08 ? 181  GLY A C   1 
ATOM   1005 O  O   . GLY A  1  146 ? 19.031  13.883 13.248  1.00 34.51 ? 181  GLY A O   1 
ATOM   1006 N  N   . SER A  1  147 ? 18.208  12.066 12.185  1.00 34.00 ? 182  SER A N   1 
ATOM   1007 C  CA  . SER A  1  147 ? 17.248  11.718 13.232  1.00 31.80 ? 182  SER A CA  1 
ATOM   1008 C  C   . SER A  1  147 ? 17.882  11.309 14.556  1.00 35.48 ? 182  SER A C   1 
ATOM   1009 O  O   . SER A  1  147 ? 17.208  11.294 15.588  1.00 35.90 ? 182  SER A O   1 
ATOM   1010 C  CB  . SER A  1  147 ? 16.263  10.647 12.741  1.00 36.38 ? 182  SER A CB  1 
ATOM   1011 O  OG  . SER A  1  147 ? 16.948  9.506  12.241  1.00 40.15 ? 182  SER A OG  1 
ATOM   1012 N  N   . LYS A  1  148 ? 19.177  11.005 14.542  1.00 36.26 ? 183  LYS A N   1 
ATOM   1013 C  CA  . LYS A  1  148 ? 19.861  10.696 15.787  1.00 34.89 ? 183  LYS A CA  1 
ATOM   1014 C  C   . LYS A  1  148 ? 19.906  11.891 16.708  1.00 35.29 ? 183  LYS A C   1 
ATOM   1015 O  O   . LYS A  1  148 ? 19.945  11.748 17.932  1.00 38.53 ? 183  LYS A O   1 
ATOM   1016 C  CB  . LYS A  1  148 ? 21.284  10.196 15.536  1.00 34.91 ? 183  LYS A CB  1 
ATOM   1017 C  CG  . LYS A  1  148 ? 21.376  8.723  15.236  1.00 35.35 ? 183  LYS A CG  1 
ATOM   1018 C  CD  . LYS A  1  148 ? 22.828  8.354  14.935  1.00 34.97 ? 183  LYS A CD  1 
ATOM   1019 C  CE  . LYS A  1  148 ? 23.022  6.847  14.867  1.00 31.68 ? 183  LYS A CE  1 
ATOM   1020 N  NZ  . LYS A  1  148 ? 24.468  6.521  15.044  1.00 33.99 ? 183  LYS A NZ  1 
ATOM   1021 N  N   . VAL A  1  149 ? 19.939  13.078 16.124  1.00 28.43 ? 184  VAL A N   1 
ATOM   1022 C  CA  . VAL A  1  149 ? 19.996  14.274 16.933  1.00 29.07 ? 184  VAL A CA  1 
ATOM   1023 C  C   . VAL A  1  149 ? 18.696  15.059 16.823  1.00 25.31 ? 184  VAL A C   1 
ATOM   1024 O  O   . VAL A  1  149 ? 18.253  15.661 17.806  1.00 26.58 ? 184  VAL A O   1 
ATOM   1025 C  CB  . VAL A  1  149 ? 21.203  15.153 16.509  1.00 29.93 ? 184  VAL A CB  1 
ATOM   1026 C  CG1 . VAL A  1  149 ? 21.330  16.358 17.399  1.00 26.04 ? 184  VAL A CG1 1 
ATOM   1027 C  CG2 . VAL A  1  149 ? 22.484  14.303 16.566  1.00 32.41 ? 184  VAL A CG2 1 
ATOM   1028 N  N   . MET A  1  150 ? 18.092  15.050 15.636  1.00 25.47 ? 185  MET A N   1 
ATOM   1029 C  CA  . MET A  1  150 ? 16.953  15.942 15.346  1.00 23.53 ? 185  MET A CA  1 
ATOM   1030 C  C   . MET A  1  150 ? 15.829  15.186 14.674  1.00 22.35 ? 185  MET A C   1 
ATOM   1031 O  O   . MET A  1  150 ? 15.534  15.375 13.503  1.00 23.39 ? 185  MET A O   1 
ATOM   1032 C  CB  . MET A  1  150 ? 17.406  17.142 14.480  1.00 22.44 ? 185  MET A CB  1 
ATOM   1033 C  CG  . MET A  1  150 ? 18.433  18.036 15.184  1.00 25.16 ? 185  MET A CG  1 
ATOM   1034 S  SD  . MET A  1  150 ? 18.962  19.419 14.140  1.00 26.45 ? 185  MET A SD  1 
ATOM   1035 C  CE  . MET A  1  150 ? 19.409  18.550 12.647  1.00 25.95 ? 185  MET A CE  1 
ATOM   1036 N  N   . PRO A  1  151 ? 15.196  14.281 15.424  1.00 21.59 ? 186  PRO A N   1 
ATOM   1037 C  CA  . PRO A  1  151 ? 14.202  13.417 14.785  1.00 26.41 ? 186  PRO A CA  1 
ATOM   1038 C  C   . PRO A  1  151 ? 12.988  14.173 14.203  1.00 24.41 ? 186  PRO A C   1 
ATOM   1039 O  O   . PRO A  1  151 ? 12.541  13.824 13.107  1.00 22.04 ? 186  PRO A O   1 
ATOM   1040 C  CB  . PRO A  1  151 ? 13.800  12.452 15.912  1.00 27.48 ? 186  PRO A CB  1 
ATOM   1041 C  CG  . PRO A  1  151 ? 14.245  13.129 17.204  1.00 27.76 ? 186  PRO A CG  1 
ATOM   1042 C  CD  . PRO A  1  151 ? 15.471  13.917 16.820  1.00 24.13 ? 186  PRO A CD  1 
ATOM   1043 N  N   . ASN A  1  152 ? 12.461  15.181 14.910  1.00 22.06 ? 187  ASN A N   1 
ATOM   1044 C  CA  . ASN A  1  152 ? 11.342  15.951 14.357  1.00 22.42 ? 187  ASN A CA  1 
ATOM   1045 C  C   . ASN A  1  152 ? 11.707  16.691 13.082  1.00 22.66 ? 187  ASN A C   1 
ATOM   1046 O  O   . ASN A  1  152 ? 10.967  16.686 12.106  1.00 21.87 ? 187  ASN A O   1 
ATOM   1047 C  CB  . ASN A  1  152 ? 10.795  16.964 15.368  1.00 20.33 ? 187  ASN A CB  1 
ATOM   1048 C  CG  . ASN A  1  152 ? 10.036  16.300 16.513  1.00 23.04 ? 187  ASN A CG  1 
ATOM   1049 O  OD1 . ASN A  1  152 ? 8.838   16.071 16.419  1.00 24.61 ? 187  ASN A OD1 1 
ATOM   1050 N  ND2 . ASN A  1  152 ? 10.734  16.012 17.595  1.00 24.69 ? 187  ASN A ND2 1 
ATOM   1051 N  N   . ILE A  1  153 ? 12.844  17.362 13.115  1.00 19.20 ? 188  ILE A N   1 
ATOM   1052 C  CA  . ILE A  1  153 ? 13.294  18.085 11.941  1.00 19.31 ? 188  ILE A CA  1 
ATOM   1053 C  C   . ILE A  1  153 ? 13.600  17.145 10.783  1.00 21.68 ? 188  ILE A C   1 
ATOM   1054 O  O   . ILE A  1  153 ? 13.273  17.421 9.650   1.00 22.32 ? 188  ILE A O   1 
ATOM   1055 C  CB  . ILE A  1  153 ? 14.513  18.936 12.296  1.00 22.35 ? 188  ILE A CB  1 
ATOM   1056 C  CG1 . ILE A  1  153 ? 14.068  20.036 13.286  1.00 19.88 ? 188  ILE A CG1 1 
ATOM   1057 C  CG2 . ILE A  1  153 ? 15.122  19.555 11.045  1.00 23.21 ? 188  ILE A CG2 1 
ATOM   1058 C  CD1 . ILE A  1  153 ? 15.251  20.690 14.073  1.00 21.35 ? 188  ILE A CD1 1 
ATOM   1059 N  N   . GLU A  1  154 ? 14.230  16.024 11.084  1.00 23.90 ? 189  GLU A N   1 
ATOM   1060 C  CA  . GLU A  1  154 ? 14.513  15.050 10.046  1.00 22.41 ? 189  GLU A CA  1 
ATOM   1061 C  C   . GLU A  1  154 ? 13.225  14.537 9.398   1.00 22.98 ? 189  GLU A C   1 
ATOM   1062 O  O   . GLU A  1  154 ? 13.204  14.271 8.196   1.00 23.76 ? 189  GLU A O   1 
ATOM   1063 C  CB  . GLU A  1  154 ? 15.356  13.899 10.622  1.00 27.38 ? 189  GLU A CB  1 
ATOM   1064 C  CG  . GLU A  1  154 ? 15.557  12.752 9.658   1.00 26.17 ? 189  GLU A CG  1 
ATOM   1065 C  CD  . GLU A  1  154 ? 16.297  13.159 8.394   1.00 30.21 ? 189  GLU A CD  1 
ATOM   1066 O  OE1 . GLU A  1  154 ? 16.968  14.217 8.383   1.00 27.66 ? 189  GLU A OE1 1 
ATOM   1067 O  OE2 . GLU A  1  154 ? 16.205  12.419 7.404   1.00 29.74 ? 189  GLU A OE2 1 
ATOM   1068 N  N   . LYS A  1  155 ? 12.149  14.396 10.176  1.00 23.94 ? 190  LYS A N   1 
ATOM   1069 C  CA  . LYS A  1  155 ? 10.878  13.985 9.592   1.00 21.58 ? 190  LYS A CA  1 
ATOM   1070 C  C   . LYS A  1  155 ? 10.330  15.075 8.689   1.00 24.29 ? 190  LYS A C   1 
ATOM   1071 O  O   . LYS A  1  155 ? 9.897   14.810 7.580   1.00 23.91 ? 190  LYS A O   1 
ATOM   1072 C  CB  . LYS A  1  155 ? 9.825   13.638 10.653  1.00 21.81 ? 190  LYS A CB  1 
ATOM   1073 C  CG  . LYS A  1  155 ? 8.471   13.247 10.019  1.00 27.41 ? 190  LYS A CG  1 
ATOM   1074 C  CD  . LYS A  1  155 ? 7.459   12.791 11.093  1.00 29.16 ? 190  LYS A CD  1 
ATOM   1075 C  CE  . LYS A  1  155 ? 6.146   12.380 10.416  1.00 33.32 ? 190  LYS A CE  1 
ATOM   1076 N  NZ  . LYS A  1  155 ? 5.031   12.127 11.374  1.00 32.40 ? 190  LYS A NZ  1 
ATOM   1077 N  N   . LEU A  1  156 ? 10.362  16.322 9.151   1.00 23.03 ? 191  LEU A N   1 
ATOM   1078 C  CA  . LEU A  1  156 ? 9.958   17.409 8.260   1.00 21.19 ? 191  LEU A CA  1 
ATOM   1079 C  C   . LEU A  1  156 ? 10.736  17.407 6.944   1.00 19.11 ? 191  LEU A C   1 
ATOM   1080 O  O   . LEU A  1  156 ? 10.168  17.634 5.881   1.00 20.63 ? 191  LEU A O   1 
ATOM   1081 C  CB  . LEU A  1  156 ? 10.181  18.758 8.945   1.00 20.88 ? 191  LEU A CB  1 
ATOM   1082 C  CG  . LEU A  1  156 ? 9.276   19.120 10.113  1.00 18.90 ? 191  LEU A CG  1 
ATOM   1083 C  CD1 . LEU A  1  156 ? 9.723   20.468 10.616  1.00 20.17 ? 191  LEU A CD1 1 
ATOM   1084 C  CD2 . LEU A  1  156 ? 7.837   19.212 9.672   1.00 19.32 ? 191  LEU A CD2 1 
ATOM   1085 N  N   . ARG A  1  157 ? 12.052  17.206 7.052   1.00 20.44 ? 192  ARG A N   1 
ATOM   1086 C  CA  . ARG A  1  157 ? 12.967  17.250 5.918   1.00 19.12 ? 192  ARG A CA  1 
ATOM   1087 C  C   . ARG A  1  157 ? 12.759  16.103 4.957   1.00 22.23 ? 192  ARG A C   1 
ATOM   1088 O  O   . ARG A  1  157 ? 12.668  16.310 3.758   1.00 22.64 ? 192  ARG A O   1 
ATOM   1089 C  CB  . ARG A  1  157 ? 14.421  17.200 6.398   1.00 20.16 ? 192  ARG A CB  1 
ATOM   1090 C  CG  . ARG A  1  157 ? 15.424  17.511 5.277   1.00 22.56 ? 192  ARG A CG  1 
ATOM   1091 C  CD  . ARG A  1  157 ? 16.790  16.879 5.555   1.00 30.35 ? 192  ARG A CD  1 
ATOM   1092 N  NE  . ARG A  1  157 ? 16.673  15.424 5.687   1.00 27.23 ? 192  ARG A NE  1 
ATOM   1093 C  CZ  . ARG A  1  157 ? 16.539  14.568 4.668   1.00 31.32 ? 192  ARG A CZ  1 
ATOM   1094 N  NH1 . ARG A  1  157 ? 16.502  14.994 3.413   1.00 27.32 ? 192  ARG A NH1 1 
ATOM   1095 N  NH2 . ARG A  1  157 ? 16.427  13.269 4.910   1.00 27.86 ? 192  ARG A NH2 1 
ATOM   1096 N  N   . SER A  1  158 ? 12.686  14.891 5.504   1.00 24.73 ? 193  SER A N   1 
ATOM   1097 C  CA  . SER A  1  158 ? 12.578  13.721 4.641   1.00 23.55 ? 193  SER A CA  1 
ATOM   1098 C  C   . SER A  1  158 ? 11.176  13.600 4.041   1.00 25.15 ? 193  SER A C   1 
ATOM   1099 O  O   . SER A  1  158 ? 11.015  13.152 2.902   1.00 24.26 ? 193  SER A O   1 
ATOM   1100 C  CB  . SER A  1  158 ? 12.960  12.447 5.394   1.00 28.06 ? 193  SER A CB  1 
ATOM   1101 O  OG  . SER A  1  158 ? 12.069  12.209 6.451   1.00 36.11 ? 193  SER A OG  1 
ATOM   1102 N  N   . CYS A  1  159 ? 10.149  14.027 4.775   1.00 24.82 ? 194  CYS A N   1 
ATOM   1103 C  CA  A CYS A  1  159 ? 8.807   13.835 4.252   0.50 25.67 ? 194  CYS A CA  1 
ATOM   1104 C  CA  B CYS A  1  159 ? 8.757   13.851 4.332   0.50 25.66 ? 194  CYS A CA  1 
ATOM   1105 C  C   . CYS A  1  159 ? 8.256   15.010 3.473   1.00 27.40 ? 194  CYS A C   1 
ATOM   1106 O  O   . CYS A  1  159 ? 7.384   14.836 2.631   1.00 23.27 ? 194  CYS A O   1 
ATOM   1107 C  CB  A CYS A  1  159 ? 7.886   13.365 5.357   0.50 28.87 ? 194  CYS A CB  1 
ATOM   1108 C  CB  B CYS A  1  159 ? 7.832   13.642 5.541   0.50 28.66 ? 194  CYS A CB  1 
ATOM   1109 S  SG  A CYS A  1  159 ? 8.492   11.777 5.916   0.50 34.10 ? 194  CYS A SG  1 
ATOM   1110 S  SG  B CYS A  1  159 ? 6.102   13.191 5.161   0.50 33.86 ? 194  CYS A SG  1 
ATOM   1111 N  N   . GLY A  1  160 ? 8.803   16.199 3.708   1.00 24.35 ? 195  GLY A N   1 
ATOM   1112 C  CA  . GLY A  1  160 ? 8.389   17.363 2.950   1.00 22.56 ? 195  GLY A CA  1 
ATOM   1113 C  C   . GLY A  1  160 ? 9.272   17.638 1.745   1.00 26.03 ? 195  GLY A C   1 
ATOM   1114 O  O   . GLY A  1  160 ? 9.758   16.721 1.072   1.00 23.98 ? 195  GLY A O   1 
ATOM   1115 N  N   . THR A  1  161 ? 9.486   18.930 1.489   1.00 23.60 ? 196  THR A N   1 
ATOM   1116 C  CA  . THR A  1  161 ? 10.299  19.420 0.399   1.00 23.31 ? 196  THR A CA  1 
ATOM   1117 C  C   . THR A  1  161 ? 11.521  20.086 1.027   1.00 21.08 ? 196  THR A C   1 
ATOM   1118 O  O   . THR A  1  161 ? 11.378  20.920 1.926   1.00 21.58 ? 196  THR A O   1 
ATOM   1119 C  CB  . THR A  1  161 ? 9.508   20.465 -0.409  1.00 20.76 ? 196  THR A CB  1 
ATOM   1120 O  OG1 . THR A  1  161 ? 8.382   19.824 -1.030  1.00 24.98 ? 196  THR A OG1 1 
ATOM   1121 C  CG2 . THR A  1  161 ? 10.364  21.109 -1.491  1.00 23.08 ? 196  THR A CG2 1 
ATOM   1122 N  N   . HIS A  1  162 ? 12.709  19.698 0.585   1.00 22.57 ? 197  HIS A N   1 
ATOM   1123 C  CA  . HIS A  1  162 ? 13.914  20.253 1.176   1.00 20.67 ? 197  HIS A CA  1 
ATOM   1124 C  C   . HIS A  1  162 ? 14.908  20.651 0.107   1.00 24.14 ? 197  HIS A C   1 
ATOM   1125 O  O   . HIS A  1  162 ? 14.952  20.058 -0.972  1.00 22.76 ? 197  HIS A O   1 
ATOM   1126 C  CB  . HIS A  1  162 ? 14.530  19.297 2.204   1.00 21.22 ? 197  HIS A CB  1 
ATOM   1127 C  CG  . HIS A  1  162 ? 15.436  18.253 1.612   1.00 23.10 ? 197  HIS A CG  1 
ATOM   1128 N  ND1 . HIS A  1  162 ? 14.951  17.124 0.986   1.00 25.26 ? 197  HIS A ND1 1 
ATOM   1129 C  CD2 . HIS A  1  162 ? 16.790  18.157 1.568   1.00 27.43 ? 197  HIS A CD2 1 
ATOM   1130 C  CE1 . HIS A  1  162 ? 15.964  16.384 0.565   1.00 28.57 ? 197  HIS A CE1 1 
ATOM   1131 N  NE2 . HIS A  1  162 ? 17.093  16.985 0.909   1.00 27.80 ? 197  HIS A NE2 1 
ATOM   1132 N  N   . ALA A  1  163 ? 15.673  21.705 0.390   1.00 19.74 ? 198  ALA A N   1 
ATOM   1133 C  CA  . ALA A  1  163 ? 16.852  22.037 -0.411  1.00 21.56 ? 198  ALA A CA  1 
ATOM   1134 C  C   . ALA A  1  163 ? 18.086  21.508 0.329   1.00 15.56 ? 198  ALA A C   1 
ATOM   1135 O  O   . ALA A  1  163 ? 18.095  21.411 1.544   1.00 20.46 ? 198  ALA A O   1 
ATOM   1136 C  CB  . ALA A  1  163 ? 16.958  23.577 -0.601  1.00 20.31 ? 198  ALA A CB  1 
ATOM   1137 N  N   . PRO A  1  164 ? 19.145  21.175 -0.404  1.00 15.65 ? 199  PRO A N   1 
ATOM   1138 C  CA  . PRO A  1  164 ? 20.358  20.767 0.322   1.00 20.39 ? 199  PRO A CA  1 
ATOM   1139 C  C   . PRO A  1  164 ? 20.945  21.957 1.102   1.00 17.55 ? 199  PRO A C   1 
ATOM   1140 O  O   . PRO A  1  164 ? 21.618  21.779 2.124   1.00 20.38 ? 199  PRO A O   1 
ATOM   1141 C  CB  . PRO A  1  164 ? 21.313  20.330 -0.805  1.00 22.21 ? 199  PRO A CB  1 
ATOM   1142 C  CG  . PRO A  1  164 ? 20.840  21.070 -2.018  1.00 21.96 ? 199  PRO A CG  1 
ATOM   1143 C  CD  . PRO A  1  164 ? 19.322  21.171 -1.861  1.00 19.03 ? 199  PRO A CD  1 
ATOM   1144 N  N   . TYR A  1  165 ? 20.706  23.157 0.575   1.00 20.36 ? 200  TYR A N   1 
ATOM   1145 C  CA  . TYR A  1  165 ? 20.988  24.377 1.331   1.00 18.68 ? 200  TYR A CA  1 
ATOM   1146 C  C   . TYR A  1  165 ? 20.283  25.569 0.714   1.00 16.19 ? 200  TYR A C   1 
ATOM   1147 O  O   . TYR A  1  165 ? 19.809  25.506 -0.394  1.00 18.22 ? 200  TYR A O   1 
ATOM   1148 C  CB  . TYR A  1  165 ? 22.496  24.639 1.465   1.00 17.69 ? 200  TYR A CB  1 
ATOM   1149 C  CG  . TYR A  1  165 ? 23.229  24.741 0.152   1.00 22.24 ? 200  TYR A CG  1 
ATOM   1150 C  CD1 . TYR A  1  165 ? 23.368  25.951 -0.506  1.00 23.21 ? 200  TYR A CD1 1 
ATOM   1151 C  CD2 . TYR A  1  165 ? 23.790  23.602 -0.421  1.00 25.68 ? 200  TYR A CD2 1 
ATOM   1152 C  CE1 . TYR A  1  165 ? 24.073  26.014 -1.732  1.00 25.33 ? 200  TYR A CE1 1 
ATOM   1153 C  CE2 . TYR A  1  165 ? 24.487  23.652 -1.603  1.00 30.01 ? 200  TYR A CE2 1 
ATOM   1154 C  CZ  . TYR A  1  165 ? 24.629  24.854 -2.252  1.00 29.17 ? 200  TYR A CZ  1 
ATOM   1155 O  OH  . TYR A  1  165 ? 25.326  24.847 -3.441  1.00 33.11 ? 200  TYR A OH  1 
ATOM   1156 N  N   . MET A  1  166 ? 20.186  26.645 1.486   1.00 19.03 ? 201  MET A N   1 
ATOM   1157 C  CA  . MET A  1  166 ? 19.658  27.896 0.978   1.00 17.89 ? 201  MET A CA  1 
ATOM   1158 C  C   . MET A  1  166 ? 20.722  28.984 1.134   1.00 16.26 ? 201  MET A C   1 
ATOM   1159 O  O   . MET A  1  166 ? 21.414  29.033 2.142   1.00 17.12 ? 201  MET A O   1 
ATOM   1160 C  CB  . MET A  1  166 ? 18.377  28.302 1.727   1.00 18.94 ? 201  MET A CB  1 
ATOM   1161 C  CG  . MET A  1  166 ? 17.738  29.586 1.194   1.00 16.98 ? 201  MET A CG  1 
ATOM   1162 S  SD  . MET A  1  166 ? 16.284  30.043 2.206   1.00 19.24 ? 201  MET A SD  1 
ATOM   1163 C  CE  . MET A  1  166 ? 17.063  30.522 3.741   1.00 19.37 ? 201  MET A CE  1 
ATOM   1164 N  N   . ARG A  1  167 ? 20.890  29.800 0.098   1.00 15.45 ? 202  ARG A N   1 
ATOM   1165 C  CA  . ARG A  1  167 ? 21.923  30.840 0.107   1.00 17.56 ? 202  ARG A CA  1 
ATOM   1166 C  C   . ARG A  1  167 ? 21.374  32.109 0.786   1.00 17.28 ? 202  ARG A C   1 
ATOM   1167 O  O   . ARG A  1  167 ? 20.319  32.618 0.421   1.00 15.93 ? 202  ARG A O   1 
ATOM   1168 C  CB  . ARG A  1  167 ? 22.385  31.146 -1.313  1.00 17.07 ? 202  ARG A CB  1 
ATOM   1169 C  CG  . ARG A  1  167 ? 23.521  32.196 -1.436  1.00 17.79 ? 202  ARG A CG  1 
ATOM   1170 C  CD  . ARG A  1  167 ? 24.003  32.432 -2.902  1.00 17.51 ? 202  ARG A CD  1 
ATOM   1171 N  NE  . ARG A  1  167 ? 24.253  31.147 -3.546  1.00 20.93 ? 202  ARG A NE  1 
ATOM   1172 C  CZ  . ARG A  1  167 ? 23.577  30.642 -4.575  1.00 22.54 ? 202  ARG A CZ  1 
ATOM   1173 N  NH1 . ARG A  1  167 ? 22.609  31.331 -5.184  1.00 20.53 ? 202  ARG A NH1 1 
ATOM   1174 N  NH2 . ARG A  1  167 ? 23.888  29.424 -5.011  1.00 24.33 ? 202  ARG A NH2 1 
ATOM   1175 N  N   . PRO A  1  168 ? 22.096  32.604 1.784   1.00 15.93 ? 203  PRO A N   1 
ATOM   1176 C  CA  . PRO A  1  168 ? 21.719  33.844 2.480   1.00 15.26 ? 203  PRO A CA  1 
ATOM   1177 C  C   . PRO A  1  168 ? 22.150  35.066 1.666   1.00 15.37 ? 203  PRO A C   1 
ATOM   1178 O  O   . PRO A  1  168 ? 22.725  34.926 0.593   1.00 15.44 ? 203  PRO A O   1 
ATOM   1179 C  CB  . PRO A  1  168 ? 22.500  33.740 3.789   1.00 16.12 ? 203  PRO A CB  1 
ATOM   1180 C  CG  . PRO A  1  168 ? 23.788  32.993 3.365   1.00 16.15 ? 203  PRO A CG  1 
ATOM   1181 C  CD  . PRO A  1  168 ? 23.237  31.926 2.429   1.00 15.36 ? 203  PRO A CD  1 
ATOM   1182 N  N   . VAL A  1  169 ? 21.867  36.279 2.158   1.00 14.06 ? 204  VAL A N   1 
ATOM   1183 C  CA  . VAL A  1  169 ? 22.399  37.450 1.453   1.00 13.46 ? 204  VAL A CA  1 
ATOM   1184 C  C   . VAL A  1  169 ? 23.621  37.910 2.232   1.00 13.84 ? 204  VAL A C   1 
ATOM   1185 O  O   . VAL A  1  169 ? 23.775  37.566 3.398   1.00 15.42 ? 204  VAL A O   1 
ATOM   1186 C  CB  . VAL A  1  169 ? 21.445  38.658 1.415   1.00 13.86 ? 204  VAL A CB  1 
ATOM   1187 C  CG1 . VAL A  1  169 ? 20.409  38.494 0.317   1.00 16.49 ? 204  VAL A CG1 1 
ATOM   1188 C  CG2 . VAL A  1  169 ? 20.818  38.930 2.788   1.00 14.94 ? 204  VAL A CG2 1 
ATOM   1189 N  N   . TYR A  1  170 ? 24.472  38.668 1.547   1.00 13.36 ? 205  TYR A N   1 
ATOM   1190 C  CA  . TYR A  1  170 ? 25.636  39.305 2.163   1.00 13.83 ? 205  TYR A CA  1 
ATOM   1191 C  C   . TYR A  1  170 ? 25.210  40.661 2.749   1.00 14.69 ? 205  TYR A C   1 
ATOM   1192 O  O   . TYR A  1  170 ? 24.397  41.357 2.138   1.00 15.49 ? 205  TYR A O   1 
ATOM   1193 C  CB  . TYR A  1  170 ? 26.665  39.532 1.079   1.00 13.64 ? 205  TYR A CB  1 
ATOM   1194 C  CG  . TYR A  1  170 ? 27.946  40.079 1.641   1.00 16.84 ? 205  TYR A CG  1 
ATOM   1195 C  CD1 . TYR A  1  170 ? 28.255  41.432 1.528   1.00 14.46 ? 205  TYR A CD1 1 
ATOM   1196 C  CD2 . TYR A  1  170 ? 28.820  39.251 2.316   1.00 16.34 ? 205  TYR A CD2 1 
ATOM   1197 C  CE1 . TYR A  1  170 ? 29.451  41.926 2.072   1.00 14.64 ? 205  TYR A CE1 1 
ATOM   1198 C  CE2 . TYR A  1  170 ? 30.015  39.734 2.870   1.00 14.36 ? 205  TYR A CE2 1 
ATOM   1199 C  CZ  . TYR A  1  170 ? 30.301  41.075 2.752   1.00 16.06 ? 205  TYR A CZ  1 
ATOM   1200 O  OH  . TYR A  1  170 ? 31.463  41.546 3.289   1.00 14.96 ? 205  TYR A OH  1 
ATOM   1201 N  N   . PRO A  1  171 ? 25.740  41.030 3.933   1.00 13.50 ? 206  PRO A N   1 
ATOM   1202 C  CA  . PRO A  1  171 ? 26.595  40.231 4.819   1.00 15.46 ? 206  PRO A CA  1 
ATOM   1203 C  C   . PRO A  1  171 ? 25.779  39.126 5.489   1.00 13.84 ? 206  PRO A C   1 
ATOM   1204 O  O   . PRO A  1  171 ? 24.615  39.311 5.847   1.00 14.65 ? 206  PRO A O   1 
ATOM   1205 C  CB  . PRO A  1  171 ? 27.074  41.225 5.888   1.00 16.61 ? 206  PRO A CB  1 
ATOM   1206 C  CG  . PRO A  1  171 ? 26.441  42.553 5.519   1.00 21.51 ? 206  PRO A CG  1 
ATOM   1207 C  CD  . PRO A  1  171 ? 25.392  42.339 4.513   1.00 15.51 ? 206  PRO A CD  1 
ATOM   1208 N  N   . THR A  1  172 ? 26.419  37.989 5.682   1.00 13.25 ? 207  THR A N   1 
ATOM   1209 C  CA  . THR A  1  172 ? 25.735  36.826 6.252   1.00 14.03 ? 207  THR A CA  1 
ATOM   1210 C  C   . THR A  1  172 ? 25.590  36.895 7.765   1.00 16.13 ? 207  THR A C   1 
ATOM   1211 O  O   . THR A  1  172 ? 26.050  36.006 8.514   1.00 14.63 ? 207  THR A O   1 
ATOM   1212 C  CB  . THR A  1  172 ? 26.434  35.503 5.768   1.00 14.94 ? 207  THR A CB  1 
ATOM   1213 O  OG1 . THR A  1  172 ? 27.837  35.552 6.085   1.00 14.89 ? 207  THR A OG1 1 
ATOM   1214 C  CG2 . THR A  1  172 ? 26.283  35.365 4.262   1.00 16.96 ? 207  THR A CG2 1 
ATOM   1215 N  N   . LYS A  1  173 ? 24.893  37.947 8.209   1.00 15.72 ? 208  LYS A N   1 
ATOM   1216 C  CA  . LYS A  1  173 ? 24.532  38.141 9.604   1.00 18.15 ? 208  LYS A CA  1 
ATOM   1217 C  C   . LYS A  1  173 ? 23.009  38.235 9.760   1.00 15.91 ? 208  LYS A C   1 
ATOM   1218 O  O   . LYS A  1  173 ? 22.254  38.266 8.785   1.00 16.41 ? 208  LYS A O   1 
ATOM   1219 C  CB  . LYS A  1  173 ? 25.194  39.412 10.136  1.00 19.80 ? 208  LYS A CB  1 
ATOM   1220 C  CG  . LYS A  1  173 ? 26.731  39.261 10.184  1.00 18.00 ? 208  LYS A CG  1 
ATOM   1221 C  CD  . LYS A  1  173 ? 27.387  40.083 11.216  1.00 24.22 ? 208  LYS A CD  1 
ATOM   1222 C  CE  . LYS A  1  173 ? 28.888  39.816 11.221  1.00 23.06 ? 208  LYS A CE  1 
ATOM   1223 N  NZ  . LYS A  1  173 ? 29.472  40.313 12.471  1.00 26.22 ? 208  LYS A NZ  1 
ATOM   1224 N  N   . THR A  1  174 ? 22.573  38.331 11.001  1.00 16.05 ? 209  THR A N   1 
ATOM   1225 C  CA  . THR A  1  174 ? 21.155  38.082 11.316  1.00 16.49 ? 209  THR A CA  1 
ATOM   1226 C  C   . THR A  1  174 ? 20.187  39.115 10.786  1.00 16.28 ? 209  THR A C   1 
ATOM   1227 O  O   . THR A  1  174 ? 19.222  38.779 10.065  1.00 14.86 ? 209  THR A O   1 
ATOM   1228 C  CB  . THR A  1  174 ? 21.007  37.998 12.805  1.00 18.42 ? 209  THR A CB  1 
ATOM   1229 O  OG1 . THR A  1  174 ? 21.916  37.010 13.264  1.00 18.10 ? 209  THR A OG1 1 
ATOM   1230 C  CG2 . THR A  1  174 ? 19.552  37.649 13.211  1.00 20.20 ? 209  THR A CG2 1 
ATOM   1231 N  N   . PHE A  1  175 ? 20.390  40.370 11.156  1.00 16.81 ? 210  PHE A N   1 
ATOM   1232 C  CA  . PHE A  1  175 ? 19.395  41.369 10.741  1.00 17.15 ? 210  PHE A CA  1 
ATOM   1233 C  C   . PHE A  1  175 ? 19.200  41.510 9.235   1.00 14.16 ? 210  PHE A C   1 
ATOM   1234 O  O   . PHE A  1  175 ? 18.050  41.575 8.769   1.00 15.54 ? 210  PHE A O   1 
ATOM   1235 C  CB  . PHE A  1  175 ? 19.612  42.734 11.430  1.00 19.00 ? 210  PHE A CB  1 
ATOM   1236 C  CG  . PHE A  1  175 ? 18.814  42.893 12.722  1.00 24.86 ? 210  PHE A CG  1 
ATOM   1237 C  CD1 . PHE A  1  175 ? 18.439  41.784 13.458  1.00 32.69 ? 210  PHE A CD1 1 
ATOM   1238 C  CD2 . PHE A  1  175 ? 18.469  44.147 13.198  1.00 30.35 ? 210  PHE A CD2 1 
ATOM   1239 C  CE1 . PHE A  1  175 ? 17.718  41.924 14.650  1.00 39.84 ? 210  PHE A CE1 1 
ATOM   1240 C  CE2 . PHE A  1  175 ? 17.774  44.298 14.396  1.00 30.07 ? 210  PHE A CE2 1 
ATOM   1241 C  CZ  . PHE A  1  175 ? 17.387  43.190 15.113  1.00 34.04 ? 210  PHE A CZ  1 
ATOM   1242 N  N   . PRO A  1  176 ? 20.294  41.617 8.455   1.00 13.35 ? 211  PRO A N   1 
ATOM   1243 C  CA  . PRO A  1  176 ? 20.112  41.725 7.006   1.00 14.09 ? 211  PRO A CA  1 
ATOM   1244 C  C   . PRO A  1  176 ? 19.391  40.505 6.451   1.00 12.25 ? 211  PRO A C   1 
ATOM   1245 O  O   . PRO A  1  176 ? 18.570  40.652 5.567   1.00 14.47 ? 211  PRO A O   1 
ATOM   1246 C  CB  . PRO A  1  176 ? 21.546  41.815 6.482   1.00 16.36 ? 211  PRO A CB  1 
ATOM   1247 C  CG  . PRO A  1  176 ? 22.248  42.552 7.626   1.00 13.68 ? 211  PRO A CG  1 
ATOM   1248 C  CD  . PRO A  1  176 ? 21.711  41.869 8.845   1.00 15.02 ? 211  PRO A CD  1 
ATOM   1249 N  N   . ASN A  1  177 ? 19.700  39.317 6.964   1.00 11.71 ? 212  ASN A N   1 
ATOM   1250 C  CA  . ASN A  1  177 ? 19.013  38.135 6.466   1.00 13.94 ? 212  ASN A CA  1 
ATOM   1251 C  C   . ASN A  1  177 ? 17.563  37.905 6.903   1.00 14.02 ? 212  ASN A C   1 
ATOM   1252 O  O   . ASN A  1  177 ? 16.703  37.503 6.069   1.00 14.83 ? 212  ASN A O   1 
ATOM   1253 C  CB  . ASN A  1  177 ? 19.874  36.890 6.710   1.00 12.80 ? 212  ASN A CB  1 
ATOM   1254 C  CG  . ASN A  1  177 ? 20.913  36.733 5.648   1.00 14.29 ? 212  ASN A CG  1 
ATOM   1255 O  OD1 . ASN A  1  177 ? 20.618  36.195 4.572   1.00 15.33 ? 212  ASN A OD1 1 
ATOM   1256 N  ND2 . ASN A  1  177 ? 22.130  37.275 5.894   1.00 14.25 ? 212  ASN A ND2 1 
ATOM   1257 N  N   . LEU A  1  178 ? 17.268  38.118 8.175   1.00 14.13 ? 213  LEU A N   1 
ATOM   1258 C  CA  . LEU A  1  178 ? 15.862  38.021 8.553   1.00 13.32 ? 213  LEU A CA  1 
ATOM   1259 C  C   . LEU A  1  178 ? 15.035  39.034 7.783   1.00 15.16 ? 213  LEU A C   1 
ATOM   1260 O  O   . LEU A  1  178 ? 13.934  38.717 7.367   1.00 15.77 ? 213  LEU A O   1 
ATOM   1261 C  CB  . LEU A  1  178 ? 15.655  38.192 10.046  1.00 15.98 ? 213  LEU A CB  1 
ATOM   1262 C  CG  . LEU A  1  178 ? 16.328  37.157 10.951  1.00 15.41 ? 213  LEU A CG  1 
ATOM   1263 C  CD1 . LEU A  1  178 ? 16.116  37.582 12.407  1.00 17.74 ? 213  LEU A CD1 1 
ATOM   1264 C  CD2 . LEU A  1  178 ? 15.779  35.770 10.668  1.00 21.35 ? 213  LEU A CD2 1 
ATOM   1265 N  N   . TYR A  1  179 ? 15.518  40.262 7.610   1.00 13.86 ? 214  TYR A N   1 
ATOM   1266 C  CA  . TYR A  1  179 ? 14.622  41.221 6.954   1.00 14.09 ? 214  TYR A CA  1 
ATOM   1267 C  C   . TYR A  1  179 ? 14.529  40.947 5.437   1.00 16.68 ? 214  TYR A C   1 
ATOM   1268 O  O   . TYR A  1  179 ? 13.493  41.198 4.802   1.00 15.21 ? 214  TYR A O   1 
ATOM   1269 C  CB  . TYR A  1  179 ? 15.061  42.667 7.255   1.00 16.23 ? 214  TYR A CB  1 
ATOM   1270 C  CG  . TYR A  1  179 ? 13.959  43.672 7.017   1.00 15.19 ? 214  TYR A CG  1 
ATOM   1271 C  CD1 . TYR A  1  179 ? 14.170  44.795 6.225   1.00 15.84 ? 214  TYR A CD1 1 
ATOM   1272 C  CD2 . TYR A  1  179 ? 12.725  43.497 7.608   1.00 16.13 ? 214  TYR A CD2 1 
ATOM   1273 C  CE1 . TYR A  1  179 ? 13.130  45.742 5.992   1.00 15.87 ? 214  TYR A CE1 1 
ATOM   1274 C  CE2 . TYR A  1  179 ? 11.686  44.418 7.401   1.00 18.66 ? 214  TYR A CE2 1 
ATOM   1275 C  CZ  . TYR A  1  179 ? 11.899  45.529 6.607   1.00 17.38 ? 214  TYR A CZ  1 
ATOM   1276 O  OH  . TYR A  1  179 ? 10.847  46.422 6.418   1.00 17.74 ? 214  TYR A OH  1 
ATOM   1277 N  N   . THR A  1  180 ? 15.589  40.387 4.863   1.00 13.75 ? 215  THR A N   1 
ATOM   1278 C  CA  . THR A  1  180 ? 15.529  39.903 3.481   1.00 15.33 ? 215  THR A CA  1 
ATOM   1279 C  C   . THR A  1  180 ? 14.473  38.784 3.364   1.00 16.31 ? 215  THR A C   1 
ATOM   1280 O  O   . THR A  1  180 ? 13.668  38.796 2.401   1.00 16.85 ? 215  THR A O   1 
ATOM   1281 C  CB  . THR A  1  180 ? 16.919  39.424 2.974   1.00 15.36 ? 215  THR A CB  1 
ATOM   1282 O  OG1 . THR A  1  180 ? 17.691  40.559 2.592   1.00 12.71 ? 215  THR A OG1 1 
ATOM   1283 C  CG2 . THR A  1  180 ? 16.798  38.527 1.709   1.00 14.65 ? 215  THR A CG2 1 
ATOM   1284 N  N   . LEU A  1  181 ? 14.507  37.819 4.290   1.00 15.15 ? 216  LEU A N   1 
ATOM   1285 C  CA  . LEU A  1  181 ? 13.490  36.742 4.272   1.00 14.92 ? 216  LEU A CA  1 
ATOM   1286 C  C   . LEU A  1  181 ? 12.094  37.375 4.248   1.00 18.02 ? 216  LEU A C   1 
ATOM   1287 O  O   . LEU A  1  181 ? 11.231  36.983 3.468   1.00 20.67 ? 216  LEU A O   1 
ATOM   1288 C  CB  . LEU A  1  181 ? 13.621  35.813 5.471   1.00 15.94 ? 216  LEU A CB  1 
ATOM   1289 C  CG  . LEU A  1  181 ? 14.762  34.800 5.395   1.00 18.72 ? 216  LEU A CG  1 
ATOM   1290 C  CD1 . LEU A  1  181 ? 14.946  34.132 6.764   1.00 21.22 ? 216  LEU A CD1 1 
ATOM   1291 C  CD2 . LEU A  1  181 ? 14.419  33.743 4.296   1.00 20.92 ? 216  LEU A CD2 1 
ATOM   1292 N  N   . ALA A  1  182 ? 11.896  38.398 5.080   1.00 14.90 ? 217  ALA A N   1 
ATOM   1293 C  CA  . ALA A  1  182 ? 10.579  39.039 5.198   1.00 17.45 ? 217  ALA A CA  1 
ATOM   1294 C  C   . ALA A  1  182 ? 10.148  39.903 4.014   1.00 17.57 ? 217  ALA A C   1 
ATOM   1295 O  O   . ALA A  1  182 ? 8.949   40.197 3.886   1.00 16.79 ? 217  ALA A O   1 
ATOM   1296 C  CB  . ALA A  1  182 ? 10.482  39.896 6.512   1.00 17.67 ? 217  ALA A CB  1 
ATOM   1297 N  N   . THR A  1  183 ? 11.087  40.365 3.191   1.00 15.48 ? 218  THR A N   1 
ATOM   1298 C  CA  . THR A  1  183 ? 10.766  41.368 2.176   1.00 15.47 ? 218  THR A CA  1 
ATOM   1299 C  C   . THR A  1  183 ? 11.034  40.951 0.740   1.00 15.50 ? 218  THR A C   1 
ATOM   1300 O  O   . THR A  1  183 ? 10.562  41.588 -0.194  1.00 14.99 ? 218  THR A O   1 
ATOM   1301 C  CB  . THR A  1  183 ? 11.600  42.682 2.373   1.00 15.70 ? 218  THR A CB  1 
ATOM   1302 O  OG1 . THR A  1  183 ? 13.002  42.365 2.361   1.00 16.34 ? 218  THR A OG1 1 
ATOM   1303 C  CG2 . THR A  1  183 ? 11.237  43.447 3.649   1.00 13.99 ? 218  THR A CG2 1 
ATOM   1304 N  N   . GLY A  1  184 ? 11.821  39.896 0.528   1.00 14.94 ? 219  GLY A N   1 
ATOM   1305 C  CA  . GLY A  1  184 ? 12.261  39.579 -0.806  1.00 16.34 ? 219  GLY A CA  1 
ATOM   1306 C  C   . GLY A  1  184 ? 13.293  40.545 -1.366  1.00 18.07 ? 219  GLY A C   1 
ATOM   1307 O  O   . GLY A  1  184 ? 13.632  40.466 -2.557  1.00 16.22 ? 219  GLY A O   1 
ATOM   1308 N  N   . LEU A  1  185 ? 13.862  41.412 -0.519  1.00 15.87 ? 220  LEU A N   1 
ATOM   1309 C  CA  . LEU A  1  185 ? 14.769  42.445 -1.036  1.00 16.01 ? 220  LEU A CA  1 
ATOM   1310 C  C   . LEU A  1  185 ? 16.230  42.230 -0.666  1.00 15.25 ? 220  LEU A C   1 
ATOM   1311 O  O   . LEU A  1  185 ? 16.521  41.679 0.396   1.00 14.86 ? 220  LEU A O   1 
ATOM   1312 C  CB  . LEU A  1  185 ? 14.376  43.817 -0.485  1.00 14.03 ? 220  LEU A CB  1 
ATOM   1313 C  CG  . LEU A  1  185 ? 13.015  44.278 -1.033  1.00 14.30 ? 220  LEU A CG  1 
ATOM   1314 C  CD1 . LEU A  1  185 ? 12.599  45.506 -0.205  1.00 17.26 ? 220  LEU A CD1 1 
ATOM   1315 C  CD2 . LEU A  1  185 ? 13.103  44.647 -2.493  1.00 16.95 ? 220  LEU A CD2 1 
ATOM   1316 N  N   . TYR A  1  186 ? 17.124  42.679 -1.534  1.00 14.43 ? 221  TYR A N   1 
ATOM   1317 C  CA  . TYR A  1  186 ? 18.540  42.812 -1.116  1.00 15.14 ? 221  TYR A CA  1 
ATOM   1318 C  C   . TYR A  1  186 ? 18.634  43.843 0.015   1.00 14.08 ? 221  TYR A C   1 
ATOM   1319 O  O   . TYR A  1  186 ? 17.871  44.820 0.038   1.00 17.40 ? 221  TYR A O   1 
ATOM   1320 C  CB  . TYR A  1  186 ? 19.415  43.286 -2.261  1.00 14.16 ? 221  TYR A CB  1 
ATOM   1321 C  CG  . TYR A  1  186 ? 19.420  42.350 -3.440  1.00 15.84 ? 221  TYR A CG  1 
ATOM   1322 C  CD1 . TYR A  1  186 ? 19.863  41.033 -3.301  1.00 14.45 ? 221  TYR A CD1 1 
ATOM   1323 C  CD2 . TYR A  1  186 ? 18.963  42.772 -4.661  1.00 14.82 ? 221  TYR A CD2 1 
ATOM   1324 C  CE1 . TYR A  1  186 ? 19.882  40.159 -4.390  1.00 15.20 ? 221  TYR A CE1 1 
ATOM   1325 C  CE2 . TYR A  1  186 ? 18.957  41.893 -5.783  1.00 18.48 ? 221  TYR A CE2 1 
ATOM   1326 C  CZ  . TYR A  1  186 ? 19.415  40.594 -5.617  1.00 17.17 ? 221  TYR A CZ  1 
ATOM   1327 O  OH  . TYR A  1  186 ? 19.406  39.721 -6.678  1.00 17.11 ? 221  TYR A OH  1 
ATOM   1328 N  N   . PRO A  1  187 ? 19.599  43.662 0.941   1.00 13.24 ? 222  PRO A N   1 
ATOM   1329 C  CA  . PRO A  1  187 ? 19.838  44.676 1.987   1.00 13.40 ? 222  PRO A CA  1 
ATOM   1330 C  C   . PRO A  1  187 ? 20.019  46.097 1.440   1.00 12.91 ? 222  PRO A C   1 
ATOM   1331 O  O   . PRO A  1  187 ? 19.518  47.020 2.097   1.00 16.40 ? 222  PRO A O   1 
ATOM   1332 C  CB  . PRO A  1  187 ? 21.114  44.174 2.707   1.00 13.55 ? 222  PRO A CB  1 
ATOM   1333 C  CG  . PRO A  1  187 ? 21.034  42.608 2.503   1.00 13.57 ? 222  PRO A CG  1 
ATOM   1334 C  CD  . PRO A  1  187 ? 20.310  42.381 1.184   1.00 11.62 ? 222  PRO A CD  1 
ATOM   1335 N  N   . GLU A  1  188 ? 20.655  46.270 0.284   1.00 13.57 ? 223  GLU A N   1 
ATOM   1336 C  CA  . GLU A  1  188 ? 20.916  47.626 -0.231  1.00 15.57 ? 223  GLU A CA  1 
ATOM   1337 C  C   . GLU A  1  188 ? 19.583  48.298 -0.553  1.00 17.59 ? 223  GLU A C   1 
ATOM   1338 O  O   . GLU A  1  188 ? 19.490  49.530 -0.563  1.00 16.45 ? 223  GLU A O   1 
ATOM   1339 C  CB  . GLU A  1  188 ? 21.821  47.614 -1.486  1.00 14.57 ? 223  GLU A CB  1 
ATOM   1340 C  CG  . GLU A  1  188 ? 21.160  46.888 -2.657  1.00 14.86 ? 223  GLU A CG  1 
ATOM   1341 C  CD  . GLU A  1  188 ? 21.981  46.918 -3.929  1.00 16.01 ? 223  GLU A CD  1 
ATOM   1342 O  OE1 . GLU A  1  188 ? 23.117  47.450 -3.921  1.00 18.11 ? 223  GLU A OE1 1 
ATOM   1343 O  OE2 . GLU A  1  188 ? 21.470  46.410 -4.937  1.00 18.68 ? 223  GLU A OE2 1 
ATOM   1344 N  N   . SER A  1  189 ? 18.556  47.479 -0.791  1.00 14.16 ? 224  SER A N   1 
ATOM   1345 C  CA  . SER A  1  189 ? 17.227  47.977 -1.062  1.00 15.24 ? 224  SER A CA  1 
ATOM   1346 C  C   . SER A  1  189 ? 16.353  48.089 0.178   1.00 18.18 ? 224  SER A C   1 
ATOM   1347 O  O   . SER A  1  189 ? 15.715  49.108 0.354   1.00 21.21 ? 224  SER A O   1 
ATOM   1348 C  CB  . SER A  1  189 ? 16.534  47.133 -2.147  1.00 15.19 ? 224  SER A CB  1 
ATOM   1349 O  OG  . SER A  1  189 ? 17.063  47.412 -3.419  1.00 16.73 ? 224  SER A OG  1 
ATOM   1350 N  N   . HIS A  1  190 ? 16.316  47.079 1.057   1.00 14.12 ? 225  HIS A N   1 
ATOM   1351 C  CA  . HIS A  1  190 ? 15.507  47.221 2.258   1.00 14.83 ? 225  HIS A CA  1 
ATOM   1352 C  C   . HIS A  1  190 ? 16.087  48.110 3.361   1.00 17.42 ? 225  HIS A C   1 
ATOM   1353 O  O   . HIS A  1  190 ? 15.356  48.538 4.281   1.00 19.51 ? 225  HIS A O   1 
ATOM   1354 C  CB  . HIS A  1  190 ? 15.035  45.869 2.836   1.00 16.07 ? 225  HIS A CB  1 
ATOM   1355 C  CG  . HIS A  1  190 ? 16.115  44.933 3.287   1.00 14.78 ? 225  HIS A CG  1 
ATOM   1356 N  ND1 . HIS A  1  190 ? 17.010  45.239 4.288   1.00 14.91 ? 225  HIS A ND1 1 
ATOM   1357 C  CD2 . HIS A  1  190 ? 16.322  43.627 2.987   1.00 17.13 ? 225  HIS A CD2 1 
ATOM   1358 C  CE1 . HIS A  1  190 ? 17.750  44.174 4.561   1.00 15.05 ? 225  HIS A CE1 1 
ATOM   1359 N  NE2 . HIS A  1  190 ? 17.351  43.181 3.787   1.00 17.20 ? 225  HIS A NE2 1 
ATOM   1360 N  N   . GLY A  1  191 ? 17.401  48.340 3.277   1.00 15.58 ? 226  GLY A N   1 
ATOM   1361 C  CA  . GLY A  1  191 ? 18.092  49.278 4.165   1.00 17.01 ? 226  GLY A CA  1 
ATOM   1362 C  C   . GLY A  1  191 ? 18.828  48.709 5.385   1.00 15.95 ? 226  GLY A C   1 
ATOM   1363 O  O   . GLY A  1  191 ? 19.572  49.430 6.036   1.00 16.98 ? 226  GLY A O   1 
ATOM   1364 N  N   . ILE A  1  192 ? 18.564  47.457 5.749   1.00 15.50 ? 227  ILE A N   1 
ATOM   1365 C  CA  . ILE A  1  192 ? 19.197  46.858 6.926   1.00 15.18 ? 227  ILE A CA  1 
ATOM   1366 C  C   . ILE A  1  192 ? 20.464  46.186 6.395   1.00 15.37 ? 227  ILE A C   1 
ATOM   1367 O  O   . ILE A  1  192 ? 20.496  44.971 6.106   1.00 15.96 ? 227  ILE A O   1 
ATOM   1368 C  CB  . ILE A  1  192 ? 18.261  45.872 7.655   1.00 16.10 ? 227  ILE A CB  1 
ATOM   1369 C  CG1 . ILE A  1  192 ? 16.894  46.542 7.948   1.00 16.30 ? 227  ILE A CG1 1 
ATOM   1370 C  CG2 . ILE A  1  192 ? 18.867  45.415 8.962   1.00 15.34 ? 227  ILE A CG2 1 
ATOM   1371 C  CD1 . ILE A  1  192 ? 17.058  47.886 8.757   1.00 18.61 ? 227  ILE A CD1 1 
ATOM   1372 N  N   . VAL A  1  193 ? 21.489  47.011 6.183   1.00 15.20 ? 228  VAL A N   1 
ATOM   1373 C  CA  . VAL A  1  193 ? 22.686  46.575 5.457   1.00 15.51 ? 228  VAL A CA  1 
ATOM   1374 C  C   . VAL A  1  193 ? 23.721  45.955 6.396   1.00 13.93 ? 228  VAL A C   1 
ATOM   1375 O  O   . VAL A  1  193 ? 24.729  45.429 5.928   1.00 15.30 ? 228  VAL A O   1 
ATOM   1376 C  CB  . VAL A  1  193 ? 23.364  47.730 4.686   1.00 16.84 ? 228  VAL A CB  1 
ATOM   1377 C  CG1 . VAL A  1  193 ? 22.338  48.423 3.716   1.00 18.08 ? 228  VAL A CG1 1 
ATOM   1378 C  CG2 . VAL A  1  193 ? 23.945  48.737 5.694   1.00 17.18 ? 228  VAL A CG2 1 
ATOM   1379 N  N   . GLY A  1  194 ? 23.457  46.012 7.693   1.00 16.46 ? 229  GLY A N   1 
ATOM   1380 C  CA  . GLY A  1  194 ? 24.248  45.294 8.686   1.00 16.29 ? 229  GLY A CA  1 
ATOM   1381 C  C   . GLY A  1  194 ? 23.503  45.167 10.013  1.00 19.05 ? 229  GLY A C   1 
ATOM   1382 O  O   . GLY A  1  194 ? 22.468  45.806 10.206  1.00 19.03 ? 229  GLY A O   1 
ATOM   1383 N  N   . ASN A  1  195 ? 24.029  44.359 10.930  1.00 18.88 ? 230  ASN A N   1 
ATOM   1384 C  CA  . ASN A  1  195 ? 23.535  44.349 12.313  1.00 14.23 ? 230  ASN A CA  1 
ATOM   1385 C  C   . ASN A  1  195 ? 23.790  45.704 12.980  1.00 18.82 ? 230  ASN A C   1 
ATOM   1386 O  O   . ASN A  1  195 ? 23.077  46.113 13.908  1.00 19.48 ? 230  ASN A O   1 
ATOM   1387 C  CB  . ASN A  1  195 ? 24.239  43.279 13.140  1.00 18.14 ? 230  ASN A CB  1 
ATOM   1388 C  CG  . ASN A  1  195 ? 23.741  41.877 12.862  1.00 18.83 ? 230  ASN A CG  1 
ATOM   1389 O  OD1 . ASN A  1  195 ? 22.754  41.666 12.147  1.00 19.03 ? 230  ASN A OD1 1 
ATOM   1390 N  ND2 . ASN A  1  195 ? 24.426  40.899 13.438  1.00 19.11 ? 230  ASN A ND2 1 
ATOM   1391 N  N   . SER A  1  196 ? 24.833  46.376 12.520  1.00 18.68 ? 231  SER A N   1 
ATOM   1392 C  CA  . SER A  1  196 ? 25.113  47.739 12.935  1.00 20.23 ? 231  SER A CA  1 
ATOM   1393 C  C   . SER A  1  196 ? 25.338  48.531 11.677  1.00 18.61 ? 231  SER A C   1 
ATOM   1394 O  O   . SER A  1  196 ? 25.910  48.021 10.703  1.00 19.02 ? 231  SER A O   1 
ATOM   1395 C  CB  . SER A  1  196 ? 26.386  47.791 13.790  1.00 24.39 ? 231  SER A CB  1 
ATOM   1396 O  OG  . SER A  1  196 ? 26.175  47.178 15.044  1.00 28.02 ? 231  SER A OG  1 
ATOM   1397 N  N   . MET A  1  197 ? 24.859  49.778 11.680  1.00 18.83 ? 232  MET A N   1 
ATOM   1398 C  CA  . MET A  1  197 ? 25.109  50.672 10.564  1.00 15.93 ? 232  MET A CA  1 
ATOM   1399 C  C   . MET A  1  197 ? 24.984  52.146 10.962  1.00 20.46 ? 232  MET A C   1 
ATOM   1400 O  O   . MET A  1  197 ? 24.271  52.504 11.919  1.00 21.84 ? 232  MET A O   1 
ATOM   1401 C  CB  . MET A  1  197 ? 24.168  50.350 9.371   1.00 22.62 ? 232  MET A CB  1 
ATOM   1402 C  CG  . MET A  1  197 ? 22.835  49.789 9.771   1.00 25.70 ? 232  MET A CG  1 
ATOM   1403 S  SD  . MET A  1  197 ? 21.629  49.690 8.427   1.00 21.95 ? 232  MET A SD  1 
ATOM   1404 C  CE  . MET A  1  197 ? 20.200  49.394 9.484   1.00 21.04 ? 232  MET A CE  1 
ATOM   1405 N  N   . TYR A  1  198 ? 25.677  52.984 10.210  1.00 18.47 ? 233  TYR A N   1 
ATOM   1406 C  CA  . TYR A  1  198 ? 25.596  54.417 10.406  1.00 21.76 ? 233  TYR A CA  1 
ATOM   1407 C  C   . TYR A  1  198 ? 24.896  55.023 9.209   1.00 19.15 ? 233  TYR A C   1 
ATOM   1408 O  O   . TYR A  1  198 ? 25.267  54.752 8.064   1.00 19.72 ? 233  TYR A O   1 
ATOM   1409 C  CB  . TYR A  1  198 ? 27.018  54.994 10.603  1.00 23.08 ? 233  TYR A CB  1 
ATOM   1410 C  CG  . TYR A  1  198 ? 27.023  56.504 10.688  1.00 22.65 ? 233  TYR A CG  1 
ATOM   1411 C  CD1 . TYR A  1  198 ? 26.513  57.164 11.805  1.00 25.98 ? 233  TYR A CD1 1 
ATOM   1412 C  CD2 . TYR A  1  198 ? 27.542  57.263 9.644   1.00 25.12 ? 233  TYR A CD2 1 
ATOM   1413 C  CE1 . TYR A  1  198 ? 26.515  58.556 11.863  1.00 26.02 ? 233  TYR A CE1 1 
ATOM   1414 C  CE2 . TYR A  1  198 ? 27.548  58.636 9.697   1.00 26.40 ? 233  TYR A CE2 1 
ATOM   1415 C  CZ  . TYR A  1  198 ? 27.046  59.273 10.805  1.00 27.74 ? 233  TYR A CZ  1 
ATOM   1416 O  OH  . TYR A  1  198 ? 27.067  60.652 10.807  1.00 30.83 ? 233  TYR A OH  1 
ATOM   1417 N  N   . ASP A  1  199 ? 23.864  55.826 9.446   1.00 21.27 ? 234  ASP A N   1 
ATOM   1418 C  CA  . ASP A  1  199 ? 23.262  56.573 8.355   1.00 20.20 ? 234  ASP A CA  1 
ATOM   1419 C  C   . ASP A  1  199 ? 23.712  58.046 8.373   1.00 23.16 ? 234  ASP A C   1 
ATOM   1420 O  O   . ASP A  1  199 ? 23.411  58.765 9.325   1.00 25.99 ? 234  ASP A O   1 
ATOM   1421 C  CB  . ASP A  1  199 ? 21.742  56.486 8.429   1.00 22.49 ? 234  ASP A CB  1 
ATOM   1422 C  CG  . ASP A  1  199 ? 21.084  57.136 7.234   1.00 27.22 ? 234  ASP A CG  1 
ATOM   1423 O  OD1 . ASP A  1  199 ? 21.349  58.337 7.001   1.00 26.62 ? 234  ASP A OD1 1 
ATOM   1424 O  OD2 . ASP A  1  199 ? 20.328  56.448 6.516   1.00 25.80 ? 234  ASP A OD2 1 
ATOM   1425 N  N   . PRO A  1  200 ? 24.443  58.481 7.337   1.00 22.71 ? 235  PRO A N   1 
ATOM   1426 C  CA  . PRO A  1  200 ? 25.059  59.822 7.403   1.00 22.52 ? 235  PRO A CA  1 
ATOM   1427 C  C   . PRO A  1  200 ? 24.044  60.949 7.270   1.00 30.04 ? 235  PRO A C   1 
ATOM   1428 O  O   . PRO A  1  200 ? 24.358  62.080 7.655   1.00 31.28 ? 235  PRO A O   1 
ATOM   1429 C  CB  . PRO A  1  200 ? 26.046  59.834 6.237   1.00 27.90 ? 235  PRO A CB  1 
ATOM   1430 C  CG  . PRO A  1  200 ? 25.598  58.738 5.300   1.00 30.94 ? 235  PRO A CG  1 
ATOM   1431 C  CD  . PRO A  1  200 ? 24.842  57.723 6.143   1.00 23.32 ? 235  PRO A CD  1 
ATOM   1432 N  N   . VAL A  1  201 ? 22.859  60.655 6.733   1.00 23.80 ? 236  VAL A N   1 
ATOM   1433 C  CA  . VAL A  1  201 ? 21.778  61.655 6.659   1.00 29.52 ? 236  VAL A CA  1 
ATOM   1434 C  C   . VAL A  1  201 ? 21.015  61.745 7.984   1.00 29.21 ? 236  VAL A C   1 
ATOM   1435 O  O   . VAL A  1  201 ? 20.699  62.847 8.448   1.00 33.62 ? 236  VAL A O   1 
ATOM   1436 C  CB  . VAL A  1  201 ? 20.828  61.422 5.447   1.00 25.56 ? 236  VAL A CB  1 
ATOM   1437 C  CG1 . VAL A  1  201 ? 19.621  62.398 5.488   1.00 27.40 ? 236  VAL A CG1 1 
ATOM   1438 C  CG2 . VAL A  1  201 ? 21.575  61.561 4.144   1.00 27.72 ? 236  VAL A CG2 1 
ATOM   1439 N  N   . PHE A  1  202 ? 20.723  60.610 8.615   1.00 28.53 ? 237  PHE A N   1 
ATOM   1440 C  CA  . PHE A  1  202 ? 20.164  60.626 9.962   1.00 25.16 ? 237  PHE A CA  1 
ATOM   1441 C  C   . PHE A  1  202 ? 21.223  61.124 10.956  1.00 29.67 ? 237  PHE A C   1 
ATOM   1442 O  O   . PHE A  1  202 ? 20.882  61.648 12.015  1.00 29.53 ? 237  PHE A O   1 
ATOM   1443 C  CB  . PHE A  1  202 ? 19.723  59.238 10.456  1.00 26.57 ? 237  PHE A CB  1 
ATOM   1444 C  CG  . PHE A  1  202 ? 18.665  58.564 9.615   1.00 29.22 ? 237  PHE A CG  1 
ATOM   1445 C  CD1 . PHE A  1  202 ? 17.868  59.283 8.748   1.00 26.67 ? 237  PHE A CD1 1 
ATOM   1446 C  CD2 . PHE A  1  202 ? 18.463  57.185 9.733   1.00 21.84 ? 237  PHE A CD2 1 
ATOM   1447 C  CE1 . PHE A  1  202 ? 16.879  58.640 7.979   1.00 29.22 ? 237  PHE A CE1 1 
ATOM   1448 C  CE2 . PHE A  1  202 ? 17.490  56.548 8.981   1.00 23.34 ? 237  PHE A CE2 1 
ATOM   1449 C  CZ  . PHE A  1  202 ? 16.706  57.279 8.091   1.00 26.14 ? 237  PHE A CZ  1 
ATOM   1450 N  N   . ASP A  1  203 ? 22.497  60.960 10.603  1.00 26.70 ? 238  ASP A N   1 
ATOM   1451 C  CA  . ASP A  1  203 ? 23.585  61.065 11.579  1.00 29.22 ? 238  ASP A CA  1 
ATOM   1452 C  C   . ASP A  1  203 ? 23.214  60.260 12.815  1.00 31.39 ? 238  ASP A C   1 
ATOM   1453 O  O   . ASP A  1  203 ? 23.178  60.775 13.933  1.00 29.48 ? 238  ASP A O   1 
ATOM   1454 C  CB  . ASP A  1  203 ? 23.858  62.532 11.956  1.00 33.91 ? 238  ASP A CB  1 
ATOM   1455 C  CG  . ASP A  1  203 ? 25.064  62.689 12.871  1.00 37.43 ? 238  ASP A CG  1 
ATOM   1456 O  OD1 . ASP A  1  203 ? 26.026  61.905 12.738  1.00 36.86 ? 238  ASP A OD1 1 
ATOM   1457 O  OD2 . ASP A  1  203 ? 25.060  63.605 13.731  1.00 39.79 ? 238  ASP A OD2 1 
ATOM   1458 N  N   . ALA A  1  204 ? 22.917  58.979 12.625  1.00 25.28 ? 239  ALA A N   1 
ATOM   1459 C  CA  . ALA A  1  204 ? 22.494  58.170 13.745  1.00 25.87 ? 239  ALA A CA  1 
ATOM   1460 C  C   . ALA A  1  204 ? 22.990  56.769 13.488  1.00 23.57 ? 239  ALA A C   1 
ATOM   1461 O  O   . ALA A  1  204 ? 23.290  56.422 12.352  1.00 19.73 ? 239  ALA A O   1 
ATOM   1462 C  CB  . ALA A  1  204 ? 20.982  58.182 13.876  1.00 27.47 ? 239  ALA A CB  1 
ATOM   1463 N  N   . THR A  1  205 ? 23.077  55.987 14.557  1.00 24.99 ? 240  THR A N   1 
ATOM   1464 C  CA  . THR A  1  205 ? 23.654  54.657 14.468  1.00 25.80 ? 240  THR A CA  1 
ATOM   1465 C  C   . THR A  1  205 ? 22.677  53.609 14.967  1.00 25.42 ? 240  THR A C   1 
ATOM   1466 O  O   . THR A  1  205 ? 22.099  53.748 16.040  1.00 27.10 ? 240  THR A O   1 
ATOM   1467 C  CB  . THR A  1  205 ? 24.968  54.571 15.279  1.00 24.99 ? 240  THR A CB  1 
ATOM   1468 O  OG1 . THR A  1  205 ? 25.886  55.575 14.813  1.00 28.29 ? 240  THR A OG1 1 
ATOM   1469 C  CG2 . THR A  1  205 ? 25.596  53.211 15.083  1.00 25.16 ? 240  THR A CG2 1 
ATOM   1470 N  N   . PHE A  1  206 ? 22.516  52.556 14.173  1.00 23.95 ? 241  PHE A N   1 
ATOM   1471 C  CA  . PHE A  1  206 ? 21.608  51.436 14.418  1.00 21.78 ? 241  PHE A CA  1 
ATOM   1472 C  C   . PHE A  1  206 ? 22.424  50.274 14.944  1.00 23.53 ? 241  PHE A C   1 
ATOM   1473 O  O   . PHE A  1  206 ? 23.449  49.965 14.372  1.00 21.88 ? 241  PHE A O   1 
ATOM   1474 C  CB  . PHE A  1  206 ? 20.995  51.054 13.057  1.00 21.15 ? 241  PHE A CB  1 
ATOM   1475 C  CG  . PHE A  1  206 ? 20.078  49.829 13.045  1.00 23.27 ? 241  PHE A CG  1 
ATOM   1476 C  CD1 . PHE A  1  206 ? 18.710  49.979 12.817  1.00 24.45 ? 241  PHE A CD1 1 
ATOM   1477 C  CD2 . PHE A  1  206 ? 20.591  48.535 13.130  1.00 22.22 ? 241  PHE A CD2 1 
ATOM   1478 C  CE1 . PHE A  1  206 ? 17.864  48.882 12.710  1.00 24.44 ? 241  PHE A CE1 1 
ATOM   1479 C  CE2 . PHE A  1  206 ? 19.750  47.425 13.048  1.00 24.87 ? 241  PHE A CE2 1 
ATOM   1480 C  CZ  . PHE A  1  206 ? 18.378  47.599 12.836  1.00 24.45 ? 241  PHE A CZ  1 
ATOM   1481 N  N   . HIS A  1  207 ? 21.951  49.629 16.011  1.00 27.14 ? 242  HIS A N   1 
ATOM   1482 C  CA  . HIS A  1  207 ? 22.550  48.388 16.544  1.00 29.53 ? 242  HIS A CA  1 
ATOM   1483 C  C   . HIS A  1  207 ? 21.513  47.301 16.837  1.00 31.74 ? 242  HIS A C   1 
ATOM   1484 O  O   . HIS A  1  207 ? 20.374  47.592 17.236  1.00 30.90 ? 242  HIS A O   1 
ATOM   1485 C  CB  . HIS A  1  207 ? 23.291  48.651 17.850  1.00 31.00 ? 242  HIS A CB  1 
ATOM   1486 C  CG  . HIS A  1  207 ? 24.414  49.627 17.740  1.00 32.16 ? 242  HIS A CG  1 
ATOM   1487 N  ND1 . HIS A  1  207 ? 25.621  49.310 17.155  1.00 38.00 ? 242  HIS A ND1 1 
ATOM   1488 C  CD2 . HIS A  1  207 ? 24.539  50.897 18.198  1.00 35.76 ? 242  HIS A CD2 1 
ATOM   1489 C  CE1 . HIS A  1  207 ? 26.432  50.353 17.229  1.00 34.02 ? 242  HIS A CE1 1 
ATOM   1490 N  NE2 . HIS A  1  207 ? 25.798  51.329 17.855  1.00 32.37 ? 242  HIS A NE2 1 
ATOM   1491 N  N   . LEU A  1  208 ? 21.925  46.041 16.693  1.00 32.44 ? 243  LEU A N   1 
ATOM   1492 C  CA  . LEU A  1  208 ? 21.025  44.912 16.900  1.00 32.06 ? 243  LEU A CA  1 
ATOM   1493 C  C   . LEU A  1  208 ? 20.482  44.960 18.323  1.00 38.20 ? 243  LEU A C   1 
ATOM   1494 O  O   . LEU A  1  208 ? 19.313  44.643 18.571  1.00 35.20 ? 243  LEU A O   1 
ATOM   1495 C  CB  . LEU A  1  208 ? 21.743  43.580 16.608  1.00 31.40 ? 243  LEU A CB  1 
ATOM   1496 C  CG  . LEU A  1  208 ? 20.948  42.276 16.775  1.00 38.66 ? 243  LEU A CG  1 
ATOM   1497 C  CD1 . LEU A  1  208 ? 21.436  41.170 15.806  1.00 30.89 ? 243  LEU A CD1 1 
ATOM   1498 C  CD2 . LEU A  1  208 ? 20.964  41.785 18.223  1.00 38.73 ? 243  LEU A CD2 1 
ATOM   1499 N  N   . ARG A  1  209 ? 21.327  45.398 19.249  1.00 38.01 ? 244  ARG A N   1 
ATOM   1500 C  CA  . ARG A  1  209 ? 20.905  45.589 20.633  1.00 36.94 ? 244  ARG A CA  1 
ATOM   1501 C  C   . ARG A  1  209 ? 20.748  47.087 20.894  1.00 39.43 ? 244  ARG A C   1 
ATOM   1502 O  O   . ARG A  1  209 ? 21.570  47.885 20.450  1.00 43.54 ? 244  ARG A O   1 
ATOM   1503 C  CB  . ARG A  1  209 ? 21.931  44.971 21.589  1.00 44.16 ? 244  ARG A CB  1 
ATOM   1504 N  N   . GLY A  1  210 ? 19.693  47.483 21.600  1.00 40.34 ? 245  GLY A N   1 
ATOM   1505 C  CA  . GLY A  1  210 ? 19.441  48.902 21.812  1.00 39.56 ? 245  GLY A CA  1 
ATOM   1506 C  C   . GLY A  1  210 ? 18.126  49.368 21.197  1.00 39.10 ? 245  GLY A C   1 
ATOM   1507 O  O   . GLY A  1  210 ? 17.443  48.598 20.508  1.00 39.88 ? 245  GLY A O   1 
ATOM   1508 N  N   . ARG A  1  211 ? 17.761  50.626 21.436  1.00 37.37 ? 246  ARG A N   1 
ATOM   1509 C  CA  . ARG A  1  211 ? 16.413  51.083 21.081  1.00 36.78 ? 246  ARG A CA  1 
ATOM   1510 C  C   . ARG A  1  211 ? 16.283  51.787 19.725  1.00 33.84 ? 246  ARG A C   1 
ATOM   1511 O  O   . ARG A  1  211 ? 15.178  51.848 19.164  1.00 31.14 ? 246  ARG A O   1 
ATOM   1512 C  CB  . ARG A  1  211 ? 15.807  51.949 22.198  1.00 41.43 ? 246  ARG A CB  1 
ATOM   1513 N  N   . GLU A  1  212 ? 17.385  52.318 19.198  1.00 35.72 ? 247  GLU A N   1 
ATOM   1514 C  CA  . GLU A  1  212 ? 17.346  53.021 17.910  1.00 33.01 ? 247  GLU A CA  1 
ATOM   1515 C  C   . GLU A  1  212 ? 16.718  52.165 16.790  1.00 29.10 ? 247  GLU A C   1 
ATOM   1516 O  O   . GLU A  1  212 ? 16.010  52.687 15.932  1.00 30.08 ? 247  GLU A O   1 
ATOM   1517 C  CB  . GLU A  1  212 ? 18.744  53.508 17.501  1.00 29.44 ? 247  GLU A CB  1 
ATOM   1518 C  CG  . GLU A  1  212 ? 18.825  54.188 16.120  1.00 30.47 ? 247  GLU A CG  1 
ATOM   1519 C  CD  . GLU A  1  212 ? 17.980  55.443 16.039  1.00 35.10 ? 247  GLU A CD  1 
ATOM   1520 O  OE1 . GLU A  1  212 ? 17.486  55.781 14.944  1.00 31.51 ? 247  GLU A OE1 1 
ATOM   1521 O  OE2 . GLU A  1  212 ? 17.809  56.099 17.082  1.00 41.79 ? 247  GLU A OE2 1 
ATOM   1522 N  N   . LYS A  1  213 ? 16.990  50.859 16.808  1.00 30.64 ? 248  LYS A N   1 
ATOM   1523 C  CA  . LYS A  1  213 ? 16.453  49.940 15.793  1.00 25.30 ? 248  LYS A CA  1 
ATOM   1524 C  C   . LYS A  1  213 ? 14.931  49.896 15.781  1.00 29.48 ? 248  LYS A C   1 
ATOM   1525 O  O   . LYS A  1  213 ? 14.342  49.496 14.784  1.00 26.64 ? 248  LYS A O   1 
ATOM   1526 C  CB  . LYS A  1  213 ? 16.956  48.520 16.027  1.00 26.86 ? 248  LYS A CB  1 
ATOM   1527 C  CG  . LYS A  1  213 ? 16.527  47.935 17.376  1.00 32.50 ? 248  LYS A CG  1 
ATOM   1528 C  CD  . LYS A  1  213 ? 16.584  46.410 17.348  1.00 34.87 ? 248  LYS A CD  1 
ATOM   1529 C  CE  . LYS A  1  213 ? 16.137  45.800 18.685  1.00 37.86 ? 248  LYS A CE  1 
ATOM   1530 N  NZ  . LYS A  1  213 ? 17.178  45.932 19.754  1.00 33.55 ? 248  LYS A NZ  1 
ATOM   1531 N  N   . PHE A  1  214 ? 14.284  50.289 16.881  1.00 29.20 ? 249  PHE A N   1 
ATOM   1532 C  CA  . PHE A  1  214 ? 12.811  50.313 16.894  1.00 29.54 ? 249  PHE A CA  1 
ATOM   1533 C  C   . PHE A  1  214 ? 12.209  51.450 16.062  1.00 30.62 ? 249  PHE A C   1 
ATOM   1534 O  O   . PHE A  1  214 ? 11.039  51.382 15.670  1.00 34.08 ? 249  PHE A O   1 
ATOM   1535 C  CB  . PHE A  1  214 ? 12.249  50.302 18.332  1.00 33.01 ? 249  PHE A CB  1 
ATOM   1536 C  CG  . PHE A  1  214 ? 12.506  49.011 19.058  1.00 32.30 ? 249  PHE A CG  1 
ATOM   1537 C  CD1 . PHE A  1  214 ? 11.746  47.889 18.781  1.00 34.59 ? 249  PHE A CD1 1 
ATOM   1538 C  CD2 . PHE A  1  214 ? 13.532  48.907 19.971  1.00 32.42 ? 249  PHE A CD2 1 
ATOM   1539 C  CE1 . PHE A  1  214 ? 11.990  46.688 19.416  1.00 39.66 ? 249  PHE A CE1 1 
ATOM   1540 C  CE2 . PHE A  1  214 ? 13.782  47.710 20.610  1.00 36.32 ? 249  PHE A CE2 1 
ATOM   1541 C  CZ  . PHE A  1  214 ? 13.014  46.597 20.334  1.00 36.45 ? 249  PHE A CZ  1 
ATOM   1542 N  N   . ASN A  1  215 ? 12.993  52.489 15.791  1.00 27.14 ? 250  ASN A N   1 
ATOM   1543 C  CA  . ASN A  1  215 ? 12.548  53.569 14.895  1.00 28.50 ? 250  ASN A CA  1 
ATOM   1544 C  C   . ASN A  1  215 ? 12.290  53.058 13.466  1.00 30.69 ? 250  ASN A C   1 
ATOM   1545 O  O   . ASN A  1  215 ? 13.169  52.447 12.847  1.00 25.65 ? 250  ASN A O   1 
ATOM   1546 C  CB  . ASN A  1  215 ? 13.573  54.707 14.879  1.00 31.30 ? 250  ASN A CB  1 
ATOM   1547 C  CG  . ASN A  1  215 ? 13.036  55.983 14.228  1.00 34.49 ? 250  ASN A CG  1 
ATOM   1548 O  OD1 . ASN A  1  215 ? 12.235  55.937 13.290  1.00 33.15 ? 250  ASN A OD1 1 
ATOM   1549 N  ND2 . ASN A  1  215 ? 13.488  57.132 14.728  1.00 35.40 ? 250  ASN A ND2 1 
ATOM   1550 N  N   . HIS A  1  216 ? 11.097  53.326 12.931  1.00 29.09 ? 251  HIS A N   1 
ATOM   1551 C  CA  . HIS A  1  216 ? 10.715  52.789 11.624  1.00 29.52 ? 251  HIS A CA  1 
ATOM   1552 C  C   . HIS A  1  216 ? 11.484  53.366 10.434  1.00 28.28 ? 251  HIS A C   1 
ATOM   1553 O  O   . HIS A  1  216 ? 11.499  52.777 9.348   1.00 25.63 ? 251  HIS A O   1 
ATOM   1554 C  CB  . HIS A  1  216 ? 9.199   52.918 11.399  1.00 30.84 ? 251  HIS A CB  1 
ATOM   1555 C  CG  . HIS A  1  216 ? 8.383   51.982 12.242  1.00 33.08 ? 251  HIS A CG  1 
ATOM   1556 N  ND1 . HIS A  1  216 ? 7.093   51.619 11.917  1.00 36.57 ? 251  HIS A ND1 1 
ATOM   1557 C  CD2 . HIS A  1  216 ? 8.672   51.343 13.400  1.00 31.76 ? 251  HIS A CD2 1 
ATOM   1558 C  CE1 . HIS A  1  216 ? 6.622   50.796 12.838  1.00 37.23 ? 251  HIS A CE1 1 
ATOM   1559 N  NE2 . HIS A  1  216 ? 7.561   50.611 13.749  1.00 35.96 ? 251  HIS A NE2 1 
ATOM   1560 N  N   . ARG A  1  217 ? 12.135  54.510 10.622  1.00 27.55 ? 252  ARG A N   1 
ATOM   1561 C  CA  . ARG A  1  217 ? 12.839  55.129 9.514   1.00 27.26 ? 252  ARG A CA  1 
ATOM   1562 C  C   . ARG A  1  217 ? 13.933  54.221 8.931   1.00 23.46 ? 252  ARG A C   1 
ATOM   1563 O  O   . ARG A  1  217 ? 14.346  54.417 7.789   1.00 27.90 ? 252  ARG A O   1 
ATOM   1564 C  CB  . ARG A  1  217 ? 13.455  56.466 9.926   1.00 28.75 ? 252  ARG A CB  1 
ATOM   1565 C  CG  . ARG A  1  217 ? 14.554  56.333 10.962  1.00 30.82 ? 252  ARG A CG  1 
ATOM   1566 C  CD  . ARG A  1  217 ? 15.092  57.708 11.349  1.00 32.12 ? 252  ARG A CD  1 
ATOM   1567 N  NE  . ARG A  1  217 ? 15.986  57.626 12.504  1.00 29.90 ? 252  ARG A NE  1 
ATOM   1568 C  CZ  . ARG A  1  217 ? 16.679  58.658 12.975  1.00 32.43 ? 252  ARG A CZ  1 
ATOM   1569 N  NH1 . ARG A  1  217 ? 16.588  59.841 12.382  1.00 30.25 ? 252  ARG A NH1 1 
ATOM   1570 N  NH2 . ARG A  1  217 ? 17.461  58.499 14.030  1.00 30.75 ? 252  ARG A NH2 1 
ATOM   1571 N  N   . TRP A  1  218 ? 14.398  53.233 9.695   1.00 23.76 ? 253  TRP A N   1 
ATOM   1572 C  CA  . TRP A  1  218 ? 15.472  52.356 9.163   1.00 21.05 ? 253  TRP A CA  1 
ATOM   1573 C  C   . TRP A  1  218 ? 14.986  51.327 8.163   1.00 22.16 ? 253  TRP A C   1 
ATOM   1574 O  O   . TRP A  1  218 ? 15.752  50.860 7.330   1.00 18.77 ? 253  TRP A O   1 
ATOM   1575 C  CB  . TRP A  1  218 ? 16.192  51.613 10.282  1.00 20.69 ? 253  TRP A CB  1 
ATOM   1576 C  CG  . TRP A  1  218 ? 16.927  52.538 11.195  1.00 22.33 ? 253  TRP A CG  1 
ATOM   1577 C  CD1 . TRP A  1  218 ? 16.468  53.074 12.352  1.00 26.14 ? 253  TRP A CD1 1 
ATOM   1578 C  CD2 . TRP A  1  218 ? 18.255  53.042 11.010  1.00 22.98 ? 253  TRP A CD2 1 
ATOM   1579 N  NE1 . TRP A  1  218 ? 17.440  53.890 12.914  1.00 24.87 ? 253  TRP A NE1 1 
ATOM   1580 C  CE2 . TRP A  1  218 ? 18.540  53.879 12.103  1.00 22.46 ? 253  TRP A CE2 1 
ATOM   1581 C  CE3 . TRP A  1  218 ? 19.228  52.862 10.026  1.00 21.84 ? 253  TRP A CE3 1 
ATOM   1582 C  CZ2 . TRP A  1  218 ? 19.756  54.542 12.229  1.00 23.39 ? 253  TRP A CZ2 1 
ATOM   1583 C  CZ3 . TRP A  1  218 ? 20.446  53.512 10.165  1.00 23.48 ? 253  TRP A CZ3 1 
ATOM   1584 C  CH2 . TRP A  1  218 ? 20.693  54.326 11.260  1.00 22.46 ? 253  TRP A CH2 1 
ATOM   1585 N  N   . TRP A  1  219 ? 13.707  50.977 8.260   1.00 22.41 ? 254  TRP A N   1 
ATOM   1586 C  CA  . TRP A  1  219 ? 13.199  49.744 7.657   1.00 21.10 ? 254  TRP A CA  1 
ATOM   1587 C  C   . TRP A  1  219 ? 12.434  49.997 6.376   1.00 21.84 ? 254  TRP A C   1 
ATOM   1588 O  O   . TRP A  1  219 ? 11.336  50.553 6.428   1.00 21.19 ? 254  TRP A O   1 
ATOM   1589 C  CB  . TRP A  1  219 ? 12.300  49.021 8.668   1.00 20.54 ? 254  TRP A CB  1 
ATOM   1590 C  CG  . TRP A  1  219 ? 12.986  48.744 9.995   1.00 22.14 ? 254  TRP A CG  1 
ATOM   1591 C  CD1 . TRP A  1  219 ? 13.137  49.624 11.038  1.00 23.78 ? 254  TRP A CD1 1 
ATOM   1592 C  CD2 . TRP A  1  219 ? 13.619  47.520 10.412  1.00 21.28 ? 254  TRP A CD2 1 
ATOM   1593 N  NE1 . TRP A  1  219 ? 13.808  49.021 12.069  1.00 22.62 ? 254  TRP A NE1 1 
ATOM   1594 C  CE2 . TRP A  1  219 ? 14.117  47.731 11.717  1.00 22.09 ? 254  TRP A CE2 1 
ATOM   1595 C  CE3 . TRP A  1  219 ? 13.803  46.264 9.812   1.00 19.19 ? 254  TRP A CE3 1 
ATOM   1596 C  CZ2 . TRP A  1  219 ? 14.805  46.740 12.438  1.00 23.65 ? 254  TRP A CZ2 1 
ATOM   1597 C  CZ3 . TRP A  1  219 ? 14.477  45.258 10.545  1.00 20.24 ? 254  TRP A CZ3 1 
ATOM   1598 C  CH2 . TRP A  1  219 ? 14.969  45.511 11.845  1.00 19.72 ? 254  TRP A CH2 1 
ATOM   1599 N  N   . GLY A  1  220 ? 13.007  49.604 5.232   1.00 18.51 ? 255  GLY A N   1 
ATOM   1600 C  CA  . GLY A  1  220 ? 12.365  49.821 3.942   1.00 21.18 ? 255  GLY A CA  1 
ATOM   1601 C  C   . GLY A  1  220 ? 11.628  48.609 3.395   1.00 19.05 ? 255  GLY A C   1 
ATOM   1602 O  O   . GLY A  1  220 ? 11.473  47.599 4.082   1.00 20.29 ? 255  GLY A O   1 
ATOM   1603 N  N   . GLY A  1  221 ? 11.184  48.712 2.150   1.00 19.64 ? 256  GLY A N   1 
ATOM   1604 C  CA  . GLY A  1  221 ? 10.414  47.654 1.531   1.00 19.72 ? 256  GLY A CA  1 
ATOM   1605 C  C   . GLY A  1  221 ? 9.082   47.440 2.233   1.00 23.20 ? 256  GLY A C   1 
ATOM   1606 O  O   . GLY A  1  221 ? 8.584   48.307 2.974   1.00 24.60 ? 256  GLY A O   1 
ATOM   1607 N  N   . GLN A  1  222 ? 8.506   46.269 2.027   1.00 17.37 ? 257  GLN A N   1 
ATOM   1608 C  CA  . GLN A  1  222 ? 7.242   45.937 2.666   1.00 16.87 ? 257  GLN A CA  1 
ATOM   1609 C  C   . GLN A  1  222 ? 7.299   44.495 3.157   1.00 18.70 ? 257  GLN A C   1 
ATOM   1610 O  O   . GLN A  1  222 ? 7.166   43.555 2.359   1.00 19.70 ? 257  GLN A O   1 
ATOM   1611 C  CB  . GLN A  1  222 ? 6.111   46.091 1.643   1.00 19.12 ? 257  GLN A CB  1 
ATOM   1612 C  CG  . GLN A  1  222 ? 4.742   45.849 2.249   1.00 23.35 ? 257  GLN A CG  1 
ATOM   1613 C  CD  . GLN A  1  222 ? 3.632   46.007 1.240   1.00 25.92 ? 257  GLN A CD  1 
ATOM   1614 O  OE1 . GLN A  1  222 ? 3.220   47.121 0.917   1.00 31.03 ? 257  GLN A OE1 1 
ATOM   1615 N  NE2 . GLN A  1  222 ? 3.140   44.894 0.741   1.00 19.00 ? 257  GLN A NE2 1 
ATOM   1616 N  N   . PRO A  1  223 ? 7.523   44.314 4.462   1.00 18.15 ? 258  PRO A N   1 
ATOM   1617 C  CA  . PRO A  1  223 ? 7.704   42.966 5.000   1.00 20.18 ? 258  PRO A CA  1 
ATOM   1618 C  C   . PRO A  1  223 ? 6.385   42.182 4.961   1.00 23.32 ? 258  PRO A C   1 
ATOM   1619 O  O   . PRO A  1  223 ? 5.293   42.773 4.868   1.00 19.56 ? 258  PRO A O   1 
ATOM   1620 C  CB  . PRO A  1  223 ? 8.146   43.220 6.427   1.00 19.81 ? 258  PRO A CB  1 
ATOM   1621 C  CG  . PRO A  1  223 ? 7.565   44.607 6.790   1.00 16.48 ? 258  PRO A CG  1 
ATOM   1622 C  CD  . PRO A  1  223 ? 7.692   45.366 5.483   1.00 19.05 ? 258  PRO A CD  1 
ATOM   1623 N  N   . LEU A  1  224 ? 6.491   40.854 5.019   1.00 18.19 ? 259  LEU A N   1 
ATOM   1624 C  CA  . LEU A  1  224 ? 5.328   39.995 4.821   1.00 19.17 ? 259  LEU A CA  1 
ATOM   1625 C  C   . LEU A  1  224 ? 4.133   40.349 5.721   1.00 22.03 ? 259  LEU A C   1 
ATOM   1626 O  O   . LEU A  1  224 ? 2.970   40.268 5.284   1.00 22.17 ? 259  LEU A O   1 
ATOM   1627 C  CB  . LEU A  1  224 ? 5.727   38.546 5.025   1.00 21.87 ? 259  LEU A CB  1 
ATOM   1628 C  CG  . LEU A  1  224 ? 4.629   37.513 4.739   1.00 19.69 ? 259  LEU A CG  1 
ATOM   1629 C  CD1 . LEU A  1  224 ? 4.329   37.413 3.270   1.00 19.23 ? 259  LEU A CD1 1 
ATOM   1630 C  CD2 . LEU A  1  224 ? 5.085   36.159 5.279   1.00 19.71 ? 259  LEU A CD2 1 
ATOM   1631 N  N   . TRP A  1  225 ? 4.377   40.717 6.973   1.00 19.08 ? 260  TRP A N   1 
ATOM   1632 C  CA  . TRP A  1  225 ? 3.238   40.979 7.868   1.00 22.63 ? 260  TRP A CA  1 
ATOM   1633 C  C   . TRP A  1  225 ? 2.424   42.199 7.427   1.00 22.84 ? 260  TRP A C   1 
ATOM   1634 O  O   . TRP A  1  225 ? 1.180   42.238 7.614   1.00 24.01 ? 260  TRP A O   1 
ATOM   1635 C  CB  . TRP A  1  225 ? 3.657   41.114 9.334   1.00 21.61 ? 260  TRP A CB  1 
ATOM   1636 C  CG  . TRP A  1  225 ? 4.727   42.145 9.615   1.00 24.03 ? 260  TRP A CG  1 
ATOM   1637 C  CD1 . TRP A  1  225 ? 4.549   43.453 9.999   1.00 23.44 ? 260  TRP A CD1 1 
ATOM   1638 C  CD2 . TRP A  1  225 ? 6.153   41.929 9.574   1.00 23.31 ? 260  TRP A CD2 1 
ATOM   1639 N  NE1 . TRP A  1  225 ? 5.788   44.062 10.182  1.00 25.37 ? 260  TRP A NE1 1 
ATOM   1640 C  CE2 . TRP A  1  225 ? 6.776   43.148 9.917   1.00 21.05 ? 260  TRP A CE2 1 
ATOM   1641 C  CE3 . TRP A  1  225 ? 6.949   40.825 9.264   1.00 23.08 ? 260  TRP A CE3 1 
ATOM   1642 C  CZ2 . TRP A  1  225 ? 8.155   43.284 9.992   1.00 21.82 ? 260  TRP A CZ2 1 
ATOM   1643 C  CZ3 . TRP A  1  225 ? 8.322   40.967 9.315   1.00 21.03 ? 260  TRP A CZ3 1 
ATOM   1644 C  CH2 . TRP A  1  225 ? 8.912   42.187 9.680   1.00 23.68 ? 260  TRP A CH2 1 
ATOM   1645 N  N   . ILE A  1  226 ? 3.105   43.186 6.841   1.00 18.86 ? 261  ILE A N   1 
ATOM   1646 C  CA  . ILE A  1  226 ? 2.427   44.364 6.311   1.00 21.75 ? 261  ILE A CA  1 
ATOM   1647 C  C   . ILE A  1  226 ? 1.711   44.052 4.994   1.00 25.76 ? 261  ILE A C   1 
ATOM   1648 O  O   . ILE A  1  226 ? 0.578   44.498 4.763   1.00 23.97 ? 261  ILE A O   1 
ATOM   1649 C  CB  . ILE A  1  226 ? 3.402   45.525 6.111   1.00 22.94 ? 261  ILE A CB  1 
ATOM   1650 C  CG1 . ILE A  1  226 ? 3.946   45.961 7.467   1.00 27.74 ? 261  ILE A CG1 1 
ATOM   1651 C  CG2 . ILE A  1  226 ? 2.715   46.675 5.349   1.00 23.61 ? 261  ILE A CG2 1 
ATOM   1652 C  CD1 . ILE A  1  226 ? 2.876   46.369 8.426   1.00 27.42 ? 261  ILE A CD1 1 
ATOM   1653 N  N   . THR A  1  227 ? 2.357   43.272 4.134   1.00 22.13 ? 262  THR A N   1 
ATOM   1654 C  CA  . THR A  1  227 ? 1.709   42.808 2.918   1.00 24.77 ? 262  THR A CA  1 
ATOM   1655 C  C   . THR A  1  227 ? 0.428   42.024 3.238   1.00 26.84 ? 262  THR A C   1 
ATOM   1656 O  O   . THR A  1  227 ? -0.606  42.191 2.584   1.00 27.14 ? 262  THR A O   1 
ATOM   1657 C  CB  . THR A  1  227 ? 2.650   41.904 2.134   1.00 23.41 ? 262  THR A CB  1 
ATOM   1658 O  OG1 . THR A  1  227 ? 3.867   42.628 1.857   1.00 22.62 ? 262  THR A OG1 1 
ATOM   1659 C  CG2 . THR A  1  227 ? 2.016   41.473 0.823   1.00 21.22 ? 262  THR A CG2 1 
ATOM   1660 N  N   . ALA A  1  228 ? 0.516   41.142 4.224   1.00 22.34 ? 263  ALA A N   1 
ATOM   1661 C  CA  . ALA A  1  228 ? -0.631  40.364 4.660   1.00 20.41 ? 263  ALA A CA  1 
ATOM   1662 C  C   . ALA A  1  228 ? -1.710  41.326 5.127   1.00 24.63 ? 263  ALA A C   1 
ATOM   1663 O  O   . ALA A  1  228 ? -2.853  41.311 4.623   1.00 26.95 ? 263  ALA A O   1 
ATOM   1664 C  CB  . ALA A  1  228 ? -0.221  39.413 5.798   1.00 24.81 ? 263  ALA A CB  1 
ATOM   1665 N  N   . THR A  1  229 ? -1.349  42.178 6.073   1.00 22.17 ? 264  THR A N   1 
ATOM   1666 C  CA  . THR A  1  229 ? -2.317  43.092 6.678   1.00 28.40 ? 264  THR A CA  1 
ATOM   1667 C  C   . THR A  1  229 ? -3.010  43.996 5.662   1.00 29.65 ? 264  THR A C   1 
ATOM   1668 O  O   . THR A  1  229 ? -4.243  44.172 5.708   1.00 28.81 ? 264  THR A O   1 
ATOM   1669 C  CB  . THR A  1  229 ? -1.670  43.950 7.778   1.00 30.11 ? 264  THR A CB  1 
ATOM   1670 O  OG1 . THR A  1  229 ? -1.151  43.088 8.799   1.00 30.69 ? 264  THR A OG1 1 
ATOM   1671 C  CG2 . THR A  1  229 ? -2.724  44.853 8.406   1.00 29.69 ? 264  THR A CG2 1 
ATOM   1672 N  N   . LYS A  1  230 ? -2.237  44.577 4.746   1.00 27.26 ? 265  LYS A N   1 
ATOM   1673 C  CA  . LYS A  1  230 ? -2.818  45.476 3.760   1.00 30.92 ? 265  LYS A CA  1 
ATOM   1674 C  C   . LYS A  1  230 ? -3.772  44.751 2.813   1.00 29.03 ? 265  LYS A C   1 
ATOM   1675 O  O   . LYS A  1  230 ? -4.630  45.384 2.210   1.00 32.08 ? 265  LYS A O   1 
ATOM   1676 C  CB  . LYS A  1  230 ? -1.738  46.246 2.979   1.00 28.63 ? 265  LYS A CB  1 
ATOM   1677 C  CG  . LYS A  1  230 ? -0.988  47.275 3.837   1.00 30.41 ? 265  LYS A CG  1 
ATOM   1678 C  CD  . LYS A  1  230 ? -0.168  48.239 2.985   1.00 40.87 ? 265  LYS A CD  1 
ATOM   1679 C  CE  . LYS A  1  230 ? -0.468  49.702 3.337   1.00 39.76 ? 265  LYS A CE  1 
ATOM   1680 N  NZ  . LYS A  1  230 ? 0.116   50.094 4.652   1.00 51.75 ? 265  LYS A NZ  1 
ATOM   1681 N  N   . GLN A  1  231 ? -3.612  43.435 2.674   1.00 25.29 ? 266  GLN A N   1 
ATOM   1682 C  CA  . GLN A  1  231 ? -4.504  42.619 1.846   1.00 27.11 ? 266  GLN A CA  1 
ATOM   1683 C  C   . GLN A  1  231 ? -5.549  41.817 2.651   1.00 26.29 ? 266  GLN A C   1 
ATOM   1684 O  O   . GLN A  1  231 ? -6.115  40.845 2.149   1.00 26.85 ? 266  GLN A O   1 
ATOM   1685 C  CB  . GLN A  1  231 ? -3.688  41.699 0.929   1.00 26.49 ? 266  GLN A CB  1 
ATOM   1686 C  CG  . GLN A  1  231 ? -2.874  42.530 -0.069  1.00 27.67 ? 266  GLN A CG  1 
ATOM   1687 C  CD  . GLN A  1  231 ? -1.955  41.709 -0.938  1.00 27.07 ? 266  GLN A CD  1 
ATOM   1688 O  OE1 . GLN A  1  231 ? -2.338  40.658 -1.464  1.00 27.31 ? 266  GLN A OE1 1 
ATOM   1689 N  NE2 . GLN A  1  231 ? -0.718  42.201 -1.115  1.00 27.15 ? 266  GLN A NE2 1 
ATOM   1690 N  N   . GLY A  1  232 ? -5.798  42.242 3.884   1.00 26.65 ? 267  GLY A N   1 
ATOM   1691 C  CA  . GLY A  1  232 ? -6.835  41.646 4.718   1.00 28.92 ? 267  GLY A CA  1 
ATOM   1692 C  C   . GLY A  1  232 ? -6.514  40.238 5.187   1.00 32.54 ? 267  GLY A C   1 
ATOM   1693 O  O   . GLY A  1  232 ? -7.418  39.453 5.455   1.00 27.87 ? 267  GLY A O   1 
ATOM   1694 N  N   . VAL A  1  233 ? -5.225  39.898 5.287   1.00 25.73 ? 268  VAL A N   1 
ATOM   1695 C  CA  . VAL A  1  233 ? -4.858  38.632 5.907   1.00 25.99 ? 268  VAL A CA  1 
ATOM   1696 C  C   . VAL A  1  233 ? -4.189  38.902 7.253   1.00 28.53 ? 268  VAL A C   1 
ATOM   1697 O  O   . VAL A  1  233 ? -3.276  39.727 7.356   1.00 27.66 ? 268  VAL A O   1 
ATOM   1698 C  CB  . VAL A  1  233 ? -3.943  37.790 5.019   1.00 28.11 ? 268  VAL A CB  1 
ATOM   1699 C  CG1 . VAL A  1  233 ? -3.421  36.572 5.795   1.00 24.20 ? 268  VAL A CG1 1 
ATOM   1700 C  CG2 . VAL A  1  233 ? -4.683  37.380 3.745   1.00 27.07 ? 268  VAL A CG2 1 
ATOM   1701 N  N   . ARG A  1  234 ? -4.657  38.233 8.296   1.00 26.35 ? 269  ARG A N   1 
ATOM   1702 C  CA  . ARG A  1  234 ? -4.167  38.561 9.620   1.00 25.15 ? 269  ARG A CA  1 
ATOM   1703 C  C   . ARG A  1  234 ? -2.855  37.837 9.961   1.00 27.02 ? 269  ARG A C   1 
ATOM   1704 O  O   . ARG A  1  234 ? -2.726  36.638 9.740   1.00 24.34 ? 269  ARG A O   1 
ATOM   1705 C  CB  . ARG A  1  234 ? -5.199  38.276 10.693  1.00 29.96 ? 269  ARG A CB  1 
ATOM   1706 C  CG  . ARG A  1  234 ? -4.727  38.775 12.043  1.00 35.21 ? 269  ARG A CG  1 
ATOM   1707 C  CD  . ARG A  1  234 ? -5.843  38.744 13.062  1.00 40.71 ? 269  ARG A CD  1 
ATOM   1708 N  NE  . ARG A  1  234 ? -5.780  39.892 13.963  1.00 47.02 ? 269  ARG A NE  1 
ATOM   1709 C  CZ  . ARG A  1  234 ? -6.564  40.031 15.027  1.00 46.69 ? 269  ARG A CZ  1 
ATOM   1710 N  NH1 . ARG A  1  234 ? -7.453  39.087 15.322  1.00 42.13 ? 269  ARG A NH1 1 
ATOM   1711 N  NH2 . ARG A  1  234 ? -6.454  41.102 15.801  1.00 51.45 ? 269  ARG A NH2 1 
ATOM   1712 N  N   . ALA A  1  235 ? -1.916  38.574 10.542  1.00 27.93 ? 270  ALA A N   1 
ATOM   1713 C  CA  . ALA A  1  235 ? -0.616  38.001 10.909  1.00 24.96 ? 270  ALA A CA  1 
ATOM   1714 C  C   . ALA A  1  235 ? -0.448  37.916 12.422  1.00 29.92 ? 270  ALA A C   1 
ATOM   1715 O  O   . ALA A  1  235 ? -0.912  38.796 13.129  1.00 34.60 ? 270  ALA A O   1 
ATOM   1716 C  CB  . ALA A  1  235 ? 0.503   38.865 10.309  1.00 28.27 ? 270  ALA A CB  1 
ATOM   1717 N  N   . GLY A  1  236 ? 0.206   36.857 12.913  1.00 27.69 ? 271  GLY A N   1 
ATOM   1718 C  CA  . GLY A  1  236 ? 0.681   36.802 14.290  1.00 24.08 ? 271  GLY A CA  1 
ATOM   1719 C  C   . GLY A  1  236 ? 1.954   37.653 14.397  1.00 34.76 ? 271  GLY A C   1 
ATOM   1720 O  O   . GLY A  1  236 ? 2.354   38.280 13.418  1.00 31.13 ? 271  GLY A O   1 
ATOM   1721 N  N   . THR A  1  237 ? 2.605   37.666 15.560  1.00 35.03 ? 272  THR A N   1 
ATOM   1722 C  CA  . THR A  1  237 ? 3.845   38.445 15.748  1.00 29.40 ? 272  THR A CA  1 
ATOM   1723 C  C   . THR A  1  237 ? 5.048   37.947 14.936  1.00 33.80 ? 272  THR A C   1 
ATOM   1724 O  O   . THR A  1  237 ? 5.272   36.748 14.817  1.00 33.85 ? 272  THR A O   1 
ATOM   1725 C  CB  . THR A  1  237 ? 4.277   38.434 17.207  1.00 37.45 ? 272  THR A CB  1 
ATOM   1726 O  OG1 . THR A  1  237 ? 3.116   38.498 18.043  1.00 42.00 ? 272  THR A OG1 1 
ATOM   1727 C  CG2 . THR A  1  237 ? 5.188   39.642 17.497  1.00 30.99 ? 272  THR A CG2 1 
ATOM   1728 N  N   . PHE A  1  238 ? 5.826   38.869 14.383  1.00 32.74 ? 273  PHE A N   1 
ATOM   1729 C  CA  . PHE A  1  238 ? 7.103   38.489 13.787  1.00 28.38 ? 273  PHE A CA  1 
ATOM   1730 C  C   . PHE A  1  238 ? 8.239   39.053 14.629  1.00 36.20 ? 273  PHE A C   1 
ATOM   1731 O  O   . PHE A  1  238 ? 9.341   39.321 14.124  1.00 38.99 ? 273  PHE A O   1 
ATOM   1732 C  CB  . PHE A  1  238 ? 7.215   38.977 12.352  1.00 33.32 ? 273  PHE A CB  1 
ATOM   1733 C  CG  . PHE A  1  238 ? 6.444   38.140 11.370  1.00 29.77 ? 273  PHE A CG  1 
ATOM   1734 C  CD1 . PHE A  1  238 ? 5.081   37.980 11.511  1.00 32.70 ? 273  PHE A CD1 1 
ATOM   1735 C  CD2 . PHE A  1  238 ? 7.088   37.525 10.308  1.00 29.90 ? 273  PHE A CD2 1 
ATOM   1736 C  CE1 . PHE A  1  238 ? 4.364   37.202 10.606  1.00 28.59 ? 273  PHE A CE1 1 
ATOM   1737 C  CE2 . PHE A  1  238 ? 6.387   36.766 9.412   1.00 31.30 ? 273  PHE A CE2 1 
ATOM   1738 C  CZ  . PHE A  1  238 ? 5.016   36.617 9.556   1.00 30.80 ? 273  PHE A CZ  1 
ATOM   1739 N  N   . PHE A  1  239 ? 7.948   39.255 15.910  1.00 33.34 ? 274  PHE A N   1 
ATOM   1740 C  CA  . PHE A  1  239 ? 8.961   39.680 16.865  1.00 33.97 ? 274  PHE A CA  1 
ATOM   1741 C  C   . PHE A  1  239 ? 8.693   39.030 18.210  1.00 35.74 ? 274  PHE A C   1 
ATOM   1742 O  O   . PHE A  1  239 ? 7.553   38.980 18.660  1.00 34.97 ? 274  PHE A O   1 
ATOM   1743 C  CB  . PHE A  1  239 ? 8.978   41.208 16.982  1.00 33.45 ? 274  PHE A CB  1 
ATOM   1744 N  N   . TRP A  1  240 ? 9.736   38.514 18.857  1.00 28.18 ? 275  TRP A N   1 
ATOM   1745 C  CA  . TRP A  1  240 ? 9.569   37.974 20.198  1.00 33.35 ? 275  TRP A CA  1 
ATOM   1746 C  C   . TRP A  1  240 ? 10.610  38.604 21.103  1.00 31.18 ? 275  TRP A C   1 
ATOM   1747 O  O   . TRP A  1  240 ? 11.786  38.626 20.751  1.00 34.62 ? 275  TRP A O   1 
ATOM   1748 C  CB  . TRP A  1  240 ? 9.766   36.449 20.193  1.00 32.29 ? 275  TRP A CB  1 
ATOM   1749 C  CG  . TRP A  1  240 ? 8.735   35.702 19.385  1.00 33.08 ? 275  TRP A CG  1 
ATOM   1750 C  CD1 . TRP A  1  240 ? 8.860   35.261 18.099  1.00 28.31 ? 275  TRP A CD1 1 
ATOM   1751 C  CD2 . TRP A  1  240 ? 7.422   35.313 19.820  1.00 30.56 ? 275  TRP A CD2 1 
ATOM   1752 N  NE1 . TRP A  1  240 ? 7.698   34.616 17.704  1.00 27.05 ? 275  TRP A NE1 1 
ATOM   1753 C  CE2 . TRP A  1  240 ? 6.808   34.633 18.747  1.00 28.18 ? 275  TRP A CE2 1 
ATOM   1754 C  CE3 . TRP A  1  240 ? 6.711   35.466 21.016  1.00 32.25 ? 275  TRP A CE3 1 
ATOM   1755 C  CZ2 . TRP A  1  240 ? 5.513   34.112 18.833  1.00 27.78 ? 275  TRP A CZ2 1 
ATOM   1756 C  CZ3 . TRP A  1  240 ? 5.420   34.942 21.097  1.00 30.49 ? 275  TRP A CZ3 1 
ATOM   1757 C  CH2 . TRP A  1  240 ? 4.841   34.277 20.011  1.00 29.51 ? 275  TRP A CH2 1 
ATOM   1758 N  N   . SER A  1  241 ? 10.172  39.124 22.247  1.00 36.27 ? 276  SER A N   1 
ATOM   1759 C  CA  . SER A  1  241 ? 11.091  39.641 23.266  1.00 40.21 ? 276  SER A CA  1 
ATOM   1760 C  C   . SER A  1  241 ? 12.004  38.520 23.721  1.00 38.98 ? 276  SER A C   1 
ATOM   1761 O  O   . SER A  1  241 ? 11.546  37.404 23.971  1.00 36.83 ? 276  SER A O   1 
ATOM   1762 C  CB  . SER A  1  241 ? 10.337  40.188 24.483  1.00 41.12 ? 276  SER A CB  1 
ATOM   1763 O  OG  . SER A  1  241 ? 9.595   41.350 24.166  1.00 49.21 ? 276  SER A OG  1 
ATOM   1764 N  N   . VAL A  1  242 ? 13.289  38.829 23.851  1.00 39.59 ? 277  VAL A N   1 
ATOM   1765 C  CA  . VAL A  1  242 ? 14.287  37.825 24.186  1.00 39.84 ? 277  VAL A CA  1 
ATOM   1766 C  C   . VAL A  1  242 ? 13.980  37.105 25.488  1.00 38.84 ? 277  VAL A C   1 
ATOM   1767 O  O   . VAL A  1  242 ? 14.407  35.964 25.679  1.00 41.16 ? 277  VAL A O   1 
ATOM   1768 C  CB  . VAL A  1  242 ? 15.708  38.436 24.277  1.00 42.30 ? 277  VAL A CB  1 
ATOM   1769 C  CG1 . VAL A  1  242 ? 16.059  39.151 22.976  1.00 43.26 ? 277  VAL A CG1 1 
ATOM   1770 C  CG2 . VAL A  1  242 ? 15.812  39.383 25.466  1.00 44.99 ? 277  VAL A CG2 1 
ATOM   1771 N  N   . SER A  1  243 ? 13.239  37.766 26.370  1.00 39.93 ? 278  SER A N   1 
ATOM   1772 C  CA  . SER A  1  243 ? 12.963  37.225 27.703  1.00 40.54 ? 278  SER A CA  1 
ATOM   1773 C  C   . SER A  1  243 ? 11.856  36.166 27.732  1.00 39.97 ? 278  SER A C   1 
ATOM   1774 O  O   . SER A  1  243 ? 11.669  35.493 28.743  1.00 46.87 ? 278  SER A O   1 
ATOM   1775 C  CB  . SER A  1  243 ? 12.605  38.353 28.677  1.00 43.40 ? 278  SER A CB  1 
ATOM   1776 O  OG  . SER A  1  243 ? 11.262  38.777 28.487  1.00 52.22 ? 278  SER A OG  1 
ATOM   1777 N  N   . ILE A  1  244 ? 11.128  36.017 26.634  1.00 32.72 ? 279  ILE A N   1 
ATOM   1778 C  CA  . ILE A  1  244 ? 10.057  35.029 26.565  1.00 33.97 ? 279  ILE A CA  1 
ATOM   1779 C  C   . ILE A  1  244 ? 10.622  33.677 26.146  1.00 30.54 ? 279  ILE A C   1 
ATOM   1780 O  O   . ILE A  1  244 ? 11.169  33.543 25.053  1.00 28.02 ? 279  ILE A O   1 
ATOM   1781 C  CB  . ILE A  1  244 ? 8.967   35.467 25.563  1.00 34.24 ? 279  ILE A CB  1 
ATOM   1782 C  CG1 . ILE A  1  244 ? 8.436   36.844 25.950  1.00 39.59 ? 279  ILE A CG1 1 
ATOM   1783 C  CG2 . ILE A  1  244 ? 7.826   34.452 25.505  1.00 30.70 ? 279  ILE A CG2 1 
ATOM   1784 C  CD1 . ILE A  1  244 ? 7.284   37.311 25.098  1.00 35.26 ? 279  ILE A CD1 1 
ATOM   1785 N  N   . PRO A  1  245 ? 10.503  32.665 27.018  1.00 30.39 ? 280  PRO A N   1 
ATOM   1786 C  CA  . PRO A  1  245 ? 11.062  31.347 26.683  1.00 30.75 ? 280  PRO A CA  1 
ATOM   1787 C  C   . PRO A  1  245 ? 10.438  30.731 25.436  1.00 28.46 ? 280  PRO A C   1 
ATOM   1788 O  O   . PRO A  1  245 ? 9.280   30.986 25.133  1.00 24.37 ? 280  PRO A O   1 
ATOM   1789 C  CB  . PRO A  1  245 ? 10.701  30.484 27.894  1.00 30.90 ? 280  PRO A CB  1 
ATOM   1790 C  CG  . PRO A  1  245 ? 9.602   31.223 28.615  1.00 33.18 ? 280  PRO A CG  1 
ATOM   1791 C  CD  . PRO A  1  245 ? 9.796   32.676 28.313  1.00 29.30 ? 280  PRO A CD  1 
ATOM   1792 N  N   . HIS A  1  246 ? 11.190  29.887 24.740  1.00 25.54 ? 281  HIS A N   1 
ATOM   1793 C  CA  . HIS A  1  246 ? 10.670  29.257 23.526  1.00 25.83 ? 281  HIS A CA  1 
ATOM   1794 C  C   . HIS A  1  246 ? 9.364   28.502 23.751  1.00 26.41 ? 281  HIS A C   1 
ATOM   1795 O  O   . HIS A  1  246 ? 8.461   28.542 22.910  1.00 24.11 ? 281  HIS A O   1 
ATOM   1796 C  CB  . HIS A  1  246 ? 11.719  28.324 22.926  1.00 25.33 ? 281  HIS A CB  1 
ATOM   1797 C  CG  . HIS A  1  246 ? 12.937  29.047 22.456  1.00 29.91 ? 281  HIS A CG  1 
ATOM   1798 N  ND1 . HIS A  1  246 ? 13.989  28.412 21.830  1.00 30.27 ? 281  HIS A ND1 1 
ATOM   1799 C  CD2 . HIS A  1  246 ? 13.263  30.361 22.502  1.00 26.07 ? 281  HIS A CD2 1 
ATOM   1800 C  CE1 . HIS A  1  246 ? 14.917  29.303 21.525  1.00 30.57 ? 281  HIS A CE1 1 
ATOM   1801 N  NE2 . HIS A  1  246 ? 14.502  30.492 21.923  1.00 28.47 ? 281  HIS A NE2 1 
ATOM   1802 N  N   . GLU A  1  247 ? 9.260   27.827 24.888  1.00 23.03 ? 282  GLU A N   1 
ATOM   1803 C  CA  . GLU A  1  247 ? 8.038   27.074 25.180  1.00 26.58 ? 282  GLU A CA  1 
ATOM   1804 C  C   . GLU A  1  247 ? 6.799   27.976 25.233  1.00 27.52 ? 282  GLU A C   1 
ATOM   1805 O  O   . GLU A  1  247 ? 5.715   27.569 24.831  1.00 25.59 ? 282  GLU A O   1 
ATOM   1806 C  CB  . GLU A  1  247 ? 8.200   26.305 26.477  1.00 27.58 ? 282  GLU A CB  1 
ATOM   1807 C  CG  . GLU A  1  247 ? 9.299   25.250 26.430  1.00 27.35 ? 282  GLU A CG  1 
ATOM   1808 C  CD  . GLU A  1  247 ? 10.650  25.767 26.894  1.00 29.14 ? 282  GLU A CD  1 
ATOM   1809 O  OE1 . GLU A  1  247 ? 10.881  26.998 26.946  1.00 27.12 ? 282  GLU A OE1 1 
ATOM   1810 O  OE2 . GLU A  1  247 ? 11.509  24.921 27.213  1.00 35.39 ? 282  GLU A OE2 1 
ATOM   1811 N  N   . ARG A  1  248 ? 6.969   29.200 25.726  1.00 25.37 ? 283  ARG A N   1 
ATOM   1812 C  CA  . ARG A  1  248 ? 5.867   30.158 25.799  1.00 25.08 ? 283  ARG A CA  1 
ATOM   1813 C  C   . ARG A  1  248 ? 5.553   30.694 24.409  1.00 26.15 ? 283  ARG A C   1 
ATOM   1814 O  O   . ARG A  1  248 ? 4.390   30.923 24.081  1.00 26.41 ? 283  ARG A O   1 
ATOM   1815 C  CB  . ARG A  1  248 ? 6.193   31.297 26.771  1.00 30.48 ? 283  ARG A CB  1 
ATOM   1816 C  CG  . ARG A  1  248 ? 5.199   32.453 26.793  1.00 30.21 ? 283  ARG A CG  1 
ATOM   1817 C  CD  . ARG A  1  248 ? 3.819   32.015 27.259  1.00 34.30 ? 283  ARG A CD  1 
ATOM   1818 N  NE  . ARG A  1  248 ? 3.833   31.350 28.566  1.00 31.47 ? 283  ARG A NE  1 
ATOM   1819 C  CZ  . ARG A  1  248 ? 2.847   30.570 29.001  1.00 33.22 ? 283  ARG A CZ  1 
ATOM   1820 N  NH1 . ARG A  1  248 ? 1.784   30.366 28.233  1.00 31.85 ? 283  ARG A NH1 1 
ATOM   1821 N  NH2 . ARG A  1  248 ? 2.916   29.993 30.199  1.00 34.38 ? 283  ARG A NH2 1 
ATOM   1822 N  N   . ARG A  1  249 ? 6.584   30.890 23.589  1.00 23.81 ? 284  ARG A N   1 
ATOM   1823 C  CA  . ARG A  1  249 ? 6.356   31.283 22.198  1.00 24.06 ? 284  ARG A CA  1 
ATOM   1824 C  C   . ARG A  1  249 ? 5.538   30.242 21.465  1.00 25.51 ? 284  ARG A C   1 
ATOM   1825 O  O   . ARG A  1  249 ? 4.653   30.586 20.674  1.00 23.97 ? 284  ARG A O   1 
ATOM   1826 C  CB  . ARG A  1  249 ? 7.672   31.496 21.443  1.00 24.93 ? 284  ARG A CB  1 
ATOM   1827 C  CG  . ARG A  1  249 ? 8.585   32.559 22.064  1.00 26.39 ? 284  ARG A CG  1 
ATOM   1828 C  CD  . ARG A  1  249 ? 9.939   32.651 21.349  1.00 25.70 ? 284  ARG A CD  1 
ATOM   1829 N  NE  . ARG A  1  249 ? 10.853  33.355 22.243  1.00 27.32 ? 284  ARG A NE  1 
ATOM   1830 C  CZ  . ARG A  1  249 ? 12.005  33.905 21.898  1.00 30.72 ? 284  ARG A CZ  1 
ATOM   1831 N  NH1 . ARG A  1  249 ? 12.444  33.822 20.650  1.00 27.16 ? 284  ARG A NH1 1 
ATOM   1832 N  NH2 . ARG A  1  249 ? 12.730  34.515 22.830  1.00 30.16 ? 284  ARG A NH2 1 
ATOM   1833 N  N   . ILE A  1  250 ? 5.869   28.968 21.674  1.00 23.52 ? 285  ILE A N   1 
ATOM   1834 C  CA  . ILE A  1  250 ? 5.114   27.888 21.039  1.00 22.78 ? 285  ILE A CA  1 
ATOM   1835 C  C   . ILE A  1  250 ? 3.667   27.817 21.564  1.00 22.90 ? 285  ILE A C   1 
ATOM   1836 O  O   . ILE A  1  250 ? 2.722   27.715 20.787  1.00 21.96 ? 285  ILE A O   1 
ATOM   1837 C  CB  . ILE A  1  250 ? 5.826   26.510 21.195  1.00 23.37 ? 285  ILE A CB  1 
ATOM   1838 C  CG1 . ILE A  1  250 ? 7.137   26.498 20.394  1.00 22.34 ? 285  ILE A CG1 1 
ATOM   1839 C  CG2 . ILE A  1  250 ? 4.923   25.364 20.726  1.00 21.63 ? 285  ILE A CG2 1 
ATOM   1840 C  CD1 . ILE A  1  250 ? 6.980   26.792 18.939  1.00 20.80 ? 285  ILE A CD1 1 
ATOM   1841 N  N   . LEU A  1  251 ? 3.498   27.871 22.879  1.00 22.07 ? 286  LEU A N   1 
ATOM   1842 C  CA  . LEU A  1  251 ? 2.144   27.842 23.466  1.00 25.11 ? 286  LEU A CA  1 
ATOM   1843 C  C   . LEU A  1  251 ? 1.273   29.001 22.973  1.00 25.43 ? 286  LEU A C   1 
ATOM   1844 O  O   . LEU A  1  251 ? 0.063   28.840 22.762  1.00 24.04 ? 286  LEU A O   1 
ATOM   1845 C  CB  . LEU A  1  251 ? 2.203   27.843 24.990  1.00 26.12 ? 286  LEU A CB  1 
ATOM   1846 C  CG  . LEU A  1  251 ? 2.621   26.488 25.577  1.00 27.75 ? 286  LEU A CG  1 
ATOM   1847 C  CD1 . LEU A  1  251 ? 2.916   26.607 27.047  1.00 29.22 ? 286  LEU A CD1 1 
ATOM   1848 C  CD2 . LEU A  1  251 ? 1.560   25.428 25.323  1.00 29.66 ? 286  LEU A CD2 1 
ATOM   1849 N  N   . THR A  1  252 ? 1.895   30.162 22.799  1.00 27.67 ? 287  THR A N   1 
ATOM   1850 C  CA  . THR A  1  252 ? 1.193   31.344 22.306  1.00 25.35 ? 287  THR A CA  1 
ATOM   1851 C  C   . THR A  1  252 ? 0.689   31.128 20.891  1.00 24.30 ? 287  THR A C   1 
ATOM   1852 O  O   . THR A  1  252 ? -0.467  31.407 20.592  1.00 24.51 ? 287  THR A O   1 
ATOM   1853 C  CB  . THR A  1  252 ? 2.083   32.599 22.384  1.00 24.73 ? 287  THR A CB  1 
ATOM   1854 O  OG1 . THR A  1  252 ? 2.361   32.905 23.751  1.00 29.69 ? 287  THR A OG1 1 
ATOM   1855 C  CG2 . THR A  1  252 ? 1.413   33.803 21.689  1.00 25.51 ? 287  THR A CG2 1 
ATOM   1856 N  N   . ILE A  1  253 ? 1.549   30.624 20.010  1.00 23.62 ? 288  ILE A N   1 
ATOM   1857 C  CA  . ILE A  1  253 ? 1.138   30.358 18.637  1.00 19.83 ? 288  ILE A CA  1 
ATOM   1858 C  C   . ILE A  1  253 ? -0.029  29.382 18.638  1.00 21.07 ? 288  ILE A C   1 
ATOM   1859 O  O   . ILE A  1  253 ? -1.034  29.580 17.954  1.00 23.46 ? 288  ILE A O   1 
ATOM   1860 C  CB  . ILE A  1  253 ? 2.326   29.806 17.798  1.00 19.23 ? 288  ILE A CB  1 
ATOM   1861 C  CG1 . ILE A  1  253 ? 3.306   30.952 17.493  1.00 20.95 ? 288  ILE A CG1 1 
ATOM   1862 C  CG2 . ILE A  1  253 ? 1.852   29.184 16.481  1.00 19.84 ? 288  ILE A CG2 1 
ATOM   1863 C  CD1 . ILE A  1  253 ? 4.725   30.447 17.055  1.00 21.50 ? 288  ILE A CD1 1 
ATOM   1864 N  N   . LEU A  1  254 ? 0.080   28.336 19.444  1.00 23.20 ? 289  LEU A N   1 
ATOM   1865 C  CA  . LEU A  1  254 ? -0.994  27.337 19.475  1.00 23.43 ? 289  LEU A CA  1 
ATOM   1866 C  C   . LEU A  1  254 ? -2.310  27.923 20.004  1.00 25.07 ? 289  LEU A C   1 
ATOM   1867 O  O   . LEU A  1  254 ? -3.383  27.600 19.487  1.00 27.06 ? 289  LEU A O   1 
ATOM   1868 C  CB  . LEU A  1  254 ? -0.576  26.125 20.303  1.00 24.48 ? 289  LEU A CB  1 
ATOM   1869 C  CG  . LEU A  1  254 ? 0.532   25.256 19.685  1.00 20.74 ? 289  LEU A CG  1 
ATOM   1870 C  CD1 . LEU A  1  254 ? 1.146   24.357 20.734  1.00 25.47 ? 289  LEU A CD1 1 
ATOM   1871 C  CD2 . LEU A  1  254 ? 0.074   24.474 18.435  1.00 27.64 ? 289  LEU A CD2 1 
ATOM   1872 N  N   . GLN A  1  255 ? -2.207  28.794 21.006  1.00 24.81 ? 290  GLN A N   1 
ATOM   1873 C  CA  . GLN A  1  255 ? -3.362  29.521 21.544  1.00 26.49 ? 290  GLN A CA  1 
ATOM   1874 C  C   . GLN A  1  255 ? -3.979  30.405 20.464  1.00 29.55 ? 290  GLN A C   1 
ATOM   1875 O  O   . GLN A  1  255 ? -5.201  30.403 20.278  1.00 28.18 ? 290  GLN A O   1 
ATOM   1876 C  CB  . GLN A  1  255 ? -2.945  30.367 22.745  1.00 27.40 ? 290  GLN A CB  1 
ATOM   1877 C  CG  . GLN A  1  255 ? -4.081  30.989 23.531  1.00 39.32 ? 290  GLN A CG  1 
ATOM   1878 C  CD  . GLN A  1  255 ? -4.445  30.159 24.743  1.00 47.31 ? 290  GLN A CD  1 
ATOM   1879 O  OE1 . GLN A  1  255 ? -3.567  29.711 25.488  1.00 50.67 ? 290  GLN A OE1 1 
ATOM   1880 N  NE2 . GLN A  1  255 ? -5.742  29.934 24.942  1.00 52.24 ? 290  GLN A NE2 1 
ATOM   1881 N  N   . TRP A  1  256 ? -3.156  31.161 19.739  1.00 24.49 ? 291  TRP A N   1 
ATOM   1882 C  CA  . TRP A  1  256 ? -3.700  31.950 18.645  1.00 23.61 ? 291  TRP A CA  1 
ATOM   1883 C  C   . TRP A  1  256 ? -4.415  31.083 17.589  1.00 24.62 ? 291  TRP A C   1 
ATOM   1884 O  O   . TRP A  1  256 ? -5.395  31.513 16.993  1.00 26.51 ? 291  TRP A O   1 
ATOM   1885 C  CB  . TRP A  1  256 ? -2.619  32.801 17.958  1.00 22.71 ? 291  TRP A CB  1 
ATOM   1886 C  CG  . TRP A  1  256 ? -2.061  33.962 18.760  1.00 24.54 ? 291  TRP A CG  1 
ATOM   1887 C  CD1 . TRP A  1  256 ? -2.690  34.700 19.738  1.00 27.80 ? 291  TRP A CD1 1 
ATOM   1888 C  CD2 . TRP A  1  256 ? -0.760  34.535 18.603  1.00 26.60 ? 291  TRP A CD2 1 
ATOM   1889 N  NE1 . TRP A  1  256 ? -1.846  35.699 20.195  1.00 25.78 ? 291  TRP A NE1 1 
ATOM   1890 C  CE2 . TRP A  1  256 ? -0.654  35.610 19.516  1.00 25.34 ? 291  TRP A CE2 1 
ATOM   1891 C  CE3 . TRP A  1  256 ? 0.331   34.239 17.775  1.00 25.79 ? 291  TRP A CE3 1 
ATOM   1892 C  CZ2 . TRP A  1  256 ? 0.498   36.395 19.618  1.00 25.64 ? 291  TRP A CZ2 1 
ATOM   1893 C  CZ3 . TRP A  1  256 ? 1.480   35.017 17.888  1.00 24.13 ? 291  TRP A CZ3 1 
ATOM   1894 C  CH2 . TRP A  1  256 ? 1.556   36.079 18.796  1.00 25.34 ? 291  TRP A CH2 1 
ATOM   1895 N  N   . LEU A  1  257 ? -3.902  29.881 17.321  1.00 24.21 ? 292  LEU A N   1 
ATOM   1896 C  CA  . LEU A  1  257 ? -4.530  28.990 16.348  1.00 25.96 ? 292  LEU A CA  1 
ATOM   1897 C  C   . LEU A  1  257 ? -5.865  28.442 16.853  1.00 27.98 ? 292  LEU A C   1 
ATOM   1898 O  O   . LEU A  1  257 ? -6.658  27.947 16.060  1.00 26.77 ? 292  LEU A O   1 
ATOM   1899 C  CB  . LEU A  1  257 ? -3.623  27.798 16.002  1.00 24.15 ? 292  LEU A CB  1 
ATOM   1900 C  CG  . LEU A  1  257 ? -2.476  28.112 15.039  1.00 24.34 ? 292  LEU A CG  1 
ATOM   1901 C  CD1 . LEU A  1  257 ? -1.344  27.055 15.125  1.00 27.01 ? 292  LEU A CD1 1 
ATOM   1902 C  CD2 . LEU A  1  257 ? -3.003  28.258 13.628  1.00 26.88 ? 292  LEU A CD2 1 
ATOM   1903 N  N   . SER A  1  258 ? -6.080  28.508 18.167  1.00 27.88 ? 293  SER A N   1 
ATOM   1904 C  CA  . SER A  1  258 ? -7.334  28.050 18.768  1.00 30.42 ? 293  SER A CA  1 
ATOM   1905 C  C   . SER A  1  258 ? -8.380  29.153 18.864  1.00 29.27 ? 293  SER A C   1 
ATOM   1906 O  O   . SER A  1  258 ? -9.481  28.930 19.376  1.00 31.00 ? 293  SER A O   1 
ATOM   1907 C  CB  . SER A  1  258 ? -7.078  27.497 20.171  1.00 32.47 ? 293  SER A CB  1 
ATOM   1908 O  OG  . SER A  1  258 ? -6.271  26.346 20.089  1.00 41.16 ? 293  SER A OG  1 
ATOM   1909 N  N   . LEU A  1  259 ? -8.055  30.342 18.376  1.00 25.91 ? 294  LEU A N   1 
ATOM   1910 C  CA  . LEU A  1  259 ? -8.964  31.471 18.481  1.00 25.94 ? 294  LEU A CA  1 
ATOM   1911 C  C   . LEU A  1  259 ? -10.191 31.307 17.585  1.00 26.96 ? 294  LEU A C   1 
ATOM   1912 O  O   . LEU A  1  259 ? -10.189 30.507 16.659  1.00 28.23 ? 294  LEU A O   1 
ATOM   1913 C  CB  . LEU A  1  259 ? -8.242  32.757 18.108  1.00 30.63 ? 294  LEU A CB  1 
ATOM   1914 C  CG  . LEU A  1  259 ? -7.287  33.383 19.119  1.00 25.86 ? 294  LEU A CG  1 
ATOM   1915 C  CD1 . LEU A  1  259 ? -6.522  34.475 18.403  1.00 27.95 ? 294  LEU A CD1 1 
ATOM   1916 C  CD2 . LEU A  1  259 ? -8.082  33.991 20.294  1.00 32.06 ? 294  LEU A CD2 1 
ATOM   1917 N  N   . PRO A  1  260 ? -11.253 32.075 17.879  1.00 30.33 ? 295  PRO A N   1 
ATOM   1918 C  CA  . PRO A  1  260 ? -12.457 32.131 17.042  1.00 31.36 ? 295  PRO A CA  1 
ATOM   1919 C  C   . PRO A  1  260 ? -12.086 32.467 15.598  1.00 31.97 ? 295  PRO A C   1 
ATOM   1920 O  O   . PRO A  1  260 ? -11.126 33.225 15.356  1.00 27.62 ? 295  PRO A O   1 
ATOM   1921 C  CB  . PRO A  1  260 ? -13.265 33.278 17.671  1.00 31.62 ? 295  PRO A CB  1 
ATOM   1922 C  CG  . PRO A  1  260 ? -12.866 33.250 19.110  1.00 35.91 ? 295  PRO A CG  1 
ATOM   1923 C  CD  . PRO A  1  260 ? -11.378 32.885 19.097  1.00 29.02 ? 295  PRO A CD  1 
ATOM   1924 N  N   . ASP A  1  261 ? -12.819 31.884 14.651  1.00 29.99 ? 296  ASP A N   1 
ATOM   1925 C  CA  . ASP A  1  261 ? -12.587 32.112 13.219  1.00 28.62 ? 296  ASP A CA  1 
ATOM   1926 C  C   . ASP A  1  261 ? -12.372 33.579 12.862  1.00 32.41 ? 296  ASP A C   1 
ATOM   1927 O  O   . ASP A  1  261 ? -11.640 33.879 11.925  1.00 30.90 ? 296  ASP A O   1 
ATOM   1928 C  CB  . ASP A  1  261 ? -13.774 31.602 12.378  1.00 32.49 ? 296  ASP A CB  1 
ATOM   1929 C  CG  . ASP A  1  261 ? -13.835 30.083 12.281  1.00 37.72 ? 296  ASP A CG  1 
ATOM   1930 O  OD1 . ASP A  1  261 ? -12.823 29.398 12.540  1.00 33.66 ? 296  ASP A OD1 1 
ATOM   1931 O  OD2 . ASP A  1  261 ? -14.916 29.564 11.926  1.00 40.50 ? 296  ASP A OD2 1 
ATOM   1932 N  N   . ASN A  1  262 ? -13.024 34.493 13.582  1.00 26.99 ? 297  ASN A N   1 
ATOM   1933 C  CA  . ASN A  1  262 ? -12.944 35.914 13.218  1.00 26.78 ? 297  ASN A CA  1 
ATOM   1934 C  C   . ASN A  1  262 ? -11.758 36.622 13.870  1.00 28.70 ? 297  ASN A C   1 
ATOM   1935 O  O   . ASN A  1  262 ? -11.528 37.811 13.646  1.00 30.80 ? 297  ASN A O   1 
ATOM   1936 C  CB  . ASN A  1  262 ? -14.261 36.660 13.515  1.00 27.32 ? 297  ASN A CB  1 
ATOM   1937 C  CG  . ASN A  1  262 ? -14.559 36.759 15.005  1.00 31.15 ? 297  ASN A CG  1 
ATOM   1938 O  OD1 . ASN A  1  262 ? -13.931 36.079 15.836  1.00 28.90 ? 297  ASN A OD1 1 
ATOM   1939 N  ND2 . ASN A  1  262 ? -15.518 37.615 15.358  1.00 26.34 ? 297  ASN A ND2 1 
ATOM   1940 N  N   . GLU A  1  263 ? -10.993 35.893 14.677  1.00 28.07 ? 298  GLU A N   1 
ATOM   1941 C  CA  . GLU A  1  263 ? -9.783  36.470 15.265  1.00 29.54 ? 298  GLU A CA  1 
ATOM   1942 C  C   . GLU A  1  263 ? -8.496  35.780 14.771  1.00 31.39 ? 298  GLU A C   1 
ATOM   1943 O  O   . GLU A  1  263 ? -7.412  36.374 14.810  1.00 29.75 ? 298  GLU A O   1 
ATOM   1944 C  CB  . GLU A  1  263 ? -9.852  36.410 16.801  1.00 30.35 ? 298  GLU A CB  1 
ATOM   1945 C  CG  . GLU A  1  263 ? -11.059 37.152 17.411  1.00 30.01 ? 298  GLU A CG  1 
ATOM   1946 C  CD  . GLU A  1  263 ? -11.124 36.985 18.918  1.00 42.67 ? 298  GLU A CD  1 
ATOM   1947 O  OE1 . GLU A  1  263 ? -10.053 36.803 19.525  1.00 43.65 ? 298  GLU A OE1 1 
ATOM   1948 O  OE2 . GLU A  1  263 ? -12.235 37.038 19.507  1.00 45.50 ? 298  GLU A OE2 1 
ATOM   1949 N  N   . ARG A  1  264 ? -8.618  34.545 14.298  1.00 25.74 ? 299  ARG A N   1 
ATOM   1950 C  CA  . ARG A  1  264 ? -7.433  33.689 14.110  1.00 27.15 ? 299  ARG A CA  1 
ATOM   1951 C  C   . ARG A  1  264 ? -6.473  34.185 13.014  1.00 25.09 ? 299  ARG A C   1 
ATOM   1952 O  O   . ARG A  1  264 ? -6.884  34.413 11.884  1.00 25.59 ? 299  ARG A O   1 
ATOM   1953 C  CB  . ARG A  1  264 ? -7.899  32.274 13.777  1.00 26.05 ? 299  ARG A CB  1 
ATOM   1954 C  CG  . ARG A  1  264 ? -6.839  31.211 13.886  1.00 27.62 ? 299  ARG A CG  1 
ATOM   1955 C  CD  . ARG A  1  264 ? -7.383  29.837 13.441  1.00 26.59 ? 299  ARG A CD  1 
ATOM   1956 N  NE  . ARG A  1  264 ? -8.147  29.890 12.206  1.00 32.37 ? 299  ARG A NE  1 
ATOM   1957 C  CZ  . ARG A  1  264 ? -9.467  29.683 12.138  1.00 27.66 ? 299  ARG A CZ  1 
ATOM   1958 N  NH1 . ARG A  1  264 ? -10.143 29.390 13.245  1.00 31.18 ? 299  ARG A NH1 1 
ATOM   1959 N  NH2 . ARG A  1  264 ? -10.087 29.742 10.972  1.00 32.96 ? 299  ARG A NH2 1 
ATOM   1960 N  N   . PRO A  1  265 ? -5.167  34.337 13.333  1.00 24.89 ? 300  PRO A N   1 
ATOM   1961 C  CA  . PRO A  1  265 ? -4.263  34.738 12.243  1.00 22.54 ? 300  PRO A CA  1 
ATOM   1962 C  C   . PRO A  1  265 ? -4.019  33.635 11.218  1.00 22.80 ? 300  PRO A C   1 
ATOM   1963 O  O   . PRO A  1  265 ? -4.225  32.460 11.501  1.00 23.46 ? 300  PRO A O   1 
ATOM   1964 C  CB  . PRO A  1  265 ? -2.945  35.059 12.960  1.00 21.71 ? 300  PRO A CB  1 
ATOM   1965 C  CG  . PRO A  1  265 ? -3.312  35.320 14.359  1.00 22.15 ? 300  PRO A CG  1 
ATOM   1966 C  CD  . PRO A  1  265 ? -4.515  34.417 14.644  1.00 25.41 ? 300  PRO A CD  1 
ATOM   1967 N  N   . SER A  1  266 ? -3.565  34.023 10.031  1.00 20.17 ? 301  SER A N   1 
ATOM   1968 C  CA  . SER A  1  266 ? -3.246  33.055 8.982   1.00 23.43 ? 301  SER A CA  1 
ATOM   1969 C  C   . SER A  1  266 ? -1.750  32.763 8.860   1.00 22.56 ? 301  SER A C   1 
ATOM   1970 O  O   . SER A  1  266 ? -1.357  31.738 8.303   1.00 21.51 ? 301  SER A O   1 
ATOM   1971 C  CB  . SER A  1  266 ? -3.725  33.556 7.640   1.00 24.86 ? 301  SER A CB  1 
ATOM   1972 O  OG  . SER A  1  266 ? -5.141  33.571 7.623   1.00 27.88 ? 301  SER A OG  1 
ATOM   1973 N  N   . VAL A  1  267 ? -0.934  33.694 9.326   1.00 21.40 ? 302  VAL A N   1 
ATOM   1974 C  CA  . VAL A  1  267 ? 0.530   33.494 9.274   1.00 19.48 ? 302  VAL A CA  1 
ATOM   1975 C  C   . VAL A  1  267 ? 1.148   33.731 10.642  1.00 20.82 ? 302  VAL A C   1 
ATOM   1976 O  O   . VAL A  1  267 ? 0.737   34.646 11.372  1.00 21.09 ? 302  VAL A O   1 
ATOM   1977 C  CB  . VAL A  1  267 ? 1.192   34.372 8.168   1.00 23.98 ? 302  VAL A CB  1 
ATOM   1978 C  CG1 . VAL A  1  267 ? 0.929   35.840 8.407   1.00 22.79 ? 302  VAL A CG1 1 
ATOM   1979 C  CG2 . VAL A  1  267 ? 2.732   34.108 8.064   1.00 18.91 ? 302  VAL A CG2 1 
ATOM   1980 N  N   . TYR A  1  268 ? 2.123   32.877 10.994  1.00 17.60 ? 303  TYR A N   1 
ATOM   1981 C  CA  . TYR A  1  268 ? 2.755   32.863 12.295  1.00 18.12 ? 303  TYR A CA  1 
ATOM   1982 C  C   . TYR A  1  268 ? 4.253   32.745 12.073  1.00 16.95 ? 303  TYR A C   1 
ATOM   1983 O  O   . TYR A  1  268 ? 4.704   32.167 11.091  1.00 18.10 ? 303  TYR A O   1 
ATOM   1984 C  CB  . TYR A  1  268 ? 2.323   31.640 13.111  1.00 20.32 ? 303  TYR A CB  1 
ATOM   1985 C  CG  . TYR A  1  268 ? 0.819   31.583 13.291  1.00 20.81 ? 303  TYR A CG  1 
ATOM   1986 C  CD1 . TYR A  1  268 ? 0.240   32.078 14.448  1.00 23.79 ? 303  TYR A CD1 1 
ATOM   1987 C  CD2 . TYR A  1  268 ? -0.007  31.118 12.273  1.00 20.83 ? 303  TYR A CD2 1 
ATOM   1988 C  CE1 . TYR A  1  268 ? -1.141  32.071 14.627  1.00 21.85 ? 303  TYR A CE1 1 
ATOM   1989 C  CE2 . TYR A  1  268 ? -1.416  31.122 12.428  1.00 20.48 ? 303  TYR A CE2 1 
ATOM   1990 C  CZ  . TYR A  1  268 ? -1.954  31.584 13.619  1.00 24.31 ? 303  TYR A CZ  1 
ATOM   1991 O  OH  . TYR A  1  268 ? -3.330  31.605 13.833  1.00 23.01 ? 303  TYR A OH  1 
ATOM   1992 N  N   . ALA A  1  269 ? 5.000   33.313 13.008  1.00 19.99 ? 304  ALA A N   1 
ATOM   1993 C  CA  . ALA A  1  269 ? 6.461   33.181 12.995  1.00 17.63 ? 304  ALA A CA  1 
ATOM   1994 C  C   . ALA A  1  269 ? 6.959   32.796 14.371  1.00 20.23 ? 304  ALA A C   1 
ATOM   1995 O  O   . ALA A  1  269 ? 6.532   33.350 15.398  1.00 18.60 ? 304  ALA A O   1 
ATOM   1996 C  CB  . ALA A  1  269 ? 7.091   34.485 12.580  1.00 19.25 ? 304  ALA A CB  1 
ATOM   1997 N  N   . PHE A  1  270 ? 7.890   31.842 14.387  1.00 17.78 ? 305  PHE A N   1 
ATOM   1998 C  CA  . PHE A  1  270 ? 8.610   31.486 15.579  1.00 18.92 ? 305  PHE A CA  1 
ATOM   1999 C  C   . PHE A  1  270 ? 10.076  31.773 15.259  1.00 17.32 ? 305  PHE A C   1 
ATOM   2000 O  O   . PHE A  1  270 ? 10.501  31.580 14.121  1.00 19.17 ? 305  PHE A O   1 
ATOM   2001 C  CB  . PHE A  1  270 ? 8.449   29.991 15.926  1.00 18.22 ? 305  PHE A CB  1 
ATOM   2002 C  CG  . PHE A  1  270 ? 9.410   29.527 17.002  1.00 21.77 ? 305  PHE A CG  1 
ATOM   2003 C  CD1 . PHE A  1  270 ? 9.066   29.592 18.344  1.00 19.99 ? 305  PHE A CD1 1 
ATOM   2004 C  CD2 . PHE A  1  270 ? 10.659  29.035 16.656  1.00 20.45 ? 305  PHE A CD2 1 
ATOM   2005 C  CE1 . PHE A  1  270 ? 9.944   29.189 19.343  1.00 24.20 ? 305  PHE A CE1 1 
ATOM   2006 C  CE2 . PHE A  1  270 ? 11.555  28.637 17.636  1.00 19.68 ? 305  PHE A CE2 1 
ATOM   2007 C  CZ  . PHE A  1  270 ? 11.213  28.707 18.979  1.00 21.95 ? 305  PHE A CZ  1 
ATOM   2008 N  N   . TYR A  1  271 ? 10.817  32.260 16.254  1.00 18.56 ? 306  TYR A N   1 
ATOM   2009 C  CA  . TYR A  1  271 ? 12.254  32.517 16.104  1.00 18.11 ? 306  TYR A CA  1 
ATOM   2010 C  C   . TYR A  1  271 ? 13.027  31.901 17.270  1.00 18.73 ? 306  TYR A C   1 
ATOM   2011 O  O   . TYR A  1  271 ? 12.652  32.058 18.439  1.00 21.06 ? 306  TYR A O   1 
ATOM   2012 C  CB  . TYR A  1  271 ? 12.547  34.028 16.042  1.00 22.05 ? 306  TYR A CB  1 
ATOM   2013 C  CG  . TYR A  1  271 ? 14.028  34.373 16.180  1.00 18.15 ? 306  TYR A CG  1 
ATOM   2014 C  CD1 . TYR A  1  271 ? 14.911  34.211 15.105  1.00 20.49 ? 306  TYR A CD1 1 
ATOM   2015 C  CD2 . TYR A  1  271 ? 14.536  34.852 17.382  1.00 24.25 ? 306  TYR A CD2 1 
ATOM   2016 C  CE1 . TYR A  1  271 ? 16.285  34.531 15.249  1.00 19.36 ? 306  TYR A CE1 1 
ATOM   2017 C  CE2 . TYR A  1  271 ? 15.891  35.171 17.524  1.00 24.02 ? 306  TYR A CE2 1 
ATOM   2018 C  CZ  . TYR A  1  271 ? 16.754  35.009 16.458  1.00 25.71 ? 306  TYR A CZ  1 
ATOM   2019 O  OH  . TYR A  1  271 ? 18.087  35.332 16.659  1.00 22.61 ? 306  TYR A OH  1 
ATOM   2020 N  N   . SER A  1  272 ? 14.119  31.217 16.943  1.00 17.39 ? 307  SER A N   1 
ATOM   2021 C  CA  . SER A  1  272 ? 15.073  30.748 17.927  1.00 19.36 ? 307  SER A CA  1 
ATOM   2022 C  C   . SER A  1  272 ? 16.451  31.343 17.704  1.00 16.17 ? 307  SER A C   1 
ATOM   2023 O  O   . SER A  1  272 ? 16.936  31.362 16.586  1.00 18.05 ? 307  SER A O   1 
ATOM   2024 C  CB  . SER A  1  272 ? 15.224  29.231 17.860  1.00 21.99 ? 307  SER A CB  1 
ATOM   2025 O  OG  . SER A  1  272 ? 16.258  28.858 18.737  1.00 23.79 ? 307  SER A OG  1 
ATOM   2026 N  N   . GLU A  1  273 ? 17.076  31.803 18.781  1.00 19.39 ? 308  GLU A N   1 
ATOM   2027 C  CA  . GLU A  1  273 ? 18.418  32.389 18.701  1.00 21.43 ? 308  GLU A CA  1 
ATOM   2028 C  C   . GLU A  1  273 ? 19.502  31.320 18.676  1.00 22.64 ? 308  GLU A C   1 
ATOM   2029 O  O   . GLU A  1  273 ? 20.705  31.617 18.484  1.00 21.31 ? 308  GLU A O   1 
ATOM   2030 C  CB  . GLU A  1  273 ? 18.632  33.324 19.875  1.00 24.51 ? 308  GLU A CB  1 
ATOM   2031 C  CG  . GLU A  1  273 ? 18.843  32.614 21.201  1.00 24.72 ? 308  GLU A CG  1 
ATOM   2032 C  CD  . GLU A  1  273 ? 17.557  32.073 21.845  1.00 32.91 ? 308  GLU A CD  1 
ATOM   2033 O  OE1 . GLU A  1  273 ? 17.697  31.210 22.759  1.00 35.14 ? 308  GLU A OE1 1 
ATOM   2034 O  OE2 . GLU A  1  273 ? 16.425  32.494 21.449  1.00 28.89 ? 308  GLU A OE2 1 
ATOM   2035 N  N   . GLN A  1  274 ? 19.090  30.076 18.883  1.00 18.66 ? 309  GLN A N   1 
ATOM   2036 C  CA  . GLN A  1  274 ? 19.963  28.920 18.678  1.00 19.09 ? 309  GLN A CA  1 
ATOM   2037 C  C   . GLN A  1  274 ? 19.752  28.326 17.271  1.00 18.16 ? 309  GLN A C   1 
ATOM   2038 O  O   . GLN A  1  274 ? 18.679  28.451 16.685  1.00 21.11 ? 309  GLN A O   1 
ATOM   2039 C  CB  . GLN A  1  274 ? 19.689  27.873 19.783  1.00 20.77 ? 309  GLN A CB  1 
ATOM   2040 C  CG  . GLN A  1  274 ? 20.212  28.279 21.168  1.00 26.18 ? 309  GLN A CG  1 
ATOM   2041 C  CD  . GLN A  1  274 ? 21.723  28.046 21.303  1.00 26.32 ? 309  GLN A CD  1 
ATOM   2042 O  OE1 . GLN A  1  274 ? 22.482  28.253 20.355  1.00 21.94 ? 309  GLN A OE1 1 
ATOM   2043 N  NE2 . GLN A  1  274 ? 22.151  27.578 22.470  1.00 26.25 ? 309  GLN A NE2 1 
ATOM   2044 N  N   . PRO A  1  275 ? 20.767  27.646 16.706  1.00 17.04 ? 310  PRO A N   1 
ATOM   2045 C  CA  . PRO A  1  275 ? 22.034  27.276 17.334  1.00 15.92 ? 310  PRO A CA  1 
ATOM   2046 C  C   . PRO A  1  275 ? 23.148  28.304 17.193  1.00 19.96 ? 310  PRO A C   1 
ATOM   2047 O  O   . PRO A  1  275 ? 24.295  27.977 17.487  1.00 20.32 ? 310  PRO A O   1 
ATOM   2048 C  CB  . PRO A  1  275 ? 22.394  25.982 16.608  1.00 17.43 ? 310  PRO A CB  1 
ATOM   2049 C  CG  . PRO A  1  275 ? 21.881  26.200 15.228  1.00 19.91 ? 310  PRO A CG  1 
ATOM   2050 C  CD  . PRO A  1  275 ? 20.581  26.966 15.405  1.00 18.41 ? 310  PRO A CD  1 
ATOM   2051 N  N   . ASP A  1  276 ? 22.806  29.535 16.832  1.00 18.85 ? 311  ASP A N   1 
ATOM   2052 C  CA  . ASP A  1  276 ? 23.795  30.593 16.649  1.00 20.47 ? 311  ASP A CA  1 
ATOM   2053 C  C   . ASP A  1  276 ? 24.624  30.834 17.908  1.00 19.83 ? 311  ASP A C   1 
ATOM   2054 O  O   . ASP A  1  276 ? 25.857  30.881 17.855  1.00 21.18 ? 311  ASP A O   1 
ATOM   2055 C  CB  . ASP A  1  276 ? 23.079  31.883 16.204  1.00 19.58 ? 311  ASP A CB  1 
ATOM   2056 C  CG  . ASP A  1  276 ? 24.052  33.032 15.896  1.00 17.73 ? 311  ASP A CG  1 
ATOM   2057 O  OD1 . ASP A  1  276 ? 24.706  32.986 14.840  1.00 17.34 ? 311  ASP A OD1 1 
ATOM   2058 O  OD2 . ASP A  1  276 ? 24.143  33.959 16.727  1.00 23.74 ? 311  ASP A OD2 1 
ATOM   2059 N  N   . PHE A  1  277 ? 23.970  31.004 19.056  1.00 20.55 ? 312  PHE A N   1 
ATOM   2060 C  CA  . PHE A  1  277 ? 24.716  31.272 20.284  1.00 21.65 ? 312  PHE A CA  1 
ATOM   2061 C  C   . PHE A  1  277 ? 25.779  30.218 20.551  1.00 26.33 ? 312  PHE A C   1 
ATOM   2062 O  O   . PHE A  1  277 ? 26.945  30.551 20.794  1.00 22.06 ? 312  PHE A O   1 
ATOM   2063 C  CB  . PHE A  1  277 ? 23.829  31.415 21.540  1.00 25.16 ? 312  PHE A CB  1 
ATOM   2064 C  CG  . PHE A  1  277 ? 24.646  31.470 22.830  1.00 30.98 ? 312  PHE A CG  1 
ATOM   2065 C  CD1 . PHE A  1  277 ? 25.122  32.682 23.321  1.00 35.44 ? 312  PHE A CD1 1 
ATOM   2066 C  CD2 . PHE A  1  277 ? 25.003  30.306 23.497  1.00 31.93 ? 312  PHE A CD2 1 
ATOM   2067 C  CE1 . PHE A  1  277 ? 25.898  32.733 24.477  1.00 36.91 ? 312  PHE A CE1 1 
ATOM   2068 C  CE2 . PHE A  1  277 ? 25.785  30.351 24.653  1.00 37.58 ? 312  PHE A CE2 1 
ATOM   2069 C  CZ  . PHE A  1  277 ? 26.228  31.570 25.141  1.00 38.87 ? 312  PHE A CZ  1 
ATOM   2070 N  N   . SER A  1  278 ? 25.386  28.948 20.523  1.00 22.60 ? 313  SER A N   1 
ATOM   2071 C  CA  . SER A  1  278 ? 26.350  27.891 20.801  1.00 23.28 ? 313  SER A CA  1 
ATOM   2072 C  C   . SER A  1  278 ? 27.382  27.752 19.682  1.00 25.83 ? 313  SER A C   1 
ATOM   2073 O  O   . SER A  1  278 ? 28.539  27.415 19.947  1.00 22.66 ? 313  SER A O   1 
ATOM   2074 C  CB  . SER A  1  278 ? 25.630  26.570 21.094  1.00 26.58 ? 313  SER A CB  1 
ATOM   2075 O  OG  . SER A  1  278 ? 24.907  26.688 22.325  1.00 24.42 ? 313  SER A OG  1 
ATOM   2076 N  N   . GLY A  1  279 ? 26.978  28.031 18.441  1.00 19.34 ? 314  GLY A N   1 
ATOM   2077 C  CA  . GLY A  1  279 ? 27.944  28.093 17.345  1.00 18.80 ? 314  GLY A CA  1 
ATOM   2078 C  C   . GLY A  1  279 ? 29.075  29.087 17.608  1.00 19.22 ? 314  GLY A C   1 
ATOM   2079 O  O   . GLY A  1  279 ? 30.251  28.772 17.412  1.00 20.40 ? 314  GLY A O   1 
ATOM   2080 N  N   . HIS A  1  280 ? 28.737  30.304 18.028  1.00 18.03 ? 315  HIS A N   1 
ATOM   2081 C  CA  . HIS A  1  280 ? 29.771  31.269 18.428  1.00 20.98 ? 315  HIS A CA  1 
ATOM   2082 C  C   . HIS A  1  280 ? 30.711  30.781 19.528  1.00 23.42 ? 315  HIS A C   1 
ATOM   2083 O  O   . HIS A  1  280 ? 31.927  30.949 19.444  1.00 21.37 ? 315  HIS A O   1 
ATOM   2084 C  CB  . HIS A  1  280 ? 29.142  32.583 18.872  1.00 18.25 ? 315  HIS A CB  1 
ATOM   2085 C  CG  . HIS A  1  280 ? 28.568  33.365 17.736  1.00 21.32 ? 315  HIS A CG  1 
ATOM   2086 N  ND1 . HIS A  1  280 ? 29.363  33.975 16.787  1.00 18.22 ? 315  HIS A ND1 1 
ATOM   2087 C  CD2 . HIS A  1  280 ? 27.287  33.626 17.385  1.00 18.30 ? 315  HIS A CD2 1 
ATOM   2088 C  CE1 . HIS A  1  280 ? 28.590  34.586 15.902  1.00 20.50 ? 315  HIS A CE1 1 
ATOM   2089 N  NE2 . HIS A  1  280 ? 27.332  34.410 16.258  1.00 18.42 ? 315  HIS A NE2 1 
ATOM   2090 N  N   . LYS A  1  281 ? 30.142  30.199 20.573  1.00 22.07 ? 316  LYS A N   1 
ATOM   2091 C  CA  . LYS A  1  281 ? 30.938  29.741 21.703  1.00 22.84 ? 316  LYS A CA  1 
ATOM   2092 C  C   . LYS A  1  281 ? 31.855  28.572 21.367  1.00 26.81 ? 316  LYS A C   1 
ATOM   2093 O  O   . LYS A  1  281 ? 33.021  28.567 21.792  1.00 28.20 ? 316  LYS A O   1 
ATOM   2094 C  CB  . LYS A  1  281 ? 30.024  29.356 22.870  1.00 26.97 ? 316  LYS A CB  1 
ATOM   2095 C  CG  . LYS A  1  281 ? 30.782  28.847 24.105  1.00 30.32 ? 316  LYS A CG  1 
ATOM   2096 C  CD  . LYS A  1  281 ? 29.851  28.566 25.283  1.00 39.22 ? 316  LYS A CD  1 
ATOM   2097 C  CE  . LYS A  1  281 ? 30.651  28.102 26.495  1.00 43.99 ? 316  LYS A CE  1 
ATOM   2098 N  NZ  . LYS A  1  281 ? 29.770  27.597 27.590  1.00 50.61 ? 316  LYS A NZ  1 
ATOM   2099 N  N   . TYR A  1  282 ? 31.337  27.579 20.641  1.00 22.80 ? 317  TYR A N   1 
ATOM   2100 C  CA  . TYR A  1  282 ? 32.053  26.308 20.482  1.00 27.77 ? 317  TYR A CA  1 
ATOM   2101 C  C   . TYR A  1  282 ? 32.523  26.014 19.070  1.00 27.00 ? 317  TYR A C   1 
ATOM   2102 O  O   . TYR A  1  282 ? 33.263  25.047 18.849  1.00 29.39 ? 317  TYR A O   1 
ATOM   2103 C  CB  . TYR A  1  282 ? 31.189  25.129 20.947  1.00 27.59 ? 317  TYR A CB  1 
ATOM   2104 C  CG  . TYR A  1  282 ? 30.711  25.215 22.373  1.00 34.17 ? 317  TYR A CG  1 
ATOM   2105 C  CD1 . TYR A  1  282 ? 31.583  25.011 23.434  1.00 38.31 ? 317  TYR A CD1 1 
ATOM   2106 C  CD2 . TYR A  1  282 ? 29.378  25.475 22.657  1.00 31.65 ? 317  TYR A CD2 1 
ATOM   2107 C  CE1 . TYR A  1  282 ? 31.138  25.081 24.754  1.00 41.03 ? 317  TYR A CE1 1 
ATOM   2108 C  CE2 . TYR A  1  282 ? 28.926  25.536 23.955  1.00 38.22 ? 317  TYR A CE2 1 
ATOM   2109 C  CZ  . TYR A  1  282 ? 29.808  25.343 25.002  1.00 44.29 ? 317  TYR A CZ  1 
ATOM   2110 O  OH  . TYR A  1  282 ? 29.344  25.408 26.299  1.00 49.74 ? 317  TYR A OH  1 
ATOM   2111 N  N   . GLY A  1  283 ? 32.071  26.812 18.106  1.00 24.65 ? 318  GLY A N   1 
ATOM   2112 C  CA  . GLY A  1  283 ? 32.404  26.564 16.719  1.00 21.67 ? 318  GLY A CA  1 
ATOM   2113 C  C   . GLY A  1  283 ? 31.424  25.553 16.147  1.00 25.23 ? 318  GLY A C   1 
ATOM   2114 O  O   . GLY A  1  283 ? 30.773  24.835 16.916  1.00 25.67 ? 318  GLY A O   1 
ATOM   2115 N  N   . PRO A  1  284 ? 31.317  25.478 14.814  1.00 23.69 ? 319  PRO A N   1 
ATOM   2116 C  CA  . PRO A  1  284 ? 30.276  24.649 14.180  1.00 22.67 ? 319  PRO A CA  1 
ATOM   2117 C  C   . PRO A  1  284 ? 30.503  23.135 14.287  1.00 26.70 ? 319  PRO A C   1 
ATOM   2118 O  O   . PRO A  1  284 ? 29.531  22.390 14.201  1.00 30.86 ? 319  PRO A O   1 
ATOM   2119 C  CB  . PRO A  1  284 ? 30.335  25.070 12.704  1.00 24.24 ? 319  PRO A CB  1 
ATOM   2120 C  CG  . PRO A  1  284 ? 31.730  25.592 12.538  1.00 20.61 ? 319  PRO A CG  1 
ATOM   2121 C  CD  . PRO A  1  284 ? 32.041  26.290 13.813  1.00 20.85 ? 319  PRO A CD  1 
ATOM   2122 N  N   . PHE A  1  285 ? 31.739  22.685 14.470  1.00 28.01 ? 320  PHE A N   1 
ATOM   2123 C  CA  . PHE A  1  285 ? 32.004  21.245 14.500  1.00 30.82 ? 320  PHE A CA  1 
ATOM   2124 C  C   . PHE A  1  285 ? 32.209  20.739 15.922  1.00 33.32 ? 320  PHE A C   1 
ATOM   2125 O  O   . PHE A  1  285 ? 32.614  19.599 16.133  1.00 36.26 ? 320  PHE A O   1 
ATOM   2126 C  CB  . PHE A  1  285 ? 33.211  20.900 13.623  1.00 32.87 ? 320  PHE A CB  1 
ATOM   2127 C  CG  . PHE A  1  285 ? 33.028  21.270 12.171  1.00 41.77 ? 320  PHE A CG  1 
ATOM   2128 C  CD1 . PHE A  1  285 ? 32.174  20.547 11.363  1.00 45.01 ? 320  PHE A CD1 1 
ATOM   2129 C  CD2 . PHE A  1  285 ? 33.711  22.345 11.620  1.00 37.47 ? 320  PHE A CD2 1 
ATOM   2130 C  CE1 . PHE A  1  285 ? 32.007  20.885 10.025  1.00 47.96 ? 320  PHE A CE1 1 
ATOM   2131 C  CE2 . PHE A  1  285 ? 33.547  22.684 10.290  1.00 41.40 ? 320  PHE A CE2 1 
ATOM   2132 C  CZ  . PHE A  1  285 ? 32.696  21.950 9.493   1.00 41.80 ? 320  PHE A CZ  1 
ATOM   2133 N  N   . GLY A  1  286 ? 31.921  21.598 16.892  1.00 33.08 ? 321  GLY A N   1 
ATOM   2134 C  CA  . GLY A  1  286 ? 32.112  21.273 18.295  1.00 35.42 ? 321  GLY A CA  1 
ATOM   2135 C  C   . GLY A  1  286 ? 31.201  20.156 18.774  1.00 35.38 ? 321  GLY A C   1 
ATOM   2136 O  O   . GLY A  1  286 ? 30.065  20.035 18.313  1.00 31.39 ? 321  GLY A O   1 
ATOM   2137 N  N   . PRO A  1  287 ? 31.694  19.314 19.699  1.00 34.16 ? 322  PRO A N   1 
ATOM   2138 C  CA  . PRO A  1  287 ? 30.768  18.313 20.245  1.00 34.66 ? 322  PRO A CA  1 
ATOM   2139 C  C   . PRO A  1  287 ? 29.669  19.020 21.006  1.00 31.83 ? 322  PRO A C   1 
ATOM   2140 O  O   . PRO A  1  287 ? 28.575  18.484 21.203  1.00 33.34 ? 322  PRO A O   1 
ATOM   2141 C  CB  . PRO A  1  287 ? 31.650  17.491 21.202  1.00 34.98 ? 322  PRO A CB  1 
ATOM   2142 C  CG  . PRO A  1  287 ? 32.835  18.360 21.482  1.00 37.58 ? 322  PRO A CG  1 
ATOM   2143 C  CD  . PRO A  1  287 ? 33.054  19.177 20.240  1.00 33.18 ? 322  PRO A CD  1 
ATOM   2144 N  N   . GLU A  1  288 ? 29.951  20.240 21.438  1.00 31.50 ? 323  GLU A N   1 
ATOM   2145 C  CA  . GLU A  1  288 ? 28.992  20.940 22.262  1.00 33.00 ? 323  GLU A CA  1 
ATOM   2146 C  C   . GLU A  1  288 ? 27.764  21.393 21.465  1.00 30.79 ? 323  GLU A C   1 
ATOM   2147 O  O   . GLU A  1  288 ? 26.823  21.909 22.054  1.00 32.65 ? 323  GLU A O   1 
ATOM   2148 C  CB  . GLU A  1  288 ? 29.648  22.119 23.007  1.00 33.92 ? 323  GLU A CB  1 
ATOM   2149 C  CG  . GLU A  1  288 ? 30.837  21.737 23.894  1.00 36.93 ? 323  GLU A CG  1 
ATOM   2150 C  CD  . GLU A  1  288 ? 32.170  21.674 23.142  1.00 40.17 ? 323  GLU A CD  1 
ATOM   2151 O  OE1 . GLU A  1  288 ? 32.166  21.608 21.893  1.00 33.96 ? 323  GLU A OE1 1 
ATOM   2152 O  OE2 . GLU A  1  288 ? 33.236  21.687 23.807  1.00 43.47 ? 323  GLU A OE2 1 
ATOM   2153 N  N   . MET A  1  289 ? 27.768  21.181 20.146  1.00 27.67 ? 324  MET A N   1 
ATOM   2154 C  CA  . MET A  1  289 ? 26.649  21.628 19.291  1.00 26.07 ? 324  MET A CA  1 
ATOM   2155 C  C   . MET A  1  289 ? 25.482  20.655 19.328  1.00 25.81 ? 324  MET A C   1 
ATOM   2156 O  O   . MET A  1  289 ? 24.366  20.987 18.931  1.00 24.07 ? 324  MET A O   1 
ATOM   2157 C  CB  . MET A  1  289 ? 27.069  21.802 17.824  1.00 29.67 ? 324  MET A CB  1 
ATOM   2158 C  CG  . MET A  1  289 ? 28.009  22.965 17.552  1.00 30.25 ? 324  MET A CG  1 
ATOM   2159 S  SD  . MET A  1  289 ? 27.361  24.501 18.196  1.00 26.64 ? 324  MET A SD  1 
ATOM   2160 C  CE  . MET A  1  289 ? 25.834  24.694 17.233  1.00 21.68 ? 324  MET A CE  1 
ATOM   2161 N  N   . THR A  1  290 ? 25.737  19.434 19.764  1.00 24.74 ? 325  THR A N   1 
ATOM   2162 C  CA  . THR A  1  290 ? 24.674  18.438 19.780  1.00 26.26 ? 325  THR A CA  1 
ATOM   2163 C  C   . THR A  1  290 ? 23.505  18.875 20.648  1.00 26.17 ? 325  THR A C   1 
ATOM   2164 O  O   . THR A  1  290 ? 22.353  18.809 20.224  1.00 27.45 ? 325  THR A O   1 
ATOM   2165 C  CB  . THR A  1  290 ? 25.187  17.068 20.247  1.00 31.95 ? 325  THR A CB  1 
ATOM   2166 O  OG1 . THR A  1  290 ? 26.332  16.712 19.468  1.00 32.07 ? 325  THR A OG1 1 
ATOM   2167 C  CG2 . THR A  1  290 ? 24.138  16.026 20.034  1.00 33.20 ? 325  THR A CG2 1 
ATOM   2168 N  N   . ASN A  1  291 ? 23.803  19.349 21.855  1.00 24.44 ? 326  ASN A N   1 
ATOM   2169 C  CA  . ASN A  1  291 ? 22.756  19.691 22.810  1.00 31.10 ? 326  ASN A CA  1 
ATOM   2170 C  C   . ASN A  1  291 ? 21.825  20.801 22.326  1.00 29.93 ? 326  ASN A C   1 
ATOM   2171 O  O   . ASN A  1  291 ? 20.612  20.667 22.426  1.00 25.99 ? 326  ASN A O   1 
ATOM   2172 C  CB  . ASN A  1  291 ? 23.347  20.035 24.175  1.00 31.95 ? 326  ASN A CB  1 
ATOM   2173 C  CG  . ASN A  1  291 ? 22.277  20.296 25.222  1.00 45.45 ? 326  ASN A CG  1 
ATOM   2174 O  OD1 . ASN A  1  291 ? 21.660  19.357 25.745  1.00 51.46 ? 326  ASN A OD1 1 
ATOM   2175 N  ND2 . ASN A  1  291 ? 22.045  21.578 25.532  1.00 46.86 ? 326  ASN A ND2 1 
ATOM   2176 N  N   . PRO A  1  292 ? 22.385  21.904 21.788  1.00 30.16 ? 327  PRO A N   1 
ATOM   2177 C  CA  . PRO A  1  292 ? 21.467  22.950 21.305  1.00 25.91 ? 327  PRO A CA  1 
ATOM   2178 C  C   . PRO A  1  292 ? 20.597  22.463 20.163  1.00 24.22 ? 327  PRO A C   1 
ATOM   2179 O  O   . PRO A  1  292 ? 19.464  22.897 20.021  1.00 25.34 ? 327  PRO A O   1 
ATOM   2180 C  CB  . PRO A  1  292 ? 22.410  24.054 20.794  1.00 30.33 ? 327  PRO A CB  1 
ATOM   2181 C  CG  . PRO A  1  292 ? 23.732  23.771 21.419  1.00 30.21 ? 327  PRO A CG  1 
ATOM   2182 C  CD  . PRO A  1  292 ? 23.800  22.312 21.742  1.00 29.84 ? 327  PRO A CD  1 
ATOM   2183 N  N   . LEU A  1  293 ? 21.138  21.592 19.313  1.00 24.52 ? 328  LEU A N   1 
ATOM   2184 C  CA  . LEU A  1  293 ? 20.375  21.056 18.208  1.00 24.52 ? 328  LEU A CA  1 
ATOM   2185 C  C   . LEU A  1  293 ? 19.270  20.127 18.712  1.00 24.85 ? 328  LEU A C   1 
ATOM   2186 O  O   . LEU A  1  293 ? 18.170  20.108 18.172  1.00 21.71 ? 328  LEU A O   1 
ATOM   2187 C  CB  . LEU A  1  293 ? 21.277  20.336 17.213  1.00 23.97 ? 328  LEU A CB  1 
ATOM   2188 C  CG  . LEU A  1  293 ? 22.229  21.262 16.436  1.00 22.53 ? 328  LEU A CG  1 
ATOM   2189 C  CD1 . LEU A  1  293 ? 23.215  20.440 15.631  1.00 25.83 ? 328  LEU A CD1 1 
ATOM   2190 C  CD2 . LEU A  1  293 ? 21.442  22.192 15.522  1.00 20.74 ? 328  LEU A CD2 1 
ATOM   2191 N  N   . ARG A  1  294 ? 19.558  19.369 19.758  1.00 22.44 ? 329  ARG A N   1 
ATOM   2192 C  CA  . ARG A  1  294 ? 18.502  18.564 20.367  1.00 27.50 ? 329  ARG A CA  1 
ATOM   2193 C  C   . ARG A  1  294 ? 17.373  19.441 20.909  1.00 25.38 ? 329  ARG A C   1 
ATOM   2194 O  O   . ARG A  1  294 ? 16.177  19.121 20.739  1.00 21.37 ? 329  ARG A O   1 
ATOM   2195 C  CB  . ARG A  1  294 ? 19.061  17.729 21.506  1.00 28.89 ? 329  ARG A CB  1 
ATOM   2196 C  CG  . ARG A  1  294 ? 20.048  16.661 21.103  1.00 28.00 ? 329  ARG A CG  1 
ATOM   2197 C  CD  . ARG A  1  294 ? 20.307  15.783 22.335  1.00 30.74 ? 329  ARG A CD  1 
ATOM   2198 N  NE  . ARG A  1  294 ? 21.408  14.834 22.162  1.00 32.06 ? 329  ARG A NE  1 
ATOM   2199 C  CZ  . ARG A  1  294 ? 21.293  13.667 21.538  1.00 36.41 ? 329  ARG A CZ  1 
ATOM   2200 N  NH1 . ARG A  1  294 ? 22.353  12.865 21.441  1.00 37.83 ? 329  ARG A NH1 1 
ATOM   2201 N  NH2 . ARG A  1  294 ? 20.127  13.306 21.006  1.00 35.20 ? 329  ARG A NH2 1 
ATOM   2202 N  N   . GLU A  1  295 ? 17.754  20.541 21.553  1.00 24.29 ? 330  GLU A N   1 
ATOM   2203 C  CA  . GLU A  1  295 ? 16.775  21.455 22.168  1.00 28.12 ? 330  GLU A CA  1 
ATOM   2204 C  C   . GLU A  1  295 ? 15.860  22.082 21.129  1.00 26.32 ? 330  GLU A C   1 
ATOM   2205 O  O   . GLU A  1  295 ? 14.646  22.185 21.334  1.00 22.96 ? 330  GLU A O   1 
ATOM   2206 C  CB  . GLU A  1  295 ? 17.450  22.587 22.951  1.00 28.37 ? 330  GLU A CB  1 
ATOM   2207 C  CG  . GLU A  1  295 ? 18.251  22.172 24.173  1.00 36.14 ? 330  GLU A CG  1 
ATOM   2208 C  CD  . GLU A  1  295 ? 18.524  23.361 25.082  1.00 46.94 ? 330  GLU A CD  1 
ATOM   2209 O  OE1 . GLU A  1  295 ? 17.600  24.193 25.257  1.00 53.38 ? 330  GLU A OE1 1 
ATOM   2210 O  OE2 . GLU A  1  295 ? 19.653  23.479 25.616  1.00 47.85 ? 330  GLU A OE2 1 
ATOM   2211 N  N   . ILE A  1  296 ? 16.438  22.527 20.019  1.00 23.46 ? 331  ILE A N   1 
ATOM   2212 C  CA  . ILE A  1  296 ? 15.615  23.048 18.928  1.00 22.46 ? 331  ILE A CA  1 
ATOM   2213 C  C   . ILE A  1  296 ? 14.655  21.981 18.414  1.00 22.90 ? 331  ILE A C   1 
ATOM   2214 O  O   . ILE A  1  296 ? 13.481  22.245 18.139  1.00 20.53 ? 331  ILE A O   1 
ATOM   2215 C  CB  . ILE A  1  296 ? 16.468  23.534 17.747  1.00 24.46 ? 331  ILE A CB  1 
ATOM   2216 C  CG1 . ILE A  1  296 ? 17.367  24.695 18.170  1.00 23.46 ? 331  ILE A CG1 1 
ATOM   2217 C  CG2 . ILE A  1  296 ? 15.559  23.970 16.601  1.00 24.49 ? 331  ILE A CG2 1 
ATOM   2218 C  CD1 . ILE A  1  296 ? 18.523  24.975 17.173  1.00 25.36 ? 331  ILE A CD1 1 
ATOM   2219 N  N   . ASP A  1  297 ? 15.160  20.756 18.287  1.00 23.75 ? 332  ASP A N   1 
ATOM   2220 C  CA  . ASP A  1  297 ? 14.316  19.678 17.807  1.00 23.86 ? 332  ASP A CA  1 
ATOM   2221 C  C   . ASP A  1  297 ? 13.166  19.419 18.771  1.00 21.73 ? 332  ASP A C   1 
ATOM   2222 O  O   . ASP A  1  297 ? 12.058  19.167 18.342  1.00 22.62 ? 332  ASP A O   1 
ATOM   2223 C  CB  . ASP A  1  297 ? 15.092  18.380 17.567  1.00 24.58 ? 332  ASP A CB  1 
ATOM   2224 C  CG  . ASP A  1  297 ? 14.266  17.373 16.776  1.00 23.98 ? 332  ASP A CG  1 
ATOM   2225 O  OD1 . ASP A  1  297 ? 14.115  17.565 15.565  1.00 23.45 ? 332  ASP A OD1 1 
ATOM   2226 O  OD2 . ASP A  1  297 ? 13.714  16.419 17.384  1.00 26.18 ? 332  ASP A OD2 1 
ATOM   2227 N  N   . LYS A  1  298 ? 13.441  19.487 20.068  1.00 22.66 ? 333  LYS A N   1 
ATOM   2228 C  CA  . LYS A  1  298 ? 12.383  19.319 21.073  1.00 23.37 ? 333  LYS A CA  1 
ATOM   2229 C  C   . LYS A  1  298 ? 11.305  20.381 20.900  1.00 27.88 ? 333  LYS A C   1 
ATOM   2230 O  O   . LYS A  1  298 ? 10.107  20.094 20.982  1.00 25.24 ? 333  LYS A O   1 
ATOM   2231 C  CB  . LYS A  1  298 ? 12.972  19.375 22.473  1.00 27.22 ? 333  LYS A CB  1 
ATOM   2232 C  CG  . LYS A  1  298 ? 11.924  19.288 23.599  1.00 31.43 ? 333  LYS A CG  1 
ATOM   2233 C  CD  . LYS A  1  298 ? 12.556  19.029 24.966  1.00 37.57 ? 333  LYS A CD  1 
ATOM   2234 C  CE  . LYS A  1  298 ? 11.463  18.655 25.997  1.00 42.63 ? 333  LYS A CE  1 
ATOM   2235 N  NZ  . LYS A  1  298 ? 11.999  18.439 27.396  1.00 46.70 ? 333  LYS A NZ  1 
ATOM   2236 N  N   . THR A  1  299 ? 11.735  21.612 20.634  1.00 23.56 ? 334  THR A N   1 
ATOM   2237 C  CA  . THR A  1  299 ? 10.796  22.699 20.341  1.00 23.24 ? 334  THR A CA  1 
ATOM   2238 C  C   . THR A  1  299 ? 9.949   22.426 19.079  1.00 22.38 ? 334  THR A C   1 
ATOM   2239 O  O   . THR A  1  299 ? 8.728   22.617 19.077  1.00 22.85 ? 334  THR A O   1 
ATOM   2240 C  CB  . THR A  1  299 ? 11.555  24.046 20.224  1.00 21.14 ? 334  THR A CB  1 
ATOM   2241 O  OG1 . THR A  1  299 ? 12.273  24.290 21.444  1.00 23.12 ? 334  THR A OG1 1 
ATOM   2242 C  CG2 . THR A  1  299 ? 10.568  25.187 19.938  1.00 21.80 ? 334  THR A CG2 1 
ATOM   2243 N  N   . VAL A  1  300 ? 10.572  21.971 18.000  1.00 19.12 ? 335  VAL A N   1 
ATOM   2244 C  CA  . VAL A  1  300 ? 9.811   21.592 16.817  1.00 21.47 ? 335  VAL A CA  1 
ATOM   2245 C  C   . VAL A  1  300 ? 8.790   20.496 17.183  1.00 20.75 ? 335  VAL A C   1 
ATOM   2246 O  O   . VAL A  1  300 ? 7.655   20.502 16.704  1.00 19.74 ? 335  VAL A O   1 
ATOM   2247 C  CB  . VAL A  1  300 ? 10.740  21.151 15.632  1.00 20.26 ? 335  VAL A CB  1 
ATOM   2248 C  CG1 . VAL A  1  300 ? 9.911   20.608 14.470  1.00 16.77 ? 335  VAL A CG1 1 
ATOM   2249 C  CG2 . VAL A  1  300 ? 11.634  22.328 15.169  1.00 19.71 ? 335  VAL A CG2 1 
ATOM   2250 N  N   . GLY A  1  301 ? 9.183   19.596 18.082  1.00 24.12 ? 336  GLY A N   1 
ATOM   2251 C  CA  . GLY A  1  301 ? 8.298   18.512 18.504  1.00 22.64 ? 336  GLY A CA  1 
ATOM   2252 C  C   . GLY A  1  301 ? 7.104   19.029 19.281  1.00 26.07 ? 336  GLY A C   1 
ATOM   2253 O  O   . GLY A  1  301 ? 5.960   18.569 19.094  1.00 28.38 ? 336  GLY A O   1 
ATOM   2254 N  N   . GLN A  1  302 ? 7.367   19.985 20.163  1.00 24.25 ? 337  GLN A N   1 
ATOM   2255 C  CA  . GLN A  1  302 ? 6.289   20.632 20.904  1.00 23.77 ? 337  GLN A CA  1 
ATOM   2256 C  C   . GLN A  1  302 ? 5.301   21.226 19.931  1.00 25.73 ? 337  GLN A C   1 
ATOM   2257 O  O   . GLN A  1  302 ? 4.084   21.035 20.073  1.00 23.62 ? 337  GLN A O   1 
ATOM   2258 C  CB  . GLN A  1  302 ? 6.821   21.670 21.895  1.00 24.84 ? 337  GLN A CB  1 
ATOM   2259 C  CG  . GLN A  1  302 ? 7.475   21.006 23.099  1.00 27.09 ? 337  GLN A CG  1 
ATOM   2260 C  CD  . GLN A  1  302 ? 8.233   21.965 23.978  1.00 30.06 ? 337  GLN A CD  1 
ATOM   2261 O  OE1 . GLN A  1  302 ? 8.777   21.575 25.020  1.00 36.99 ? 337  GLN A OE1 1 
ATOM   2262 N  NE2 . GLN A  1  302 ? 8.260   23.230 23.588  1.00 26.69 ? 337  GLN A NE2 1 
ATOM   2263 N  N   . LEU A  1  303 ? 5.810   21.920 18.916  1.00 22.33 ? 338  LEU A N   1 
ATOM   2264 C  CA  . LEU A  1  303 ? 4.900   22.548 17.943  1.00 21.91 ? 338  LEU A CA  1 
ATOM   2265 C  C   . LEU A  1  303 ? 4.089   21.498 17.200  1.00 26.23 ? 338  LEU A C   1 
ATOM   2266 O  O   . LEU A  1  303 ? 2.866   21.612 17.067  1.00 25.04 ? 338  LEU A O   1 
ATOM   2267 C  CB  . LEU A  1  303 ? 5.683   23.409 16.942  1.00 22.28 ? 338  LEU A CB  1 
ATOM   2268 C  CG  . LEU A  1  303 ? 4.858   23.992 15.792  1.00 23.02 ? 338  LEU A CG  1 
ATOM   2269 C  CD1 . LEU A  1  303 ? 3.725   24.894 16.325  1.00 25.35 ? 338  LEU A CD1 1 
ATOM   2270 C  CD2 . LEU A  1  303 ? 5.732   24.749 14.772  1.00 22.02 ? 338  LEU A CD2 1 
ATOM   2271 N  N   . MET A  1  304 ? 4.761   20.450 16.725  1.00 23.28 ? 339  MET A N   1 
ATOM   2272 C  CA  . MET A  1  304 ? 4.057   19.449 15.918  1.00 25.07 ? 339  MET A CA  1 
ATOM   2273 C  C   . MET A  1  304 ? 3.051   18.633 16.762  1.00 26.28 ? 339  MET A C   1 
ATOM   2274 O  O   . MET A  1  304 ? 1.921   18.374 16.304  1.00 28.06 ? 339  MET A O   1 
ATOM   2275 C  CB  . MET A  1  304 ? 5.025   18.537 15.154  1.00 23.01 ? 339  MET A CB  1 
ATOM   2276 C  CG  . MET A  1  304 ? 5.937   19.262 14.110  1.00 22.57 ? 339  MET A CG  1 
ATOM   2277 S  SD  . MET A  1  304 ? 5.069   20.385 13.002  1.00 24.20 ? 339  MET A SD  1 
ATOM   2278 C  CE  . MET A  1  304 ? 4.084   19.301 11.964  1.00 28.10 ? 339  MET A CE  1 
ATOM   2279 N  N   . ASP A  1  305 ? 3.454   18.262 17.975  1.00 26.84 ? 340  ASP A N   1 
ATOM   2280 C  CA  . ASP A  1  305 ? 2.548   17.611 18.942  1.00 27.94 ? 340  ASP A CA  1 
ATOM   2281 C  C   . ASP A  1  305 ? 1.344   18.510 19.219  1.00 30.48 ? 340  ASP A C   1 
ATOM   2282 O  O   . ASP A  1  305 ? 0.189   18.056 19.291  1.00 30.64 ? 340  ASP A O   1 
ATOM   2283 C  CB  . ASP A  1  305 ? 3.267   17.351 20.264  1.00 26.19 ? 340  ASP A CB  1 
ATOM   2284 C  CG  . ASP A  1  305 ? 4.234   16.172 20.206  1.00 28.33 ? 340  ASP A CG  1 
ATOM   2285 O  OD1 . ASP A  1  305 ? 4.283   15.468 19.183  1.00 30.48 ? 340  ASP A OD1 1 
ATOM   2286 O  OD2 . ASP A  1  305 ? 4.970   15.970 21.196  1.00 30.09 ? 340  ASP A OD2 1 
ATOM   2287 N  N   . GLY A  1  306 ? 1.621   19.796 19.400  1.00 27.70 ? 341  GLY A N   1 
ATOM   2288 C  CA  . GLY A  1  306 ? 0.582   20.778 19.638  1.00 31.85 ? 341  GLY A CA  1 
ATOM   2289 C  C   . GLY A  1  306 ? -0.375  20.884 18.474  1.00 29.18 ? 341  GLY A C   1 
ATOM   2290 O  O   . GLY A  1  306 ? -1.601  20.972 18.668  1.00 29.66 ? 341  GLY A O   1 
ATOM   2291 N  N   . LEU A  1  307 ? 0.162   20.872 17.257  1.00 24.97 ? 342  LEU A N   1 
ATOM   2292 C  CA  . LEU A  1  307 ? -0.666  20.969 16.059  1.00 24.49 ? 342  LEU A CA  1 
ATOM   2293 C  C   . LEU A  1  307 ? -1.541  19.721 15.888  1.00 29.23 ? 342  LEU A C   1 
ATOM   2294 O  O   . LEU A  1  307 ? -2.696  19.805 15.476  1.00 31.12 ? 342  LEU A O   1 
ATOM   2295 C  CB  . LEU A  1  307 ? 0.186   21.142 14.801  1.00 24.53 ? 342  LEU A CB  1 
ATOM   2296 C  CG  . LEU A  1  307 ? 0.869   22.513 14.642  1.00 23.24 ? 342  LEU A CG  1 
ATOM   2297 C  CD1 . LEU A  1  307 ? 1.741   22.512 13.387  1.00 26.35 ? 342  LEU A CD1 1 
ATOM   2298 C  CD2 . LEU A  1  307 ? -0.169  23.626 14.607  1.00 23.95 ? 342  LEU A CD2 1 
ATOM   2299 N  N   . LYS A  1  308 ? -0.948  18.570 16.181  1.00 29.47 ? 343  LYS A N   1 
ATOM   2300 C  CA  . LYS A  1  308 ? -1.670  17.305 16.154  1.00 31.19 ? 343  LYS A CA  1 
ATOM   2301 C  C   . LYS A  1  308 ? -2.807  17.339 17.175  1.00 31.94 ? 343  LYS A C   1 
ATOM   2302 O  O   . LYS A  1  308 ? -3.932  16.948 16.861  1.00 35.84 ? 343  LYS A O   1 
ATOM   2303 C  CB  . LYS A  1  308 ? -0.721  16.150 16.447  1.00 30.76 ? 343  LYS A CB  1 
ATOM   2304 C  CG  . LYS A  1  308 ? -1.327  14.780 16.190  1.00 35.43 ? 343  LYS A CG  1 
ATOM   2305 C  CD  . LYS A  1  308 ? -0.381  13.685 16.646  1.00 34.49 ? 343  LYS A CD  1 
ATOM   2306 C  CE  . LYS A  1  308 ? -1.028  12.305 16.512  1.00 40.02 ? 343  LYS A CE  1 
ATOM   2307 N  NZ  . LYS A  1  308 ? -0.260  11.283 17.288  1.00 37.17 ? 343  LYS A NZ  1 
ATOM   2308 N  N   . GLN A  1  309 ? -2.527  17.828 18.380  1.00 31.88 ? 344  GLN A N   1 
ATOM   2309 C  CA  . GLN A  1  309 ? -3.576  18.025 19.393  1.00 37.96 ? 344  GLN A CA  1 
ATOM   2310 C  C   . GLN A  1  309 ? -4.750  18.865 18.895  1.00 37.71 ? 344  GLN A C   1 
ATOM   2311 O  O   . GLN A  1  309 ? -5.895  18.639 19.301  1.00 40.89 ? 344  GLN A O   1 
ATOM   2312 C  CB  . GLN A  1  309 ? -3.016  18.666 20.674  1.00 36.56 ? 344  GLN A CB  1 
ATOM   2313 C  CG  . GLN A  1  309 ? -2.143  17.749 21.496  1.00 39.80 ? 344  GLN A CG  1 
ATOM   2314 C  CD  . GLN A  1  309 ? -2.012  18.176 22.951  1.00 42.28 ? 344  GLN A CD  1 
ATOM   2315 O  OE1 . GLN A  1  309 ? -1.848  17.332 23.834  1.00 42.47 ? 344  GLN A OE1 1 
ATOM   2316 N  NE2 . GLN A  1  309 ? -2.081  19.487 23.209  1.00 40.31 ? 344  GLN A NE2 1 
ATOM   2317 N  N   . LEU A  1  310 ? -4.461  19.841 18.036  1.00 31.69 ? 345  LEU A N   1 
ATOM   2318 C  CA  . LEU A  1  310 ? -5.470  20.737 17.486  1.00 32.09 ? 345  LEU A CA  1 
ATOM   2319 C  C   . LEU A  1  310 ? -6.053  20.227 16.189  1.00 28.13 ? 345  LEU A C   1 
ATOM   2320 O  O   . LEU A  1  310 ? -6.860  20.901 15.545  1.00 30.19 ? 345  LEU A O   1 
ATOM   2321 C  CB  . LEU A  1  310 ? -4.860  22.118 17.241  1.00 31.73 ? 345  LEU A CB  1 
ATOM   2322 C  CG  . LEU A  1  310 ? -4.384  22.859 18.481  1.00 33.12 ? 345  LEU A CG  1 
ATOM   2323 C  CD1 . LEU A  1  310 ? -3.972  24.267 18.076  1.00 31.00 ? 345  LEU A CD1 1 
ATOM   2324 C  CD2 . LEU A  1  310 ? -5.497  22.900 19.519  1.00 37.34 ? 345  LEU A CD2 1 
ATOM   2325 N  N   . LYS A  1  311 ? -5.637  19.031 15.797  1.00 28.76 ? 346  LYS A N   1 
ATOM   2326 C  CA  . LYS A  1  311 ? -6.062  18.442 14.534  1.00 29.91 ? 346  LYS A CA  1 
ATOM   2327 C  C   . LYS A  1  311 ? -5.622  19.298 13.340  1.00 31.28 ? 346  LYS A C   1 
ATOM   2328 O  O   . LYS A  1  311 ? -6.318  19.393 12.334  1.00 25.54 ? 346  LYS A O   1 
ATOM   2329 C  CB  . LYS A  1  311 ? -7.591  18.215 14.534  1.00 32.58 ? 346  LYS A CB  1 
ATOM   2330 C  CG  . LYS A  1  311 ? -8.090  17.462 15.758  1.00 35.27 ? 346  LYS A CG  1 
ATOM   2331 C  CD  . LYS A  1  311 ? -9.593  17.178 15.655  1.00 38.21 ? 346  LYS A CD  1 
ATOM   2332 C  CE  . LYS A  1  311 ? -10.162 16.716 16.991  1.00 49.03 ? 346  LYS A CE  1 
ATOM   2333 N  NZ  . LYS A  1  311 ? -9.567  15.421 17.422  1.00 49.14 ? 346  LYS A NZ  1 
ATOM   2334 N  N   . LEU A  1  312 ? -4.433  19.896 13.459  1.00 28.34 ? 347  LEU A N   1 
ATOM   2335 C  CA  . LEU A  1  312 ? -3.926  20.817 12.451  1.00 30.21 ? 347  LEU A CA  1 
ATOM   2336 C  C   . LEU A  1  312 ? -2.676  20.286 11.743  1.00 30.16 ? 347  LEU A C   1 
ATOM   2337 O  O   . LEU A  1  312 ? -2.142  20.947 10.860  1.00 25.37 ? 347  LEU A O   1 
ATOM   2338 C  CB  . LEU A  1  312 ? -3.620  22.180 13.105  1.00 28.22 ? 347  LEU A CB  1 
ATOM   2339 C  CG  . LEU A  1  312 ? -4.860  22.973 13.542  1.00 27.37 ? 347  LEU A CG  1 
ATOM   2340 C  CD1 . LEU A  1  312 ? -4.483  24.302 14.177  1.00 29.42 ? 347  LEU A CD1 1 
ATOM   2341 C  CD2 . LEU A  1  312 ? -5.735  23.203 12.329  1.00 29.45 ? 347  LEU A CD2 1 
ATOM   2342 N  N   . HIS A  1  313 ? -2.222  19.088 12.095  1.00 27.97 ? 348  HIS A N   1 
ATOM   2343 C  CA  . HIS A  1  313 ? -0.900  18.653 11.631  1.00 29.95 ? 348  HIS A CA  1 
ATOM   2344 C  C   . HIS A  1  313 ? -0.864  18.312 10.158  1.00 31.79 ? 348  HIS A C   1 
ATOM   2345 O  O   . HIS A  1  313 ? 0.214   18.128 9.612   1.00 24.92 ? 348  HIS A O   1 
ATOM   2346 C  CB  . HIS A  1  313 ? -0.381  17.480 12.457  1.00 27.68 ? 348  HIS A CB  1 
ATOM   2347 C  CG  . HIS A  1  313 ? -1.362  16.364 12.568  1.00 31.02 ? 348  HIS A CG  1 
ATOM   2348 N  ND1 . HIS A  1  313 ? -1.109  15.094 12.096  1.00 36.69 ? 348  HIS A ND1 1 
ATOM   2349 C  CD2 . HIS A  1  313 ? -2.613  16.335 13.083  1.00 29.53 ? 348  HIS A CD2 1 
ATOM   2350 C  CE1 . HIS A  1  313 ? -2.161  14.327 12.323  1.00 29.33 ? 348  HIS A CE1 1 
ATOM   2351 N  NE2 . HIS A  1  313 ? -3.087  15.055 12.918  1.00 37.38 ? 348  HIS A NE2 1 
ATOM   2352 N  N   . ARG A  1  314 ? -2.033  18.204 9.520   1.00 28.79 ? 349  ARG A N   1 
ATOM   2353 C  CA  . ARG A  1  314 ? -2.102  17.965 8.081   1.00 31.31 ? 349  ARG A CA  1 
ATOM   2354 C  C   . ARG A  1  314 ? -2.878  19.096 7.434   1.00 29.56 ? 349  ARG A C   1 
ATOM   2355 O  O   . ARG A  1  314 ? -3.459  18.955 6.353   1.00 29.70 ? 349  ARG A O   1 
ATOM   2356 C  CB  . ARG A  1  314 ? -2.745  16.598 7.778   1.00 34.43 ? 349  ARG A CB  1 
ATOM   2357 C  CG  . ARG A  1  314 ? -1.960  15.430 8.384   1.00 32.92 ? 349  ARG A CG  1 
ATOM   2358 C  CD  . ARG A  1  314 ? -2.711  14.103 8.254   1.00 38.42 ? 349  ARG A CD  1 
ATOM   2359 N  NE  . ARG A  1  314 ? -3.093  13.817 6.872   1.00 36.82 ? 349  ARG A NE  1 
ATOM   2360 C  CZ  . ARG A  1  314 ? -2.295  13.231 5.988   1.00 37.41 ? 349  ARG A CZ  1 
ATOM   2361 N  NH1 . ARG A  1  314 ? -1.067  12.874 6.342   1.00 36.52 ? 349  ARG A NH1 1 
ATOM   2362 N  NH2 . ARG A  1  314 ? -2.720  13.005 4.754   1.00 38.56 ? 349  ARG A NH2 1 
ATOM   2363 N  N   . CYS A  1  315 ? -2.839  20.239 8.110   1.00 28.17 ? 350  CYS A N   1 
ATOM   2364 C  CA  . CYS A  1  315 ? -3.555  21.430 7.691   1.00 27.78 ? 350  CYS A CA  1 
ATOM   2365 C  C   . CYS A  1  315 ? -2.563  22.587 7.424   1.00 27.81 ? 350  CYS A C   1 
ATOM   2366 O  O   . CYS A  1  315 ? -2.630  23.247 6.396   1.00 31.66 ? 350  CYS A O   1 
ATOM   2367 C  CB  . CYS A  1  315 ? -4.551  21.804 8.796   1.00 29.50 ? 350  CYS A CB  1 
ATOM   2368 S  SG  . CYS A  1  315 ? -5.383  23.425 8.640   1.00 34.76 ? 350  CYS A SG  1 
ATOM   2369 N  N   . VAL A  1  316 ? -1.617  22.775 8.336   1.00 30.19 ? 351  VAL A N   1 
ATOM   2370 C  CA  . VAL A  1  316 ? -0.705  23.929 8.315   1.00 25.27 ? 351  VAL A CA  1 
ATOM   2371 C  C   . VAL A  1  316 ? 0.467   23.707 7.344   1.00 27.23 ? 351  VAL A C   1 
ATOM   2372 O  O   . VAL A  1  316 ? 0.918   22.576 7.154   1.00 25.91 ? 351  VAL A O   1 
ATOM   2373 C  CB  . VAL A  1  316 ? -0.139  24.134 9.736   1.00 26.90 ? 351  VAL A CB  1 
ATOM   2374 C  CG1 . VAL A  1  316 ? 0.975   25.155 9.753   1.00 26.16 ? 351  VAL A CG1 1 
ATOM   2375 C  CG2 . VAL A  1  316 ? -1.260  24.518 10.720  1.00 28.53 ? 351  VAL A CG2 1 
ATOM   2376 N  N   . ASN A  1  317 ? 0.952   24.773 6.718   1.00 23.41 ? 352  ASN A N   1 
ATOM   2377 C  CA  . ASN A  1  317 ? 2.225   24.696 6.014   1.00 22.56 ? 352  ASN A CA  1 
ATOM   2378 C  C   . ASN A  1  317 ? 3.305   25.216 6.956   1.00 24.53 ? 352  ASN A C   1 
ATOM   2379 O  O   . ASN A  1  317 ? 3.140   26.276 7.551   1.00 24.14 ? 352  ASN A O   1 
ATOM   2380 C  CB  . ASN A  1  317 ? 2.205   25.504 4.735   1.00 21.21 ? 352  ASN A CB  1 
ATOM   2381 C  CG  . ASN A  1  317 ? 1.322   24.891 3.688   1.00 25.50 ? 352  ASN A CG  1 
ATOM   2382 O  OD1 . ASN A  1  317 ? 1.509   23.736 3.304   1.00 24.00 ? 352  ASN A OD1 1 
ATOM   2383 N  ND2 . ASN A  1  317 ? 0.346   25.651 3.222   1.00 23.73 ? 352  ASN A ND2 1 
ATOM   2384 N  N   . VAL A  1  318 ? 4.380   24.450 7.123   1.00 21.26 ? 353  VAL A N   1 
ATOM   2385 C  CA  . VAL A  1  318 ? 5.465   24.832 8.015   1.00 19.17 ? 353  VAL A CA  1 
ATOM   2386 C  C   . VAL A  1  318 ? 6.710   25.089 7.185   1.00 22.18 ? 353  VAL A C   1 
ATOM   2387 O  O   . VAL A  1  318 ? 7.089   24.261 6.359   1.00 20.34 ? 353  VAL A O   1 
ATOM   2388 C  CB  . VAL A  1  318 ? 5.798   23.704 9.021   1.00 20.99 ? 353  VAL A CB  1 
ATOM   2389 C  CG1 . VAL A  1  318 ? 7.010   24.092 9.907   1.00 19.20 ? 353  VAL A CG1 1 
ATOM   2390 C  CG2 . VAL A  1  318 ? 4.589   23.376 9.894   1.00 24.69 ? 353  VAL A CG2 1 
ATOM   2391 N  N   . ILE A  1  319 ? 7.363   26.231 7.402   1.00 18.79 ? 354  ILE A N   1 
ATOM   2392 C  CA  . ILE A  1  319 ? 8.654   26.463 6.770   1.00 18.34 ? 354  ILE A CA  1 
ATOM   2393 C  C   . ILE A  1  319 ? 9.678   26.446 7.898   1.00 20.28 ? 354  ILE A C   1 
ATOM   2394 O  O   . ILE A  1  319 ? 9.518   27.128 8.905   1.00 20.49 ? 354  ILE A O   1 
ATOM   2395 C  CB  . ILE A  1  319 ? 8.666   27.804 5.987   1.00 18.90 ? 354  ILE A CB  1 
ATOM   2396 C  CG1 . ILE A  1  319 ? 7.811   27.656 4.721   1.00 19.54 ? 354  ILE A CG1 1 
ATOM   2397 C  CG2 . ILE A  1  319 ? 10.101  28.223 5.585   1.00 23.49 ? 354  ILE A CG2 1 
ATOM   2398 C  CD1 . ILE A  1  319 ? 7.594   28.926 3.972   1.00 19.72 ? 354  ILE A CD1 1 
ATOM   2399 N  N   . PHE A  1  320 ? 10.708  25.623 7.749   1.00 19.37 ? 355  PHE A N   1 
ATOM   2400 C  CA  . PHE A  1  320 ? 11.806  25.586 8.696   1.00 18.10 ? 355  PHE A CA  1 
ATOM   2401 C  C   . PHE A  1  320 ? 12.999  26.206 7.957   1.00 18.36 ? 355  PHE A C   1 
ATOM   2402 O  O   . PHE A  1  320 ? 13.432  25.695 6.912   1.00 18.38 ? 355  PHE A O   1 
ATOM   2403 C  CB  . PHE A  1  320 ? 12.105  24.128 9.074   1.00 18.58 ? 355  PHE A CB  1 
ATOM   2404 C  CG  . PHE A  1  320 ? 13.167  23.979 10.103  1.00 18.05 ? 355  PHE A CG  1 
ATOM   2405 C  CD1 . PHE A  1  320 ? 12.888  24.147 11.449  1.00 16.18 ? 355  PHE A CD1 1 
ATOM   2406 C  CD2 . PHE A  1  320 ? 14.471  23.681 9.718   1.00 19.01 ? 355  PHE A CD2 1 
ATOM   2407 C  CE1 . PHE A  1  320 ? 13.875  24.014 12.396  1.00 20.00 ? 355  PHE A CE1 1 
ATOM   2408 C  CE2 . PHE A  1  320 ? 15.466  23.532 10.666  1.00 18.14 ? 355  PHE A CE2 1 
ATOM   2409 C  CZ  . PHE A  1  320 ? 15.184  23.699 11.986  1.00 21.06 ? 355  PHE A CZ  1 
ATOM   2410 N  N   . VAL A  1  321 ? 13.503  27.335 8.459   1.00 17.81 ? 356  VAL A N   1 
ATOM   2411 C  CA  . VAL A  1  321 ? 14.440  28.100 7.634   1.00 17.31 ? 356  VAL A CA  1 
ATOM   2412 C  C   . VAL A  1  321 ? 15.451  28.832 8.510   1.00 16.85 ? 356  VAL A C   1 
ATOM   2413 O  O   . VAL A  1  321 ? 15.095  29.364 9.554   1.00 17.35 ? 356  VAL A O   1 
ATOM   2414 C  CB  . VAL A  1  321 ? 13.663  29.121 6.778   1.00 19.77 ? 356  VAL A CB  1 
ATOM   2415 C  CG1 . VAL A  1  321 ? 12.980  30.149 7.684   1.00 18.59 ? 356  VAL A CG1 1 
ATOM   2416 C  CG2 . VAL A  1  321 ? 14.529  29.793 5.748   1.00 18.40 ? 356  VAL A CG2 1 
ATOM   2417 N  N   . GLY A  1  322 ? 16.705  28.856 8.077   1.00 17.17 ? 357  GLY A N   1 
ATOM   2418 C  CA  . GLY A  1  322 ? 17.738  29.577 8.808   1.00 15.86 ? 357  GLY A CA  1 
ATOM   2419 C  C   . GLY A  1  322 ? 18.079  30.926 8.172   1.00 15.63 ? 357  GLY A C   1 
ATOM   2420 O  O   . GLY A  1  322 ? 17.730  31.210 7.016   1.00 16.08 ? 357  GLY A O   1 
ATOM   2421 N  N   . ASP A  1  323 ? 18.826  31.736 8.915   1.00 16.89 ? 358  ASP A N   1 
ATOM   2422 C  CA  . ASP A  1  323 ? 19.259  33.029 8.401   1.00 14.01 ? 358  ASP A CA  1 
ATOM   2423 C  C   . ASP A  1  323 ? 20.653  32.997 7.769   1.00 13.90 ? 358  ASP A C   1 
ATOM   2424 O  O   . ASP A  1  323 ? 20.954  33.759 6.827   1.00 18.07 ? 358  ASP A O   1 
ATOM   2425 C  CB  . ASP A  1  323 ? 19.093  34.157 9.461   1.00 16.18 ? 358  ASP A CB  1 
ATOM   2426 C  CG  . ASP A  1  323 ? 19.950  33.974 10.693  1.00 18.53 ? 358  ASP A CG  1 
ATOM   2427 O  OD1 . ASP A  1  323 ? 20.383  32.831 10.979  1.00 16.63 ? 358  ASP A OD1 1 
ATOM   2428 O  OD2 . ASP A  1  323 ? 20.227  34.980 11.412  1.00 18.18 ? 358  ASP A OD2 1 
ATOM   2429 N  N   . HIS A  1  324 ? 21.516  32.134 8.301   1.00 14.63 ? 359  HIS A N   1 
ATOM   2430 C  CA  . HIS A  1  324 ? 22.878  32.002 7.767   1.00 15.20 ? 359  HIS A CA  1 
ATOM   2431 C  C   . HIS A  1  324 ? 23.508  30.834 8.491   1.00 13.29 ? 359  HIS A C   1 
ATOM   2432 O  O   . HIS A  1  324 ? 22.950  30.325 9.461   1.00 14.72 ? 359  HIS A O   1 
ATOM   2433 C  CB  . HIS A  1  324 ? 23.726  33.246 8.077   1.00 15.91 ? 359  HIS A CB  1 
ATOM   2434 C  CG  . HIS A  1  324 ? 23.693  33.617 9.520   1.00 14.06 ? 359  HIS A CG  1 
ATOM   2435 N  ND1 . HIS A  1  324 ? 24.378  32.915 10.495  1.00 13.04 ? 359  HIS A ND1 1 
ATOM   2436 C  CD2 . HIS A  1  324 ? 22.966  34.559 10.167  1.00 15.02 ? 359  HIS A CD2 1 
ATOM   2437 C  CE1 . HIS A  1  324 ? 24.078  33.418 11.681  1.00 15.99 ? 359  HIS A CE1 1 
ATOM   2438 N  NE2 . HIS A  1  324 ? 23.253  34.432 11.507  1.00 14.43 ? 359  HIS A NE2 1 
ATOM   2439 N  N   . GLY A  1  325 ? 24.691  30.455 8.030   1.00 15.91 ? 360  GLY A N   1 
ATOM   2440 C  CA  . GLY A  1  325 ? 25.469  29.394 8.632   1.00 14.93 ? 360  GLY A CA  1 
ATOM   2441 C  C   . GLY A  1  325 ? 26.465  29.835 9.693   1.00 14.97 ? 360  GLY A C   1 
ATOM   2442 O  O   . GLY A  1  325 ? 26.242  30.792 10.433  1.00 16.40 ? 360  GLY A O   1 
ATOM   2443 N  N   . MET A  1  326 ? 27.542  29.076 9.831   1.00 13.78 ? 361  MET A N   1 
ATOM   2444 C  CA  . MET A  1  326 ? 28.498  29.293 10.915  1.00 14.60 ? 361  MET A CA  1 
ATOM   2445 C  C   . MET A  1  326 ? 29.844  28.713 10.503  1.00 17.38 ? 361  MET A C   1 
ATOM   2446 O  O   . MET A  1  326 ? 29.918  27.620 9.928   1.00 16.73 ? 361  MET A O   1 
ATOM   2447 C  CB  . MET A  1  326 ? 28.036  28.600 12.229  1.00 16.44 ? 361  MET A CB  1 
ATOM   2448 C  CG  . MET A  1  326 ? 28.938  28.880 13.460  1.00 16.55 ? 361  MET A CG  1 
ATOM   2449 S  SD  . MET A  1  326 ? 28.920  30.617 14.018  1.00 17.95 ? 361  MET A SD  1 
ATOM   2450 C  CE  . MET A  1  326 ? 27.187  30.776 14.559  1.00 17.56 ? 361  MET A CE  1 
ATOM   2451 N  N   . GLU A  1  327 ? 30.900  29.459 10.791  1.00 16.76 ? 362  GLU A N   1 
ATOM   2452 C  CA  . GLU A  1  327 ? 32.256  29.056 10.381  1.00 16.75 ? 362  GLU A CA  1 
ATOM   2453 C  C   . GLU A  1  327 ? 33.159  28.963 11.580  1.00 18.11 ? 362  GLU A C   1 
ATOM   2454 O  O   . GLU A  1  327 ? 32.885  29.530 12.638  1.00 16.92 ? 362  GLU A O   1 
ATOM   2455 C  CB  . GLU A  1  327 ? 32.823  30.093 9.382   1.00 16.50 ? 362  GLU A CB  1 
ATOM   2456 C  CG  . GLU A  1  327 ? 34.267  29.834 8.836   1.00 18.17 ? 362  GLU A CG  1 
ATOM   2457 C  CD  . GLU A  1  327 ? 34.409  28.523 8.067   1.00 19.37 ? 362  GLU A CD  1 
ATOM   2458 O  OE1 . GLU A  1  327 ? 34.617  27.503 8.722   1.00 21.41 ? 362  GLU A OE1 1 
ATOM   2459 O  OE2 . GLU A  1  327 ? 34.319  28.509 6.817   1.00 20.30 ? 362  GLU A OE2 1 
ATOM   2460 N  N   . ASP A  1  328 ? 34.248  28.202 11.419  1.00 18.94 ? 363  ASP A N   1 
ATOM   2461 C  CA  . ASP A  1  328 ? 35.294  28.127 12.433  1.00 20.90 ? 363  ASP A CA  1 
ATOM   2462 C  C   . ASP A  1  328 ? 36.109  29.423 12.402  1.00 19.85 ? 363  ASP A C   1 
ATOM   2463 O  O   . ASP A  1  328 ? 36.789  29.680 11.413  1.00 18.51 ? 363  ASP A O   1 
ATOM   2464 C  CB  . ASP A  1  328 ? 36.214  26.948 12.084  1.00 22.50 ? 363  ASP A CB  1 
ATOM   2465 C  CG  . ASP A  1  328 ? 35.649  25.616 12.521  1.00 31.36 ? 363  ASP A CG  1 
ATOM   2466 O  OD1 . ASP A  1  328 ? 35.367  25.462 13.738  1.00 31.13 ? 363  ASP A OD1 1 
ATOM   2467 O  OD2 . ASP A  1  328 ? 35.511  24.725 11.655  1.00 34.70 ? 363  ASP A OD2 1 
ATOM   2468 N  N   . VAL A  1  329 ? 36.018  30.230 13.456  1.00 20.06 ? 364  VAL A N   1 
ATOM   2469 C  CA  . VAL A  1  329 ? 36.720  31.515 13.558  1.00 20.20 ? 364  VAL A CA  1 
ATOM   2470 C  C   . VAL A  1  329 ? 37.202  31.693 14.997  1.00 26.92 ? 364  VAL A C   1 
ATOM   2471 O  O   . VAL A  1  329 ? 36.395  31.686 15.925  1.00 26.84 ? 364  VAL A O   1 
ATOM   2472 C  CB  . VAL A  1  329 ? 35.791  32.716 13.151  1.00 19.12 ? 364  VAL A CB  1 
ATOM   2473 C  CG1 . VAL A  1  329 ? 36.594  34.034 13.069  1.00 21.37 ? 364  VAL A CG1 1 
ATOM   2474 C  CG2 . VAL A  1  329 ? 35.061  32.430 11.844  1.00 20.37 ? 364  VAL A CG2 1 
ATOM   2475 N  N   . THR A  1  330 ? 38.516  31.809 15.192  1.00 22.79 ? 365  THR A N   1 
ATOM   2476 C  CA  . THR A  1  330 ? 39.099  31.948 16.527  1.00 24.44 ? 365  THR A CA  1 
ATOM   2477 C  C   . THR A  1  330 ? 39.963  33.208 16.656  1.00 25.71 ? 365  THR A C   1 
ATOM   2478 O  O   . THR A  1  330 ? 40.356  33.814 15.645  1.00 25.18 ? 365  THR A O   1 
ATOM   2479 C  CB  . THR A  1  330 ? 39.961  30.721 16.911  1.00 28.29 ? 365  THR A CB  1 
ATOM   2480 O  OG1 . THR A  1  330 ? 41.007  30.535 15.947  1.00 32.44 ? 365  THR A OG1 1 
ATOM   2481 C  CG2 . THR A  1  330 ? 39.119  29.467 16.962  1.00 33.38 ? 365  THR A CG2 1 
ATOM   2482 N  N   . CYS A  1  331 ? 40.276  33.572 17.901  1.00 29.51 ? 366  CYS A N   1 
ATOM   2483 C  CA  . CYS A  1  331 ? 41.081  34.753 18.213  1.00 31.52 ? 366  CYS A CA  1 
ATOM   2484 C  C   . CYS A  1  331 ? 42.407  34.737 17.465  1.00 29.74 ? 366  CYS A C   1 
ATOM   2485 O  O   . CYS A  1  331 ? 42.908  35.785 17.041  1.00 28.54 ? 366  CYS A O   1 
ATOM   2486 C  CB  . CYS A  1  331 ? 41.364  34.832 19.730  1.00 34.48 ? 366  CYS A CB  1 
ATOM   2487 S  SG  . CYS A  1  331 ? 39.884  34.988 20.738  1.00 51.34 ? 366  CYS A SG  1 
ATOM   2488 N  N   . ASP A  1  332 ? 42.977  33.548 17.288  1.00 27.45 ? 367  ASP A N   1 
ATOM   2489 C  CA  . ASP A  1  332 ? 44.298  33.452 16.651  1.00 28.66 ? 367  ASP A CA  1 
ATOM   2490 C  C   . ASP A  1  332 ? 44.301  33.810 15.175  1.00 29.98 ? 367  ASP A C   1 
ATOM   2491 O  O   . ASP A  1  332 ? 45.362  33.934 14.565  1.00 27.34 ? 367  ASP A O   1 
ATOM   2492 C  CB  . ASP A  1  332 ? 44.846  32.040 16.780  1.00 32.29 ? 367  ASP A CB  1 
ATOM   2493 C  CG  . ASP A  1  332 ? 45.132  31.652 18.218  1.00 37.63 ? 367  ASP A CG  1 
ATOM   2494 O  OD1 . ASP A  1  332 ? 45.193  32.546 19.107  1.00 37.43 ? 367  ASP A OD1 1 
ATOM   2495 O  OD2 . ASP A  1  332 ? 45.297  30.437 18.452  1.00 42.71 ? 367  ASP A OD2 1 
ATOM   2496 N  N   . ARG A  1  333 ? 43.119  33.919 14.571  1.00 25.05 ? 368  ARG A N   1 
ATOM   2497 C  CA  . ARG A  1  333 ? 43.052  34.265 13.155  1.00 21.67 ? 368  ARG A CA  1 
ATOM   2498 C  C   . ARG A  1  333 ? 42.425  35.647 12.973  1.00 21.07 ? 368  ARG A C   1 
ATOM   2499 O  O   . ARG A  1  333 ? 41.337  35.785 12.411  1.00 20.43 ? 368  ARG A O   1 
ATOM   2500 C  CB  . ARG A  1  333 ? 42.289  33.190 12.356  1.00 20.26 ? 368  ARG A CB  1 
ATOM   2501 C  CG  . ARG A  1  333 ? 43.087  31.888 12.266  1.00 19.18 ? 368  ARG A CG  1 
ATOM   2502 C  CD  . ARG A  1  333 ? 42.481  30.841 11.344  1.00 23.19 ? 368  ARG A CD  1 
ATOM   2503 N  NE  . ARG A  1  333 ? 41.091  30.525 11.698  1.00 20.80 ? 368  ARG A NE  1 
ATOM   2504 C  CZ  . ARG A  1  333 ? 40.713  29.520 12.482  1.00 24.67 ? 368  ARG A CZ  1 
ATOM   2505 N  NH1 . ARG A  1  333 ? 41.621  28.712 13.041  1.00 22.84 ? 368  ARG A NH1 1 
ATOM   2506 N  NH2 . ARG A  1  333 ? 39.423  29.326 12.723  1.00 22.06 ? 368  ARG A NH2 1 
ATOM   2507 N  N   . THR A  1  334 ? 43.124  36.663 13.460  1.00 20.89 ? 369  THR A N   1 
ATOM   2508 C  CA  . THR A  1  334 ? 42.687  38.044 13.304  1.00 20.22 ? 369  THR A CA  1 
ATOM   2509 C  C   . THR A  1  334 ? 43.738  38.908 12.618  1.00 22.83 ? 369  THR A C   1 
ATOM   2510 O  O   . THR A  1  334 ? 44.869  39.028 13.116  1.00 22.76 ? 369  THR A O   1 
ATOM   2511 C  CB  . THR A  1  334 ? 42.416  38.690 14.647  1.00 21.39 ? 369  THR A CB  1 
ATOM   2512 O  OG1 . THR A  1  334 ? 41.487  37.888 15.410  1.00 23.82 ? 369  THR A OG1 1 
ATOM   2513 C  CG2 . THR A  1  334 ? 41.851  40.095 14.456  1.00 22.19 ? 369  THR A CG2 1 
ATOM   2514 N  N   . GLU A  1  335 ? 43.363  39.534 11.500  1.00 19.77 ? 370  GLU A N   1 
ATOM   2515 C  CA  . GLU A  1  335 ? 44.204  40.567 10.877  1.00 22.55 ? 370  GLU A CA  1 
ATOM   2516 C  C   . GLU A  1  335 ? 43.964  41.903 11.586  1.00 22.68 ? 370  GLU A C   1 
ATOM   2517 O  O   . GLU A  1  335 ? 42.833  42.231 11.945  1.00 21.68 ? 370  GLU A O   1 
ATOM   2518 C  CB  . GLU A  1  335 ? 43.864  40.705 9.385   1.00 20.76 ? 370  GLU A CB  1 
ATOM   2519 C  CG  . GLU A  1  335 ? 44.277  39.533 8.505   1.00 21.27 ? 370  GLU A CG  1 
ATOM   2520 C  CD  . GLU A  1  335 ? 45.602  39.773 7.807   1.00 21.46 ? 370  GLU A CD  1 
ATOM   2521 O  OE1 . GLU A  1  335 ? 46.269  40.780 8.116   1.00 23.12 ? 370  GLU A OE1 1 
ATOM   2522 O  OE2 . GLU A  1  335 ? 45.965  38.969 6.937   1.00 22.87 ? 370  GLU A OE2 1 
ATOM   2523 N  N   . PHE A  1  336 ? 45.021  42.682 11.806  1.00 19.74 ? 371  PHE A N   1 
ATOM   2524 C  CA  . PHE A  1  336 ? 44.848  44.005 12.396  1.00 20.75 ? 371  PHE A CA  1 
ATOM   2525 C  C   . PHE A  1  336 ? 45.179  45.106 11.394  1.00 21.46 ? 371  PHE A C   1 
ATOM   2526 O  O   . PHE A  1  336 ? 46.209  45.037 10.735  1.00 23.49 ? 371  PHE A O   1 
ATOM   2527 C  CB  . PHE A  1  336 ? 45.731  44.124 13.639  1.00 24.03 ? 371  PHE A CB  1 
ATOM   2528 C  CG  . PHE A  1  336 ? 45.306  43.202 14.736  1.00 25.39 ? 371  PHE A CG  1 
ATOM   2529 C  CD1 . PHE A  1  336 ? 44.186  43.497 15.499  1.00 26.04 ? 371  PHE A CD1 1 
ATOM   2530 C  CD2 . PHE A  1  336 ? 45.976  42.026 14.963  1.00 26.18 ? 371  PHE A CD2 1 
ATOM   2531 C  CE1 . PHE A  1  336 ? 43.770  42.650 16.498  1.00 27.85 ? 371  PHE A CE1 1 
ATOM   2532 C  CE2 . PHE A  1  336 ? 45.560  41.163 15.966  1.00 25.19 ? 371  PHE A CE2 1 
ATOM   2533 C  CZ  . PHE A  1  336 ? 44.449  41.480 16.734  1.00 29.85 ? 371  PHE A CZ  1 
ATOM   2534 N  N   . LEU A  1  337 ? 44.297  46.096 11.259  1.00 19.21 ? 372  LEU A N   1 
ATOM   2535 C  CA  . LEU A  1  337 ? 44.572  47.204 10.346  1.00 21.91 ? 372  LEU A CA  1 
ATOM   2536 C  C   . LEU A  1  337 ? 45.806  48.013 10.769  1.00 21.19 ? 372  LEU A C   1 
ATOM   2537 O  O   . LEU A  1  337 ? 46.492  48.591 9.915   1.00 23.75 ? 372  LEU A O   1 
ATOM   2538 C  CB  . LEU A  1  337 ? 43.382  48.136 10.243  1.00 18.63 ? 372  LEU A CB  1 
ATOM   2539 C  CG  . LEU A  1  337 ? 42.133  47.470 9.624   1.00 20.57 ? 372  LEU A CG  1 
ATOM   2540 C  CD1 . LEU A  1  337 ? 41.055  48.506 9.409   1.00 22.39 ? 372  LEU A CD1 1 
ATOM   2541 C  CD2 . LEU A  1  337 ? 42.432  46.768 8.313   1.00 21.56 ? 372  LEU A CD2 1 
ATOM   2542 N  N   . SER A  1  338 ? 46.046  48.082 12.068  1.00 22.70 ? 373  SER A N   1 
ATOM   2543 C  CA  . SER A  1  338 ? 47.238  48.772 12.592  1.00 26.03 ? 373  SER A CA  1 
ATOM   2544 C  C   . SER A  1  338 ? 48.544  48.239 11.988  1.00 27.08 ? 373  SER A C   1 
ATOM   2545 O  O   . SER A  1  338 ? 49.569  48.943 11.960  1.00 27.19 ? 373  SER A O   1 
ATOM   2546 C  CB  . SER A  1  338 ? 47.263  48.708 14.120  1.00 24.58 ? 373  SER A CB  1 
ATOM   2547 O  OG  . SER A  1  338 ? 47.240  47.369 14.583  1.00 25.53 ? 373  SER A OG  1 
ATOM   2548 N  N   . ASN A  1  339 ? 48.527  47.000 11.511  1.00 24.87 ? 374  ASN A N   1 
ATOM   2549 C  CA  . ASN A  1  339 ? 49.681  46.472 10.778  1.00 22.90 ? 374  ASN A CA  1 
ATOM   2550 C  C   . ASN A  1  339 ? 49.901  47.035 9.380   1.00 27.42 ? 374  ASN A C   1 
ATOM   2551 O  O   . ASN A  1  339 ? 50.946  46.789 8.793   1.00 25.23 ? 374  ASN A O   1 
ATOM   2552 C  CB  . ASN A  1  339 ? 49.604  44.963 10.656  1.00 23.45 ? 374  ASN A CB  1 
ATOM   2553 C  CG  . ASN A  1  339 ? 49.774  44.270 11.987  1.00 30.63 ? 374  ASN A CG  1 
ATOM   2554 O  OD1 . ASN A  1  339 ? 49.243  43.181 12.209  1.00 29.19 ? 374  ASN A OD1 1 
ATOM   2555 N  ND2 . ASN A  1  339 ? 50.505  44.908 12.889  1.00 28.59 ? 374  ASN A ND2 1 
ATOM   2556 N  N   . TYR A  1  340 ? 48.907  47.747 8.844   1.00 23.03 ? 375  TYR A N   1 
ATOM   2557 C  CA  . TYR A  1  340 ? 48.924  48.222 7.466   1.00 23.50 ? 375  TYR A CA  1 
ATOM   2558 C  C   . TYR A  1  340 ? 48.859  49.738 7.426   1.00 25.81 ? 375  TYR A C   1 
ATOM   2559 O  O   . TYR A  1  340 ? 49.276  50.353 6.453   1.00 24.96 ? 375  TYR A O   1 
ATOM   2560 C  CB  . TYR A  1  340 ? 47.688  47.724 6.715   1.00 20.12 ? 375  TYR A CB  1 
ATOM   2561 C  CG  . TYR A  1  340 ? 47.616  46.225 6.556   1.00 20.49 ? 375  TYR A CG  1 
ATOM   2562 C  CD1 . TYR A  1  340 ? 47.200  45.424 7.605   1.00 20.06 ? 375  TYR A CD1 1 
ATOM   2563 C  CD2 . TYR A  1  340 ? 47.927  45.630 5.350   1.00 20.89 ? 375  TYR A CD2 1 
ATOM   2564 C  CE1 . TYR A  1  340 ? 47.137  44.026 7.449   1.00 18.54 ? 375  TYR A CE1 1 
ATOM   2565 C  CE2 . TYR A  1  340 ? 47.856  44.245 5.180   1.00 18.79 ? 375  TYR A CE2 1 
ATOM   2566 C  CZ  . TYR A  1  340 ? 47.468  43.472 6.240   1.00 19.81 ? 375  TYR A CZ  1 
ATOM   2567 O  OH  . TYR A  1  340 ? 47.392  42.113 6.059   1.00 22.66 ? 375  TYR A OH  1 
ATOM   2568 N  N   . LEU A  1  341 ? 48.266  50.324 8.458   1.00 25.17 ? 376  LEU A N   1 
ATOM   2569 C  CA  . LEU A  1  341 ? 47.945  51.748 8.451   1.00 27.20 ? 376  LEU A CA  1 
ATOM   2570 C  C   . LEU A  1  341 ? 48.552  52.419 9.665   1.00 27.89 ? 376  LEU A C   1 
ATOM   2571 O  O   . LEU A  1  341 ? 48.597  51.841 10.743  1.00 24.93 ? 376  LEU A O   1 
ATOM   2572 C  CB  . LEU A  1  341 ? 46.431  51.969 8.511   1.00 24.92 ? 376  LEU A CB  1 
ATOM   2573 C  CG  . LEU A  1  341 ? 45.584  51.290 7.452   1.00 21.04 ? 376  LEU A CG  1 
ATOM   2574 C  CD1 . LEU A  1  341 ? 44.107  51.569 7.766   1.00 24.49 ? 376  LEU A CD1 1 
ATOM   2575 C  CD2 . LEU A  1  341 ? 45.967  51.785 6.062   1.00 23.22 ? 376  LEU A CD2 1 
ATOM   2576 N  N   . THR A  1  342 ? 48.976  53.668 9.491   1.00 30.65 ? 377  THR A N   1 
ATOM   2577 C  CA  . THR A  1  342 ? 49.715  54.363 10.532  1.00 34.43 ? 377  THR A CA  1 
ATOM   2578 C  C   . THR A  1  342 ? 48.856  54.899 11.675  1.00 35.90 ? 377  THR A C   1 
ATOM   2579 O  O   . THR A  1  342 ? 49.271  54.862 12.836  1.00 39.86 ? 377  THR A O   1 
ATOM   2580 C  CB  . THR A  1  342 ? 50.581  55.501 9.916   1.00 33.08 ? 377  THR A CB  1 
ATOM   2581 O  OG1 . THR A  1  342 ? 51.577  54.916 9.067   1.00 39.59 ? 377  THR A OG1 1 
ATOM   2582 C  CG2 . THR A  1  342 ? 51.276  56.293 11.005  1.00 39.58 ? 377  THR A CG2 1 
ATOM   2583 N  N   . ASN A  1  343 ? 47.662  55.390 11.362  1.00 35.54 ? 378  ASN A N   1 
ATOM   2584 C  CA  . ASN A  1  343 ? 46.807  56.002 12.380  1.00 37.26 ? 378  ASN A CA  1 
ATOM   2585 C  C   . ASN A  1  343 ? 45.387  55.446 12.380  1.00 35.05 ? 378  ASN A C   1 
ATOM   2586 O  O   . ASN A  1  343 ? 44.465  56.094 11.890  1.00 37.89 ? 378  ASN A O   1 
ATOM   2587 C  CB  . ASN A  1  343 ? 46.728  57.518 12.182  1.00 40.19 ? 378  ASN A CB  1 
ATOM   2588 C  CG  . ASN A  1  343 ? 48.083  58.191 12.236  1.00 47.97 ? 378  ASN A CG  1 
ATOM   2589 O  OD1 . ASN A  1  343 ? 48.533  58.788 11.254  1.00 51.80 ? 378  ASN A OD1 1 
ATOM   2590 N  ND2 . ASN A  1  343 ? 48.742  58.101 13.385  1.00 52.69 ? 378  ASN A ND2 1 
ATOM   2591 N  N   . VAL A  1  344 ? 45.200  54.266 12.952  1.00 33.63 ? 379  VAL A N   1 
ATOM   2592 C  CA  . VAL A  1  344 ? 43.885  53.631 12.933  1.00 28.86 ? 379  VAL A CA  1 
ATOM   2593 C  C   . VAL A  1  344 ? 42.935  54.234 13.958  1.00 32.28 ? 379  VAL A C   1 
ATOM   2594 O  O   . VAL A  1  344 ? 41.754  53.904 13.983  1.00 31.62 ? 379  VAL A O   1 
ATOM   2595 C  CB  . VAL A  1  344 ? 43.976  52.113 13.178  1.00 32.42 ? 379  VAL A CB  1 
ATOM   2596 C  CG1 . VAL A  1  344 ? 44.792  51.459 12.085  1.00 27.44 ? 379  VAL A CG1 1 
ATOM   2597 C  CG2 . VAL A  1  344 ? 44.572  51.814 14.565  1.00 30.89 ? 379  VAL A CG2 1 
ATOM   2598 N  N   . ASP A  1  345 ? 43.433  55.112 14.822  1.00 36.48 ? 380  ASP A N   1 
ATOM   2599 C  CA  . ASP A  1  345 ? 42.542  55.724 15.804  1.00 33.32 ? 380  ASP A CA  1 
ATOM   2600 C  C   . ASP A  1  345 ? 41.662  56.782 15.165  1.00 30.66 ? 380  ASP A C   1 
ATOM   2601 O  O   . ASP A  1  345 ? 40.709  57.256 15.780  1.00 31.94 ? 380  ASP A O   1 
ATOM   2602 C  CB  . ASP A  1  345 ? 43.309  56.303 17.007  1.00 40.92 ? 380  ASP A CB  1 
ATOM   2603 C  CG  . ASP A  1  345 ? 43.922  55.222 17.900  1.00 42.98 ? 380  ASP A CG  1 
ATOM   2604 O  OD1 . ASP A  1  345 ? 43.360  54.110 18.018  1.00 40.71 ? 380  ASP A OD1 1 
ATOM   2605 O  OD2 . ASP A  1  345 ? 44.982  55.494 18.501  1.00 46.31 ? 380  ASP A OD2 1 
ATOM   2606 N  N   . ASP A  1  346 ? 41.964  57.137 13.917  1.00 29.09 ? 381  ASP A N   1 
ATOM   2607 C  CA  . ASP A  1  346 ? 41.178  58.136 13.207  1.00 28.28 ? 381  ASP A CA  1 
ATOM   2608 C  C   . ASP A  1  346 ? 40.088  57.527 12.313  1.00 27.36 ? 381  ASP A C   1 
ATOM   2609 O  O   . ASP A  1  346 ? 39.343  58.259 11.644  1.00 28.61 ? 381  ASP A O   1 
ATOM   2610 C  CB  . ASP A  1  346 ? 42.082  59.023 12.371  1.00 30.99 ? 381  ASP A CB  1 
ATOM   2611 C  CG  . ASP A  1  346 ? 43.020  59.854 13.226  1.00 38.20 ? 381  ASP A CG  1 
ATOM   2612 O  OD1 . ASP A  1  346 ? 42.581  60.309 14.303  1.00 34.89 ? 381  ASP A OD1 1 
ATOM   2613 O  OD2 . ASP A  1  346 ? 44.186  60.048 12.820  1.00 40.36 ? 381  ASP A OD2 1 
ATOM   2614 N  N   . ILE A  1  347 ? 40.003  56.200 12.287  1.00 25.30 ? 382  ILE A N   1 
ATOM   2615 C  CA  . ILE A  1  347 ? 38.942  55.553 11.483  1.00 23.57 ? 382  ILE A CA  1 
ATOM   2616 C  C   . ILE A  1  347 ? 38.049  54.738 12.397  1.00 25.03 ? 382  ILE A C   1 
ATOM   2617 O  O   . ILE A  1  347 ? 38.481  54.294 13.453  1.00 24.41 ? 382  ILE A O   1 
ATOM   2618 C  CB  . ILE A  1  347 ? 39.471  54.605 10.385  1.00 23.91 ? 382  ILE A CB  1 
ATOM   2619 C  CG1 . ILE A  1  347 ? 40.395  53.552 10.982  1.00 23.32 ? 382  ILE A CG1 1 
ATOM   2620 C  CG2 . ILE A  1  347 ? 40.127  55.383 9.262   1.00 29.21 ? 382  ILE A CG2 1 
ATOM   2621 C  CD1 . ILE A  1  347 ? 40.792  52.456 10.003  1.00 24.60 ? 382  ILE A CD1 1 
ATOM   2622 N  N   . THR A  1  348 ? 36.799  54.573 11.983  1.00 23.31 ? 383  THR A N   1 
ATOM   2623 C  CA  . THR A  1  348 ? 35.889  53.634 12.616  1.00 24.02 ? 383  THR A CA  1 
ATOM   2624 C  C   . THR A  1  348 ? 35.759  52.428 11.700  1.00 21.70 ? 383  THR A C   1 
ATOM   2625 O  O   . THR A  1  348 ? 35.578  52.584 10.496  1.00 23.90 ? 383  THR A O   1 
ATOM   2626 C  CB  . THR A  1  348 ? 34.518  54.273 12.842  1.00 27.21 ? 383  THR A CB  1 
ATOM   2627 O  OG1 . THR A  1  348 ? 34.630  55.247 13.888  1.00 25.16 ? 383  THR A OG1 1 
ATOM   2628 C  CG2 . THR A  1  348 ? 33.479  53.206 13.241  1.00 23.37 ? 383  THR A CG2 1 
ATOM   2629 N  N   . LEU A  1  349 ? 35.876  51.239 12.271  1.00 18.42 ? 384  LEU A N   1 
ATOM   2630 C  CA  . LEU A  1  349 ? 35.732  50.004 11.508  1.00 16.89 ? 384  LEU A CA  1 
ATOM   2631 C  C   . LEU A  1  349 ? 34.573  49.180 12.027  1.00 19.53 ? 384  LEU A C   1 
ATOM   2632 O  O   . LEU A  1  349 ? 34.528  48.845 13.199  1.00 21.36 ? 384  LEU A O   1 
ATOM   2633 C  CB  . LEU A  1  349 ? 37.016  49.168 11.624  1.00 19.17 ? 384  LEU A CB  1 
ATOM   2634 C  CG  . LEU A  1  349 ? 36.971  47.758 11.018  1.00 20.27 ? 384  LEU A CG  1 
ATOM   2635 C  CD1 . LEU A  1  349 ? 37.032  47.856 9.512   1.00 20.60 ? 384  LEU A CD1 1 
ATOM   2636 C  CD2 . LEU A  1  349 ? 38.114  46.900 11.545  1.00 21.22 ? 384  LEU A CD2 1 
ATOM   2637 N  N   . VAL A  1  350 ? 33.634  48.863 11.133  1.00 19.88 ? 385  VAL A N   1 
ATOM   2638 C  CA  . VAL A  1  350 ? 32.706  47.778 11.391  1.00 17.39 ? 385  VAL A CA  1 
ATOM   2639 C  C   . VAL A  1  350 ? 33.512  46.500 11.147  1.00 14.65 ? 385  VAL A C   1 
ATOM   2640 O  O   . VAL A  1  350 ? 33.952  46.238 10.023  1.00 17.44 ? 385  VAL A O   1 
ATOM   2641 C  CB  . VAL A  1  350 ? 31.514  47.861 10.416  1.00 16.23 ? 385  VAL A CB  1 
ATOM   2642 C  CG1 . VAL A  1  350 ? 30.476  46.860 10.847  1.00 20.50 ? 385  VAL A CG1 1 
ATOM   2643 C  CG2 . VAL A  1  350 ? 30.925  49.247 10.447  1.00 20.01 ? 385  VAL A CG2 1 
ATOM   2644 N  N   . PRO A  1  351 ? 33.759  45.733 12.202  1.00 17.32 ? 386  PRO A N   1 
ATOM   2645 C  CA  . PRO A  1  351 ? 34.806  44.717 12.092  1.00 15.68 ? 386  PRO A CA  1 
ATOM   2646 C  C   . PRO A  1  351 ? 34.285  43.298 12.038  1.00 18.60 ? 386  PRO A C   1 
ATOM   2647 O  O   . PRO A  1  351 ? 33.069  43.043 12.001  1.00 17.42 ? 386  PRO A O   1 
ATOM   2648 C  CB  . PRO A  1  351 ? 35.566  44.894 13.406  1.00 19.28 ? 386  PRO A CB  1 
ATOM   2649 C  CG  . PRO A  1  351 ? 34.456  45.219 14.391  1.00 19.01 ? 386  PRO A CG  1 
ATOM   2650 C  CD  . PRO A  1  351 ? 33.348  45.934 13.604  1.00 17.80 ? 386  PRO A CD  1 
ATOM   2651 N  N   . GLY A  1  352 ? 35.232  42.375 12.043  1.00 18.38 ? 387  GLY A N   1 
ATOM   2652 C  CA  . GLY A  1  352 ? 34.919  40.955 12.158  1.00 17.34 ? 387  GLY A CA  1 
ATOM   2653 C  C   . GLY A  1  352 ? 35.048  40.205 10.860  1.00 16.94 ? 387  GLY A C   1 
ATOM   2654 O  O   . GLY A  1  352 ? 36.103  40.197 10.230  1.00 16.74 ? 387  GLY A O   1 
ATOM   2655 N  N   . THR A  1  353 ? 33.946  39.577 10.442  1.00 16.61 ? 388  THR A N   1 
ATOM   2656 C  CA  . THR A  1  353 ? 33.957  38.719 9.265   1.00 15.17 ? 388  THR A CA  1 
ATOM   2657 C  C   . THR A  1  353 ? 33.659  39.537 8.005   1.00 15.99 ? 388  THR A C   1 
ATOM   2658 O  O   . THR A  1  353 ? 33.474  38.989 6.899   1.00 16.16 ? 388  THR A O   1 
ATOM   2659 C  CB  . THR A  1  353 ? 32.866  37.649 9.431   1.00 17.42 ? 388  THR A CB  1 
ATOM   2660 O  OG1 . THR A  1  353 ? 31.643  38.329 9.716   1.00 16.85 ? 388  THR A OG1 1 
ATOM   2661 C  CG2 . THR A  1  353 ? 33.214  36.729 10.597  1.00 15.93 ? 388  THR A CG2 1 
ATOM   2662 N  N   . LEU A  1  354 ? 33.611  40.854 8.192   1.00 15.81 ? 389  LEU A N   1 
ATOM   2663 C  CA  . LEU A  1  354 ? 33.534  41.803 7.085   1.00 15.36 ? 389  LEU A CA  1 
ATOM   2664 C  C   . LEU A  1  354 ? 34.165  43.094 7.616   1.00 17.81 ? 389  LEU A C   1 
ATOM   2665 O  O   . LEU A  1  354 ? 34.417  43.214 8.832   1.00 17.31 ? 389  LEU A O   1 
ATOM   2666 C  CB  . LEU A  1  354 ? 32.067  42.034 6.635   1.00 17.02 ? 389  LEU A CB  1 
ATOM   2667 C  CG  . LEU A  1  354 ? 31.141  42.756 7.605   1.00 20.23 ? 389  LEU A CG  1 
ATOM   2668 C  CD1 . LEU A  1  354 ? 29.895  43.153 6.885   1.00 26.58 ? 389  LEU A CD1 1 
ATOM   2669 C  CD2 . LEU A  1  354 ? 30.795  41.868 8.807   1.00 23.31 ? 389  LEU A CD2 1 
ATOM   2670 N  N   . GLY A  1  355 ? 34.521  44.017 6.720   1.00 16.12 ? 390  GLY A N   1 
ATOM   2671 C  CA  . GLY A  1  355 ? 34.965  45.318 7.186   1.00 16.16 ? 390  GLY A CA  1 
ATOM   2672 C  C   . GLY A  1  355 ? 34.280  46.446 6.445   1.00 16.90 ? 390  GLY A C   1 
ATOM   2673 O  O   . GLY A  1  355 ? 34.126  46.365 5.229   1.00 18.02 ? 390  GLY A O   1 
ATOM   2674 N  N   . ARG A  1  356 ? 33.841  47.482 7.166   1.00 15.99 ? 391  ARG A N   1 
ATOM   2675 C  CA  . ARG A  1  356 ? 33.391  48.707 6.502   1.00 14.67 ? 391  ARG A CA  1 
ATOM   2676 C  C   . ARG A  1  356 ? 34.137  49.842 7.210   1.00 16.88 ? 391  ARG A C   1 
ATOM   2677 O  O   . ARG A  1  356 ? 34.167  49.875 8.418   1.00 17.09 ? 391  ARG A O   1 
ATOM   2678 C  CB  . ARG A  1  356 ? 31.869  48.896 6.675   1.00 17.30 ? 391  ARG A CB  1 
ATOM   2679 C  CG  . ARG A  1  356 ? 31.073  47.656 6.222   1.00 14.95 ? 391  ARG A CG  1 
ATOM   2680 C  CD  . ARG A  1  356 ? 29.664  48.051 5.714   1.00 14.94 ? 391  ARG A CD  1 
ATOM   2681 N  NE  . ARG A  1  356 ? 28.855  48.717 6.728   1.00 16.34 ? 391  ARG A NE  1 
ATOM   2682 C  CZ  . ARG A  1  356 ? 28.162  48.105 7.688   1.00 18.30 ? 391  ARG A CZ  1 
ATOM   2683 N  NH1 . ARG A  1  356 ? 28.155  46.770 7.793   1.00 19.68 ? 391  ARG A NH1 1 
ATOM   2684 N  NH2 . ARG A  1  356 ? 27.472  48.836 8.575   1.00 15.14 ? 391  ARG A NH2 1 
ATOM   2685 N  N   . ILE A  1  357 ? 34.746  50.737 6.454   1.00 15.54 ? 392  ILE A N   1 
ATOM   2686 C  CA  . ILE A  1  357 ? 35.590  51.785 7.055   1.00 18.27 ? 392  ILE A CA  1 
ATOM   2687 C  C   . ILE A  1  357 ? 35.032  53.181 6.721   1.00 17.10 ? 392  ILE A C   1 
ATOM   2688 O  O   . ILE A  1  357 ? 34.646  53.444 5.595   1.00 20.44 ? 392  ILE A O   1 
ATOM   2689 C  CB  . ILE A  1  357 ? 37.036  51.692 6.540   1.00 17.60 ? 392  ILE A CB  1 
ATOM   2690 C  CG1 . ILE A  1  357 ? 37.693  50.397 7.005   1.00 18.97 ? 392  ILE A CG1 1 
ATOM   2691 C  CG2 . ILE A  1  357 ? 37.869  52.913 7.018   1.00 19.20 ? 392  ILE A CG2 1 
ATOM   2692 C  CD1 . ILE A  1  357 ? 38.985  50.085 6.234   1.00 20.59 ? 392  ILE A CD1 1 
ATOM   2693 N  N   . ARG A  1  358 ? 35.043  54.063 7.720   1.00 19.30 ? 393  ARG A N   1 
ATOM   2694 C  CA  . ARG A  1  358 ? 34.660  55.465 7.568   1.00 20.93 ? 393  ARG A CA  1 
ATOM   2695 C  C   . ARG A  1  358 ? 35.507  56.236 8.576   1.00 23.04 ? 393  ARG A C   1 
ATOM   2696 O  O   . ARG A  1  358 ? 36.043  55.665 9.516   1.00 21.93 ? 393  ARG A O   1 
ATOM   2697 C  CB  . ARG A  1  358 ? 33.168  55.674 7.857   1.00 20.63 ? 393  ARG A CB  1 
ATOM   2698 C  CG  . ARG A  1  358 ? 32.672  55.284 9.264   1.00 23.15 ? 393  ARG A CG  1 
ATOM   2699 C  CD  . ARG A  1  358 ? 31.141  55.465 9.397   1.00 23.04 ? 393  ARG A CD  1 
ATOM   2700 N  NE  . ARG A  1  358 ? 30.667  55.312 10.773  1.00 23.71 ? 393  ARG A NE  1 
ATOM   2701 C  CZ  . ARG A  1  358 ? 30.216  54.178 11.308  1.00 23.08 ? 393  ARG A CZ  1 
ATOM   2702 N  NH1 . ARG A  1  358 ? 30.186  53.053 10.608  1.00 20.53 ? 393  ARG A NH1 1 
ATOM   2703 N  NH2 . ARG A  1  358 ? 29.817  54.160 12.566  1.00 25.62 ? 393  ARG A NH2 1 
ATOM   2704 N  N   . PRO A  1  359 ? 35.650  57.542 8.375   1.00 25.44 ? 394  PRO A N   1 
ATOM   2705 C  CA  . PRO A  1  359 ? 36.371  58.299 9.400   1.00 26.93 ? 394  PRO A CA  1 
ATOM   2706 C  C   . PRO A  1  359 ? 35.662  58.296 10.749  1.00 25.01 ? 394  PRO A C   1 
ATOM   2707 O  O   . PRO A  1  359 ? 34.430  58.278 10.827  1.00 25.84 ? 394  PRO A O   1 
ATOM   2708 C  CB  . PRO A  1  359 ? 36.391  59.721 8.822   1.00 30.43 ? 394  PRO A CB  1 
ATOM   2709 C  CG  . PRO A  1  359 ? 35.188  59.770 7.900   1.00 27.85 ? 394  PRO A CG  1 
ATOM   2710 C  CD  . PRO A  1  359 ? 35.153  58.391 7.287   1.00 24.17 ? 394  PRO A CD  1 
ATOM   2711 N  N   . LYS A  1  360 ? 36.439  58.324 11.824  1.00 25.20 ? 395  LYS A N   1 
ATOM   2712 C  CA  . LYS A  1  360 ? 35.866  58.305 13.166  1.00 25.83 ? 395  LYS A CA  1 
ATOM   2713 C  C   . LYS A  1  360 ? 34.986  59.531 13.376  1.00 30.14 ? 395  LYS A C   1 
ATOM   2714 O  O   . LYS A  1  360 ? 33.881  59.452 13.958  1.00 26.42 ? 395  LYS A O   1 
ATOM   2715 C  CB  . LYS A  1  360 ? 36.988  58.251 14.214  1.00 27.70 ? 395  LYS A CB  1 
ATOM   2716 C  CG  . LYS A  1  360 ? 36.483  58.255 15.645  1.00 32.29 ? 395  LYS A CG  1 
ATOM   2717 C  CD  . LYS A  1  360 ? 37.644  58.341 16.629  1.00 36.72 ? 395  LYS A CD  1 
ATOM   2718 C  CE  . LYS A  1  360 ? 37.144  58.595 18.035  1.00 36.74 ? 395  LYS A CE  1 
ATOM   2719 N  NZ  . LYS A  1  360 ? 38.272  58.753 18.987  1.00 44.14 ? 395  LYS A NZ  1 
ATOM   2720 N  N   . ILE A  1  361 ? 35.481  60.673 12.902  1.00 28.57 ? 396  ILE A N   1 
ATOM   2721 C  CA  . ILE A  1  361 ? 34.682  61.888 12.890  1.00 32.59 ? 396  ILE A CA  1 
ATOM   2722 C  C   . ILE A  1  361 ? 33.985  61.964 11.546  1.00 31.82 ? 396  ILE A C   1 
ATOM   2723 O  O   . ILE A  1  361 ? 34.642  61.979 10.507  1.00 34.54 ? 396  ILE A O   1 
ATOM   2724 C  CB  . ILE A  1  361 ? 35.554  63.149 13.085  1.00 34.53 ? 396  ILE A CB  1 
ATOM   2725 C  CG1 . ILE A  1  361 ? 36.223  63.125 14.461  1.00 35.05 ? 396  ILE A CG1 1 
ATOM   2726 C  CG2 . ILE A  1  361 ? 34.700  64.393 12.905  1.00 32.31 ? 396  ILE A CG2 1 
ATOM   2727 C  CD1 . ILE A  1  361 ? 37.141  64.309 14.726  1.00 35.20 ? 396  ILE A CD1 1 
ATOM   2728 N  N   . PRO A  1  362 ? 32.646  61.967 11.546  1.00 32.66 ? 397  PRO A N   1 
ATOM   2729 C  CA  . PRO A  1  362 ? 31.933  61.961 10.273  1.00 32.88 ? 397  PRO A CA  1 
ATOM   2730 C  C   . PRO A  1  362 ? 32.343  63.131 9.416   1.00 37.61 ? 397  PRO A C   1 
ATOM   2731 O  O   . PRO A  1  362 ? 32.470  64.253 9.920   1.00 37.16 ? 397  PRO A O   1 
ATOM   2732 C  CB  . PRO A  1  362 ? 30.467  62.126 10.690  1.00 37.97 ? 397  PRO A CB  1 
ATOM   2733 C  CG  . PRO A  1  362 ? 30.401  61.542 12.035  1.00 32.82 ? 397  PRO A CG  1 
ATOM   2734 C  CD  . PRO A  1  362 ? 31.730  61.844 12.689  1.00 31.78 ? 397  PRO A CD  1 
ATOM   2735 N  N   . ASN A  1  363 ? 32.536  62.862 8.130   1.00 35.77 ? 398  ASN A N   1 
ATOM   2736 C  CA  . ASN A  1  363 ? 32.890  63.892 7.170   1.00 41.08 ? 398  ASN A CA  1 
ATOM   2737 C  C   . ASN A  1  363 ? 34.291  64.477 7.398   1.00 39.60 ? 398  ASN A C   1 
ATOM   2738 O  O   . ASN A  1  363 ? 34.619  65.522 6.837   1.00 40.33 ? 398  ASN A O   1 
ATOM   2739 C  CB  . ASN A  1  363 ? 31.847  65.010 7.198   1.00 40.15 ? 398  ASN A CB  1 
ATOM   2740 C  CG  . ASN A  1  363 ? 30.434  64.504 6.930   1.00 49.15 ? 398  ASN A CG  1 
ATOM   2741 O  OD1 . ASN A  1  363 ? 29.460  65.001 7.509   1.00 53.01 ? 398  ASN A OD1 1 
ATOM   2742 N  ND2 . ASN A  1  363 ? 30.316  63.512 6.052   1.00 46.45 ? 398  ASN A ND2 1 
ATOM   2743 N  N   . ASN A  1  364 ? 35.108  63.808 8.214   1.00 38.85 ? 399  ASN A N   1 
ATOM   2744 C  CA  . ASN A  1  364 ? 36.469  64.284 8.475   1.00 36.52 ? 399  ASN A CA  1 
ATOM   2745 C  C   . ASN A  1  364 ? 37.234  64.497 7.176   1.00 35.40 ? 399  ASN A C   1 
ATOM   2746 O  O   . ASN A  1  364 ? 37.492  63.559 6.414   1.00 33.89 ? 399  ASN A O   1 
ATOM   2747 C  CB  . ASN A  1  364 ? 37.238  63.346 9.400   1.00 36.46 ? 399  ASN A CB  1 
ATOM   2748 C  CG  . ASN A  1  364 ? 38.620  63.873 9.751   1.00 42.91 ? 399  ASN A CG  1 
ATOM   2749 O  OD1 . ASN A  1  364 ? 39.077  64.885 9.212   1.00 42.61 ? 399  ASN A OD1 1 
ATOM   2750 N  ND2 . ASN A  1  364 ? 39.298  63.181 10.659  1.00 44.17 ? 399  ASN A ND2 1 
ATOM   2751 N  N   . LEU A  1  365 ? 37.607  65.750 6.939   1.00 37.01 ? 400  LEU A N   1 
ATOM   2752 C  CA  . LEU A  1  365 ? 38.178  66.150 5.657   1.00 38.48 ? 400  LEU A CA  1 
ATOM   2753 C  C   . LEU A  1  365 ? 39.565  65.564 5.414   1.00 35.47 ? 400  LEU A C   1 
ATOM   2754 O  O   . LEU A  1  365 ? 40.021  65.512 4.284   1.00 36.85 ? 400  LEU A O   1 
ATOM   2755 C  CB  . LEU A  1  365 ? 38.193  67.678 5.544   1.00 40.79 ? 400  LEU A CB  1 
ATOM   2756 C  CG  . LEU A  1  365 ? 36.792  68.262 5.755   1.00 40.22 ? 400  LEU A CG  1 
ATOM   2757 C  CD1 . LEU A  1  365 ? 36.762  69.778 5.617   1.00 39.78 ? 400  LEU A CD1 1 
ATOM   2758 C  CD2 . LEU A  1  365 ? 35.852  67.607 4.770   1.00 42.31 ? 400  LEU A CD2 1 
ATOM   2759 N  N   . LYS A  1  366 ? 40.237  65.118 6.465   1.00 36.57 ? 401  LYS A N   1 
ATOM   2760 C  CA  . LYS A  1  366 ? 41.579  64.558 6.279   1.00 35.87 ? 401  LYS A CA  1 
ATOM   2761 C  C   . LYS A  1  366 ? 41.542  63.060 5.932   1.00 37.79 ? 401  LYS A C   1 
ATOM   2762 O  O   . LYS A  1  366 ? 42.567  62.460 5.582   1.00 36.97 ? 401  LYS A O   1 
ATOM   2763 C  CB  . LYS A  1  366 ? 42.463  64.809 7.496   1.00 42.16 ? 401  LYS A CB  1 
ATOM   2764 C  CG  . LYS A  1  366 ? 43.753  65.555 7.159   1.00 40.31 ? 401  LYS A CG  1 
ATOM   2765 C  CD  . LYS A  1  366 ? 44.768  65.396 8.271   1.00 43.82 ? 401  LYS A CD  1 
ATOM   2766 C  CE  . LYS A  1  366 ? 44.203  65.831 9.609   1.00 43.36 ? 401  LYS A CE  1 
ATOM   2767 N  NZ  . LYS A  1  366 ? 45.302  65.877 10.623  1.00 52.54 ? 401  LYS A NZ  1 
ATOM   2768 N  N   . TYR A  1  367 ? 40.361  62.465 6.024   1.00 35.61 ? 402  TYR A N   1 
ATOM   2769 C  CA  . TYR A  1  367 ? 40.178  61.085 5.588   1.00 32.45 ? 402  TYR A CA  1 
ATOM   2770 C  C   . TYR A  1  367 ? 40.744  60.911 4.168   1.00 33.51 ? 402  TYR A C   1 
ATOM   2771 O  O   . TYR A  1  367 ? 40.339  61.620 3.253   1.00 33.22 ? 402  TYR A O   1 
ATOM   2772 C  CB  . TYR A  1  367 ? 38.679  60.726 5.656   1.00 32.85 ? 402  TYR A CB  1 
ATOM   2773 C  CG  . TYR A  1  367 ? 38.334  59.289 5.331   1.00 31.96 ? 402  TYR A CG  1 
ATOM   2774 C  CD1 . TYR A  1  367 ? 38.940  58.234 6.012   1.00 29.00 ? 402  TYR A CD1 1 
ATOM   2775 C  CD2 . TYR A  1  367 ? 37.380  58.991 4.366   1.00 30.67 ? 402  TYR A CD2 1 
ATOM   2776 C  CE1 . TYR A  1  367 ? 38.620  56.937 5.723   1.00 27.68 ? 402  TYR A CE1 1 
ATOM   2777 C  CE2 . TYR A  1  367 ? 37.044  57.688 4.075   1.00 31.90 ? 402  TYR A CE2 1 
ATOM   2778 C  CZ  . TYR A  1  367 ? 37.663  56.661 4.763   1.00 28.39 ? 402  TYR A CZ  1 
ATOM   2779 O  OH  . TYR A  1  367 ? 37.351  55.348 4.454   1.00 29.82 ? 402  TYR A OH  1 
ATOM   2780 N  N   . ASP A  1  368 ? 41.678  59.975 3.994   1.00 30.94 ? 403  ASP A N   1 
ATOM   2781 C  CA  . ASP A  1  368 ? 42.322  59.718 2.706   1.00 28.09 ? 403  ASP A CA  1 
ATOM   2782 C  C   . ASP A  1  368 ? 42.064  58.294 2.187   1.00 29.55 ? 403  ASP A C   1 
ATOM   2783 O  O   . ASP A  1  368 ? 42.939  57.434 2.280   1.00 29.34 ? 403  ASP A O   1 
ATOM   2784 C  CB  . ASP A  1  368 ? 43.825  59.886 2.875   1.00 24.45 ? 403  ASP A CB  1 
ATOM   2785 C  CG  . ASP A  1  368 ? 44.555  60.093 1.559   1.00 28.73 ? 403  ASP A CG  1 
ATOM   2786 O  OD1 . ASP A  1  368 ? 44.042  59.709 0.482   1.00 29.00 ? 403  ASP A OD1 1 
ATOM   2787 O  OD2 . ASP A  1  368 ? 45.681  60.633 1.618   1.00 29.01 ? 403  ASP A OD2 1 
ATOM   2788 N  N   . PRO A  1  369 ? 40.883  58.043 1.611   1.00 29.38 ? 404  PRO A N   1 
ATOM   2789 C  CA  . PRO A  1  369 ? 40.560  56.671 1.180   1.00 25.66 ? 404  PRO A CA  1 
ATOM   2790 C  C   . PRO A  1  369 ? 41.483  56.040 0.128   1.00 25.31 ? 404  PRO A C   1 
ATOM   2791 O  O   . PRO A  1  369 ? 41.712  54.826 0.205   1.00 26.68 ? 404  PRO A O   1 
ATOM   2792 C  CB  . PRO A  1  369 ? 39.117  56.789 0.641   1.00 30.34 ? 404  PRO A CB  1 
ATOM   2793 C  CG  . PRO A  1  369 ? 38.854  58.277 0.511   1.00 33.41 ? 404  PRO A CG  1 
ATOM   2794 C  CD  . PRO A  1  369 ? 39.720  58.944 1.534   1.00 29.98 ? 404  PRO A CD  1 
ATOM   2795 N  N   . LYS A  1  370 ? 42.000  56.798 -0.845  1.00 24.42 ? 405  LYS A N   1 
ATOM   2796 C  CA  . LYS A  1  370 ? 42.915  56.197 -1.808  1.00 23.48 ? 405  LYS A CA  1 
ATOM   2797 C  C   . LYS A  1  370 ? 44.230  55.743 -1.157  1.00 21.08 ? 405  LYS A C   1 
ATOM   2798 O  O   . LYS A  1  370 ? 44.784  54.714 -1.528  1.00 25.21 ? 405  LYS A O   1 
ATOM   2799 C  CB  . LYS A  1  370 ? 43.189  57.137 -3.002  1.00 24.36 ? 405  LYS A CB  1 
ATOM   2800 C  CG  . LYS A  1  370 ? 41.966  57.372 -3.864  1.00 31.29 ? 405  LYS A CG  1 
ATOM   2801 C  CD  . LYS A  1  370 ? 42.295  58.037 -5.199  1.00 35.96 ? 405  LYS A CD  1 
ATOM   2802 C  CE  . LYS A  1  370 ? 40.990  58.313 -5.960  1.00 39.73 ? 405  LYS A CE  1 
ATOM   2803 N  NZ  . LYS A  1  370 ? 41.220  58.792 -7.368  1.00 39.05 ? 405  LYS A NZ  1 
ATOM   2804 N  N   . ALA A  1  371 ? 44.721  56.513 -0.200  1.00 21.75 ? 406  ALA A N   1 
ATOM   2805 C  CA  . ALA A  1  371 ? 45.944  56.141 0.523   1.00 23.47 ? 406  ALA A CA  1 
ATOM   2806 C  C   . ALA A  1  371 ? 45.694  54.908 1.382   1.00 23.60 ? 406  ALA A C   1 
ATOM   2807 O  O   . ALA A  1  371 ? 46.532  54.018 1.462   1.00 21.11 ? 406  ALA A O   1 
ATOM   2808 C  CB  . ALA A  1  371 ? 46.436  57.277 1.383   1.00 25.61 ? 406  ALA A CB  1 
ATOM   2809 N  N   . ILE A  1  372 ? 44.536  54.877 2.031   1.00 21.56 ? 407  ILE A N   1 
ATOM   2810 C  CA  . ILE A  1  372 ? 44.182  53.734 2.870   1.00 22.73 ? 407  ILE A CA  1 
ATOM   2811 C  C   . ILE A  1  372 ? 44.089  52.480 2.019   1.00 21.87 ? 407  ILE A C   1 
ATOM   2812 O  O   . ILE A  1  372 ? 44.709  51.462 2.342   1.00 21.24 ? 407  ILE A O   1 
ATOM   2813 C  CB  . ILE A  1  372 ? 42.867  53.989 3.654   1.00 25.13 ? 407  ILE A CB  1 
ATOM   2814 C  CG1 . ILE A  1  372 ? 43.110  55.023 4.755   1.00 26.04 ? 407  ILE A CG1 1 
ATOM   2815 C  CG2 . ILE A  1  372 ? 42.330  52.679 4.258   1.00 22.10 ? 407  ILE A CG2 1 
ATOM   2816 C  CD1 . ILE A  1  372 ? 41.823  55.525 5.451   1.00 28.65 ? 407  ILE A CD1 1 
ATOM   2817 N  N   . ILE A  1  373 ? 43.326  52.538 0.933   1.00 20.93 ? 408  ILE A N   1 
ATOM   2818 C  CA  . ILE A  1  373 ? 43.234  51.396 0.037   1.00 23.03 ? 408  ILE A CA  1 
ATOM   2819 C  C   . ILE A  1  373 ? 44.586  50.929 -0.469  1.00 25.59 ? 408  ILE A C   1 
ATOM   2820 O  O   . ILE A  1  373 ? 44.839  49.728 -0.518  1.00 20.71 ? 408  ILE A O   1 
ATOM   2821 C  CB  . ILE A  1  373 ? 42.327  51.664 -1.156  1.00 24.37 ? 408  ILE A CB  1 
ATOM   2822 C  CG1 . ILE A  1  373 ? 40.876  51.757 -0.691  1.00 27.77 ? 408  ILE A CG1 1 
ATOM   2823 C  CG2 . ILE A  1  373 ? 42.431  50.531 -2.171  1.00 27.58 ? 408  ILE A CG2 1 
ATOM   2824 C  CD1 . ILE A  1  373 ? 39.895  51.590 -1.824  1.00 33.59 ? 408  ILE A CD1 1 
ATOM   2825 N  N   . ALA A  1  374 ? 45.458  51.869 -0.842  1.00 21.47 ? 409  ALA A N   1 
ATOM   2826 C  CA  . ALA A  1  374 ? 46.770  51.479 -1.373  1.00 24.02 ? 409  ALA A CA  1 
ATOM   2827 C  C   . ALA A  1  374 ? 47.545  50.656 -0.322  1.00 19.87 ? 409  ALA A C   1 
ATOM   2828 O  O   . ALA A  1  374 ? 48.155  49.635 -0.660  1.00 23.75 ? 409  ALA A O   1 
ATOM   2829 C  CB  . ALA A  1  374 ? 47.566  52.711 -1.789  1.00 24.54 ? 409  ALA A CB  1 
ATOM   2830 N  N   . ASN A  1  375 ? 47.519  51.110 0.923   1.00 21.19 ? 410  ASN A N   1 
ATOM   2831 C  CA  . ASN A  1  375 ? 48.188  50.405 2.039   1.00 21.19 ? 410  ASN A CA  1 
ATOM   2832 C  C   . ASN A  1  375 ? 47.558  49.054 2.395   1.00 22.27 ? 410  ASN A C   1 
ATOM   2833 O  O   . ASN A  1  375 ? 48.169  48.257 3.122   1.00 20.75 ? 410  ASN A O   1 
ATOM   2834 C  CB  . ASN A  1  375 ? 48.243  51.264 3.312   1.00 21.72 ? 410  ASN A CB  1 
ATOM   2835 C  CG  . ASN A  1  375 ? 49.456  52.194 3.334   1.00 26.54 ? 410  ASN A CG  1 
ATOM   2836 O  OD1 . ASN A  1  375 ? 49.899  52.664 2.281   1.00 26.75 ? 410  ASN A OD1 1 
ATOM   2837 N  ND2 . ASN A  1  375 ? 49.986  52.449 4.527   1.00 26.90 ? 410  ASN A ND2 1 
ATOM   2838 N  N   . LEU A  1  376 ? 46.338  48.809 1.913   1.00 21.31 ? 411  LEU A N   1 
ATOM   2839 C  CA  . LEU A  1  376 ? 45.618  47.556 2.216   1.00 20.43 ? 411  LEU A CA  1 
ATOM   2840 C  C   . LEU A  1  376 ? 45.656  46.563 1.052   1.00 22.64 ? 411  LEU A C   1 
ATOM   2841 O  O   . LEU A  1  376 ? 45.108  45.463 1.139   1.00 18.67 ? 411  LEU A O   1 
ATOM   2842 C  CB  . LEU A  1  376 ? 44.151  47.868 2.605   1.00 17.90 ? 411  LEU A CB  1 
ATOM   2843 C  CG  . LEU A  1  376 ? 43.913  48.676 3.891   1.00 19.84 ? 411  LEU A CG  1 
ATOM   2844 C  CD1 . LEU A  1  376 ? 42.417  48.893 4.120   1.00 19.82 ? 411  LEU A CD1 1 
ATOM   2845 C  CD2 . LEU A  1  376 ? 44.502  47.927 5.100   1.00 19.37 ? 411  LEU A CD2 1 
ATOM   2846 N  N   . THR A  1  377 ? 46.300  46.943 -0.054  1.00 19.12 ? 412  THR A N   1 
ATOM   2847 C  CA  . THR A  1  377 ? 46.254  46.134 -1.255  1.00 20.80 ? 412  THR A CA  1 
ATOM   2848 C  C   . THR A  1  377 ? 47.462  45.241 -1.446  1.00 23.16 ? 412  THR A C   1 
ATOM   2849 O  O   . THR A  1  377 ? 48.561  45.739 -1.738  1.00 21.07 ? 412  THR A O   1 
ATOM   2850 C  CB  . THR A  1  377 ? 46.114  47.042 -2.515  1.00 23.40 ? 412  THR A CB  1 
ATOM   2851 O  OG1 . THR A  1  377 ? 44.884  47.771 -2.424  1.00 23.77 ? 412  THR A OG1 1 
ATOM   2852 C  CG2 . THR A  1  377 ? 46.131  46.215 -3.789  1.00 23.35 ? 412  THR A CG2 1 
ATOM   2853 N  N   . CYS A  1  378 ? 47.254  43.934 -1.313  1.00 18.52 ? 413  CYS A N   1 
ATOM   2854 C  CA  . CYS A  1  378 ? 48.302  42.953 -1.603  1.00 20.34 ? 413  CYS A CA  1 
ATOM   2855 C  C   . CYS A  1  378 ? 49.605  43.277 -0.883  1.00 25.13 ? 413  CYS A C   1 
ATOM   2856 O  O   . CYS A  1  378 ? 50.690  43.277 -1.502  1.00 23.21 ? 413  CYS A O   1 
ATOM   2857 C  CB  . CYS A  1  378 ? 48.549  42.883 -3.111  1.00 25.07 ? 413  CYS A CB  1 
ATOM   2858 S  SG  . CYS A  1  378 ? 47.028  42.506 -4.046  1.00 25.85 ? 413  CYS A SG  1 
ATOM   2859 N  N   . LYS A  1  379 ? 49.501  43.529 0.420   1.00 21.10 ? 414  LYS A N   1 
ATOM   2860 C  CA  . LYS A  1  379 ? 50.657  43.915 1.222   1.00 22.61 ? 414  LYS A CA  1 
ATOM   2861 C  C   . LYS A  1  379 ? 51.271  42.775 2.030   1.00 26.96 ? 414  LYS A C   1 
ATOM   2862 O  O   . LYS A  1  379 ? 52.384  42.919 2.516   1.00 26.73 ? 414  LYS A O   1 
ATOM   2863 C  CB  . LYS A  1  379 ? 50.336  45.071 2.158   1.00 23.81 ? 414  LYS A CB  1 
ATOM   2864 C  CG  . LYS A  1  379 ? 50.086  46.372 1.462   1.00 23.81 ? 414  LYS A CG  1 
ATOM   2865 C  CD  . LYS A  1  379 ? 51.196  46.744 0.492   1.00 29.07 ? 414  LYS A CD  1 
ATOM   2866 C  CE  . LYS A  1  379 ? 51.116  48.224 0.183   1.00 33.30 ? 414  LYS A CE  1 
ATOM   2867 N  NZ  . LYS A  1  379 ? 51.570  48.548 -1.200  1.00 39.94 ? 414  LYS A NZ  1 
ATOM   2868 N  N   . LYS A  1  380 ? 50.551  41.663 2.180   1.00 23.21 ? 415  LYS A N   1 
ATOM   2869 C  CA  . LYS A  1  380 ? 51.100  40.428 2.779   1.00 25.23 ? 415  LYS A CA  1 
ATOM   2870 C  C   . LYS A  1  380 ? 50.816  39.308 1.814   1.00 25.02 ? 415  LYS A C   1 
ATOM   2871 O  O   . LYS A  1  380 ? 49.758  39.281 1.198   1.00 24.77 ? 415  LYS A O   1 
ATOM   2872 C  CB  . LYS A  1  380 ? 50.406  40.056 4.096   1.00 21.46 ? 415  LYS A CB  1 
ATOM   2873 C  CG  . LYS A  1  380 ? 50.702  40.946 5.290   1.00 28.40 ? 415  LYS A CG  1 
ATOM   2874 C  CD  . LYS A  1  380 ? 49.995  40.387 6.571   1.00 28.93 ? 415  LYS A CD  1 
ATOM   2875 C  CE  . LYS A  1  380 ? 49.869  38.836 6.588   1.00 37.20 ? 415  LYS A CE  1 
ATOM   2876 N  NZ  . LYS A  1  380 ? 48.532  38.271 7.110   1.00 27.45 ? 415  LYS A NZ  1 
ATOM   2877 N  N   . PRO A  1  381 ? 51.740  38.351 1.694   1.00 24.68 ? 416  PRO A N   1 
ATOM   2878 C  CA  . PRO A  1  381 ? 51.534  37.224 0.781   1.00 28.74 ? 416  PRO A CA  1 
ATOM   2879 C  C   . PRO A  1  381 ? 50.292  36.404 1.150   1.00 33.85 ? 416  PRO A C   1 
ATOM   2880 O  O   . PRO A  1  381 ? 49.608  35.872 0.279   1.00 34.34 ? 416  PRO A O   1 
ATOM   2881 C  CB  . PRO A  1  381 ? 52.799  36.382 0.980   1.00 31.63 ? 416  PRO A CB  1 
ATOM   2882 C  CG  . PRO A  1  381 ? 53.326  36.787 2.312   1.00 35.31 ? 416  PRO A CG  1 
ATOM   2883 C  CD  . PRO A  1  381 ? 53.021  38.253 2.416   1.00 30.73 ? 416  PRO A CD  1 
ATOM   2884 N  N   . ASP A  1  382 ? 50.018  36.293 2.438   1.00 26.39 ? 417  ASP A N   1 
ATOM   2885 C  CA  . ASP A  1  382 ? 48.924  35.441 2.869   1.00 32.68 ? 417  ASP A CA  1 
ATOM   2886 C  C   . ASP A  1  382 ? 47.713  36.266 3.304   1.00 29.35 ? 417  ASP A C   1 
ATOM   2887 O  O   . ASP A  1  382 ? 46.868  35.781 4.037   1.00 33.36 ? 417  ASP A O   1 
ATOM   2888 C  CB  . ASP A  1  382 ? 49.387  34.494 3.994   1.00 34.78 ? 417  ASP A CB  1 
ATOM   2889 C  CG  . ASP A  1  382 ? 50.352  35.160 4.991   1.00 40.39 ? 417  ASP A CG  1 
ATOM   2890 O  OD1 . ASP A  1  382 ? 50.909  36.247 4.704   1.00 39.19 ? 417  ASP A OD1 1 
ATOM   2891 O  OD2 . ASP A  1  382 ? 50.567  34.576 6.078   1.00 44.21 ? 417  ASP A OD2 1 
ATOM   2892 N  N   . GLN A  1  383 ? 47.634  37.513 2.841   1.00 25.69 ? 418  GLN A N   1 
ATOM   2893 C  CA  . GLN A  1  383 ? 46.677  38.470 3.371   1.00 21.53 ? 418  GLN A CA  1 
ATOM   2894 C  C   . GLN A  1  383 ? 45.252  37.923 3.415   1.00 20.69 ? 418  GLN A C   1 
ATOM   2895 O  O   . GLN A  1  383 ? 44.731  37.413 2.425   1.00 21.69 ? 418  GLN A O   1 
ATOM   2896 C  CB  . GLN A  1  383 ? 46.715  39.719 2.508   1.00 23.75 ? 418  GLN A CB  1 
ATOM   2897 C  CG  . GLN A  1  383 ? 46.138  40.902 3.159   1.00 20.32 ? 418  GLN A CG  1 
ATOM   2898 C  CD  . GLN A  1  383 ? 46.365  42.114 2.294   1.00 23.19 ? 418  GLN A CD  1 
ATOM   2899 O  OE1 . GLN A  1  383 ? 47.506  42.455 2.005   1.00 21.76 ? 418  GLN A OE1 1 
ATOM   2900 N  NE2 . GLN A  1  383 ? 45.279  42.761 1.855   1.00 19.22 ? 418  GLN A NE2 1 
ATOM   2901 N  N   . HIS A  1  384 ? 44.625  38.030 4.581   1.00 19.16 ? 419  HIS A N   1 
ATOM   2902 C  CA  . HIS A  1  384 ? 43.357  37.342 4.808   1.00 19.16 ? 419  HIS A CA  1 
ATOM   2903 C  C   . HIS A  1  384 ? 42.123  38.235 4.666   1.00 20.53 ? 419  HIS A C   1 
ATOM   2904 O  O   . HIS A  1  384 ? 41.063  37.945 5.246   1.00 17.92 ? 419  HIS A O   1 
ATOM   2905 C  CB  . HIS A  1  384 ? 43.396  36.648 6.176   1.00 17.50 ? 419  HIS A CB  1 
ATOM   2906 C  CG  . HIS A  1  384 ? 44.522  35.660 6.287   1.00 19.69 ? 419  HIS A CG  1 
ATOM   2907 N  ND1 . HIS A  1  384 ? 44.556  34.495 5.558   1.00 21.17 ? 419  HIS A ND1 1 
ATOM   2908 C  CD2 . HIS A  1  384 ? 45.678  35.694 6.993   1.00 22.57 ? 419  HIS A CD2 1 
ATOM   2909 C  CE1 . HIS A  1  384 ? 45.670  33.838 5.820   1.00 22.77 ? 419  HIS A CE1 1 
ATOM   2910 N  NE2 . HIS A  1  384 ? 46.364  34.537 6.696   1.00 22.43 ? 419  HIS A NE2 1 
ATOM   2911 N  N   . PHE A  1  385 ? 42.265  39.312 3.902   1.00 18.34 ? 420  PHE A N   1 
ATOM   2912 C  CA  . PHE A  1  385 ? 41.104  40.102 3.473   1.00 17.85 ? 420  PHE A CA  1 
ATOM   2913 C  C   . PHE A  1  385 ? 41.504  40.830 2.208   1.00 20.02 ? 420  PHE A C   1 
ATOM   2914 O  O   . PHE A  1  385 ? 42.677  40.854 1.838   1.00 18.54 ? 420  PHE A O   1 
ATOM   2915 C  CB  . PHE A  1  385 ? 40.713  41.156 4.508   1.00 15.04 ? 420  PHE A CB  1 
ATOM   2916 C  CG  . PHE A  1  385 ? 41.803  42.136 4.796   1.00 15.92 ? 420  PHE A CG  1 
ATOM   2917 C  CD1 . PHE A  1  385 ? 41.849  43.352 4.146   1.00 19.65 ? 420  PHE A CD1 1 
ATOM   2918 C  CD2 . PHE A  1  385 ? 42.785  41.837 5.743   1.00 18.82 ? 420  PHE A CD2 1 
ATOM   2919 C  CE1 . PHE A  1  385 ? 42.868  44.260 4.400   1.00 19.18 ? 420  PHE A CE1 1 
ATOM   2920 C  CE2 . PHE A  1  385 ? 43.829  42.744 6.001   1.00 18.92 ? 420  PHE A CE2 1 
ATOM   2921 C  CZ  . PHE A  1  385 ? 43.854  43.967 5.344   1.00 20.23 ? 420  PHE A CZ  1 
ATOM   2922 N  N   . LYS A  1  386 ? 40.529  41.422 1.531   1.00 16.93 ? 421  LYS A N   1 
ATOM   2923 C  CA  . LYS A  1  386 ? 40.841  42.212 0.341   1.00 15.11 ? 421  LYS A CA  1 
ATOM   2924 C  C   . LYS A  1  386 ? 39.983  43.469 0.327   1.00 17.64 ? 421  LYS A C   1 
ATOM   2925 O  O   . LYS A  1  386 ? 38.756  43.380 0.466   1.00 18.83 ? 421  LYS A O   1 
ATOM   2926 C  CB  . LYS A  1  386 ? 40.601  41.391 -0.945  1.00 17.19 ? 421  LYS A CB  1 
ATOM   2927 C  CG  . LYS A  1  386 ? 40.925  42.174 -2.261  1.00 15.34 ? 421  LYS A CG  1 
ATOM   2928 C  CD  . LYS A  1  386 ? 40.559  41.395 -3.494  1.00 18.51 ? 421  LYS A CD  1 
ATOM   2929 C  CE  . LYS A  1  386 ? 41.399  40.111 -3.681  1.00 22.39 ? 421  LYS A CE  1 
ATOM   2930 N  NZ  . LYS A  1  386 ? 42.920  40.312 -3.544  1.00 19.62 ? 421  LYS A NZ  1 
ATOM   2931 N  N   . PRO A  1  387 ? 40.616  44.648 0.152   1.00 18.28 ? 422  PRO A N   1 
ATOM   2932 C  CA  . PRO A  1  387 ? 39.819  45.867 0.168   1.00 16.63 ? 422  PRO A CA  1 
ATOM   2933 C  C   . PRO A  1  387 ? 39.183  46.089 -1.184  1.00 16.31 ? 422  PRO A C   1 
ATOM   2934 O  O   . PRO A  1  387 ? 39.745  45.752 -2.228  1.00 17.13 ? 422  PRO A O   1 
ATOM   2935 C  CB  . PRO A  1  387 ? 40.870  46.968 0.436   1.00 17.75 ? 422  PRO A CB  1 
ATOM   2936 C  CG  . PRO A  1  387 ? 42.089  46.453 -0.257  1.00 17.94 ? 422  PRO A CG  1 
ATOM   2937 C  CD  . PRO A  1  387 ? 42.051  44.940 -0.005  1.00 19.61 ? 422  PRO A CD  1 
ATOM   2938 N  N   . TYR A  1  388 ? 37.992  46.677 -1.147  1.00 18.38 ? 423  TYR A N   1 
ATOM   2939 C  CA  . TYR A  1  388 ? 37.247  47.034 -2.335  1.00 18.27 ? 423  TYR A CA  1 
ATOM   2940 C  C   . TYR A  1  388 ? 36.580  48.373 -2.095  1.00 16.54 ? 423  TYR A C   1 
ATOM   2941 O  O   . TYR A  1  388 ? 35.972  48.576 -1.057  1.00 16.77 ? 423  TYR A O   1 
ATOM   2942 C  CB  . TYR A  1  388 ? 36.097  46.059 -2.566  1.00 19.08 ? 423  TYR A CB  1 
ATOM   2943 C  CG  . TYR A  1  388 ? 36.441  44.716 -3.164  1.00 17.49 ? 423  TYR A CG  1 
ATOM   2944 C  CD1 . TYR A  1  388 ? 36.361  44.505 -4.527  1.00 19.50 ? 423  TYR A CD1 1 
ATOM   2945 C  CD2 . TYR A  1  388 ? 36.800  43.648 -2.347  1.00 16.09 ? 423  TYR A CD2 1 
ATOM   2946 C  CE1 . TYR A  1  388 ? 36.635  43.259 -5.080  1.00 19.76 ? 423  TYR A CE1 1 
ATOM   2947 C  CE2 . TYR A  1  388 ? 37.096  42.413 -2.884  1.00 18.27 ? 423  TYR A CE2 1 
ATOM   2948 C  CZ  . TYR A  1  388 ? 37.013  42.223 -4.253  1.00 18.23 ? 423  TYR A CZ  1 
ATOM   2949 O  OH  . TYR A  1  388 ? 37.298  40.993 -4.807  1.00 19.29 ? 423  TYR A OH  1 
ATOM   2950 N  N   . MET A  1  389 ? 36.621  49.263 -3.083  1.00 19.80 ? 424  MET A N   1 
ATOM   2951 C  CA  . MET A  1  389 ? 35.593  50.280 -3.122  1.00 17.63 ? 424  MET A CA  1 
ATOM   2952 C  C   . MET A  1  389 ? 34.288  49.549 -3.465  1.00 18.10 ? 424  MET A C   1 
ATOM   2953 O  O   . MET A  1  389 ? 34.288  48.591 -4.234  1.00 17.56 ? 424  MET A O   1 
ATOM   2954 C  CB  . MET A  1  389 ? 35.916  51.334 -4.171  1.00 25.78 ? 424  MET A CB  1 
ATOM   2955 C  CG  . MET A  1  389 ? 37.138  52.158 -3.784  1.00 30.40 ? 424  MET A CG  1 
ATOM   2956 S  SD  . MET A  1  389 ? 36.867  53.160 -2.302  1.00 40.57 ? 424  MET A SD  1 
ATOM   2957 C  CE  . MET A  1  389 ? 35.611  54.280 -2.919  1.00 38.71 ? 424  MET A CE  1 
ATOM   2958 N  N   . LYS A  1  390 ? 33.181  49.961 -2.866  1.00 17.58 ? 425  LYS A N   1 
ATOM   2959 C  CA  . LYS A  1  390 ? 31.983  49.123 -2.955  1.00 16.66 ? 425  LYS A CA  1 
ATOM   2960 C  C   . LYS A  1  390 ? 31.516  48.875 -4.389  1.00 18.69 ? 425  LYS A C   1 
ATOM   2961 O  O   . LYS A  1  390 ? 30.938  47.817 -4.684  1.00 17.54 ? 425  LYS A O   1 
ATOM   2962 C  CB  . LYS A  1  390 ? 30.848  49.644 -2.064  1.00 15.69 ? 425  LYS A CB  1 
ATOM   2963 C  CG  . LYS A  1  390 ? 30.307  51.061 -2.418  1.00 14.80 ? 425  LYS A CG  1 
ATOM   2964 C  CD  . LYS A  1  390 ? 29.249  51.503 -1.398  1.00 17.84 ? 425  LYS A CD  1 
ATOM   2965 C  CE  . LYS A  1  390 ? 28.748  52.897 -1.785  1.00 16.70 ? 425  LYS A CE  1 
ATOM   2966 N  NZ  . LYS A  1  390 ? 27.484  53.250 -1.107  1.00 17.66 ? 425  LYS A NZ  1 
ATOM   2967 N  N   . GLN A  1  391 ? 31.748  49.831 -5.288  1.00 17.18 ? 426  GLN A N   1 
ATOM   2968 C  CA  . GLN A  1  391 ? 31.347  49.624 -6.686  1.00 17.70 ? 426  GLN A CA  1 
ATOM   2969 C  C   . GLN A  1  391 ? 32.116  48.498 -7.352  1.00 19.76 ? 426  GLN A C   1 
ATOM   2970 O  O   . GLN A  1  391 ? 31.721  47.984 -8.403  1.00 19.70 ? 426  GLN A O   1 
ATOM   2971 C  CB  . GLN A  1  391 ? 31.527  50.917 -7.490  1.00 23.58 ? 426  GLN A CB  1 
ATOM   2972 C  CG  . GLN A  1  391 ? 32.974  51.297 -7.735  1.00 24.21 ? 426  GLN A CG  1 
ATOM   2973 C  CD  . GLN A  1  391 ? 33.510  52.294 -6.725  1.00 32.19 ? 426  GLN A CD  1 
ATOM   2974 O  OE1 . GLN A  1  391 ? 33.125  52.294 -5.539  1.00 29.53 ? 426  GLN A OE1 1 
ATOM   2975 N  NE2 . GLN A  1  391 ? 34.393  53.175 -7.196  1.00 39.00 ? 426  GLN A NE2 1 
ATOM   2976 N  N   . HIS A  1  392 ? 33.238  48.113 -6.750  1.00 19.62 ? 427  HIS A N   1 
ATOM   2977 C  CA  . HIS A  1  392 ? 34.040  47.048 -7.308  1.00 17.75 ? 427  HIS A CA  1 
ATOM   2978 C  C   . HIS A  1  392 ? 33.741  45.679 -6.729  1.00 16.69 ? 427  HIS A C   1 
ATOM   2979 O  O   . HIS A  1  392 ? 34.294  44.684 -7.215  1.00 16.74 ? 427  HIS A O   1 
ATOM   2980 C  CB  . HIS A  1  392 ? 35.517  47.348 -7.129  1.00 17.53 ? 427  HIS A CB  1 
ATOM   2981 C  CG  . HIS A  1  392 ? 35.996  48.495 -7.964  1.00 20.07 ? 427  HIS A CG  1 
ATOM   2982 N  ND1 . HIS A  1  392 ? 37.091  49.258 -7.625  1.00 25.02 ? 427  HIS A ND1 1 
ATOM   2983 C  CD2 . HIS A  1  392 ? 35.519  49.010 -9.122  1.00 27.30 ? 427  HIS A CD2 1 
ATOM   2984 C  CE1 . HIS A  1  392 ? 37.274  50.193 -8.544  1.00 25.05 ? 427  HIS A CE1 1 
ATOM   2985 N  NE2 . HIS A  1  392 ? 36.337  50.061 -9.465  1.00 31.44 ? 427  HIS A NE2 1 
ATOM   2986 N  N   . LEU A  1  393 ? 32.895  45.609 -5.698  1.00 16.74 ? 428  LEU A N   1 
ATOM   2987 C  CA  . LEU A  1  393 ? 32.521  44.289 -5.161  1.00 16.76 ? 428  LEU A CA  1 
ATOM   2988 C  C   . LEU A  1  393 ? 31.825  43.484 -6.241  1.00 17.30 ? 428  LEU A C   1 
ATOM   2989 O  O   . LEU A  1  393 ? 31.147  44.050 -7.077  1.00 16.01 ? 428  LEU A O   1 
ATOM   2990 C  CB  . LEU A  1  393 ? 31.581  44.403 -3.951  1.00 15.18 ? 428  LEU A CB  1 
ATOM   2991 C  CG  . LEU A  1  393 ? 32.202  44.998 -2.690  1.00 16.53 ? 428  LEU A CG  1 
ATOM   2992 C  CD1 . LEU A  1  393 ? 31.115  45.423 -1.734  1.00 14.57 ? 428  LEU A CD1 1 
ATOM   2993 C  CD2 . LEU A  1  393 ? 33.170  43.964 -2.033  1.00 15.35 ? 428  LEU A CD2 1 
ATOM   2994 N  N   . PRO A  1  394 ? 31.981  42.152 -6.218  1.00 15.98 ? 429  PRO A N   1 
ATOM   2995 C  CA  . PRO A  1  394 ? 31.221  41.307 -7.153  1.00 17.91 ? 429  PRO A CA  1 
ATOM   2996 C  C   . PRO A  1  394 ? 29.762  41.728 -7.196  1.00 15.20 ? 429  PRO A C   1 
ATOM   2997 O  O   . PRO A  1  394 ? 29.114  41.902 -6.142  1.00 16.49 ? 429  PRO A O   1 
ATOM   2998 C  CB  . PRO A  1  394 ? 31.331  39.915 -6.518  1.00 16.30 ? 429  PRO A CB  1 
ATOM   2999 C  CG  . PRO A  1  394 ? 32.688  39.957 -5.824  1.00 16.83 ? 429  PRO A CG  1 
ATOM   3000 C  CD  . PRO A  1  394 ? 32.806  41.357 -5.289  1.00 16.79 ? 429  PRO A CD  1 
ATOM   3001 N  N   . LYS A  1  395 ? 29.244  41.832 -8.410  1.00 16.93 ? 430  LYS A N   1 
ATOM   3002 C  CA  . LYS A  1  395 ? 27.879  42.272 -8.620  1.00 17.45 ? 430  LYS A CA  1 
ATOM   3003 C  C   . LYS A  1  395 ? 26.868  41.308 -8.009  1.00 16.63 ? 430  LYS A C   1 
ATOM   3004 O  O   . LYS A  1  395 ? 25.794  41.732 -7.558  1.00 17.34 ? 430  LYS A O   1 
ATOM   3005 C  CB  . LYS A  1  395 ? 27.645  42.488 -10.124 1.00 16.88 ? 430  LYS A CB  1 
ATOM   3006 C  CG  . LYS A  1  395 ? 28.586  43.508 -10.722 1.00 15.76 ? 430  LYS A CG  1 
ATOM   3007 C  CD  . LYS A  1  395 ? 28.393  44.908 -10.093 1.00 17.09 ? 430  LYS A CD  1 
ATOM   3008 C  CE  . LYS A  1  395 ? 27.263  45.697 -10.812 1.00 20.90 ? 430  LYS A CE  1 
ATOM   3009 N  NZ  . LYS A  1  395 ? 27.176  47.098 -10.266 1.00 20.54 ? 430  LYS A NZ  1 
ATOM   3010 N  N   . ARG A  1  396 ? 27.212  40.015 -7.948  1.00 15.45 ? 431  ARG A N   1 
ATOM   3011 C  CA  . ARG A  1  396 ? 26.323  39.045 -7.320  1.00 15.97 ? 431  ARG A CA  1 
ATOM   3012 C  C   . ARG A  1  396 ? 25.970  39.395 -5.856  1.00 17.87 ? 431  ARG A C   1 
ATOM   3013 O  O   . ARG A  1  396 ? 24.962  38.935 -5.327  1.00 15.43 ? 431  ARG A O   1 
ATOM   3014 C  CB  . ARG A  1  396 ? 26.934  37.643 -7.367  1.00 14.49 ? 431  ARG A CB  1 
ATOM   3015 C  CG  . ARG A  1  396 ? 28.303  37.558 -6.663  1.00 14.37 ? 431  ARG A CG  1 
ATOM   3016 C  CD  . ARG A  1  396 ? 28.950  36.178 -6.814  1.00 16.26 ? 431  ARG A CD  1 
ATOM   3017 N  NE  . ARG A  1  396 ? 30.327  36.219 -6.289  1.00 14.82 ? 431  ARG A NE  1 
ATOM   3018 C  CZ  . ARG A  1  396 ? 30.606  36.116 -4.987  1.00 15.22 ? 431  ARG A CZ  1 
ATOM   3019 N  NH1 . ARG A  1  396 ? 29.621  35.885 -4.107  1.00 13.60 ? 431  ARG A NH1 1 
ATOM   3020 N  NH2 . ARG A  1  396 ? 31.860  36.195 -4.560  1.00 15.93 ? 431  ARG A NH2 1 
ATOM   3021 N  N   . LEU A  1  397 ? 26.831  40.152 -5.177  1.00 17.22 ? 432  LEU A N   1 
ATOM   3022 C  CA  . LEU A  1  397 ? 26.557  40.512 -3.787  1.00 16.39 ? 432  LEU A CA  1 
ATOM   3023 C  C   . LEU A  1  397 ? 25.505  41.594 -3.664  1.00 16.93 ? 432  LEU A C   1 
ATOM   3024 O  O   . LEU A  1  397 ? 24.890  41.750 -2.619  1.00 16.00 ? 432  LEU A O   1 
ATOM   3025 C  CB  . LEU A  1  397 ? 27.838  40.977 -3.077  1.00 14.31 ? 432  LEU A CB  1 
ATOM   3026 C  CG  . LEU A  1  397 ? 28.970  39.957 -3.003  1.00 14.24 ? 432  LEU A CG  1 
ATOM   3027 C  CD1 . LEU A  1  397 ? 30.219  40.611 -2.356  1.00 16.78 ? 432  LEU A CD1 1 
ATOM   3028 C  CD2 . LEU A  1  397 ? 28.563  38.730 -2.203  1.00 17.21 ? 432  LEU A CD2 1 
ATOM   3029 N  N   . HIS A  1  398 ? 25.301  42.347 -4.741  1.00 16.54 ? 433  HIS A N   1 
ATOM   3030 C  CA  . HIS A  1  398 ? 24.314  43.439 -4.754  1.00 15.54 ? 433  HIS A CA  1 
ATOM   3031 C  C   . HIS A  1  398 ? 24.461  44.329 -3.533  1.00 15.24 ? 433  HIS A C   1 
ATOM   3032 O  O   . HIS A  1  398 ? 23.469  44.678 -2.895  1.00 15.87 ? 433  HIS A O   1 
ATOM   3033 C  CB  . HIS A  1  398 ? 22.866  42.891 -4.880  1.00 15.89 ? 433  HIS A CB  1 
ATOM   3034 C  CG  . HIS A  1  398 ? 22.620  42.195 -6.185  1.00 16.51 ? 433  HIS A CG  1 
ATOM   3035 N  ND1 . HIS A  1  398 ? 22.411  42.884 -7.367  1.00 16.27 ? 433  HIS A ND1 1 
ATOM   3036 C  CD2 . HIS A  1  398 ? 22.598  40.880 -6.503  1.00 17.09 ? 433  HIS A CD2 1 
ATOM   3037 C  CE1 . HIS A  1  398 ? 22.259  42.013 -8.352  1.00 21.26 ? 433  HIS A CE1 1 
ATOM   3038 N  NE2 . HIS A  1  398 ? 22.368  40.793 -7.855  1.00 17.37 ? 433  HIS A NE2 1 
ATOM   3039 N  N   . TYR A  1  399 ? 25.702  44.715 -3.207  1.00 15.64 ? 434  TYR A N   1 
ATOM   3040 C  CA  . TYR A  1  399 ? 25.918  45.393 -1.951  1.00 15.67 ? 434  TYR A CA  1 
ATOM   3041 C  C   . TYR A  1  399 ? 26.598  46.760 -2.125  1.00 16.31 ? 434  TYR A C   1 
ATOM   3042 O  O   . TYR A  1  399 ? 27.765  46.919 -1.780  1.00 17.47 ? 434  TYR A O   1 
ATOM   3043 C  CB  . TYR A  1  399 ? 26.820  44.522 -1.053  1.00 14.76 ? 434  TYR A CB  1 
ATOM   3044 C  CG  . TYR A  1  399 ? 26.786  44.936 0.380   1.00 15.50 ? 434  TYR A CG  1 
ATOM   3045 C  CD1 . TYR A  1  399 ? 25.621  44.827 1.154   1.00 12.92 ? 434  TYR A CD1 1 
ATOM   3046 C  CD2 . TYR A  1  399 ? 27.932  45.418 0.984   1.00 14.53 ? 434  TYR A CD2 1 
ATOM   3047 C  CE1 . TYR A  1  399 ? 25.600  45.242 2.468   1.00 14.29 ? 434  TYR A CE1 1 
ATOM   3048 C  CE2 . TYR A  1  399 ? 27.925  45.799 2.315   1.00 14.82 ? 434  TYR A CE2 1 
ATOM   3049 C  CZ  . TYR A  1  399 ? 26.781  45.676 3.057   1.00 14.31 ? 434  TYR A CZ  1 
ATOM   3050 O  OH  . TYR A  1  399 ? 26.814  46.066 4.370   1.00 15.01 ? 434  TYR A OH  1 
ATOM   3051 N  N   . ALA A  1  400 ? 25.894  47.739 -2.670  1.00 18.69 ? 435  ALA A N   1 
ATOM   3052 C  CA  . ALA A  1  400 ? 26.559  49.015 -2.932  1.00 15.73 ? 435  ALA A CA  1 
ATOM   3053 C  C   . ALA A  1  400 ? 25.597  50.186 -2.952  1.00 17.37 ? 435  ALA A C   1 
ATOM   3054 O  O   . ALA A  1  400 ? 25.956  51.281 -2.516  1.00 19.81 ? 435  ALA A O   1 
ATOM   3055 C  CB  . ALA A  1  400 ? 27.343  48.953 -4.233  1.00 18.24 ? 435  ALA A CB  1 
ATOM   3056 N  N   . ASN A  1  401 ? 24.381  49.952 -3.454  1.00 16.00 ? 436  ASN A N   1 
ATOM   3057 C  CA  . ASN A  1  401 ? 23.432  51.057 -3.660  1.00 19.44 ? 436  ASN A CA  1 
ATOM   3058 C  C   . ASN A  1  401 ? 22.656  51.507 -2.417  1.00 17.10 ? 436  ASN A C   1 
ATOM   3059 O  O   . ASN A  1  401 ? 21.414  51.464 -2.357  1.00 14.87 ? 436  ASN A O   1 
ATOM   3060 C  CB  . ASN A  1  401 ? 22.468  50.735 -4.794  1.00 18.55 ? 436  ASN A CB  1 
ATOM   3061 C  CG  . ASN A  1  401 ? 21.627  51.936 -5.190  1.00 23.19 ? 436  ASN A CG  1 
ATOM   3062 O  OD1 . ASN A  1  401 ? 22.068  53.072 -5.032  1.00 22.70 ? 436  ASN A OD1 1 
ATOM   3063 N  ND2 . ASN A  1  401 ? 20.406  51.696 -5.694  1.00 20.84 ? 436  ASN A ND2 1 
ATOM   3064 N  N   . ASN A  1  402 ? 23.384  51.988 -1.414  1.00 18.82 ? 437  ASN A N   1 
ATOM   3065 C  CA  . ASN A  1  402 ? 22.746  52.482 -0.216  1.00 16.32 ? 437  ASN A CA  1 
ATOM   3066 C  C   . ASN A  1  402 ? 23.731  53.385 0.503   1.00 17.33 ? 437  ASN A C   1 
ATOM   3067 O  O   . ASN A  1  402 ? 24.920  53.066 0.579   1.00 16.77 ? 437  ASN A O   1 
ATOM   3068 C  CB  . ASN A  1  402 ? 22.330  51.334 0.692   1.00 16.48 ? 437  ASN A CB  1 
ATOM   3069 C  CG  . ASN A  1  402 ? 21.345  51.769 1.807   1.00 20.44 ? 437  ASN A CG  1 
ATOM   3070 O  OD1 . ASN A  1  402 ? 21.713  52.490 2.758   1.00 17.26 ? 437  ASN A OD1 1 
ATOM   3071 N  ND2 . ASN A  1  402 ? 20.108  51.308 1.702   1.00 15.18 ? 437  ASN A ND2 1 
ATOM   3072 N  N   . ARG A  1  403 ? 23.244  54.505 1.024   1.00 19.45 ? 438  ARG A N   1 
ATOM   3073 C  CA  . ARG A  1  403 ? 24.122  55.488 1.674   1.00 18.65 ? 438  ARG A CA  1 
ATOM   3074 C  C   . ARG A  1  403 ? 24.700  54.964 3.007   1.00 20.02 ? 438  ARG A C   1 
ATOM   3075 O  O   . ARG A  1  403 ? 25.688  55.508 3.536   1.00 19.68 ? 438  ARG A O   1 
ATOM   3076 C  CB  . ARG A  1  403 ? 23.356  56.803 1.915   1.00 19.60 ? 438  ARG A CB  1 
ATOM   3077 C  CG  . ARG A  1  403 ? 22.290  56.696 2.943   1.00 20.60 ? 438  ARG A CG  1 
ATOM   3078 C  CD  . ARG A  1  403 ? 21.266  57.840 2.781   1.00 23.90 ? 438  ARG A CD  1 
ATOM   3079 N  NE  . ARG A  1  403 ? 20.419  57.938 3.962   1.00 22.18 ? 438  ARG A NE  1 
ATOM   3080 C  CZ  . ARG A  1  403 ? 19.228  58.516 3.980   1.00 30.75 ? 438  ARG A CZ  1 
ATOM   3081 N  NH1 . ARG A  1  403 ? 18.735  59.054 2.870   1.00 28.17 ? 438  ARG A NH1 1 
ATOM   3082 N  NH2 . ARG A  1  403 ? 18.529  58.542 5.104   1.00 28.47 ? 438  ARG A NH2 1 
ATOM   3083 N  N   . ARG A  1  404 ? 24.118  53.882 3.528   1.00 16.10 ? 439  ARG A N   1 
ATOM   3084 C  CA  . ARG A  1  404 ? 24.570  53.284 4.776   1.00 18.05 ? 439  ARG A CA  1 
ATOM   3085 C  C   . ARG A  1  404 ? 25.710  52.302 4.542   1.00 19.20 ? 439  ARG A C   1 
ATOM   3086 O  O   . ARG A  1  404 ? 26.239  51.793 5.500   1.00 15.84 ? 439  ARG A O   1 
ATOM   3087 C  CB  . ARG A  1  404 ? 23.444  52.532 5.488   1.00 17.82 ? 439  ARG A CB  1 
ATOM   3088 C  CG  . ARG A  1  404 ? 22.317  53.433 5.942   1.00 19.81 ? 439  ARG A CG  1 
ATOM   3089 C  CD  . ARG A  1  404 ? 21.041  52.676 6.303   1.00 16.78 ? 439  ARG A CD  1 
ATOM   3090 N  NE  . ARG A  1  404 ? 19.908  53.617 6.430   1.00 20.58 ? 439  ARG A NE  1 
ATOM   3091 C  CZ  . ARG A  1  404 ? 18.643  53.249 6.579   1.00 21.66 ? 439  ARG A CZ  1 
ATOM   3092 N  NH1 . ARG A  1  404 ? 18.327  51.957 6.604   1.00 16.88 ? 439  ARG A NH1 1 
ATOM   3093 N  NH2 . ARG A  1  404 ? 17.680  54.174 6.689   1.00 21.45 ? 439  ARG A NH2 1 
ATOM   3094 N  N   . ILE A  1  405 ? 26.011  51.988 3.280   1.00 16.66 ? 440  ILE A N   1 
ATOM   3095 C  CA  . ILE A  1  405 ? 27.169  51.139 2.965   1.00 17.25 ? 440  ILE A CA  1 
ATOM   3096 C  C   . ILE A  1  405 ? 28.380  52.025 2.700   1.00 15.32 ? 440  ILE A C   1 
ATOM   3097 O  O   . ILE A  1  405 ? 28.411  52.808 1.732   1.00 17.59 ? 440  ILE A O   1 
ATOM   3098 C  CB  . ILE A  1  405 ? 26.886  50.218 1.767   1.00 17.25 ? 440  ILE A CB  1 
ATOM   3099 C  CG1 . ILE A  1  405 ? 25.608  49.402 2.056   1.00 14.90 ? 440  ILE A CG1 1 
ATOM   3100 C  CG2 . ILE A  1  405 ? 28.131  49.322 1.464   1.00 18.06 ? 440  ILE A CG2 1 
ATOM   3101 C  CD1 . ILE A  1  405 ? 25.121  48.599 0.853   1.00 19.19 ? 440  ILE A CD1 1 
ATOM   3102 N  N   . GLU A  1  406 ? 29.361  51.938 3.596   1.00 16.15 ? 441  GLU A N   1 
ATOM   3103 C  CA  . GLU A  1  406 ? 30.585  52.724 3.429   1.00 17.54 ? 441  GLU A CA  1 
ATOM   3104 C  C   . GLU A  1  406 ? 31.245  52.475 2.055   1.00 18.72 ? 441  GLU A C   1 
ATOM   3105 O  O   . GLU A  1  406 ? 31.223  51.348 1.508   1.00 16.18 ? 441  GLU A O   1 
ATOM   3106 C  CB  . GLU A  1  406 ? 31.549  52.429 4.587   1.00 17.56 ? 441  GLU A CB  1 
ATOM   3107 C  CG  . GLU A  1  406 ? 31.153  52.986 5.993   1.00 17.29 ? 441  GLU A CG  1 
ATOM   3108 C  CD  . GLU A  1  406 ? 30.027  52.200 6.679   1.00 17.96 ? 441  GLU A CD  1 
ATOM   3109 O  OE1 . GLU A  1  406 ? 29.617  51.132 6.166   1.00 17.79 ? 441  GLU A OE1 1 
ATOM   3110 O  OE2 . GLU A  1  406 ? 29.564  52.633 7.738   1.00 19.94 ? 441  GLU A OE2 1 
ATOM   3111 N  N   . ASP A  1  407 ? 31.850  53.520 1.481   1.00 18.43 ? 442  ASP A N   1 
ATOM   3112 C  CA  . ASP A  1  407 ? 32.566  53.368 0.224   1.00 17.77 ? 442  ASP A CA  1 
ATOM   3113 C  C   . ASP A  1  407 ? 33.623  52.286 0.308   1.00 16.83 ? 442  ASP A C   1 
ATOM   3114 O  O   . ASP A  1  407 ? 33.829  51.556 -0.642  1.00 17.69 ? 442  ASP A O   1 
ATOM   3115 C  CB  . ASP A  1  407 ? 33.290  54.661 -0.155  1.00 24.73 ? 442  ASP A CB  1 
ATOM   3116 C  CG  . ASP A  1  407 ? 32.345  55.750 -0.623  1.00 30.60 ? 442  ASP A CG  1 
ATOM   3117 O  OD1 . ASP A  1  407 ? 31.157  55.462 -0.846  1.00 23.29 ? 442  ASP A OD1 1 
ATOM   3118 O  OD2 . ASP A  1  407 ? 32.799  56.900 -0.775  1.00 31.70 ? 442  ASP A OD2 1 
ATOM   3119 N  N   . LEU A  1  408 ? 34.358  52.257 1.421   1.00 19.72 ? 443  LEU A N   1 
ATOM   3120 C  CA  . LEU A  1  408 ? 35.471  51.312 1.596   1.00 17.69 ? 443  LEU A CA  1 
ATOM   3121 C  C   . LEU A  1  408 ? 34.999  50.051 2.310   1.00 16.23 ? 443  LEU A C   1 
ATOM   3122 O  O   . LEU A  1  408 ? 34.468  50.121 3.410   1.00 18.67 ? 443  LEU A O   1 
ATOM   3123 C  CB  . LEU A  1  408 ? 36.613  51.970 2.391   1.00 14.53 ? 443  LEU A CB  1 
ATOM   3124 C  CG  . LEU A  1  408 ? 37.869  51.116 2.612   1.00 23.62 ? 443  LEU A CG  1 
ATOM   3125 C  CD1 . LEU A  1  408 ? 38.293  50.354 1.366   1.00 23.03 ? 443  LEU A CD1 1 
ATOM   3126 C  CD2 . LEU A  1  408 ? 39.021  52.032 3.068   1.00 24.57 ? 443  LEU A CD2 1 
ATOM   3127 N  N   . HIS A  1  409 ? 35.188  48.903 1.659   1.00 15.49 ? 444  HIS A N   1 
ATOM   3128 C  CA  . HIS A  1  409 ? 34.746  47.626 2.207   1.00 14.64 ? 444  HIS A CA  1 
ATOM   3129 C  C   . HIS A  1  409 ? 35.922  46.658 2.273   1.00 16.77 ? 444  HIS A C   1 
ATOM   3130 O  O   . HIS A  1  409 ? 36.804  46.705 1.411   1.00 16.77 ? 444  HIS A O   1 
ATOM   3131 C  CB  . HIS A  1  409 ? 33.680  47.007 1.290   1.00 15.67 ? 444  HIS A CB  1 
ATOM   3132 C  CG  . HIS A  1  409 ? 32.877  45.949 1.972   1.00 13.52 ? 444  HIS A CG  1 
ATOM   3133 N  ND1 . HIS A  1  409 ? 31.852  46.259 2.831   1.00 15.60 ? 444  HIS A ND1 1 
ATOM   3134 C  CD2 . HIS A  1  409 ? 32.960  44.598 1.945   1.00 16.50 ? 444  HIS A CD2 1 
ATOM   3135 C  CE1 . HIS A  1  409 ? 31.343  45.142 3.325   1.00 15.54 ? 444  HIS A CE1 1 
ATOM   3136 N  NE2 . HIS A  1  409 ? 31.994  44.119 2.799   1.00 13.08 ? 444  HIS A NE2 1 
ATOM   3137 N  N   . LEU A  1  410 ? 35.923  45.752 3.256   1.00 15.99 ? 445  LEU A N   1 
ATOM   3138 C  CA  . LEU A  1  410 ? 36.895  44.677 3.226   1.00 14.74 ? 445  LEU A CA  1 
ATOM   3139 C  C   . LEU A  1  410 ? 36.145  43.366 3.137   1.00 13.70 ? 445  LEU A C   1 
ATOM   3140 O  O   . LEU A  1  410 ? 35.339  43.070 3.997   1.00 14.87 ? 445  LEU A O   1 
ATOM   3141 C  CB  . LEU A  1  410 ? 37.744  44.664 4.513   1.00 15.96 ? 445  LEU A CB  1 
ATOM   3142 C  CG  . LEU A  1  410 ? 38.278  46.020 4.969   1.00 15.16 ? 445  LEU A CG  1 
ATOM   3143 C  CD1 . LEU A  1  410 ? 38.953  45.869 6.363   1.00 19.32 ? 445  LEU A CD1 1 
ATOM   3144 C  CD2 . LEU A  1  410 ? 39.229  46.590 3.953   1.00 16.64 ? 445  LEU A CD2 1 
ATOM   3145 N  N   . LEU A  1  411 ? 36.419  42.605 2.086   1.00 15.02 ? 446  LEU A N   1 
ATOM   3146 C  CA  . LEU A  1  411 ? 35.919  41.236 1.985   1.00 17.43 ? 446  LEU A CA  1 
ATOM   3147 C  C   . LEU A  1  411 ? 36.898  40.336 2.728   1.00 17.98 ? 446  LEU A C   1 
ATOM   3148 O  O   . LEU A  1  411 ? 38.099  40.259 2.389   1.00 18.39 ? 446  LEU A O   1 
ATOM   3149 C  CB  . LEU A  1  411 ? 35.806  40.820 0.528   1.00 17.46 ? 446  LEU A CB  1 
ATOM   3150 C  CG  . LEU A  1  411 ? 34.495  40.780 -0.260  1.00 28.56 ? 446  LEU A CG  1 
ATOM   3151 C  CD1 . LEU A  1  411 ? 34.636  39.825 -1.472  1.00 23.86 ? 446  LEU A CD1 1 
ATOM   3152 C  CD2 . LEU A  1  411 ? 33.289  40.395 0.584   1.00 17.98 ? 446  LEU A CD2 1 
ATOM   3153 N  N   . VAL A  1  412 ? 36.419  39.650 3.761   1.00 15.19 ? 447  VAL A N   1 
ATOM   3154 C  CA  . VAL A  1  412 ? 37.351  38.918 4.630   1.00 16.34 ? 447  VAL A CA  1 
ATOM   3155 C  C   . VAL A  1  412 ? 37.382  37.428 4.262   1.00 19.62 ? 447  VAL A C   1 
ATOM   3156 O  O   . VAL A  1  412 ? 36.344  36.853 3.900   1.00 16.71 ? 447  VAL A O   1 
ATOM   3157 C  CB  . VAL A  1  412 ? 36.943  39.074 6.126   1.00 15.79 ? 447  VAL A CB  1 
ATOM   3158 C  CG1 . VAL A  1  412 ? 37.902  38.294 7.036   1.00 15.83 ? 447  VAL A CG1 1 
ATOM   3159 C  CG2 . VAL A  1  412 ? 36.911  40.564 6.543   1.00 16.38 ? 447  VAL A CG2 1 
ATOM   3160 N  N   . GLU A  1  413 ? 38.559  36.800 4.338   1.00 17.08 ? 448  GLU A N   1 
ATOM   3161 C  CA  . GLU A  1  413 ? 38.670  35.392 3.994   1.00 16.83 ? 448  GLU A CA  1 
ATOM   3162 C  C   . GLU A  1  413 ? 37.927  34.545 5.045   1.00 16.85 ? 448  GLU A C   1 
ATOM   3163 O  O   . GLU A  1  413 ? 37.963  34.851 6.231   1.00 15.65 ? 448  GLU A O   1 
ATOM   3164 C  CB  . GLU A  1  413 ? 40.162  34.986 3.939   1.00 18.55 ? 448  GLU A CB  1 
ATOM   3165 C  CG  . GLU A  1  413 ? 40.397  33.533 3.566   1.00 22.06 ? 448  GLU A CG  1 
ATOM   3166 C  CD  . GLU A  1  413 ? 41.861  33.194 3.612   1.00 28.72 ? 448  GLU A CD  1 
ATOM   3167 O  OE1 . GLU A  1  413 ? 42.645  34.135 3.450   1.00 23.73 ? 448  GLU A OE1 1 
ATOM   3168 O  OE2 . GLU A  1  413 ? 42.220  32.022 3.830   1.00 28.20 ? 448  GLU A OE2 1 
ATOM   3169 N  N   . ARG A  1  414 ? 37.232  33.494 4.611   1.00 17.82 ? 449  ARG A N   1 
ATOM   3170 C  CA  . ARG A  1  414 ? 36.560  32.626 5.582   1.00 17.90 ? 449  ARG A CA  1 
ATOM   3171 C  C   . ARG A  1  414 ? 37.559  32.123 6.633   1.00 17.11 ? 449  ARG A C   1 
ATOM   3172 O  O   . ARG A  1  414 ? 38.750  31.882 6.319   1.00 17.09 ? 449  ARG A O   1 
ATOM   3173 C  CB  . ARG A  1  414 ? 35.910  31.430 4.854   1.00 18.72 ? 449  ARG A CB  1 
ATOM   3174 C  CG  . ARG A  1  414 ? 36.951  30.468 4.225   1.00 21.58 ? 449  ARG A CG  1 
ATOM   3175 C  CD  . ARG A  1  414 ? 36.334  29.439 3.256   1.00 29.14 ? 449  ARG A CD  1 
ATOM   3176 N  NE  . ARG A  1  414 ? 36.060  30.026 1.936   1.00 33.74 ? 449  ARG A NE  1 
ATOM   3177 C  CZ  . ARG A  1  414 ? 35.368  29.430 0.961   1.00 33.59 ? 449  ARG A CZ  1 
ATOM   3178 N  NH1 . ARG A  1  414 ? 34.841  28.216 1.133   1.00 33.81 ? 449  ARG A NH1 1 
ATOM   3179 N  NH2 . ARG A  1  414 ? 35.176  30.058 -0.189  1.00 34.33 ? 449  ARG A NH2 1 
ATOM   3180 N  N   . ARG A  1  415 ? 37.053  31.957 7.863   1.00 15.75 ? 450  ARG A N   1 
ATOM   3181 C  CA  . ARG A  1  415 ? 37.830  31.535 9.039   1.00 18.22 ? 450  ARG A CA  1 
ATOM   3182 C  C   . ARG A  1  415 ? 38.630  32.649 9.679   1.00 16.84 ? 450  ARG A C   1 
ATOM   3183 O  O   . ARG A  1  415 ? 39.240  32.427 10.737  1.00 18.62 ? 450  ARG A O   1 
ATOM   3184 C  CB  . ARG A  1  415 ? 38.720  30.290 8.756   1.00 19.50 ? 450  ARG A CB  1 
ATOM   3185 C  CG  . ARG A  1  415 ? 37.991  29.145 8.068   1.00 22.73 ? 450  ARG A CG  1 
ATOM   3186 C  CD  . ARG A  1  415 ? 38.922  27.947 7.768   1.00 23.96 ? 450  ARG A CD  1 
ATOM   3187 N  NE  . ARG A  1  415 ? 39.247  27.212 8.992   1.00 29.21 ? 450  ARG A NE  1 
ATOM   3188 C  CZ  . ARG A  1  415 ? 40.431  27.237 9.604   1.00 32.70 ? 450  ARG A CZ  1 
ATOM   3189 N  NH1 . ARG A  1  415 ? 41.435  27.955 9.109   1.00 35.94 ? 450  ARG A NH1 1 
ATOM   3190 N  NH2 . ARG A  1  415 ? 40.616  26.534 10.709  1.00 32.13 ? 450  ARG A NH2 1 
ATOM   3191 N  N   . TRP A  1  416 ? 38.572  33.867 9.111   1.00 14.15 ? 451  TRP A N   1 
ATOM   3192 C  CA  . TRP A  1  416 ? 39.305  34.999 9.665   1.00 17.47 ? 451  TRP A CA  1 
ATOM   3193 C  C   . TRP A  1  416 ? 38.451  36.153 10.171  1.00 17.97 ? 451  TRP A C   1 
ATOM   3194 O  O   . TRP A  1  416 ? 37.278  36.290 9.810   1.00 15.95 ? 451  TRP A O   1 
ATOM   3195 C  CB  . TRP A  1  416 ? 40.367  35.520 8.646   1.00 16.86 ? 451  TRP A CB  1 
ATOM   3196 C  CG  . TRP A  1  416 ? 41.553  34.606 8.594   1.00 16.05 ? 451  TRP A CG  1 
ATOM   3197 C  CD1 . TRP A  1  416 ? 41.637  33.391 7.980   1.00 18.94 ? 451  TRP A CD1 1 
ATOM   3198 C  CD2 . TRP A  1  416 ? 42.822  34.839 9.210   1.00 17.87 ? 451  TRP A CD2 1 
ATOM   3199 N  NE1 . TRP A  1  416 ? 42.892  32.842 8.187   1.00 19.32 ? 451  TRP A NE1 1 
ATOM   3200 C  CE2 . TRP A  1  416 ? 43.623  33.705 8.966   1.00 20.07 ? 451  TRP A CE2 1 
ATOM   3201 C  CE3 . TRP A  1  416 ? 43.337  35.873 9.992   1.00 18.16 ? 451  TRP A CE3 1 
ATOM   3202 C  CZ2 . TRP A  1  416 ? 44.932  33.600 9.445   1.00 21.79 ? 451  TRP A CZ2 1 
ATOM   3203 C  CZ3 . TRP A  1  416 ? 44.638  35.774 10.467  1.00 19.93 ? 451  TRP A CZ3 1 
ATOM   3204 C  CH2 . TRP A  1  416 ? 45.418  34.649 10.188  1.00 22.44 ? 451  TRP A CH2 1 
ATOM   3205 N  N   . HIS A  1  417 ? 39.058  36.974 11.024  1.00 16.53 ? 452  HIS A N   1 
ATOM   3206 C  CA  . HIS A  1  417 ? 38.506  38.244 11.426  1.00 16.33 ? 452  HIS A CA  1 
ATOM   3207 C  C   . HIS A  1  417 ? 39.451  39.373 11.004  1.00 20.90 ? 452  HIS A C   1 
ATOM   3208 O  O   . HIS A  1  417 ? 40.666  39.157 10.854  1.00 19.51 ? 452  HIS A O   1 
ATOM   3209 C  CB  . HIS A  1  417 ? 38.420  38.322 12.937  1.00 18.73 ? 452  HIS A CB  1 
ATOM   3210 C  CG  . HIS A  1  417 ? 37.144  37.799 13.510  1.00 20.32 ? 452  HIS A CG  1 
ATOM   3211 N  ND1 . HIS A  1  417 ? 37.017  37.482 14.842  1.00 23.34 ? 452  HIS A ND1 1 
ATOM   3212 C  CD2 . HIS A  1  417 ? 35.927  37.575 12.950  1.00 20.53 ? 452  HIS A CD2 1 
ATOM   3213 C  CE1 . HIS A  1  417 ? 35.778  37.074 15.082  1.00 26.95 ? 452  HIS A CE1 1 
ATOM   3214 N  NE2 . HIS A  1  417 ? 35.092  37.140 13.954  1.00 19.31 ? 452  HIS A NE2 1 
ATOM   3215 N  N   . VAL A  1  418 ? 38.876  40.560 10.817  1.00 20.28 ? 453  VAL A N   1 
ATOM   3216 C  CA  A VAL A  1  418 ? 39.653  41.793 10.675  0.50 18.26 ? 453  VAL A CA  1 
ATOM   3217 C  CA  B VAL A  1  418 ? 39.666  41.790 10.705  0.50 18.26 ? 453  VAL A CA  1 
ATOM   3218 C  C   . VAL A  1  418 ? 39.290  42.728 11.837  1.00 20.93 ? 453  VAL A C   1 
ATOM   3219 O  O   . VAL A  1  418 ? 38.104  42.933 12.145  1.00 21.00 ? 453  VAL A O   1 
ATOM   3220 C  CB  A VAL A  1  418 ? 39.443  42.463 9.278   0.50 18.01 ? 453  VAL A CB  1 
ATOM   3221 C  CB  B VAL A  1  418 ? 39.467  42.509 9.368   0.50 18.02 ? 453  VAL A CB  1 
ATOM   3222 C  CG1 A VAL A  1  418 ? 37.988  42.938 9.078   0.50 15.31 ? 453  VAL A CG1 1 
ATOM   3223 C  CG1 B VAL A  1  418 ? 40.169  43.876 9.387   0.50 19.17 ? 453  VAL A CG1 1 
ATOM   3224 C  CG2 A VAL A  1  418 ? 40.445  43.607 9.052   0.50 19.08 ? 453  VAL A CG2 1 
ATOM   3225 C  CG2 B VAL A  1  418 ? 40.006  41.665 8.253   0.50 16.24 ? 453  VAL A CG2 1 
ATOM   3226 N  N   . ALA A  1  419 ? 40.303  43.275 12.508  1.00 18.35 ? 454  ALA A N   1 
ATOM   3227 C  CA  . ALA A  1  419 ? 40.063  44.192 13.604  1.00 19.88 ? 454  ALA A CA  1 
ATOM   3228 C  C   . ALA A  1  419 ? 40.919  45.436 13.406  1.00 21.10 ? 454  ALA A C   1 
ATOM   3229 O  O   . ALA A  1  419 ? 41.882  45.417 12.641  1.00 21.93 ? 454  ALA A O   1 
ATOM   3230 C  CB  . ALA A  1  419 ? 40.396  43.525 14.939  1.00 22.11 ? 454  ALA A CB  1 
ATOM   3231 N  N   . ARG A  1  420 ? 40.562  46.512 14.096  1.00 20.15 ? 455  ARG A N   1 
ATOM   3232 C  CA  . ARG A  1  420 ? 41.267  47.763 13.890  1.00 25.16 ? 455  ARG A CA  1 
ATOM   3233 C  C   . ARG A  1  420 ? 42.684  47.673 14.480  1.00 27.19 ? 455  ARG A C   1 
ATOM   3234 O  O   . ARG A  1  420 ? 43.666  48.079 13.845  1.00 23.91 ? 455  ARG A O   1 
ATOM   3235 C  CB  . ARG A  1  420 ? 40.459  48.914 14.494  1.00 26.67 ? 455  ARG A CB  1 
ATOM   3236 C  CG  . ARG A  1  420 ? 40.799  50.286 13.946  1.00 29.39 ? 455  ARG A CG  1 
ATOM   3237 C  CD  . ARG A  1  420 ? 39.831  51.340 14.474  1.00 27.22 ? 455  ARG A CD  1 
ATOM   3238 N  NE  . ARG A  1  420 ? 39.596  51.181 15.904  1.00 31.37 ? 455  ARG A NE  1 
ATOM   3239 C  CZ  . ARG A  1  420 ? 40.328  51.767 16.851  1.00 39.45 ? 455  ARG A CZ  1 
ATOM   3240 N  NH1 . ARG A  1  420 ? 41.353  52.548 16.524  1.00 36.39 ? 455  ARG A NH1 1 
ATOM   3241 N  NH2 . ARG A  1  420 ? 40.040  51.559 18.126  1.00 38.86 ? 455  ARG A NH2 1 
ATOM   3242 N  N   . LYS A  1  421 ? 42.793  47.091 15.668  1.00 27.75 ? 456  LYS A N   1 
ATOM   3243 C  CA  . LYS A  1  421 ? 44.091  47.001 16.359  1.00 31.61 ? 456  LYS A CA  1 
ATOM   3244 C  C   . LYS A  1  421 ? 44.047  46.016 17.529  1.00 35.63 ? 456  LYS A C   1 
ATOM   3245 O  O   . LYS A  1  421 ? 42.968  45.741 18.081  1.00 31.71 ? 456  LYS A O   1 
ATOM   3246 C  CB  . LYS A  1  421 ? 44.562  48.384 16.842  1.00 30.05 ? 456  LYS A CB  1 
ATOM   3247 C  CG  . LYS A  1  421 ? 43.712  48.984 17.945  1.00 35.41 ? 456  LYS A CG  1 
ATOM   3248 C  CD  . LYS A  1  421 ? 44.240  50.337 18.399  1.00 36.12 ? 456  LYS A CD  1 
ATOM   3249 C  CE  . LYS A  1  421 ? 43.306  50.943 19.449  1.00 46.52 ? 456  LYS A CE  1 
ATOM   3250 N  NZ  . LYS A  1  421 ? 43.801  52.232 20.022  1.00 48.20 ? 456  LYS A NZ  1 
ATOM   3251 N  N   . PRO A  1  422 ? 45.218  45.473 17.907  1.00 34.33 ? 457  PRO A N   1 
ATOM   3252 C  CA  . PRO A  1  422 ? 45.265  44.432 18.936  1.00 38.31 ? 457  PRO A CA  1 
ATOM   3253 C  C   . PRO A  1  422 ? 44.606  44.891 20.219  1.00 38.24 ? 457  PRO A C   1 
ATOM   3254 O  O   . PRO A  1  422 ? 44.002  44.075 20.907  1.00 48.63 ? 457  PRO A O   1 
ATOM   3255 C  CB  . PRO A  1  422 ? 46.763  44.213 19.148  1.00 31.72 ? 457  PRO A CB  1 
ATOM   3256 C  CG  . PRO A  1  422 ? 47.379  44.591 17.855  1.00 35.62 ? 457  PRO A CG  1 
ATOM   3257 C  CD  . PRO A  1  422 ? 46.546  45.720 17.315  1.00 30.55 ? 457  PRO A CD  1 
ATOM   3258 N  N   . LEU A  1  423 ? 44.706  46.180 20.526  1.00 41.91 ? 458  LEU A N   1 
ATOM   3259 C  CA  . LEU A  1  423 ? 44.070  46.735 21.719  1.00 49.15 ? 458  LEU A CA  1 
ATOM   3260 C  C   . LEU A  1  423 ? 42.584  46.379 21.812  1.00 51.86 ? 458  LEU A C   1 
ATOM   3261 O  O   . LEU A  1  423 ? 42.220  45.243 22.136  1.00 54.07 ? 458  LEU A O   1 
ATOM   3262 C  CB  . LEU A  1  423 ? 44.241  48.258 21.752  1.00 49.22 ? 458  LEU A CB  1 
ATOM   3263 N  N   . CYS A  1  433 ? 40.195  31.579 22.941  1.00 53.90 ? 468  CYS A N   1 
ATOM   3264 C  CA  . CYS A  1  433 ? 39.421  32.722 23.407  1.00 49.40 ? 468  CYS A CA  1 
ATOM   3265 C  C   . CYS A  1  433 ? 37.994  32.286 23.702  1.00 43.95 ? 468  CYS A C   1 
ATOM   3266 O  O   . CYS A  1  433 ? 37.690  31.100 23.683  1.00 41.83 ? 468  CYS A O   1 
ATOM   3267 C  CB  . CYS A  1  433 ? 39.417  33.813 22.342  1.00 52.85 ? 468  CYS A CB  1 
ATOM   3268 S  SG  . CYS A  1  433 ? 38.849  33.237 20.718  1.00 45.74 ? 468  CYS A SG  1 
ATOM   3269 N  N   . PHE A  1  434 ? 37.107  33.242 23.953  1.00 44.77 ? 469  PHE A N   1 
ATOM   3270 C  CA  . PHE A  1  434 ? 35.725  32.901 24.274  1.00 44.75 ? 469  PHE A CA  1 
ATOM   3271 C  C   . PHE A  1  434 ? 34.815  32.651 23.066  1.00 41.74 ? 469  PHE A C   1 
ATOM   3272 O  O   . PHE A  1  434 ? 33.633  32.364 23.235  1.00 38.60 ? 469  PHE A O   1 
ATOM   3273 C  CB  . PHE A  1  434 ? 35.103  33.959 25.187  1.00 51.48 ? 469  PHE A CB  1 
ATOM   3274 C  CG  . PHE A  1  434 ? 35.636  33.925 26.590  1.00 56.51 ? 469  PHE A CG  1 
ATOM   3275 C  CD1 . PHE A  1  434 ? 35.506  35.022 27.426  1.00 61.58 ? 469  PHE A CD1 1 
ATOM   3276 C  CD2 . PHE A  1  434 ? 36.280  32.793 27.065  1.00 55.85 ? 469  PHE A CD2 1 
ATOM   3277 C  CE1 . PHE A  1  434 ? 35.999  34.988 28.715  1.00 62.52 ? 469  PHE A CE1 1 
ATOM   3278 C  CE2 . PHE A  1  434 ? 36.780  32.752 28.354  1.00 63.38 ? 469  PHE A CE2 1 
ATOM   3279 C  CZ  . PHE A  1  434 ? 36.639  33.852 29.180  1.00 65.95 ? 469  PHE A CZ  1 
ATOM   3280 N  N   . PHE A  1  435 ? 35.348  32.760 21.853  1.00 33.94 ? 470  PHE A N   1 
ATOM   3281 C  CA  . PHE A  1  435 ? 34.554  32.392 20.680  1.00 34.26 ? 470  PHE A CA  1 
ATOM   3282 C  C   . PHE A  1  435 ? 35.353  31.503 19.748  1.00 32.98 ? 470  PHE A C   1 
ATOM   3283 O  O   . PHE A  1  435 ? 36.574  31.644 19.636  1.00 35.33 ? 470  PHE A O   1 
ATOM   3284 C  CB  . PHE A  1  435 ? 34.086  33.628 19.925  1.00 32.18 ? 470  PHE A CB  1 
ATOM   3285 C  CG  . PHE A  1  435 ? 35.187  34.340 19.207  1.00 36.70 ? 470  PHE A CG  1 
ATOM   3286 C  CD1 . PHE A  1  435 ? 35.623  33.904 17.961  1.00 33.93 ? 470  PHE A CD1 1 
ATOM   3287 C  CD2 . PHE A  1  435 ? 35.797  35.447 19.778  1.00 39.12 ? 470  PHE A CD2 1 
ATOM   3288 C  CE1 . PHE A  1  435 ? 36.668  34.571 17.292  1.00 30.57 ? 470  PHE A CE1 1 
ATOM   3289 C  CE2 . PHE A  1  435 ? 36.828  36.109 19.114  1.00 38.02 ? 470  PHE A CE2 1 
ATOM   3290 C  CZ  . PHE A  1  435 ? 37.254  35.663 17.869  1.00 31.71 ? 470  PHE A CZ  1 
ATOM   3291 N  N   . GLN A  1  436 ? 34.666  30.580 19.091  1.00 22.50 ? 471  GLN A N   1 
ATOM   3292 C  CA  . GLN A  1  436 ? 35.300  29.690 18.134  1.00 24.98 ? 471  GLN A CA  1 
ATOM   3293 C  C   . GLN A  1  436 ? 34.502  29.630 16.837  1.00 22.42 ? 471  GLN A C   1 
ATOM   3294 O  O   . GLN A  1  436 ? 34.849  28.881 15.927  1.00 22.43 ? 471  GLN A O   1 
ATOM   3295 C  CB  . GLN A  1  436 ? 35.406  28.292 18.734  1.00 29.99 ? 471  GLN A CB  1 
ATOM   3296 C  CG  . GLN A  1  436 ? 36.255  28.247 19.994  1.00 32.06 ? 471  GLN A CG  1 
ATOM   3297 C  CD  . GLN A  1  436 ? 36.199  26.898 20.669  1.00 38.74 ? 471  GLN A CD  1 
ATOM   3298 O  OE1 . GLN A  1  436 ? 35.534  26.734 21.698  1.00 42.37 ? 471  GLN A OE1 1 
ATOM   3299 N  NE2 . GLN A  1  436 ? 36.885  25.915 20.092  1.00 40.10 ? 471  GLN A NE2 1 
ATOM   3300 N  N   . GLY A  1  437 ? 33.396  30.377 16.792  1.00 20.61 ? 472  GLY A N   1 
ATOM   3301 C  CA  . GLY A  1  437 ? 32.585  30.424 15.600  1.00 17.64 ? 472  GLY A CA  1 
ATOM   3302 C  C   . GLY A  1  437 ? 32.156  31.841 15.244  1.00 16.78 ? 472  GLY A C   1 
ATOM   3303 O  O   . GLY A  1  437 ? 31.952  32.679 16.115  1.00 17.21 ? 472  GLY A O   1 
ATOM   3304 N  N   . ASP A  1  438 ? 32.045  32.115 13.949  1.00 16.49 ? 473  ASP A N   1 
ATOM   3305 C  CA  . ASP A  1  438 ? 31.406  33.359 13.494  1.00 17.36 ? 473  ASP A CA  1 
ATOM   3306 C  C   . ASP A  1  438 ? 30.887  33.210 12.046  1.00 15.47 ? 473  ASP A C   1 
ATOM   3307 O  O   . ASP A  1  438 ? 31.080  32.184 11.376  1.00 16.12 ? 473  ASP A O   1 
ATOM   3308 C  CB  . ASP A  1  438 ? 32.389  34.548 13.660  1.00 15.40 ? 473  ASP A CB  1 
ATOM   3309 C  CG  . ASP A  1  438 ? 31.695  35.901 13.831  1.00 19.50 ? 473  ASP A CG  1 
ATOM   3310 O  OD1 . ASP A  1  438 ? 30.435  35.989 13.776  1.00 16.35 ? 473  ASP A OD1 1 
ATOM   3311 O  OD2 . ASP A  1  438 ? 32.431  36.909 14.009  1.00 18.88 ? 473  ASP A OD2 1 
ATOM   3312 N  N   . HIS A  1  439 ? 30.236  34.257 11.548  1.00 14.83 ? 474  HIS A N   1 
ATOM   3313 C  CA  . HIS A  1  439 ? 29.664  34.244 10.230  1.00 14.03 ? 474  HIS A CA  1 
ATOM   3314 C  C   . HIS A  1  439 ? 29.552  35.702 9.798   1.00 13.14 ? 474  HIS A C   1 
ATOM   3315 O  O   . HIS A  1  439 ? 29.736  36.600 10.613  1.00 14.25 ? 474  HIS A O   1 
ATOM   3316 C  CB  . HIS A  1  439 ? 28.244  33.640 10.311  1.00 14.75 ? 474  HIS A CB  1 
ATOM   3317 C  CG  . HIS A  1  439 ? 27.407  34.270 11.370  1.00 14.98 ? 474  HIS A CG  1 
ATOM   3318 N  ND1 . HIS A  1  439 ? 26.627  35.387 11.139  1.00 16.41 ? 474  HIS A ND1 1 
ATOM   3319 C  CD2 . HIS A  1  439 ? 27.298  34.001 12.692  1.00 15.56 ? 474  HIS A CD2 1 
ATOM   3320 C  CE1 . HIS A  1  439 ? 26.048  35.750 12.266  1.00 16.30 ? 474  HIS A CE1 1 
ATOM   3321 N  NE2 . HIS A  1  439 ? 26.439  34.930 13.225  1.00 17.35 ? 474  HIS A NE2 1 
ATOM   3322 N  N   . GLY A  1  440 ? 29.259  35.930 8.527   1.00 14.29 ? 475  GLY A N   1 
ATOM   3323 C  CA  . GLY A  1  440 ? 29.221  37.282 7.966   1.00 14.67 ? 475  GLY A CA  1 
ATOM   3324 C  C   . GLY A  1  440 ? 29.885  37.347 6.595   1.00 14.09 ? 475  GLY A C   1 
ATOM   3325 O  O   . GLY A  1  440 ? 29.689  38.294 5.814   1.00 13.57 ? 475  GLY A O   1 
ATOM   3326 N  N   . PHE A  1  441 ? 30.640  36.311 6.277   1.00 13.61 ? 476  PHE A N   1 
ATOM   3327 C  CA  . PHE A  1  441 ? 31.428  36.230 5.044   1.00 15.36 ? 476  PHE A CA  1 
ATOM   3328 C  C   . PHE A  1  441 ? 30.580  36.211 3.776   1.00 15.54 ? 476  PHE A C   1 
ATOM   3329 O  O   . PHE A  1  441 ? 29.367  35.961 3.825   1.00 15.08 ? 476  PHE A O   1 
ATOM   3330 C  CB  . PHE A  1  441 ? 32.322  34.958 5.052   1.00 14.86 ? 476  PHE A CB  1 
ATOM   3331 C  CG  . PHE A  1  441 ? 33.199  34.816 6.292   1.00 14.10 ? 476  PHE A CG  1 
ATOM   3332 C  CD1 . PHE A  1  441 ? 34.360  35.592 6.447   1.00 16.29 ? 476  PHE A CD1 1 
ATOM   3333 C  CD2 . PHE A  1  441 ? 32.912  33.861 7.248   1.00 15.36 ? 476  PHE A CD2 1 
ATOM   3334 C  CE1 . PHE A  1  441 ? 35.186  35.419 7.572   1.00 15.53 ? 476  PHE A CE1 1 
ATOM   3335 C  CE2 . PHE A  1  441 ? 33.702  33.698 8.383   1.00 15.97 ? 476  PHE A CE2 1 
ATOM   3336 C  CZ  . PHE A  1  441 ? 34.838  34.470 8.557   1.00 16.44 ? 476  PHE A CZ  1 
ATOM   3337 N  N   . ASP A  1  442 ? 31.250  36.476 2.660   1.00 15.53 ? 477  ASP A N   1 
ATOM   3338 C  CA  . ASP A  1  442 ? 30.738  36.273 1.302   1.00 14.74 ? 477  ASP A CA  1 
ATOM   3339 C  C   . ASP A  1  442 ? 29.680  35.159 1.286   1.00 15.10 ? 477  ASP A C   1 
ATOM   3340 O  O   . ASP A  1  442 ? 29.932  34.017 1.734   1.00 14.16 ? 477  ASP A O   1 
ATOM   3341 C  CB  . ASP A  1  442 ? 31.940  35.869 0.423   1.00 18.20 ? 477  ASP A CB  1 
ATOM   3342 C  CG  . ASP A  1  442 ? 31.598  35.764 -1.050  1.00 20.49 ? 477  ASP A CG  1 
ATOM   3343 O  OD1 . ASP A  1  442 ? 30.441  35.475 -1.396  1.00 17.40 ? 477  ASP A OD1 1 
ATOM   3344 O  OD2 . ASP A  1  442 ? 32.523  35.950 -1.886  1.00 19.34 ? 477  ASP A OD2 1 
ATOM   3345 N  N   . ASN A  1  443 ? 28.493  35.480 0.778   1.00 14.56 ? 478  ASN A N   1 
ATOM   3346 C  CA  . ASN A  1  443 ? 27.383  34.528 0.845   1.00 15.08 ? 478  ASN A CA  1 
ATOM   3347 C  C   . ASN A  1  443 ? 27.457  33.300 -0.073  1.00 18.79 ? 478  ASN A C   1 
ATOM   3348 O  O   . ASN A  1  443 ? 26.534  32.462 -0.065  1.00 18.16 ? 478  ASN A O   1 
ATOM   3349 C  CB  . ASN A  1  443 ? 26.053  35.259 0.605   1.00 14.45 ? 478  ASN A CB  1 
ATOM   3350 C  CG  . ASN A  1  443 ? 25.901  35.747 -0.831  1.00 14.63 ? 478  ASN A CG  1 
ATOM   3351 O  OD1 . ASN A  1  443 ? 26.890  35.996 -1.534  1.00 16.07 ? 478  ASN A OD1 1 
ATOM   3352 N  ND2 . ASN A  1  443 ? 24.635  35.915 -1.278  1.00 14.17 ? 478  ASN A ND2 1 
ATOM   3353 N  N   . LYS A  1  444 ? 28.525  33.165 -0.849  1.00 17.23 ? 479  LYS A N   1 
ATOM   3354 C  CA  . LYS A  1  444 ? 28.706  31.909 -1.585  1.00 19.63 ? 479  LYS A CA  1 
ATOM   3355 C  C   . LYS A  1  444 ? 29.597  30.902 -0.845  1.00 20.92 ? 479  LYS A C   1 
ATOM   3356 O  O   . LYS A  1  444 ? 29.721  29.746 -1.257  1.00 21.17 ? 479  LYS A O   1 
ATOM   3357 C  CB  . LYS A  1  444 ? 29.209  32.159 -3.002  1.00 20.48 ? 479  LYS A CB  1 
ATOM   3358 C  CG  . LYS A  1  444 ? 30.632  32.515 -3.150  1.00 23.26 ? 479  LYS A CG  1 
ATOM   3359 C  CD  . LYS A  1  444 ? 30.925  32.580 -4.681  1.00 24.06 ? 479  LYS A CD  1 
ATOM   3360 C  CE  . LYS A  1  444 ? 32.392  32.814 -4.991  1.00 28.02 ? 479  LYS A CE  1 
ATOM   3361 N  NZ  . LYS A  1  444 ? 33.197  31.649 -4.560  1.00 33.35 ? 479  LYS A NZ  1 
ATOM   3362 N  N   . VAL A  1  445 ? 30.173  31.322 0.277   1.00 16.89 ? 480  VAL A N   1 
ATOM   3363 C  CA  . VAL A  1  445 ? 31.037  30.457 1.094   1.00 18.04 ? 480  VAL A CA  1 
ATOM   3364 C  C   . VAL A  1  445 ? 30.219  29.303 1.670   1.00 19.11 ? 480  VAL A C   1 
ATOM   3365 O  O   . VAL A  1  445 ? 29.208  29.528 2.314   1.00 16.54 ? 480  VAL A O   1 
ATOM   3366 C  CB  . VAL A  1  445 ? 31.680  31.279 2.243   1.00 17.02 ? 480  VAL A CB  1 
ATOM   3367 C  CG1 . VAL A  1  445 ? 32.298  30.395 3.317   1.00 21.86 ? 480  VAL A CG1 1 
ATOM   3368 C  CG2 . VAL A  1  445 ? 32.717  32.264 1.674   1.00 23.04 ? 480  VAL A CG2 1 
ATOM   3369 N  N   . ASN A  1  446 ? 30.666  28.065 1.457   1.00 19.30 ? 481  ASN A N   1 
ATOM   3370 C  CA  . ASN A  1  446 ? 29.916  26.914 1.949   1.00 21.82 ? 481  ASN A CA  1 
ATOM   3371 C  C   . ASN A  1  446 ? 29.471  26.958 3.394   1.00 19.44 ? 481  ASN A C   1 
ATOM   3372 O  O   . ASN A  1  446 ? 28.333  26.591 3.704   1.00 20.89 ? 481  ASN A O   1 
ATOM   3373 C  CB  . ASN A  1  446 ? 30.668  25.597 1.682   1.00 23.91 ? 481  ASN A CB  1 
ATOM   3374 C  CG  . ASN A  1  446 ? 30.448  25.088 0.274   1.00 36.69 ? 481  ASN A CG  1 
ATOM   3375 O  OD1 . ASN A  1  446 ? 29.561  25.570 -0.448  1.00 39.05 ? 481  ASN A OD1 1 
ATOM   3376 N  ND2 . ASN A  1  446 ? 31.255  24.106 -0.134  1.00 43.65 ? 481  ASN A ND2 1 
ATOM   3377 N  N   . SER A  1  447 ? 30.354  27.364 4.298   1.00 15.36 ? 482  SER A N   1 
ATOM   3378 C  CA  . SER A  1  447 ? 30.005  27.415 5.710   1.00 15.39 ? 482  SER A CA  1 
ATOM   3379 C  C   . SER A  1  447 ? 28.881  28.412 6.011   1.00 16.54 ? 482  SER A C   1 
ATOM   3380 O  O   . SER A  1  447 ? 28.269  28.311 7.048   1.00 15.36 ? 482  SER A O   1 
ATOM   3381 C  CB  . SER A  1  447 ? 31.231  27.775 6.570   1.00 19.00 ? 482  SER A CB  1 
ATOM   3382 O  OG  . SER A  1  447 ? 31.781  29.031 6.173   1.00 18.87 ? 482  SER A OG  1 
ATOM   3383 N  N   . MET A  1  448 ? 28.613  29.346 5.100   1.00 15.39 ? 483  MET A N   1 
ATOM   3384 C  CA  . MET A  1  448 ? 27.559  30.335 5.350   1.00 13.87 ? 483  MET A CA  1 
ATOM   3385 C  C   . MET A  1  448 ? 26.186  29.891 4.886   1.00 15.48 ? 483  MET A C   1 
ATOM   3386 O  O   . MET A  1  448 ? 25.196  30.548 5.191   1.00 15.21 ? 483  MET A O   1 
ATOM   3387 C  CB  . MET A  1  448 ? 27.894  31.650 4.664   1.00 14.91 ? 483  MET A CB  1 
ATOM   3388 C  CG  . MET A  1  448 ? 29.150  32.352 5.212   1.00 12.93 ? 483  MET A CG  1 
ATOM   3389 S  SD  . MET A  1  448 ? 29.028  32.784 6.969   1.00 14.82 ? 483  MET A SD  1 
ATOM   3390 C  CE  . MET A  1  448 ? 29.921  31.419 7.757   1.00 15.58 ? 483  MET A CE  1 
ATOM   3391 N  N   . GLN A  1  449 ? 26.120  28.787 4.149   1.00 14.81 ? 484  GLN A N   1 
ATOM   3392 C  CA  . GLN A  1  449 ? 24.800  28.328 3.656   1.00 14.16 ? 484  GLN A CA  1 
ATOM   3393 C  C   . GLN A  1  449 ? 23.921  27.880 4.800   1.00 15.53 ? 484  GLN A C   1 
ATOM   3394 O  O   . GLN A  1  449 ? 24.407  27.408 5.825   1.00 18.67 ? 484  GLN A O   1 
ATOM   3395 C  CB  . GLN A  1  449 ? 24.960  27.193 2.638   1.00 18.22 ? 484  GLN A CB  1 
ATOM   3396 C  CG  . GLN A  1  449 ? 25.977  27.551 1.529   1.00 18.55 ? 484  GLN A CG  1 
ATOM   3397 C  CD  . GLN A  1  449 ? 25.638  28.882 0.832   1.00 18.83 ? 484  GLN A CD  1 
ATOM   3398 O  OE1 . GLN A  1  449 ? 24.582  29.011 0.208   1.00 17.81 ? 484  GLN A OE1 1 
ATOM   3399 N  NE2 . GLN A  1  449 ? 26.533  29.879 0.946   1.00 15.07 ? 484  GLN A NE2 1 
ATOM   3400 N  N   . THR A  1  450 ? 22.616  27.985 4.606   1.00 14.25 ? 485  THR A N   1 
ATOM   3401 C  CA  . THR A  1  450 ? 21.703  27.684 5.699   1.00 14.56 ? 485  THR A CA  1 
ATOM   3402 C  C   . THR A  1  450 ? 20.622  26.729 5.206   1.00 16.61 ? 485  THR A C   1 
ATOM   3403 O  O   . THR A  1  450 ? 20.787  26.102 4.161   1.00 17.25 ? 485  THR A O   1 
ATOM   3404 C  CB  . THR A  1  450 ? 21.141  28.977 6.369   1.00 15.45 ? 485  THR A CB  1 
ATOM   3405 O  OG1 . THR A  1  450 ? 20.452  28.632 7.576   1.00 16.51 ? 485  THR A OG1 1 
ATOM   3406 C  CG2 . THR A  1  450 ? 20.226  29.726 5.429   1.00 15.84 ? 485  THR A CG2 1 
ATOM   3407 N  N   . VAL A  1  451 ? 19.562  26.562 5.992   1.00 20.43 ? 486  VAL A N   1 
ATOM   3408 C  CA  A VAL A  1  451 ? 18.581  25.494 5.771   0.50 18.07 ? 486  VAL A CA  1 
ATOM   3409 C  CA  B VAL A  1  451 ? 18.594  25.502 5.722   0.50 18.08 ? 486  VAL A CA  1 
ATOM   3410 C  C   . VAL A  1  451 ? 17.258  26.002 5.189   1.00 20.02 ? 486  VAL A C   1 
ATOM   3411 O  O   . VAL A  1  451 ? 16.863  27.138 5.436   1.00 19.11 ? 486  VAL A O   1 
ATOM   3412 C  CB  A VAL A  1  451 ? 18.298  24.743 7.091   0.50 19.33 ? 486  VAL A CB  1 
ATOM   3413 C  CB  B VAL A  1  451 ? 18.372  24.643 6.966   0.50 19.37 ? 486  VAL A CB  1 
ATOM   3414 C  CG1 A VAL A  1  451 ? 17.717  25.690 8.142   0.50 18.53 ? 486  VAL A CG1 1 
ATOM   3415 C  CG1 B VAL A  1  451 ? 19.650  23.904 7.295   0.50 18.35 ? 486  VAL A CG1 1 
ATOM   3416 C  CG2 A VAL A  1  451 ? 17.365  23.557 6.854   0.50 20.53 ? 486  VAL A CG2 1 
ATOM   3417 C  CG2 B VAL A  1  451 ? 17.905  25.500 8.147   0.50 18.53 ? 486  VAL A CG2 1 
ATOM   3418 N  N   . PHE A  1  452 ? 16.593  25.148 4.414   1.00 18.45 ? 487  PHE A N   1 
ATOM   3419 C  CA  . PHE A  1  452 ? 15.203  25.356 4.012   1.00 16.76 ? 487  PHE A CA  1 
ATOM   3420 C  C   . PHE A  1  452 ? 14.483  24.000 3.938   1.00 19.03 ? 487  PHE A C   1 
ATOM   3421 O  O   . PHE A  1  452 ? 14.954  23.070 3.266   1.00 18.86 ? 487  PHE A O   1 
ATOM   3422 C  CB  . PHE A  1  452 ? 15.049  26.024 2.656   1.00 17.61 ? 487  PHE A CB  1 
ATOM   3423 C  CG  . PHE A  1  452 ? 13.621  26.018 2.199   1.00 19.46 ? 487  PHE A CG  1 
ATOM   3424 C  CD1 . PHE A  1  452 ? 12.723  26.944 2.724   1.00 20.21 ? 487  PHE A CD1 1 
ATOM   3425 C  CD2 . PHE A  1  452 ? 13.148  25.033 1.351   1.00 21.73 ? 487  PHE A CD2 1 
ATOM   3426 C  CE1 . PHE A  1  452 ? 11.388  26.902 2.372   1.00 20.94 ? 487  PHE A CE1 1 
ATOM   3427 C  CE2 . PHE A  1  452 ? 11.808  25.012 0.970   1.00 23.71 ? 487  PHE A CE2 1 
ATOM   3428 C  CZ  . PHE A  1  452 ? 10.936  25.946 1.486   1.00 23.64 ? 487  PHE A CZ  1 
ATOM   3429 N  N   . VAL A  1  453 ? 13.366  23.897 4.648   1.00 18.52 ? 488  VAL A N   1 
ATOM   3430 C  CA  . VAL A  1  453 ? 12.439  22.779 4.510   1.00 18.32 ? 488  VAL A CA  1 
ATOM   3431 C  C   . VAL A  1  453 ? 11.019  23.313 4.481   1.00 21.69 ? 488  VAL A C   1 
ATOM   3432 O  O   . VAL A  1  453 ? 10.672  24.210 5.262   1.00 19.48 ? 488  VAL A O   1 
ATOM   3433 C  CB  . VAL A  1  453 ? 12.532  21.807 5.712   1.00 17.84 ? 488  VAL A CB  1 
ATOM   3434 C  CG1 . VAL A  1  453 ? 11.435  20.737 5.599   1.00 20.65 ? 488  VAL A CG1 1 
ATOM   3435 C  CG2 . VAL A  1  453 ? 13.945  21.175 5.820   1.00 17.82 ? 488  VAL A CG2 1 
ATOM   3436 N  N   . GLY A  1  454 ? 10.206  22.790 3.560   1.00 19.35 ? 489  GLY A N   1 
ATOM   3437 C  CA  . GLY A  1  454 ? 8.795   23.137 3.508   1.00 22.68 ? 489  GLY A CA  1 
ATOM   3438 C  C   . GLY A  1  454 ? 7.997   21.864 3.710   1.00 23.57 ? 489  GLY A C   1 
ATOM   3439 O  O   . GLY A  1  454 ? 8.275   20.845 3.066   1.00 24.42 ? 489  GLY A O   1 
ATOM   3440 N  N   . TYR A  1  455 ? 7.031   21.911 4.610   1.00 21.63 ? 490  TYR A N   1 
ATOM   3441 C  CA  . TYR A  1  455 ? 6.217   20.732 4.911   1.00 21.66 ? 490  TYR A CA  1 
ATOM   3442 C  C   . TYR A  1  455 ? 4.763   21.123 5.029   1.00 24.84 ? 490  TYR A C   1 
ATOM   3443 O  O   . TYR A  1  455 ? 4.426   22.049 5.767   1.00 22.77 ? 490  TYR A O   1 
ATOM   3444 C  CB  . TYR A  1  455 ? 6.677   20.108 6.212   1.00 20.42 ? 490  TYR A CB  1 
ATOM   3445 C  CG  . TYR A  1  455 ? 5.892   18.907 6.703   1.00 22.84 ? 490  TYR A CG  1 
ATOM   3446 C  CD1 . TYR A  1  455 ? 6.326   17.610 6.435   1.00 24.97 ? 490  TYR A CD1 1 
ATOM   3447 C  CD2 . TYR A  1  455 ? 4.739   19.072 7.470   1.00 26.28 ? 490  TYR A CD2 1 
ATOM   3448 C  CE1 . TYR A  1  455 ? 5.610   16.509 6.893   1.00 26.02 ? 490  TYR A CE1 1 
ATOM   3449 C  CE2 . TYR A  1  455 ? 4.023   17.979 7.940   1.00 27.15 ? 490  TYR A CE2 1 
ATOM   3450 C  CZ  . TYR A  1  455 ? 4.463   16.701 7.646   1.00 27.87 ? 490  TYR A CZ  1 
ATOM   3451 O  OH  . TYR A  1  455 ? 3.759   15.609 8.126   1.00 28.73 ? 490  TYR A OH  1 
ATOM   3452 N  N   . GLY A  1  456 ? 3.902   20.385 4.340   1.00 25.56 ? 491  GLY A N   1 
ATOM   3453 C  CA  . GLY A  1  456 ? 2.472   20.576 4.488   1.00 25.29 ? 491  GLY A CA  1 
ATOM   3454 C  C   . GLY A  1  456 ? 1.763   20.380 3.171   1.00 24.74 ? 491  GLY A C   1 
ATOM   3455 O  O   . GLY A  1  456 ? 2.368   20.029 2.171   1.00 24.35 ? 491  GLY A O   1 
ATOM   3456 N  N   . PRO A  1  457 ? 0.456   20.628 3.159   1.00 23.95 ? 492  PRO A N   1 
ATOM   3457 C  CA  . PRO A  1  457 ? -0.329  20.297 1.975   1.00 27.10 ? 492  PRO A CA  1 
ATOM   3458 C  C   . PRO A  1  457 ? 0.142   21.005 0.712   1.00 29.17 ? 492  PRO A C   1 
ATOM   3459 O  O   . PRO A  1  457 ? 0.008   20.462 -0.388  1.00 27.18 ? 492  PRO A O   1 
ATOM   3460 C  CB  . PRO A  1  457 ? -1.747  20.752 2.359   1.00 28.01 ? 492  PRO A CB  1 
ATOM   3461 C  CG  . PRO A  1  457 ? -1.556  21.776 3.436   1.00 26.76 ? 492  PRO A CG  1 
ATOM   3462 C  CD  . PRO A  1  457 ? -0.339  21.304 4.203   1.00 24.52 ? 492  PRO A CD  1 
ATOM   3463 N  N   . THR A  1  458 ? 0.684   22.215 0.847   1.00 26.53 ? 493  THR A N   1 
ATOM   3464 C  CA  . THR A  1  458 ? 0.996   22.990 -0.348  1.00 24.50 ? 493  THR A CA  1 
ATOM   3465 C  C   . THR A  1  458 ? 2.380   22.677 -0.917  1.00 23.33 ? 493  THR A C   1 
ATOM   3466 O  O   . THR A  1  458 ? 2.659   22.934 -2.097  1.00 24.28 ? 493  THR A O   1 
ATOM   3467 C  CB  . THR A  1  458 ? 0.839   24.513 -0.108  1.00 25.57 ? 493  THR A CB  1 
ATOM   3468 O  OG1 . THR A  1  458 ? -0.374  24.769 0.613   1.00 29.80 ? 493  THR A OG1 1 
ATOM   3469 C  CG2 . THR A  1  458 ? 0.873   25.290 -1.430  1.00 26.92 ? 493  THR A CG2 1 
ATOM   3470 N  N   . PHE A  1  459 ? 3.246   22.119 -0.084  1.00 23.90 ? 494  PHE A N   1 
ATOM   3471 C  CA  . PHE A  1  459 ? 4.563   21.696 -0.541  1.00 22.33 ? 494  PHE A CA  1 
ATOM   3472 C  C   . PHE A  1  459 ? 4.499   20.306 -1.155  1.00 26.12 ? 494  PHE A C   1 
ATOM   3473 O  O   . PHE A  1  459 ? 3.524   19.581 -0.973  1.00 29.00 ? 494  PHE A O   1 
ATOM   3474 C  CB  . PHE A  1  459 ? 5.574   21.720 0.601   1.00 23.29 ? 494  PHE A CB  1 
ATOM   3475 C  CG  . PHE A  1  459 ? 5.958   23.107 1.005   1.00 21.31 ? 494  PHE A CG  1 
ATOM   3476 C  CD1 . PHE A  1  459 ? 5.458   23.658 2.172   1.00 21.99 ? 494  PHE A CD1 1 
ATOM   3477 C  CD2 . PHE A  1  459 ? 6.778   23.870 0.185   1.00 23.41 ? 494  PHE A CD2 1 
ATOM   3478 C  CE1 . PHE A  1  459 ? 5.787   24.946 2.530   1.00 23.66 ? 494  PHE A CE1 1 
ATOM   3479 C  CE2 . PHE A  1  459 ? 7.124   25.183 0.543   1.00 21.71 ? 494  PHE A CE2 1 
ATOM   3480 C  CZ  . PHE A  1  459 ? 6.612   25.708 1.718   1.00 21.69 ? 494  PHE A CZ  1 
ATOM   3481 N  N   . LYS A  1  460 ? 5.536   19.943 -1.880  1.00 26.24 ? 495  LYS A N   1 
ATOM   3482 C  CA  . LYS A  1  460 ? 5.605   18.600 -2.425  1.00 30.57 ? 495  LYS A CA  1 
ATOM   3483 C  C   . LYS A  1  460 ? 5.981   17.582 -1.348  1.00 31.40 ? 495  LYS A C   1 
ATOM   3484 O  O   . LYS A  1  460 ? 6.411   17.947 -0.254  1.00 28.07 ? 495  LYS A O   1 
ATOM   3485 C  CB  . LYS A  1  460 ? 6.542   18.553 -3.629  1.00 25.87 ? 495  LYS A CB  1 
ATOM   3486 C  CG  . LYS A  1  460 ? 6.031   19.363 -4.806  1.00 29.87 ? 495  LYS A CG  1 
ATOM   3487 C  CD  . LYS A  1  460 ? 6.941   19.218 -6.010  1.00 30.37 ? 495  LYS A CD  1 
ATOM   3488 C  CE  . LYS A  1  460 ? 6.265   19.791 -7.237  1.00 35.01 ? 495  LYS A CE  1 
ATOM   3489 N  NZ  . LYS A  1  460 ? 7.258   20.080 -8.304  1.00 39.25 ? 495  LYS A NZ  1 
ATOM   3490 N  N   . TYR A  1  461 ? 5.759   16.301 -1.647  1.00 29.20 ? 496  TYR A N   1 
ATOM   3491 C  CA  . TYR A  1  461 ? 5.998   15.211 -0.709  1.00 28.77 ? 496  TYR A CA  1 
ATOM   3492 C  C   . TYR A  1  461 ? 7.325   14.541 -1.079  1.00 26.08 ? 496  TYR A C   1 
ATOM   3493 O  O   . TYR A  1  461 ? 7.570   14.301 -2.255  1.00 30.12 ? 496  TYR A O   1 
ATOM   3494 C  CB  . TYR A  1  461 ? 4.822   14.220 -0.837  1.00 31.53 ? 496  TYR A CB  1 
ATOM   3495 C  CG  . TYR A  1  461 ? 4.951   12.904 -0.099  1.00 30.64 ? 496  TYR A CG  1 
ATOM   3496 C  CD1 . TYR A  1  461 ? 5.088   11.704 -0.804  1.00 35.98 ? 496  TYR A CD1 1 
ATOM   3497 C  CD2 . TYR A  1  461 ? 4.894   12.847 1.288   1.00 32.50 ? 496  TYR A CD2 1 
ATOM   3498 C  CE1 . TYR A  1  461 ? 5.183   10.496 -0.140  1.00 35.18 ? 496  TYR A CE1 1 
ATOM   3499 C  CE2 . TYR A  1  461 ? 4.982   11.632 1.967   1.00 33.71 ? 496  TYR A CE2 1 
ATOM   3500 C  CZ  . TYR A  1  461 ? 5.125   10.462 1.237   1.00 37.06 ? 496  TYR A CZ  1 
ATOM   3501 O  OH  . TYR A  1  461 ? 5.227   9.254  1.895   1.00 40.42 ? 496  TYR A OH  1 
ATOM   3502 N  N   . ARG A  1  462 ? 8.171   14.269 -0.082  1.00 25.85 ? 497  ARG A N   1 
ATOM   3503 C  CA  . ARG A  1  462 ? 9.464   13.623 -0.289  1.00 27.94 ? 497  ARG A CA  1 
ATOM   3504 C  C   . ARG A  1  462 ? 10.205  14.131 -1.539  1.00 32.14 ? 497  ARG A C   1 
ATOM   3505 O  O   . ARG A  1  462 ? 10.617  13.354 -2.409  1.00 30.14 ? 497  ARG A O   1 
ATOM   3506 C  CB  . ARG A  1  462 ? 9.282   12.095 -0.351  1.00 29.46 ? 497  ARG A CB  1 
ATOM   3507 C  CG  . ARG A  1  462 ? 8.869   11.444 0.968   1.00 31.22 ? 497  ARG A CG  1 
ATOM   3508 C  CD  . ARG A  1  462 ? 8.811   9.919  0.810   1.00 32.89 ? 497  ARG A CD  1 
ATOM   3509 N  NE  . ARG A  1  462 ? 8.269   9.255  1.992   1.00 34.16 ? 497  ARG A NE  1 
ATOM   3510 C  CZ  . ARG A  1  462 ? 8.945   9.058  3.119   1.00 37.42 ? 497  ARG A CZ  1 
ATOM   3511 N  NH1 . ARG A  1  462 ? 10.200  9.485  3.237   1.00 37.76 ? 497  ARG A NH1 1 
ATOM   3512 N  NH2 . ARG A  1  462 ? 8.365   8.444  4.135   1.00 38.93 ? 497  ARG A NH2 1 
ATOM   3513 N  N   . THR A  1  463 ? 10.396  15.443 -1.623  1.00 29.62 ? 498  THR A N   1 
ATOM   3514 C  CA  . THR A  1  463 ? 10.981  16.044 -2.803  1.00 27.92 ? 498  THR A CA  1 
ATOM   3515 C  C   . THR A  1  463 ? 12.194  16.882 -2.412  1.00 28.20 ? 498  THR A C   1 
ATOM   3516 O  O   . THR A  1  463 ? 12.122  17.659 -1.463  1.00 25.22 ? 498  THR A O   1 
ATOM   3517 C  CB  . THR A  1  463 ? 9.962   16.928 -3.521  1.00 27.64 ? 498  THR A CB  1 
ATOM   3518 O  OG1 . THR A  1  463 ? 8.913   16.102 -4.050  1.00 30.49 ? 498  THR A OG1 1 
ATOM   3519 C  CG2 . THR A  1  463 ? 10.616  17.725 -4.653  1.00 30.16 ? 498  THR A CG2 1 
ATOM   3520 N  N   . LYS A  1  464 ? 13.294  16.701 -3.134  1.00 26.60 ? 499  LYS A N   1 
ATOM   3521 C  CA  . LYS A  1  464 ? 14.487  17.530 -2.956  1.00 26.47 ? 499  LYS A CA  1 
ATOM   3522 C  C   . LYS A  1  464 ? 14.533  18.527 -4.110  1.00 29.71 ? 499  LYS A C   1 
ATOM   3523 O  O   . LYS A  1  464 ? 14.240  18.186 -5.255  1.00 27.55 ? 499  LYS A O   1 
ATOM   3524 C  CB  . LYS A  1  464 ? 15.749  16.660 -2.928  1.00 26.92 ? 499  LYS A CB  1 
ATOM   3525 C  CG  . LYS A  1  464 ? 17.088  17.444 -2.857  1.00 26.66 ? 499  LYS A CG  1 
ATOM   3526 C  CD  . LYS A  1  464 ? 18.236  16.566 -2.322  1.00 27.56 ? 499  LYS A CD  1 
ATOM   3527 C  CE  . LYS A  1  464 ? 19.565  17.322 -2.319  1.00 30.02 ? 499  LYS A CE  1 
ATOM   3528 N  NZ  . LYS A  1  464 ? 20.653  16.574 -1.614  1.00 29.92 ? 499  LYS A NZ  1 
ATOM   3529 N  N   . VAL A  1  465 ? 14.904  19.765 -3.810  1.00 24.79 ? 500  VAL A N   1 
ATOM   3530 C  CA  . VAL A  1  465 ? 14.976  20.800 -4.832  1.00 22.91 ? 500  VAL A CA  1 
ATOM   3531 C  C   . VAL A  1  465 ? 16.382  21.398 -4.811  1.00 21.11 ? 500  VAL A C   1 
ATOM   3532 O  O   . VAL A  1  465 ? 17.076  21.265 -3.821  1.00 25.08 ? 500  VAL A O   1 
ATOM   3533 C  CB  . VAL A  1  465 ? 13.898  21.876 -4.589  1.00 23.94 ? 500  VAL A CB  1 
ATOM   3534 C  CG1 . VAL A  1  465 ? 12.506  21.225 -4.631  1.00 24.25 ? 500  VAL A CG1 1 
ATOM   3535 C  CG2 . VAL A  1  465 ? 14.129  22.555 -3.229  1.00 24.66 ? 500  VAL A CG2 1 
ATOM   3536 N  N   . PRO A  1  466 ? 16.809  22.025 -5.917  1.00 24.24 ? 501  PRO A N   1 
ATOM   3537 C  CA  . PRO A  1  466 ? 18.170  22.575 -5.921  1.00 25.70 ? 501  PRO A CA  1 
ATOM   3538 C  C   . PRO A  1  466 ? 18.257  23.716 -4.916  1.00 23.99 ? 501  PRO A C   1 
ATOM   3539 O  O   . PRO A  1  466 ? 17.229  24.259 -4.503  1.00 19.34 ? 501  PRO A O   1 
ATOM   3540 C  CB  . PRO A  1  466 ? 18.343  23.134 -7.344  1.00 26.77 ? 501  PRO A CB  1 
ATOM   3541 C  CG  . PRO A  1  466 ? 17.243  22.556 -8.156  1.00 32.41 ? 501  PRO A CG  1 
ATOM   3542 C  CD  . PRO A  1  466 ? 16.127  22.171 -7.213  1.00 23.24 ? 501  PRO A CD  1 
ATOM   3543 N  N   . PRO A  1  467 ? 19.476  24.054 -4.503  1.00 23.57 ? 502  PRO A N   1 
ATOM   3544 C  CA  . PRO A  1  467 ? 19.617  25.210 -3.617  1.00 19.87 ? 502  PRO A CA  1 
ATOM   3545 C  C   . PRO A  1  467 ? 19.110  26.467 -4.290  1.00 20.19 ? 502  PRO A C   1 
ATOM   3546 O  O   . PRO A  1  467 ? 19.137  26.587 -5.513  1.00 21.29 ? 502  PRO A O   1 
ATOM   3547 C  CB  . PRO A  1  467 ? 21.128  25.307 -3.379  1.00 23.08 ? 502  PRO A CB  1 
ATOM   3548 C  CG  . PRO A  1  467 ? 21.784  24.394 -4.357  1.00 28.89 ? 502  PRO A CG  1 
ATOM   3549 C  CD  . PRO A  1  467 ? 20.751  23.376 -4.780  1.00 24.35 ? 502  PRO A CD  1 
ATOM   3550 N  N   . PHE A  1  468 ? 18.662  27.421 -3.490  1.00 17.63 ? 503  PHE A N   1 
ATOM   3551 C  CA  . PHE A  1  468 ? 18.134  28.654 -4.054  1.00 16.22 ? 503  PHE A CA  1 
ATOM   3552 C  C   . PHE A  1  468 ? 18.415  29.758 -3.052  1.00 17.89 ? 503  PHE A C   1 
ATOM   3553 O  O   . PHE A  1  468 ? 18.851  29.482 -1.933  1.00 18.15 ? 503  PHE A O   1 
ATOM   3554 C  CB  . PHE A  1  468 ? 16.624  28.531 -4.291  1.00 17.00 ? 503  PHE A CB  1 
ATOM   3555 C  CG  . PHE A  1  468 ? 15.816  28.269 -3.036  1.00 17.63 ? 503  PHE A CG  1 
ATOM   3556 C  CD1 . PHE A  1  468 ? 15.491  26.979 -2.663  1.00 21.05 ? 503  PHE A CD1 1 
ATOM   3557 C  CD2 . PHE A  1  468 ? 15.373  29.323 -2.234  1.00 16.60 ? 503  PHE A CD2 1 
ATOM   3558 C  CE1 . PHE A  1  468 ? 14.729  26.749 -1.527  1.00 18.71 ? 503  PHE A CE1 1 
ATOM   3559 C  CE2 . PHE A  1  468 ? 14.626  29.112 -1.103  1.00 18.50 ? 503  PHE A CE2 1 
ATOM   3560 C  CZ  . PHE A  1  468 ? 14.303  27.804 -0.730  1.00 20.76 ? 503  PHE A CZ  1 
ATOM   3561 N  N   . GLU A  1  469 ? 18.130  30.993 -3.444  1.00 18.50 ? 504  GLU A N   1 
ATOM   3562 C  CA  . GLU A  1  469 ? 18.466  32.151 -2.616  1.00 17.73 ? 504  GLU A CA  1 
ATOM   3563 C  C   . GLU A  1  469 ? 17.288  32.606 -1.767  1.00 18.14 ? 504  GLU A C   1 
ATOM   3564 O  O   . GLU A  1  469 ? 16.125  32.549 -2.206  1.00 16.74 ? 504  GLU A O   1 
ATOM   3565 C  CB  . GLU A  1  469 ? 18.907  33.308 -3.519  1.00 15.95 ? 504  GLU A CB  1 
ATOM   3566 C  CG  . GLU A  1  469 ? 20.161  32.927 -4.372  1.00 19.52 ? 504  GLU A CG  1 
ATOM   3567 C  CD  . GLU A  1  469 ? 20.763  34.097 -5.117  1.00 20.43 ? 504  GLU A CD  1 
ATOM   3568 O  OE1 . GLU A  1  469 ? 20.011  35.051 -5.489  1.00 20.20 ? 504  GLU A OE1 1 
ATOM   3569 O  OE2 . GLU A  1  469 ? 21.995  34.046 -5.376  1.00 21.05 ? 504  GLU A OE2 1 
ATOM   3570 N  N   . ASN A  1  470 ? 17.598  33.127 -0.583  1.00 16.52 ? 505  ASN A N   1 
ATOM   3571 C  CA  . ASN A  1  470 ? 16.550  33.482 0.362   1.00 18.05 ? 505  ASN A CA  1 
ATOM   3572 C  C   . ASN A  1  470 ? 15.671  34.629 -0.108  1.00 15.54 ? 505  ASN A C   1 
ATOM   3573 O  O   . ASN A  1  470 ? 14.566  34.786 0.401   1.00 15.95 ? 505  ASN A O   1 
ATOM   3574 C  CB  . ASN A  1  470 ? 17.074  33.724 1.784   1.00 17.32 ? 505  ASN A CB  1 
ATOM   3575 C  CG  . ASN A  1  470 ? 18.012  34.945 1.890   1.00 14.66 ? 505  ASN A CG  1 
ATOM   3576 O  OD1 . ASN A  1  470 ? 18.404  35.520 0.890   1.00 17.40 ? 505  ASN A OD1 1 
ATOM   3577 N  ND2 . ASN A  1  470 ? 18.360  35.316 3.128   1.00 17.97 ? 505  ASN A ND2 1 
ATOM   3578 N  N   . ILE A  1  471 ? 16.158  35.412 -1.072  1.00 16.92 ? 506  ILE A N   1 
ATOM   3579 C  CA  . ILE A  1  471 ? 15.369  36.505 -1.651  1.00 16.90 ? 506  ILE A CA  1 
ATOM   3580 C  C   . ILE A  1  471 ? 14.119  35.966 -2.358  1.00 17.23 ? 506  ILE A C   1 
ATOM   3581 O  O   . ILE A  1  471 ? 13.163  36.700 -2.601  1.00 18.13 ? 506  ILE A O   1 
ATOM   3582 C  CB  . ILE A  1  471 ? 16.178  37.361 -2.664  1.00 15.88 ? 506  ILE A CB  1 
ATOM   3583 C  CG1 . ILE A  1  471 ? 16.797  36.510 -3.788  1.00 18.54 ? 506  ILE A CG1 1 
ATOM   3584 C  CG2 . ILE A  1  471 ? 17.297  38.165 -1.962  1.00 16.13 ? 506  ILE A CG2 1 
ATOM   3585 C  CD1 . ILE A  1  471 ? 17.354  37.336 -4.968  1.00 17.34 ? 506  ILE A CD1 1 
ATOM   3586 N  N   . GLU A  1  472 ? 14.136  34.676 -2.684  1.00 17.23 ? 507  GLU A N   1 
ATOM   3587 C  CA  . GLU A  1  472 ? 13.036  34.083 -3.450  1.00 18.13 ? 507  GLU A CA  1 
ATOM   3588 C  C   . GLU A  1  472 ? 11.845  33.707 -2.575  1.00 17.08 ? 507  GLU A C   1 
ATOM   3589 O  O   . GLU A  1  472 ? 10.722  33.507 -3.095  1.00 18.18 ? 507  GLU A O   1 
ATOM   3590 C  CB  . GLU A  1  472 ? 13.516  32.819 -4.171  1.00 16.69 ? 507  GLU A CB  1 
ATOM   3591 C  CG  . GLU A  1  472 ? 14.658  33.045 -5.166  1.00 16.20 ? 507  GLU A CG  1 
ATOM   3592 C  CD  . GLU A  1  472 ? 14.292  33.979 -6.328  1.00 18.38 ? 507  GLU A CD  1 
ATOM   3593 O  OE1 . GLU A  1  472 ? 13.088  34.065 -6.686  1.00 20.35 ? 507  GLU A OE1 1 
ATOM   3594 O  OE2 . GLU A  1  472 ? 15.207  34.642 -6.901  1.00 18.90 ? 507  GLU A OE2 1 
ATOM   3595 N  N   . LEU A  1  473 ? 12.053  33.609 -1.260  1.00 16.54 ? 508  LEU A N   1 
ATOM   3596 C  CA  . LEU A  1  473 ? 11.037  33.023 -0.378  1.00 20.28 ? 508  LEU A CA  1 
ATOM   3597 C  C   . LEU A  1  473 ? 9.807   33.919 -0.156  1.00 20.17 ? 508  LEU A C   1 
ATOM   3598 O  O   . LEU A  1  473 ? 8.684   33.425 -0.002  1.00 20.93 ? 508  LEU A O   1 
ATOM   3599 C  CB  . LEU A  1  473 ? 11.642  32.633 0.966   1.00 20.09 ? 508  LEU A CB  1 
ATOM   3600 C  CG  . LEU A  1  473 ? 12.149  31.193 1.024   1.00 29.90 ? 508  LEU A CG  1 
ATOM   3601 C  CD1 . LEU A  1  473 ? 12.666  30.851 2.401   1.00 27.12 ? 508  LEU A CD1 1 
ATOM   3602 C  CD2 . LEU A  1  473 ? 11.027  30.214 0.616   1.00 25.70 ? 508  LEU A CD2 1 
ATOM   3603 N  N   . TYR A  1  474 ? 10.014  35.238 -0.139  1.00 17.73 ? 509  TYR A N   1 
ATOM   3604 C  CA  . TYR A  1  474 ? 8.897   36.151 0.078   1.00 19.37 ? 509  TYR A CA  1 
ATOM   3605 C  C   . TYR A  1  474 ? 7.779   35.902 -0.974  1.00 19.85 ? 509  TYR A C   1 
ATOM   3606 O  O   . TYR A  1  474 ? 6.590   35.792 -0.621  1.00 21.17 ? 509  TYR A O   1 
ATOM   3607 C  CB  . TYR A  1  474 ? 9.401   37.612 0.056   1.00 19.27 ? 509  TYR A CB  1 
ATOM   3608 C  CG  . TYR A  1  474 ? 8.315   38.697 -0.005  1.00 17.46 ? 509  TYR A CG  1 
ATOM   3609 C  CD1 . TYR A  1  474 ? 8.011   39.319 -1.203  1.00 17.06 ? 509  TYR A CD1 1 
ATOM   3610 C  CD2 . TYR A  1  474 ? 7.676   39.137 1.148   1.00 21.20 ? 509  TYR A CD2 1 
ATOM   3611 C  CE1 . TYR A  1  474 ? 7.050   40.339 -1.268  1.00 18.92 ? 509  TYR A CE1 1 
ATOM   3612 C  CE2 . TYR A  1  474 ? 6.696   40.173 1.106   1.00 20.76 ? 509  TYR A CE2 1 
ATOM   3613 C  CZ  . TYR A  1  474 ? 6.407   40.754 -0.115  1.00 19.52 ? 509  TYR A CZ  1 
ATOM   3614 O  OH  . TYR A  1  474 ? 5.466   41.746 -0.210  1.00 18.01 ? 509  TYR A OH  1 
ATOM   3615 N  N   . ASN A  1  475 ? 8.151   35.790 -2.246  1.00 18.61 ? 510  ASN A N   1 
ATOM   3616 C  CA  . ASN A  1  475 ? 7.138   35.513 -3.269  1.00 19.10 ? 510  ASN A CA  1 
ATOM   3617 C  C   . ASN A  1  475 ? 6.355   34.238 -2.938  1.00 21.31 ? 510  ASN A C   1 
ATOM   3618 O  O   . ASN A  1  475 ? 5.132   34.187 -3.115  1.00 23.26 ? 510  ASN A O   1 
ATOM   3619 C  CB  . ASN A  1  475 ? 7.756   35.395 -4.670  1.00 20.80 ? 510  ASN A CB  1 
ATOM   3620 C  CG  . ASN A  1  475 ? 8.097   36.741 -5.285  1.00 16.62 ? 510  ASN A CG  1 
ATOM   3621 O  OD1 . ASN A  1  475 ? 7.469   37.756 -4.958  1.00 20.92 ? 510  ASN A OD1 1 
ATOM   3622 N  ND2 . ASN A  1  475 ? 9.078   36.760 -6.186  1.00 19.95 ? 510  ASN A ND2 1 
ATOM   3623 N  N   . VAL A  1  476 ? 7.078   33.211 -2.508  1.00 20.85 ? 511  VAL A N   1 
ATOM   3624 C  CA  . VAL A  1  476 ? 6.501   31.880 -2.255  1.00 24.35 ? 511  VAL A CA  1 
ATOM   3625 C  C   . VAL A  1  476 ? 5.597   31.922 -1.019  1.00 25.24 ? 511  VAL A C   1 
ATOM   3626 O  O   . VAL A  1  476 ? 4.529   31.290 -0.976  1.00 25.01 ? 511  VAL A O   1 
ATOM   3627 C  CB  . VAL A  1  476 ? 7.605   30.809 -2.101  1.00 23.79 ? 511  VAL A CB  1 
ATOM   3628 C  CG1 . VAL A  1  476 ? 7.049   29.476 -1.520  1.00 23.01 ? 511  VAL A CG1 1 
ATOM   3629 C  CG2 . VAL A  1  476 ? 8.330   30.568 -3.448  1.00 21.55 ? 511  VAL A CG2 1 
ATOM   3630 N  N   . MET A  1  477 ? 5.996   32.707 -0.020  1.00 19.44 ? 512  MET A N   1 
ATOM   3631 C  CA  . MET A  1  477 ? 5.166   32.855 1.156   1.00 18.13 ? 512  MET A CA  1 
ATOM   3632 C  C   . MET A  1  477 ? 3.893   33.619 0.793   1.00 21.53 ? 512  MET A C   1 
ATOM   3633 O  O   . MET A  1  477 ? 2.811   33.329 1.320   1.00 24.60 ? 512  MET A O   1 
ATOM   3634 C  CB  . MET A  1  477 ? 5.948   33.548 2.279   1.00 18.51 ? 512  MET A CB  1 
ATOM   3635 C  CG  . MET A  1  477 ? 7.085   32.668 2.778   1.00 18.38 ? 512  MET A CG  1 
ATOM   3636 S  SD  . MET A  1  477 ? 7.914   33.230 4.271   1.00 20.55 ? 512  MET A SD  1 
ATOM   3637 C  CE  . MET A  1  477 ? 8.695   34.717 3.620   1.00 22.07 ? 512  MET A CE  1 
ATOM   3638 N  N   . CYS A  1  478 ? 4.015   34.602 -0.092  1.00 20.04 ? 513  CYS A N   1 
ATOM   3639 C  CA  . CYS A  1  478 ? 2.848   35.317 -0.591  1.00 23.32 ? 513  CYS A CA  1 
ATOM   3640 C  C   . CYS A  1  478 ? 1.929   34.344 -1.320  1.00 25.22 ? 513  CYS A C   1 
ATOM   3641 O  O   . CYS A  1  478 ? 0.726   34.355 -1.084  1.00 26.71 ? 513  CYS A O   1 
ATOM   3642 C  CB  . CYS A  1  478 ? 3.266   36.462 -1.516  1.00 24.81 ? 513  CYS A CB  1 
ATOM   3643 S  SG  . CYS A  1  478 ? 3.851   37.908 -0.572  1.00 21.66 ? 513  CYS A SG  1 
ATOM   3644 N  N   . ASP A  1  479 ? 2.511   33.502 -2.183  1.00 24.14 ? 514  ASP A N   1 
ATOM   3645 C  CA  . ASP A  1  479 ? 1.757   32.429 -2.835  1.00 27.38 ? 514  ASP A CA  1 
ATOM   3646 C  C   . ASP A  1  479 ? 1.030   31.548 -1.829  1.00 26.31 ? 514  ASP A C   1 
ATOM   3647 O  O   . ASP A  1  479 ? -0.161  31.267 -1.998  1.00 31.94 ? 514  ASP A O   1 
ATOM   3648 C  CB  . ASP A  1  479 ? 2.656   31.554 -3.716  1.00 27.90 ? 514  ASP A CB  1 
ATOM   3649 C  CG  . ASP A  1  479 ? 3.147   32.279 -4.966  1.00 26.44 ? 514  ASP A CG  1 
ATOM   3650 O  OD1 . ASP A  1  479 ? 2.445   33.191 -5.442  1.00 29.34 ? 514  ASP A OD1 1 
ATOM   3651 O  OD2 . ASP A  1  479 ? 4.238   31.924 -5.468  1.00 29.66 ? 514  ASP A OD2 1 
ATOM   3652 N  N   . LEU A  1  480 ? 1.736   31.096 -0.794  1.00 26.89 ? 515  LEU A N   1 
ATOM   3653 C  CA  . LEU A  1  480 ? 1.151   30.228 0.224   1.00 26.79 ? 515  LEU A CA  1 
ATOM   3654 C  C   . LEU A  1  480 ? 0.001   30.907 0.971   1.00 29.68 ? 515  LEU A C   1 
ATOM   3655 O  O   . LEU A  1  480 ? -0.828  30.225 1.586   1.00 31.45 ? 515  LEU A O   1 
ATOM   3656 C  CB  . LEU A  1  480 ? 2.206   29.728 1.225   1.00 25.84 ? 515  LEU A CB  1 
ATOM   3657 C  CG  . LEU A  1  480 ? 3.305   28.789 0.712   1.00 27.08 ? 515  LEU A CG  1 
ATOM   3658 C  CD1 . LEU A  1  480 ? 4.519   28.752 1.652   1.00 26.23 ? 515  LEU A CD1 1 
ATOM   3659 C  CD2 . LEU A  1  480 ? 2.762   27.381 0.492   1.00 30.35 ? 515  LEU A CD2 1 
ATOM   3660 N  N   . LEU A  1  481 ? -0.057  32.239 0.928   1.00 26.14 ? 516  LEU A N   1 
ATOM   3661 C  CA  . LEU A  1  481 ? -1.099  32.962 1.662   1.00 25.08 ? 516  LEU A CA  1 
ATOM   3662 C  C   . LEU A  1  481 ? -2.118  33.656 0.767   1.00 27.04 ? 516  LEU A C   1 
ATOM   3663 O  O   . LEU A  1  481 ? -2.968  34.391 1.259   1.00 29.96 ? 516  LEU A O   1 
ATOM   3664 C  CB  . LEU A  1  481 ? -0.479  34.001 2.611   1.00 26.54 ? 516  LEU A CB  1 
ATOM   3665 C  CG  . LEU A  1  481 ? 0.350   33.398 3.755   1.00 24.80 ? 516  LEU A CG  1 
ATOM   3666 C  CD1 . LEU A  1  481 ? 1.328   34.446 4.314   1.00 22.90 ? 516  LEU A CD1 1 
ATOM   3667 C  CD2 . LEU A  1  481 ? -0.542  32.872 4.870   1.00 25.31 ? 516  LEU A CD2 1 
ATOM   3668 N  N   . GLY A  1  482 ? -2.018  33.444 -0.539  1.00 31.36 ? 517  GLY A N   1 
ATOM   3669 C  CA  . GLY A  1  482 ? -2.889  34.129 -1.487  1.00 28.84 ? 517  GLY A CA  1 
ATOM   3670 C  C   . GLY A  1  482 ? -2.634  35.623 -1.622  1.00 33.13 ? 517  GLY A C   1 
ATOM   3671 O  O   . GLY A  1  482 ? -3.533  36.381 -1.990  1.00 30.70 ? 517  GLY A O   1 
ATOM   3672 N  N   . LEU A  1  483 ? -1.408  36.062 -1.332  1.00 28.87 ? 518  LEU A N   1 
ATOM   3673 C  CA  . LEU A  1  483 ? -1.088  37.486 -1.345  1.00 24.88 ? 518  LEU A CA  1 
ATOM   3674 C  C   . LEU A  1  483 ? -0.404  37.893 -2.640  1.00 23.18 ? 518  LEU A C   1 
ATOM   3675 O  O   . LEU A  1  483 ? 0.271   37.087 -3.270  1.00 27.33 ? 518  LEU A O   1 
ATOM   3676 C  CB  . LEU A  1  483 ? -0.161  37.822 -0.150  1.00 21.61 ? 518  LEU A CB  1 
ATOM   3677 C  CG  . LEU A  1  483 ? -0.693  37.649 1.270   1.00 25.84 ? 518  LEU A CG  1 
ATOM   3678 C  CD1 . LEU A  1  483 ? 0.454   37.829 2.267   1.00 24.19 ? 518  LEU A CD1 1 
ATOM   3679 C  CD2 . LEU A  1  483 ? -1.828  38.642 1.570   1.00 24.83 ? 518  LEU A CD2 1 
ATOM   3680 N  N   . LYS A  1  484 ? -0.580  39.149 -3.048  1.00 23.76 ? 519  LYS A N   1 
ATOM   3681 C  CA  . LYS A  1  484 ? 0.171   39.702 -4.166  1.00 27.45 ? 519  LYS A CA  1 
ATOM   3682 C  C   . LYS A  1  484 ? 1.440   40.358 -3.634  1.00 24.73 ? 519  LYS A C   1 
ATOM   3683 O  O   . LYS A  1  484 ? 1.369   41.292 -2.846  1.00 25.27 ? 519  LYS A O   1 
ATOM   3684 C  CB  . LYS A  1  484 ? -0.657  40.737 -4.915  1.00 30.81 ? 519  LYS A CB  1 
ATOM   3685 C  CG  . LYS A  1  484 ? -1.839  40.099 -5.643  1.00 35.45 ? 519  LYS A CG  1 
ATOM   3686 C  CD  . LYS A  1  484 ? -2.626  41.115 -6.460  1.00 47.36 ? 519  LYS A CD  1 
ATOM   3687 C  CE  . LYS A  1  484 ? -3.926  40.491 -6.974  1.00 54.18 ? 519  LYS A CE  1 
ATOM   3688 N  NZ  . LYS A  1  484 ? -4.881  41.502 -7.506  1.00 63.28 ? 519  LYS A NZ  1 
ATOM   3689 N  N   . PRO A  1  485 ? 2.602   39.863 -4.061  1.00 25.75 ? 520  PRO A N   1 
ATOM   3690 C  CA  . PRO A  1  485 ? 3.813   40.414 -3.437  1.00 18.98 ? 520  PRO A CA  1 
ATOM   3691 C  C   . PRO A  1  485 ? 4.108   41.849 -3.850  1.00 21.03 ? 520  PRO A C   1 
ATOM   3692 O  O   . PRO A  1  485 ? 3.865   42.231 -5.003  1.00 23.24 ? 520  PRO A O   1 
ATOM   3693 C  CB  . PRO A  1  485 ? 4.921   39.447 -3.911  1.00 20.11 ? 520  PRO A CB  1 
ATOM   3694 C  CG  . PRO A  1  485 ? 4.403   38.832 -5.153  1.00 28.64 ? 520  PRO A CG  1 
ATOM   3695 C  CD  . PRO A  1  485 ? 2.899   38.760 -4.996  1.00 23.32 ? 520  PRO A CD  1 
ATOM   3696 N  N   . ALA A  1  486 ? 4.641   42.642 -2.913  1.00 20.80 ? 521  ALA A N   1 
ATOM   3697 C  CA  . ALA A  1  486 ? 5.205   43.943 -3.247  1.00 21.22 ? 521  ALA A CA  1 
ATOM   3698 C  C   . ALA A  1  486 ? 6.425   43.729 -4.155  1.00 23.04 ? 521  ALA A C   1 
ATOM   3699 O  O   . ALA A  1  486 ? 7.001   42.635 -4.174  1.00 21.09 ? 521  ALA A O   1 
ATOM   3700 C  CB  . ALA A  1  486 ? 5.604   44.708 -1.937  1.00 16.57 ? 521  ALA A CB  1 
ATOM   3701 N  N   . PRO A  1  487 ? 6.832   44.769 -4.900  1.00 21.73 ? 522  PRO A N   1 
ATOM   3702 C  CA  . PRO A  1  487 ? 7.966   44.665 -5.817  1.00 22.15 ? 522  PRO A CA  1 
ATOM   3703 C  C   . PRO A  1  487 ? 9.201   44.197 -5.043  1.00 19.20 ? 522  PRO A C   1 
ATOM   3704 O  O   . PRO A  1  487 ? 9.553   44.762 -3.999  1.00 21.00 ? 522  PRO A O   1 
ATOM   3705 C  CB  . PRO A  1  487 ? 8.135   46.101 -6.321  1.00 24.58 ? 522  PRO A CB  1 
ATOM   3706 C  CG  . PRO A  1  487 ? 6.734   46.688 -6.189  1.00 21.92 ? 522  PRO A CG  1 
ATOM   3707 C  CD  . PRO A  1  487 ? 6.175   46.092 -4.967  1.00 24.88 ? 522  PRO A CD  1 
ATOM   3708 N  N   . ASN A  1  488 ? 9.829   43.144 -5.517  1.00 16.53 ? 523  ASN A N   1 
ATOM   3709 C  CA  . ASN A  1  488 ? 10.981  42.646 -4.766  1.00 17.65 ? 523  ASN A CA  1 
ATOM   3710 C  C   . ASN A  1  488 ? 12.014  42.035 -5.699  1.00 19.20 ? 523  ASN A C   1 
ATOM   3711 O  O   . ASN A  1  488 ? 11.859  42.112 -6.915  1.00 19.26 ? 523  ASN A O   1 
ATOM   3712 C  CB  . ASN A  1  488 ? 10.520  41.676 -3.681  1.00 17.55 ? 523  ASN A CB  1 
ATOM   3713 C  CG  . ASN A  1  488 ? 9.953   40.392 -4.244  1.00 21.86 ? 523  ASN A CG  1 
ATOM   3714 O  OD1 . ASN A  1  488 ? 10.692  39.414 -4.418  1.00 20.17 ? 523  ASN A OD1 1 
ATOM   3715 N  ND2 . ASN A  1  488 ? 8.628   40.361 -4.487  1.00 17.14 ? 523  ASN A ND2 1 
ATOM   3716 N  N   . ASN A  1  489 ? 13.084  41.453 -5.151  1.00 17.04 ? 524  ASN A N   1 
ATOM   3717 C  CA  . ASN A  1  489 ? 14.174  40.966 -6.005  1.00 15.95 ? 524  ASN A CA  1 
ATOM   3718 C  C   . ASN A  1  489 ? 14.137  39.492 -6.352  1.00 17.52 ? 524  ASN A C   1 
ATOM   3719 O  O   . ASN A  1  489 ? 14.956  39.037 -7.151  1.00 18.42 ? 524  ASN A O   1 
ATOM   3720 C  CB  . ASN A  1  489 ? 15.512  41.313 -5.382  1.00 15.27 ? 524  ASN A CB  1 
ATOM   3721 C  CG  . ASN A  1  489 ? 15.634  42.800 -5.158  1.00 18.49 ? 524  ASN A CG  1 
ATOM   3722 O  OD1 . ASN A  1  489 ? 15.776  43.266 -4.025  1.00 14.73 ? 524  ASN A OD1 1 
ATOM   3723 N  ND2 . ASN A  1  489 ? 15.526  43.551 -6.257  1.00 16.38 ? 524  ASN A ND2 1 
ATOM   3724 N  N   . GLY A  1  490 ? 13.192  38.762 -5.767  1.00 17.65 ? 525  GLY A N   1 
ATOM   3725 C  CA  . GLY A  1  490 ? 12.913  37.416 -6.229  1.00 16.51 ? 525  GLY A CA  1 
ATOM   3726 C  C   . GLY A  1  490 ? 12.465  37.443 -7.698  1.00 20.49 ? 525  GLY A C   1 
ATOM   3727 O  O   . GLY A  1  490 ? 12.177  38.507 -8.306  1.00 20.80 ? 525  GLY A O   1 
ATOM   3728 N  N   . THR A  1  491 ? 12.430  36.255 -8.286  1.00 18.52 ? 526  THR A N   1 
ATOM   3729 C  CA  . THR A  1  491 ? 11.985  36.085 -9.677  1.00 21.46 ? 526  THR A CA  1 
ATOM   3730 C  C   . THR A  1  491 ? 10.787  35.132 -9.546  1.00 22.29 ? 526  THR A C   1 
ATOM   3731 O  O   . THR A  1  491 ? 10.941  33.934 -9.271  1.00 21.14 ? 526  THR A O   1 
ATOM   3732 C  CB  . THR A  1  491 ? 13.120  35.510 -10.591 1.00 23.35 ? 526  THR A CB  1 
ATOM   3733 O  OG1 . THR A  1  491 ? 14.200  36.454 -10.694 1.00 20.83 ? 526  THR A OG1 1 
ATOM   3734 C  CG2 . THR A  1  491 ? 12.607  35.202 -12.036 1.00 21.57 ? 526  THR A CG2 1 
ATOM   3735 N  N   . HIS A  1  492 ? 9.590   35.695 -9.663  1.00 20.92 ? 527  HIS A N   1 
ATOM   3736 C  CA  . HIS A  1  492 ? 8.398   34.987 -9.257  1.00 22.44 ? 527  HIS A CA  1 
ATOM   3737 C  C   . HIS A  1  492 ? 8.074   33.899 -10.262 1.00 24.01 ? 527  HIS A C   1 
ATOM   3738 O  O   . HIS A  1  492 ? 7.825   34.186 -11.433 1.00 20.98 ? 527  HIS A O   1 
ATOM   3739 C  CB  . HIS A  1  492 ? 7.230   35.959 -9.145  1.00 24.31 ? 527  HIS A CB  1 
ATOM   3740 C  CG  . HIS A  1  492 ? 6.128   35.469 -8.265  1.00 21.46 ? 527  HIS A CG  1 
ATOM   3741 N  ND1 . HIS A  1  492 ? 5.055   36.260 -7.918  1.00 22.53 ? 527  HIS A ND1 1 
ATOM   3742 C  CD2 . HIS A  1  492 ? 5.946   34.284 -7.633  1.00 22.26 ? 527  HIS A CD2 1 
ATOM   3743 C  CE1 . HIS A  1  492 ? 4.245   35.573 -7.130  1.00 25.73 ? 527  HIS A CE1 1 
ATOM   3744 N  NE2 . HIS A  1  492 ? 4.765   34.372 -6.942  1.00 25.20 ? 527  HIS A NE2 1 
ATOM   3745 N  N   . GLY A  1  493 ? 8.035   32.659 -9.783  1.00 25.13 ? 528  GLY A N   1 
ATOM   3746 C  CA  . GLY A  1  493 ? 7.883   31.511 -10.652 1.00 23.57 ? 528  GLY A CA  1 
ATOM   3747 C  C   . GLY A  1  493 ? 9.103   30.616 -10.560 1.00 27.02 ? 528  GLY A C   1 
ATOM   3748 O  O   . GLY A  1  493 ? 9.000   29.403 -10.780 1.00 26.24 ? 528  GLY A O   1 
ATOM   3749 N  N   . SER A  1  494 ? 10.256  31.202 -10.214 1.00 23.19 ? 529  SER A N   1 
ATOM   3750 C  CA  . SER A  1  494 ? 11.504  30.439 -10.148 1.00 21.39 ? 529  SER A CA  1 
ATOM   3751 C  C   . SER A  1  494 ? 11.481  29.326 -9.101  1.00 21.29 ? 529  SER A C   1 
ATOM   3752 O  O   . SER A  1  494 ? 12.292  28.396 -9.187  1.00 23.03 ? 529  SER A O   1 
ATOM   3753 C  CB  . SER A  1  494 ? 12.713  31.363 -9.907  1.00 21.71 ? 529  SER A CB  1 
ATOM   3754 O  OG  . SER A  1  494 ? 12.737  31.803 -8.555  1.00 20.93 ? 529  SER A OG  1 
ATOM   3755 N  N   . LEU A  1  495 ? 10.577  29.408 -8.117  1.00 20.01 ? 530  LEU A N   1 
ATOM   3756 C  CA  . LEU A  1  495 ? 10.423  28.350 -7.121  1.00 22.06 ? 530  LEU A CA  1 
ATOM   3757 C  C   . LEU A  1  495 ? 9.096   27.582 -7.226  1.00 23.69 ? 530  LEU A C   1 
ATOM   3758 O  O   . LEU A  1  495 ? 8.682   26.916 -6.266  1.00 22.66 ? 530  LEU A O   1 
ATOM   3759 C  CB  . LEU A  1  495 ? 10.564  28.892 -5.692  1.00 22.73 ? 530  LEU A CB  1 
ATOM   3760 C  CG  . LEU A  1  495 ? 11.932  29.494 -5.353  1.00 21.36 ? 530  LEU A CG  1 
ATOM   3761 C  CD1 . LEU A  1  495 ? 11.982  29.811 -3.845  1.00 21.93 ? 530  LEU A CD1 1 
ATOM   3762 C  CD2 . LEU A  1  495 ? 13.050  28.537 -5.742  1.00 20.59 ? 530  LEU A CD2 1 
ATOM   3763 N  N   . ASN A  1  496 ? 8.437   27.662 -8.374  1.00 23.28 ? 531  ASN A N   1 
ATOM   3764 C  CA  . ASN A  1  496 ? 7.187   26.911 -8.552  1.00 24.71 ? 531  ASN A CA  1 
ATOM   3765 C  C   . ASN A  1  496 ? 7.369   25.407 -8.294  1.00 26.10 ? 531  ASN A C   1 
ATOM   3766 O  O   . ASN A  1  496 ? 6.443   24.717 -7.836  1.00 27.64 ? 531  ASN A O   1 
ATOM   3767 C  CB  . ASN A  1  496 ? 6.604   27.136 -9.946  1.00 25.87 ? 531  ASN A CB  1 
ATOM   3768 C  CG  . ASN A  1  496 ? 5.785   28.406 -10.043 1.00 27.01 ? 531  ASN A CG  1 
ATOM   3769 O  OD1 . ASN A  1  496 ? 5.430   29.001 -9.035  1.00 29.57 ? 531  ASN A OD1 1 
ATOM   3770 N  ND2 . ASN A  1  496 ? 5.464   28.814 -11.271 1.00 28.38 ? 531  ASN A ND2 1 
ATOM   3771 N  N   . HIS A  1  497 ? 8.567   24.903 -8.563  1.00 26.98 ? 532  HIS A N   1 
ATOM   3772 C  CA  . HIS A  1  497 ? 8.844   23.472 -8.407  1.00 28.28 ? 532  HIS A CA  1 
ATOM   3773 C  C   . HIS A  1  497 ? 8.869   22.976 -6.961  1.00 26.92 ? 532  HIS A C   1 
ATOM   3774 O  O   . HIS A  1  497 ? 9.001   21.771 -6.720  1.00 27.45 ? 532  HIS A O   1 
ATOM   3775 C  CB  . HIS A  1  497 ? 10.135  23.082 -9.147  1.00 26.98 ? 532  HIS A CB  1 
ATOM   3776 C  CG  . HIS A  1  497 ? 11.368  23.765 -8.623  1.00 23.15 ? 532  HIS A CG  1 
ATOM   3777 N  ND1 . HIS A  1  497 ? 11.718  25.050 -8.986  1.00 26.33 ? 532  HIS A ND1 1 
ATOM   3778 C  CD2 . HIS A  1  497 ? 12.327  23.336 -7.769  1.00 25.20 ? 532  HIS A CD2 1 
ATOM   3779 C  CE1 . HIS A  1  497 ? 12.848  25.380 -8.383  1.00 24.08 ? 532  HIS A CE1 1 
ATOM   3780 N  NE2 . HIS A  1  497 ? 13.236  24.361 -7.629  1.00 20.77 ? 532  HIS A NE2 1 
ATOM   3781 N  N   . LEU A  1  498 ? 8.746   23.885 -5.988  1.00 26.07 ? 533  LEU A N   1 
ATOM   3782 C  CA  . LEU A  1  498 ? 8.666   23.477 -4.588  1.00 24.17 ? 533  LEU A CA  1 
ATOM   3783 C  C   . LEU A  1  498 ? 7.232   23.137 -4.216  1.00 23.54 ? 533  LEU A C   1 
ATOM   3784 O  O   . LEU A  1  498 ? 6.971   22.584 -3.150  1.00 23.33 ? 533  LEU A O   1 
ATOM   3785 C  CB  . LEU A  1  498 ? 9.117   24.607 -3.644  1.00 22.67 ? 533  LEU A CB  1 
ATOM   3786 C  CG  . LEU A  1  498 ? 10.621  24.828 -3.423  1.00 20.65 ? 533  LEU A CG  1 
ATOM   3787 C  CD1 . LEU A  1  498 ? 11.305  25.170 -4.731  1.00 21.61 ? 533  LEU A CD1 1 
ATOM   3788 C  CD2 . LEU A  1  498 ? 10.823  25.947 -2.368  1.00 20.06 ? 533  LEU A CD2 1 
ATOM   3789 N  N   . LEU A  1  499 ? 6.299   23.512 -5.085  1.00 27.73 ? 534  LEU A N   1 
ATOM   3790 C  CA  . LEU A  1  499 ? 4.897   23.548 -4.691  1.00 27.26 ? 534  LEU A CA  1 
ATOM   3791 C  C   . LEU A  1  499 ? 4.034   22.518 -5.441  1.00 25.21 ? 534  LEU A C   1 
ATOM   3792 O  O   . LEU A  1  499 ? 4.196   22.339 -6.643  1.00 28.23 ? 534  LEU A O   1 
ATOM   3793 C  CB  . LEU A  1  499 ? 4.329   24.951 -4.933  1.00 27.03 ? 534  LEU A CB  1 
ATOM   3794 C  CG  . LEU A  1  499 ? 5.033   26.131 -4.241  1.00 28.42 ? 534  LEU A CG  1 
ATOM   3795 C  CD1 . LEU A  1  499 ? 4.491   27.466 -4.740  1.00 31.87 ? 534  LEU A CD1 1 
ATOM   3796 C  CD2 . LEU A  1  499 ? 4.919   26.020 -2.725  1.00 23.67 ? 534  LEU A CD2 1 
ATOM   3797 N  N   . ARG A  1  500 ? 3.121   21.881 -4.709  1.00 29.56 ? 535  ARG A N   1 
ATOM   3798 C  CA  . ARG A  1  500 ? 2.092   21.000 -5.288  1.00 33.14 ? 535  ARG A CA  1 
ATOM   3799 C  C   . ARG A  1  500 ? 0.985   21.826 -5.954  1.00 34.68 ? 535  ARG A C   1 
ATOM   3800 O  O   . ARG A  1  500 ? 0.452   21.463 -7.010  1.00 33.28 ? 535  ARG A O   1 
ATOM   3801 C  CB  . ARG A  1  500 ? 1.500   20.111 -4.186  1.00 32.79 ? 535  ARG A CB  1 
ATOM   3802 C  CG  . ARG A  1  500 ? 0.140   19.488 -4.505  1.00 37.37 ? 535  ARG A CG  1 
ATOM   3803 C  CD  . ARG A  1  500 ? -0.440  18.809 -3.274  1.00 36.49 ? 535  ARG A CD  1 
ATOM   3804 N  NE  . ARG A  1  500 ? 0.554   17.970 -2.606  1.00 38.34 ? 535  ARG A NE  1 
ATOM   3805 C  CZ  . ARG A  1  500 ? 0.776   16.692 -2.908  1.00 42.42 ? 535  ARG A CZ  1 
ATOM   3806 N  NH1 . ARG A  1  500 ? 0.070   16.109 -3.865  1.00 42.72 ? 535  ARG A NH1 1 
ATOM   3807 N  NH2 . ARG A  1  500 ? 1.700   15.994 -2.255  1.00 39.13 ? 535  ARG A NH2 1 
ATOM   3808 N  N   . THR A  1  501 ? 0.644   22.945 -5.325  1.00 32.02 ? 536  THR A N   1 
ATOM   3809 C  CA  . THR A  1  501 ? -0.407  23.822 -5.817  1.00 33.52 ? 536  THR A CA  1 
ATOM   3810 C  C   . THR A  1  501 ? -0.037  25.256 -5.439  1.00 32.52 ? 536  THR A C   1 
ATOM   3811 O  O   . THR A  1  501 ? 0.959   25.463 -4.757  1.00 31.94 ? 536  THR A O   1 
ATOM   3812 C  CB  . THR A  1  501 ? -1.771  23.425 -5.191  1.00 39.52 ? 536  THR A CB  1 
ATOM   3813 O  OG1 . THR A  1  501 ? -2.842  24.076 -5.886  1.00 42.02 ? 536  THR A OG1 1 
ATOM   3814 C  CG2 . THR A  1  501 ? -1.815  23.788 -3.715  1.00 37.95 ? 536  THR A CG2 1 
ATOM   3815 N  N   . ASN A  1  502 ? -0.829  26.229 -5.888  1.00 36.17 ? 537  ASN A N   1 
ATOM   3816 C  CA  . ASN A  1  502 ? -0.610  27.649 -5.581  1.00 37.81 ? 537  ASN A CA  1 
ATOM   3817 C  C   . ASN A  1  502 ? 0.583   28.239 -6.320  1.00 36.59 ? 537  ASN A C   1 
ATOM   3818 O  O   . ASN A  1  502 ? 1.115   29.285 -5.935  1.00 34.34 ? 537  ASN A O   1 
ATOM   3819 C  CB  . ASN A  1  502 ? -0.471  27.886 -4.075  1.00 37.26 ? 537  ASN A CB  1 
ATOM   3820 C  CG  . ASN A  1  502 ? -1.814  27.964 -3.369  1.00 39.71 ? 537  ASN A CG  1 
ATOM   3821 O  OD1 . ASN A  1  502 ? -2.755  27.240 -3.704  1.00 41.91 ? 537  ASN A OD1 1 
ATOM   3822 N  ND2 . ASN A  1  502 ? -1.910  28.854 -2.388  1.00 41.40 ? 537  ASN A ND2 1 
ATOM   3823 N  N   . THR A  1  503 ? 1.009   27.558 -7.380  1.00 34.05 ? 538  THR A N   1 
ATOM   3824 C  CA  . THR A  1  503 ? 2.126   28.037 -8.176  1.00 34.50 ? 538  THR A CA  1 
ATOM   3825 C  C   . THR A  1  503 ? 1.726   29.359 -8.832  1.00 36.31 ? 538  THR A C   1 
ATOM   3826 O  O   . THR A  1  503 ? 0.533   29.668 -8.974  1.00 38.28 ? 538  THR A O   1 
ATOM   3827 C  CB  . THR A  1  503 ? 2.516   27.024 -9.264  1.00 35.43 ? 538  THR A CB  1 
ATOM   3828 O  OG1 . THR A  1  503 ? 1.350   26.679 -10.027 1.00 37.30 ? 538  THR A OG1 1 
ATOM   3829 C  CG2 . THR A  1  503 ? 3.112   25.746 -8.649  1.00 31.19 ? 538  THR A CG2 1 
ATOM   3830 N  N   . PHE A  1  504 ? 2.714   30.147 -9.231  1.00 32.80 ? 539  PHE A N   1 
ATOM   3831 C  CA  . PHE A  1  504 ? 2.429   31.422 -9.878  1.00 32.47 ? 539  PHE A CA  1 
ATOM   3832 C  C   . PHE A  1  504 ? 2.687   31.312 -11.371 1.00 31.75 ? 539  PHE A C   1 
ATOM   3833 O  O   . PHE A  1  504 ? 3.762   30.895 -11.781 1.00 34.36 ? 539  PHE A O   1 
ATOM   3834 C  CB  . PHE A  1  504 ? 3.304   32.504 -9.249  1.00 29.26 ? 539  PHE A CB  1 
ATOM   3835 C  CG  . PHE A  1  504 ? 3.295   33.797 -9.981  1.00 30.07 ? 539  PHE A CG  1 
ATOM   3836 C  CD1 . PHE A  1  504 ? 2.306   34.730 -9.754  1.00 28.08 ? 539  PHE A CD1 1 
ATOM   3837 C  CD2 . PHE A  1  504 ? 4.292   34.093 -10.877 1.00 27.56 ? 539  PHE A CD2 1 
ATOM   3838 C  CE1 . PHE A  1  504 ? 2.316   35.936 -10.415 1.00 28.35 ? 539  PHE A CE1 1 
ATOM   3839 C  CE2 . PHE A  1  504 ? 4.300   35.284 -11.548 1.00 31.94 ? 539  PHE A CE2 1 
ATOM   3840 C  CZ  . PHE A  1  504 ? 3.312   36.210 -11.318 1.00 31.34 ? 539  PHE A CZ  1 
ATOM   3841 N  N   . ARG A  1  505 ? 1.703   31.665 -12.197 1.00 33.75 ? 540  ARG A N   1 
ATOM   3842 C  CA  . ARG A  1  505 ? 1.914   31.560 -13.638 1.00 31.95 ? 540  ARG A CA  1 
ATOM   3843 C  C   . ARG A  1  505 ? 2.635   32.792 -14.161 1.00 33.35 ? 540  ARG A C   1 
ATOM   3844 O  O   . ARG A  1  505 ? 2.056   33.879 -14.236 1.00 33.82 ? 540  ARG A O   1 
ATOM   3845 C  CB  . ARG A  1  505 ? 0.599   31.362 -14.410 1.00 39.48 ? 540  ARG A CB  1 
ATOM   3846 C  CG  . ARG A  1  505 ? 0.845   31.135 -15.897 1.00 38.96 ? 540  ARG A CG  1 
ATOM   3847 C  CD  . ARG A  1  505 ? -0.445  31.126 -16.719 1.00 50.60 ? 540  ARG A CD  1 
ATOM   3848 N  NE  . ARG A  1  505 ? -0.177  30.807 -18.124 1.00 52.24 ? 540  ARG A NE  1 
ATOM   3849 C  CZ  . ARG A  1  505 ? 0.371   31.653 -18.994 1.00 58.82 ? 540  ARG A CZ  1 
ATOM   3850 N  NH1 . ARG A  1  505 ? 0.719   32.877 -18.611 1.00 56.89 ? 540  ARG A NH1 1 
ATOM   3851 N  NH2 . ARG A  1  505 ? 0.580   31.279 -20.251 1.00 64.02 ? 540  ARG A NH2 1 
ATOM   3852 N  N   . PRO A  1  506 ? 3.913   32.632 -14.523 1.00 32.89 ? 541  PRO A N   1 
ATOM   3853 C  CA  . PRO A  1  506 ? 4.676   33.794 -14.972 1.00 36.60 ? 541  PRO A CA  1 
ATOM   3854 C  C   . PRO A  1  506 ? 4.272   34.146 -16.393 1.00 38.72 ? 541  PRO A C   1 
ATOM   3855 O  O   . PRO A  1  506 ? 3.697   33.313 -17.085 1.00 38.41 ? 541  PRO A O   1 
ATOM   3856 C  CB  . PRO A  1  506 ? 6.126   33.291 -14.939 1.00 35.64 ? 541  PRO A CB  1 
ATOM   3857 C  CG  . PRO A  1  506 ? 6.015   31.816 -15.139 1.00 34.18 ? 541  PRO A CG  1 
ATOM   3858 C  CD  . PRO A  1  506 ? 4.708   31.389 -14.536 1.00 33.80 ? 541  PRO A CD  1 
ATOM   3859 N  N   . THR A  1  507 ? 4.555   35.371 -16.815 1.00 40.93 ? 542  THR A N   1 
ATOM   3860 C  CA  . THR A  1  507 ? 4.293   35.763 -18.190 1.00 43.16 ? 542  THR A CA  1 
ATOM   3861 C  C   . THR A  1  507 ? 5.531   36.428 -18.753 1.00 43.00 ? 542  THR A C   1 
ATOM   3862 O  O   . THR A  1  507 ? 6.165   37.258 -18.093 1.00 43.89 ? 542  THR A O   1 
ATOM   3863 C  CB  . THR A  1  507 ? 3.093   36.713 -18.299 1.00 46.49 ? 542  THR A CB  1 
ATOM   3864 O  OG1 . THR A  1  507 ? 3.531   38.066 -18.117 1.00 54.25 ? 542  THR A OG1 1 
ATOM   3865 C  CG2 . THR A  1  507 ? 2.033   36.362 -17.250 1.00 40.70 ? 542  THR A CG2 1 
ATOM   3866 N  N   . LEU A  1  508 ? 5.884   36.027 -19.966 1.00 41.95 ? 543  LEU A N   1 
ATOM   3867 C  CA  . LEU A  1  508 ? 7.042   36.549 -20.670 1.00 41.23 ? 543  LEU A CA  1 
ATOM   3868 C  C   . LEU A  1  508 ? 6.947   38.067 -20.777 1.00 42.08 ? 543  LEU A C   1 
ATOM   3869 O  O   . LEU A  1  508 ? 5.894   38.597 -21.130 1.00 43.04 ? 543  LEU A O   1 
ATOM   3870 C  CB  . LEU A  1  508 ? 7.070   35.918 -22.060 1.00 41.99 ? 543  LEU A CB  1 
ATOM   3871 C  CG  . LEU A  1  508 ? 8.376   35.567 -22.759 1.00 41.06 ? 543  LEU A CG  1 
ATOM   3872 C  CD1 . LEU A  1  508 ? 9.367   34.998 -21.790 1.00 37.88 ? 543  LEU A CD1 1 
ATOM   3873 C  CD2 . LEU A  1  508 ? 8.082   34.568 -23.854 1.00 44.26 ? 543  LEU A CD2 1 
ATOM   3874 N  N   . PRO A  1  509 ? 8.040   38.782 -20.464 1.00 40.69 ? 544  PRO A N   1 
ATOM   3875 C  CA  . PRO A  1  509 ? 7.993   40.237 -20.636 1.00 40.15 ? 544  PRO A CA  1 
ATOM   3876 C  C   . PRO A  1  509 ? 7.877   40.560 -22.117 1.00 44.06 ? 544  PRO A C   1 
ATOM   3877 O  O   . PRO A  1  509 ? 8.423   39.826 -22.941 1.00 41.34 ? 544  PRO A O   1 
ATOM   3878 C  CB  . PRO A  1  509 ? 9.351   40.699 -20.100 1.00 40.93 ? 544  PRO A CB  1 
ATOM   3879 C  CG  . PRO A  1  509 ? 10.226  39.515 -20.181 1.00 37.34 ? 544  PRO A CG  1 
ATOM   3880 C  CD  . PRO A  1  509 ? 9.351   38.325 -19.969 1.00 36.87 ? 544  PRO A CD  1 
ATOM   3881 N  N   . GLU A  1  510 ? 7.167   41.632 -22.454 1.00 43.79 ? 545  GLU A N   1 
ATOM   3882 C  CA  . GLU A  1  510 ? 6.991   42.003 -23.850 1.00 46.24 ? 545  GLU A CA  1 
ATOM   3883 C  C   . GLU A  1  510 ? 8.194   42.775 -24.373 1.00 40.85 ? 545  GLU A C   1 
ATOM   3884 O  O   . GLU A  1  510 ? 8.703   43.688 -23.717 1.00 42.29 ? 545  GLU A O   1 
ATOM   3885 C  CB  . GLU A  1  510 ? 5.694   42.799 -24.039 1.00 49.76 ? 545  GLU A CB  1 
ATOM   3886 C  CG  . GLU A  1  510 ? 4.453   41.920 -24.068 1.00 56.02 ? 545  GLU A CG  1 
ATOM   3887 C  CD  . GLU A  1  510 ? 3.184   42.677 -23.723 1.00 67.53 ? 545  GLU A CD  1 
ATOM   3888 O  OE1 . GLU A  1  510 ? 2.131   42.023 -23.546 1.00 69.73 ? 545  GLU A OE1 1 
ATOM   3889 O  OE2 . GLU A  1  510 ? 3.242   43.921 -23.621 1.00 68.45 ? 545  GLU A OE2 1 
ATOM   3890 N  N   . GLU A  1  511 ? 8.662   42.387 -25.551 1.00 38.20 ? 546  GLU A N   1 
ATOM   3891 C  CA  . GLU A  1  511 ? 9.749   43.095 -26.211 1.00 38.76 ? 546  GLU A CA  1 
ATOM   3892 C  C   . GLU A  1  511 ? 9.348   44.538 -26.471 1.00 40.36 ? 546  GLU A C   1 
ATOM   3893 O  O   . GLU A  1  511 ? 8.251   44.806 -26.946 1.00 41.97 ? 546  GLU A O   1 
ATOM   3894 C  CB  . GLU A  1  511 ? 10.099  42.398 -27.522 1.00 37.67 ? 546  GLU A CB  1 
ATOM   3895 C  CG  . GLU A  1  511 ? 11.345  42.904 -28.227 1.00 42.60 ? 546  GLU A CG  1 
ATOM   3896 C  CD  . GLU A  1  511 ? 11.807  41.943 -29.315 1.00 48.64 ? 546  GLU A CD  1 
ATOM   3897 O  OE1 . GLU A  1  511 ? 10.932  41.374 -30.008 1.00 53.48 ? 546  GLU A OE1 1 
ATOM   3898 O  OE2 . GLU A  1  511 ? 13.036  41.746 -29.474 1.00 47.99 ? 546  GLU A OE2 1 
ATOM   3899 N  N   . VAL A  1  512 ? 10.237  45.467 -26.147 1.00 35.05 ? 547  VAL A N   1 
ATOM   3900 C  CA  . VAL A  1  512 ? 9.971   46.879 -26.363 1.00 36.32 ? 547  VAL A CA  1 
ATOM   3901 C  C   . VAL A  1  512 ? 10.526  47.378 -27.696 1.00 41.83 ? 547  VAL A C   1 
ATOM   3902 O  O   . VAL A  1  512 ? 9.874   48.153 -28.397 1.00 42.31 ? 547  VAL A O   1 
ATOM   3903 C  CB  . VAL A  1  512 ? 10.580  47.716 -25.238 1.00 39.26 ? 547  VAL A CB  1 
ATOM   3904 C  CG1 . VAL A  1  512 ? 10.430  49.209 -25.536 1.00 34.13 ? 547  VAL A CG1 1 
ATOM   3905 C  CG2 . VAL A  1  512 ? 9.928   47.343 -23.916 1.00 36.12 ? 547  VAL A CG2 1 
ATOM   3906 N  N   . SER A  1  513 ? 11.733  46.944 -28.040 1.00 35.60 ? 548  SER A N   1 
ATOM   3907 C  CA  . SER A  1  513 ? 12.370  47.394 -29.269 1.00 40.11 ? 548  SER A CA  1 
ATOM   3908 C  C   . SER A  1  513 ? 12.616  46.225 -30.207 1.00 40.79 ? 548  SER A C   1 
ATOM   3909 O  O   . SER A  1  513 ? 13.262  45.248 -29.833 1.00 38.72 ? 548  SER A O   1 
ATOM   3910 C  CB  . SER A  1  513 ? 13.692  48.126 -28.984 1.00 39.34 ? 548  SER A CB  1 
ATOM   3911 O  OG  . SER A  1  513 ? 13.476  49.345 -28.283 1.00 34.73 ? 548  SER A OG  1 
ATOM   3912 N  N   . ARG A  1  514 ? 12.086  46.328 -31.426 1.00 42.81 ? 549  ARG A N   1 
ATOM   3913 C  CA  . ARG A  1  514 ? 12.347  45.333 -32.457 1.00 40.40 ? 549  ARG A CA  1 
ATOM   3914 C  C   . ARG A  1  514 ? 13.587  45.723 -33.266 1.00 41.13 ? 549  ARG A C   1 
ATOM   3915 O  O   . ARG A  1  514 ? 13.837  46.911 -33.512 1.00 43.13 ? 549  ARG A O   1 
ATOM   3916 C  CB  . ARG A  1  514 ? 11.119  45.168 -33.359 1.00 44.85 ? 549  ARG A CB  1 
ATOM   3917 N  N   . PRO A  1  515 ? 14.375  44.727 -33.688 1.00 35.51 ? 550  PRO A N   1 
ATOM   3918 C  CA  . PRO A  1  515 ? 15.616  45.011 -34.416 1.00 39.99 ? 550  PRO A CA  1 
ATOM   3919 C  C   . PRO A  1  515 ? 15.398  45.508 -35.843 1.00 45.85 ? 550  PRO A C   1 
ATOM   3920 O  O   . PRO A  1  515 ? 14.382  45.213 -36.481 1.00 43.17 ? 550  PRO A O   1 
ATOM   3921 C  CB  . PRO A  1  515 ? 16.308  43.654 -34.473 1.00 38.42 ? 550  PRO A CB  1 
ATOM   3922 C  CG  . PRO A  1  515 ? 15.220  42.659 -34.342 1.00 40.90 ? 550  PRO A CG  1 
ATOM   3923 C  CD  . PRO A  1  515 ? 14.161  43.285 -33.484 1.00 39.78 ? 550  PRO A CD  1 
ATOM   3924 N  N   . ASN A  1  516 ? 16.362  46.282 -36.320 1.00 44.91 ? 551  ASN A N   1 
ATOM   3925 C  CA  . ASN A  1  516 ? 16.516  46.533 -37.737 1.00 47.13 ? 551  ASN A CA  1 
ATOM   3926 C  C   . ASN A  1  516 ? 17.323  45.385 -38.305 1.00 47.61 ? 551  ASN A C   1 
ATOM   3927 O  O   . ASN A  1  516 ? 18.142  44.796 -37.604 1.00 45.81 ? 551  ASN A O   1 
ATOM   3928 C  CB  . ASN A  1  516 ? 17.280  47.826 -37.960 1.00 47.17 ? 551  ASN A CB  1 
ATOM   3929 C  CG  . ASN A  1  516 ? 16.550  49.023 -37.425 1.00 51.56 ? 551  ASN A CG  1 
ATOM   3930 O  OD1 . ASN A  1  516 ? 15.426  49.312 -37.843 1.00 49.90 ? 551  ASN A OD1 1 
ATOM   3931 N  ND2 . ASN A  1  516 ? 17.181  49.737 -36.497 1.00 48.23 ? 551  ASN A ND2 1 
ATOM   3932 N  N   . TYR A  1  517 ? 17.097  45.061 -39.571 1.00 48.03 ? 552  TYR A N   1 
ATOM   3933 C  CA  . TYR A  1  517 ? 17.893  44.041 -40.232 1.00 49.25 ? 552  TYR A CA  1 
ATOM   3934 C  C   . TYR A  1  517 ? 18.554  44.662 -41.453 1.00 54.93 ? 552  TYR A C   1 
ATOM   3935 O  O   . TYR A  1  517 ? 18.112  44.439 -42.578 1.00 54.39 ? 552  TYR A O   1 
ATOM   3936 C  CB  . TYR A  1  517 ? 17.014  42.871 -40.666 1.00 47.99 ? 552  TYR A CB  1 
ATOM   3937 C  CG  . TYR A  1  517 ? 16.362  42.112 -39.534 1.00 48.07 ? 552  TYR A CG  1 
ATOM   3938 C  CD1 . TYR A  1  517 ? 15.199  42.578 -38.934 1.00 42.47 ? 552  TYR A CD1 1 
ATOM   3939 C  CD2 . TYR A  1  517 ? 16.895  40.914 -39.084 1.00 46.02 ? 552  TYR A CD2 1 
ATOM   3940 C  CE1 . TYR A  1  517 ? 14.594  41.877 -37.910 1.00 45.35 ? 552  TYR A CE1 1 
ATOM   3941 C  CE2 . TYR A  1  517 ? 16.301  40.209 -38.065 1.00 44.97 ? 552  TYR A CE2 1 
ATOM   3942 C  CZ  . TYR A  1  517 ? 15.151  40.691 -37.479 1.00 43.38 ? 552  TYR A CZ  1 
ATOM   3943 O  OH  . TYR A  1  517 ? 14.558  39.986 -36.457 1.00 46.10 ? 552  TYR A OH  1 
ATOM   3944 N  N   . PRO A  1  518 ? 19.615  45.452 -41.234 1.00 55.51 ? 553  PRO A N   1 
ATOM   3945 C  CA  . PRO A  1  518 ? 20.248  46.208 -42.318 1.00 52.50 ? 553  PRO A CA  1 
ATOM   3946 C  C   . PRO A  1  518 ? 21.078  45.329 -43.246 1.00 57.83 ? 553  PRO A C   1 
ATOM   3947 O  O   . PRO A  1  518 ? 21.862  44.500 -42.775 1.00 55.91 ? 553  PRO A O   1 
ATOM   3948 C  CB  . PRO A  1  518 ? 21.167  47.174 -41.570 1.00 51.23 ? 553  PRO A CB  1 
ATOM   3949 C  CG  . PRO A  1  518 ? 21.535  46.439 -40.334 1.00 51.48 ? 553  PRO A CG  1 
ATOM   3950 C  CD  . PRO A  1  518 ? 20.302  45.654 -39.944 1.00 50.50 ? 553  PRO A CD  1 
ATOM   3951 N  N   . GLY A  1  519 ? 20.902  45.512 -44.554 1.00 59.18 ? 554  GLY A N   1 
ATOM   3952 C  CA  . GLY A  1  519 ? 21.775  44.896 -45.539 1.00 56.12 ? 554  GLY A CA  1 
ATOM   3953 C  C   . GLY A  1  519 ? 22.854  45.889 -45.919 1.00 56.66 ? 554  GLY A C   1 
ATOM   3954 O  O   . GLY A  1  519 ? 23.011  46.914 -45.249 1.00 55.95 ? 554  GLY A O   1 
ATOM   3955 N  N   . ILE A  1  520 ? 23.598  45.600 -46.984 1.00 57.24 ? 555  ILE A N   1 
ATOM   3956 C  CA  . ILE A  1  520 ? 24.629  46.523 -47.447 1.00 54.80 ? 555  ILE A CA  1 
ATOM   3957 C  C   . ILE A  1  520 ? 24.022  47.838 -47.911 1.00 55.26 ? 555  ILE A C   1 
ATOM   3958 O  O   . ILE A  1  520 ? 22.998  47.851 -48.587 1.00 60.58 ? 555  ILE A O   1 
ATOM   3959 C  CB  . ILE A  1  520 ? 25.463  45.937 -48.591 1.00 55.87 ? 555  ILE A CB  1 
ATOM   3960 C  CG1 . ILE A  1  520 ? 26.242  44.710 -48.115 1.00 52.35 ? 555  ILE A CG1 1 
ATOM   3961 C  CG2 . ILE A  1  520 ? 26.420  46.986 -49.125 1.00 59.22 ? 555  ILE A CG2 1 
ATOM   3962 C  CD1 . ILE A  1  520 ? 27.438  44.403 -48.979 1.00 53.86 ? 555  ILE A CD1 1 
ATOM   3963 N  N   . MET A  1  521 ? 24.661  48.943 -47.545 1.00 53.56 ? 556  MET A N   1 
ATOM   3964 C  CA  . MET A  1  521 ? 24.161  50.263 -47.898 1.00 56.65 ? 556  MET A CA  1 
ATOM   3965 C  C   . MET A  1  521 ? 25.302  51.268 -47.941 1.00 57.42 ? 556  MET A C   1 
ATOM   3966 O  O   . MET A  1  521 ? 25.077  52.473 -48.091 1.00 59.67 ? 556  MET A O   1 
ATOM   3967 C  CB  . MET A  1  521 ? 23.086  50.720 -46.908 1.00 55.77 ? 556  MET A CB  1 
ATOM   3968 N  N   . TYR A  1  522 ? 26.527  50.766 -47.810 1.00 54.79 ? 557  TYR A N   1 
ATOM   3969 C  CA  . TYR A  1  522 ? 27.716  51.614 -47.847 1.00 54.06 ? 557  TYR A CA  1 
ATOM   3970 C  C   . TYR A  1  522 ? 28.866  50.895 -48.544 1.00 53.02 ? 557  TYR A C   1 
ATOM   3971 O  O   . TYR A  1  522 ? 28.818  49.683 -48.745 1.00 56.27 ? 557  TYR A O   1 
ATOM   3972 C  CB  . TYR A  1  522 ? 28.110  52.047 -46.430 1.00 54.65 ? 557  TYR A CB  1 
ATOM   3973 C  CG  . TYR A  1  522 ? 26.985  52.760 -45.710 1.00 51.96 ? 557  TYR A CG  1 
ATOM   3974 C  CD1 . TYR A  1  522 ? 26.027  52.050 -44.992 1.00 51.96 ? 557  TYR A CD1 1 
ATOM   3975 C  CD2 . TYR A  1  522 ? 26.869  54.139 -45.766 1.00 53.05 ? 557  TYR A CD2 1 
ATOM   3976 C  CE1 . TYR A  1  522 ? 24.991  52.698 -44.345 1.00 48.97 ? 557  TYR A CE1 1 
ATOM   3977 C  CE2 . TYR A  1  522 ? 25.836  54.797 -45.123 1.00 52.52 ? 557  TYR A CE2 1 
ATOM   3978 C  CZ  . TYR A  1  522 ? 24.901  54.072 -44.414 1.00 51.13 ? 557  TYR A CZ  1 
ATOM   3979 O  OH  . TYR A  1  522 ? 23.872  54.733 -43.781 1.00 49.87 ? 557  TYR A OH  1 
ATOM   3980 N  N   . LEU A  1  523 ? 29.883  51.652 -48.936 1.00 54.64 ? 558  LEU A N   1 
ATOM   3981 C  CA  . LEU A  1  523 ? 31.083  51.082 -49.537 1.00 54.59 ? 558  LEU A CA  1 
ATOM   3982 C  C   . LEU A  1  523 ? 32.270  51.483 -48.679 1.00 53.42 ? 558  LEU A C   1 
ATOM   3983 O  O   . LEU A  1  523 ? 32.247  52.538 -48.044 1.00 54.90 ? 558  LEU A O   1 
ATOM   3984 C  CB  . LEU A  1  523 ? 31.288  51.613 -50.962 1.00 52.77 ? 558  LEU A CB  1 
ATOM   3985 C  CG  . LEU A  1  523 ? 30.106  51.582 -51.937 1.00 49.56 ? 558  LEU A CG  1 
ATOM   3986 C  CD1 . LEU A  1  523 ? 30.448  52.351 -53.200 1.00 52.02 ? 558  LEU A CD1 1 
ATOM   3987 C  CD2 . LEU A  1  523 ? 29.681  50.151 -52.274 1.00 50.22 ? 558  LEU A CD2 1 
ATOM   3988 N  N   . GLN A  1  524 ? 33.310  50.655 -48.672 1.00 57.30 ? 559  GLN A N   1 
ATOM   3989 C  CA  . GLN A  1  524 ? 34.505  50.950 -47.897 1.00 53.37 ? 559  GLN A CA  1 
ATOM   3990 C  C   . GLN A  1  524 ? 34.866  52.424 -48.023 1.00 55.62 ? 559  GLN A C   1 
ATOM   3991 O  O   . GLN A  1  524 ? 35.272  53.068 -47.056 1.00 52.92 ? 559  GLN A O   1 
ATOM   3992 C  CB  . GLN A  1  524 ? 35.667  50.075 -48.366 1.00 58.14 ? 559  GLN A CB  1 
ATOM   3993 N  N   . SER A  1  525 ? 34.689  52.957 -49.226 1.00 55.57 ? 560  SER A N   1 
ATOM   3994 C  CA  . SER A  1  525 ? 35.017  54.345 -49.523 1.00 55.89 ? 560  SER A CA  1 
ATOM   3995 C  C   . SER A  1  525 ? 34.215  55.341 -48.687 1.00 55.78 ? 560  SER A C   1 
ATOM   3996 O  O   . SER A  1  525 ? 34.603  56.499 -48.551 1.00 58.16 ? 560  SER A O   1 
ATOM   3997 C  CB  . SER A  1  525 ? 34.810  54.616 -51.018 1.00 54.14 ? 560  SER A CB  1 
ATOM   3998 O  OG  . SER A  1  525 ? 33.637  53.970 -51.493 1.00 53.92 ? 560  SER A OG  1 
ATOM   3999 N  N   . ASP A  1  526 ? 33.100  54.885 -48.127 1.00 56.59 ? 561  ASP A N   1 
ATOM   4000 C  CA  . ASP A  1  526 ? 32.224  55.738 -47.327 1.00 54.72 ? 561  ASP A CA  1 
ATOM   4001 C  C   . ASP A  1  526 ? 32.782  55.991 -45.920 1.00 58.93 ? 561  ASP A C   1 
ATOM   4002 O  O   . ASP A  1  526 ? 32.358  56.923 -45.232 1.00 57.25 ? 561  ASP A O   1 
ATOM   4003 C  CB  . ASP A  1  526 ? 30.835  55.103 -47.218 1.00 57.01 ? 561  ASP A CB  1 
ATOM   4004 C  CG  . ASP A  1  526 ? 30.100  55.064 -48.549 1.00 56.89 ? 561  ASP A CG  1 
ATOM   4005 O  OD1 . ASP A  1  526 ? 30.220  56.042 -49.313 1.00 57.82 ? 561  ASP A OD1 1 
ATOM   4006 O  OD2 . ASP A  1  526 ? 29.399  54.064 -48.823 1.00 52.61 ? 561  ASP A OD2 1 
ATOM   4007 N  N   . PHE A  1  527 ? 33.746  55.173 -45.506 1.00 56.28 ? 562  PHE A N   1 
ATOM   4008 C  CA  . PHE A  1  527 ? 34.228  55.197 -44.127 1.00 56.85 ? 562  PHE A CA  1 
ATOM   4009 C  C   . PHE A  1  527 ? 35.556  55.925 -43.927 1.00 57.25 ? 562  PHE A C   1 
ATOM   4010 O  O   . PHE A  1  527 ? 36.543  55.642 -44.601 1.00 59.52 ? 562  PHE A O   1 
ATOM   4011 C  CB  . PHE A  1  527 ? 34.354  53.769 -43.590 1.00 54.22 ? 562  PHE A CB  1 
ATOM   4012 C  CG  . PHE A  1  527 ? 33.043  53.069 -43.417 1.00 55.92 ? 562  PHE A CG  1 
ATOM   4013 C  CD1 . PHE A  1  527 ? 32.548  52.238 -44.408 1.00 54.44 ? 562  PHE A CD1 1 
ATOM   4014 C  CD2 . PHE A  1  527 ? 32.301  53.240 -42.259 1.00 53.16 ? 562  PHE A CD2 1 
ATOM   4015 C  CE1 . PHE A  1  527 ? 31.335  51.591 -44.246 1.00 56.28 ? 562  PHE A CE1 1 
ATOM   4016 C  CE2 . PHE A  1  527 ? 31.087  52.600 -42.093 1.00 51.63 ? 562  PHE A CE2 1 
ATOM   4017 C  CZ  . PHE A  1  527 ? 30.601  51.775 -43.087 1.00 52.20 ? 562  PHE A CZ  1 
ATOM   4018 N  N   . ASP A  1  528 ? 35.577  56.851 -42.976 1.00 58.53 ? 563  ASP A N   1 
ATOM   4019 C  CA  . ASP A  1  528 ? 36.815  57.502 -42.565 1.00 59.21 ? 563  ASP A CA  1 
ATOM   4020 C  C   . ASP A  1  528 ? 37.015  57.322 -41.056 1.00 58.21 ? 563  ASP A C   1 
ATOM   4021 O  O   . ASP A  1  528 ? 36.887  58.275 -40.287 1.00 56.20 ? 563  ASP A O   1 
ATOM   4022 C  CB  . ASP A  1  528 ? 36.784  58.991 -42.923 1.00 61.46 ? 563  ASP A CB  1 
ATOM   4023 C  CG  . ASP A  1  528 ? 38.159  59.640 -42.848 1.00 67.62 ? 563  ASP A CG  1 
ATOM   4024 O  OD1 . ASP A  1  528 ? 39.171  58.902 -42.867 1.00 66.30 ? 563  ASP A OD1 1 
ATOM   4025 O  OD2 . ASP A  1  528 ? 38.227  60.888 -42.778 1.00 69.12 ? 563  ASP A OD2 1 
ATOM   4026 N  N   . LEU A  1  529 ? 37.336  56.097 -40.646 1.00 55.17 ? 564  LEU A N   1 
ATOM   4027 C  CA  . LEU A  1  529 ? 37.405  55.749 -39.225 1.00 54.38 ? 564  LEU A CA  1 
ATOM   4028 C  C   . LEU A  1  529 ? 38.825  55.704 -38.656 1.00 52.13 ? 564  LEU A C   1 
ATOM   4029 O  O   . LEU A  1  529 ? 39.019  55.665 -37.441 1.00 51.57 ? 564  LEU A O   1 
ATOM   4030 C  CB  . LEU A  1  529 ? 36.718  54.404 -38.990 1.00 55.31 ? 564  LEU A CB  1 
ATOM   4031 C  CG  . LEU A  1  529 ? 35.325  54.268 -39.601 1.00 54.14 ? 564  LEU A CG  1 
ATOM   4032 C  CD1 . LEU A  1  529 ? 34.854  52.825 -39.533 1.00 51.37 ? 564  LEU A CD1 1 
ATOM   4033 C  CD2 . LEU A  1  529 ? 34.330  55.209 -38.926 1.00 53.78 ? 564  LEU A CD2 1 
ATOM   4034 N  N   . GLY A  1  530 ? 39.822  55.705 -39.527 1.00 49.76 ? 565  GLY A N   1 
ATOM   4035 C  CA  . GLY A  1  530 ? 41.192  55.657 -39.065 1.00 49.42 ? 565  GLY A CA  1 
ATOM   4036 C  C   . GLY A  1  530 ? 41.642  54.225 -38.866 1.00 52.10 ? 565  GLY A C   1 
ATOM   4037 O  O   . GLY A  1  530 ? 42.716  53.964 -38.322 1.00 46.01 ? 565  GLY A O   1 
ATOM   4038 N  N   . CYS A  1  531 ? 40.821  53.289 -39.322 1.00 49.36 ? 566  CYS A N   1 
ATOM   4039 C  CA  . CYS A  1  531 ? 41.174  51.885 -39.219 1.00 52.99 ? 566  CYS A CA  1 
ATOM   4040 C  C   . CYS A  1  531 ? 42.058  51.461 -40.387 1.00 55.44 ? 566  CYS A C   1 
ATOM   4041 O  O   . CYS A  1  531 ? 42.135  52.151 -41.405 1.00 56.48 ? 566  CYS A O   1 
ATOM   4042 C  CB  . CYS A  1  531 ? 39.914  51.018 -39.152 1.00 53.70 ? 566  CYS A CB  1 
ATOM   4043 S  SG  . CYS A  1  531 ? 38.790  51.460 -37.789 1.00 54.94 ? 566  CYS A SG  1 
ATOM   4044 N  N   . THR A  1  532 ? 42.744  50.338 -40.220 1.00 52.59 ? 567  THR A N   1 
ATOM   4045 C  CA  . THR A  1  532 ? 43.493  49.733 -41.309 1.00 56.48 ? 567  THR A CA  1 
ATOM   4046 C  C   . THR A  1  532 ? 43.485  48.222 -41.159 1.00 57.89 ? 567  THR A C   1 
ATOM   4047 O  O   . THR A  1  532 ? 43.407  47.685 -40.047 1.00 54.80 ? 567  THR A O   1 
ATOM   4048 C  CB  . THR A  1  532 ? 44.962  50.210 -41.362 1.00 56.61 ? 567  THR A CB  1 
ATOM   4049 O  OG1 . THR A  1  532 ? 45.681  49.685 -40.239 1.00 57.63 ? 567  THR A OG1 1 
ATOM   4050 C  CG2 . THR A  1  532 ? 45.049  51.733 -41.368 1.00 55.03 ? 567  THR A CG2 1 
ATOM   4051 N  N   . CYS A  1  533 ? 43.564  47.541 -42.292 1.00 58.97 ? 568  CYS A N   1 
ATOM   4052 C  CA  . CYS A  1  533 ? 43.671  46.097 -42.305 1.00 57.33 ? 568  CYS A CA  1 
ATOM   4053 C  C   . CYS A  1  533 ? 44.466  45.691 -43.539 1.00 61.99 ? 568  CYS A C   1 
ATOM   4054 O  O   . CYS A  1  533 ? 44.234  46.206 -44.634 1.00 62.37 ? 568  CYS A O   1 
ATOM   4055 C  CB  . CYS A  1  533 ? 42.282  45.460 -42.318 1.00 49.99 ? 568  CYS A CB  1 
ATOM   4056 S  SG  . CYS A  1  533 ? 42.275  43.693 -41.968 1.00 57.77 ? 568  CYS A SG  1 
ATOM   4057 N  N   . ASP A  1  534 ? 45.414  44.778 -43.356 1.00 61.45 ? 569  ASP A N   1 
ATOM   4058 C  CA  . ASP A  1  534 ? 46.213  44.282 -44.467 1.00 60.34 ? 569  ASP A CA  1 
ATOM   4059 C  C   . ASP A  1  534 ? 45.602  43.011 -45.056 1.00 63.89 ? 569  ASP A C   1 
ATOM   4060 O  O   . ASP A  1  534 ? 45.769  41.916 -44.511 1.00 62.46 ? 569  ASP A O   1 
ATOM   4061 C  CB  . ASP A  1  534 ? 47.645  44.024 -44.007 1.00 62.96 ? 569  ASP A CB  1 
ATOM   4062 C  CG  . ASP A  1  534 ? 48.235  45.205 -43.258 1.00 68.32 ? 569  ASP A CG  1 
ATOM   4063 O  OD1 . ASP A  1  534 ? 47.584  46.276 -43.222 1.00 66.02 ? 569  ASP A OD1 1 
ATOM   4064 O  OD2 . ASP A  1  534 ? 49.348  45.058 -42.705 1.00 67.39 ? 569  ASP A OD2 1 
ATOM   4065 N  N   . GLY A  1  550 ? 20.474  31.878 -40.621 1.00 63.59 ? 585  GLY A N   1 
ATOM   4066 C  CA  . GLY A  1  550 ? 20.112  30.725 -41.426 1.00 63.50 ? 585  GLY A CA  1 
ATOM   4067 C  C   . GLY A  1  550 ? 21.175  30.352 -42.443 1.00 64.72 ? 585  GLY A C   1 
ATOM   4068 O  O   . GLY A  1  550 ? 21.256  30.952 -43.516 1.00 65.35 ? 585  GLY A O   1 
ATOM   4069 N  N   . SER A  1  551 ? 21.988  29.353 -42.112 1.00 68.07 ? 586  SER A N   1 
ATOM   4070 C  CA  . SER A  1  551 ? 21.862  28.630 -40.851 1.00 65.47 ? 586  SER A CA  1 
ATOM   4071 C  C   . SER A  1  551 ? 22.681  29.289 -39.742 1.00 65.30 ? 586  SER A C   1 
ATOM   4072 O  O   . SER A  1  551 ? 23.636  28.705 -39.220 1.00 65.14 ? 586  SER A O   1 
ATOM   4073 C  CB  . SER A  1  551 ? 22.291  27.174 -41.028 1.00 66.11 ? 586  SER A CB  1 
ATOM   4074 O  OG  . SER A  1  551 ? 23.628  27.102 -41.489 1.00 70.86 ? 586  SER A OG  1 
ATOM   4075 N  N   . THR A  1  552 ? 22.302  30.513 -39.392 1.00 63.50 ? 587  THR A N   1 
ATOM   4076 C  CA  . THR A  1  552 ? 22.934  31.228 -38.293 1.00 62.80 ? 587  THR A CA  1 
ATOM   4077 C  C   . THR A  1  552 ? 21.945  31.392 -37.143 1.00 55.80 ? 587  THR A C   1 
ATOM   4078 O  O   . THR A  1  552 ? 22.094  30.750 -36.105 1.00 60.37 ? 587  THR A O   1 
ATOM   4079 C  CB  . THR A  1  552 ? 23.489  32.600 -38.747 1.00 62.90 ? 587  THR A CB  1 
ATOM   4080 O  OG1 . THR A  1  552 ? 24.400  32.401 -39.835 1.00 58.93 ? 587  THR A OG1 1 
ATOM   4081 C  CG2 . THR A  1  552 ? 24.224  33.313 -37.599 1.00 53.24 ? 587  THR A CG2 1 
ATOM   4082 N  N   . GLU A  1  553 ? 20.924  32.224 -37.327 1.00 55.86 ? 588  GLU A N   1 
ATOM   4083 C  CA  . GLU A  1  553 ? 20.008  32.505 -36.223 1.00 54.89 ? 588  GLU A CA  1 
ATOM   4084 C  C   . GLU A  1  553 ? 19.579  31.213 -35.534 1.00 53.58 ? 588  GLU A C   1 
ATOM   4085 O  O   . GLU A  1  553 ? 19.498  31.149 -34.308 1.00 52.81 ? 588  GLU A O   1 
ATOM   4086 C  CB  . GLU A  1  553 ? 18.794  33.327 -36.668 1.00 52.05 ? 588  GLU A CB  1 
ATOM   4087 C  CG  . GLU A  1  553 ? 17.725  33.466 -35.584 1.00 48.44 ? 588  GLU A CG  1 
ATOM   4088 C  CD  . GLU A  1  553 ? 17.324  34.914 -35.320 1.00 53.03 ? 588  GLU A CD  1 
ATOM   4089 O  OE1 . GLU A  1  553 ? 18.120  35.825 -35.629 1.00 50.41 ? 588  GLU A OE1 1 
ATOM   4090 O  OE2 . GLU A  1  553 ? 16.210  35.144 -34.796 1.00 53.79 ? 588  GLU A OE2 1 
ATOM   4091 N  N   . GLU A  1  554 ? 19.340  30.173 -36.324 1.00 56.11 ? 589  GLU A N   1 
ATOM   4092 C  CA  . GLU A  1  554 ? 18.953  28.882 -35.769 1.00 54.61 ? 589  GLU A CA  1 
ATOM   4093 C  C   . GLU A  1  554 ? 20.112  28.185 -35.049 1.00 53.54 ? 589  GLU A C   1 
ATOM   4094 O  O   . GLU A  1  554 ? 19.882  27.451 -34.083 1.00 50.22 ? 589  GLU A O   1 
ATOM   4095 C  CB  . GLU A  1  554 ? 18.353  27.974 -36.854 1.00 54.97 ? 589  GLU A CB  1 
ATOM   4096 N  N   . ARG A  1  555 ? 21.346  28.428 -35.497 1.00 54.18 ? 590  ARG A N   1 
ATOM   4097 C  CA  . ARG A  1  555 ? 22.512  27.729 -34.933 1.00 51.76 ? 590  ARG A CA  1 
ATOM   4098 C  C   . ARG A  1  555 ? 23.378  28.525 -33.944 1.00 52.58 ? 590  ARG A C   1 
ATOM   4099 O  O   . ARG A  1  555 ? 24.171  27.948 -33.195 1.00 49.22 ? 590  ARG A O   1 
ATOM   4100 C  CB  . ARG A  1  555 ? 23.431  27.204 -36.026 1.00 54.20 ? 590  ARG A CB  1 
ATOM   4101 C  CG  . ARG A  1  555 ? 24.385  26.137 -35.505 1.00 57.38 ? 590  ARG A CG  1 
ATOM   4102 C  CD  . ARG A  1  555 ? 25.855  26.503 -35.647 1.00 54.75 ? 590  ARG A CD  1 
ATOM   4103 N  NE  . ARG A  1  555 ? 26.681  25.561 -34.888 1.00 56.01 ? 590  ARG A NE  1 
ATOM   4104 C  CZ  . ARG A  1  555 ? 28.010  25.584 -34.833 1.00 55.82 ? 590  ARG A CZ  1 
ATOM   4105 N  NH1 . ARG A  1  555 ? 28.696  26.506 -35.496 1.00 60.27 ? 590  ARG A NH1 1 
ATOM   4106 N  NH2 . ARG A  1  555 ? 28.655  24.679 -34.110 1.00 54.40 ? 590  ARG A NH2 1 
ATOM   4107 N  N   . HIS A  1  556 ? 23.282  29.843 -33.964 1.00 50.81 ? 591  HIS A N   1 
ATOM   4108 C  CA  . HIS A  1  556 ? 24.079  30.605 -33.020 1.00 47.65 ? 591  HIS A CA  1 
ATOM   4109 C  C   . HIS A  1  556 ? 23.219  31.269 -31.950 1.00 43.57 ? 591  HIS A C   1 
ATOM   4110 O  O   . HIS A  1  556 ? 23.748  31.769 -30.965 1.00 42.85 ? 591  HIS A O   1 
ATOM   4111 C  CB  . HIS A  1  556 ? 25.022  31.584 -33.731 1.00 46.92 ? 591  HIS A CB  1 
ATOM   4112 C  CG  . HIS A  1  556 ? 26.193  30.919 -34.395 1.00 47.56 ? 591  HIS A CG  1 
ATOM   4113 N  ND1 . HIS A  1  556 ? 27.167  30.244 -33.689 1.00 45.77 ? 591  HIS A ND1 1 
ATOM   4114 C  CD2 . HIS A  1  556 ? 26.551  30.833 -35.700 1.00 50.31 ? 591  HIS A CD2 1 
ATOM   4115 C  CE1 . HIS A  1  556 ? 28.070  29.766 -34.527 1.00 47.92 ? 591  HIS A CE1 1 
ATOM   4116 N  NE2 . HIS A  1  556 ? 27.719  30.108 -35.755 1.00 48.79 ? 591  HIS A NE2 1 
ATOM   4117 N  N   . LEU A  1  557 ? 21.900  31.251 -32.146 1.00 44.76 ? 592  LEU A N   1 
ATOM   4118 C  CA  . LEU A  1  557 ? 20.930  31.608 -31.105 1.00 39.03 ? 592  LEU A CA  1 
ATOM   4119 C  C   . LEU A  1  557 ? 20.097  30.391 -30.753 1.00 39.22 ? 592  LEU A C   1 
ATOM   4120 O  O   . LEU A  1  557 ? 18.928  30.308 -31.125 1.00 39.74 ? 592  LEU A O   1 
ATOM   4121 C  CB  . LEU A  1  557 ? 19.988  32.733 -31.555 1.00 36.43 ? 592  LEU A CB  1 
ATOM   4122 C  CG  . LEU A  1  557 ? 20.449  34.190 -31.533 1.00 39.05 ? 592  LEU A CG  1 
ATOM   4123 C  CD1 . LEU A  1  557 ? 20.691  34.679 -30.116 1.00 36.11 ? 592  LEU A CD1 1 
ATOM   4124 C  CD2 . LEU A  1  557 ? 21.699  34.363 -32.366 1.00 42.21 ? 592  LEU A CD2 1 
ATOM   4125 N  N   . LEU A  1  558 ? 20.686  29.450 -30.023 1.00 37.07 ? 593  LEU A N   1 
ATOM   4126 C  CA  . LEU A  1  558 ? 19.988  28.207 -29.709 1.00 35.43 ? 593  LEU A CA  1 
ATOM   4127 C  C   . LEU A  1  558 ? 18.715  28.425 -28.898 1.00 35.92 ? 593  LEU A C   1 
ATOM   4128 O  O   . LEU A  1  558 ? 17.814  27.584 -28.918 1.00 37.99 ? 593  LEU A O   1 
ATOM   4129 C  CB  . LEU A  1  558 ? 20.908  27.239 -28.973 1.00 35.16 ? 593  LEU A CB  1 
ATOM   4130 C  CG  . LEU A  1  558 ? 22.227  26.914 -29.668 1.00 38.50 ? 593  LEU A CG  1 
ATOM   4131 C  CD1 . LEU A  1  558 ? 23.027  25.931 -28.841 1.00 36.11 ? 593  LEU A CD1 1 
ATOM   4132 C  CD2 . LEU A  1  558 ? 21.959  26.371 -31.076 1.00 39.47 ? 593  LEU A CD2 1 
ATOM   4133 N  N   . TYR A  1  559 ? 18.620  29.550 -28.195 1.00 33.43 ? 594  TYR A N   1 
ATOM   4134 C  CA  . TYR A  1  559 ? 17.470  29.767 -27.316 1.00 32.43 ? 594  TYR A CA  1 
ATOM   4135 C  C   . TYR A  1  559 ? 16.659  30.999 -27.697 1.00 32.62 ? 594  TYR A C   1 
ATOM   4136 O  O   . TYR A  1  559 ? 15.921  31.543 -26.883 1.00 33.08 ? 594  TYR A O   1 
ATOM   4137 C  CB  . TYR A  1  559 ? 17.944  29.835 -25.850 1.00 31.71 ? 594  TYR A CB  1 
ATOM   4138 C  CG  . TYR A  1  559 ? 19.150  28.949 -25.627 1.00 26.37 ? 594  TYR A CG  1 
ATOM   4139 C  CD1 . TYR A  1  559 ? 19.009  27.578 -25.507 1.00 30.17 ? 594  TYR A CD1 1 
ATOM   4140 C  CD2 . TYR A  1  559 ? 20.431  29.488 -25.557 1.00 30.95 ? 594  TYR A CD2 1 
ATOM   4141 C  CE1 . TYR A  1  559 ? 20.093  26.766 -25.320 1.00 27.89 ? 594  TYR A CE1 1 
ATOM   4142 C  CE2 . TYR A  1  559 ? 21.534  28.681 -25.377 1.00 30.48 ? 594  TYR A CE2 1 
ATOM   4143 C  CZ  . TYR A  1  559 ? 21.357  27.318 -25.267 1.00 32.42 ? 594  TYR A CZ  1 
ATOM   4144 O  OH  . TYR A  1  559 ? 22.436  26.487 -25.088 1.00 29.90 ? 594  TYR A OH  1 
ATOM   4145 N  N   . GLY A  1  560 ? 16.781  31.426 -28.950 1.00 35.29 ? 595  GLY A N   1 
ATOM   4146 C  CA  . GLY A  1  560 ? 16.035  32.574 -29.427 1.00 36.95 ? 595  GLY A CA  1 
ATOM   4147 C  C   . GLY A  1  560 ? 16.819  33.846 -29.203 1.00 36.32 ? 595  GLY A C   1 
ATOM   4148 O  O   . GLY A  1  560 ? 17.742  33.884 -28.383 1.00 34.43 ? 595  GLY A O   1 
ATOM   4149 N  N   . ARG A  1  561 ? 16.477  34.899 -29.932 1.00 36.96 ? 596  ARG A N   1 
ATOM   4150 C  CA  . ARG A  1  561 ? 17.180  36.149 -29.728 1.00 38.48 ? 596  ARG A CA  1 
ATOM   4151 C  C   . ARG A  1  561 ? 16.688  36.781 -28.433 1.00 36.85 ? 596  ARG A C   1 
ATOM   4152 O  O   . ARG A  1  561 ? 15.498  36.690 -28.105 1.00 34.03 ? 596  ARG A O   1 
ATOM   4153 C  CB  . ARG A  1  561 ? 16.968  37.105 -30.896 1.00 43.06 ? 596  ARG A CB  1 
ATOM   4154 C  CG  . ARG A  1  561 ? 15.634  37.787 -30.873 1.00 43.86 ? 596  ARG A CG  1 
ATOM   4155 C  CD  . ARG A  1  561 ? 15.659  39.050 -31.710 1.00 49.34 ? 596  ARG A CD  1 
ATOM   4156 N  NE  . ARG A  1  561 ? 14.407  39.786 -31.577 1.00 48.96 ? 596  ARG A NE  1 
ATOM   4157 C  CZ  . ARG A  1  561 ? 13.315  39.524 -32.285 1.00 56.16 ? 596  ARG A CZ  1 
ATOM   4158 N  NH1 . ARG A  1  561 ? 13.318  38.539 -33.180 1.00 58.45 ? 596  ARG A NH1 1 
ATOM   4159 N  NH2 . ARG A  1  561 ? 12.215  40.244 -32.097 1.00 54.78 ? 596  ARG A NH2 1 
ATOM   4160 N  N   . PRO A  1  562 ? 17.604  37.414 -27.687 1.00 34.52 ? 597  PRO A N   1 
ATOM   4161 C  CA  . PRO A  1  562 ? 17.199  38.130 -26.474 1.00 33.95 ? 597  PRO A CA  1 
ATOM   4162 C  C   . PRO A  1  562 ? 16.197  39.204 -26.853 1.00 35.92 ? 597  PRO A C   1 
ATOM   4163 O  O   . PRO A  1  562 ? 16.291  39.749 -27.954 1.00 39.84 ? 597  PRO A O   1 
ATOM   4164 C  CB  . PRO A  1  562 ? 18.500  38.800 -26.001 1.00 32.74 ? 597  PRO A CB  1 
ATOM   4165 C  CG  . PRO A  1  562 ? 19.604  38.088 -26.707 1.00 36.43 ? 597  PRO A CG  1 
ATOM   4166 C  CD  . PRO A  1  562 ? 19.026  37.614 -28.010 1.00 35.74 ? 597  PRO A CD  1 
ATOM   4167 N  N   . ALA A  1  563 ? 15.249  39.503 -25.975 1.00 32.54 ? 598  ALA A N   1 
ATOM   4168 C  CA  . ALA A  1  563 ? 14.338  40.606 -26.227 1.00 34.33 ? 598  ALA A CA  1 
ATOM   4169 C  C   . ALA A  1  563 ? 14.864  41.855 -25.539 1.00 34.42 ? 598  ALA A C   1 
ATOM   4170 O  O   . ALA A  1  563 ? 15.297  41.799 -24.382 1.00 34.86 ? 598  ALA A O   1 
ATOM   4171 C  CB  . ALA A  1  563 ? 12.955  40.270 -25.749 1.00 32.19 ? 598  ALA A CB  1 
ATOM   4172 N  N   . VAL A  1  564 ? 14.859  42.971 -26.262 1.00 33.72 ? 599  VAL A N   1 
ATOM   4173 C  CA  . VAL A  1  564 ? 15.283  44.255 -25.701 1.00 32.92 ? 599  VAL A CA  1 
ATOM   4174 C  C   . VAL A  1  564 ? 14.087  44.870 -24.998 1.00 36.54 ? 599  VAL A C   1 
ATOM   4175 O  O   . VAL A  1  564 ? 13.059  45.114 -25.622 1.00 35.68 ? 599  VAL A O   1 
ATOM   4176 C  CB  . VAL A  1  564 ? 15.797  45.202 -26.800 1.00 34.50 ? 599  VAL A CB  1 
ATOM   4177 C  CG1 . VAL A  1  564 ? 15.983  46.626 -26.266 1.00 35.30 ? 599  VAL A CG1 1 
ATOM   4178 C  CG2 . VAL A  1  564 ? 17.087  44.676 -27.377 1.00 34.05 ? 599  VAL A CG2 1 
ATOM   4179 N  N   . LEU A  1  565 ? 14.209  45.120 -23.695 1.00 33.63 ? 600  LEU A N   1 
ATOM   4180 C  CA  . LEU A  1  565 ? 13.057  45.553 -22.913 1.00 31.04 ? 600  LEU A CA  1 
ATOM   4181 C  C   . LEU A  1  565 ? 13.035  47.047 -22.631 1.00 31.05 ? 600  LEU A C   1 
ATOM   4182 O  O   . LEU A  1  565 ? 12.358  47.499 -21.720 1.00 34.86 ? 600  LEU A O   1 
ATOM   4183 C  CB  . LEU A  1  565 ? 12.971  44.766 -21.611 1.00 30.71 ? 600  LEU A CB  1 
ATOM   4184 C  CG  . LEU A  1  565 ? 12.874  43.253 -21.783 1.00 32.33 ? 600  LEU A CG  1 
ATOM   4185 C  CD1 . LEU A  1  565 ? 12.822  42.594 -20.410 1.00 37.86 ? 600  LEU A CD1 1 
ATOM   4186 C  CD2 . LEU A  1  565 ? 11.660  42.866 -22.594 1.00 37.27 ? 600  LEU A CD2 1 
ATOM   4187 N  N   . TYR A  1  566 ? 13.778  47.808 -23.421 1.00 31.13 ? 601  TYR A N   1 
ATOM   4188 C  CA  . TYR A  1  566 ? 13.762  49.264 -23.307 1.00 33.58 ? 601  TYR A CA  1 
ATOM   4189 C  C   . TYR A  1  566 ? 13.739  49.863 -24.702 1.00 35.83 ? 601  TYR A C   1 
ATOM   4190 O  O   . TYR A  1  566 ? 13.955  49.159 -25.680 1.00 32.29 ? 601  TYR A O   1 
ATOM   4191 C  CB  . TYR A  1  566 ? 14.976  49.790 -22.517 1.00 28.88 ? 601  TYR A CB  1 
ATOM   4192 C  CG  . TYR A  1  566 ? 16.341  49.434 -23.082 1.00 31.04 ? 601  TYR A CG  1 
ATOM   4193 C  CD1 . TYR A  1  566 ? 16.890  48.170 -22.901 1.00 29.13 ? 601  TYR A CD1 1 
ATOM   4194 C  CD2 . TYR A  1  566 ? 17.088  50.372 -23.759 1.00 28.34 ? 601  TYR A CD2 1 
ATOM   4195 C  CE1 . TYR A  1  566 ? 18.137  47.854 -23.408 1.00 33.08 ? 601  TYR A CE1 1 
ATOM   4196 C  CE2 . TYR A  1  566 ? 18.339  50.070 -24.265 1.00 32.74 ? 601  TYR A CE2 1 
ATOM   4197 C  CZ  . TYR A  1  566 ? 18.859  48.815 -24.079 1.00 30.28 ? 601  TYR A CZ  1 
ATOM   4198 O  OH  . TYR A  1  566 ? 20.101  48.523 -24.588 1.00 35.42 ? 601  TYR A OH  1 
ATOM   4199 N  N   . ARG A  1  567 ? 13.507  51.165 -24.782 1.00 34.43 ? 602  ARG A N   1 
ATOM   4200 C  CA  . ARG A  1  567 ? 13.411  51.853 -26.065 1.00 33.86 ? 602  ARG A CA  1 
ATOM   4201 C  C   . ARG A  1  567 ? 14.788  52.228 -26.586 1.00 36.38 ? 602  ARG A C   1 
ATOM   4202 O  O   . ARG A  1  567 ? 15.495  53.022 -25.977 1.00 36.98 ? 602  ARG A O   1 
ATOM   4203 C  CB  . ARG A  1  567 ? 12.547  53.101 -25.923 1.00 36.58 ? 602  ARG A CB  1 
ATOM   4204 N  N   . THR A  1  568 ? 15.160  51.655 -27.722 1.00 34.43 ? 603  THR A N   1 
ATOM   4205 C  CA  . THR A  1  568 ? 16.459  51.908 -28.304 1.00 36.75 ? 603  THR A CA  1 
ATOM   4206 C  C   . THR A  1  568 ? 16.455  51.483 -29.774 1.00 39.51 ? 603  THR A C   1 
ATOM   4207 O  O   . THR A  1  568 ? 15.471  50.939 -30.272 1.00 40.54 ? 603  THR A O   1 
ATOM   4208 C  CB  . THR A  1  568 ? 17.545  51.132 -27.545 1.00 35.62 ? 603  THR A CB  1 
ATOM   4209 O  OG1 . THR A  1  568 ? 18.844  51.607 -27.918 1.00 37.31 ? 603  THR A OG1 1 
ATOM   4210 C  CG2 . THR A  1  568 ? 17.443  49.647 -27.852 1.00 36.49 ? 603  THR A CG2 1 
ATOM   4211 N  N   . SER A  1  569 ? 17.564  51.720 -30.456 1.00 37.47 ? 604  SER A N   1 
ATOM   4212 C  CA  . SER A  1  569 ? 17.671  51.377 -31.864 1.00 40.26 ? 604  SER A CA  1 
ATOM   4213 C  C   . SER A  1  569 ? 18.860  50.444 -32.079 1.00 38.40 ? 604  SER A C   1 
ATOM   4214 O  O   . SER A  1  569 ? 19.999  50.797 -31.758 1.00 38.13 ? 604  SER A O   1 
ATOM   4215 C  CB  . SER A  1  569 ? 17.807  52.652 -32.697 1.00 40.08 ? 604  SER A CB  1 
ATOM   4216 O  OG  . SER A  1  569 ? 18.366  52.380 -33.978 1.00 47.50 ? 604  SER A OG  1 
ATOM   4217 N  N   . TYR A  1  570 ? 18.597  49.247 -32.606 1.00 35.56 ? 605  TYR A N   1 
ATOM   4218 C  CA  . TYR A  1  570 ? 19.669  48.272 -32.839 1.00 38.19 ? 605  TYR A CA  1 
ATOM   4219 C  C   . TYR A  1  570 ? 19.435  47.346 -34.035 1.00 38.28 ? 605  TYR A C   1 
ATOM   4220 O  O   . TYR A  1  570 ? 18.301  47.151 -34.472 1.00 41.36 ? 605  TYR A O   1 
ATOM   4221 C  CB  . TYR A  1  570 ? 19.899  47.417 -31.591 1.00 36.47 ? 605  TYR A CB  1 
ATOM   4222 C  CG  . TYR A  1  570 ? 18.864  46.347 -31.351 1.00 34.18 ? 605  TYR A CG  1 
ATOM   4223 C  CD1 . TYR A  1  570 ? 19.151  45.017 -31.605 1.00 35.82 ? 605  TYR A CD1 1 
ATOM   4224 C  CD2 . TYR A  1  570 ? 17.606  46.662 -30.867 1.00 33.32 ? 605  TYR A CD2 1 
ATOM   4225 C  CE1 . TYR A  1  570 ? 18.215  44.032 -31.372 1.00 35.94 ? 605  TYR A CE1 1 
ATOM   4226 C  CE2 . TYR A  1  570 ? 16.665  45.688 -30.642 1.00 33.31 ? 605  TYR A CE2 1 
ATOM   4227 C  CZ  . TYR A  1  570 ? 16.979  44.376 -30.885 1.00 28.82 ? 605  TYR A CZ  1 
ATOM   4228 O  OH  . TYR A  1  570 ? 16.027  43.408 -30.647 1.00 40.39 ? 605  TYR A OH  1 
ATOM   4229 N  N   . ASP A  1  571 ? 20.519  46.762 -34.530 1.00 39.83 ? 606  ASP A N   1 
ATOM   4230 C  CA  . ASP A  1  571 ? 20.493  45.944 -35.738 1.00 39.26 ? 606  ASP A CA  1 
ATOM   4231 C  C   . ASP A  1  571 ? 20.891  44.508 -35.452 1.00 40.81 ? 606  ASP A C   1 
ATOM   4232 O  O   . ASP A  1  571 ? 21.851  44.262 -34.726 1.00 39.44 ? 606  ASP A O   1 
ATOM   4233 C  CB  . ASP A  1  571 ? 21.488  46.496 -36.756 1.00 41.11 ? 606  ASP A CB  1 
ATOM   4234 C  CG  . ASP A  1  571 ? 21.333  47.977 -36.980 1.00 41.78 ? 606  ASP A CG  1 
ATOM   4235 O  OD1 . ASP A  1  571 ? 20.194  48.490 -36.930 1.00 47.88 ? 606  ASP A OD1 1 
ATOM   4236 O  OD2 . ASP A  1  571 ? 22.363  48.629 -37.203 1.00 38.31 ? 606  ASP A OD2 1 
ATOM   4237 N  N   . ILE A  1  572 ? 20.179  43.551 -36.036 1.00 41.10 ? 607  ILE A N   1 
ATOM   4238 C  CA  . ILE A  1  572 ? 20.683  42.188 -36.029 1.00 41.21 ? 607  ILE A CA  1 
ATOM   4239 C  C   . ILE A  1  572 ? 21.772  42.115 -37.085 1.00 41.22 ? 607  ILE A C   1 
ATOM   4240 O  O   . ILE A  1  572 ? 21.611  42.645 -38.183 1.00 45.26 ? 607  ILE A O   1 
ATOM   4241 C  CB  . ILE A  1  572 ? 19.593  41.161 -36.365 1.00 43.38 ? 607  ILE A CB  1 
ATOM   4242 C  CG1 . ILE A  1  572 ? 18.461  41.224 -35.342 1.00 43.78 ? 607  ILE A CG1 1 
ATOM   4243 C  CG2 . ILE A  1  572 ? 20.186  39.768 -36.428 1.00 43.29 ? 607  ILE A CG2 1 
ATOM   4244 C  CD1 . ILE A  1  572 ? 18.899  40.929 -33.908 1.00 41.73 ? 607  ILE A CD1 1 
ATOM   4245 N  N   . LEU A  1  573 ? 22.885  41.478 -36.752 1.00 38.27 ? 608  LEU A N   1 
ATOM   4246 C  CA  . LEU A  1  573 ? 23.960  41.274 -37.703 1.00 42.95 ? 608  LEU A CA  1 
ATOM   4247 C  C   . LEU A  1  573 ? 24.315  39.801 -37.734 1.00 45.26 ? 608  LEU A C   1 
ATOM   4248 O  O   . LEU A  1  573 ? 24.662  39.218 -36.708 1.00 42.93 ? 608  LEU A O   1 
ATOM   4249 C  CB  . LEU A  1  573 ? 25.189  42.096 -37.329 1.00 41.59 ? 608  LEU A CB  1 
ATOM   4250 C  CG  . LEU A  1  573 ? 25.020  43.611 -37.196 1.00 41.56 ? 608  LEU A CG  1 
ATOM   4251 C  CD1 . LEU A  1  573 ? 26.357  44.235 -36.830 1.00 43.18 ? 608  LEU A CD1 1 
ATOM   4252 C  CD2 . LEU A  1  573 ? 24.452  44.242 -38.468 1.00 42.18 ? 608  LEU A CD2 1 
ATOM   4253 N  N   . TYR A  1  574 ? 24.215  39.198 -38.916 1.00 45.92 ? 609  TYR A N   1 
ATOM   4254 C  CA  . TYR A  1  574 ? 24.529  37.786 -39.080 1.00 44.97 ? 609  TYR A CA  1 
ATOM   4255 C  C   . TYR A  1  574 ? 25.956  37.617 -39.557 1.00 44.24 ? 609  TYR A C   1 
ATOM   4256 O  O   . TYR A  1  574 ? 26.496  38.483 -40.241 1.00 47.99 ? 609  TYR A O   1 
ATOM   4257 C  CB  . TYR A  1  574 ? 23.565  37.129 -40.070 1.00 48.01 ? 609  TYR A CB  1 
ATOM   4258 C  CG  . TYR A  1  574 ? 22.112  37.292 -39.701 1.00 45.74 ? 609  TYR A CG  1 
ATOM   4259 C  CD1 . TYR A  1  574 ? 21.546  36.533 -38.686 1.00 45.88 ? 609  TYR A CD1 1 
ATOM   4260 C  CD2 . TYR A  1  574 ? 21.307  38.211 -40.358 1.00 47.30 ? 609  TYR A CD2 1 
ATOM   4261 C  CE1 . TYR A  1  574 ? 20.225  36.675 -38.338 1.00 46.84 ? 609  TYR A CE1 1 
ATOM   4262 C  CE2 . TYR A  1  574 ? 19.969  38.360 -40.018 1.00 48.72 ? 609  TYR A CE2 1 
ATOM   4263 C  CZ  . TYR A  1  574 ? 19.437  37.587 -39.005 1.00 49.28 ? 609  TYR A CZ  1 
ATOM   4264 O  OH  . TYR A  1  574 ? 18.117  37.725 -38.650 1.00 52.25 ? 609  TYR A OH  1 
ATOM   4265 N  N   . HIS A  1  575 ? 26.567  36.502 -39.179 1.00 43.53 ? 610  HIS A N   1 
ATOM   4266 C  CA  . HIS A  1  575 ? 27.918  36.184 -39.609 1.00 46.31 ? 610  HIS A CA  1 
ATOM   4267 C  C   . HIS A  1  575 ? 27.999  34.670 -39.653 1.00 49.10 ? 610  HIS A C   1 
ATOM   4268 O  O   . HIS A  1  575 ? 27.131  33.986 -39.106 1.00 45.76 ? 610  HIS A O   1 
ATOM   4269 C  CB  . HIS A  1  575 ? 28.965  36.751 -38.636 1.00 45.04 ? 610  HIS A CB  1 
ATOM   4270 C  CG  . HIS A  1  575 ? 28.775  38.205 -38.320 1.00 45.21 ? 610  HIS A CG  1 
ATOM   4271 N  ND1 . HIS A  1  575 ? 27.804  38.655 -37.451 1.00 44.06 ? 610  HIS A ND1 1 
ATOM   4272 C  CD2 . HIS A  1  575 ? 29.433  39.308 -38.749 1.00 45.70 ? 610  HIS A CD2 1 
ATOM   4273 C  CE1 . HIS A  1  575 ? 27.859  39.973 -37.373 1.00 43.04 ? 610  HIS A CE1 1 
ATOM   4274 N  NE2 . HIS A  1  575 ? 28.842  40.395 -38.148 1.00 44.96 ? 610  HIS A NE2 1 
ATOM   4275 N  N   . THR A  1  576 ? 29.026  34.136 -40.306 1.00 44.20 ? 611  THR A N   1 
ATOM   4276 C  CA  . THR A  1  576 ? 29.170  32.692 -40.350 1.00 43.76 ? 611  THR A CA  1 
ATOM   4277 C  C   . THR A  1  576 ? 29.244  32.131 -38.939 1.00 47.29 ? 611  THR A C   1 
ATOM   4278 O  O   . THR A  1  576 ? 28.552  31.162 -38.612 1.00 48.93 ? 611  THR A O   1 
ATOM   4279 C  CB  . THR A  1  576 ? 30.427  32.254 -41.115 1.00 47.05 ? 611  THR A CB  1 
ATOM   4280 O  OG1 . THR A  1  576 ? 30.369  32.750 -42.459 1.00 44.21 ? 611  THR A OG1 1 
ATOM   4281 C  CG2 . THR A  1  576 ? 30.517  30.740 -41.138 1.00 45.28 ? 611  THR A CG2 1 
ATOM   4282 N  N   . ASP A  1  577 ? 30.066  32.758 -38.102 1.00 43.65 ? 612  ASP A N   1 
ATOM   4283 C  CA  . ASP A  1  577 ? 30.374  32.208 -36.780 1.00 42.73 ? 612  ASP A CA  1 
ATOM   4284 C  C   . ASP A  1  577 ? 29.640  32.855 -35.615 1.00 41.72 ? 612  ASP A C   1 
ATOM   4285 O  O   . ASP A  1  577 ? 29.739  32.378 -34.491 1.00 42.29 ? 612  ASP A O   1 
ATOM   4286 C  CB  . ASP A  1  577 ? 31.870  32.281 -36.512 1.00 42.60 ? 612  ASP A CB  1 
ATOM   4287 C  CG  . ASP A  1  577 ? 32.681  31.629 -37.607 1.00 46.73 ? 612  ASP A CG  1 
ATOM   4288 O  OD1 . ASP A  1  577 ? 32.085  30.855 -38.378 1.00 47.58 ? 612  ASP A OD1 1 
ATOM   4289 O  OD2 . ASP A  1  577 ? 33.897  31.889 -37.690 1.00 48.71 ? 612  ASP A OD2 1 
ATOM   4290 N  N   . PHE A  1  578 ? 28.922  33.939 -35.859 1.00 42.01 ? 613  PHE A N   1 
ATOM   4291 C  CA  . PHE A  1  578 ? 28.259  34.610 -34.745 1.00 42.02 ? 613  PHE A CA  1 
ATOM   4292 C  C   . PHE A  1  578 ? 27.161  35.553 -35.192 1.00 42.28 ? 613  PHE A C   1 
ATOM   4293 O  O   . PHE A  1  578 ? 27.128  35.996 -36.346 1.00 42.99 ? 613  PHE A O   1 
ATOM   4294 C  CB  . PHE A  1  578 ? 29.283  35.337 -33.866 1.00 33.72 ? 613  PHE A CB  1 
ATOM   4295 C  CG  . PHE A  1  578 ? 29.885  36.570 -34.502 1.00 39.84 ? 613  PHE A CG  1 
ATOM   4296 C  CD1 . PHE A  1  578 ? 29.334  37.824 -34.284 1.00 36.47 ? 613  PHE A CD1 1 
ATOM   4297 C  CD2 . PHE A  1  578 ? 31.015  36.476 -35.303 1.00 40.21 ? 613  PHE A CD2 1 
ATOM   4298 C  CE1 . PHE A  1  578 ? 29.883  38.958 -34.860 1.00 37.68 ? 613  PHE A CE1 1 
ATOM   4299 C  CE2 . PHE A  1  578 ? 31.572  37.610 -35.884 1.00 42.09 ? 613  PHE A CE2 1 
ATOM   4300 C  CZ  . PHE A  1  578 ? 30.998  38.854 -35.665 1.00 39.94 ? 613  PHE A CZ  1 
ATOM   4301 N  N   . GLU A  1  579 ? 26.248  35.831 -34.272 1.00 35.44 ? 614  GLU A N   1 
ATOM   4302 C  CA  . GLU A  1  579 ? 25.214  36.819 -34.485 1.00 38.30 ? 614  GLU A CA  1 
ATOM   4303 C  C   . GLU A  1  579 ? 25.288  37.843 -33.359 1.00 40.79 ? 614  GLU A C   1 
ATOM   4304 O  O   . GLU A  1  579 ? 25.823  37.560 -32.279 1.00 37.67 ? 614  GLU A O   1 
ATOM   4305 C  CB  . GLU A  1  579 ? 23.835  36.153 -34.503 1.00 39.36 ? 614  GLU A CB  1 
ATOM   4306 C  CG  . GLU A  1  579 ? 22.662  37.112 -34.718 1.00 40.54 ? 614  GLU A CG  1 
ATOM   4307 C  CD  . GLU A  1  579 ? 21.352  36.376 -34.942 1.00 46.64 ? 614  GLU A CD  1 
ATOM   4308 O  OE1 . GLU A  1  579 ? 21.417  35.196 -35.355 1.00 47.25 ? 614  GLU A OE1 1 
ATOM   4309 O  OE2 . GLU A  1  579 ? 20.269  36.972 -34.705 1.00 41.80 ? 614  GLU A OE2 1 
ATOM   4310 N  N   . SER A  1  580 ? 24.766  39.035 -33.614 1.00 38.04 ? 615  SER A N   1 
ATOM   4311 C  CA  . SER A  1  580 ? 24.775  40.083 -32.608 1.00 38.66 ? 615  SER A CA  1 
ATOM   4312 C  C   . SER A  1  580 ? 23.604  41.032 -32.779 1.00 40.66 ? 615  SER A C   1 
ATOM   4313 O  O   . SER A  1  580 ? 23.023  41.142 -33.864 1.00 35.91 ? 615  SER A O   1 
ATOM   4314 C  CB  . SER A  1  580 ? 26.093  40.861 -32.655 1.00 39.22 ? 615  SER A CB  1 
ATOM   4315 O  OG  . SER A  1  580 ? 26.276  41.498 -33.902 1.00 40.80 ? 615  SER A OG  1 
ATOM   4316 N  N   . GLY A  1  581 ? 23.238  41.686 -31.683 1.00 33.31 ? 616  GLY A N   1 
ATOM   4317 C  CA  . GLY A  1  581 ? 22.346  42.821 -31.725 1.00 33.41 ? 616  GLY A CA  1 
ATOM   4318 C  C   . GLY A  1  581 ? 23.182  44.066 -31.524 1.00 38.21 ? 616  GLY A C   1 
ATOM   4319 O  O   . GLY A  1  581 ? 23.531  44.413 -30.387 1.00 37.61 ? 616  GLY A O   1 
ATOM   4320 N  N   . TYR A  1  582 ? 23.533  44.722 -32.628 1.00 34.10 ? 617  TYR A N   1 
ATOM   4321 C  CA  . TYR A  1  582 ? 24.394  45.899 -32.597 1.00 33.46 ? 617  TYR A CA  1 
ATOM   4322 C  C   . TYR A  1  582 ? 23.611  47.172 -32.316 1.00 34.73 ? 617  TYR A C   1 
ATOM   4323 O  O   . TYR A  1  582 ? 22.664  47.506 -33.014 1.00 37.52 ? 617  TYR A O   1 
ATOM   4324 C  CB  . TYR A  1  582 ? 25.169  46.040 -33.913 1.00 32.17 ? 617  TYR A CB  1 
ATOM   4325 C  CG  . TYR A  1  582 ? 26.072  47.240 -33.942 1.00 33.39 ? 617  TYR A CG  1 
ATOM   4326 C  CD1 . TYR A  1  582 ? 27.360  47.175 -33.441 1.00 31.37 ? 617  TYR A CD1 1 
ATOM   4327 C  CD2 . TYR A  1  582 ? 25.632  48.450 -34.462 1.00 35.87 ? 617  TYR A CD2 1 
ATOM   4328 C  CE1 . TYR A  1  582 ? 28.190  48.277 -33.457 1.00 32.84 ? 617  TYR A CE1 1 
ATOM   4329 C  CE2 . TYR A  1  582 ? 26.454  49.558 -34.489 1.00 34.77 ? 617  TYR A CE2 1 
ATOM   4330 C  CZ  . TYR A  1  582 ? 27.730  49.467 -33.977 1.00 34.02 ? 617  TYR A CZ  1 
ATOM   4331 O  OH  . TYR A  1  582 ? 28.554  50.572 -34.007 1.00 38.38 ? 617  TYR A OH  1 
ATOM   4332 N  N   . SER A  1  583 ? 24.007  47.893 -31.276 1.00 32.37 ? 618  SER A N   1 
ATOM   4333 C  CA  . SER A  1  583 ? 23.296  49.093 -30.895 1.00 32.02 ? 618  SER A CA  1 
ATOM   4334 C  C   . SER A  1  583 ? 23.830  50.289 -31.659 1.00 35.15 ? 618  SER A C   1 
ATOM   4335 O  O   . SER A  1  583 ? 25.033  50.541 -31.647 1.00 35.97 ? 618  SER A O   1 
ATOM   4336 C  CB  . SER A  1  583 ? 23.478  49.364 -29.404 1.00 30.72 ? 618  SER A CB  1 
ATOM   4337 O  OG  . SER A  1  583 ? 22.966  50.639 -29.086 1.00 35.02 ? 618  SER A OG  1 
ATOM   4338 N  N   . GLU A  1  584 ? 22.939  51.037 -32.301 1.00 37.69 ? 619  GLU A N   1 
ATOM   4339 C  CA  . GLU A  1  584 ? 23.348  52.223 -33.043 1.00 39.34 ? 619  GLU A CA  1 
ATOM   4340 C  C   . GLU A  1  584 ? 23.486  53.406 -32.095 1.00 39.96 ? 619  GLU A C   1 
ATOM   4341 O  O   . GLU A  1  584 ? 23.952  54.488 -32.471 1.00 41.01 ? 619  GLU A O   1 
ATOM   4342 C  CB  . GLU A  1  584 ? 22.375  52.512 -34.202 1.00 43.03 ? 619  GLU A CB  1 
ATOM   4343 C  CG  . GLU A  1  584 ? 22.328  51.375 -35.228 1.00 42.95 ? 619  GLU A CG  1 
ATOM   4344 C  CD  . GLU A  1  584 ? 21.677  51.769 -36.561 1.00 50.35 ? 619  GLU A CD  1 
ATOM   4345 O  OE1 . GLU A  1  584 ? 20.884  52.737 -36.595 1.00 47.79 ? 619  GLU A OE1 1 
ATOM   4346 O  OE2 . GLU A  1  584 ? 21.965  51.092 -37.572 1.00 46.24 ? 619  GLU A OE2 1 
ATOM   4347 N  N   . ILE A  1  585 ? 23.115  53.172 -30.841 1.00 37.91 ? 620  ILE A N   1 
ATOM   4348 C  CA  . ILE A  1  585 ? 23.186  54.199 -29.814 1.00 38.45 ? 620  ILE A CA  1 
ATOM   4349 C  C   . ILE A  1  585 ? 24.482  54.073 -29.019 1.00 36.73 ? 620  ILE A C   1 
ATOM   4350 O  O   . ILE A  1  585 ? 25.175  55.072 -28.786 1.00 32.26 ? 620  ILE A O   1 
ATOM   4351 C  CB  . ILE A  1  585 ? 21.983  54.107 -28.869 1.00 37.49 ? 620  ILE A CB  1 
ATOM   4352 C  CG1 . ILE A  1  585 ? 20.689  54.011 -29.684 1.00 40.16 ? 620  ILE A CG1 1 
ATOM   4353 C  CG2 . ILE A  1  585 ? 21.940  55.309 -27.927 1.00 39.05 ? 620  ILE A CG2 1 
ATOM   4354 C  CD1 . ILE A  1  585 ? 20.333  55.301 -30.401 1.00 42.29 ? 620  ILE A CD1 1 
ATOM   4355 N  N   . PHE A  1  586 ? 24.823  52.850 -28.615 1.00 32.80 ? 621  PHE A N   1 
ATOM   4356 C  CA  . PHE A  1  586 ? 26.019  52.663 -27.795 1.00 32.62 ? 621  PHE A CA  1 
ATOM   4357 C  C   . PHE A  1  586 ? 27.219  52.239 -28.618 1.00 34.50 ? 621  PHE A C   1 
ATOM   4358 O  O   . PHE A  1  586 ? 28.320  52.071 -28.089 1.00 32.06 ? 621  PHE A O   1 
ATOM   4359 C  CB  . PHE A  1  586 ? 25.726  51.717 -26.631 1.00 32.17 ? 621  PHE A CB  1 
ATOM   4360 C  CG  . PHE A  1  586 ? 24.609  52.210 -25.755 1.00 31.09 ? 621  PHE A CG  1 
ATOM   4361 C  CD1 . PHE A  1  586 ? 24.848  53.168 -24.779 1.00 34.74 ? 621  PHE A CD1 1 
ATOM   4362 C  CD2 . PHE A  1  586 ? 23.313  51.754 -25.937 1.00 34.76 ? 621  PHE A CD2 1 
ATOM   4363 C  CE1 . PHE A  1  586 ? 23.816  53.654 -23.990 1.00 34.76 ? 621  PHE A CE1 1 
ATOM   4364 C  CE2 . PHE A  1  586 ? 22.278  52.230 -25.144 1.00 34.82 ? 621  PHE A CE2 1 
ATOM   4365 C  CZ  . PHE A  1  586 ? 22.534  53.183 -24.175 1.00 34.89 ? 621  PHE A CZ  1 
ATOM   4366 N  N   . LEU A  1  587 ? 26.987  52.080 -29.923 1.00 34.11 ? 622  LEU A N   1 
ATOM   4367 C  CA  . LEU A  1  587 ? 28.051  51.905 -30.896 1.00 32.07 ? 622  LEU A CA  1 
ATOM   4368 C  C   . LEU A  1  587 ? 28.796  50.614 -30.676 1.00 33.19 ? 622  LEU A C   1 
ATOM   4369 O  O   . LEU A  1  587 ? 29.985  50.511 -30.973 1.00 35.37 ? 622  LEU A O   1 
ATOM   4370 C  CB  . LEU A  1  587 ? 29.020  53.088 -30.873 1.00 32.83 ? 622  LEU A CB  1 
ATOM   4371 C  CG  . LEU A  1  587 ? 28.443  54.505 -30.956 1.00 33.42 ? 622  LEU A CG  1 
ATOM   4372 C  CD1 . LEU A  1  587 ? 29.564  55.509 -31.056 1.00 36.22 ? 622  LEU A CD1 1 
ATOM   4373 C  CD2 . LEU A  1  587 ? 27.468  54.676 -32.127 1.00 40.93 ? 622  LEU A CD2 1 
ATOM   4374 N  N   . MET A  1  588 ? 28.085  49.626 -30.146 1.00 32.32 ? 623  MET A N   1 
ATOM   4375 C  CA  . MET A  1  588 ? 28.639  48.304 -29.976 1.00 31.62 ? 623  MET A CA  1 
ATOM   4376 C  C   . MET A  1  588 ? 27.456  47.380 -29.761 1.00 27.31 ? 623  MET A C   1 
ATOM   4377 O  O   . MET A  1  588 ? 26.322  47.847 -29.561 1.00 32.06 ? 623  MET A O   1 
ATOM   4378 C  CB  . MET A  1  588 ? 29.597  48.282 -28.772 1.00 32.03 ? 623  MET A CB  1 
ATOM   4379 C  CG  . MET A  1  588 ? 28.893  48.492 -27.432 1.00 28.77 ? 623  MET A CG  1 
ATOM   4380 S  SD  . MET A  1  588 ? 30.091  48.799 -26.092 1.00 33.35 ? 623  MET A SD  1 
ATOM   4381 C  CE  . MET A  1  588 ? 30.697  50.423 -26.545 1.00 29.87 ? 623  MET A CE  1 
ATOM   4382 N  N   . PRO A  1  589 ? 27.692  46.068 -29.829 1.00 28.32 ? 624  PRO A N   1 
ATOM   4383 C  CA  . PRO A  1  589 ? 26.612  45.109 -29.582 1.00 29.64 ? 624  PRO A CA  1 
ATOM   4384 C  C   . PRO A  1  589 ? 26.140  45.125 -28.124 1.00 31.87 ? 624  PRO A C   1 
ATOM   4385 O  O   . PRO A  1  589 ? 26.950  45.301 -27.203 1.00 30.19 ? 624  PRO A O   1 
ATOM   4386 C  CB  . PRO A  1  589 ? 27.261  43.761 -29.884 1.00 29.11 ? 624  PRO A CB  1 
ATOM   4387 C  CG  . PRO A  1  589 ? 28.421  44.075 -30.752 1.00 30.83 ? 624  PRO A CG  1 
ATOM   4388 C  CD  . PRO A  1  589 ? 28.920  45.410 -30.305 1.00 31.25 ? 624  PRO A CD  1 
ATOM   4389 N  N   . LEU A  1  590 ? 24.838  44.960 -27.940 1.00 30.52 ? 625  LEU A N   1 
ATOM   4390 C  CA  . LEU A  1  590 ? 24.242  44.704 -26.635 1.00 33.74 ? 625  LEU A CA  1 
ATOM   4391 C  C   . LEU A  1  590 ? 24.495  43.251 -26.272 1.00 33.59 ? 625  LEU A C   1 
ATOM   4392 O  O   . LEU A  1  590 ? 24.460  42.863 -25.093 1.00 28.75 ? 625  LEU A O   1 
ATOM   4393 C  CB  . LEU A  1  590 ? 22.732  44.952 -26.696 1.00 30.49 ? 625  LEU A CB  1 
ATOM   4394 C  CG  . LEU A  1  590 ? 22.325  46.286 -27.338 1.00 32.64 ? 625  LEU A CG  1 
ATOM   4395 C  CD1 . LEU A  1  590 ? 20.815  46.450 -27.379 1.00 29.58 ? 625  LEU A CD1 1 
ATOM   4396 C  CD2 . LEU A  1  590 ? 22.958  47.423 -26.553 1.00 33.69 ? 625  LEU A CD2 1 
ATOM   4397 N  N   . TRP A  1  591 ? 24.719  42.437 -27.301 1.00 28.56 ? 626  TRP A N   1 
ATOM   4398 C  CA  . TRP A  1  591 ? 24.940  41.006 -27.119 1.00 27.36 ? 626  TRP A CA  1 
ATOM   4399 C  C   . TRP A  1  591 ? 25.527  40.368 -28.377 1.00 30.63 ? 626  TRP A C   1 
ATOM   4400 O  O   . TRP A  1  591 ? 25.209  40.784 -29.480 1.00 30.97 ? 626  TRP A O   1 
ATOM   4401 C  CB  . TRP A  1  591 ? 23.648  40.299 -26.736 1.00 30.52 ? 626  TRP A CB  1 
ATOM   4402 C  CG  . TRP A  1  591 ? 22.509  40.439 -27.721 1.00 31.19 ? 626  TRP A CG  1 
ATOM   4403 C  CD1 . TRP A  1  591 ? 21.454  41.291 -27.622 1.00 30.15 ? 626  TRP A CD1 1 
ATOM   4404 C  CD2 . TRP A  1  591 ? 22.303  39.683 -28.932 1.00 32.97 ? 626  TRP A CD2 1 
ATOM   4405 N  NE1 . TRP A  1  591 ? 20.604  41.121 -28.693 1.00 34.08 ? 626  TRP A NE1 1 
ATOM   4406 C  CE2 . TRP A  1  591 ? 21.099  40.136 -29.506 1.00 33.62 ? 626  TRP A CE2 1 
ATOM   4407 C  CE3 . TRP A  1  591 ? 23.020  38.672 -29.579 1.00 33.67 ? 626  TRP A CE3 1 
ATOM   4408 C  CZ2 . TRP A  1  591 ? 20.595  39.619 -30.714 1.00 39.30 ? 626  TRP A CZ2 1 
ATOM   4409 C  CZ3 . TRP A  1  591 ? 22.511  38.148 -30.784 1.00 35.82 ? 626  TRP A CZ3 1 
ATOM   4410 C  CH2 . TRP A  1  591 ? 21.318  38.626 -31.330 1.00 35.22 ? 626  TRP A CH2 1 
ATOM   4411 N  N   . THR A  1  592 ? 26.369  39.355 -28.188 1.00 29.86 ? 627  THR A N   1 
ATOM   4412 C  CA  . THR A  1  592 ? 27.048  38.664 -29.283 1.00 31.05 ? 627  THR A CA  1 
ATOM   4413 C  C   . THR A  1  592 ? 26.924  37.192 -28.974 1.00 34.00 ? 627  THR A C   1 
ATOM   4414 O  O   . THR A  1  592 ? 27.346  36.737 -27.912 1.00 32.50 ? 627  THR A O   1 
ATOM   4415 C  CB  . THR A  1  592 ? 28.526  39.038 -29.344 1.00 31.00 ? 627  THR A CB  1 
ATOM   4416 O  OG1 . THR A  1  592 ? 28.648  40.437 -29.607 1.00 33.09 ? 627  THR A OG1 1 
ATOM   4417 C  CG2 . THR A  1  592 ? 29.247  38.254 -30.435 1.00 33.49 ? 627  THR A CG2 1 
ATOM   4418 N  N   . SER A  1  593 ? 26.318  36.443 -29.881 1.00 32.01 ? 628  SER A N   1 
ATOM   4419 C  CA  . SER A  1  593 ? 25.938  35.081 -29.561 1.00 32.24 ? 628  SER A CA  1 
ATOM   4420 C  C   . SER A  1  593 ? 26.553  34.095 -30.539 1.00 38.15 ? 628  SER A C   1 
ATOM   4421 O  O   . SER A  1  593 ? 26.476  34.283 -31.753 1.00 38.78 ? 628  SER A O   1 
ATOM   4422 C  CB  . SER A  1  593 ? 24.419  34.952 -29.548 1.00 31.01 ? 628  SER A CB  1 
ATOM   4423 O  OG  . SER A  1  593 ? 24.021  33.626 -29.217 1.00 31.45 ? 628  SER A OG  1 
ATOM   4424 N  N   . TYR A  1  594 ? 27.165  33.044 -30.014 1.00 36.05 ? 629  TYR A N   1 
ATOM   4425 C  CA  . TYR A  1  594 ? 27.805  32.070 -30.887 1.00 39.07 ? 629  TYR A CA  1 
ATOM   4426 C  C   . TYR A  1  594 ? 27.926  30.706 -30.232 1.00 41.54 ? 629  TYR A C   1 
ATOM   4427 O  O   . TYR A  1  594 ? 28.006  30.601 -29.011 1.00 41.21 ? 629  TYR A O   1 
ATOM   4428 C  CB  . TYR A  1  594 ? 29.171  32.591 -31.336 1.00 39.62 ? 629  TYR A CB  1 
ATOM   4429 C  CG  . TYR A  1  594 ? 30.158  32.854 -30.215 1.00 39.45 ? 629  TYR A CG  1 
ATOM   4430 C  CD1 . TYR A  1  594 ? 30.169  34.066 -29.525 1.00 36.33 ? 629  TYR A CD1 1 
ATOM   4431 C  CD2 . TYR A  1  594 ? 31.095  31.893 -29.858 1.00 39.93 ? 629  TYR A CD2 1 
ATOM   4432 C  CE1 . TYR A  1  594 ? 31.092  34.297 -28.498 1.00 35.94 ? 629  TYR A CE1 1 
ATOM   4433 C  CE2 . TYR A  1  594 ? 32.013  32.119 -28.856 1.00 37.94 ? 629  TYR A CE2 1 
ATOM   4434 C  CZ  . TYR A  1  594 ? 32.006  33.318 -28.175 1.00 35.15 ? 629  TYR A CZ  1 
ATOM   4435 O  OH  . TYR A  1  594 ? 32.933  33.512 -27.187 1.00 35.31 ? 629  TYR A OH  1 
ATOM   4436 N  N   . THR A  1  595 ? 27.919  29.653 -31.040 1.00 40.71 ? 630  THR A N   1 
ATOM   4437 C  CA  . THR A  1  595 ? 28.085  28.316 -30.493 1.00 40.71 ? 630  THR A CA  1 
ATOM   4438 C  C   . THR A  1  595 ? 29.438  27.727 -30.898 1.00 46.88 ? 630  THR A C   1 
ATOM   4439 O  O   . THR A  1  595 ? 29.910  27.914 -32.031 1.00 44.62 ? 630  THR A O   1 
ATOM   4440 C  CB  . THR A  1  595 ? 26.932  27.379 -30.896 1.00 39.87 ? 630  THR A CB  1 
ATOM   4441 O  OG1 . THR A  1  595 ? 25.678  27.957 -30.508 1.00 41.53 ? 630  THR A OG1 1 
ATOM   4442 C  CG2 . THR A  1  595 ? 27.086  26.015 -30.235 1.00 43.77 ? 630  THR A CG2 1 
ATOM   4443 N  N   . ILE A  1  596 ? 30.055  27.032 -29.949 1.00 44.42 ? 631  ILE A N   1 
ATOM   4444 C  CA  . ILE A  1  596 ? 31.362  26.431 -30.124 1.00 42.96 ? 631  ILE A CA  1 
ATOM   4445 C  C   . ILE A  1  596 ? 31.285  24.937 -29.839 1.00 49.06 ? 631  ILE A C   1 
ATOM   4446 O  O   . ILE A  1  596 ? 31.045  24.513 -28.697 1.00 43.75 ? 631  ILE A O   1 
ATOM   4447 C  CB  . ILE A  1  596 ? 32.396  27.086 -29.190 1.00 44.28 ? 631  ILE A CB  1 
ATOM   4448 C  CG1 . ILE A  1  596 ? 32.540  28.579 -29.510 1.00 45.90 ? 631  ILE A CG1 1 
ATOM   4449 C  CG2 . ILE A  1  596 ? 33.739  26.365 -29.261 1.00 45.11 ? 631  ILE A CG2 1 
ATOM   4450 C  CD1 . ILE A  1  596 ? 33.242  28.884 -30.826 1.00 44.75 ? 631  ILE A CD1 1 
ATOM   4451 N  N   . SER A  1  597 ? 31.491  24.133 -30.880 1.00 49.45 ? 632  SER A N   1 
ATOM   4452 C  CA  . SER A  1  597 ? 31.394  22.684 -30.735 1.00 50.48 ? 632  SER A CA  1 
ATOM   4453 C  C   . SER A  1  597 ? 32.552  22.128 -29.918 1.00 46.38 ? 632  SER A C   1 
ATOM   4454 O  O   . SER A  1  597 ? 33.625  22.731 -29.828 1.00 47.76 ? 632  SER A O   1 
ATOM   4455 C  CB  . SER A  1  597 ? 31.328  21.989 -32.101 1.00 52.29 ? 632  SER A CB  1 
ATOM   4456 O  OG  . SER A  1  597 ? 32.578  22.056 -32.763 1.00 54.79 ? 632  SER A OG  1 
ATOM   4457 N  N   . LYS A  1  598 ? 32.319  20.969 -29.320 1.00 47.05 ? 633  LYS A N   1 
ATOM   4458 C  CA  . LYS A  1  598 ? 33.341  20.292 -28.550 1.00 48.63 ? 633  LYS A CA  1 
ATOM   4459 C  C   . LYS A  1  598 ? 34.620  20.101 -29.351 1.00 54.22 ? 633  LYS A C   1 
ATOM   4460 O  O   . LYS A  1  598 ? 35.716  20.177 -28.801 1.00 53.31 ? 633  LYS A O   1 
ATOM   4461 C  CB  . LYS A  1  598 ? 32.832  18.936 -28.074 1.00 47.52 ? 633  LYS A CB  1 
ATOM   4462 C  CG  . LYS A  1  598 ? 33.906  18.071 -27.455 1.00 44.52 ? 633  LYS A CG  1 
ATOM   4463 C  CD  . LYS A  1  598 ? 33.331  16.749 -26.978 1.00 47.85 ? 633  LYS A CD  1 
ATOM   4464 C  CE  . LYS A  1  598 ? 34.332  16.016 -26.103 1.00 54.96 ? 633  LYS A CE  1 
ATOM   4465 N  NZ  . LYS A  1  598 ? 33.812  14.706 -25.654 1.00 56.22 ? 633  LYS A NZ  1 
ATOM   4466 N  N   . GLN A  1  599 ? 34.480  19.844 -30.648 1.00 55.57 ? 634  GLN A N   1 
ATOM   4467 C  CA  . GLN A  1  599 ? 35.648  19.571 -31.488 1.00 58.20 ? 634  GLN A CA  1 
ATOM   4468 C  C   . GLN A  1  599 ? 36.077  20.787 -32.304 1.00 61.13 ? 634  GLN A C   1 
ATOM   4469 O  O   . GLN A  1  599 ? 36.834  20.663 -33.271 1.00 63.98 ? 634  GLN A O   1 
ATOM   4470 C  CB  . GLN A  1  599 ? 35.404  18.365 -32.402 1.00 58.22 ? 634  GLN A CB  1 
ATOM   4471 C  CG  . GLN A  1  599 ? 34.037  18.343 -33.067 1.00 57.77 ? 634  GLN A CG  1 
ATOM   4472 C  CD  . GLN A  1  599 ? 32.959  17.754 -32.170 1.00 58.59 ? 634  GLN A CD  1 
ATOM   4473 O  OE1 . GLN A  1  599 ? 33.236  16.906 -31.321 1.00 54.57 ? 634  GLN A OE1 1 
ATOM   4474 N  NE2 . GLN A  1  599 ? 31.719  18.199 -32.362 1.00 56.19 ? 634  GLN A NE2 1 
ATOM   4475 N  N   . ALA A  1  600 ? 35.595  21.962 -31.912 1.00 57.96 ? 635  ALA A N   1 
ATOM   4476 C  CA  . ALA A  1  600 ? 36.017  23.196 -32.560 1.00 57.61 ? 635  ALA A CA  1 
ATOM   4477 C  C   . ALA A  1  600 ? 37.527  23.373 -32.419 1.00 56.02 ? 635  ALA A C   1 
ATOM   4478 O  O   . ALA A  1  600 ? 38.128  22.930 -31.441 1.00 57.20 ? 635  ALA A O   1 
ATOM   4479 C  CB  . ALA A  1  600 ? 35.269  24.399 -31.982 1.00 57.15 ? 635  ALA A CB  1 
ATOM   4480 N  N   . GLU A  1  601 ? 38.133  24.016 -33.410 1.00 55.14 ? 636  GLU A N   1 
ATOM   4481 C  CA  . GLU A  1  601 ? 39.572  24.199 -33.439 1.00 56.82 ? 636  GLU A CA  1 
ATOM   4482 C  C   . GLU A  1  601 ? 39.935  25.654 -33.179 1.00 53.69 ? 636  GLU A C   1 
ATOM   4483 O  O   . GLU A  1  601 ? 39.306  26.565 -33.718 1.00 56.84 ? 636  GLU A O   1 
ATOM   4484 C  CB  . GLU A  1  601 ? 40.132  23.754 -34.796 1.00 58.75 ? 636  GLU A CB  1 
ATOM   4485 N  N   . VAL A  1  602 ? 40.954  25.864 -32.354 1.00 52.00 ? 637  VAL A N   1 
ATOM   4486 C  CA  . VAL A  1  602 ? 41.421  27.207 -32.027 1.00 54.90 ? 637  VAL A CA  1 
ATOM   4487 C  C   . VAL A  1  602 ? 42.619  27.631 -32.879 1.00 59.84 ? 637  VAL A C   1 
ATOM   4488 O  O   . VAL A  1  602 ? 43.718  27.079 -32.757 1.00 58.63 ? 637  VAL A O   1 
ATOM   4489 C  CB  . VAL A  1  602 ? 41.804  27.318 -30.538 1.00 56.67 ? 637  VAL A CB  1 
ATOM   4490 C  CG1 . VAL A  1  602 ? 42.567  28.607 -30.267 1.00 51.53 ? 637  VAL A CG1 1 
ATOM   4491 C  CG2 . VAL A  1  602 ? 40.562  27.239 -29.674 1.00 54.99 ? 637  VAL A CG2 1 
ATOM   4492 N  N   . SER A  1  603 ? 42.395  28.625 -33.730 1.00 58.49 ? 638  SER A N   1 
ATOM   4493 C  CA  . SER A  1  603 ? 43.443  29.172 -34.580 1.00 58.11 ? 638  SER A CA  1 
ATOM   4494 C  C   . SER A  1  603 ? 44.014  30.432 -33.947 1.00 59.09 ? 638  SER A C   1 
ATOM   4495 O  O   . SER A  1  603 ? 43.484  30.929 -32.956 1.00 60.13 ? 638  SER A O   1 
ATOM   4496 C  CB  . SER A  1  603 ? 42.867  29.508 -35.948 1.00 58.65 ? 638  SER A CB  1 
ATOM   4497 O  OG  . SER A  1  603 ? 41.753  30.372 -35.815 1.00 57.07 ? 638  SER A OG  1 
ATOM   4498 N  N   . SER A  1  604 ? 45.090  30.954 -34.523 1.00 59.98 ? 639  SER A N   1 
ATOM   4499 C  CA  . SER A  1  604 ? 45.727  32.156 -33.990 1.00 60.21 ? 639  SER A CA  1 
ATOM   4500 C  C   . SER A  1  604 ? 45.336  33.391 -34.795 1.00 54.73 ? 639  SER A C   1 
ATOM   4501 O  O   . SER A  1  604 ? 44.643  33.285 -35.802 1.00 59.92 ? 639  SER A O   1 
ATOM   4502 C  CB  . SER A  1  604 ? 47.249  31.995 -33.992 1.00 64.00 ? 639  SER A CB  1 
ATOM   4503 O  OG  . SER A  1  604 ? 47.625  30.686 -33.596 1.00 67.87 ? 639  SER A OG  1 
ATOM   4504 N  N   . ILE A  1  605 ? 45.775  34.560 -34.344 1.00 55.25 ? 640  ILE A N   1 
ATOM   4505 C  CA  . ILE A  1  605 ? 45.563  35.795 -35.088 1.00 56.64 ? 640  ILE A CA  1 
ATOM   4506 C  C   . ILE A  1  605 ? 46.842  36.137 -35.840 1.00 61.48 ? 640  ILE A C   1 
ATOM   4507 O  O   . ILE A  1  605 ? 47.819  36.567 -35.226 1.00 63.96 ? 640  ILE A O   1 
ATOM   4508 C  CB  . ILE A  1  605 ? 45.223  36.984 -34.163 1.00 57.68 ? 640  ILE A CB  1 
ATOM   4509 C  CG1 . ILE A  1  605 ? 43.770  36.915 -33.683 1.00 55.05 ? 640  ILE A CG1 1 
ATOM   4510 C  CG2 . ILE A  1  605 ? 45.456  38.314 -34.881 1.00 55.76 ? 640  ILE A CG2 1 
ATOM   4511 C  CD1 . ILE A  1  605 ? 43.377  38.091 -32.806 1.00 49.54 ? 640  ILE A CD1 1 
ATOM   4512 N  N   . PRO A  1  606 ? 46.844  35.938 -37.170 1.00 58.20 ? 641  PRO A N   1 
ATOM   4513 C  CA  . PRO A  1  606 ? 48.036  36.182 -37.992 1.00 57.37 ? 641  PRO A CA  1 
ATOM   4514 C  C   . PRO A  1  606 ? 48.673  37.538 -37.701 1.00 57.11 ? 641  PRO A C   1 
ATOM   4515 O  O   . PRO A  1  606 ? 47.966  38.518 -37.473 1.00 56.07 ? 641  PRO A O   1 
ATOM   4516 C  CB  . PRO A  1  606 ? 47.482  36.142 -39.419 1.00 59.44 ? 641  PRO A CB  1 
ATOM   4517 C  CG  . PRO A  1  606 ? 46.338  35.188 -39.334 1.00 59.45 ? 641  PRO A CG  1 
ATOM   4518 C  CD  . PRO A  1  606 ? 45.719  35.420 -37.969 1.00 58.05 ? 641  PRO A CD  1 
ATOM   4519 N  N   . GLU A  1  607 ? 50.001  37.586 -37.719 1.00 59.76 ? 642  GLU A N   1 
ATOM   4520 C  CA  . GLU A  1  607 ? 50.731  38.794 -37.345 1.00 60.67 ? 642  GLU A CA  1 
ATOM   4521 C  C   . GLU A  1  607 ? 50.361  40.024 -38.175 1.00 56.63 ? 642  GLU A C   1 
ATOM   4522 O  O   . GLU A  1  607 ? 50.436  41.144 -37.686 1.00 58.91 ? 642  GLU A O   1 
ATOM   4523 C  CB  . GLU A  1  607 ? 52.242  38.551 -37.401 1.00 64.04 ? 642  GLU A CB  1 
ATOM   4524 N  N   . HIS A  1  608 ? 49.960  39.817 -39.423 1.00 57.61 ? 643  HIS A N   1 
ATOM   4525 C  CA  . HIS A  1  608 ? 49.624  40.938 -40.299 1.00 59.42 ? 643  HIS A CA  1 
ATOM   4526 C  C   . HIS A  1  608 ? 48.220  41.477 -40.033 1.00 59.15 ? 643  HIS A C   1 
ATOM   4527 O  O   . HIS A  1  608 ? 47.833  42.520 -40.568 1.00 56.03 ? 643  HIS A O   1 
ATOM   4528 C  CB  . HIS A  1  608 ? 49.764  40.537 -41.769 1.00 57.63 ? 643  HIS A CB  1 
ATOM   4529 C  CG  . HIS A  1  608 ? 48.748  39.537 -42.223 1.00 57.31 ? 643  HIS A CG  1 
ATOM   4530 N  ND1 . HIS A  1  608 ? 48.862  38.188 -41.961 1.00 56.63 ? 643  HIS A ND1 1 
ATOM   4531 C  CD2 . HIS A  1  608 ? 47.599  39.689 -42.925 1.00 59.49 ? 643  HIS A CD2 1 
ATOM   4532 C  CE1 . HIS A  1  608 ? 47.828  37.552 -42.485 1.00 58.99 ? 643  HIS A CE1 1 
ATOM   4533 N  NE2 . HIS A  1  608 ? 47.046  38.439 -43.074 1.00 59.64 ? 643  HIS A NE2 1 
ATOM   4534 N  N   . LEU A  1  609 ? 47.468  40.756 -39.201 1.00 60.47 ? 644  LEU A N   1 
ATOM   4535 C  CA  . LEU A  1  609 ? 46.102  41.136 -38.842 1.00 56.39 ? 644  LEU A CA  1 
ATOM   4536 C  C   . LEU A  1  609 ? 46.011  41.599 -37.393 1.00 57.08 ? 644  LEU A C   1 
ATOM   4537 O  O   . LEU A  1  609 ? 44.917  41.853 -36.884 1.00 54.91 ? 644  LEU A O   1 
ATOM   4538 C  CB  . LEU A  1  609 ? 45.150  39.963 -39.054 1.00 54.94 ? 644  LEU A CB  1 
ATOM   4539 C  CG  . LEU A  1  609 ? 45.005  39.448 -40.485 1.00 55.45 ? 644  LEU A CG  1 
ATOM   4540 C  CD1 . LEU A  1  609 ? 44.254  38.126 -40.487 1.00 55.23 ? 644  LEU A CD1 1 
ATOM   4541 C  CD2 . LEU A  1  609 ? 44.305  40.490 -41.349 1.00 57.34 ? 644  LEU A CD2 1 
ATOM   4542 N  N   . THR A  1  610 ? 47.162  41.696 -36.732 1.00 56.25 ? 645  THR A N   1 
ATOM   4543 C  CA  . THR A  1  610 ? 47.226  42.145 -35.345 1.00 57.44 ? 645  THR A CA  1 
ATOM   4544 C  C   . THR A  1  610 ? 46.336  43.351 -35.116 1.00 54.48 ? 645  THR A C   1 
ATOM   4545 O  O   . THR A  1  610 ? 45.484  43.354 -34.227 1.00 54.97 ? 645  THR A O   1 
ATOM   4546 C  CB  . THR A  1  610 ? 48.655  42.536 -34.948 1.00 56.40 ? 645  THR A CB  1 
ATOM   4547 O  OG1 . THR A  1  610 ? 49.508  41.393 -35.060 1.00 59.11 ? 645  THR A OG1 1 
ATOM   4548 C  CG2 . THR A  1  610 ? 48.689  43.046 -33.518 1.00 58.23 ? 645  THR A CG2 1 
ATOM   4549 N  N   . ASN A  1  611 ? 46.534  44.376 -35.932 1.00 53.11 ? 646  ASN A N   1 
ATOM   4550 C  CA  . ASN A  1  611 ? 45.799  45.618 -35.773 1.00 50.98 ? 646  ASN A CA  1 
ATOM   4551 C  C   . ASN A  1  611 ? 44.703  45.787 -36.806 1.00 49.70 ? 646  ASN A C   1 
ATOM   4552 O  O   . ASN A  1  611 ? 44.338  46.908 -37.153 1.00 51.94 ? 646  ASN A O   1 
ATOM   4553 C  CB  . ASN A  1  611 ? 46.763  46.794 -35.837 1.00 55.55 ? 646  ASN A CB  1 
ATOM   4554 C  CG  . ASN A  1  611 ? 47.896  46.658 -34.844 1.00 62.36 ? 646  ASN A CG  1 
ATOM   4555 O  OD1 . ASN A  1  611 ? 49.024  47.086 -35.102 1.00 61.41 ? 646  ASN A OD1 1 
ATOM   4556 N  ND2 . ASN A  1  611 ? 47.603  46.041 -33.699 1.00 61.54 ? 646  ASN A ND2 1 
ATOM   4557 N  N   . CYS A  1  612 ? 44.173  44.669 -37.293 1.00 48.16 ? 647  CYS A N   1 
ATOM   4558 C  CA  . CYS A  1  612 ? 43.163  44.720 -38.334 1.00 51.27 ? 647  CYS A CA  1 
ATOM   4559 C  C   . CYS A  1  612 ? 41.772  45.039 -37.797 1.00 50.00 ? 647  CYS A C   1 
ATOM   4560 O  O   . CYS A  1  612 ? 41.179  44.239 -37.069 1.00 45.50 ? 647  CYS A O   1 
ATOM   4561 C  CB  . CYS A  1  612 ? 43.111  43.404 -39.110 1.00 49.76 ? 647  CYS A CB  1 
ATOM   4562 S  SG  . CYS A  1  612 ? 41.595  43.246 -40.093 1.00 48.34 ? 647  CYS A SG  1 
ATOM   4563 N  N   . VAL A  1  613 ? 41.257  46.207 -38.173 1.00 47.78 ? 648  VAL A N   1 
ATOM   4564 C  CA  . VAL A  1  613 ? 39.866  46.555 -37.918 1.00 47.71 ? 648  VAL A CA  1 
ATOM   4565 C  C   . VAL A  1  613 ? 39.191  46.964 -39.225 1.00 50.99 ? 648  VAL A C   1 
ATOM   4566 O  O   . VAL A  1  613 ? 39.696  47.831 -39.937 1.00 51.00 ? 648  VAL A O   1 
ATOM   4567 C  CB  . VAL A  1  613 ? 39.741  47.710 -36.921 1.00 45.88 ? 648  VAL A CB  1 
ATOM   4568 C  CG1 . VAL A  1  613 ? 38.265  48.114 -36.771 1.00 47.15 ? 648  VAL A CG1 1 
ATOM   4569 C  CG2 . VAL A  1  613 ? 40.347  47.317 -35.577 1.00 45.28 ? 648  VAL A CG2 1 
ATOM   4570 N  N   . ARG A  1  614 ? 38.056  46.342 -39.537 1.00 48.00 ? 649  ARG A N   1 
ATOM   4571 C  CA  . ARG A  1  614 ? 37.364  46.609 -40.799 1.00 51.61 ? 649  ARG A CA  1 
ATOM   4572 C  C   . ARG A  1  614 ? 36.028  47.306 -40.586 1.00 50.63 ? 649  ARG A C   1 
ATOM   4573 O  O   . ARG A  1  614 ? 35.242  46.884 -39.748 1.00 49.92 ? 649  ARG A O   1 
ATOM   4574 C  CB  . ARG A  1  614 ? 37.120  45.307 -41.567 1.00 50.02 ? 649  ARG A CB  1 
ATOM   4575 C  CG  . ARG A  1  614 ? 38.347  44.450 -41.755 1.00 50.68 ? 649  ARG A CG  1 
ATOM   4576 C  CD  . ARG A  1  614 ? 38.134  43.436 -42.878 1.00 54.68 ? 649  ARG A CD  1 
ATOM   4577 N  NE  . ARG A  1  614 ? 37.109  42.446 -42.557 1.00 55.93 ? 649  ARG A NE  1 
ATOM   4578 C  CZ  . ARG A  1  614 ? 35.936  42.350 -43.175 1.00 56.89 ? 649  ARG A CZ  1 
ATOM   4579 N  NH1 . ARG A  1  614 ? 35.071  41.411 -42.810 1.00 54.37 ? 649  ARG A NH1 1 
ATOM   4580 N  NH2 . ARG A  1  614 ? 35.628  43.184 -44.163 1.00 57.14 ? 649  ARG A NH2 1 
ATOM   4581 N  N   . PRO A  1  615 ? 35.756  48.364 -41.364 1.00 52.15 ? 650  PRO A N   1 
ATOM   4582 C  CA  . PRO A  1  615 ? 34.434  49.001 -41.310 1.00 52.50 ? 650  PRO A CA  1 
ATOM   4583 C  C   . PRO A  1  615 ? 33.351  48.013 -41.731 1.00 50.17 ? 650  PRO A C   1 
ATOM   4584 O  O   . PRO A  1  615 ? 33.670  46.995 -42.348 1.00 52.81 ? 650  PRO A O   1 
ATOM   4585 C  CB  . PRO A  1  615 ? 34.549  50.141 -42.328 1.00 55.32 ? 650  PRO A CB  1 
ATOM   4586 C  CG  . PRO A  1  615 ? 35.669  49.741 -43.231 1.00 54.21 ? 650  PRO A CG  1 
ATOM   4587 C  CD  . PRO A  1  615 ? 36.633  48.982 -42.374 1.00 53.67 ? 650  PRO A CD  1 
ATOM   4588 N  N   . ASP A  1  616 ? 32.098  48.301 -41.391 1.00 50.57 ? 651  ASP A N   1 
ATOM   4589 C  CA  . ASP A  1  616 ? 30.997  47.370 -41.642 1.00 50.00 ? 651  ASP A CA  1 
ATOM   4590 C  C   . ASP A  1  616 ? 29.933  48.001 -42.536 1.00 51.84 ? 651  ASP A C   1 
ATOM   4591 O  O   . ASP A  1  616 ? 29.116  48.818 -42.083 1.00 47.88 ? 651  ASP A O   1 
ATOM   4592 C  CB  . ASP A  1  616 ? 30.373  46.879 -40.326 1.00 47.72 ? 651  ASP A CB  1 
ATOM   4593 C  CG  . ASP A  1  616 ? 29.283  45.838 -40.545 1.00 49.64 ? 651  ASP A CG  1 
ATOM   4594 O  OD1 . ASP A  1  616 ? 28.628  45.865 -41.614 1.00 49.27 ? 651  ASP A OD1 1 
ATOM   4595 O  OD2 . ASP A  1  616 ? 29.075  44.990 -39.649 1.00 47.81 ? 651  ASP A OD2 1 
ATOM   4596 N  N   . VAL A  1  617 ? 29.940  47.592 -43.804 1.00 50.79 ? 652  VAL A N   1 
ATOM   4597 C  CA  . VAL A  1  617 ? 29.089  48.191 -44.831 1.00 51.65 ? 652  VAL A CA  1 
ATOM   4598 C  C   . VAL A  1  617 ? 27.585  48.026 -44.607 1.00 51.72 ? 652  VAL A C   1 
ATOM   4599 O  O   . VAL A  1  617 ? 26.789  48.449 -45.444 1.00 52.00 ? 652  VAL A O   1 
ATOM   4600 C  CB  . VAL A  1  617 ? 29.440  47.631 -46.222 1.00 51.18 ? 652  VAL A CB  1 
ATOM   4601 C  CG1 . VAL A  1  617 ? 30.876  47.982 -46.584 1.00 51.22 ? 652  VAL A CG1 1 
ATOM   4602 C  CG2 . VAL A  1  617 ? 29.234  46.126 -46.244 1.00 50.05 ? 652  VAL A CG2 1 
ATOM   4603 N  N   . ARG A  1  618 ? 27.192  47.411 -43.493 1.00 50.58 ? 653  ARG A N   1 
ATOM   4604 C  CA  . ARG A  1  618 ? 25.771  47.294 -43.162 1.00 48.71 ? 653  ARG A CA  1 
ATOM   4605 C  C   . ARG A  1  618 ? 25.351  48.396 -42.206 1.00 47.43 ? 653  ARG A C   1 
ATOM   4606 O  O   . ARG A  1  618 ? 24.168  48.672 -42.035 1.00 45.84 ? 653  ARG A O   1 
ATOM   4607 C  CB  . ARG A  1  618 ? 25.470  45.957 -42.501 1.00 52.59 ? 653  ARG A CB  1 
ATOM   4608 C  CG  . ARG A  1  618 ? 25.668  44.741 -43.355 1.00 49.14 ? 653  ARG A CG  1 
ATOM   4609 C  CD  . ARG A  1  618 ? 25.611  43.508 -42.473 1.00 48.76 ? 653  ARG A CD  1 
ATOM   4610 N  NE  . ARG A  1  618 ? 26.813  43.414 -41.649 1.00 48.07 ? 653  ARG A NE  1 
ATOM   4611 C  CZ  . ARG A  1  618 ? 27.113  42.379 -40.872 1.00 47.20 ? 653  ARG A CZ  1 
ATOM   4612 N  NH1 . ARG A  1  618 ? 26.288  41.339 -40.797 1.00 43.40 ? 653  ARG A NH1 1 
ATOM   4613 N  NH2 . ARG A  1  618 ? 28.238  42.391 -40.167 1.00 44.29 ? 653  ARG A NH2 1 
ATOM   4614 N  N   . VAL A  1  619 ? 26.337  49.010 -41.567 1.00 48.67 ? 654  VAL A N   1 
ATOM   4615 C  CA  . VAL A  1  619 ? 26.076  49.999 -40.537 1.00 48.56 ? 654  VAL A CA  1 
ATOM   4616 C  C   . VAL A  1  619 ? 26.729  51.292 -40.947 1.00 43.54 ? 654  VAL A C   1 
ATOM   4617 O  O   . VAL A  1  619 ? 27.892  51.301 -41.354 1.00 46.82 ? 654  VAL A O   1 
ATOM   4618 C  CB  . VAL A  1  619 ? 26.657  49.552 -39.174 1.00 41.38 ? 654  VAL A CB  1 
ATOM   4619 C  CG1 . VAL A  1  619 ? 26.302  50.558 -38.097 1.00 45.14 ? 654  VAL A CG1 1 
ATOM   4620 C  CG2 . VAL A  1  619 ? 26.139  48.179 -38.823 1.00 44.61 ? 654  VAL A CG2 1 
ATOM   4621 N  N   . SER A  1  620 ? 25.983  52.382 -40.822 1.00 41.38 ? 655  SER A N   1 
ATOM   4622 C  CA  . SER A  1  620 ? 26.444  53.679 -41.287 1.00 46.13 ? 655  SER A CA  1 
ATOM   4623 C  C   . SER A  1  620 ? 27.741  54.064 -40.607 1.00 48.22 ? 655  SER A C   1 
ATOM   4624 O  O   . SER A  1  620 ? 28.015  53.633 -39.487 1.00 47.30 ? 655  SER A O   1 
ATOM   4625 C  CB  . SER A  1  620 ? 25.401  54.756 -41.014 1.00 45.52 ? 655  SER A CB  1 
ATOM   4626 O  OG  . SER A  1  620 ? 25.660  55.369 -39.768 1.00 52.16 ? 655  SER A OG  1 
ATOM   4627 N  N   . PRO A  1  621 ? 28.550  54.885 -41.282 1.00 48.00 ? 656  PRO A N   1 
ATOM   4628 C  CA  . PRO A  1  621 ? 29.790  55.368 -40.677 1.00 48.96 ? 656  PRO A CA  1 
ATOM   4629 C  C   . PRO A  1  621 ? 29.481  56.156 -39.409 1.00 48.15 ? 656  PRO A C   1 
ATOM   4630 O  O   . PRO A  1  621 ? 30.268  56.138 -38.463 1.00 44.77 ? 656  PRO A O   1 
ATOM   4631 C  CB  . PRO A  1  621 ? 30.360  56.303 -41.747 1.00 51.25 ? 656  PRO A CB  1 
ATOM   4632 C  CG  . PRO A  1  621 ? 29.751  55.824 -43.028 1.00 50.09 ? 656  PRO A CG  1 
ATOM   4633 C  CD  . PRO A  1  621 ? 28.379  55.362 -42.665 1.00 50.09 ? 656  PRO A CD  1 
ATOM   4634 N  N   . GLY A  1  622 ? 28.340  56.835 -39.398 1.00 44.00 ? 657  GLY A N   1 
ATOM   4635 C  CA  . GLY A  1  622 ? 27.973  57.678 -38.278 1.00 42.34 ? 657  GLY A CA  1 
ATOM   4636 C  C   . GLY A  1  622 ? 27.547  56.893 -37.048 1.00 44.52 ? 657  GLY A C   1 
ATOM   4637 O  O   . GLY A  1  622 ? 27.495  57.434 -35.952 1.00 41.31 ? 657  GLY A O   1 
ATOM   4638 N  N   . PHE A  1  623 ? 27.230  55.617 -37.237 1.00 46.87 ? 658  PHE A N   1 
ATOM   4639 C  CA  . PHE A  1  623 ? 26.830  54.749 -36.139 1.00 42.37 ? 658  PHE A CA  1 
ATOM   4640 C  C   . PHE A  1  623 ? 27.932  53.742 -35.837 1.00 43.35 ? 658  PHE A C   1 
ATOM   4641 O  O   . PHE A  1  623 ? 27.660  52.635 -35.360 1.00 42.58 ? 658  PHE A O   1 
ATOM   4642 C  CB  . PHE A  1  623 ? 25.541  54.004 -36.492 1.00 41.64 ? 658  PHE A CB  1 
ATOM   4643 C  CG  . PHE A  1  623 ? 24.323  54.872 -36.500 1.00 45.72 ? 658  PHE A CG  1 
ATOM   4644 C  CD1 . PHE A  1  623 ? 23.318  54.669 -37.430 1.00 48.40 ? 658  PHE A CD1 1 
ATOM   4645 C  CD2 . PHE A  1  623 ? 24.180  55.898 -35.577 1.00 45.57 ? 658  PHE A CD2 1 
ATOM   4646 C  CE1 . PHE A  1  623 ? 22.193  55.469 -37.439 1.00 48.32 ? 658  PHE A CE1 1 
ATOM   4647 C  CE2 . PHE A  1  623 ? 23.056  56.699 -35.575 1.00 45.73 ? 658  PHE A CE2 1 
ATOM   4648 C  CZ  . PHE A  1  623 ? 22.062  56.489 -36.513 1.00 50.72 ? 658  PHE A CZ  1 
ATOM   4649 N  N   . SER A  1  624 ? 29.173  54.117 -36.129 1.00 40.67 ? 659  SER A N   1 
ATOM   4650 C  CA  . SER A  1  624 ? 30.305  53.218 -35.928 1.00 42.00 ? 659  SER A CA  1 
ATOM   4651 C  C   . SER A  1  624 ? 31.344  53.840 -34.998 1.00 43.04 ? 659  SER A C   1 
ATOM   4652 O  O   . SER A  1  624 ? 31.427  55.062 -34.888 1.00 43.22 ? 659  SER A O   1 
ATOM   4653 C  CB  . SER A  1  624 ? 30.958  52.890 -37.274 1.00 43.53 ? 659  SER A CB  1 
ATOM   4654 O  OG  . SER A  1  624 ? 30.011  52.358 -38.182 1.00 43.03 ? 659  SER A OG  1 
ATOM   4655 N  N   . GLN A  1  625 ? 32.133  52.999 -34.330 1.00 39.51 ? 660  GLN A N   1 
ATOM   4656 C  CA  . GLN A  1  625 ? 33.295  53.485 -33.596 1.00 41.73 ? 660  GLN A CA  1 
ATOM   4657 C  C   . GLN A  1  625 ? 34.358  53.813 -34.638 1.00 46.48 ? 660  GLN A C   1 
ATOM   4658 O  O   . GLN A  1  625 ? 34.206  53.478 -35.810 1.00 46.97 ? 660  GLN A O   1 
ATOM   4659 C  CB  . GLN A  1  625 ? 33.837  52.419 -32.636 1.00 37.86 ? 660  GLN A CB  1 
ATOM   4660 C  CG  . GLN A  1  625 ? 32.835  51.945 -31.580 1.00 38.02 ? 660  GLN A CG  1 
ATOM   4661 C  CD  . GLN A  1  625 ? 33.390  50.814 -30.714 1.00 36.43 ? 660  GLN A CD  1 
ATOM   4662 O  OE1 . GLN A  1  625 ? 34.569  50.812 -30.376 1.00 36.15 ? 660  GLN A OE1 1 
ATOM   4663 N  NE2 . GLN A  1  625 ? 32.539  49.850 -30.360 1.00 35.05 ? 660  GLN A NE2 1 
ATOM   4664 N  N   . ASN A  1  626 ? 35.430  54.467 -34.217 1.00 46.60 ? 661  ASN A N   1 
ATOM   4665 C  CA  . ASN A  1  626 ? 36.544  54.717 -35.117 1.00 46.78 ? 661  ASN A CA  1 
ATOM   4666 C  C   . ASN A  1  626 ? 37.859  54.406 -34.437 1.00 48.51 ? 661  ASN A C   1 
ATOM   4667 O  O   . ASN A  1  626 ? 38.010  54.617 -33.235 1.00 44.37 ? 661  ASN A O   1 
ATOM   4668 C  CB  . ASN A  1  626 ? 36.530  56.157 -35.606 1.00 50.03 ? 661  ASN A CB  1 
ATOM   4669 C  CG  . ASN A  1  626 ? 36.874  57.132 -34.526 1.00 47.44 ? 661  ASN A CG  1 
ATOM   4670 O  OD1 . ASN A  1  626 ? 38.052  57.382 -34.255 1.00 50.77 ? 661  ASN A OD1 1 
ATOM   4671 N  ND2 . ASN A  1  626 ? 35.851  57.704 -33.895 1.00 48.24 ? 661  ASN A ND2 1 
ATOM   4672 N  N   . CYS A  1  627 ? 38.810  53.891 -35.205 1.00 46.07 ? 662  CYS A N   1 
ATOM   4673 C  CA  . CYS A  1  627 ? 40.049  53.416 -34.618 1.00 46.40 ? 662  CYS A CA  1 
ATOM   4674 C  C   . CYS A  1  627 ? 40.957  54.559 -34.184 1.00 45.16 ? 662  CYS A C   1 
ATOM   4675 O  O   . CYS A  1  627 ? 41.830  54.374 -33.333 1.00 44.12 ? 662  CYS A O   1 
ATOM   4676 C  CB  . CYS A  1  627 ? 40.757  52.457 -35.576 1.00 46.43 ? 662  CYS A CB  1 
ATOM   4677 S  SG  . CYS A  1  627 ? 39.731  51.028 -36.027 1.00 55.65 ? 662  CYS A SG  1 
ATOM   4678 N  N   . LEU A  1  628 ? 40.749  55.743 -34.756 1.00 44.88 ? 663  LEU A N   1 
ATOM   4679 C  CA  . LEU A  1  628 ? 41.552  56.904 -34.383 1.00 47.12 ? 663  LEU A CA  1 
ATOM   4680 C  C   . LEU A  1  628 ? 41.446  57.187 -32.889 1.00 47.50 ? 663  LEU A C   1 
ATOM   4681 O  O   . LEU A  1  628 ? 42.444  57.512 -32.226 1.00 46.31 ? 663  LEU A O   1 
ATOM   4682 C  CB  . LEU A  1  628 ? 41.131  58.154 -35.162 1.00 50.01 ? 663  LEU A CB  1 
ATOM   4683 C  CG  . LEU A  1  628 ? 41.960  59.387 -34.787 1.00 50.41 ? 663  LEU A CG  1 
ATOM   4684 C  CD1 . LEU A  1  628 ? 43.307  59.341 -35.486 1.00 53.17 ? 663  LEU A CD1 1 
ATOM   4685 C  CD2 . LEU A  1  628 ? 41.230  60.695 -35.096 1.00 54.11 ? 663  LEU A CD2 1 
ATOM   4686 N  N   . ALA A  1  629 ? 40.227  57.085 -32.368 1.00 44.41 ? 664  ALA A N   1 
ATOM   4687 C  CA  . ALA A  1  629 ? 39.997  57.319 -30.946 1.00 44.79 ? 664  ALA A CA  1 
ATOM   4688 C  C   . ALA A  1  629 ? 40.891  56.384 -30.140 1.00 40.58 ? 664  ALA A C   1 
ATOM   4689 O  O   . ALA A  1  629 ? 41.549  56.803 -29.188 1.00 41.54 ? 664  ALA A O   1 
ATOM   4690 C  CB  . ALA A  1  629 ? 38.540  57.095 -30.596 1.00 43.44 ? 664  ALA A CB  1 
ATOM   4691 N  N   . TYR A  1  630 ? 40.921  55.113 -30.526 1.00 40.85 ? 665  TYR A N   1 
ATOM   4692 C  CA  . TYR A  1  630 ? 41.811  54.185 -29.850 1.00 37.98 ? 665  TYR A CA  1 
ATOM   4693 C  C   . TYR A  1  630 ? 43.263  54.567 -30.063 1.00 45.68 ? 665  TYR A C   1 
ATOM   4694 O  O   . TYR A  1  630 ? 43.973  54.834 -29.103 1.00 42.46 ? 665  TYR A O   1 
ATOM   4695 C  CB  . TYR A  1  630 ? 41.534  52.745 -30.252 1.00 40.38 ? 665  TYR A CB  1 
ATOM   4696 C  CG  . TYR A  1  630 ? 40.186  52.294 -29.759 1.00 40.25 ? 665  TYR A CG  1 
ATOM   4697 C  CD1 . TYR A  1  630 ? 39.134  52.130 -30.635 1.00 40.07 ? 665  TYR A CD1 1 
ATOM   4698 C  CD2 . TYR A  1  630 ? 39.953  52.084 -28.399 1.00 38.22 ? 665  TYR A CD2 1 
ATOM   4699 C  CE1 . TYR A  1  630 ? 37.891  51.733 -30.194 1.00 38.94 ? 665  TYR A CE1 1 
ATOM   4700 C  CE2 . TYR A  1  630 ? 38.704  51.690 -27.944 1.00 37.83 ? 665  TYR A CE2 1 
ATOM   4701 C  CZ  . TYR A  1  630 ? 37.680  51.512 -28.850 1.00 33.09 ? 665  TYR A CZ  1 
ATOM   4702 O  OH  . TYR A  1  630 ? 36.424  51.127 -28.452 1.00 32.13 ? 665  TYR A OH  1 
ATOM   4703 N  N   . LYS A  1  631 ? 43.702  54.646 -31.314 1.00 42.91 ? 666  LYS A N   1 
ATOM   4704 C  CA  . LYS A  1  631 ? 45.071  55.079 -31.575 1.00 44.12 ? 666  LYS A CA  1 
ATOM   4705 C  C   . LYS A  1  631 ? 45.489  56.238 -30.651 1.00 43.99 ? 666  LYS A C   1 
ATOM   4706 O  O   . LYS A  1  631 ? 46.624  56.279 -30.178 1.00 47.03 ? 666  LYS A O   1 
ATOM   4707 C  CB  . LYS A  1  631 ? 45.237  55.473 -33.049 1.00 43.68 ? 666  LYS A CB  1 
ATOM   4708 N  N   . ASN A  1  632 ? 44.561  57.156 -30.378 1.00 43.84 ? 667  ASN A N   1 
ATOM   4709 C  CA  . ASN A  1  632 ? 44.853  58.378 -29.621 1.00 43.73 ? 667  ASN A CA  1 
ATOM   4710 C  C   . ASN A  1  632 ? 44.740  58.308 -28.100 1.00 47.41 ? 667  ASN A C   1 
ATOM   4711 O  O   . ASN A  1  632 ? 45.397  59.080 -27.390 1.00 44.77 ? 667  ASN A O   1 
ATOM   4712 C  CB  . ASN A  1  632 ? 43.982  59.530 -30.113 1.00 45.65 ? 667  ASN A CB  1 
ATOM   4713 C  CG  . ASN A  1  632 ? 44.563  60.211 -31.341 1.00 53.65 ? 667  ASN A CG  1 
ATOM   4714 O  OD1 . ASN A  1  632 ? 44.047  61.233 -31.799 1.00 55.44 ? 667  ASN A OD1 1 
ATOM   4715 N  ND2 . ASN A  1  632 ? 45.649  59.649 -31.875 1.00 49.23 ? 667  ASN A ND2 1 
ATOM   4716 N  N   . ASP A  1  633 ? 43.892  57.413 -27.600 1.00 44.39 ? 668  ASP A N   1 
ATOM   4717 C  CA  . ASP A  1  633 ? 43.695  57.266 -26.157 1.00 40.61 ? 668  ASP A CA  1 
ATOM   4718 C  C   . ASP A  1  633 ? 44.875  56.500 -25.600 1.00 37.29 ? 668  ASP A C   1 
ATOM   4719 O  O   . ASP A  1  633 ? 45.025  55.345 -25.915 1.00 38.37 ? 668  ASP A O   1 
ATOM   4720 C  CB  . ASP A  1  633 ? 42.410  56.477 -25.908 1.00 39.59 ? 668  ASP A CB  1 
ATOM   4721 C  CG  . ASP A  1  633 ? 42.005  56.451 -24.440 1.00 39.81 ? 668  ASP A CG  1 
ATOM   4722 O  OD1 . ASP A  1  633 ? 42.872  56.153 -23.584 1.00 38.23 ? 668  ASP A OD1 1 
ATOM   4723 O  OD2 . ASP A  1  633 ? 40.816  56.725 -24.146 1.00 39.16 ? 668  ASP A OD2 1 
ATOM   4724 N  N   . LYS A  1  634 ? 45.719  57.122 -24.782 1.00 38.09 ? 669  LYS A N   1 
ATOM   4725 C  CA  . LYS A  1  634 ? 46.925  56.444 -24.305 1.00 36.65 ? 669  LYS A CA  1 
ATOM   4726 C  C   . LYS A  1  634 ? 46.645  55.279 -23.339 1.00 40.45 ? 669  LYS A C   1 
ATOM   4727 O  O   . LYS A  1  634 ? 47.518  54.440 -23.088 1.00 34.99 ? 669  LYS A O   1 
ATOM   4728 C  CB  . LYS A  1  634 ? 47.891  57.446 -23.653 1.00 39.61 ? 669  LYS A CB  1 
ATOM   4729 N  N   . GLN A  1  635 ? 45.431  55.231 -22.797 1.00 38.87 ? 670  GLN A N   1 
ATOM   4730 C  CA  . GLN A  1  635 ? 45.108  54.274 -21.737 1.00 37.09 ? 670  GLN A CA  1 
ATOM   4731 C  C   . GLN A  1  635 ? 44.177  53.133 -22.149 1.00 38.86 ? 670  GLN A C   1 
ATOM   4732 O  O   . GLN A  1  635 ? 44.221  52.045 -21.571 1.00 37.45 ? 670  GLN A O   1 
ATOM   4733 C  CB  . GLN A  1  635 ? 44.523  55.015 -20.535 1.00 36.35 ? 670  GLN A CB  1 
ATOM   4734 C  CG  . GLN A  1  635 ? 45.498  56.026 -19.943 1.00 43.23 ? 670  GLN A CG  1 
ATOM   4735 C  CD  . GLN A  1  635 ? 45.092  56.498 -18.565 1.00 43.02 ? 670  GLN A CD  1 
ATOM   4736 O  OE1 . GLN A  1  635 ? 44.994  55.701 -17.629 1.00 48.37 ? 670  GLN A OE1 1 
ATOM   4737 N  NE2 . GLN A  1  635 ? 44.853  57.800 -18.430 1.00 38.06 ? 670  GLN A NE2 1 
ATOM   4738 N  N   . MET A  1  636 ? 43.356  53.371 -23.164 1.00 35.01 ? 671  MET A N   1 
ATOM   4739 C  CA  . MET A  1  636 ? 42.314  52.428 -23.533 1.00 31.48 ? 671  MET A CA  1 
ATOM   4740 C  C   . MET A  1  636 ? 42.615  51.706 -24.824 1.00 38.56 ? 671  MET A C   1 
ATOM   4741 O  O   . MET A  1  636 ? 42.849  52.356 -25.830 1.00 39.13 ? 671  MET A O   1 
ATOM   4742 C  CB  . MET A  1  636 ? 41.009  53.195 -23.733 1.00 34.89 ? 671  MET A CB  1 
ATOM   4743 C  CG  . MET A  1  636 ? 39.854  52.308 -24.135 1.00 32.37 ? 671  MET A CG  1 
ATOM   4744 S  SD  . MET A  1  636 ? 39.341  51.309 -22.722 1.00 31.04 ? 671  MET A SD  1 
ATOM   4745 C  CE  . MET A  1  636 ? 38.601  52.554 -21.683 1.00 34.27 ? 671  MET A CE  1 
ATOM   4746 N  N   . SER A  1  637 ? 42.569  50.379 -24.822 1.00 35.62 ? 672  SER A N   1 
ATOM   4747 C  CA  . SER A  1  637 ? 42.686  49.611 -26.058 1.00 33.98 ? 672  SER A CA  1 
ATOM   4748 C  C   . SER A  1  637 ? 41.308  49.074 -26.489 1.00 34.68 ? 672  SER A C   1 
ATOM   4749 O  O   . SER A  1  637 ? 40.276  49.678 -26.172 1.00 32.12 ? 672  SER A O   1 
ATOM   4750 C  CB  . SER A  1  637 ? 43.713  48.490 -25.879 1.00 38.37 ? 672  SER A CB  1 
ATOM   4751 O  OG  . SER A  1  637 ? 43.870  47.708 -27.049 1.00 37.35 ? 672  SER A OG  1 
ATOM   4752 N  N   . TYR A  1  638 ? 41.279  47.967 -27.225 1.00 33.53 ? 673  TYR A N   1 
ATOM   4753 C  CA  . TYR A  1  638 ? 40.010  47.400 -27.637 1.00 31.00 ? 673  TYR A CA  1 
ATOM   4754 C  C   . TYR A  1  638 ? 40.087  45.889 -27.677 1.00 32.19 ? 673  TYR A C   1 
ATOM   4755 O  O   . TYR A  1  638 ? 41.176  45.309 -27.652 1.00 37.17 ? 673  TYR A O   1 
ATOM   4756 C  CB  . TYR A  1  638 ? 39.540  47.979 -28.993 1.00 36.61 ? 673  TYR A CB  1 
ATOM   4757 C  CG  . TYR A  1  638 ? 40.435  47.609 -30.156 1.00 36.09 ? 673  TYR A CG  1 
ATOM   4758 C  CD1 . TYR A  1  638 ? 40.266  46.404 -30.833 1.00 38.33 ? 673  TYR A CD1 1 
ATOM   4759 C  CD2 . TYR A  1  638 ? 41.463  48.451 -30.560 1.00 40.24 ? 673  TYR A CD2 1 
ATOM   4760 C  CE1 . TYR A  1  638 ? 41.100  46.044 -31.892 1.00 40.75 ? 673  TYR A CE1 1 
ATOM   4761 C  CE2 . TYR A  1  638 ? 42.299  48.102 -31.623 1.00 45.02 ? 673  TYR A CE2 1 
ATOM   4762 C  CZ  . TYR A  1  638 ? 42.111  46.899 -32.281 1.00 45.45 ? 673  TYR A CZ  1 
ATOM   4763 O  OH  . TYR A  1  638 ? 42.934  46.546 -33.334 1.00 48.38 ? 673  TYR A OH  1 
ATOM   4764 N  N   . GLY A  1  639 ? 38.927  45.242 -27.707 1.00 30.43 ? 674  GLY A N   1 
ATOM   4765 C  CA  . GLY A  1  639 ? 38.884  43.800 -27.854 1.00 31.66 ? 674  GLY A CA  1 
ATOM   4766 C  C   . GLY A  1  639 ? 37.718  43.420 -28.723 1.00 32.03 ? 674  GLY A C   1 
ATOM   4767 O  O   . GLY A  1  639 ? 37.006  44.286 -29.209 1.00 34.20 ? 674  GLY A O   1 
ATOM   4768 N  N   . PHE A  1  640 ? 37.498  42.127 -28.905 1.00 31.86 ? 675  PHE A N   1 
ATOM   4769 C  CA  . PHE A  1  640 ? 36.375  41.681 -29.701 1.00 37.02 ? 675  PHE A CA  1 
ATOM   4770 C  C   . PHE A  1  640 ? 35.470  40.744 -28.902 1.00 31.79 ? 675  PHE A C   1 
ATOM   4771 O  O   . PHE A  1  640 ? 35.954  39.894 -28.156 1.00 33.96 ? 675  PHE A O   1 
ATOM   4772 C  CB  . PHE A  1  640 ? 36.879  40.994 -30.975 1.00 37.51 ? 675  PHE A CB  1 
ATOM   4773 C  CG  . PHE A  1  640 ? 37.779  41.866 -31.815 1.00 38.15 ? 675  PHE A CG  1 
ATOM   4774 C  CD1 . PHE A  1  640 ? 37.271  42.979 -32.469 1.00 38.18 ? 675  PHE A CD1 1 
ATOM   4775 C  CD2 . PHE A  1  640 ? 39.124  41.573 -31.948 1.00 38.49 ? 675  PHE A CD2 1 
ATOM   4776 C  CE1 . PHE A  1  640 ? 38.089  43.783 -33.245 1.00 38.94 ? 675  PHE A CE1 1 
ATOM   4777 C  CE2 . PHE A  1  640 ? 39.949  42.377 -32.722 1.00 40.30 ? 675  PHE A CE2 1 
ATOM   4778 C  CZ  . PHE A  1  640 ? 39.427  43.484 -33.370 1.00 40.18 ? 675  PHE A CZ  1 
ATOM   4779 N  N   . LEU A  1  641 ? 34.161  40.900 -29.060 1.00 31.84 ? 676  LEU A N   1 
ATOM   4780 C  CA  . LEU A  1  641 ? 33.220  39.994 -28.404 1.00 28.97 ? 676  LEU A CA  1 
ATOM   4781 C  C   . LEU A  1  641 ? 33.238  38.561 -28.967 1.00 35.77 ? 676  LEU A C   1 
ATOM   4782 O  O   . LEU A  1  641 ? 33.363  37.592 -28.206 1.00 28.36 ? 676  LEU A O   1 
ATOM   4783 C  CB  . LEU A  1  641 ? 31.819  40.583 -28.388 1.00 30.98 ? 676  LEU A CB  1 
ATOM   4784 C  CG  . LEU A  1  641 ? 31.706  41.876 -27.579 1.00 31.52 ? 676  LEU A CG  1 
ATOM   4785 C  CD1 . LEU A  1  641 ? 30.303  42.431 -27.692 1.00 28.08 ? 676  LEU A CD1 1 
ATOM   4786 C  CD2 . LEU A  1  641 ? 32.081  41.636 -26.109 1.00 30.63 ? 676  LEU A CD2 1 
ATOM   4787 N  N   . PHE A  1  642 ? 33.128  38.415 -30.291 1.00 33.66 ? 677  PHE A N   1 
ATOM   4788 C  CA  . PHE A  1  642 ? 33.441  37.127 -30.898 1.00 36.56 ? 677  PHE A CA  1 
ATOM   4789 C  C   . PHE A  1  642 ? 34.940  37.073 -31.149 1.00 39.02 ? 677  PHE A C   1 
ATOM   4790 O  O   . PHE A  1  642 ? 35.488  37.924 -31.851 1.00 40.54 ? 677  PHE A O   1 
ATOM   4791 C  CB  . PHE A  1  642 ? 32.679  36.869 -32.203 1.00 35.34 ? 677  PHE A CB  1 
ATOM   4792 C  CG  . PHE A  1  642 ? 33.018  35.544 -32.816 1.00 38.67 ? 677  PHE A CG  1 
ATOM   4793 C  CD1 . PHE A  1  642 ? 32.483  34.375 -32.299 1.00 37.52 ? 677  PHE A CD1 1 
ATOM   4794 C  CD2 . PHE A  1  642 ? 33.923  35.457 -33.863 1.00 40.82 ? 677  PHE A CD2 1 
ATOM   4795 C  CE1 . PHE A  1  642 ? 32.810  33.143 -32.831 1.00 40.47 ? 677  PHE A CE1 1 
ATOM   4796 C  CE2 . PHE A  1  642 ? 34.256  34.223 -34.406 1.00 40.14 ? 677  PHE A CE2 1 
ATOM   4797 C  CZ  . PHE A  1  642 ? 33.700  33.070 -33.892 1.00 42.71 ? 677  PHE A CZ  1 
ATOM   4798 N  N   . PRO A  1  643 ? 35.610  36.072 -30.568 1.00 38.68 ? 678  PRO A N   1 
ATOM   4799 C  CA  . PRO A  1  643 ? 37.068  35.991 -30.634 1.00 42.12 ? 678  PRO A CA  1 
ATOM   4800 C  C   . PRO A  1  643 ? 37.545  35.465 -31.996 1.00 43.11 ? 678  PRO A C   1 
ATOM   4801 O  O   . PRO A  1  643 ? 37.088  34.409 -32.437 1.00 44.43 ? 678  PRO A O   1 
ATOM   4802 C  CB  . PRO A  1  643 ? 37.395  34.978 -29.538 1.00 39.04 ? 678  PRO A CB  1 
ATOM   4803 C  CG  . PRO A  1  643 ? 36.236  34.063 -29.540 1.00 38.15 ? 678  PRO A CG  1 
ATOM   4804 C  CD  . PRO A  1  643 ? 35.026  34.894 -29.905 1.00 38.86 ? 678  PRO A CD  1 
ATOM   4805 N  N   . PRO A  1  644 ? 38.451  36.201 -32.656 1.00 45.76 ? 679  PRO A N   1 
ATOM   4806 C  CA  . PRO A  1  644 ? 38.981  35.710 -33.932 1.00 48.47 ? 679  PRO A CA  1 
ATOM   4807 C  C   . PRO A  1  644 ? 39.544  34.303 -33.758 1.00 51.82 ? 679  PRO A C   1 
ATOM   4808 O  O   . PRO A  1  644 ? 39.458  33.503 -34.691 1.00 53.18 ? 679  PRO A O   1 
ATOM   4809 C  CB  . PRO A  1  644 ? 40.102  36.705 -34.252 1.00 50.95 ? 679  PRO A CB  1 
ATOM   4810 C  CG  . PRO A  1  644 ? 39.691  37.966 -33.562 1.00 50.05 ? 679  PRO A CG  1 
ATOM   4811 C  CD  . PRO A  1  644 ? 39.013  37.513 -32.288 1.00 44.04 ? 679  PRO A CD  1 
ATOM   4812 N  N   . TYR A  1  645 ? 40.081  34.005 -32.575 1.00 46.31 ? 680  TYR A N   1 
ATOM   4813 C  CA  . TYR A  1  645 ? 40.674  32.697 -32.301 1.00 46.98 ? 680  TYR A CA  1 
ATOM   4814 C  C   . TYR A  1  645 ? 39.742  31.516 -32.577 1.00 48.65 ? 680  TYR A C   1 
ATOM   4815 O  O   . TYR A  1  645 ? 40.197  30.379 -32.677 1.00 53.31 ? 680  TYR A O   1 
ATOM   4816 C  CB  . TYR A  1  645 ? 41.177  32.613 -30.857 1.00 46.67 ? 680  TYR A CB  1 
ATOM   4817 C  CG  . TYR A  1  645 ? 41.996  33.800 -30.397 1.00 49.94 ? 680  TYR A CG  1 
ATOM   4818 C  CD1 . TYR A  1  645 ? 41.500  34.677 -29.440 1.00 44.94 ? 680  TYR A CD1 1 
ATOM   4819 C  CD2 . TYR A  1  645 ? 43.267  34.046 -30.914 1.00 48.58 ? 680  TYR A CD2 1 
ATOM   4820 C  CE1 . TYR A  1  645 ? 42.236  35.763 -29.014 1.00 44.75 ? 680  TYR A CE1 1 
ATOM   4821 C  CE2 . TYR A  1  645 ? 44.013  35.132 -30.488 1.00 48.57 ? 680  TYR A CE2 1 
ATOM   4822 C  CZ  . TYR A  1  645 ? 43.490  35.990 -29.536 1.00 48.57 ? 680  TYR A CZ  1 
ATOM   4823 O  OH  . TYR A  1  645 ? 44.214  37.078 -29.097 1.00 46.39 ? 680  TYR A OH  1 
ATOM   4824 N  N   . LEU A  1  646 ? 38.442  31.767 -32.694 1.00 45.61 ? 681  LEU A N   1 
ATOM   4825 C  CA  . LEU A  1  646 ? 37.491  30.666 -32.831 1.00 49.47 ? 681  LEU A CA  1 
ATOM   4826 C  C   . LEU A  1  646 ? 36.765  30.662 -34.179 1.00 48.38 ? 681  LEU A C   1 
ATOM   4827 O  O   . LEU A  1  646 ? 35.767  29.960 -34.363 1.00 47.25 ? 681  LEU A O   1 
ATOM   4828 C  CB  . LEU A  1  646 ? 36.491  30.668 -31.663 1.00 48.34 ? 681  LEU A CB  1 
ATOM   4829 C  CG  . LEU A  1  646 ? 37.114  30.450 -30.281 1.00 47.47 ? 681  LEU A CG  1 
ATOM   4830 C  CD1 . LEU A  1  646 ? 36.093  30.664 -29.159 1.00 44.87 ? 681  LEU A CD1 1 
ATOM   4831 C  CD2 . LEU A  1  646 ? 37.740  29.066 -30.174 1.00 48.89 ? 681  LEU A CD2 1 
ATOM   4832 N  N   . SER A  1  647 ? 37.284  31.454 -35.112 1.00 50.13 ? 682  SER A N   1 
ATOM   4833 C  CA  . SER A  1  647 ? 36.751  31.536 -36.468 1.00 50.53 ? 682  SER A CA  1 
ATOM   4834 C  C   . SER A  1  647 ? 36.630  30.167 -37.128 1.00 50.86 ? 682  SER A C   1 
ATOM   4835 O  O   . SER A  1  647 ? 37.404  29.260 -36.837 1.00 50.44 ? 682  SER A O   1 
ATOM   4836 C  CB  . SER A  1  647 ? 37.658  32.419 -37.313 1.00 52.59 ? 682  SER A CB  1 
ATOM   4837 O  OG  . SER A  1  647 ? 38.977  31.903 -37.316 1.00 54.46 ? 682  SER A OG  1 
ATOM   4838 N  N   . SER A  1  648 ? 35.653  30.028 -38.019 1.00 50.47 ? 683  SER A N   1 
ATOM   4839 C  CA  . SER A  1  648 ? 35.408  28.769 -38.708 1.00 49.86 ? 683  SER A CA  1 
ATOM   4840 C  C   . SER A  1  648 ? 36.293  28.645 -39.942 1.00 53.11 ? 683  SER A C   1 
ATOM   4841 O  O   . SER A  1  648 ? 36.485  27.547 -40.458 1.00 55.46 ? 683  SER A O   1 
ATOM   4842 C  CB  . SER A  1  648 ? 33.945  28.660 -39.123 1.00 49.08 ? 683  SER A CB  1 
ATOM   4843 O  OG  . SER A  1  648 ? 33.583  29.714 -40.002 1.00 46.49 ? 683  SER A OG  1 
ATOM   4844 N  N   . SER A  1  649 ? 36.820  29.776 -40.408 1.00 55.63 ? 684  SER A N   1 
ATOM   4845 C  CA  . SER A  1  649 ? 37.677  29.814 -41.594 1.00 54.55 ? 684  SER A CA  1 
ATOM   4846 C  C   . SER A  1  649 ? 38.180  31.233 -41.835 1.00 56.70 ? 684  SER A C   1 
ATOM   4847 O  O   . SER A  1  649 ? 37.492  32.198 -41.520 1.00 54.23 ? 684  SER A O   1 
ATOM   4848 C  CB  . SER A  1  649 ? 36.912  29.322 -42.817 1.00 51.94 ? 684  SER A CB  1 
ATOM   4849 O  OG  . SER A  1  649 ? 35.904  30.250 -43.194 1.00 57.72 ? 684  SER A OG  1 
ATOM   4850 N  N   . PRO A  1  650 ? 39.393  31.368 -42.390 1.00 57.92 ? 685  PRO A N   1 
ATOM   4851 C  CA  . PRO A  1  650 ? 39.980  32.695 -42.620 1.00 55.68 ? 685  PRO A CA  1 
ATOM   4852 C  C   . PRO A  1  650 ? 39.022  33.694 -43.291 1.00 56.95 ? 685  PRO A C   1 
ATOM   4853 O  O   . PRO A  1  650 ? 39.032  34.878 -42.942 1.00 55.15 ? 685  PRO A O   1 
ATOM   4854 C  CB  . PRO A  1  650 ? 41.182  32.381 -43.504 1.00 60.65 ? 685  PRO A CB  1 
ATOM   4855 C  CG  . PRO A  1  650 ? 41.626  31.020 -43.005 1.00 61.70 ? 685  PRO A CG  1 
ATOM   4856 C  CD  . PRO A  1  650 ? 40.351  30.283 -42.674 1.00 61.50 ? 685  PRO A CD  1 
ATOM   4857 N  N   . GLU A  1  651 ? 38.197  33.233 -44.224 1.00 53.63 ? 686  GLU A N   1 
ATOM   4858 C  CA  . GLU A  1  651 ? 37.175  34.104 -44.799 1.00 55.98 ? 686  GLU A CA  1 
ATOM   4859 C  C   . GLU A  1  651 ? 36.220  34.599 -43.701 1.00 55.44 ? 686  GLU A C   1 
ATOM   4860 O  O   . GLU A  1  651 ? 35.780  35.755 -43.707 1.00 48.28 ? 686  GLU A O   1 
ATOM   4861 C  CB  . GLU A  1  651 ? 36.405  33.366 -45.889 1.00 54.46 ? 686  GLU A CB  1 
ATOM   4862 C  CG  . GLU A  1  651 ? 36.611  31.863 -45.866 1.00 52.73 ? 686  GLU A CG  1 
ATOM   4863 C  CD  . GLU A  1  651 ? 35.474  31.126 -46.538 1.00 56.36 ? 686  GLU A CD  1 
ATOM   4864 O  OE1 . GLU A  1  651 ? 34.544  31.801 -47.038 1.00 57.95 ? 686  GLU A OE1 1 
ATOM   4865 O  OE2 . GLU A  1  651 ? 35.505  29.878 -46.565 1.00 54.93 ? 686  GLU A OE2 1 
ATOM   4866 N  N   . ALA A  1  652 ? 35.910  33.706 -42.764 1.00 55.58 ? 687  ALA A N   1 
ATOM   4867 C  CA  . ALA A  1  652 ? 35.076  34.029 -41.609 1.00 56.17 ? 687  ALA A CA  1 
ATOM   4868 C  C   . ALA A  1  652 ? 35.837  34.886 -40.603 1.00 52.55 ? 687  ALA A C   1 
ATOM   4869 O  O   . ALA A  1  652 ? 35.362  35.939 -40.190 1.00 52.98 ? 687  ALA A O   1 
ATOM   4870 C  CB  . ALA A  1  652 ? 34.588  32.751 -40.946 1.00 55.28 ? 687  ALA A CB  1 
ATOM   4871 N  N   . LYS A  1  653 ? 37.021  34.421 -40.225 1.00 50.74 ? 688  LYS A N   1 
ATOM   4872 C  CA  . LYS A  1  653 ? 37.870  35.103 -39.253 1.00 52.62 ? 688  LYS A CA  1 
ATOM   4873 C  C   . LYS A  1  653 ? 37.985  36.595 -39.502 1.00 54.30 ? 688  LYS A C   1 
ATOM   4874 O  O   . LYS A  1  653 ? 38.173  37.376 -38.564 1.00 52.61 ? 688  LYS A O   1 
ATOM   4875 C  CB  . LYS A  1  653 ? 39.268  34.497 -39.265 1.00 53.46 ? 688  LYS A CB  1 
ATOM   4876 C  CG  . LYS A  1  653 ? 40.176  35.018 -38.170 1.00 55.98 ? 688  LYS A CG  1 
ATOM   4877 C  CD  . LYS A  1  653 ? 41.610  34.586 -38.407 1.00 55.66 ? 688  LYS A CD  1 
ATOM   4878 C  CE  . LYS A  1  653 ? 42.176  33.823 -37.230 1.00 56.56 ? 688  LYS A CE  1 
ATOM   4879 N  NZ  . LYS A  1  653 ? 41.370  32.617 -36.920 1.00 57.31 ? 688  LYS A NZ  1 
ATOM   4880 N  N   . TYR A  1  654 ? 37.894  36.984 -40.770 1.00 54.56 ? 689  TYR A N   1 
ATOM   4881 C  CA  . TYR A  1  654 ? 37.985  38.385 -41.148 1.00 52.39 ? 689  TYR A CA  1 
ATOM   4882 C  C   . TYR A  1  654 ? 36.763  39.155 -40.670 1.00 50.07 ? 689  TYR A C   1 
ATOM   4883 O  O   . TYR A  1  654 ? 36.811  40.372 -40.520 1.00 47.86 ? 689  TYR A O   1 
ATOM   4884 C  CB  . TYR A  1  654 ? 38.151  38.525 -42.669 1.00 56.48 ? 689  TYR A CB  1 
ATOM   4885 C  CG  . TYR A  1  654 ? 39.597  38.532 -43.120 1.00 56.09 ? 689  TYR A CG  1 
ATOM   4886 C  CD1 . TYR A  1  654 ? 40.273  39.729 -43.325 1.00 59.00 ? 689  TYR A CD1 1 
ATOM   4887 C  CD2 . TYR A  1  654 ? 40.291  37.343 -43.328 1.00 58.56 ? 689  TYR A CD2 1 
ATOM   4888 C  CE1 . TYR A  1  654 ? 41.600  39.743 -43.735 1.00 60.63 ? 689  TYR A CE1 1 
ATOM   4889 C  CE2 . TYR A  1  654 ? 41.622  37.346 -43.741 1.00 57.11 ? 689  TYR A CE2 1 
ATOM   4890 C  CZ  . TYR A  1  654 ? 42.271  38.552 -43.941 1.00 59.78 ? 689  TYR A CZ  1 
ATOM   4891 O  OH  . TYR A  1  654 ? 43.591  38.573 -44.348 1.00 63.48 ? 689  TYR A OH  1 
ATOM   4892 N  N   . ASP A  1  655 ? 35.667  38.435 -40.451 1.00 50.05 ? 690  ASP A N   1 
ATOM   4893 C  CA  . ASP A  1  655 ? 34.446  39.027 -39.914 1.00 51.73 ? 690  ASP A CA  1 
ATOM   4894 C  C   . ASP A  1  655 ? 34.640  39.455 -38.466 1.00 49.21 ? 690  ASP A C   1 
ATOM   4895 O  O   . ASP A  1  655 ? 34.020  40.416 -38.006 1.00 48.36 ? 690  ASP A O   1 
ATOM   4896 C  CB  . ASP A  1  655 ? 33.290  38.031 -39.989 1.00 50.14 ? 690  ASP A CB  1 
ATOM   4897 C  CG  . ASP A  1  655 ? 32.581  38.059 -41.322 1.00 54.57 ? 690  ASP A CG  1 
ATOM   4898 O  OD1 . ASP A  1  655 ? 32.837  38.994 -42.114 1.00 52.54 ? 690  ASP A OD1 1 
ATOM   4899 O  OD2 . ASP A  1  655 ? 31.761  37.149 -41.572 1.00 55.94 ? 690  ASP A OD2 1 
ATOM   4900 N  N   . ALA A  1  656 ? 35.502  38.732 -37.755 1.00 47.25 ? 691  ALA A N   1 
ATOM   4901 C  CA  . ALA A  1  656 ? 35.759  39.007 -36.345 1.00 46.48 ? 691  ALA A CA  1 
ATOM   4902 C  C   . ALA A  1  656 ? 36.385  40.385 -36.157 1.00 47.89 ? 691  ALA A C   1 
ATOM   4903 O  O   . ALA A  1  656 ? 36.263  41.000 -35.091 1.00 44.69 ? 691  ALA A O   1 
ATOM   4904 C  CB  . ALA A  1  656 ? 36.650  37.921 -35.744 1.00 43.11 ? 691  ALA A CB  1 
ATOM   4905 N  N   . PHE A  1  657 ? 37.045  40.878 -37.199 1.00 44.16 ? 692  PHE A N   1 
ATOM   4906 C  CA  . PHE A  1  657 ? 37.746  42.146 -37.107 1.00 42.86 ? 692  PHE A CA  1 
ATOM   4907 C  C   . PHE A  1  657 ? 36.864  43.318 -37.475 1.00 41.08 ? 692  PHE A C   1 
ATOM   4908 O  O   . PHE A  1  657 ? 37.330  44.454 -37.531 1.00 44.10 ? 692  PHE A O   1 
ATOM   4909 C  CB  . PHE A  1  657 ? 39.007  42.118 -37.973 1.00 48.35 ? 692  PHE A CB  1 
ATOM   4910 C  CG  . PHE A  1  657 ? 39.968  41.038 -37.583 1.00 47.14 ? 692  PHE A CG  1 
ATOM   4911 C  CD1 . PHE A  1  657 ? 39.980  39.831 -38.254 1.00 48.51 ? 692  PHE A CD1 1 
ATOM   4912 C  CD2 . PHE A  1  657 ? 40.840  41.221 -36.525 1.00 47.77 ? 692  PHE A CD2 1 
ATOM   4913 C  CE1 . PHE A  1  657 ? 40.855  38.825 -37.883 1.00 51.82 ? 692  PHE A CE1 1 
ATOM   4914 C  CE2 . PHE A  1  657 ? 41.717  40.226 -36.150 1.00 50.26 ? 692  PHE A CE2 1 
ATOM   4915 C  CZ  . PHE A  1  657 ? 41.723  39.022 -36.829 1.00 52.34 ? 692  PHE A CZ  1 
ATOM   4916 N  N   . LEU A  1  658 ? 35.589  43.050 -37.729 1.00 41.50 ? 693  LEU A N   1 
ATOM   4917 C  CA  . LEU A  1  658 ? 34.664  44.125 -38.061 1.00 40.32 ? 693  LEU A CA  1 
ATOM   4918 C  C   . LEU A  1  658 ? 34.645  45.142 -36.937 1.00 44.72 ? 693  LEU A C   1 
ATOM   4919 O  O   . LEU A  1  658 ? 34.892  44.805 -35.776 1.00 41.38 ? 693  LEU A O   1 
ATOM   4920 C  CB  . LEU A  1  658 ? 33.253  43.590 -38.314 1.00 42.35 ? 693  LEU A CB  1 
ATOM   4921 C  CG  . LEU A  1  658 ? 33.049  42.874 -39.652 1.00 49.76 ? 693  LEU A CG  1 
ATOM   4922 C  CD1 . LEU A  1  658 ? 31.696  42.162 -39.695 1.00 46.87 ? 693  LEU A CD1 1 
ATOM   4923 C  CD2 . LEU A  1  658 ? 33.207  43.849 -40.827 1.00 49.06 ? 693  LEU A CD2 1 
ATOM   4924 N  N   . VAL A  1  659 ? 34.349  46.386 -37.288 1.00 42.28 ? 694  VAL A N   1 
ATOM   4925 C  CA  . VAL A  1  659 ? 34.304  47.475 -36.324 1.00 42.70 ? 694  VAL A CA  1 
ATOM   4926 C  C   . VAL A  1  659 ? 33.095  47.314 -35.394 1.00 42.10 ? 694  VAL A C   1 
ATOM   4927 O  O   . VAL A  1  659 ? 32.995  47.977 -34.351 1.00 38.95 ? 694  VAL A O   1 
ATOM   4928 C  CB  . VAL A  1  659 ? 34.255  48.839 -37.057 1.00 43.92 ? 694  VAL A CB  1 
ATOM   4929 C  CG1 . VAL A  1  659 ? 32.929  49.008 -37.811 1.00 42.95 ? 694  VAL A CG1 1 
ATOM   4930 C  CG2 . VAL A  1  659 ? 34.481  49.992 -36.099 1.00 41.86 ? 694  VAL A CG2 1 
ATOM   4931 N  N   . THR A  1  660 ? 32.191  46.414 -35.771 1.00 36.41 ? 695  THR A N   1 
ATOM   4932 C  CA  . THR A  1  660 ? 30.925  46.221 -35.060 1.00 40.60 ? 695  THR A CA  1 
ATOM   4933 C  C   . THR A  1  660 ? 31.007  45.027 -34.107 1.00 35.49 ? 695  THR A C   1 
ATOM   4934 O  O   . THR A  1  660 ? 30.027  44.647 -33.466 1.00 37.74 ? 695  THR A O   1 
ATOM   4935 C  CB  . THR A  1  660 ? 29.770  46.006 -36.053 1.00 39.90 ? 695  THR A CB  1 
ATOM   4936 O  OG1 . THR A  1  660 ? 30.256  45.258 -37.174 1.00 40.77 ? 695  THR A OG1 1 
ATOM   4937 C  CG2 . THR A  1  660 ? 29.239  47.348 -36.547 1.00 38.53 ? 695  THR A CG2 1 
ATOM   4938 N  N   . ASN A  1  661 ? 32.188  44.431 -34.053 1.00 34.43 ? 696  ASN A N   1 
ATOM   4939 C  CA  . ASN A  1  661 ? 32.484  43.375 -33.111 1.00 37.68 ? 696  ASN A CA  1 
ATOM   4940 C  C   . ASN A  1  661 ? 33.474  43.884 -32.047 1.00 34.66 ? 696  ASN A C   1 
ATOM   4941 O  O   . ASN A  1  661 ? 33.857  43.149 -31.135 1.00 34.86 ? 696  ASN A O   1 
ATOM   4942 C  CB  . ASN A  1  661 ? 33.058  42.180 -33.867 1.00 36.11 ? 696  ASN A CB  1 
ATOM   4943 C  CG  . ASN A  1  661 ? 33.245  40.967 -32.990 1.00 37.51 ? 696  ASN A CG  1 
ATOM   4944 O  OD1 . ASN A  1  661 ? 32.379  40.619 -32.180 1.00 37.69 ? 696  ASN A OD1 1 
ATOM   4945 N  ND2 . ASN A  1  661 ? 34.379  40.302 -33.154 1.00 39.78 ? 696  ASN A ND2 1 
ATOM   4946 N  N   . MET A  1  662 ? 33.870  45.150 -32.164 1.00 33.51 ? 697  MET A N   1 
ATOM   4947 C  CA  . MET A  1  662 ? 34.899  45.712 -31.291 1.00 34.93 ? 697  MET A CA  1 
ATOM   4948 C  C   . MET A  1  662 ? 34.325  46.451 -30.063 1.00 32.62 ? 697  MET A C   1 
ATOM   4949 O  O   . MET A  1  662 ? 33.292  47.107 -30.139 1.00 30.81 ? 697  MET A O   1 
ATOM   4950 C  CB  . MET A  1  662 ? 35.870  46.615 -32.079 1.00 34.96 ? 697  MET A CB  1 
ATOM   4951 C  CG  . MET A  1  662 ? 35.587  48.121 -32.045 1.00 36.95 ? 697  MET A CG  1 
ATOM   4952 S  SD  . MET A  1  662 ? 36.766  49.104 -33.064 1.00 42.40 ? 697  MET A SD  1 
ATOM   4953 C  CE  . MET A  1  662 ? 38.331  48.467 -32.532 1.00 33.81 ? 697  MET A CE  1 
ATOM   4954 N  N   . VAL A  1  663 ? 35.010  46.341 -28.932 1.00 32.14 ? 698  VAL A N   1 
ATOM   4955 C  CA  . VAL A  1  663 ? 34.580  47.047 -27.717 1.00 32.98 ? 698  VAL A CA  1 
ATOM   4956 C  C   . VAL A  1  663 ? 35.787  47.606 -26.972 1.00 26.65 ? 698  VAL A C   1 
ATOM   4957 O  O   . VAL A  1  663 ? 36.880  47.045 -27.052 1.00 32.10 ? 698  VAL A O   1 
ATOM   4958 C  CB  . VAL A  1  663 ? 33.802  46.105 -26.777 1.00 29.75 ? 698  VAL A CB  1 
ATOM   4959 C  CG1 . VAL A  1  663 ? 32.452  45.765 -27.377 1.00 31.87 ? 698  VAL A CG1 1 
ATOM   4960 C  CG2 . VAL A  1  663 ? 34.596  44.848 -26.549 1.00 30.82 ? 698  VAL A CG2 1 
ATOM   4961 N  N   . PRO A  1  664 ? 35.589  48.699 -26.221 1.00 28.66 ? 699  PRO A N   1 
ATOM   4962 C  CA  . PRO A  1  664 ? 36.711  49.314 -25.505 1.00 29.97 ? 699  PRO A CA  1 
ATOM   4963 C  C   . PRO A  1  664 ? 37.158  48.510 -24.295 1.00 30.25 ? 699  PRO A C   1 
ATOM   4964 O  O   . PRO A  1  664 ? 36.356  48.224 -23.401 1.00 29.47 ? 699  PRO A O   1 
ATOM   4965 C  CB  . PRO A  1  664 ? 36.161  50.667 -25.058 1.00 30.50 ? 699  PRO A CB  1 
ATOM   4966 C  CG  . PRO A  1  664 ? 34.711  50.685 -25.409 1.00 28.47 ? 699  PRO A CG  1 
ATOM   4967 C  CD  . PRO A  1  664 ? 34.309  49.369 -25.944 1.00 29.07 ? 699  PRO A CD  1 
ATOM   4968 N  N   . MET A  1  665 ? 38.432  48.152 -24.276 1.00 27.30 ? 700  MET A N   1 
ATOM   4969 C  CA  . MET A  1  665 ? 38.993  47.408 -23.159 1.00 27.39 ? 700  MET A CA  1 
ATOM   4970 C  C   . MET A  1  665 ? 40.345  47.963 -22.713 1.00 31.09 ? 700  MET A C   1 
ATOM   4971 O  O   . MET A  1  665 ? 41.257  48.140 -23.521 1.00 31.13 ? 700  MET A O   1 
ATOM   4972 C  CB  . MET A  1  665 ? 39.134  45.928 -23.530 1.00 27.49 ? 700  MET A CB  1 
ATOM   4973 C  CG  . MET A  1  665 ? 37.825  45.193 -23.846 1.00 23.03 ? 700  MET A CG  1 
ATOM   4974 S  SD  . MET A  1  665 ? 38.067  43.431 -24.035 1.00 30.43 ? 700  MET A SD  1 
ATOM   4975 C  CE  . MET A  1  665 ? 36.357  42.906 -24.120 1.00 30.43 ? 700  MET A CE  1 
ATOM   4976 N  N   . TYR A  1  666 ? 40.495  48.212 -21.415 1.00 26.42 ? 701  TYR A N   1 
ATOM   4977 C  CA  . TYR A  1  666 ? 41.821  48.472 -20.862 1.00 27.95 ? 701  TYR A CA  1 
ATOM   4978 C  C   . TYR A  1  666 ? 42.734  47.287 -21.064 1.00 27.35 ? 701  TYR A C   1 
ATOM   4979 O  O   . TYR A  1  666 ? 42.291  46.129 -20.996 1.00 27.89 ? 701  TYR A O   1 
ATOM   4980 C  CB  . TYR A  1  666 ? 41.717  48.731 -19.366 1.00 27.06 ? 701  TYR A CB  1 
ATOM   4981 C  CG  . TYR A  1  666 ? 41.160  50.073 -19.005 1.00 25.49 ? 701  TYR A CG  1 
ATOM   4982 C  CD1 . TYR A  1  666 ? 41.854  51.234 -19.320 1.00 31.24 ? 701  TYR A CD1 1 
ATOM   4983 C  CD2 . TYR A  1  666 ? 39.949  50.192 -18.306 1.00 26.57 ? 701  TYR A CD2 1 
ATOM   4984 C  CE1 . TYR A  1  666 ? 41.362  52.463 -18.978 1.00 32.49 ? 701  TYR A CE1 1 
ATOM   4985 C  CE2 . TYR A  1  666 ? 39.454  51.426 -17.948 1.00 27.20 ? 701  TYR A CE2 1 
ATOM   4986 C  CZ  . TYR A  1  666 ? 40.166  52.559 -18.296 1.00 30.18 ? 701  TYR A CZ  1 
ATOM   4987 O  OH  . TYR A  1  666 ? 39.706  53.809 -17.956 1.00 31.94 ? 701  TYR A OH  1 
ATOM   4988 N  N   . PRO A  1  667 ? 44.026  47.563 -21.342 1.00 27.45 ? 702  PRO A N   1 
ATOM   4989 C  CA  . PRO A  1  667 ? 45.019  46.490 -21.414 1.00 32.03 ? 702  PRO A CA  1 
ATOM   4990 C  C   . PRO A  1  667 ? 44.890  45.528 -20.225 1.00 29.96 ? 702  PRO A C   1 
ATOM   4991 O  O   . PRO A  1  667 ? 44.933  44.305 -20.433 1.00 32.56 ? 702  PRO A O   1 
ATOM   4992 C  CB  . PRO A  1  667 ? 46.351  47.251 -21.374 1.00 32.64 ? 702  PRO A CB  1 
ATOM   4993 C  CG  . PRO A  1  667 ? 46.053  48.555 -22.048 1.00 33.08 ? 702  PRO A CG  1 
ATOM   4994 C  CD  . PRO A  1  667 ? 44.589  48.872 -21.731 1.00 33.51 ? 702  PRO A CD  1 
ATOM   4995 N  N   . ALA A  1  668 ? 44.726  46.065 -19.012 1.00 29.98 ? 703  ALA A N   1 
ATOM   4996 C  CA  . ALA A  1  668 ? 44.558  45.232 -17.817 1.00 28.87 ? 703  ALA A CA  1 
ATOM   4997 C  C   . ALA A  1  668 ? 43.449  44.229 -18.020 1.00 25.15 ? 703  ALA A C   1 
ATOM   4998 O  O   . ALA A  1  668 ? 43.596  43.030 -17.736 1.00 27.10 ? 703  ALA A O   1 
ATOM   4999 C  CB  . ALA A  1  668 ? 44.258  46.100 -16.579 1.00 25.46 ? 703  ALA A CB  1 
ATOM   5000 N  N   . PHE A  1  669 ? 42.314  44.715 -18.498 1.00 27.50 ? 704  PHE A N   1 
ATOM   5001 C  CA  . PHE A  1  669 ? 41.211  43.825 -18.776 1.00 26.10 ? 704  PHE A CA  1 
ATOM   5002 C  C   . PHE A  1  669 ? 41.487  42.863 -19.934 1.00 27.59 ? 704  PHE A C   1 
ATOM   5003 O  O   . PHE A  1  669 ? 41.127  41.680 -19.890 1.00 28.21 ? 704  PHE A O   1 
ATOM   5004 C  CB  . PHE A  1  669 ? 39.928  44.609 -19.030 1.00 24.26 ? 704  PHE A CB  1 
ATOM   5005 C  CG  . PHE A  1  669 ? 38.721  43.739 -19.083 1.00 26.49 ? 704  PHE A CG  1 
ATOM   5006 C  CD1 . PHE A  1  669 ? 38.106  43.320 -17.913 1.00 24.98 ? 704  PHE A CD1 1 
ATOM   5007 C  CD2 . PHE A  1  669 ? 38.217  43.292 -20.295 1.00 26.87 ? 704  PHE A CD2 1 
ATOM   5008 C  CE1 . PHE A  1  669 ? 36.997  42.494 -17.959 1.00 26.27 ? 704  PHE A CE1 1 
ATOM   5009 C  CE2 . PHE A  1  669 ? 37.104  42.461 -20.339 1.00 27.98 ? 704  PHE A CE2 1 
ATOM   5010 C  CZ  . PHE A  1  669 ? 36.491  42.068 -19.165 1.00 27.10 ? 704  PHE A CZ  1 
ATOM   5011 N  N   . LYS A  1  670 ? 42.136  43.371 -20.979 1.00 28.83 ? 705  LYS A N   1 
ATOM   5012 C  CA  . LYS A  1  670 ? 42.488  42.536 -22.112 1.00 29.77 ? 705  LYS A CA  1 
ATOM   5013 C  C   . LYS A  1  670 ? 43.242  41.280 -21.691 1.00 29.74 ? 705  LYS A C   1 
ATOM   5014 O  O   . LYS A  1  670 ? 43.082  40.223 -22.311 1.00 32.62 ? 705  LYS A O   1 
ATOM   5015 C  CB  . LYS A  1  670 ? 43.301  43.346 -23.154 1.00 29.28 ? 705  LYS A CB  1 
ATOM   5016 C  CG  . LYS A  1  670 ? 42.486  44.439 -23.825 1.00 31.01 ? 705  LYS A CG  1 
ATOM   5017 C  CD  . LYS A  1  670 ? 43.228  45.149 -24.984 1.00 35.33 ? 705  LYS A CD  1 
ATOM   5018 C  CE  . LYS A  1  670 ? 43.930  44.176 -25.952 1.00 34.58 ? 705  LYS A CE  1 
ATOM   5019 N  NZ  . LYS A  1  670 ? 43.011  43.288 -26.738 1.00 34.63 ? 705  LYS A NZ  1 
ATOM   5020 N  N   . ARG A  1  671 ? 44.057  41.386 -20.642 1.00 28.06 ? 706  ARG A N   1 
ATOM   5021 C  CA  . ARG A  1  671 ? 44.776  40.222 -20.124 1.00 32.46 ? 706  ARG A CA  1 
ATOM   5022 C  C   . ARG A  1  671 ? 43.802  39.123 -19.731 1.00 32.04 ? 706  ARG A C   1 
ATOM   5023 O  O   . ARG A  1  671 ? 44.009  37.941 -20.027 1.00 29.64 ? 706  ARG A O   1 
ATOM   5024 C  CB  . ARG A  1  671 ? 45.648  40.600 -18.924 1.00 30.90 ? 706  ARG A CB  1 
ATOM   5025 C  CG  . ARG A  1  671 ? 46.843  41.491 -19.256 1.00 33.82 ? 706  ARG A CG  1 
ATOM   5026 C  CD  . ARG A  1  671 ? 47.740  41.688 -18.049 1.00 28.49 ? 706  ARG A CD  1 
ATOM   5027 N  NE  . ARG A  1  671 ? 48.402  40.435 -17.715 1.00 33.96 ? 706  ARG A NE  1 
ATOM   5028 C  CZ  . ARG A  1  671 ? 49.043  40.203 -16.574 1.00 31.46 ? 706  ARG A CZ  1 
ATOM   5029 N  NH1 . ARG A  1  671 ? 49.092  41.139 -15.638 1.00 30.84 ? 706  ARG A NH1 1 
ATOM   5030 N  NH2 . ARG A  1  671 ? 49.622  39.026 -16.374 1.00 36.35 ? 706  ARG A NH2 1 
ATOM   5031 N  N   . VAL A  1  672 ? 42.730  39.524 -19.053 1.00 29.92 ? 707  VAL A N   1 
ATOM   5032 C  CA  . VAL A  1  672 ? 41.667  38.610 -18.671 1.00 28.66 ? 707  VAL A CA  1 
ATOM   5033 C  C   . VAL A  1  672 ? 40.870  38.122 -19.874 1.00 30.81 ? 707  VAL A C   1 
ATOM   5034 O  O   . VAL A  1  672 ? 40.667  36.913 -20.065 1.00 30.74 ? 707  VAL A O   1 
ATOM   5035 C  CB  . VAL A  1  672 ? 40.698  39.321 -17.683 1.00 27.86 ? 707  VAL A CB  1 
ATOM   5036 C  CG1 . VAL A  1  672 ? 39.529  38.397 -17.305 1.00 30.15 ? 707  VAL A CG1 1 
ATOM   5037 C  CG2 . VAL A  1  672 ? 41.455  39.786 -16.465 1.00 29.53 ? 707  VAL A CG2 1 
ATOM   5038 N  N   . TRP A  1  673 ? 40.413  39.069 -20.682 1.00 27.13 ? 708  TRP A N   1 
ATOM   5039 C  CA  . TRP A  1  673 ? 39.515  38.770 -21.787 1.00 32.11 ? 708  TRP A CA  1 
ATOM   5040 C  C   . TRP A  1  673 ? 40.185  37.886 -22.839 1.00 32.35 ? 708  TRP A C   1 
ATOM   5041 O  O   . TRP A  1  673 ? 39.586  36.931 -23.329 1.00 34.34 ? 708  TRP A O   1 
ATOM   5042 C  CB  . TRP A  1  673 ? 38.986  40.063 -22.418 1.00 31.59 ? 708  TRP A CB  1 
ATOM   5043 C  CG  . TRP A  1  673 ? 37.841  39.836 -23.343 1.00 33.43 ? 708  TRP A CG  1 
ATOM   5044 C  CD1 . TRP A  1  673 ? 37.821  40.002 -24.702 1.00 29.87 ? 708  TRP A CD1 1 
ATOM   5045 C  CD2 . TRP A  1  673 ? 36.540  39.385 -22.973 1.00 31.09 ? 708  TRP A CD2 1 
ATOM   5046 N  NE1 . TRP A  1  673 ? 36.583  39.686 -25.194 1.00 31.72 ? 708  TRP A NE1 1 
ATOM   5047 C  CE2 . TRP A  1  673 ? 35.778  39.293 -24.153 1.00 29.97 ? 708  TRP A CE2 1 
ATOM   5048 C  CE3 . TRP A  1  673 ? 35.944  39.040 -21.752 1.00 29.81 ? 708  TRP A CE3 1 
ATOM   5049 C  CZ2 . TRP A  1  673 ? 34.450  38.879 -24.150 1.00 31.41 ? 708  TRP A CZ2 1 
ATOM   5050 C  CZ3 . TRP A  1  673 ? 34.623  38.630 -21.752 1.00 29.68 ? 708  TRP A CZ3 1 
ATOM   5051 C  CH2 . TRP A  1  673 ? 33.889  38.553 -22.940 1.00 31.29 ? 708  TRP A CH2 1 
ATOM   5052 N  N   . THR A  1  674 ? 41.438  38.179 -23.167 1.00 34.06 ? 709  THR A N   1 
ATOM   5053 C  CA  . THR A  1  674 ? 42.124  37.363 -24.158 1.00 34.17 ? 709  THR A CA  1 
ATOM   5054 C  C   . THR A  1  674 ? 42.282  35.935 -23.663 1.00 35.34 ? 709  THR A C   1 
ATOM   5055 O  O   . THR A  1  674 ? 42.042  34.994 -24.413 1.00 39.63 ? 709  THR A O   1 
ATOM   5056 C  CB  . THR A  1  674 ? 43.474  37.963 -24.579 1.00 34.36 ? 709  THR A CB  1 
ATOM   5057 O  OG1 . THR A  1  674 ? 43.240  39.208 -25.250 1.00 34.68 ? 709  THR A OG1 1 
ATOM   5058 C  CG2 . THR A  1  674 ? 44.225  37.005 -25.503 1.00 39.61 ? 709  THR A CG2 1 
ATOM   5059 N  N   . TYR A  1  675 ? 42.653  35.765 -22.394 1.00 34.25 ? 710  TYR A N   1 
ATOM   5060 C  CA  . TYR A  1  675 ? 42.766  34.418 -21.832 1.00 33.22 ? 710  TYR A CA  1 
ATOM   5061 C  C   . TYR A  1  675 ? 41.416  33.705 -21.862 1.00 34.95 ? 710  TYR A C   1 
ATOM   5062 O  O   . TYR A  1  675 ? 41.333  32.516 -22.191 1.00 35.02 ? 710  TYR A O   1 
ATOM   5063 C  CB  . TYR A  1  675 ? 43.356  34.459 -20.421 1.00 28.98 ? 710  TYR A CB  1 
ATOM   5064 C  CG  . TYR A  1  675 ? 43.651  33.103 -19.833 1.00 35.93 ? 710  TYR A CG  1 
ATOM   5065 C  CD1 . TYR A  1  675 ? 44.804  32.406 -20.184 1.00 36.73 ? 710  TYR A CD1 1 
ATOM   5066 C  CD2 . TYR A  1  675 ? 42.790  32.523 -18.906 1.00 33.05 ? 710  TYR A CD2 1 
ATOM   5067 C  CE1 . TYR A  1  675 ? 45.085  31.161 -19.641 1.00 35.91 ? 710  TYR A CE1 1 
ATOM   5068 C  CE2 . TYR A  1  675 ? 43.062  31.282 -18.353 1.00 34.31 ? 710  TYR A CE2 1 
ATOM   5069 C  CZ  . TYR A  1  675 ? 44.208  30.603 -18.730 1.00 38.04 ? 710  TYR A CZ  1 
ATOM   5070 O  OH  . TYR A  1  675 ? 44.470  29.367 -18.190 1.00 40.70 ? 710  TYR A OH  1 
ATOM   5071 N  N   . PHE A  1  676 ? 40.352  34.439 -21.545 1.00 32.77 ? 711  PHE A N   1 
ATOM   5072 C  CA  . PHE A  1  676 ? 39.002  33.879 -21.605 1.00 33.56 ? 711  PHE A CA  1 
ATOM   5073 C  C   . PHE A  1  676 ? 38.655  33.459 -23.037 1.00 32.72 ? 711  PHE A C   1 
ATOM   5074 O  O   . PHE A  1  676 ? 38.204  32.351 -23.276 1.00 34.47 ? 711  PHE A O   1 
ATOM   5075 C  CB  . PHE A  1  676 ? 37.981  34.898 -21.076 1.00 31.70 ? 711  PHE A CB  1 
ATOM   5076 C  CG  . PHE A  1  676 ? 36.534  34.535 -21.357 1.00 30.25 ? 711  PHE A CG  1 
ATOM   5077 C  CD1 . PHE A  1  676 ? 35.890  33.567 -20.604 1.00 32.83 ? 711  PHE A CD1 1 
ATOM   5078 C  CD2 . PHE A  1  676 ? 35.810  35.200 -22.342 1.00 34.05 ? 711  PHE A CD2 1 
ATOM   5079 C  CE1 . PHE A  1  676 ? 34.556  33.250 -20.837 1.00 34.77 ? 711  PHE A CE1 1 
ATOM   5080 C  CE2 . PHE A  1  676 ? 34.465  34.879 -22.595 1.00 30.54 ? 711  PHE A CE2 1 
ATOM   5081 C  CZ  . PHE A  1  676 ? 33.845  33.899 -21.831 1.00 32.93 ? 711  PHE A CZ  1 
ATOM   5082 N  N   . GLN A  1  677 ? 38.901  34.354 -23.985 1.00 34.01 ? 712  GLN A N   1 
ATOM   5083 C  CA  . GLN A  1  677 ? 38.522  34.136 -25.383 1.00 35.84 ? 712  GLN A CA  1 
ATOM   5084 C  C   . GLN A  1  677 ? 39.321  33.006 -26.049 1.00 37.90 ? 712  GLN A C   1 
ATOM   5085 O  O   . GLN A  1  677 ? 38.769  32.202 -26.811 1.00 37.36 ? 712  GLN A O   1 
ATOM   5086 C  CB  . GLN A  1  677 ? 38.721  35.433 -26.166 1.00 37.70 ? 712  GLN A CB  1 
ATOM   5087 C  CG  . GLN A  1  677 ? 37.824  36.586 -25.728 1.00 34.52 ? 712  GLN A CG  1 
ATOM   5088 C  CD  . GLN A  1  677 ? 36.436  36.510 -26.316 1.00 36.48 ? 712  GLN A CD  1 
ATOM   5089 O  OE1 . GLN A  1  677 ? 35.625  35.655 -25.936 1.00 40.53 ? 712  GLN A OE1 1 
ATOM   5090 N  NE2 . GLN A  1  677 ? 36.144  37.409 -27.249 1.00 34.78 ? 712  GLN A NE2 1 
ATOM   5091 N  N   . ARG A  1  678 ? 40.607  32.940 -25.722 1.00 34.37 ? 713  ARG A N   1 
ATOM   5092 C  CA  . ARG A  1  678 ? 41.565  32.044 -26.372 1.00 39.87 ? 713  ARG A CA  1 
ATOM   5093 C  C   . ARG A  1  678 ? 41.658  30.676 -25.704 1.00 43.41 ? 713  ARG A C   1 
ATOM   5094 O  O   . ARG A  1  678 ? 41.681  29.651 -26.387 1.00 47.52 ? 713  ARG A O   1 
ATOM   5095 C  CB  . ARG A  1  678 ? 42.949  32.705 -26.407 1.00 40.64 ? 713  ARG A CB  1 
ATOM   5096 C  CG  . ARG A  1  678 ? 44.043  31.905 -27.121 1.00 47.30 ? 713  ARG A CG  1 
ATOM   5097 C  CD  . ARG A  1  678 ? 45.397  32.638 -27.056 1.00 48.12 ? 713  ARG A CD  1 
ATOM   5098 N  NE  . ARG A  1  678 ? 45.873  32.810 -25.680 1.00 58.21 ? 713  ARG A NE  1 
ATOM   5099 C  CZ  . ARG A  1  678 ? 46.691  31.964 -25.048 1.00 59.31 ? 713  ARG A CZ  1 
ATOM   5100 N  NH1 . ARG A  1  678 ? 47.143  30.878 -25.669 1.00 59.51 ? 713  ARG A NH1 1 
ATOM   5101 N  NH2 . ARG A  1  678 ? 47.061  32.204 -23.792 1.00 54.02 ? 713  ARG A NH2 1 
ATOM   5102 N  N   . VAL A  1  679 ? 41.709  30.660 -24.371 1.00 39.50 ? 714  VAL A N   1 
ATOM   5103 C  CA  . VAL A  1  679 ? 41.871  29.415 -23.632 1.00 39.26 ? 714  VAL A CA  1 
ATOM   5104 C  C   . VAL A  1  679 ? 40.550  28.870 -23.065 1.00 40.91 ? 714  VAL A C   1 
ATOM   5105 O  O   . VAL A  1  679 ? 40.169  27.734 -23.345 1.00 39.29 ? 714  VAL A O   1 
ATOM   5106 C  CB  . VAL A  1  679 ? 42.925  29.558 -22.520 1.00 38.96 ? 714  VAL A CB  1 
ATOM   5107 C  CG1 . VAL A  1  679 ? 43.109  28.244 -21.763 1.00 40.52 ? 714  VAL A CG1 1 
ATOM   5108 C  CG2 . VAL A  1  679 ? 44.255  30.022 -23.109 1.00 42.54 ? 714  VAL A CG2 1 
ATOM   5109 N  N   . LEU A  1  680 ? 39.838  29.688 -22.296 1.00 37.63 ? 715  LEU A N   1 
ATOM   5110 C  CA  . LEU A  1  680 ? 38.707  29.188 -21.506 1.00 37.80 ? 715  LEU A CA  1 
ATOM   5111 C  C   . LEU A  1  680 ? 37.441  28.758 -22.277 1.00 35.53 ? 715  LEU A C   1 
ATOM   5112 O  O   . LEU A  1  680 ? 36.831  27.746 -21.938 1.00 36.65 ? 715  LEU A O   1 
ATOM   5113 C  CB  . LEU A  1  680 ? 38.364  30.188 -20.388 1.00 34.25 ? 715  LEU A CB  1 
ATOM   5114 C  CG  . LEU A  1  680 ? 39.511  30.450 -19.407 1.00 36.28 ? 715  LEU A CG  1 
ATOM   5115 C  CD1 . LEU A  1  680 ? 39.133  31.540 -18.410 1.00 31.65 ? 715  LEU A CD1 1 
ATOM   5116 C  CD2 . LEU A  1  680 ? 39.933  29.179 -18.679 1.00 36.72 ? 715  LEU A CD2 1 
ATOM   5117 N  N   . VAL A  1  681 ? 37.027  29.526 -23.280 1.00 33.74 ? 716  VAL A N   1 
ATOM   5118 C  CA  . VAL A  1  681 ? 35.817  29.194 -24.020 1.00 37.50 ? 716  VAL A CA  1 
ATOM   5119 C  C   . VAL A  1  681 ? 35.969  27.819 -24.653 1.00 39.80 ? 716  VAL A C   1 
ATOM   5120 O  O   . VAL A  1  681 ? 35.070  26.984 -24.576 1.00 36.73 ? 716  VAL A O   1 
ATOM   5121 C  CB  . VAL A  1  681 ? 35.490  30.230 -25.121 1.00 35.24 ? 716  VAL A CB  1 
ATOM   5122 C  CG1 . VAL A  1  681 ? 34.343  29.743 -25.984 1.00 36.96 ? 716  VAL A CG1 1 
ATOM   5123 C  CG2 . VAL A  1  681 ? 35.158  31.596 -24.506 1.00 34.07 ? 716  VAL A CG2 1 
ATOM   5124 N  N   . LYS A  1  682 ? 37.122  27.578 -25.269 1.00 39.46 ? 717  LYS A N   1 
ATOM   5125 C  CA  . LYS A  1  682 ? 37.382  26.268 -25.849 1.00 41.91 ? 717  LYS A CA  1 
ATOM   5126 C  C   . LYS A  1  682 ? 37.401  25.206 -24.762 1.00 40.51 ? 717  LYS A C   1 
ATOM   5127 O  O   . LYS A  1  682 ? 36.828  24.134 -24.935 1.00 40.94 ? 717  LYS A O   1 
ATOM   5128 C  CB  . LYS A  1  682 ? 38.698  26.257 -26.631 1.00 43.93 ? 717  LYS A CB  1 
ATOM   5129 C  CG  . LYS A  1  682 ? 39.216  24.859 -26.944 1.00 48.17 ? 717  LYS A CG  1 
ATOM   5130 C  CD  . LYS A  1  682 ? 38.197  24.027 -27.718 1.00 48.00 ? 717  LYS A CD  1 
ATOM   5131 C  CE  . LYS A  1  682 ? 38.671  22.577 -27.846 1.00 54.46 ? 717  LYS A CE  1 
ATOM   5132 N  NZ  . LYS A  1  682 ? 37.748  21.744 -28.667 1.00 54.52 ? 717  LYS A NZ  1 
ATOM   5133 N  N   . LYS A  1  683 ? 38.050  25.513 -23.640 1.00 38.70 ? 718  LYS A N   1 
ATOM   5134 C  CA  . LYS A  1  683 ? 38.121  24.573 -22.535 1.00 42.01 ? 718  LYS A CA  1 
ATOM   5135 C  C   . LYS A  1  683 ? 36.733  24.205 -22.023 1.00 40.96 ? 718  LYS A C   1 
ATOM   5136 O  O   . LYS A  1  683 ? 36.504  23.060 -21.647 1.00 38.57 ? 718  LYS A O   1 
ATOM   5137 C  CB  . LYS A  1  683 ? 38.961  25.110 -21.377 1.00 40.93 ? 718  LYS A CB  1 
ATOM   5138 C  CG  . LYS A  1  683 ? 38.972  24.156 -20.182 1.00 43.37 ? 718  LYS A CG  1 
ATOM   5139 C  CD  . LYS A  1  683 ? 39.894  24.617 -19.060 1.00 47.78 ? 718  LYS A CD  1 
ATOM   5140 C  CE  . LYS A  1  683 ? 39.108  25.268 -17.921 1.00 51.41 ? 718  LYS A CE  1 
ATOM   5141 N  NZ  . LYS A  1  683 ? 39.955  25.495 -16.711 1.00 50.72 ? 718  LYS A NZ  1 
ATOM   5142 N  N   . TYR A  1  684 ? 35.820  25.179 -21.998 1.00 37.27 ? 719  TYR A N   1 
ATOM   5143 C  CA  . TYR A  1  684 ? 34.433  24.907 -21.621 1.00 40.12 ? 719  TYR A CA  1 
ATOM   5144 C  C   . TYR A  1  684 ? 33.738  24.007 -22.639 1.00 37.64 ? 719  TYR A C   1 
ATOM   5145 O  O   . TYR A  1  684 ? 33.061  23.050 -22.269 1.00 37.37 ? 719  TYR A O   1 
ATOM   5146 C  CB  . TYR A  1  684 ? 33.627  26.203 -21.471 1.00 38.87 ? 719  TYR A CB  1 
ATOM   5147 C  CG  . TYR A  1  684 ? 34.176  27.159 -20.440 1.00 37.10 ? 719  TYR A CG  1 
ATOM   5148 C  CD1 . TYR A  1  684 ? 34.955  26.706 -19.382 1.00 36.22 ? 719  TYR A CD1 1 
ATOM   5149 C  CD2 . TYR A  1  684 ? 33.904  28.517 -20.517 1.00 36.98 ? 719  TYR A CD2 1 
ATOM   5150 C  CE1 . TYR A  1  684 ? 35.460  27.582 -18.439 1.00 39.78 ? 719  TYR A CE1 1 
ATOM   5151 C  CE2 . TYR A  1  684 ? 34.403  29.396 -19.582 1.00 37.25 ? 719  TYR A CE2 1 
ATOM   5152 C  CZ  . TYR A  1  684 ? 35.178  28.929 -18.547 1.00 37.62 ? 719  TYR A CZ  1 
ATOM   5153 O  OH  . TYR A  1  684 ? 35.668  29.814 -17.618 1.00 37.88 ? 719  TYR A OH  1 
ATOM   5154 N  N   . ALA A  1  685 ? 33.893  24.338 -23.919 1.00 37.45 ? 720  ALA A N   1 
ATOM   5155 C  CA  . ALA A  1  685 ? 33.310  23.553 -25.006 1.00 40.90 ? 720  ALA A CA  1 
ATOM   5156 C  C   . ALA A  1  685 ? 33.754  22.098 -24.926 1.00 40.31 ? 720  ALA A C   1 
ATOM   5157 O  O   . ALA A  1  685 ? 32.970  21.179 -25.154 1.00 42.91 ? 720  ALA A O   1 
ATOM   5158 C  CB  . ALA A  1  685 ? 33.688  24.148 -26.351 1.00 39.34 ? 720  ALA A CB  1 
ATOM   5159 N  N   . SER A  1  686 ? 35.016  21.897 -24.588 1.00 41.90 ? 721  SER A N   1 
ATOM   5160 C  CA  . SER A  1  686 ? 35.561  20.554 -24.484 1.00 42.94 ? 721  SER A CA  1 
ATOM   5161 C  C   . SER A  1  686 ? 34.971  19.786 -23.308 1.00 45.29 ? 721  SER A C   1 
ATOM   5162 O  O   . SER A  1  686 ? 34.644  18.599 -23.432 1.00 45.69 ? 721  SER A O   1 
ATOM   5163 C  CB  . SER A  1  686 ? 37.079  20.614 -24.363 1.00 44.47 ? 721  SER A CB  1 
ATOM   5164 O  OG  . SER A  1  686 ? 37.603  19.320 -24.148 1.00 51.96 ? 721  SER A OG  1 
ATOM   5165 N  N   . GLU A  1  687 ? 34.825  20.466 -22.170 1.00 44.48 ? 722  GLU A N   1 
ATOM   5166 C  CA  . GLU A  1  687 ? 34.344  19.829 -20.941 1.00 41.72 ? 722  GLU A CA  1 
ATOM   5167 C  C   . GLU A  1  687 ? 32.834  19.601 -20.928 1.00 39.92 ? 722  GLU A C   1 
ATOM   5168 O  O   . GLU A  1  687 ? 32.356  18.669 -20.293 1.00 44.59 ? 722  GLU A O   1 
ATOM   5169 C  CB  . GLU A  1  687 ? 34.747  20.651 -19.704 1.00 43.37 ? 722  GLU A CB  1 
ATOM   5170 C  CG  . GLU A  1  687 ? 36.246  20.834 -19.525 1.00 43.75 ? 722  GLU A CG  1 
ATOM   5171 C  CD  . GLU A  1  687 ? 36.592  21.842 -18.428 1.00 51.14 ? 722  GLU A CD  1 
ATOM   5172 O  OE1 . GLU A  1  687 ? 35.857  22.843 -18.269 1.00 49.88 ? 722  GLU A OE1 1 
ATOM   5173 O  OE2 . GLU A  1  687 ? 37.604  21.639 -17.723 1.00 49.22 ? 722  GLU A OE2 1 
ATOM   5174 N  N   . ARG A  1  688 ? 32.080  20.454 -21.614 1.00 38.20 ? 723  ARG A N   1 
ATOM   5175 C  CA  . ARG A  1  688 ? 30.618  20.406 -21.534 1.00 38.22 ? 723  ARG A CA  1 
ATOM   5176 C  C   . ARG A  1  688 ? 29.953  19.859 -22.796 1.00 36.05 ? 723  ARG A C   1 
ATOM   5177 O  O   . ARG A  1  688 ? 28.723  19.788 -22.886 1.00 36.56 ? 723  ARG A O   1 
ATOM   5178 C  CB  . ARG A  1  688 ? 30.077  21.796 -21.182 1.00 37.32 ? 723  ARG A CB  1 
ATOM   5179 C  CG  . ARG A  1  688 ? 30.592  22.284 -19.832 1.00 33.81 ? 723  ARG A CG  1 
ATOM   5180 C  CD  . ARG A  1  688 ? 30.323  23.773 -19.606 1.00 32.92 ? 723  ARG A CD  1 
ATOM   5181 N  NE  . ARG A  1  688 ? 28.901  24.093 -19.709 1.00 36.20 ? 723  ARG A NE  1 
ATOM   5182 C  CZ  . ARG A  1  688 ? 28.380  25.277 -19.392 1.00 32.53 ? 723  ARG A CZ  1 
ATOM   5183 N  NH1 . ARG A  1  688 ? 29.163  26.246 -18.948 1.00 34.40 ? 723  ARG A NH1 1 
ATOM   5184 N  NH2 . ARG A  1  688 ? 27.077  25.484 -19.510 1.00 31.20 ? 723  ARG A NH2 1 
ATOM   5185 N  N   . ASN A  1  689 ? 30.785  19.458 -23.756 1.00 43.22 ? 724  ASN A N   1 
ATOM   5186 C  CA  . ASN A  1  689 ? 30.333  18.969 -25.056 1.00 37.20 ? 724  ASN A CA  1 
ATOM   5187 C  C   . ASN A  1  689 ? 29.801  20.108 -25.887 1.00 36.91 ? 724  ASN A C   1 
ATOM   5188 O  O   . ASN A  1  689 ? 28.670  20.072 -26.365 1.00 37.07 ? 724  ASN A O   1 
ATOM   5189 C  CB  . ASN A  1  689 ? 29.285  17.866 -24.918 1.00 41.16 ? 724  ASN A CB  1 
ATOM   5190 C  CG  . ASN A  1  689 ? 29.131  17.044 -26.191 1.00 42.76 ? 724  ASN A CG  1 
ATOM   5191 O  OD1 . ASN A  1  689 ? 29.775  17.324 -27.203 1.00 45.33 ? 724  ASN A OD1 1 
ATOM   5192 N  ND2 . ASN A  1  689 ? 28.277  16.025 -26.143 1.00 42.42 ? 724  ASN A ND2 1 
ATOM   5193 N  N   . GLY A  1  690 ? 30.640  21.125 -26.046 1.00 38.69 ? 725  GLY A N   1 
ATOM   5194 C  CA  . GLY A  1  690 ? 30.271  22.334 -26.753 1.00 40.05 ? 725  GLY A CA  1 
ATOM   5195 C  C   . GLY A  1  690 ? 29.590  23.330 -25.827 1.00 39.65 ? 725  GLY A C   1 
ATOM   5196 O  O   . GLY A  1  690 ? 29.010  22.941 -24.807 1.00 38.12 ? 725  GLY A O   1 
ATOM   5197 N  N   . VAL A  1  691 ? 29.659  24.609 -26.187 1.00 36.66 ? 726  VAL A N   1 
ATOM   5198 C  CA  . VAL A  1  691 ? 28.980  25.655 -25.434 1.00 38.79 ? 726  VAL A CA  1 
ATOM   5199 C  C   . VAL A  1  691 ? 28.371  26.714 -26.343 1.00 39.89 ? 726  VAL A C   1 
ATOM   5200 O  O   . VAL A  1  691 ? 28.928  27.045 -27.390 1.00 40.49 ? 726  VAL A O   1 
ATOM   5201 C  CB  . VAL A  1  691 ? 29.918  26.331 -24.395 1.00 36.76 ? 726  VAL A CB  1 
ATOM   5202 C  CG1 . VAL A  1  691 ? 30.268  25.357 -23.273 1.00 37.37 ? 726  VAL A CG1 1 
ATOM   5203 C  CG2 . VAL A  1  691 ? 31.186  26.901 -25.057 1.00 35.59 ? 726  VAL A CG2 1 
ATOM   5204 N  N   . ASN A  1  692 ? 27.207  27.222 -25.954 1.00 34.38 ? 727  ASN A N   1 
ATOM   5205 C  CA  . ASN A  1  692 ? 26.682  28.424 -26.566 1.00 33.93 ? 727  ASN A CA  1 
ATOM   5206 C  C   . ASN A  1  692 ? 27.059  29.603 -25.683 1.00 35.50 ? 727  ASN A C   1 
ATOM   5207 O  O   . ASN A  1  692 ? 26.877  29.554 -24.470 1.00 32.43 ? 727  ASN A O   1 
ATOM   5208 C  CB  . ASN A  1  692 ? 25.167  28.347 -26.743 1.00 33.74 ? 727  ASN A CB  1 
ATOM   5209 C  CG  . ASN A  1  692 ? 24.583  29.647 -27.233 1.00 36.94 ? 727  ASN A CG  1 
ATOM   5210 O  OD1 . ASN A  1  692 ? 24.099  30.460 -26.442 1.00 31.79 ? 727  ASN A OD1 1 
ATOM   5211 N  ND2 . ASN A  1  692 ? 24.645  29.871 -28.548 1.00 36.39 ? 727  ASN A ND2 1 
ATOM   5212 N  N   . VAL A  1  693 ? 27.602  30.650 -26.287 1.00 32.91 ? 728  VAL A N   1 
ATOM   5213 C  CA  . VAL A  1  693 ? 28.069  31.809 -25.538 1.00 33.41 ? 728  VAL A CA  1 
ATOM   5214 C  C   . VAL A  1  693 ? 27.321  33.054 -25.962 1.00 33.26 ? 728  VAL A C   1 
ATOM   5215 O  O   . VAL A  1  693 ? 27.103  33.283 -27.147 1.00 31.83 ? 728  VAL A O   1 
ATOM   5216 C  CB  . VAL A  1  693 ? 29.571  32.055 -25.787 1.00 33.68 ? 728  VAL A CB  1 
ATOM   5217 C  CG1 . VAL A  1  693 ? 30.029  33.385 -25.164 1.00 32.26 ? 728  VAL A CG1 1 
ATOM   5218 C  CG2 . VAL A  1  693 ? 30.418  30.860 -25.324 1.00 35.13 ? 728  VAL A CG2 1 
ATOM   5219 N  N   . ILE A  1  694 ? 26.905  33.856 -24.991 1.00 31.08 ? 729  ILE A N   1 
ATOM   5220 C  CA  . ILE A  1  694 ? 26.458  35.205 -25.288 1.00 25.38 ? 729  ILE A CA  1 
ATOM   5221 C  C   . ILE A  1  694 ? 27.273  36.139 -24.423 1.00 29.63 ? 729  ILE A C   1 
ATOM   5222 O  O   . ILE A  1  694 ? 27.276  36.010 -23.196 1.00 26.29 ? 729  ILE A O   1 
ATOM   5223 C  CB  . ILE A  1  694 ? 24.948  35.430 -24.997 1.00 32.86 ? 729  ILE A CB  1 
ATOM   5224 C  CG1 . ILE A  1  694 ? 24.089  34.329 -25.621 1.00 29.96 ? 729  ILE A CG1 1 
ATOM   5225 C  CG2 . ILE A  1  694 ? 24.518  36.787 -25.504 1.00 29.38 ? 729  ILE A CG2 1 
ATOM   5226 C  CD1 . ILE A  1  694 ? 22.596  34.518 -25.409 1.00 31.17 ? 729  ILE A CD1 1 
ATOM   5227 N  N   . SER A  1  695 ? 27.972  37.069 -25.059 1.00 28.57 ? 730  SER A N   1 
ATOM   5228 C  CA  . SER A  1  695 ? 28.805  38.035 -24.355 1.00 23.64 ? 730  SER A CA  1 
ATOM   5229 C  C   . SER A  1  695 ? 28.357  39.441 -24.728 1.00 26.94 ? 730  SER A C   1 
ATOM   5230 O  O   . SER A  1  695 ? 27.714  39.652 -25.773 1.00 29.12 ? 730  SER A O   1 
ATOM   5231 C  CB  . SER A  1  695 ? 30.278  37.834 -24.688 1.00 26.83 ? 730  SER A CB  1 
ATOM   5232 O  OG  . SER A  1  695 ? 30.726  36.554 -24.287 1.00 29.70 ? 730  SER A OG  1 
ATOM   5233 N  N   . GLY A  1  696 ? 28.675  40.408 -23.871 1.00 24.48 ? 731  GLY A N   1 
ATOM   5234 C  CA  . GLY A  1  696 ? 28.261  41.783 -24.102 1.00 25.44 ? 731  GLY A CA  1 
ATOM   5235 C  C   . GLY A  1  696 ? 28.775  42.722 -23.030 1.00 27.62 ? 731  GLY A C   1 
ATOM   5236 O  O   . GLY A  1  696 ? 29.391  42.282 -22.054 1.00 25.15 ? 731  GLY A O   1 
ATOM   5237 N  N   . PRO A  1  697 ? 28.542  44.025 -23.219 1.00 27.60 ? 732  PRO A N   1 
ATOM   5238 C  CA  . PRO A  1  697 ? 28.896  45.082 -22.268 1.00 26.88 ? 732  PRO A CA  1 
ATOM   5239 C  C   . PRO A  1  697 ? 27.787  45.350 -21.261 1.00 23.96 ? 732  PRO A C   1 
ATOM   5240 O  O   . PRO A  1  697 ? 26.599  45.127 -21.547 1.00 23.46 ? 732  PRO A O   1 
ATOM   5241 C  CB  . PRO A  1  697 ? 29.057  46.310 -23.161 1.00 24.53 ? 732  PRO A CB  1 
ATOM   5242 C  CG  . PRO A  1  697 ? 28.060  46.058 -24.290 1.00 28.72 ? 732  PRO A CG  1 
ATOM   5243 C  CD  . PRO A  1  697 ? 28.028  44.568 -24.492 1.00 28.56 ? 732  PRO A CD  1 
ATOM   5244 N  N   . ILE A  1  698 ? 28.200  45.836 -20.091 1.00 22.61 ? 733  ILE A N   1 
ATOM   5245 C  CA  . ILE A  1  698 ? 27.285  46.307 -19.053 1.00 23.18 ? 733  ILE A CA  1 
ATOM   5246 C  C   . ILE A  1  698 ? 27.702  47.699 -18.642 1.00 20.48 ? 733  ILE A C   1 
ATOM   5247 O  O   . ILE A  1  698 ? 28.883  47.965 -18.465 1.00 22.68 ? 733  ILE A O   1 
ATOM   5248 C  CB  . ILE A  1  698 ? 27.250  45.372 -17.832 1.00 19.12 ? 733  ILE A CB  1 
ATOM   5249 C  CG1 . ILE A  1  698 ? 26.370  44.160 -18.157 1.00 23.13 ? 733  ILE A CG1 1 
ATOM   5250 C  CG2 . ILE A  1  698 ? 26.690  46.117 -16.576 1.00 22.72 ? 733  ILE A CG2 1 
ATOM   5251 C  CD1 . ILE A  1  698 ? 26.522  42.996 -17.236 1.00 23.41 ? 733  ILE A CD1 1 
ATOM   5252 N  N   . PHE A  1  699 ? 26.729  48.593 -18.538 1.00 20.15 ? 734  PHE A N   1 
ATOM   5253 C  CA  . PHE A  1  699 ? 26.947  49.936 -17.999 1.00 23.36 ? 734  PHE A CA  1 
ATOM   5254 C  C   . PHE A  1  699 ? 26.178  50.152 -16.694 1.00 21.52 ? 734  PHE A C   1 
ATOM   5255 O  O   . PHE A  1  699 ? 24.943  50.250 -16.673 1.00 24.27 ? 734  PHE A O   1 
ATOM   5256 C  CB  . PHE A  1  699 ? 26.526  51.024 -19.000 1.00 26.29 ? 734  PHE A CB  1 
ATOM   5257 C  CG  . PHE A  1  699 ? 27.166  50.879 -20.354 1.00 25.18 ? 734  PHE A CG  1 
ATOM   5258 C  CD1 . PHE A  1  699 ? 28.279  51.634 -20.698 1.00 24.28 ? 734  PHE A CD1 1 
ATOM   5259 C  CD2 . PHE A  1  699 ? 26.646  49.979 -21.285 1.00 27.18 ? 734  PHE A CD2 1 
ATOM   5260 C  CE1 . PHE A  1  699 ? 28.889  51.488 -21.969 1.00 23.34 ? 734  PHE A CE1 1 
ATOM   5261 C  CE2 . PHE A  1  699 ? 27.241  49.830 -22.539 1.00 27.10 ? 734  PHE A CE2 1 
ATOM   5262 C  CZ  . PHE A  1  699 ? 28.363  50.588 -22.874 1.00 26.84 ? 734  PHE A CZ  1 
ATOM   5263 N  N   . ASP A  1  700 ? 26.911  50.275 -15.594 1.00 20.04 ? 735  ASP A N   1 
ATOM   5264 C  CA  . ASP A  1  700 ? 26.277  50.564 -14.329 1.00 21.01 ? 735  ASP A CA  1 
ATOM   5265 C  C   . ASP A  1  700 ? 27.135  51.557 -13.541 1.00 25.60 ? 735  ASP A C   1 
ATOM   5266 O  O   . ASP A  1  700 ? 27.735  51.207 -12.514 1.00 22.52 ? 735  ASP A O   1 
ATOM   5267 C  CB  . ASP A  1  700 ? 26.080  49.258 -13.544 1.00 19.79 ? 735  ASP A CB  1 
ATOM   5268 C  CG  . ASP A  1  700 ? 25.248  49.463 -12.279 1.00 21.33 ? 735  ASP A CG  1 
ATOM   5269 O  OD1 . ASP A  1  700 ? 24.610  50.530 -12.144 1.00 19.44 ? 735  ASP A OD1 1 
ATOM   5270 O  OD2 . ASP A  1  700 ? 25.256  48.576 -11.413 1.00 19.07 ? 735  ASP A OD2 1 
ATOM   5271 N  N   . TYR A  1  701 ? 27.195  52.802 -14.020 1.00 25.71 ? 736  TYR A N   1 
ATOM   5272 C  CA  . TYR A  1  701 ? 28.041  53.800 -13.375 1.00 25.74 ? 736  TYR A CA  1 
ATOM   5273 C  C   . TYR A  1  701 ? 27.581  54.213 -11.978 1.00 24.25 ? 736  TYR A C   1 
ATOM   5274 O  O   . TYR A  1  701 ? 28.412  54.631 -11.169 1.00 26.62 ? 736  TYR A O   1 
ATOM   5275 C  CB  . TYR A  1  701 ? 28.259  55.035 -14.278 1.00 23.90 ? 736  TYR A CB  1 
ATOM   5276 C  CG  . TYR A  1  701 ? 29.321  54.790 -15.306 1.00 27.09 ? 736  TYR A CG  1 
ATOM   5277 C  CD1 . TYR A  1  701 ? 30.639  55.168 -15.072 1.00 26.10 ? 736  TYR A CD1 1 
ATOM   5278 C  CD2 . TYR A  1  701 ? 29.034  54.112 -16.483 1.00 22.08 ? 736  TYR A CD2 1 
ATOM   5279 C  CE1 . TYR A  1  701 ? 31.623  54.921 -15.999 1.00 27.83 ? 736  TYR A CE1 1 
ATOM   5280 C  CE2 . TYR A  1  701 ? 30.030  53.865 -17.416 1.00 25.49 ? 736  TYR A CE2 1 
ATOM   5281 C  CZ  . TYR A  1  701 ? 31.320  54.270 -17.163 1.00 28.60 ? 736  TYR A CZ  1 
ATOM   5282 O  OH  . TYR A  1  701 ? 32.322  54.024 -18.080 1.00 27.43 ? 736  TYR A OH  1 
ATOM   5283 N  N   . ASN A  1  702 ? 26.279  54.111 -11.677 1.00 25.06 ? 737  ASN A N   1 
ATOM   5284 C  CA  . ASN A  1  702 ? 25.803  54.439 -10.329 1.00 25.08 ? 737  ASN A CA  1 
ATOM   5285 C  C   . ASN A  1  702 ? 25.611  53.213 -9.434  1.00 22.71 ? 737  ASN A C   1 
ATOM   5286 O  O   . ASN A  1  702 ? 24.916  53.291 -8.428  1.00 22.85 ? 737  ASN A O   1 
ATOM   5287 C  CB  . ASN A  1  702 ? 24.507  55.250 -10.357 1.00 25.49 ? 737  ASN A CB  1 
ATOM   5288 C  CG  . ASN A  1  702 ? 23.374  54.512 -11.043 1.00 31.87 ? 737  ASN A CG  1 
ATOM   5289 O  OD1 . ASN A  1  702 ? 23.547  53.386 -11.505 1.00 25.88 ? 737  ASN A OD1 1 
ATOM   5290 N  ND2 . ASN A  1  702 ? 22.204  55.147 -11.114 1.00 34.79 ? 737  ASN A ND2 1 
ATOM   5291 N  N   . TYR A  1  703 ? 26.216  52.101 -9.837  1.00 20.67 ? 738  TYR A N   1 
ATOM   5292 C  CA  . TYR A  1  703 ? 26.229  50.857 -9.060  1.00 21.61 ? 738  TYR A CA  1 
ATOM   5293 C  C   . TYR A  1  703 ? 24.900  50.496 -8.415  1.00 21.21 ? 738  TYR A C   1 
ATOM   5294 O  O   . TYR A  1  703 ? 24.854  50.072 -7.253  1.00 18.77 ? 738  TYR A O   1 
ATOM   5295 C  CB  . TYR A  1  703 ? 27.361  50.849 -7.997  1.00 20.97 ? 738  TYR A CB  1 
ATOM   5296 C  CG  . TYR A  1  703 ? 27.461  52.095 -7.139  1.00 25.25 ? 738  TYR A CG  1 
ATOM   5297 C  CD1 . TYR A  1  703 ? 26.723  52.222 -5.973  1.00 23.63 ? 738  TYR A CD1 1 
ATOM   5298 C  CD2 . TYR A  1  703 ? 28.311  53.140 -7.492  1.00 29.81 ? 738  TYR A CD2 1 
ATOM   5299 C  CE1 . TYR A  1  703 ? 26.816  53.365 -5.178  1.00 25.63 ? 738  TYR A CE1 1 
ATOM   5300 C  CE2 . TYR A  1  703 ? 28.417  54.286 -6.697  1.00 30.75 ? 738  TYR A CE2 1 
ATOM   5301 C  CZ  . TYR A  1  703 ? 27.667  54.384 -5.548  1.00 31.99 ? 738  TYR A CZ  1 
ATOM   5302 O  OH  . TYR A  1  703 ? 27.753  55.503 -4.757  1.00 39.67 ? 738  TYR A OH  1 
ATOM   5303 N  N   . ASN A  1  704 ? 23.811  50.621 -9.160  1.00 19.90 ? 739  ASN A N   1 
ATOM   5304 C  CA  . ASN A  1  704 ? 22.524  50.207 -8.608  1.00 18.41 ? 739  ASN A CA  1 
ATOM   5305 C  C   . ASN A  1  704 ? 22.036  48.848 -9.155  1.00 19.19 ? 739  ASN A C   1 
ATOM   5306 O  O   . ASN A  1  704 ? 20.913  48.428 -8.874  1.00 19.31 ? 739  ASN A O   1 
ATOM   5307 C  CB  . ASN A  1  704 ? 21.462  51.302 -8.797  1.00 22.86 ? 739  ASN A CB  1 
ATOM   5308 C  CG  . ASN A  1  704 ? 21.044  51.457 -10.249 1.00 23.93 ? 739  ASN A CG  1 
ATOM   5309 O  OD1 . ASN A  1  704 ? 21.524  50.748 -11.116 1.00 20.27 ? 739  ASN A OD1 1 
ATOM   5310 N  ND2 . ASN A  1  704 ? 20.139  52.391 -10.512 1.00 24.71 ? 739  ASN A ND2 1 
ATOM   5311 N  N   . GLY A  1  705 ? 22.880  48.161 -9.928  1.00 19.65 ? 740  GLY A N   1 
ATOM   5312 C  CA  . GLY A  1  705 ? 22.541  46.828 -10.399 1.00 16.89 ? 740  GLY A CA  1 
ATOM   5313 C  C   . GLY A  1  705 ? 21.600  46.824 -11.602 1.00 20.76 ? 740  GLY A C   1 
ATOM   5314 O  O   . GLY A  1  705 ? 21.117  45.772 -12.019 1.00 18.99 ? 740  GLY A O   1 
ATOM   5315 N  N   . LEU A  1  706 ? 21.342  48.007 -12.153 1.00 19.26 ? 741  LEU A N   1 
ATOM   5316 C  CA  . LEU A  1  706 ? 20.361  48.155 -13.245 1.00 21.61 ? 741  LEU A CA  1 
ATOM   5317 C  C   . LEU A  1  706 ? 21.024  48.807 -14.452 1.00 24.56 ? 741  LEU A C   1 
ATOM   5318 O  O   . LEU A  1  706 ? 21.966  49.576 -14.318 1.00 22.83 ? 741  LEU A O   1 
ATOM   5319 C  CB  . LEU A  1  706 ? 19.189  49.037 -12.808 1.00 20.88 ? 741  LEU A CB  1 
ATOM   5320 C  CG  . LEU A  1  706 ? 18.428  48.666 -11.531 1.00 20.22 ? 741  LEU A CG  1 
ATOM   5321 C  CD1 . LEU A  1  706 ? 17.404  49.742 -11.162 1.00 23.41 ? 741  LEU A CD1 1 
ATOM   5322 C  CD2 . LEU A  1  706 ? 17.789  47.276 -11.699 1.00 20.42 ? 741  LEU A CD2 1 
ATOM   5323 N  N   . ARG A  1  707 ? 20.529  48.482 -15.636 1.00 23.27 ? 742  ARG A N   1 
ATOM   5324 C  CA  . ARG A  1  707 ? 20.963  49.147 -16.865 1.00 23.94 ? 742  ARG A CA  1 
ATOM   5325 C  C   . ARG A  1  707 ? 21.055  50.675 -16.716 1.00 22.87 ? 742  ARG A C   1 
ATOM   5326 O  O   . ARG A  1  707 ? 20.088  51.302 -16.314 1.00 26.21 ? 742  ARG A O   1 
ATOM   5327 C  CB  . ARG A  1  707 ? 19.909  48.823 -17.950 1.00 26.02 ? 742  ARG A CB  1 
ATOM   5328 C  CG  . ARG A  1  707 ? 20.221  49.367 -19.312 1.00 32.60 ? 742  ARG A CG  1 
ATOM   5329 C  CD  . ARG A  1  707 ? 19.117  48.982 -20.269 1.00 30.35 ? 742  ARG A CD  1 
ATOM   5330 N  NE  . ARG A  1  707 ? 17.820  49.352 -19.714 1.00 33.27 ? 742  ARG A NE  1 
ATOM   5331 C  CZ  . ARG A  1  707 ? 17.270  50.557 -19.852 1.00 38.19 ? 742  ARG A CZ  1 
ATOM   5332 N  NH1 . ARG A  1  707 ? 17.908  51.509 -20.540 1.00 32.25 ? 742  ARG A NH1 1 
ATOM   5333 N  NH2 . ARG A  1  707 ? 16.086  50.812 -19.297 1.00 35.79 ? 742  ARG A NH2 1 
ATOM   5334 N  N   . ASP A  1  708 ? 22.210  51.275 -17.035 1.00 24.65 ? 743  ASP A N   1 
ATOM   5335 C  CA  . ASP A  1  708 ? 22.314  52.737 -17.137 1.00 25.59 ? 743  ASP A CA  1 
ATOM   5336 C  C   . ASP A  1  708 ? 21.518  53.256 -18.362 1.00 28.66 ? 743  ASP A C   1 
ATOM   5337 O  O   . ASP A  1  708 ? 21.530  52.642 -19.436 1.00 28.77 ? 743  ASP A O   1 
ATOM   5338 C  CB  . ASP A  1  708 ? 23.767  53.168 -17.359 1.00 25.38 ? 743  ASP A CB  1 
ATOM   5339 C  CG  . ASP A  1  708 ? 24.586  53.221 -16.081 1.00 23.39 ? 743  ASP A CG  1 
ATOM   5340 O  OD1 . ASP A  1  708 ? 24.023  53.096 -14.976 1.00 25.73 ? 743  ASP A OD1 1 
ATOM   5341 O  OD2 . ASP A  1  708 ? 25.799  53.399 -16.202 1.00 25.38 ? 743  ASP A OD2 1 
ATOM   5342 N  N   . ILE A  1  709 ? 20.865  54.400 -18.204 1.00 30.21 ? 744  ILE A N   1 
ATOM   5343 C  CA  . ILE A  1  709 ? 20.377  55.136 -19.371 1.00 33.54 ? 744  ILE A CA  1 
ATOM   5344 C  C   . ILE A  1  709 ? 21.525  55.992 -19.898 1.00 35.89 ? 744  ILE A C   1 
ATOM   5345 O  O   . ILE A  1  709 ? 22.541  56.127 -19.225 1.00 35.54 ? 744  ILE A O   1 
ATOM   5346 C  CB  . ILE A  1  709 ? 19.184  56.019 -19.020 1.00 34.90 ? 744  ILE A CB  1 
ATOM   5347 C  CG1 . ILE A  1  709 ? 19.582  57.066 -17.979 1.00 37.65 ? 744  ILE A CG1 1 
ATOM   5348 C  CG2 . ILE A  1  709 ? 18.047  55.176 -18.477 1.00 35.73 ? 744  ILE A CG2 1 
ATOM   5349 C  CD1 . ILE A  1  709 ? 18.392  57.862 -17.448 1.00 40.67 ? 744  ILE A CD1 1 
ATOM   5350 N  N   . GLU A  1  710 ? 21.384  56.565 -21.095 1.00 40.01 ? 745  GLU A N   1 
ATOM   5351 C  CA  . GLU A  1  710 ? 22.493  57.318 -21.704 1.00 39.02 ? 745  GLU A CA  1 
ATOM   5352 C  C   . GLU A  1  710 ? 23.080  58.375 -20.777 1.00 41.01 ? 745  GLU A C   1 
ATOM   5353 O  O   . GLU A  1  710 ? 24.306  58.524 -20.680 1.00 40.06 ? 745  GLU A O   1 
ATOM   5354 C  CB  . GLU A  1  710 ? 22.035  58.025 -22.971 1.00 42.23 ? 745  GLU A CB  1 
ATOM   5355 C  CG  . GLU A  1  710 ? 21.538  57.120 -24.046 1.00 44.05 ? 745  GLU A CG  1 
ATOM   5356 C  CD  . GLU A  1  710 ? 21.488  57.842 -25.369 1.00 50.06 ? 745  GLU A CD  1 
ATOM   5357 O  OE1 . GLU A  1  710 ? 20.367  58.114 -25.852 1.00 54.76 ? 745  GLU A OE1 1 
ATOM   5358 O  OE2 . GLU A  1  710 ? 22.576  58.163 -25.901 1.00 48.95 ? 745  GLU A OE2 1 
ATOM   5359 N  N   . ASP A  1  711 ? 22.196  59.123 -20.120 1.00 40.77 ? 746  ASP A N   1 
ATOM   5360 C  CA  . ASP A  1  711 ? 22.609  60.209 -19.233 1.00 45.00 ? 746  ASP A CA  1 
ATOM   5361 C  C   . ASP A  1  711 ? 23.505  59.758 -18.080 1.00 43.94 ? 746  ASP A C   1 
ATOM   5362 O  O   . ASP A  1  711 ? 24.236  60.565 -17.494 1.00 41.05 ? 746  ASP A O   1 
ATOM   5363 C  CB  . ASP A  1  711 ? 21.389  60.921 -18.643 1.00 47.49 ? 746  ASP A CB  1 
ATOM   5364 C  CG  . ASP A  1  711 ? 21.782  61.970 -17.615 1.00 55.67 ? 746  ASP A CG  1 
ATOM   5365 O  OD1 . ASP A  1  711 ? 22.671  62.796 -17.931 1.00 58.54 ? 746  ASP A OD1 1 
ATOM   5366 O  OD2 . ASP A  1  711 ? 21.222  61.963 -16.491 1.00 57.80 ? 746  ASP A OD2 1 
ATOM   5367 N  N   . GLU A  1  712 ? 23.439  58.476 -17.743 1.00 38.46 ? 747  GLU A N   1 
ATOM   5368 C  CA  . GLU A  1  712 ? 24.151  57.973 -16.569 1.00 37.64 ? 747  GLU A CA  1 
ATOM   5369 C  C   . GLU A  1  712 ? 25.576  57.509 -16.866 1.00 33.84 ? 747  GLU A C   1 
ATOM   5370 O  O   . GLU A  1  712 ? 26.385  57.327 -15.957 1.00 32.93 ? 747  GLU A O   1 
ATOM   5371 C  CB  . GLU A  1  712 ? 23.341  56.855 -15.912 1.00 34.89 ? 747  GLU A CB  1 
ATOM   5372 C  CG  . GLU A  1  712 ? 22.088  57.363 -15.255 1.00 35.68 ? 747  GLU A CG  1 
ATOM   5373 C  CD  . GLU A  1  712 ? 21.278  56.273 -14.588 1.00 37.64 ? 747  GLU A CD  1 
ATOM   5374 O  OE1 . GLU A  1  712 ? 21.115  55.190 -15.184 1.00 32.94 ? 747  GLU A OE1 1 
ATOM   5375 O  OE2 . GLU A  1  712 ? 20.775  56.513 -13.468 1.00 43.44 ? 747  GLU A OE2 1 
ATOM   5376 N  N   . ILE A  1  713 ? 25.880  57.316 -18.142 1.00 32.68 ? 748  ILE A N   1 
ATOM   5377 C  CA  . ILE A  1  713 ? 27.219  56.889 -18.555 1.00 32.15 ? 748  ILE A CA  1 
ATOM   5378 C  C   . ILE A  1  713 ? 28.218  58.032 -18.384 1.00 32.42 ? 748  ILE A C   1 
ATOM   5379 O  O   . ILE A  1  713 ? 27.952  59.162 -18.797 1.00 35.79 ? 748  ILE A O   1 
ATOM   5380 C  CB  . ILE A  1  713 ? 27.197  56.343 -20.003 1.00 32.49 ? 748  ILE A CB  1 
ATOM   5381 C  CG1 . ILE A  1  713 ? 26.313  55.086 -20.049 1.00 35.01 ? 748  ILE A CG1 1 
ATOM   5382 C  CG2 . ILE A  1  713 ? 28.620  56.063 -20.538 1.00 30.66 ? 748  ILE A CG2 1 
ATOM   5383 C  CD1 . ILE A  1  713 ? 26.336  54.366 -21.355 1.00 34.65 ? 748  ILE A CD1 1 
ATOM   5384 N  N   . LYS A  1  714 ? 29.369  57.739 -17.781 1.00 27.88 ? 749  LYS A N   1 
ATOM   5385 C  CA  . LYS A  1  714 ? 30.260  58.798 -17.324 1.00 31.68 ? 749  LYS A CA  1 
ATOM   5386 C  C   . LYS A  1  714 ? 31.640  58.725 -17.926 1.00 32.89 ? 749  LYS A C   1 
ATOM   5387 O  O   . LYS A  1  714 ? 32.484  59.570 -17.642 1.00 35.51 ? 749  LYS A O   1 
ATOM   5388 C  CB  . LYS A  1  714 ? 30.409  58.759 -15.800 1.00 30.43 ? 749  LYS A CB  1 
ATOM   5389 C  CG  . LYS A  1  714 ? 29.124  59.028 -15.019 1.00 31.71 ? 749  LYS A CG  1 
ATOM   5390 C  CD  . LYS A  1  714 ? 28.510  60.379 -15.385 1.00 34.92 ? 749  LYS A CD  1 
ATOM   5391 C  CE  . LYS A  1  714 ? 27.192  60.569 -14.636 1.00 33.76 ? 749  LYS A CE  1 
ATOM   5392 N  NZ  . LYS A  1  714 ? 26.322  61.591 -15.279 1.00 43.03 ? 749  LYS A NZ  1 
ATOM   5393 N  N   . GLN A  1  715 ? 31.898  57.712 -18.730 1.00 26.16 ? 750  GLN A N   1 
ATOM   5394 C  CA  . GLN A  1  715 ? 33.225  57.590 -19.311 1.00 30.51 ? 750  GLN A CA  1 
ATOM   5395 C  C   . GLN A  1  715 ? 33.145  57.208 -20.778 1.00 29.94 ? 750  GLN A C   1 
ATOM   5396 O  O   . GLN A  1  715 ? 32.360  56.332 -21.149 1.00 29.64 ? 750  GLN A O   1 
ATOM   5397 C  CB  . GLN A  1  715 ? 34.050  56.560 -18.549 1.00 32.23 ? 750  GLN A CB  1 
ATOM   5398 C  CG  . GLN A  1  715 ? 35.454  56.391 -19.098 1.00 29.30 ? 750  GLN A CG  1 
ATOM   5399 C  CD  . GLN A  1  715 ? 36.284  55.420 -18.266 1.00 36.35 ? 750  GLN A CD  1 
ATOM   5400 O  OE1 . GLN A  1  715 ? 35.922  55.080 -17.129 1.00 35.01 ? 750  GLN A OE1 1 
ATOM   5401 N  NE2 . GLN A  1  715 ? 37.407  54.976 -18.826 1.00 35.96 ? 750  GLN A NE2 1 
ATOM   5402 N  N   . TYR A  1  716 ? 33.972  57.848 -21.604 1.00 31.58 ? 751  TYR A N   1 
ATOM   5403 C  CA  . TYR A  1  716 ? 33.982  57.588 -23.052 1.00 30.34 ? 751  TYR A CA  1 
ATOM   5404 C  C   . TYR A  1  716 ? 35.415  57.413 -23.528 1.00 30.70 ? 751  TYR A C   1 
ATOM   5405 O  O   . TYR A  1  716 ? 36.341  57.872 -22.864 1.00 32.10 ? 751  TYR A O   1 
ATOM   5406 C  CB  . TYR A  1  716 ? 33.342  58.750 -23.805 1.00 33.06 ? 751  TYR A CB  1 
ATOM   5407 C  CG  . TYR A  1  716 ? 31.889  58.952 -23.480 1.00 29.94 ? 751  TYR A CG  1 
ATOM   5408 C  CD1 . TYR A  1  716 ? 31.499  59.784 -22.443 1.00 34.24 ? 751  TYR A CD1 1 
ATOM   5409 C  CD2 . TYR A  1  716 ? 30.900  58.294 -24.206 1.00 35.27 ? 751  TYR A CD2 1 
ATOM   5410 C  CE1 . TYR A  1  716 ? 30.171  59.956 -22.129 1.00 32.23 ? 751  TYR A CE1 1 
ATOM   5411 C  CE2 . TYR A  1  716 ? 29.554  58.471 -23.907 1.00 31.95 ? 751  TYR A CE2 1 
ATOM   5412 C  CZ  . TYR A  1  716 ? 29.202  59.308 -22.868 1.00 35.06 ? 751  TYR A CZ  1 
ATOM   5413 O  OH  . TYR A  1  716 ? 27.877  59.491 -22.560 1.00 37.25 ? 751  TYR A OH  1 
ATOM   5414 N  N   . VAL A  1  717 ? 35.617  56.728 -24.645 1.00 30.64 ? 752  VAL A N   1 
ATOM   5415 C  CA  . VAL A  1  717 ? 36.980  56.625 -25.186 1.00 32.44 ? 752  VAL A CA  1 
ATOM   5416 C  C   . VAL A  1  717 ? 37.451  58.031 -25.529 1.00 33.76 ? 752  VAL A C   1 
ATOM   5417 O  O   . VAL A  1  717 ? 36.672  58.849 -26.017 1.00 34.96 ? 752  VAL A O   1 
ATOM   5418 C  CB  . VAL A  1  717 ? 37.085  55.702 -26.413 1.00 31.46 ? 752  VAL A CB  1 
ATOM   5419 C  CG1 . VAL A  1  717 ? 38.540  55.628 -26.903 1.00 33.43 ? 752  VAL A CG1 1 
ATOM   5420 C  CG2 . VAL A  1  717 ? 36.615  54.296 -26.070 1.00 30.29 ? 752  VAL A CG2 1 
ATOM   5421 N  N   . GLU A  1  718 ? 38.716  58.322 -25.241 1.00 36.46 ? 753  GLU A N   1 
ATOM   5422 C  CA  . GLU A  1  718 ? 39.225  59.679 -25.407 1.00 37.00 ? 753  GLU A CA  1 
ATOM   5423 C  C   . GLU A  1  718 ? 38.833  60.286 -26.761 1.00 39.52 ? 753  GLU A C   1 
ATOM   5424 O  O   . GLU A  1  718 ? 38.906  59.625 -27.805 1.00 38.11 ? 753  GLU A O   1 
ATOM   5425 C  CB  . GLU A  1  718 ? 40.743  59.728 -25.220 1.00 38.17 ? 753  GLU A CB  1 
ATOM   5426 C  CG  . GLU A  1  718 ? 41.320  61.098 -25.501 1.00 37.14 ? 753  GLU A CG  1 
ATOM   5427 C  CD  . GLU A  1  718 ? 42.740  61.252 -25.010 1.00 40.13 ? 753  GLU A CD  1 
ATOM   5428 O  OE1 . GLU A  1  718 ? 43.341  62.315 -25.269 1.00 36.63 ? 753  GLU A OE1 1 
ATOM   5429 O  OE2 . GLU A  1  718 ? 43.257  60.316 -24.364 1.00 39.88 ? 753  GLU A OE2 1 
ATOM   5430 N  N   . GLY A  1  719 ? 38.379  61.535 -26.711 1.00 35.81 ? 754  GLY A N   1 
ATOM   5431 C  CA  . GLY A  1  719 ? 38.067  62.316 -27.892 1.00 41.04 ? 754  GLY A CA  1 
ATOM   5432 C  C   . GLY A  1  719 ? 36.830  61.857 -28.632 1.00 42.32 ? 754  GLY A C   1 
ATOM   5433 O  O   . GLY A  1  719 ? 36.538  62.361 -29.717 1.00 42.31 ? 754  GLY A O   1 
ATOM   5434 N  N   . SER A  1  720 ? 36.095  60.912 -28.052 1.00 36.76 ? 755  SER A N   1 
ATOM   5435 C  CA  . SER A  1  720 ? 35.004  60.262 -28.771 1.00 35.70 ? 755  SER A CA  1 
ATOM   5436 C  C   . SER A  1  720 ? 33.702  60.220 -27.988 1.00 38.91 ? 755  SER A C   1 
ATOM   5437 O  O   . SER A  1  720 ? 33.630  60.678 -26.849 1.00 37.76 ? 755  SER A O   1 
ATOM   5438 C  CB  . SER A  1  720 ? 35.403  58.824 -29.098 1.00 35.57 ? 755  SER A CB  1 
ATOM   5439 O  OG  . SER A  1  720 ? 35.132  57.971 -27.982 1.00 34.82 ? 755  SER A OG  1 
ATOM   5440 N  N   . SER A  1  721 ? 32.677  59.635 -28.598 1.00 37.48 ? 756  SER A N   1 
ATOM   5441 C  CA  . SER A  1  721 ? 31.438  59.341 -27.884 1.00 38.30 ? 756  SER A CA  1 
ATOM   5442 C  C   . SER A  1  721 ? 31.200  57.823 -27.773 1.00 32.81 ? 756  SER A C   1 
ATOM   5443 O  O   . SER A  1  721 ? 30.072  57.365 -27.653 1.00 30.37 ? 756  SER A O   1 
ATOM   5444 C  CB  . SER A  1  721 ? 30.253  60.026 -28.557 1.00 37.60 ? 756  SER A CB  1 
ATOM   5445 O  OG  . SER A  1  721 ? 30.149  59.616 -29.907 1.00 42.13 ? 756  SER A OG  1 
ATOM   5446 N  N   . ILE A  1  722 ? 32.275  57.048 -27.831 1.00 33.54 ? 757  ILE A N   1 
ATOM   5447 C  CA  . ILE A  1  722 ? 32.188  55.608 -27.582 1.00 28.94 ? 757  ILE A CA  1 
ATOM   5448 C  C   . ILE A  1  722 ? 32.175  55.350 -26.071 1.00 31.68 ? 757  ILE A C   1 
ATOM   5449 O  O   . ILE A  1  722 ? 33.184  55.574 -25.395 1.00 31.04 ? 757  ILE A O   1 
ATOM   5450 C  CB  . ILE A  1  722 ? 33.411  54.900 -28.149 1.00 32.46 ? 757  ILE A CB  1 
ATOM   5451 C  CG1 . ILE A  1  722 ? 33.603  55.291 -29.618 1.00 31.23 ? 757  ILE A CG1 1 
ATOM   5452 C  CG2 . ILE A  1  722 ? 33.270  53.395 -28.024 1.00 30.37 ? 757  ILE A CG2 1 
ATOM   5453 C  CD1 . ILE A  1  722 ? 34.930  54.826 -30.172 1.00 32.42 ? 757  ILE A CD1 1 
ATOM   5454 N  N   . PRO A  1  723 ? 31.041  54.861 -25.542 1.00 32.97 ? 758  PRO A N   1 
ATOM   5455 C  CA  . PRO A  1  723 ? 30.890  54.697 -24.088 1.00 29.37 ? 758  PRO A CA  1 
ATOM   5456 C  C   . PRO A  1  723 ? 31.667  53.491 -23.580 1.00 26.36 ? 758  PRO A C   1 
ATOM   5457 O  O   . PRO A  1  723 ? 31.757  52.478 -24.262 1.00 28.69 ? 758  PRO A O   1 
ATOM   5458 C  CB  . PRO A  1  723 ? 29.393  54.466 -23.928 1.00 30.69 ? 758  PRO A CB  1 
ATOM   5459 C  CG  . PRO A  1  723 ? 29.012  53.741 -25.204 1.00 30.07 ? 758  PRO A CG  1 
ATOM   5460 C  CD  . PRO A  1  723 ? 29.856  54.385 -26.280 1.00 31.99 ? 758  PRO A CD  1 
ATOM   5461 N  N   . VAL A  1  724 ? 32.205  53.603 -22.367 1.00 29.27 ? 759  VAL A N   1 
ATOM   5462 C  CA  . VAL A  1  724 ? 33.046  52.564 -21.785 1.00 25.41 ? 759  VAL A CA  1 
ATOM   5463 C  C   . VAL A  1  724 ? 32.234  51.710 -20.792 1.00 22.92 ? 759  VAL A C   1 
ATOM   5464 O  O   . VAL A  1  724 ? 31.727  52.224 -19.803 1.00 25.01 ? 759  VAL A O   1 
ATOM   5465 C  CB  . VAL A  1  724 ? 34.268  53.193 -21.074 1.00 27.62 ? 759  VAL A CB  1 
ATOM   5466 C  CG1 . VAL A  1  724 ? 35.160  52.111 -20.445 1.00 27.78 ? 759  VAL A CG1 1 
ATOM   5467 C  CG2 . VAL A  1  724 ? 35.074  54.029 -22.068 1.00 27.98 ? 759  VAL A CG2 1 
ATOM   5468 N  N   . PRO A  1  725 ? 32.083  50.414 -21.082 1.00 22.96 ? 760  PRO A N   1 
ATOM   5469 C  CA  . PRO A  1  725 ? 31.366  49.508 -20.173 1.00 21.79 ? 760  PRO A CA  1 
ATOM   5470 C  C   . PRO A  1  725 ? 32.040  49.442 -18.794 1.00 26.18 ? 760  PRO A C   1 
ATOM   5471 O  O   . PRO A  1  725 ? 33.279  49.503 -18.719 1.00 24.87 ? 760  PRO A O   1 
ATOM   5472 C  CB  . PRO A  1  725 ? 31.476  48.152 -20.883 1.00 25.63 ? 760  PRO A CB  1 
ATOM   5473 C  CG  . PRO A  1  725 ? 31.627  48.509 -22.333 1.00 24.65 ? 760  PRO A CG  1 
ATOM   5474 C  CD  . PRO A  1  725 ? 32.498  49.736 -22.323 1.00 25.37 ? 760  PRO A CD  1 
ATOM   5475 N  N   . THR A  1  726 ? 31.248  49.312 -17.725 1.00 24.45 ? 761  THR A N   1 
ATOM   5476 C  CA  . THR A  1  726 ? 31.828  49.102 -16.389 1.00 22.92 ? 761  THR A CA  1 
ATOM   5477 C  C   . THR A  1  726 ? 32.147  47.637 -16.171 1.00 23.87 ? 761  THR A C   1 
ATOM   5478 O  O   . THR A  1  726 ? 33.009  47.284 -15.355 1.00 22.05 ? 761  THR A O   1 
ATOM   5479 C  CB  . THR A  1  726 ? 30.874  49.569 -15.273 1.00 21.28 ? 761  THR A CB  1 
ATOM   5480 O  OG1 . THR A  1  726 ? 29.610  48.922 -15.415 1.00 20.71 ? 761  THR A OG1 1 
ATOM   5481 C  CG2 . THR A  1  726 ? 30.678  51.069 -15.343 1.00 23.62 ? 761  THR A CG2 1 
ATOM   5482 N  N   . HIS A  1  727 ? 31.458  46.790 -16.926 1.00 21.02 ? 762  HIS A N   1 
ATOM   5483 C  CA  . HIS A  1  727 ? 31.623  45.345 -16.857 1.00 21.22 ? 762  HIS A CA  1 
ATOM   5484 C  C   . HIS A  1  727 ? 31.397  44.703 -18.222 1.00 22.09 ? 762  HIS A C   1 
ATOM   5485 O  O   . HIS A  1  727 ? 30.737  45.283 -19.092 1.00 25.00 ? 762  HIS A O   1 
ATOM   5486 C  CB  . HIS A  1  727 ? 30.580  44.773 -15.901 1.00 19.53 ? 762  HIS A CB  1 
ATOM   5487 C  CG  . HIS A  1  727 ? 30.694  45.292 -14.501 1.00 22.22 ? 762  HIS A CG  1 
ATOM   5488 N  ND1 . HIS A  1  727 ? 30.180  46.515 -14.115 1.00 21.01 ? 762  HIS A ND1 1 
ATOM   5489 C  CD2 . HIS A  1  727 ? 31.207  44.727 -13.382 1.00 21.26 ? 762  HIS A CD2 1 
ATOM   5490 C  CE1 . HIS A  1  727 ? 30.414  46.698 -12.825 1.00 21.49 ? 762  HIS A CE1 1 
ATOM   5491 N  NE2 . HIS A  1  727 ? 31.025  45.622 -12.358 1.00 18.98 ? 762  HIS A NE2 1 
ATOM   5492 N  N   . TYR A  1  728 ? 31.918  43.495 -18.394 1.00 23.65 ? 763  TYR A N   1 
ATOM   5493 C  CA  . TYR A  1  728 ? 31.549  42.666 -19.536 1.00 24.31 ? 763  TYR A CA  1 
ATOM   5494 C  C   . TYR A  1  728 ? 30.999  41.360 -19.021 1.00 25.99 ? 763  TYR A C   1 
ATOM   5495 O  O   . TYR A  1  728 ? 31.519  40.828 -18.045 1.00 24.41 ? 763  TYR A O   1 
ATOM   5496 C  CB  . TYR A  1  728 ? 32.757  42.399 -20.416 1.00 23.41 ? 763  TYR A CB  1 
ATOM   5497 C  CG  . TYR A  1  728 ? 33.133  43.596 -21.237 1.00 23.84 ? 763  TYR A CG  1 
ATOM   5498 C  CD1 . TYR A  1  728 ? 34.172  44.437 -20.845 1.00 22.49 ? 763  TYR A CD1 1 
ATOM   5499 C  CD2 . TYR A  1  728 ? 32.450  43.891 -22.410 1.00 23.88 ? 763  TYR A CD2 1 
ATOM   5500 C  CE1 . TYR A  1  728 ? 34.515  45.533 -21.593 1.00 27.00 ? 763  TYR A CE1 1 
ATOM   5501 C  CE2 . TYR A  1  728 ? 32.788  44.983 -23.155 1.00 26.64 ? 763  TYR A CE2 1 
ATOM   5502 C  CZ  . TYR A  1  728 ? 33.828  45.791 -22.763 1.00 26.83 ? 763  TYR A CZ  1 
ATOM   5503 O  OH  . TYR A  1  728 ? 34.148  46.898 -23.529 1.00 26.08 ? 763  TYR A OH  1 
ATOM   5504 N  N   . TYR A  1  729 ? 29.938  40.862 -19.656 1.00 21.82 ? 764  TYR A N   1 
ATOM   5505 C  CA  . TYR A  1  729 ? 29.308  39.634 -19.196 1.00 24.89 ? 764  TYR A CA  1 
ATOM   5506 C  C   . TYR A  1  729 ? 29.522  38.530 -20.208 1.00 27.33 ? 764  TYR A C   1 
ATOM   5507 O  O   . TYR A  1  729 ? 29.777  38.781 -21.391 1.00 27.04 ? 764  TYR A O   1 
ATOM   5508 C  CB  . TYR A  1  729 ? 27.796  39.830 -18.962 1.00 23.35 ? 764  TYR A CB  1 
ATOM   5509 C  CG  . TYR A  1  729 ? 26.976  40.004 -20.245 1.00 24.35 ? 764  TYR A CG  1 
ATOM   5510 C  CD1 . TYR A  1  729 ? 26.484  38.890 -20.947 1.00 26.63 ? 764  TYR A CD1 1 
ATOM   5511 C  CD2 . TYR A  1  729 ? 26.682  41.273 -20.750 1.00 26.03 ? 764  TYR A CD2 1 
ATOM   5512 C  CE1 . TYR A  1  729 ? 25.728  39.044 -22.125 1.00 25.91 ? 764  TYR A CE1 1 
ATOM   5513 C  CE2 . TYR A  1  729 ? 25.923  41.431 -21.933 1.00 24.68 ? 764  TYR A CE2 1 
ATOM   5514 C  CZ  . TYR A  1  729 ? 25.459  40.308 -22.612 1.00 26.02 ? 764  TYR A CZ  1 
ATOM   5515 O  OH  . TYR A  1  729 ? 24.697  40.459 -23.768 1.00 28.09 ? 764  TYR A OH  1 
ATOM   5516 N  N   . SER A  1  730 ? 29.424  37.303 -19.735 1.00 25.38 ? 765  SER A N   1 
ATOM   5517 C  CA  . SER A  1  730 ? 29.318  36.188 -20.648 1.00 27.07 ? 765  SER A CA  1 
ATOM   5518 C  C   . SER A  1  730 ? 28.425  35.137 -20.020 1.00 27.36 ? 765  SER A C   1 
ATOM   5519 O  O   . SER A  1  730 ? 28.495  34.891 -18.812 1.00 23.92 ? 765  SER A O   1 
ATOM   5520 C  CB  . SER A  1  730 ? 30.705  35.645 -21.013 1.00 28.75 ? 765  SER A CB  1 
ATOM   5521 O  OG  . SER A  1  730 ? 30.597  34.679 -22.038 1.00 34.44 ? 765  SER A OG  1 
ATOM   5522 N  N   . ILE A  1  731 ? 27.542  34.568 -20.827 1.00 24.78 ? 766  ILE A N   1 
ATOM   5523 C  CA  . ILE A  1  731 ? 26.597  33.567 -20.356 1.00 24.55 ? 766  ILE A CA  1 
ATOM   5524 C  C   . ILE A  1  731 ? 26.856  32.324 -21.179 1.00 29.49 ? 766  ILE A C   1 
ATOM   5525 O  O   . ILE A  1  731 ? 26.668  32.343 -22.389 1.00 29.18 ? 766  ILE A O   1 
ATOM   5526 C  CB  . ILE A  1  731 ? 25.141  33.980 -20.606 1.00 26.16 ? 766  ILE A CB  1 
ATOM   5527 C  CG1 . ILE A  1  731 ? 24.760  35.236 -19.810 1.00 21.80 ? 766  ILE A CG1 1 
ATOM   5528 C  CG2 . ILE A  1  731 ? 24.211  32.850 -20.240 1.00 25.78 ? 766  ILE A CG2 1 
ATOM   5529 C  CD1 . ILE A  1  731 ? 23.384  35.813 -20.203 1.00 22.94 ? 766  ILE A CD1 1 
ATOM   5530 N  N   . ILE A  1  732 ? 27.268  31.249 -20.527 1.00 25.42 ? 767  ILE A N   1 
ATOM   5531 C  CA  . ILE A  1  732 ? 27.693  30.048 -21.241 1.00 28.84 ? 767  ILE A CA  1 
ATOM   5532 C  C   . ILE A  1  732 ? 26.742  28.889 -20.962 1.00 30.22 ? 767  ILE A C   1 
ATOM   5533 O  O   . ILE A  1  732 ? 26.638  28.413 -19.833 1.00 28.08 ? 767  ILE A O   1 
ATOM   5534 C  CB  . ILE A  1  732 ? 29.124  29.696 -20.852 1.00 30.21 ? 767  ILE A CB  1 
ATOM   5535 C  CG1 . ILE A  1  732 ? 30.007  30.933 -21.051 1.00 31.94 ? 767  ILE A CG1 1 
ATOM   5536 C  CG2 . ILE A  1  732 ? 29.645  28.532 -21.712 1.00 31.62 ? 767  ILE A CG2 1 
ATOM   5537 C  CD1 . ILE A  1  732 ? 31.287  30.894 -20.296 1.00 34.30 ? 767  ILE A CD1 1 
ATOM   5538 N  N   . THR A  1  733 ? 26.056  28.436 -22.007 1.00 29.12 ? 768  THR A N   1 
ATOM   5539 C  CA  . THR A  1  733 ? 24.981  27.470 -21.858 1.00 27.47 ? 768  THR A CA  1 
ATOM   5540 C  C   . THR A  1  733 ? 25.344  26.176 -22.585 1.00 31.93 ? 768  THR A C   1 
ATOM   5541 O  O   . THR A  1  733 ? 25.975  26.207 -23.639 1.00 32.24 ? 768  THR A O   1 
ATOM   5542 C  CB  . THR A  1  733 ? 23.669  28.026 -22.429 1.00 31.20 ? 768  THR A CB  1 
ATOM   5543 O  OG1 . THR A  1  733 ? 23.458  29.361 -21.942 1.00 28.75 ? 768  THR A OG1 1 
ATOM   5544 C  CG2 . THR A  1  733 ? 22.484  27.141 -22.044 1.00 30.92 ? 768  THR A CG2 1 
ATOM   5545 N  N   . SER A  1  734 ? 24.955  25.049 -21.997 1.00 30.67 ? 769  SER A N   1 
ATOM   5546 C  CA  . SER A  1  734 ? 25.156  23.735 -22.600 1.00 33.60 ? 769  SER A CA  1 
ATOM   5547 C  C   . SER A  1  734 ? 24.029  22.793 -22.169 1.00 33.20 ? 769  SER A C   1 
ATOM   5548 O  O   . SER A  1  734 ? 23.069  23.206 -21.502 1.00 33.96 ? 769  SER A O   1 
ATOM   5549 C  CB  . SER A  1  734 ? 26.543  23.166 -22.251 1.00 32.82 ? 769  SER A CB  1 
ATOM   5550 O  OG  . SER A  1  734 ? 26.730  22.948 -20.846 1.00 32.60 ? 769  SER A OG  1 
ATOM   5551 N  N   . CYS A  1  735 ? 24.127  21.527 -22.559 1.00 34.04 ? 770  CYS A N   1 
ATOM   5552 C  CA  . CYS A  1  735 ? 23.081  20.572 -22.235 1.00 30.56 ? 770  CYS A CA  1 
ATOM   5553 C  C   . CYS A  1  735 ? 23.368  19.988 -20.862 1.00 30.77 ? 770  CYS A C   1 
ATOM   5554 O  O   . CYS A  1  735 ? 24.509  19.610 -20.566 1.00 30.11 ? 770  CYS A O   1 
ATOM   5555 C  CB  . CYS A  1  735 ? 23.033  19.456 -23.289 1.00 33.18 ? 770  CYS A CB  1 
ATOM   5556 S  SG  . CYS A  1  735 ? 21.496  18.543 -23.290 1.00 34.80 ? 770  CYS A SG  1 
ATOM   5557 N  N   . LEU A  1  736 ? 22.348  19.930 -20.004 1.00 28.54 ? 771  LEU A N   1 
ATOM   5558 C  CA  . LEU A  1  736 ? 22.551  19.365 -18.676 1.00 29.67 ? 771  LEU A CA  1 
ATOM   5559 C  C   . LEU A  1  736 ? 23.024  17.931 -18.810 1.00 33.67 ? 771  LEU A C   1 
ATOM   5560 O  O   . LEU A  1  736 ? 23.901  17.487 -18.074 1.00 27.92 ? 771  LEU A O   1 
ATOM   5561 C  CB  . LEU A  1  736 ? 21.277  19.415 -17.832 1.00 28.27 ? 771  LEU A CB  1 
ATOM   5562 C  CG  . LEU A  1  736 ? 21.481  19.096 -16.355 1.00 30.53 ? 771  LEU A CG  1 
ATOM   5563 C  CD1 . LEU A  1  736 ? 22.422  20.117 -15.714 1.00 29.93 ? 771  LEU A CD1 1 
ATOM   5564 C  CD2 . LEU A  1  736 ? 20.141  19.089 -15.657 1.00 30.98 ? 771  LEU A CD2 1 
ATOM   5565 N  N   . ASP A  1  737 ? 22.422  17.212 -19.758 1.00 32.21 ? 772  ASP A N   1 
ATOM   5566 C  CA  . ASP A  1  737 ? 22.893  15.889 -20.107 1.00 35.45 ? 772  ASP A CA  1 
ATOM   5567 C  C   . ASP A  1  737 ? 24.093  16.074 -21.016 1.00 34.90 ? 772  ASP A C   1 
ATOM   5568 O  O   . ASP A  1  737 ? 23.943  16.338 -22.210 1.00 38.42 ? 772  ASP A O   1 
ATOM   5569 C  CB  . ASP A  1  737 ? 21.803  15.113 -20.830 1.00 37.39 ? 772  ASP A CB  1 
ATOM   5570 C  CG  . ASP A  1  737 ? 22.256  13.718 -21.240 1.00 42.04 ? 772  ASP A CG  1 
ATOM   5571 O  OD1 . ASP A  1  737 ? 23.453  13.396 -21.056 1.00 37.09 ? 772  ASP A OD1 1 
ATOM   5572 O  OD2 . ASP A  1  737 ? 21.407  12.952 -21.740 1.00 42.52 ? 772  ASP A OD2 1 
ATOM   5573 N  N   . PHE A  1  738 ? 25.288  15.969 -20.444 1.00 33.95 ? 773  PHE A N   1 
ATOM   5574 C  CA  . PHE A  1  738 ? 26.498  16.264 -21.203 1.00 37.50 ? 773  PHE A CA  1 
ATOM   5575 C  C   . PHE A  1  738 ? 26.715  15.293 -22.376 1.00 37.37 ? 773  PHE A C   1 
ATOM   5576 O  O   . PHE A  1  738 ? 27.505  15.570 -23.280 1.00 37.69 ? 773  PHE A O   1 
ATOM   5577 C  CB  . PHE A  1  738 ? 27.737  16.354 -20.291 1.00 33.31 ? 773  PHE A CB  1 
ATOM   5578 C  CG  . PHE A  1  738 ? 27.847  15.241 -19.284 1.00 37.27 ? 773  PHE A CG  1 
ATOM   5579 C  CD1 . PHE A  1  738 ? 28.377  14.009 -19.642 1.00 37.24 ? 773  PHE A CD1 1 
ATOM   5580 C  CD2 . PHE A  1  738 ? 27.431  15.433 -17.962 1.00 39.63 ? 773  PHE A CD2 1 
ATOM   5581 C  CE1 . PHE A  1  738 ? 28.475  12.974 -18.700 1.00 38.59 ? 773  PHE A CE1 1 
ATOM   5582 C  CE2 . PHE A  1  738 ? 27.534  14.415 -17.013 1.00 37.01 ? 773  PHE A CE2 1 
ATOM   5583 C  CZ  . PHE A  1  738 ? 28.055  13.181 -17.380 1.00 35.26 ? 773  PHE A CZ  1 
ATOM   5584 N  N   . THR A  1  739 ? 26.007  14.169 -22.377 1.00 38.43 ? 774  THR A N   1 
ATOM   5585 C  CA  . THR A  1  739 ? 26.171  13.222 -23.480 1.00 40.25 ? 774  THR A CA  1 
ATOM   5586 C  C   . THR A  1  739 ? 25.614  13.801 -24.787 1.00 42.36 ? 774  THR A C   1 
ATOM   5587 O  O   . THR A  1  739 ? 25.964  13.353 -25.875 1.00 42.25 ? 774  THR A O   1 
ATOM   5588 C  CB  . THR A  1  739 ? 25.551  11.838 -23.183 1.00 36.60 ? 774  THR A CB  1 
ATOM   5589 O  OG1 . THR A  1  739 ? 24.119  11.906 -23.258 1.00 39.70 ? 774  THR A OG1 1 
ATOM   5590 C  CG2 . THR A  1  739 ? 25.978  11.341 -21.802 1.00 40.14 ? 774  THR A CG2 1 
ATOM   5591 N  N   . GLN A  1  740 ? 24.755  14.810 -24.669 1.00 40.21 ? 775  GLN A N   1 
ATOM   5592 C  CA  . GLN A  1  740 ? 24.217  15.497 -25.832 1.00 38.29 ? 775  GLN A CA  1 
ATOM   5593 C  C   . GLN A  1  740 ? 24.963  16.807 -26.072 1.00 40.50 ? 775  GLN A C   1 
ATOM   5594 O  O   . GLN A  1  740 ? 25.258  17.546 -25.133 1.00 38.79 ? 775  GLN A O   1 
ATOM   5595 C  CB  . GLN A  1  740 ? 22.725  15.772 -25.658 1.00 40.78 ? 775  GLN A CB  1 
ATOM   5596 C  CG  . GLN A  1  740 ? 21.929  14.573 -25.202 1.00 38.32 ? 775  GLN A CG  1 
ATOM   5597 C  CD  . GLN A  1  740 ? 20.462  14.746 -25.480 1.00 48.28 ? 775  GLN A CD  1 
ATOM   5598 O  OE1 . GLN A  1  740 ? 19.938  15.861 -25.436 1.00 49.04 ? 775  GLN A OE1 1 
ATOM   5599 N  NE2 . GLN A  1  740 ? 19.784  13.645 -25.788 1.00 54.43 ? 775  GLN A NE2 1 
ATOM   5600 N  N   . PRO A  1  741 ? 25.280  17.095 -27.337 1.00 42.45 ? 776  PRO A N   1 
ATOM   5601 C  CA  . PRO A  1  741 ? 25.993  18.321 -27.704 1.00 41.00 ? 776  PRO A CA  1 
ATOM   5602 C  C   . PRO A  1  741 ? 25.111  19.532 -27.444 1.00 39.93 ? 776  PRO A C   1 
ATOM   5603 O  O   . PRO A  1  741 ? 23.889  19.424 -27.561 1.00 41.10 ? 776  PRO A O   1 
ATOM   5604 C  CB  . PRO A  1  741 ? 26.214  18.153 -29.215 1.00 42.67 ? 776  PRO A CB  1 
ATOM   5605 C  CG  . PRO A  1  741 ? 26.124  16.670 -29.445 1.00 44.64 ? 776  PRO A CG  1 
ATOM   5606 C  CD  . PRO A  1  741 ? 25.056  16.222 -28.503 1.00 45.04 ? 776  PRO A CD  1 
ATOM   5607 N  N   . ALA A  1  742 ? 25.716  20.664 -27.108 1.00 39.45 ? 777  ALA A N   1 
ATOM   5608 C  CA  . ALA A  1  742 ? 24.947  21.878 -26.825 1.00 41.55 ? 777  ALA A CA  1 
ATOM   5609 C  C   . ALA A  1  742 ? 23.854  22.151 -27.860 1.00 43.13 ? 777  ALA A C   1 
ATOM   5610 O  O   . ALA A  1  742 ? 22.745  22.551 -27.507 1.00 42.84 ? 777  ALA A O   1 
ATOM   5611 C  CB  . ALA A  1  742 ? 25.877  23.082 -26.700 1.00 38.73 ? 777  ALA A CB  1 
ATOM   5612 N  N   . ASP A  1  743 ? 24.153  21.931 -29.141 1.00 46.29 ? 778  ASP A N   1 
ATOM   5613 C  CA  . ASP A  1  743 ? 23.190  22.282 -30.193 1.00 44.11 ? 778  ASP A CA  1 
ATOM   5614 C  C   . ASP A  1  743 ? 22.128  21.216 -30.486 1.00 48.06 ? 778  ASP A C   1 
ATOM   5615 O  O   . ASP A  1  743 ? 21.204  21.451 -31.266 1.00 50.73 ? 778  ASP A O   1 
ATOM   5616 C  CB  . ASP A  1  743 ? 23.895  22.733 -31.484 1.00 51.49 ? 778  ASP A CB  1 
ATOM   5617 C  CG  . ASP A  1  743 ? 24.683  21.614 -32.162 1.00 54.50 ? 778  ASP A CG  1 
ATOM   5618 O  OD1 . ASP A  1  743 ? 24.594  20.442 -31.728 1.00 50.48 ? 778  ASP A OD1 1 
ATOM   5619 O  OD2 . ASP A  1  743 ? 25.394  21.918 -33.146 1.00 58.08 ? 778  ASP A OD2 1 
ATOM   5620 N  N   . LYS A  1  744 ? 22.250  20.054 -29.852 1.00 48.16 ? 779  LYS A N   1 
ATOM   5621 C  CA  . LYS A  1  744 ? 21.267  18.989 -30.024 1.00 48.21 ? 779  LYS A CA  1 
ATOM   5622 C  C   . LYS A  1  744 ? 20.748  18.542 -28.666 1.00 48.38 ? 779  LYS A C   1 
ATOM   5623 O  O   . LYS A  1  744 ? 20.636  17.345 -28.386 1.00 46.02 ? 779  LYS A O   1 
ATOM   5624 C  CB  . LYS A  1  744 ? 21.878  17.797 -30.781 1.00 47.80 ? 779  LYS A CB  1 
ATOM   5625 N  N   . CYS A  1  745 ? 20.427  19.514 -27.817 1.00 47.17 ? 780  CYS A N   1 
ATOM   5626 C  CA  . CYS A  1  745 ? 19.978  19.207 -26.471 1.00 42.37 ? 780  CYS A CA  1 
ATOM   5627 C  C   . CYS A  1  745 ? 18.474  18.999 -26.437 1.00 41.39 ? 780  CYS A C   1 
ATOM   5628 O  O   . CYS A  1  745 ? 17.702  19.878 -26.813 1.00 42.22 ? 780  CYS A O   1 
ATOM   5629 C  CB  . CYS A  1  745 ? 20.386  20.313 -25.496 1.00 41.95 ? 780  CYS A CB  1 
ATOM   5630 S  SG  . CYS A  1  745 ? 20.038  19.869 -23.789 1.00 40.19 ? 780  CYS A SG  1 
ATOM   5631 N  N   . ASP A  1  746 ? 18.065  17.824 -25.980 1.00 43.40 ? 781  ASP A N   1 
ATOM   5632 C  CA  . ASP A  1  746 ? 16.657  17.478 -25.915 1.00 45.42 ? 781  ASP A CA  1 
ATOM   5633 C  C   . ASP A  1  746 ? 15.950  18.034 -24.683 1.00 46.13 ? 781  ASP A C   1 
ATOM   5634 O  O   . ASP A  1  746 ? 14.752  18.315 -24.742 1.00 45.68 ? 781  ASP A O   1 
ATOM   5635 C  CB  . ASP A  1  746 ? 16.489  15.960 -25.920 1.00 52.20 ? 781  ASP A CB  1 
ATOM   5636 C  CG  . ASP A  1  746 ? 16.598  15.370 -27.304 1.00 55.76 ? 781  ASP A CG  1 
ATOM   5637 O  OD1 . ASP A  1  746 ? 17.064  14.212 -27.423 1.00 59.62 ? 781  ASP A OD1 1 
ATOM   5638 O  OD2 . ASP A  1  746 ? 16.219  16.070 -28.269 1.00 54.89 ? 781  ASP A OD2 1 
ATOM   5639 N  N   . GLY A  1  747 ? 16.684  18.178 -23.575 1.00 42.88 ? 782  GLY A N   1 
ATOM   5640 C  CA  . GLY A  1  747 ? 16.078  18.460 -22.280 1.00 36.79 ? 782  GLY A CA  1 
ATOM   5641 C  C   . GLY A  1  747 ? 16.665  19.652 -21.537 1.00 36.03 ? 782  GLY A C   1 
ATOM   5642 O  O   . GLY A  1  747 ? 16.998  20.664 -22.158 1.00 34.23 ? 782  GLY A O   1 
ATOM   5643 N  N   . PRO A  1  748 ? 16.808  19.533 -20.203 1.00 35.95 ? 783  PRO A N   1 
ATOM   5644 C  CA  . PRO A  1  748 ? 17.227  20.679 -19.380 1.00 34.47 ? 783  PRO A CA  1 
ATOM   5645 C  C   . PRO A  1  748 ? 18.588  21.229 -19.762 1.00 30.90 ? 783  PRO A C   1 
ATOM   5646 O  O   . PRO A  1  748 ? 19.442  20.515 -20.300 1.00 30.60 ? 783  PRO A O   1 
ATOM   5647 C  CB  . PRO A  1  748 ? 17.267  20.103 -17.954 1.00 33.73 ? 783  PRO A CB  1 
ATOM   5648 C  CG  . PRO A  1  748 ? 16.324  18.943 -17.994 1.00 38.88 ? 783  PRO A CG  1 
ATOM   5649 C  CD  . PRO A  1  748 ? 16.495  18.355 -19.380 1.00 33.59 ? 783  PRO A CD  1 
ATOM   5650 N  N   . LEU A  1  749 ? 18.784  22.514 -19.476 1.00 29.55 ? 784  LEU A N   1 
ATOM   5651 C  CA  . LEU A  1  749 ? 20.033  23.202 -19.782 1.00 24.86 ? 784  LEU A CA  1 
ATOM   5652 C  C   . LEU A  1  749 ? 20.962  23.343 -18.566 1.00 27.72 ? 784  LEU A C   1 
ATOM   5653 O  O   . LEU A  1  749 ? 20.525  23.211 -17.419 1.00 27.85 ? 784  LEU A O   1 
ATOM   5654 C  CB  . LEU A  1  749 ? 19.737  24.588 -20.357 1.00 29.00 ? 784  LEU A CB  1 
ATOM   5655 C  CG  . LEU A  1  749 ? 18.840  24.669 -21.602 1.00 33.13 ? 784  LEU A CG  1 
ATOM   5656 C  CD1 . LEU A  1  749 ? 18.568  26.115 -22.000 1.00 29.65 ? 784  LEU A CD1 1 
ATOM   5657 C  CD2 . LEU A  1  749 ? 19.466  23.915 -22.765 1.00 31.00 ? 784  LEU A CD2 1 
ATOM   5658 N  N   . SER A  1  750 ? 22.240  23.589 -18.836 1.00 28.19 ? 785  SER A N   1 
ATOM   5659 C  CA  . SER A  1  750 ? 23.227  23.919 -17.805 1.00 28.81 ? 785  SER A CA  1 
ATOM   5660 C  C   . SER A  1  750 ? 23.830  25.285 -18.133 1.00 27.06 ? 785  SER A C   1 
ATOM   5661 O  O   . SER A  1  750 ? 24.200  25.544 -19.282 1.00 28.61 ? 785  SER A O   1 
ATOM   5662 C  CB  . SER A  1  750 ? 24.315  22.837 -17.731 1.00 28.64 ? 785  SER A CB  1 
ATOM   5663 O  OG  . SER A  1  750 ? 25.393  23.210 -16.890 1.00 32.94 ? 785  SER A OG  1 
ATOM   5664 N  N   . VAL A  1  751 ? 23.928  26.178 -17.145 1.00 24.55 ? 786  VAL A N   1 
ATOM   5665 C  CA  . VAL A  1  751 ? 24.432  27.526 -17.434 1.00 20.39 ? 786  VAL A CA  1 
ATOM   5666 C  C   . VAL A  1  751 ? 25.449  27.990 -16.375 1.00 24.28 ? 786  VAL A C   1 
ATOM   5667 O  O   . VAL A  1  751 ? 25.311  27.677 -15.201 1.00 23.67 ? 786  VAL A O   1 
ATOM   5668 C  CB  . VAL A  1  751 ? 23.257  28.550 -17.557 1.00 25.32 ? 786  VAL A CB  1 
ATOM   5669 C  CG1 . VAL A  1  751 ? 22.542  28.735 -16.221 1.00 26.58 ? 786  VAL A CG1 1 
ATOM   5670 C  CG2 . VAL A  1  751 ? 23.748  29.895 -18.121 1.00 23.96 ? 786  VAL A CG2 1 
ATOM   5671 N  N   . SER A  1  752 ? 26.490  28.685 -16.806 1.00 25.79 ? 787  SER A N   1 
ATOM   5672 C  CA  . SER A  1  752 ? 27.333  29.434 -15.882 1.00 24.77 ? 787  SER A CA  1 
ATOM   5673 C  C   . SER A  1  752 ? 27.548  30.798 -16.514 1.00 27.14 ? 787  SER A C   1 
ATOM   5674 O  O   . SER A  1  752 ? 27.606  30.922 -17.740 1.00 27.83 ? 787  SER A O   1 
ATOM   5675 C  CB  . SER A  1  752 ? 28.662  28.725 -15.592 1.00 26.46 ? 787  SER A CB  1 
ATOM   5676 O  OG  . SER A  1  752 ? 29.400  28.504 -16.773 1.00 34.23 ? 787  SER A OG  1 
ATOM   5677 N  N   . SER A  1  753 ? 27.620  31.837 -15.696 1.00 22.36 ? 788  SER A N   1 
ATOM   5678 C  CA  . SER A  1  753 ? 27.797  33.175 -16.252 1.00 20.75 ? 788  SER A CA  1 
ATOM   5679 C  C   . SER A  1  753 ? 28.728  33.973 -15.371 1.00 23.82 ? 788  SER A C   1 
ATOM   5680 O  O   . SER A  1  753 ? 28.970  33.594 -14.237 1.00 21.96 ? 788  SER A O   1 
ATOM   5681 C  CB  . SER A  1  753 ? 26.472  33.912 -16.356 1.00 23.58 ? 788  SER A CB  1 
ATOM   5682 O  OG  . SER A  1  753 ? 25.458  33.084 -16.859 1.00 29.61 ? 788  SER A OG  1 
ATOM   5683 N  N   . PHE A  1  754 ? 29.219  35.084 -15.907 1.00 21.76 ? 789  PHE A N   1 
ATOM   5684 C  CA  . PHE A  1  754 ? 30.107  35.982 -15.182 1.00 20.50 ? 789  PHE A CA  1 
ATOM   5685 C  C   . PHE A  1  754 ? 29.779  37.432 -15.498 1.00 22.48 ? 789  PHE A C   1 
ATOM   5686 O  O   . PHE A  1  754 ? 29.256  37.744 -16.575 1.00 23.67 ? 789  PHE A O   1 
ATOM   5687 C  CB  . PHE A  1  754 ? 31.557  35.739 -15.615 1.00 27.24 ? 789  PHE A CB  1 
ATOM   5688 C  CG  . PHE A  1  754 ? 31.973  34.301 -15.568 1.00 28.63 ? 789  PHE A CG  1 
ATOM   5689 C  CD1 . PHE A  1  754 ? 31.773  33.471 -16.662 1.00 31.89 ? 789  PHE A CD1 1 
ATOM   5690 C  CD2 . PHE A  1  754 ? 32.582  33.785 -14.438 1.00 26.61 ? 789  PHE A CD2 1 
ATOM   5691 C  CE1 . PHE A  1  754 ? 32.162  32.134 -16.615 1.00 32.26 ? 789  PHE A CE1 1 
ATOM   5692 C  CE2 . PHE A  1  754 ? 32.985  32.458 -14.387 1.00 31.31 ? 789  PHE A CE2 1 
ATOM   5693 C  CZ  . PHE A  1  754 ? 32.772  31.632 -15.475 1.00 34.19 ? 789  PHE A CZ  1 
ATOM   5694 N  N   . ILE A  1  755 ? 30.109  38.318 -14.560 1.00 20.65 ? 790  ILE A N   1 
ATOM   5695 C  CA  . ILE A  1  755 ? 30.059  39.757 -14.782 1.00 19.33 ? 790  ILE A CA  1 
ATOM   5696 C  C   . ILE A  1  755 ? 31.421  40.306 -14.343 1.00 20.65 ? 790  ILE A C   1 
ATOM   5697 O  O   . ILE A  1  755 ? 31.683  40.521 -13.156 1.00 20.13 ? 790  ILE A O   1 
ATOM   5698 C  CB  . ILE A  1  755 ? 28.926  40.450 -13.998 1.00 19.18 ? 790  ILE A CB  1 
ATOM   5699 C  CG1 . ILE A  1  755 ? 27.561  39.905 -14.446 1.00 18.82 ? 790  ILE A CG1 1 
ATOM   5700 C  CG2 . ILE A  1  755 ? 28.992  41.987 -14.210 1.00 22.93 ? 790  ILE A CG2 1 
ATOM   5701 C  CD1 . ILE A  1  755 ? 26.365  40.345 -13.560 1.00 19.90 ? 790  ILE A CD1 1 
ATOM   5702 N  N   . LEU A  1  756 ? 32.313  40.471 -15.316 1.00 22.36 ? 791  LEU A N   1 
ATOM   5703 C  CA  . LEU A  1  756 ? 33.683  40.836 -15.028 1.00 22.19 ? 791  LEU A CA  1 
ATOM   5704 C  C   . LEU A  1  756 ? 33.828  42.354 -14.958 1.00 21.53 ? 791  LEU A C   1 
ATOM   5705 O  O   . LEU A  1  756 ? 33.353  43.083 -15.834 1.00 21.75 ? 791  LEU A O   1 
ATOM   5706 C  CB  . LEU A  1  756 ? 34.639  40.254 -16.099 1.00 21.55 ? 791  LEU A CB  1 
ATOM   5707 C  CG  . LEU A  1  756 ? 34.457  38.740 -16.353 1.00 23.68 ? 791  LEU A CG  1 
ATOM   5708 C  CD1 . LEU A  1  756 ? 35.443  38.260 -17.451 1.00 25.23 ? 791  LEU A CD1 1 
ATOM   5709 C  CD2 . LEU A  1  756 ? 34.672  37.929 -15.082 1.00 23.54 ? 791  LEU A CD2 1 
ATOM   5710 N  N   . PRO A  1  757 ? 34.476  42.843 -13.902 1.00 21.40 ? 792  PRO A N   1 
ATOM   5711 C  CA  . PRO A  1  757 ? 34.658  44.298 -13.793 1.00 20.03 ? 792  PRO A CA  1 
ATOM   5712 C  C   . PRO A  1  757 ? 35.679  44.822 -14.796 1.00 21.16 ? 792  PRO A C   1 
ATOM   5713 O  O   . PRO A  1  757 ? 36.740  44.250 -14.975 1.00 22.94 ? 792  PRO A O   1 
ATOM   5714 C  CB  . PRO A  1  757 ? 35.166  44.501 -12.349 1.00 22.55 ? 792  PRO A CB  1 
ATOM   5715 C  CG  . PRO A  1  757 ? 35.653  43.162 -11.916 1.00 26.12 ? 792  PRO A CG  1 
ATOM   5716 C  CD  . PRO A  1  757 ? 35.001  42.101 -12.740 1.00 22.45 ? 792  PRO A CD  1 
ATOM   5717 N  N   . HIS A  1  758 ? 35.336  45.928 -15.439 1.00 24.01 ? 793  HIS A N   1 
ATOM   5718 C  CA  . HIS A  1  758 ? 36.221  46.499 -16.450 1.00 22.52 ? 793  HIS A CA  1 
ATOM   5719 C  C   . HIS A  1  758 ? 37.054  47.570 -15.764 1.00 22.95 ? 793  HIS A C   1 
ATOM   5720 O  O   . HIS A  1  758 ? 36.596  48.698 -15.610 1.00 24.25 ? 793  HIS A O   1 
ATOM   5721 C  CB  . HIS A  1  758 ? 35.402  47.101 -17.596 1.00 25.41 ? 793  HIS A CB  1 
ATOM   5722 C  CG  . HIS A  1  758 ? 36.253  47.683 -18.683 1.00 22.02 ? 793  HIS A CG  1 
ATOM   5723 N  ND1 . HIS A  1  758 ? 35.851  48.746 -19.460 1.00 24.59 ? 793  HIS A ND1 1 
ATOM   5724 C  CD2 . HIS A  1  758 ? 37.513  47.383 -19.073 1.00 27.24 ? 793  HIS A CD2 1 
ATOM   5725 C  CE1 . HIS A  1  758 ? 36.817  49.059 -20.305 1.00 24.69 ? 793  HIS A CE1 1 
ATOM   5726 N  NE2 . HIS A  1  758 ? 37.836  48.245 -20.094 1.00 24.88 ? 793  HIS A NE2 1 
ATOM   5727 N  N   . ARG A  1  759 ? 38.258  47.189 -15.331 1.00 23.26 ? 794  ARG A N   1 
ATOM   5728 C  CA  . ARG A  1  759 ? 39.099  48.046 -14.512 1.00 22.60 ? 794  ARG A CA  1 
ATOM   5729 C  C   . ARG A  1  759 ? 40.459  48.297 -15.202 1.00 25.05 ? 794  ARG A C   1 
ATOM   5730 O  O   . ARG A  1  759 ? 40.950  47.444 -15.943 1.00 28.41 ? 794  ARG A O   1 
ATOM   5731 C  CB  . ARG A  1  759 ? 39.300  47.420 -13.129 1.00 22.20 ? 794  ARG A CB  1 
ATOM   5732 C  CG  . ARG A  1  759 ? 38.010  47.449 -12.277 1.00 21.01 ? 794  ARG A CG  1 
ATOM   5733 C  CD  . ARG A  1  759 ? 38.194  46.781 -10.923 1.00 23.71 ? 794  ARG A CD  1 
ATOM   5734 N  NE  . ARG A  1  759 ? 39.252  47.397 -10.134 1.00 25.18 ? 794  ARG A NE  1 
ATOM   5735 C  CZ  . ARG A  1  759 ? 39.533  47.057 -8.882  1.00 24.84 ? 794  ARG A CZ  1 
ATOM   5736 N  NH1 . ARG A  1  759 ? 38.798  46.135 -8.264  1.00 23.05 ? 794  ARG A NH1 1 
ATOM   5737 N  NH2 . ARG A  1  759 ? 40.540  47.647 -8.246  1.00 21.72 ? 794  ARG A NH2 1 
ATOM   5738 N  N   . PRO A  1  760 ? 41.063  49.467 -14.947 1.00 25.41 ? 795  PRO A N   1 
ATOM   5739 C  CA  . PRO A  1  760 ? 42.304  49.878 -15.621 1.00 24.01 ? 795  PRO A CA  1 
ATOM   5740 C  C   . PRO A  1  760 ? 43.549  49.225 -15.016 1.00 31.49 ? 795  PRO A C   1 
ATOM   5741 O  O   . PRO A  1  760 ? 44.655  49.420 -15.510 1.00 26.42 ? 795  PRO A O   1 
ATOM   5742 C  CB  . PRO A  1  760 ? 42.323  51.400 -15.418 1.00 27.46 ? 795  PRO A CB  1 
ATOM   5743 C  CG  . PRO A  1  760 ? 41.556  51.609 -14.134 1.00 29.65 ? 795  PRO A CG  1 
ATOM   5744 C  CD  . PRO A  1  760 ? 40.485  50.546 -14.129 1.00 25.17 ? 795  PRO A CD  1 
ATOM   5745 N  N   . ASP A  1  761 ? 43.368  48.454 -13.947 1.00 27.11 ? 796  ASP A N   1 
ATOM   5746 C  CA  . ASP A  1  761 ? 44.472  47.698 -13.378 1.00 26.90 ? 796  ASP A CA  1 
ATOM   5747 C  C   . ASP A  1  761 ? 43.952  46.352 -12.890 1.00 24.42 ? 796  ASP A C   1 
ATOM   5748 O  O   . ASP A  1  761 ? 42.743  46.140 -12.827 1.00 24.37 ? 796  ASP A O   1 
ATOM   5749 C  CB  . ASP A  1  761 ? 45.125  48.476 -12.238 1.00 27.74 ? 796  ASP A CB  1 
ATOM   5750 C  CG  . ASP A  1  761 ? 44.151  48.841 -11.153 1.00 29.90 ? 796  ASP A CG  1 
ATOM   5751 O  OD1 . ASP A  1  761 ? 43.644  47.917 -10.485 1.00 28.24 ? 796  ASP A OD1 1 
ATOM   5752 O  OD2 . ASP A  1  761 ? 43.891  50.045 -10.955 1.00 33.27 ? 796  ASP A OD2 1 
ATOM   5753 N  N   . ASN A  1  762 ? 44.876  45.456 -12.563 1.00 24.73 ? 797  ASN A N   1 
ATOM   5754 C  CA  . ASN A  1  762 ? 44.531  44.192 -11.938 1.00 26.39 ? 797  ASN A CA  1 
ATOM   5755 C  C   . ASN A  1  762 ? 44.884  44.162 -10.436 1.00 21.42 ? 797  ASN A C   1 
ATOM   5756 O  O   . ASN A  1  762 ? 45.304  43.123 -9.927  1.00 22.07 ? 797  ASN A O   1 
ATOM   5757 C  CB  . ASN A  1  762 ? 45.201  43.035 -12.687 1.00 26.91 ? 797  ASN A CB  1 
ATOM   5758 C  CG  . ASN A  1  762 ? 44.470  42.686 -13.953 1.00 28.96 ? 797  ASN A CG  1 
ATOM   5759 O  OD1 . ASN A  1  762 ? 43.320  42.237 -13.901 1.00 28.65 ? 797  ASN A OD1 1 
ATOM   5760 N  ND2 . ASN A  1  762 ? 45.115  42.913 -15.116 1.00 28.90 ? 797  ASN A ND2 1 
ATOM   5761 N  N   . ASP A  1  763 ? 44.700  45.283 -9.743  1.00 21.74 ? 798  ASP A N   1 
ATOM   5762 C  CA  . ASP A  1  763 ? 45.074  45.353 -8.334  1.00 25.06 ? 798  ASP A CA  1 
ATOM   5763 C  C   . ASP A  1  763 ? 44.261  44.349 -7.523  1.00 22.43 ? 798  ASP A C   1 
ATOM   5764 O  O   . ASP A  1  763 ? 44.720  43.863 -6.505  1.00 21.42 ? 798  ASP A O   1 
ATOM   5765 C  CB  . ASP A  1  763 ? 44.900  46.751 -7.761  1.00 24.81 ? 798  ASP A CB  1 
ATOM   5766 C  CG  . ASP A  1  763 ? 45.962  47.714 -8.251  1.00 29.64 ? 798  ASP A CG  1 
ATOM   5767 O  OD1 . ASP A  1  763 ? 46.810  47.301 -9.063  1.00 29.29 ? 798  ASP A OD1 1 
ATOM   5768 O  OD2 . ASP A  1  763 ? 45.925  48.876 -7.832  1.00 33.74 ? 798  ASP A OD2 1 
ATOM   5769 N  N   . GLU A  1  764 ? 43.069  44.023 -8.006  1.00 20.78 ? 799  GLU A N   1 
ATOM   5770 C  CA  . GLU A  1  764 ? 42.229  43.032 -7.316  1.00 19.83 ? 799  GLU A CA  1 
ATOM   5771 C  C   . GLU A  1  764 ? 42.918  41.655 -7.229  1.00 24.14 ? 799  GLU A C   1 
ATOM   5772 O  O   . GLU A  1  764 ? 42.733  40.897 -6.267  1.00 20.02 ? 799  GLU A O   1 
ATOM   5773 C  CB  . GLU A  1  764 ? 40.895  42.864 -8.061  1.00 19.80 ? 799  GLU A CB  1 
ATOM   5774 C  CG  . GLU A  1  764 ? 39.936  41.961 -7.286  1.00 21.28 ? 799  GLU A CG  1 
ATOM   5775 C  CD  . GLU A  1  764 ? 38.585  41.809 -7.943  1.00 21.25 ? 799  GLU A CD  1 
ATOM   5776 O  OE1 . GLU A  1  764 ? 38.349  42.430 -9.007  1.00 19.61 ? 799  GLU A OE1 1 
ATOM   5777 O  OE2 . GLU A  1  764 ? 37.744  41.055 -7.396  1.00 19.76 ? 799  GLU A OE2 1 
ATOM   5778 N  N   . SER A  1  765 ? 43.716  41.326 -8.245  1.00 20.56 ? 800  SER A N   1 
ATOM   5779 C  CA  . SER A  1  765 ? 44.317  40.001 -8.322  1.00 23.00 ? 800  SER A CA  1 
ATOM   5780 C  C   . SER A  1  765 ? 45.761  40.088 -7.859  1.00 25.28 ? 800  SER A C   1 
ATOM   5781 O  O   . SER A  1  765 ? 46.629  40.583 -8.596  1.00 23.42 ? 800  SER A O   1 
ATOM   5782 C  CB  . SER A  1  765 ? 44.257  39.443 -9.756  1.00 23.60 ? 800  SER A CB  1 
ATOM   5783 O  OG  . SER A  1  765 ? 42.904  39.314 -10.217 1.00 23.43 ? 800  SER A OG  1 
ATOM   5784 N  N   . CYS A  1  766 ? 46.022  39.632 -6.640  1.00 22.33 ? 801  CYS A N   1 
ATOM   5785 C  CA  . CYS A  1  766 ? 47.366  39.803 -6.073  1.00 23.58 ? 801  CYS A CA  1 
ATOM   5786 C  C   . CYS A  1  766 ? 48.472  39.073 -6.833  1.00 29.16 ? 801  CYS A C   1 
ATOM   5787 O  O   . CYS A  1  766 ? 49.641  39.454 -6.728  1.00 30.54 ? 801  CYS A O   1 
ATOM   5788 C  CB  . CYS A  1  766 ? 47.400  39.468 -4.577  1.00 24.05 ? 801  CYS A CB  1 
ATOM   5789 S  SG  . CYS A  1  766 ? 46.412  40.626 -3.552  1.00 26.83 ? 801  CYS A SG  1 
ATOM   5790 N  N   . ASN A  1  767 ? 48.111  38.043 -7.594  1.00 27.03 ? 802  ASN A N   1 
ATOM   5791 C  CA  . ASN A  1  767 ? 49.104  37.271 -8.349  1.00 31.23 ? 802  ASN A CA  1 
ATOM   5792 C  C   . ASN A  1  767 ? 49.168  37.617 -9.830  1.00 30.68 ? 802  ASN A C   1 
ATOM   5793 O  O   . ASN A  1  767 ? 49.698  36.837 -10.621 1.00 34.13 ? 802  ASN A O   1 
ATOM   5794 C  CB  . ASN A  1  767 ? 48.865  35.767 -8.207  1.00 33.72 ? 802  ASN A CB  1 
ATOM   5795 C  CG  . ASN A  1  767 ? 49.082  35.274 -6.799  1.00 38.59 ? 802  ASN A CG  1 
ATOM   5796 O  OD1 . ASN A  1  767 ? 48.321  34.442 -6.298  1.00 44.07 ? 802  ASN A OD1 1 
ATOM   5797 N  ND2 . ASN A  1  767 ? 50.119  35.787 -6.143  1.00 40.50 ? 802  ASN A ND2 1 
ATOM   5798 N  N   . SER A  1  768 ? 48.656  38.783 -10.210 1.00 25.85 ? 803  SER A N   1 
ATOM   5799 C  CA  . SER A  1  768 ? 48.487  39.088 -11.628 1.00 28.21 ? 803  SER A CA  1 
ATOM   5800 C  C   . SER A  1  768 ? 49.810  39.387 -12.326 1.00 33.69 ? 803  SER A C   1 
ATOM   5801 O  O   . SER A  1  768 ? 49.833  39.587 -13.544 1.00 34.64 ? 803  SER A O   1 
ATOM   5802 C  CB  . SER A  1  768 ? 47.542  40.263 -11.837 1.00 28.82 ? 803  SER A CB  1 
ATOM   5803 O  OG  . SER A  1  768 ? 48.073  41.444 -11.281 1.00 30.49 ? 803  SER A OG  1 
ATOM   5804 N  N   . SER A  1  769 ? 50.903  39.444 -11.574 1.00 29.26 ? 804  SER A N   1 
ATOM   5805 C  CA  . SER A  1  769 ? 52.185  39.685 -12.244 1.00 34.81 ? 804  SER A CA  1 
ATOM   5806 C  C   . SER A  1  769 ? 52.636  38.384 -12.896 1.00 37.78 ? 804  SER A C   1 
ATOM   5807 O  O   . SER A  1  769 ? 53.494  38.372 -13.797 1.00 39.32 ? 804  SER A O   1 
ATOM   5808 C  CB  . SER A  1  769 ? 53.237  40.239 -11.284 1.00 36.86 ? 804  SER A CB  1 
ATOM   5809 O  OG  . SER A  1  769 ? 53.608  39.259 -10.339 1.00 33.91 ? 804  SER A OG  1 
ATOM   5810 N  N   . GLU A  1  770 ? 52.036  37.286 -12.453 1.00 32.68 ? 805  GLU A N   1 
ATOM   5811 C  CA  . GLU A  1  770 ? 52.294  35.975 -13.026 1.00 37.96 ? 805  GLU A CA  1 
ATOM   5812 C  C   . GLU A  1  770 ? 51.502  35.748 -14.305 1.00 38.16 ? 805  GLU A C   1 
ATOM   5813 O  O   . GLU A  1  770 ? 50.692  36.584 -14.707 1.00 38.22 ? 805  GLU A O   1 
ATOM   5814 C  CB  . GLU A  1  770 ? 51.954  34.890 -12.012 1.00 35.01 ? 805  GLU A CB  1 
ATOM   5815 C  CG  . GLU A  1  770 ? 52.635  35.073 -10.665 1.00 40.42 ? 805  GLU A CG  1 
ATOM   5816 C  CD  . GLU A  1  770 ? 52.368  33.915 -9.729  1.00 44.12 ? 805  GLU A CD  1 
ATOM   5817 O  OE1 . GLU A  1  770 ? 52.252  32.773 -10.219 1.00 53.65 ? 805  GLU A OE1 1 
ATOM   5818 O  OE2 . GLU A  1  770 ? 52.272  34.136 -8.503  1.00 51.28 ? 805  GLU A OE2 1 
ATOM   5819 N  N   . ASP A  1  771 ? 51.736  34.604 -14.943 1.00 37.94 ? 806  ASP A N   1 
ATOM   5820 C  CA  . ASP A  1  771 ? 51.021  34.248 -16.161 1.00 38.59 ? 806  ASP A CA  1 
ATOM   5821 C  C   . ASP A  1  771 ? 49.518  34.101 -15.882 1.00 38.63 ? 806  ASP A C   1 
ATOM   5822 O  O   . ASP A  1  771 ? 49.133  33.633 -14.810 1.00 36.29 ? 806  ASP A O   1 
ATOM   5823 C  CB  . ASP A  1  771 ? 51.565  32.938 -16.716 1.00 42.98 ? 806  ASP A CB  1 
ATOM   5824 C  CG  . ASP A  1  771 ? 50.916  32.550 -18.014 1.00 42.84 ? 806  ASP A CG  1 
ATOM   5825 O  OD1 . ASP A  1  771 ? 51.232  33.185 -19.044 1.00 45.18 ? 806  ASP A OD1 1 
ATOM   5826 O  OD2 . ASP A  1  771 ? 50.088  31.614 -18.006 1.00 46.26 ? 806  ASP A OD2 1 
ATOM   5827 N  N   . GLU A  1  772 ? 48.694  34.474 -16.860 1.00 38.22 ? 807  GLU A N   1 
ATOM   5828 C  CA  . GLU A  1  772 ? 47.234  34.438 -16.725 1.00 37.19 ? 807  GLU A CA  1 
ATOM   5829 C  C   . GLU A  1  772 ? 46.718  33.095 -16.173 1.00 38.60 ? 807  GLU A C   1 
ATOM   5830 O  O   . GLU A  1  772 ? 45.705  33.045 -15.463 1.00 34.85 ? 807  GLU A O   1 
ATOM   5831 C  CB  . GLU A  1  772 ? 46.554  34.763 -18.065 1.00 34.85 ? 807  GLU A CB  1 
ATOM   5832 C  CG  . GLU A  1  772 ? 46.571  36.249 -18.484 1.00 34.19 ? 807  GLU A CG  1 
ATOM   5833 C  CD  . GLU A  1  772 ? 47.926  36.733 -19.028 1.00 40.46 ? 807  GLU A CD  1 
ATOM   5834 O  OE1 . GLU A  1  772 ? 48.803  35.886 -19.322 1.00 35.92 ? 807  GLU A OE1 1 
ATOM   5835 O  OE2 . GLU A  1  772 ? 48.108  37.966 -19.162 1.00 36.48 ? 807  GLU A OE2 1 
ATOM   5836 N  N   . SER A  1  773 ? 47.407  32.004 -16.490 1.00 37.49 ? 808  SER A N   1 
ATOM   5837 C  CA  . SER A  1  773 ? 46.966  30.683 -16.036 1.00 36.71 ? 808  SER A CA  1 
ATOM   5838 C  C   . SER A  1  773 ? 47.040  30.543 -14.506 1.00 35.44 ? 808  SER A C   1 
ATOM   5839 O  O   . SER A  1  773 ? 46.579  29.556 -13.922 1.00 37.22 ? 808  SER A O   1 
ATOM   5840 C  CB  . SER A  1  773 ? 47.803  29.586 -16.708 1.00 40.55 ? 808  SER A CB  1 
ATOM   5841 O  OG  . SER A  1  773 ? 49.136  29.637 -16.221 1.00 40.64 ? 808  SER A OG  1 
ATOM   5842 N  N   . LYS A  1  774 ? 47.624  31.540 -13.855 1.00 36.02 ? 809  LYS A N   1 
ATOM   5843 C  CA  . LYS A  1  774 ? 47.805  31.487 -12.421 1.00 37.04 ? 809  LYS A CA  1 
ATOM   5844 C  C   . LYS A  1  774 ? 46.836  32.392 -11.665 1.00 34.60 ? 809  LYS A C   1 
ATOM   5845 O  O   . LYS A  1  774 ? 46.864  32.405 -10.438 1.00 33.96 ? 809  LYS A O   1 
ATOM   5846 C  CB  . LYS A  1  774 ? 49.228  31.905 -12.046 1.00 38.45 ? 809  LYS A CB  1 
ATOM   5847 C  CG  . LYS A  1  774 ? 50.320  31.078 -12.697 1.00 41.69 ? 809  LYS A CG  1 
ATOM   5848 C  CD  . LYS A  1  774 ? 50.254  29.623 -12.248 1.00 43.80 ? 809  LYS A CD  1 
ATOM   5849 C  CE  . LYS A  1  774 ? 51.403  28.825 -12.860 1.00 54.24 ? 809  LYS A CE  1 
ATOM   5850 N  NZ  . LYS A  1  774 ? 51.438  27.419 -12.374 1.00 62.47 ? 809  LYS A NZ  1 
ATOM   5851 N  N   . TRP A  1  775 ? 46.017  33.174 -12.368 1.00 33.77 ? 810  TRP A N   1 
ATOM   5852 C  CA  . TRP A  1  775 ? 45.155  34.125 -11.649 1.00 31.15 ? 810  TRP A CA  1 
ATOM   5853 C  C   . TRP A  1  775 ? 43.810  34.480 -12.277 1.00 30.16 ? 810  TRP A C   1 
ATOM   5854 O  O   . TRP A  1  775 ? 42.882  34.872 -11.551 1.00 27.15 ? 810  TRP A O   1 
ATOM   5855 C  CB  . TRP A  1  775 ? 45.924  35.406 -11.304 1.00 30.18 ? 810  TRP A CB  1 
ATOM   5856 C  CG  . TRP A  1  775 ? 46.399  36.177 -12.492 1.00 28.55 ? 810  TRP A CG  1 
ATOM   5857 C  CD1 . TRP A  1  775 ? 47.588  36.003 -13.163 1.00 32.47 ? 810  TRP A CD1 1 
ATOM   5858 C  CD2 . TRP A  1  775 ? 45.724  37.258 -13.145 1.00 28.69 ? 810  TRP A CD2 1 
ATOM   5859 N  NE1 . TRP A  1  775 ? 47.682  36.907 -14.192 1.00 34.35 ? 810  TRP A NE1 1 
ATOM   5860 C  CE2 . TRP A  1  775 ? 46.552  37.684 -14.212 1.00 32.28 ? 810  TRP A CE2 1 
ATOM   5861 C  CE3 . TRP A  1  775 ? 44.495  37.903 -12.942 1.00 25.93 ? 810  TRP A CE3 1 
ATOM   5862 C  CZ2 . TRP A  1  775 ? 46.198  38.733 -15.061 1.00 29.89 ? 810  TRP A CZ2 1 
ATOM   5863 C  CZ3 . TRP A  1  775 ? 44.136  38.942 -13.789 1.00 28.61 ? 810  TRP A CZ3 1 
ATOM   5864 C  CH2 . TRP A  1  775 ? 44.988  39.347 -14.844 1.00 32.03 ? 810  TRP A CH2 1 
ATOM   5865 N  N   . VAL A  1  776 ? 43.683  34.349 -13.596 1.00 26.31 ? 811  VAL A N   1 
ATOM   5866 C  CA  . VAL A  1  776 ? 42.459  34.793 -14.263 1.00 26.74 ? 811  VAL A CA  1 
ATOM   5867 C  C   . VAL A  1  776 ? 41.218  33.990 -13.873 1.00 26.81 ? 811  VAL A C   1 
ATOM   5868 O  O   . VAL A  1  776 ? 40.152  34.563 -13.635 1.00 24.87 ? 811  VAL A O   1 
ATOM   5869 C  CB  . VAL A  1  776 ? 42.603  34.794 -15.794 1.00 28.39 ? 811  VAL A CB  1 
ATOM   5870 C  CG1 . VAL A  1  776 ? 41.273  35.158 -16.452 1.00 27.52 ? 811  VAL A CG1 1 
ATOM   5871 C  CG2 . VAL A  1  776 ? 43.699  35.772 -16.200 1.00 30.72 ? 811  VAL A CG2 1 
ATOM   5872 N  N   . GLU A  1  777 ? 41.326  32.669 -13.830 1.00 26.72 ? 812  GLU A N   1 
ATOM   5873 C  CA  . GLU A  1  777 ? 40.149  31.883 -13.467 1.00 27.03 ? 812  GLU A CA  1 
ATOM   5874 C  C   . GLU A  1  777 ? 39.690  32.214 -12.046 1.00 26.37 ? 812  GLU A C   1 
ATOM   5875 O  O   . GLU A  1  777 ? 38.480  32.256 -11.778 1.00 24.55 ? 812  GLU A O   1 
ATOM   5876 C  CB  . GLU A  1  777 ? 40.389  30.378 -13.629 1.00 27.12 ? 812  GLU A CB  1 
ATOM   5877 C  CG  . GLU A  1  777 ? 40.437  29.935 -15.092 1.00 32.89 ? 812  GLU A CG  1 
ATOM   5878 C  CD  . GLU A  1  777 ? 40.265  28.431 -15.247 1.00 40.16 ? 812  GLU A CD  1 
ATOM   5879 O  OE1 . GLU A  1  777 ? 41.294  27.718 -15.323 1.00 41.18 ? 812  GLU A OE1 1 
ATOM   5880 O  OE2 . GLU A  1  777 ? 39.102  27.968 -15.277 1.00 40.03 ? 812  GLU A OE2 1 
ATOM   5881 N  N   . GLU A  1  778 ? 40.653  32.434 -11.152 1.00 24.74 ? 813  GLU A N   1 
ATOM   5882 C  CA  . GLU A  1  778 ? 40.364  32.767 -9.753  1.00 27.39 ? 813  GLU A CA  1 
ATOM   5883 C  C   . GLU A  1  778 ? 39.534  34.060 -9.697  1.00 28.21 ? 813  GLU A C   1 
ATOM   5884 O  O   . GLU A  1  778 ? 38.573  34.173 -8.910  1.00 23.65 ? 813  GLU A O   1 
ATOM   5885 C  CB  . GLU A  1  778 ? 41.673  32.901 -8.950  1.00 27.30 ? 813  GLU A CB  1 
ATOM   5886 C  CG  . GLU A  1  778 ? 41.507  33.356 -7.502  1.00 27.71 ? 813  GLU A CG  1 
ATOM   5887 C  CD  . GLU A  1  778 ? 42.823  33.425 -6.699  1.00 36.55 ? 813  GLU A CD  1 
ATOM   5888 O  OE1 . GLU A  1  778 ? 43.821  32.753 -7.060  1.00 35.35 ? 813  GLU A OE1 1 
ATOM   5889 O  OE2 . GLU A  1  778 ? 42.854  34.155 -5.680  1.00 36.95 ? 813  GLU A OE2 1 
ATOM   5890 N  N   . LEU A  1  779 ? 39.898  35.028 -10.536 1.00 24.02 ? 814  LEU A N   1 
ATOM   5891 C  CA  . LEU A  1  779 ? 39.141  36.285 -10.600 1.00 23.64 ? 814  LEU A CA  1 
ATOM   5892 C  C   . LEU A  1  779 ? 37.740  36.030 -11.123 1.00 26.32 ? 814  LEU A C   1 
ATOM   5893 O  O   . LEU A  1  779 ? 36.740  36.566 -10.596 1.00 19.58 ? 814  LEU A O   1 
ATOM   5894 C  CB  . LEU A  1  779 ? 39.854  37.303 -11.497 1.00 24.43 ? 814  LEU A CB  1 
ATOM   5895 C  CG  . LEU A  1  779 ? 39.086  38.592 -11.832 1.00 24.68 ? 814  LEU A CG  1 
ATOM   5896 C  CD1 . LEU A  1  779 ? 38.911  39.490 -10.577 1.00 19.79 ? 814  LEU A CD1 1 
ATOM   5897 C  CD2 . LEU A  1  779 ? 39.797  39.383 -12.965 1.00 24.50 ? 814  LEU A CD2 1 
ATOM   5898 N  N   . MET A  1  780 ? 37.654  35.209 -12.163 1.00 23.79 ? 815  MET A N   1 
ATOM   5899 C  CA  . MET A  1  780 ? 36.356  34.934 -12.766 1.00 24.35 ? 815  MET A CA  1 
ATOM   5900 C  C   . MET A  1  780 ? 35.408  34.240 -11.790 1.00 22.69 ? 815  MET A C   1 
ATOM   5901 O  O   . MET A  1  780 ? 34.236  34.543 -11.772 1.00 20.75 ? 815  MET A O   1 
ATOM   5902 C  CB  . MET A  1  780 ? 36.497  34.105 -14.039 1.00 23.93 ? 815  MET A CB  1 
ATOM   5903 C  CG  . MET A  1  780 ? 37.120  34.894 -15.203 1.00 25.50 ? 815  MET A CG  1 
ATOM   5904 S  SD  . MET A  1  780 ? 37.443  33.797 -16.580 1.00 34.01 ? 815  MET A SD  1 
ATOM   5905 C  CE  . MET A  1  780 ? 35.798  33.518 -17.234 1.00 32.71 ? 815  MET A CE  1 
ATOM   5906 N  N   . LYS A  1  781 ? 35.921  33.287 -11.021 1.00 21.52 ? 816  LYS A N   1 
ATOM   5907 C  CA  . LYS A  1  781 ? 35.107  32.584 -10.046 1.00 22.05 ? 816  LYS A CA  1 
ATOM   5908 C  C   . LYS A  1  781 ? 34.477  33.544 -9.038  1.00 22.35 ? 816  LYS A C   1 
ATOM   5909 O  O   . LYS A  1  781 ? 33.312  33.381 -8.665  1.00 21.54 ? 816  LYS A O   1 
ATOM   5910 C  CB  . LYS A  1  781 ? 35.940  31.515 -9.345  1.00 26.75 ? 816  LYS A CB  1 
ATOM   5911 C  CG  . LYS A  1  781 ? 36.433  30.444 -10.334 1.00 29.62 ? 816  LYS A CG  1 
ATOM   5912 C  CD  . LYS A  1  781 ? 37.151  29.321 -9.615  1.00 32.39 ? 816  LYS A CD  1 
ATOM   5913 C  CE  . LYS A  1  781 ? 37.759  28.341 -10.612 1.00 42.45 ? 816  LYS A CE  1 
ATOM   5914 N  NZ  . LYS A  1  781 ? 38.588  27.306 -9.923  1.00 48.29 ? 816  LYS A NZ  1 
ATOM   5915 N  N   . MET A  1  782 ? 35.235  34.560 -8.640  1.00 20.18 ? 817  MET A N   1 
ATOM   5916 C  CA  . MET A  1  782 ? 34.752  35.541 -7.647  1.00 19.88 ? 817  MET A CA  1 
ATOM   5917 C  C   . MET A  1  782 ? 33.625  36.380 -8.242  1.00 16.98 ? 817  MET A C   1 
ATOM   5918 O  O   . MET A  1  782 ? 32.814  36.964 -7.519  1.00 16.99 ? 817  MET A O   1 
ATOM   5919 C  CB  . MET A  1  782 ? 35.911  36.445 -7.273  1.00 19.05 ? 817  MET A CB  1 
ATOM   5920 C  CG  . MET A  1  782 ? 35.702  37.461 -6.185  1.00 24.74 ? 817  MET A CG  1 
ATOM   5921 S  SD  . MET A  1  782 ? 35.092  36.861 -4.591  1.00 29.46 ? 817  MET A SD  1 
ATOM   5922 C  CE  . MET A  1  782 ? 35.777  35.280 -4.364  1.00 17.82 ? 817  MET A CE  1 
ATOM   5923 N  N   . HIS A  1  783 ? 33.621  36.475 -9.565  1.00 18.38 ? 818  HIS A N   1 
ATOM   5924 C  CA  . HIS A  1  783 ? 32.653  37.310 -10.263 1.00 15.93 ? 818  HIS A CA  1 
ATOM   5925 C  C   . HIS A  1  783 ? 31.632  36.512 -11.045 1.00 17.41 ? 818  HIS A C   1 
ATOM   5926 O  O   . HIS A  1  783 ? 31.001  36.999 -11.969 1.00 19.50 ? 818  HIS A O   1 
ATOM   5927 C  CB  . HIS A  1  783 ? 33.378  38.388 -11.099 1.00 19.02 ? 818  HIS A CB  1 
ATOM   5928 C  CG  . HIS A  1  783 ? 34.099  39.392 -10.253 1.00 19.40 ? 818  HIS A CG  1 
ATOM   5929 N  ND1 . HIS A  1  783 ? 33.481  40.526 -9.772  1.00 18.37 ? 818  HIS A ND1 1 
ATOM   5930 C  CD2 . HIS A  1  783 ? 35.362  39.417 -9.764  1.00 18.60 ? 818  HIS A CD2 1 
ATOM   5931 C  CE1 . HIS A  1  783 ? 34.336  41.216 -9.042  1.00 18.11 ? 818  HIS A CE1 1 
ATOM   5932 N  NE2 . HIS A  1  783 ? 35.484  40.568 -9.022  1.00 19.01 ? 818  HIS A NE2 1 
ATOM   5933 N  N   . THR A  1  784 ? 31.432  35.284 -10.623 1.00 20.81 ? 819  THR A N   1 
ATOM   5934 C  CA  . THR A  1  784 ? 30.335  34.500 -11.135 1.00 18.12 ? 819  THR A CA  1 
ATOM   5935 C  C   . THR A  1  784 ? 29.019  35.258 -10.935 1.00 18.53 ? 819  THR A C   1 
ATOM   5936 O  O   . THR A  1  784 ? 28.901  36.113 -10.035 1.00 20.26 ? 819  THR A O   1 
ATOM   5937 C  CB  . THR A  1  784 ? 30.313  33.150 -10.420 1.00 19.82 ? 819  THR A CB  1 
ATOM   5938 O  OG1 . THR A  1  784 ? 29.320  32.320 -11.008 1.00 23.14 ? 819  THR A OG1 1 
ATOM   5939 C  CG2 . THR A  1  784 ? 30.063  33.316 -8.891  1.00 18.60 ? 819  THR A CG2 1 
ATOM   5940 N  N   . ALA A  1  785 ? 28.024  34.957 -11.761 1.00 19.94 ? 820  ALA A N   1 
ATOM   5941 C  CA  . ALA A  1  785 ? 26.764  35.692 -11.713 1.00 22.81 ? 820  ALA A CA  1 
ATOM   5942 C  C   . ALA A  1  785 ? 25.581  34.837 -12.164 1.00 23.03 ? 820  ALA A C   1 
ATOM   5943 O  O   . ALA A  1  785 ? 25.776  33.791 -12.801 1.00 21.22 ? 820  ALA A O   1 
ATOM   5944 C  CB  . ALA A  1  785 ? 26.863  36.951 -12.586 1.00 21.81 ? 820  ALA A CB  1 
ATOM   5945 N  N   . ARG A  1  786 ? 24.364  35.272 -11.827 1.00 20.15 ? 821  ARG A N   1 
ATOM   5946 C  CA  . ARG A  1  786 ? 23.161  34.628 -12.353 1.00 19.76 ? 821  ARG A CA  1 
ATOM   5947 C  C   . ARG A  1  786 ? 22.798  35.299 -13.664 1.00 21.44 ? 821  ARG A C   1 
ATOM   5948 O  O   . ARG A  1  786 ? 23.110  36.449 -13.879 1.00 19.20 ? 821  ARG A O   1 
ATOM   5949 C  CB  . ARG A  1  786 ? 21.971  34.776 -11.388 1.00 19.97 ? 821  ARG A CB  1 
ATOM   5950 C  CG  . ARG A  1  786 ? 22.239  34.372 -9.938  1.00 19.13 ? 821  ARG A CG  1 
ATOM   5951 C  CD  . ARG A  1  786 ? 21.086  34.803 -8.990  1.00 20.10 ? 821  ARG A CD  1 
ATOM   5952 N  NE  . ARG A  1  786 ? 20.759  36.215 -9.230  1.00 19.63 ? 821  ARG A NE  1 
ATOM   5953 C  CZ  . ARG A  1  786 ? 19.530  36.735 -9.218  1.00 20.21 ? 821  ARG A CZ  1 
ATOM   5954 N  NH1 . ARG A  1  786 ? 18.480  35.977 -8.969  1.00 20.50 ? 821  ARG A NH1 1 
ATOM   5955 N  NH2 . ARG A  1  786 ? 19.356  38.032 -9.485  1.00 17.91 ? 821  ARG A NH2 1 
ATOM   5956 N  N   . VAL A  1  787 ? 22.124  34.579 -14.552 1.00 23.22 ? 822  VAL A N   1 
ATOM   5957 C  CA  . VAL A  1  787 ? 21.647  35.205 -15.768 1.00 20.80 ? 822  VAL A CA  1 
ATOM   5958 C  C   . VAL A  1  787 ? 20.719  36.366 -15.399 1.00 20.54 ? 822  VAL A C   1 
ATOM   5959 O  O   . VAL A  1  787 ? 20.766  37.428 -16.005 1.00 20.34 ? 822  VAL A O   1 
ATOM   5960 C  CB  . VAL A  1  787 ? 20.954  34.173 -16.681 1.00 21.55 ? 822  VAL A CB  1 
ATOM   5961 C  CG1 . VAL A  1  787 ? 20.213  34.893 -17.835 1.00 21.61 ? 822  VAL A CG1 1 
ATOM   5962 C  CG2 . VAL A  1  787 ? 22.009  33.182 -17.206 1.00 20.42 ? 822  VAL A CG2 1 
ATOM   5963 N  N   . ARG A  1  788 ? 19.940  36.182 -14.341 1.00 19.90 ? 823  ARG A N   1 
ATOM   5964 C  CA  . ARG A  1  788 ? 19.015  37.206 -13.902 1.00 22.61 ? 823  ARG A CA  1 
ATOM   5965 C  C   . ARG A  1  788 ? 19.736  38.517 -13.570 1.00 20.92 ? 823  ARG A C   1 
ATOM   5966 O  O   . ARG A  1  788 ? 19.205  39.596 -13.801 1.00 22.41 ? 823  ARG A O   1 
ATOM   5967 C  CB  . ARG A  1  788 ? 18.255  36.711 -12.686 1.00 20.09 ? 823  ARG A CB  1 
ATOM   5968 C  CG  . ARG A  1  788 ? 17.020  37.503 -12.345 1.00 23.96 ? 823  ARG A CG  1 
ATOM   5969 C  CD  . ARG A  1  788 ? 15.893  37.275 -13.374 1.00 25.59 ? 823  ARG A CD  1 
ATOM   5970 N  NE  . ARG A  1  788 ? 14.764  38.086 -12.960 1.00 26.40 ? 823  ARG A NE  1 
ATOM   5971 C  CZ  . ARG A  1  788 ? 14.333  39.158 -13.602 1.00 29.63 ? 823  ARG A CZ  1 
ATOM   5972 N  NH1 . ARG A  1  788 ? 14.906  39.532 -14.736 1.00 30.81 ? 823  ARG A NH1 1 
ATOM   5973 N  NH2 . ARG A  1  788 ? 13.322  39.842 -13.098 1.00 31.35 ? 823  ARG A NH2 1 
ATOM   5974 N  N   . ASP A  1  789 ? 20.929  38.412 -12.994 1.00 18.52 ? 824  ASP A N   1 
ATOM   5975 C  CA  . ASP A  1  789 ? 21.724  39.586 -12.659 1.00 19.38 ? 824  ASP A CA  1 
ATOM   5976 C  C   . ASP A  1  789 ? 22.061  40.371 -13.933 1.00 20.13 ? 824  ASP A C   1 
ATOM   5977 O  O   . ASP A  1  789 ? 22.002  41.609 -13.984 1.00 21.66 ? 824  ASP A O   1 
ATOM   5978 C  CB  . ASP A  1  789 ? 23.054  39.155 -12.011 1.00 19.63 ? 824  ASP A CB  1 
ATOM   5979 C  CG  . ASP A  1  789 ? 22.878  38.526 -10.630 1.00 19.59 ? 824  ASP A CG  1 
ATOM   5980 O  OD1 . ASP A  1  789 ? 21.986  38.983 -9.887  1.00 19.63 ? 824  ASP A OD1 1 
ATOM   5981 O  OD2 . ASP A  1  789 ? 23.664  37.602 -10.267 1.00 20.49 ? 824  ASP A OD2 1 
ATOM   5982 N  N   . ILE A  1  790 ? 22.462  39.631 -14.957 1.00 19.82 ? 825  ILE A N   1 
ATOM   5983 C  CA  . ILE A  1  790 ? 22.805  40.200 -16.255 1.00 20.43 ? 825  ILE A CA  1 
ATOM   5984 C  C   . ILE A  1  790 ? 21.579  40.866 -16.888 1.00 21.47 ? 825  ILE A C   1 
ATOM   5985 O  O   . ILE A  1  790 ? 21.678  41.971 -17.447 1.00 20.51 ? 825  ILE A O   1 
ATOM   5986 C  CB  . ILE A  1  790 ? 23.450  39.122 -17.157 1.00 20.63 ? 825  ILE A CB  1 
ATOM   5987 C  CG1 . ILE A  1  790 ? 24.787  38.710 -16.532 1.00 21.67 ? 825  ILE A CG1 1 
ATOM   5988 C  CG2 . ILE A  1  790 ? 23.710  39.661 -18.584 1.00 20.16 ? 825  ILE A CG2 1 
ATOM   5989 C  CD1 . ILE A  1  790 ? 25.385  37.414 -17.061 1.00 22.06 ? 825  ILE A CD1 1 
ATOM   5990 N  N   . GLU A  1  791 ? 20.416  40.242 -16.729 1.00 21.20 ? 826  GLU A N   1 
ATOM   5991 C  CA  . GLU A  1  791 ? 19.176  40.821 -17.251 1.00 22.87 ? 826  GLU A CA  1 
ATOM   5992 C  C   . GLU A  1  791 ? 18.858  42.186 -16.630 1.00 25.87 ? 826  GLU A C   1 
ATOM   5993 O  O   . GLU A  1  791 ? 18.487  43.126 -17.334 1.00 23.90 ? 826  GLU A O   1 
ATOM   5994 C  CB  . GLU A  1  791 ? 18.000  39.856 -17.056 1.00 26.26 ? 826  GLU A CB  1 
ATOM   5995 C  CG  . GLU A  1  791 ? 18.121  38.628 -17.955 1.00 23.22 ? 826  GLU A CG  1 
ATOM   5996 C  CD  . GLU A  1  791 ? 16.925  37.701 -17.881 1.00 26.47 ? 826  GLU A CD  1 
ATOM   5997 O  OE1 . GLU A  1  791 ? 16.268  37.623 -16.825 1.00 28.35 ? 826  GLU A OE1 1 
ATOM   5998 O  OE2 . GLU A  1  791 ? 16.649  37.017 -18.897 1.00 28.88 ? 826  GLU A OE2 1 
ATOM   5999 N  N   . HIS A  1  792 ? 18.998  42.297 -15.310 1.00 23.09 ? 827  HIS A N   1 
ATOM   6000 C  CA  . HIS A  1  792 ? 18.804  43.597 -14.669 1.00 22.62 ? 827  HIS A CA  1 
ATOM   6001 C  C   . HIS A  1  792 ? 19.749  44.628 -15.249 1.00 20.42 ? 827  HIS A C   1 
ATOM   6002 O  O   . HIS A  1  792 ? 19.342  45.756 -15.522 1.00 23.91 ? 827  HIS A O   1 
ATOM   6003 C  CB  . HIS A  1  792 ? 19.035  43.510 -13.157 1.00 22.44 ? 827  HIS A CB  1 
ATOM   6004 C  CG  . HIS A  1  792 ? 18.045  42.633 -12.450 1.00 22.84 ? 827  HIS A CG  1 
ATOM   6005 N  ND1 . HIS A  1  792 ? 18.385  41.826 -11.380 1.00 25.47 ? 827  HIS A ND1 1 
ATOM   6006 C  CD2 . HIS A  1  792 ? 16.718  42.452 -12.651 1.00 24.41 ? 827  HIS A CD2 1 
ATOM   6007 C  CE1 . HIS A  1  792 ? 17.313  41.181 -10.959 1.00 21.49 ? 827  HIS A CE1 1 
ATOM   6008 N  NE2 . HIS A  1  792 ? 16.288  41.539 -11.714 1.00 30.65 ? 827  HIS A NE2 1 
ATOM   6009 N  N   . LEU A  1  793 ? 21.010  44.241 -15.416 1.00 19.37 ? 828  LEU A N   1 
ATOM   6010 C  CA  . LEU A  1  793 ? 22.073  45.167 -15.799 1.00 20.10 ? 828  LEU A CA  1 
ATOM   6011 C  C   . LEU A  1  793 ? 22.045  45.530 -17.293 1.00 24.09 ? 828  LEU A C   1 
ATOM   6012 O  O   . LEU A  1  793 ? 22.708  46.485 -17.693 1.00 21.38 ? 828  LEU A O   1 
ATOM   6013 C  CB  . LEU A  1  793 ? 23.442  44.572 -15.453 1.00 20.56 ? 828  LEU A CB  1 
ATOM   6014 C  CG  . LEU A  1  793 ? 23.762  44.648 -13.956 1.00 20.96 ? 828  LEU A CG  1 
ATOM   6015 C  CD1 . LEU A  1  793 ? 24.794  43.579 -13.567 1.00 21.93 ? 828  LEU A CD1 1 
ATOM   6016 C  CD2 . LEU A  1  793 ? 24.272  46.047 -13.642 1.00 23.87 ? 828  LEU A CD2 1 
ATOM   6017 N  N   . THR A  1  794 ? 21.275  44.789 -18.095 1.00 22.85 ? 829  THR A N   1 
ATOM   6018 C  CA  . THR A  1  794 ? 21.284  45.009 -19.560 1.00 23.70 ? 829  THR A CA  1 
ATOM   6019 C  C   . THR A  1  794 ? 19.933  45.351 -20.176 1.00 24.53 ? 829  THR A C   1 
ATOM   6020 O  O   . THR A  1  794 ? 19.878  45.794 -21.319 1.00 27.90 ? 829  THR A O   1 
ATOM   6021 C  CB  . THR A  1  794 ? 21.837  43.799 -20.344 1.00 24.54 ? 829  THR A CB  1 
ATOM   6022 O  OG1 . THR A  1  794 ? 20.987  42.659 -20.161 1.00 24.42 ? 829  THR A OG1 1 
ATOM   6023 C  CG2 . THR A  1  794 ? 23.273  43.478 -19.931 1.00 23.21 ? 829  THR A CG2 1 
ATOM   6024 N  N   . GLY A  1  795 ? 18.856  45.147 -19.426 1.00 22.74 ? 830  GLY A N   1 
ATOM   6025 C  CA  . GLY A  1  795 ? 17.525  45.245 -19.976 1.00 30.42 ? 830  GLY A CA  1 
ATOM   6026 C  C   . GLY A  1  795 ? 17.240  44.222 -21.066 1.00 30.38 ? 830  GLY A C   1 
ATOM   6027 O  O   . GLY A  1  795 ? 16.353  44.451 -21.893 1.00 31.13 ? 830  GLY A O   1 
ATOM   6028 N  N   . LEU A  1  796 ? 17.970  43.106 -21.073 1.00 24.97 ? 831  LEU A N   1 
ATOM   6029 C  CA  . LEU A  1  796 ? 17.705  42.002 -22.010 1.00 25.84 ? 831  LEU A CA  1 
ATOM   6030 C  C   . LEU A  1  796 ? 16.943  40.851 -21.342 1.00 29.70 ? 831  LEU A C   1 
ATOM   6031 O  O   . LEU A  1  796 ? 17.067  40.636 -20.145 1.00 27.69 ? 831  LEU A O   1 
ATOM   6032 C  CB  . LEU A  1  796 ? 19.011  41.455 -22.609 1.00 27.71 ? 831  LEU A CB  1 
ATOM   6033 C  CG  . LEU A  1  796 ? 19.941  42.426 -23.353 1.00 26.08 ? 831  LEU A CG  1 
ATOM   6034 C  CD1 . LEU A  1  796 ? 21.271  41.771 -23.711 1.00 23.88 ? 831  LEU A CD1 1 
ATOM   6035 C  CD2 . LEU A  1  796 ? 19.271  43.013 -24.595 1.00 32.93 ? 831  LEU A CD2 1 
ATOM   6036 N  N   . ASP A  1  797 ? 16.161  40.101 -22.118 1.00 25.53 ? 832  ASP A N   1 
ATOM   6037 C  CA  . ASP A  1  797 ? 15.481  38.914 -21.599 1.00 25.64 ? 832  ASP A CA  1 
ATOM   6038 C  C   . ASP A  1  797 ? 15.907  37.673 -22.395 1.00 29.23 ? 832  ASP A C   1 
ATOM   6039 O  O   . ASP A  1  797 ? 15.665  37.583 -23.598 1.00 30.14 ? 832  ASP A O   1 
ATOM   6040 C  CB  . ASP A  1  797 ? 13.954  39.089 -21.648 1.00 29.43 ? 832  ASP A CB  1 
ATOM   6041 C  CG  . ASP A  1  797 ? 13.204  37.995 -20.884 1.00 32.66 ? 832  ASP A CG  1 
ATOM   6042 O  OD1 . ASP A  1  797 ? 12.450  37.223 -21.520 1.00 34.89 ? 832  ASP A OD1 1 
ATOM   6043 O  OD2 . ASP A  1  797 ? 13.348  37.904 -19.640 1.00 31.70 ? 832  ASP A OD2 1 
ATOM   6044 N  N   . PHE A  1  798 ? 16.542  36.717 -21.728 1.00 27.82 ? 833  PHE A N   1 
ATOM   6045 C  CA  . PHE A  1  798 ? 17.155  35.582 -22.419 1.00 30.42 ? 833  PHE A CA  1 
ATOM   6046 C  C   . PHE A  1  798 ? 16.267  34.320 -22.407 1.00 29.87 ? 833  PHE A C   1 
ATOM   6047 O  O   . PHE A  1  798 ? 15.268  34.277 -21.700 1.00 27.51 ? 833  PHE A O   1 
ATOM   6048 C  CB  . PHE A  1  798 ? 18.519  35.272 -21.792 1.00 26.05 ? 833  PHE A CB  1 
ATOM   6049 C  CG  . PHE A  1  798 ? 19.510  36.412 -21.872 1.00 29.15 ? 833  PHE A CG  1 
ATOM   6050 C  CD1 . PHE A  1  798 ? 19.710  37.255 -20.782 1.00 30.42 ? 833  PHE A CD1 1 
ATOM   6051 C  CD2 . PHE A  1  798 ? 20.262  36.618 -23.022 1.00 29.21 ? 833  PHE A CD2 1 
ATOM   6052 C  CE1 . PHE A  1  798 ? 20.625  38.290 -20.844 1.00 28.17 ? 833  PHE A CE1 1 
ATOM   6053 C  CE2 . PHE A  1  798 ? 21.181  37.641 -23.097 1.00 28.42 ? 833  PHE A CE2 1 
ATOM   6054 C  CZ  . PHE A  1  798 ? 21.366  38.487 -22.003 1.00 29.54 ? 833  PHE A CZ  1 
ATOM   6055 N  N   . TYR A  1  799 ? 16.629  33.303 -23.196 1.00 28.39 ? 834  TYR A N   1 
ATOM   6056 C  CA  . TYR A  1  799 ? 15.940  31.993 -23.184 1.00 29.29 ? 834  TYR A CA  1 
ATOM   6057 C  C   . TYR A  1  799 ? 14.442  32.044 -23.520 1.00 27.53 ? 834  TYR A C   1 
ATOM   6058 O  O   . TYR A  1  799 ? 13.634  31.326 -22.934 1.00 31.20 ? 834  TYR A O   1 
ATOM   6059 C  CB  . TYR A  1  799 ? 16.150  31.241 -21.840 1.00 28.25 ? 834  TYR A CB  1 
ATOM   6060 C  CG  . TYR A  1  799 ? 17.605  31.025 -21.464 1.00 30.79 ? 834  TYR A CG  1 
ATOM   6061 C  CD1 . TYR A  1  799 ? 18.431  30.203 -22.215 1.00 30.00 ? 834  TYR A CD1 1 
ATOM   6062 C  CD2 . TYR A  1  799 ? 18.144  31.628 -20.328 1.00 30.53 ? 834  TYR A CD2 1 
ATOM   6063 C  CE1 . TYR A  1  799 ? 19.778  30.008 -21.870 1.00 28.30 ? 834  TYR A CE1 1 
ATOM   6064 C  CE2 . TYR A  1  799 ? 19.459  31.439 -19.976 1.00 26.87 ? 834  TYR A CE2 1 
ATOM   6065 C  CZ  . TYR A  1  799 ? 20.279  30.630 -20.735 1.00 32.42 ? 834  TYR A CZ  1 
ATOM   6066 O  OH  . TYR A  1  799 ? 21.595  30.474 -20.357 1.00 28.25 ? 834  TYR A OH  1 
ATOM   6067 N  N   . ARG A  1  800 ? 14.073  32.889 -24.473 1.00 32.12 ? 835  ARG A N   1 
ATOM   6068 C  CA  . ARG A  1  800 ? 12.663  33.071 -24.812 1.00 34.58 ? 835  ARG A CA  1 
ATOM   6069 C  C   . ARG A  1  800 ? 12.108  31.963 -25.727 1.00 37.64 ? 835  ARG A C   1 
ATOM   6070 O  O   . ARG A  1  800 ? 10.900  31.768 -25.796 1.00 33.49 ? 835  ARG A O   1 
ATOM   6071 C  CB  . ARG A  1  800 ? 12.445  34.448 -25.437 1.00 38.55 ? 835  ARG A CB  1 
ATOM   6072 C  CG  . ARG A  1  800 ? 12.695  35.591 -24.459 1.00 34.06 ? 835  ARG A CG  1 
ATOM   6073 C  CD  . ARG A  1  800 ? 12.616  36.946 -25.143 1.00 35.01 ? 835  ARG A CD  1 
ATOM   6074 N  NE  . ARG A  1  800 ? 11.263  37.292 -25.586 1.00 35.02 ? 835  ARG A NE  1 
ATOM   6075 C  CZ  . ARG A  1  800 ? 10.382  37.988 -24.869 1.00 38.06 ? 835  ARG A CZ  1 
ATOM   6076 N  NH1 . ARG A  1  800 ? 10.687  38.411 -23.651 1.00 36.28 ? 835  ARG A NH1 1 
ATOM   6077 N  NH2 . ARG A  1  800 ? 9.185   38.264 -25.369 1.00 37.16 ? 835  ARG A NH2 1 
ATOM   6078 N  N   . LYS A  1  801 ? 13.000  31.246 -26.409 1.00 37.46 ? 836  LYS A N   1 
ATOM   6079 C  CA  . LYS A  1  801 ? 12.604  30.162 -27.313 1.00 36.80 ? 836  LYS A CA  1 
ATOM   6080 C  C   . LYS A  1  801 ? 13.294  28.857 -26.955 1.00 33.94 ? 836  LYS A C   1 
ATOM   6081 O  O   . LYS A  1  801 ? 14.376  28.570 -27.465 1.00 37.79 ? 836  LYS A O   1 
ATOM   6082 C  CB  . LYS A  1  801 ? 12.958  30.505 -28.765 1.00 37.23 ? 836  LYS A CB  1 
ATOM   6083 C  CG  . LYS A  1  801 ? 12.383  31.814 -29.287 1.00 44.38 ? 836  LYS A CG  1 
ATOM   6084 C  CD  . LYS A  1  801 ? 10.876  31.757 -29.420 1.00 47.03 ? 836  LYS A CD  1 
ATOM   6085 C  CE  . LYS A  1  801 ? 10.369  32.939 -30.242 1.00 52.06 ? 836  LYS A CE  1 
ATOM   6086 N  NZ  . LYS A  1  801 ? 8.901   32.888 -30.482 1.00 61.22 ? 836  LYS A NZ  1 
ATOM   6087 N  N   . THR A  1  802 ? 12.663  28.050 -26.109 1.00 34.84 ? 837  THR A N   1 
ATOM   6088 C  CA  . THR A  1  802 ? 13.237  26.771 -25.715 1.00 34.03 ? 837  THR A CA  1 
ATOM   6089 C  C   . THR A  1  802 ? 12.112  25.759 -25.632 1.00 33.72 ? 837  THR A C   1 
ATOM   6090 O  O   . THR A  1  802 ? 10.941  26.110 -25.789 1.00 36.46 ? 837  THR A O   1 
ATOM   6091 C  CB  . THR A  1  802 ? 13.946  26.823 -24.314 1.00 35.28 ? 837  THR A CB  1 
ATOM   6092 O  OG1 . THR A  1  802 ? 12.962  26.914 -23.279 1.00 31.69 ? 837  THR A OG1 1 
ATOM   6093 C  CG2 . THR A  1  802 ? 14.927  28.005 -24.205 1.00 33.95 ? 837  THR A CG2 1 
ATOM   6094 N  N   . SER A  1  803 ? 12.469  24.509 -25.361 1.00 35.17 ? 838  SER A N   1 
ATOM   6095 C  CA  . SER A  1  803 ? 11.479  23.450 -25.200 1.00 34.06 ? 838  SER A CA  1 
ATOM   6096 C  C   . SER A  1  803 ? 11.102  23.221 -23.740 1.00 37.41 ? 838  SER A C   1 
ATOM   6097 O  O   . SER A  1  803 ? 10.395  22.266 -23.429 1.00 32.70 ? 838  SER A O   1 
ATOM   6098 C  CB  . SER A  1  803 ? 12.009  22.141 -25.783 1.00 38.10 ? 838  SER A CB  1 
ATOM   6099 O  OG  . SER A  1  803 ? 13.206  21.761 -25.129 1.00 39.78 ? 838  SER A OG  1 
ATOM   6100 N  N   . ARG A  1  804 ? 11.568  24.099 -22.850 1.00 32.70 ? 839  ARG A N   1 
ATOM   6101 C  CA  . ARG A  1  804 ? 11.308  23.956 -21.418 1.00 32.74 ? 839  ARG A CA  1 
ATOM   6102 C  C   . ARG A  1  804 ? 10.177  24.878 -20.962 1.00 29.23 ? 839  ARG A C   1 
ATOM   6103 O  O   . ARG A  1  804 ? 9.833   25.833 -21.663 1.00 32.32 ? 839  ARG A O   1 
ATOM   6104 C  CB  . ARG A  1  804 ? 12.588  24.275 -20.646 1.00 32.55 ? 839  ARG A CB  1 
ATOM   6105 C  CG  . ARG A  1  804 ? 13.838  23.666 -21.267 1.00 35.73 ? 839  ARG A CG  1 
ATOM   6106 C  CD  . ARG A  1  804 ? 13.677  22.154 -21.401 1.00 37.01 ? 839  ARG A CD  1 
ATOM   6107 N  NE  . ARG A  1  804 ? 13.303  21.552 -20.124 1.00 39.50 ? 839  ARG A NE  1 
ATOM   6108 C  CZ  . ARG A  1  804 ? 12.914  20.290 -19.971 1.00 39.76 ? 839  ARG A CZ  1 
ATOM   6109 N  NH1 . ARG A  1  804 ? 12.845  19.486 -21.022 1.00 43.52 ? 839  ARG A NH1 1 
ATOM   6110 N  NH2 . ARG A  1  804 ? 12.597  19.835 -18.764 1.00 42.45 ? 839  ARG A NH2 1 
ATOM   6111 N  N   . SER A  1  805 ? 9.603   24.609 -19.793 1.00 30.04 ? 840  SER A N   1 
ATOM   6112 C  CA  . SER A  1  805 ? 8.555   25.480 -19.245 1.00 30.40 ? 840  SER A CA  1 
ATOM   6113 C  C   . SER A  1  805 ? 9.144   26.841 -18.893 1.00 30.12 ? 840  SER A C   1 
ATOM   6114 O  O   . SER A  1  805 ? 10.360  26.952 -18.677 1.00 29.54 ? 840  SER A O   1 
ATOM   6115 C  CB  . SER A  1  805 ? 7.894   24.858 -18.009 1.00 31.90 ? 840  SER A CB  1 
ATOM   6116 O  OG  . SER A  1  805 ? 8.734   24.907 -16.854 1.00 30.52 ? 840  SER A OG  1 
ATOM   6117 N  N   . TYR A  1  806 ? 8.303   27.871 -18.839 1.00 29.93 ? 841  TYR A N   1 
ATOM   6118 C  CA  . TYR A  1  806 ? 8.804   29.187 -18.457 1.00 27.98 ? 841  TYR A CA  1 
ATOM   6119 C  C   . TYR A  1  806 ? 9.340   29.111 -17.015 1.00 27.83 ? 841  TYR A C   1 
ATOM   6120 O  O   . TYR A  1  806 ? 10.377  29.699 -16.710 1.00 27.69 ? 841  TYR A O   1 
ATOM   6121 C  CB  . TYR A  1  806 ? 7.720   30.261 -18.579 1.00 29.12 ? 841  TYR A CB  1 
ATOM   6122 C  CG  . TYR A  1  806 ? 8.224   31.697 -18.421 1.00 34.53 ? 841  TYR A CG  1 
ATOM   6123 C  CD1 . TYR A  1  806 ? 9.538   32.040 -18.739 1.00 32.18 ? 841  TYR A CD1 1 
ATOM   6124 C  CD2 . TYR A  1  806 ? 7.372   32.711 -17.974 1.00 32.93 ? 841  TYR A CD2 1 
ATOM   6125 C  CE1 . TYR A  1  806 ? 10.000  33.340 -18.604 1.00 33.62 ? 841  TYR A CE1 1 
ATOM   6126 C  CE2 . TYR A  1  806 ? 7.828   34.016 -17.826 1.00 36.86 ? 841  TYR A CE2 1 
ATOM   6127 C  CZ  . TYR A  1  806 ? 9.142   34.325 -18.153 1.00 36.41 ? 841  TYR A CZ  1 
ATOM   6128 O  OH  . TYR A  1  806 ? 9.589   35.626 -18.013 1.00 37.37 ? 841  TYR A OH  1 
ATOM   6129 N  N   . SER A  1  807 ? 8.647   28.370 -16.150 1.00 28.16 ? 842  SER A N   1 
ATOM   6130 C  CA  . SER A  1  807 ? 9.077   28.206 -14.746 1.00 29.05 ? 842  SER A CA  1 
ATOM   6131 C  C   . SER A  1  807 ? 10.481  27.593 -14.648 1.00 28.50 ? 842  SER A C   1 
ATOM   6132 O  O   . SER A  1  807 ? 11.317  28.033 -13.853 1.00 25.78 ? 842  SER A O   1 
ATOM   6133 C  CB  . SER A  1  807 ? 8.082   27.350 -13.955 1.00 29.27 ? 842  SER A CB  1 
ATOM   6134 O  OG  . SER A  1  807 ? 6.861   28.047 -13.738 1.00 33.19 ? 842  SER A OG  1 
ATOM   6135 N  N   . GLU A  1  808 ? 10.729  26.565 -15.446 1.00 28.43 ? 843  GLU A N   1 
ATOM   6136 C  CA  . GLU A  1  808 ? 12.041  25.923 -15.470 1.00 27.82 ? 843  GLU A CA  1 
ATOM   6137 C  C   . GLU A  1  808 ? 13.102  26.900 -15.915 1.00 27.76 ? 843  GLU A C   1 
ATOM   6138 O  O   . GLU A  1  808 ? 14.227  26.884 -15.416 1.00 26.89 ? 843  GLU A O   1 
ATOM   6139 C  CB  . GLU A  1  808 ? 12.027  24.704 -16.401 1.00 31.58 ? 843  GLU A CB  1 
ATOM   6140 C  CG  . GLU A  1  808 ? 11.145  23.579 -15.876 1.00 34.99 ? 843  GLU A CG  1 
ATOM   6141 C  CD  . GLU A  1  808 ? 11.037  22.395 -16.844 1.00 43.10 ? 843  GLU A CD  1 
ATOM   6142 O  OE1 . GLU A  1  808 ? 10.776  22.619 -18.051 1.00 43.02 ? 843  GLU A OE1 1 
ATOM   6143 O  OE2 . GLU A  1  808 ? 11.214  21.242 -16.386 1.00 45.66 ? 843  GLU A OE2 1 
ATOM   6144 N  N   . ILE A  1  809 ? 12.758  27.736 -16.885 1.00 24.12 ? 844  ILE A N   1 
ATOM   6145 C  CA  . ILE A  1  809 ? 13.712  28.694 -17.388 1.00 25.43 ? 844  ILE A CA  1 
ATOM   6146 C  C   . ILE A  1  809 ? 13.997  29.725 -16.294 1.00 24.40 ? 844  ILE A C   1 
ATOM   6147 O  O   . ILE A  1  809 ? 15.136  30.153 -16.132 1.00 25.82 ? 844  ILE A O   1 
ATOM   6148 C  CB  . ILE A  1  809 ? 13.209  29.392 -18.643 1.00 26.26 ? 844  ILE A CB  1 
ATOM   6149 C  CG1 . ILE A  1  809 ? 13.194  28.394 -19.814 1.00 25.02 ? 844  ILE A CG1 1 
ATOM   6150 C  CG2 . ILE A  1  809 ? 14.109  30.560 -19.003 1.00 26.16 ? 844  ILE A CG2 1 
ATOM   6151 C  CD1 . ILE A  1  809 ? 14.520  27.687 -20.009 1.00 27.80 ? 844  ILE A CD1 1 
ATOM   6152 N  N   . LEU A  1  810 ? 12.962  30.101 -15.547 1.00 23.08 ? 845  LEU A N   1 
ATOM   6153 C  CA  . LEU A  1  810 ? 13.151  31.067 -14.456 1.00 23.89 ? 845  LEU A CA  1 
ATOM   6154 C  C   . LEU A  1  810 ? 14.101  30.480 -13.408 1.00 25.26 ? 845  LEU A C   1 
ATOM   6155 O  O   . LEU A  1  810 ? 15.005  31.167 -12.902 1.00 21.19 ? 845  LEU A O   1 
ATOM   6156 C  CB  . LEU A  1  810 ? 11.816  31.472 -13.839 1.00 22.42 ? 845  LEU A CB  1 
ATOM   6157 C  CG  . LEU A  1  810 ? 10.930  32.341 -14.739 1.00 23.63 ? 845  LEU A CG  1 
ATOM   6158 C  CD1 . LEU A  1  810 ? 9.650   32.705 -14.004 1.00 26.53 ? 845  LEU A CD1 1 
ATOM   6159 C  CD2 . LEU A  1  810 ? 11.661  33.602 -15.137 1.00 25.10 ? 845  LEU A CD2 1 
ATOM   6160 N  N   . THR A  1  811 ? 13.924  29.201 -13.089 1.00 24.36 ? 846  THR A N   1 
ATOM   6161 C  CA  . THR A  1  811 ? 14.898  28.530 -12.223 1.00 25.50 ? 846  THR A CA  1 
ATOM   6162 C  C   . THR A  1  811 ? 16.315  28.586 -12.805 1.00 23.95 ? 846  THR A C   1 
ATOM   6163 O  O   . THR A  1  811 ? 17.278  28.849 -12.085 1.00 22.54 ? 846  THR A O   1 
ATOM   6164 C  CB  . THR A  1  811 ? 14.484  27.082 -11.924 1.00 23.94 ? 846  THR A CB  1 
ATOM   6165 O  OG1 . THR A  1  811 ? 13.135  27.076 -11.431 1.00 24.31 ? 846  THR A OG1 1 
ATOM   6166 C  CG2 . THR A  1  811 ? 15.395  26.466 -10.869 1.00 27.17 ? 846  THR A CG2 1 
ATOM   6167 N  N   . LEU A  1  812 ? 16.445  28.324 -14.104 1.00 22.77 ? 847  LEU A N   1 
ATOM   6168 C  CA  . LEU A  1  812 ? 17.735  28.383 -14.773 1.00 23.94 ? 847  LEU A CA  1 
ATOM   6169 C  C   . LEU A  1  812 ? 18.347  29.781 -14.655 1.00 22.07 ? 847  LEU A C   1 
ATOM   6170 O  O   . LEU A  1  812 ? 19.545  29.928 -14.392 1.00 22.04 ? 847  LEU A O   1 
ATOM   6171 C  CB  . LEU A  1  812 ? 17.592  28.006 -16.267 1.00 22.38 ? 847  LEU A CB  1 
ATOM   6172 C  CG  . LEU A  1  812 ? 18.905  27.950 -17.055 1.00 26.00 ? 847  LEU A CG  1 
ATOM   6173 C  CD1 . LEU A  1  812 ? 19.699  26.679 -16.711 1.00 25.43 ? 847  LEU A CD1 1 
ATOM   6174 C  CD2 . LEU A  1  812 ? 18.665  28.061 -18.547 1.00 25.84 ? 847  LEU A CD2 1 
ATOM   6175 N  N   . LYS A  1  813 ? 17.519  30.806 -14.827 1.00 20.32 ? 848  LYS A N   1 
ATOM   6176 C  CA  . LYS A  1  813 ? 18.031  32.172 -14.786 1.00 23.51 ? 848  LYS A CA  1 
ATOM   6177 C  C   . LYS A  1  813 ? 18.508  32.611 -13.394 1.00 19.96 ? 848  LYS A C   1 
ATOM   6178 O  O   . LYS A  1  813 ? 19.335  33.522 -13.282 1.00 22.48 ? 848  LYS A O   1 
ATOM   6179 C  CB  . LYS A  1  813 ? 16.994  33.153 -15.310 1.00 25.16 ? 848  LYS A CB  1 
ATOM   6180 C  CG  . LYS A  1  813 ? 16.703  33.002 -16.819 1.00 24.98 ? 848  LYS A CG  1 
ATOM   6181 C  CD  . LYS A  1  813 ? 15.712  34.101 -17.183 1.00 33.36 ? 848  LYS A CD  1 
ATOM   6182 C  CE  . LYS A  1  813 ? 15.434  34.185 -18.656 1.00 34.56 ? 848  LYS A CE  1 
ATOM   6183 N  NZ  . LYS A  1  813 ? 14.435  35.264 -18.880 1.00 33.50 ? 848  LYS A NZ  1 
ATOM   6184 N  N   . THR A  1  814 ? 17.991  31.978 -12.347 1.00 22.19 ? 849  THR A N   1 
ATOM   6185 C  CA  . THR A  1  814 ? 18.409  32.344 -10.988 1.00 21.54 ? 849  THR A CA  1 
ATOM   6186 C  C   . THR A  1  814 ? 19.598  31.538 -10.482 1.00 19.90 ? 849  THR A C   1 
ATOM   6187 O  O   . THR A  1  814 ? 20.154  31.830 -9.417  1.00 21.32 ? 849  THR A O   1 
ATOM   6188 C  CB  . THR A  1  814 ? 17.282  32.216 -9.979  1.00 19.65 ? 849  THR A CB  1 
ATOM   6189 O  OG1 . THR A  1  814 ? 16.797  30.868 -9.973  1.00 24.18 ? 849  THR A OG1 1 
ATOM   6190 C  CG2 . THR A  1  814 ? 16.132  33.190 -10.303 1.00 21.02 ? 849  THR A CG2 1 
ATOM   6191 N  N   . TYR A  1  815 ? 20.005  30.528 -11.251 1.00 22.31 ? 850  TYR A N   1 
ATOM   6192 C  CA  . TYR A  1  815 ? 21.119  29.665 -10.865 1.00 22.96 ? 850  TYR A CA  1 
ATOM   6193 C  C   . TYR A  1  815 ? 22.428  30.440 -10.719 1.00 19.61 ? 850  TYR A C   1 
ATOM   6194 O  O   . TYR A  1  815 ? 22.718  31.314 -11.513 1.00 20.07 ? 850  TYR A O   1 
ATOM   6195 C  CB  . TYR A  1  815 ? 21.320  28.569 -11.920 1.00 19.87 ? 850  TYR A CB  1 
ATOM   6196 C  CG  . TYR A  1  815 ? 22.510  27.692 -11.628 1.00 23.68 ? 850  TYR A CG  1 
ATOM   6197 C  CD1 . TYR A  1  815 ? 22.458  26.718 -10.628 1.00 27.81 ? 850  TYR A CD1 1 
ATOM   6198 C  CD2 . TYR A  1  815 ? 23.689  27.833 -12.349 1.00 27.03 ? 850  TYR A CD2 1 
ATOM   6199 C  CE1 . TYR A  1  815 ? 23.554  25.914 -10.359 1.00 27.11 ? 850  TYR A CE1 1 
ATOM   6200 C  CE2 . TYR A  1  815 ? 24.787  27.033 -12.081 1.00 23.84 ? 850  TYR A CE2 1 
ATOM   6201 C  CZ  . TYR A  1  815 ? 24.712  26.074 -11.104 1.00 27.75 ? 850  TYR A CZ  1 
ATOM   6202 O  OH  . TYR A  1  815 ? 25.827  25.289 -10.858 1.00 29.22 ? 850  TYR A OH  1 
ATOM   6203 N  N   . LEU A  1  816 ? 23.200  30.142 -9.678  1.00 19.13 ? 851  LEU A N   1 
ATOM   6204 C  CA  . LEU A  1  816 ? 24.512  30.747 -9.527  1.00 20.35 ? 851  LEU A CA  1 
ATOM   6205 C  C   . LEU A  1  816 ? 25.529  29.631 -9.435  1.00 20.46 ? 851  LEU A C   1 
ATOM   6206 O  O   . LEU A  1  816 ? 25.449  28.785 -8.547  1.00 23.26 ? 851  LEU A O   1 
ATOM   6207 C  CB  . LEU A  1  816 ? 24.586  31.598 -8.254  1.00 17.42 ? 851  LEU A CB  1 
ATOM   6208 C  CG  . LEU A  1  816 ? 25.943  32.282 -8.025  1.00 18.03 ? 851  LEU A CG  1 
ATOM   6209 C  CD1 . LEU A  1  816 ? 26.148  33.369 -9.091  1.00 21.12 ? 851  LEU A CD1 1 
ATOM   6210 C  CD2 . LEU A  1  816 ? 26.070  32.853 -6.607  1.00 20.58 ? 851  LEU A CD2 1 
ATOM   6211 N  N   . HIS A  1  817 ? 26.486  29.620 -10.358 1.00 20.55 ? 852  HIS A N   1 
ATOM   6212 C  CA  . HIS A  1  817 ? 27.557  28.647 -10.270 1.00 23.30 ? 852  HIS A CA  1 
ATOM   6213 C  C   . HIS A  1  817 ? 28.589  29.145 -9.251  1.00 23.74 ? 852  HIS A C   1 
ATOM   6214 O  O   . HIS A  1  817 ? 29.289  30.119 -9.518  1.00 24.04 ? 852  HIS A O   1 
ATOM   6215 C  CB  . HIS A  1  817 ? 28.194  28.437 -11.651 1.00 23.44 ? 852  HIS A CB  1 
ATOM   6216 C  CG  . HIS A  1  817 ? 29.007  27.185 -11.737 1.00 30.82 ? 852  HIS A CG  1 
ATOM   6217 N  ND1 . HIS A  1  817 ? 28.446  25.932 -11.613 1.00 33.63 ? 852  HIS A ND1 1 
ATOM   6218 C  CD2 . HIS A  1  817 ? 30.335  26.987 -11.908 1.00 36.62 ? 852  HIS A CD2 1 
ATOM   6219 C  CE1 . HIS A  1  817 ? 29.395  25.015 -11.715 1.00 37.46 ? 852  HIS A CE1 1 
ATOM   6220 N  NE2 . HIS A  1  817 ? 30.549  25.628 -11.894 1.00 32.70 ? 852  HIS A NE2 1 
ATOM   6221 N  N   . THR A  1  818 ? 28.679  28.493 -8.088  1.00 23.86 ? 853  THR A N   1 
ATOM   6222 C  CA  . THR A  1  818 ? 29.492  29.040 -6.980  1.00 25.91 ? 853  THR A CA  1 
ATOM   6223 C  C   . THR A  1  818 ? 30.959  28.629 -6.912  1.00 31.23 ? 853  THR A C   1 
ATOM   6224 O  O   . THR A  1  818 ? 31.745  29.320 -6.268  1.00 32.84 ? 853  THR A O   1 
ATOM   6225 C  CB  . THR A  1  818 ? 28.880  28.790 -5.576  1.00 26.88 ? 853  THR A CB  1 
ATOM   6226 O  OG1 . THR A  1  818 ? 28.795  27.380 -5.336  1.00 30.59 ? 853  THR A OG1 1 
ATOM   6227 C  CG2 . THR A  1  818 ? 27.511  29.418 -5.472  1.00 26.77 ? 853  THR A CG2 1 
ATOM   6228 N  N   . TYR A  1  819 ? 31.324  27.510 -7.530  1.00 27.67 ? 854  TYR A N   1 
ATOM   6229 C  CA  . TYR A  1  819 ? 32.729  27.040 -7.483  1.00 30.61 ? 854  TYR A CA  1 
ATOM   6230 C  C   . TYR A  1  819 ? 33.216  26.660 -6.074  1.00 38.91 ? 854  TYR A C   1 
ATOM   6231 O  O   . TYR A  1  819 ? 34.405  26.785 -5.757  1.00 45.06 ? 854  TYR A O   1 
ATOM   6232 C  CB  . TYR A  1  819 ? 33.681  28.053 -8.146  1.00 33.61 ? 854  TYR A CB  1 
ATOM   6233 C  CG  . TYR A  1  819 ? 33.284  28.375 -9.566  1.00 30.72 ? 854  TYR A CG  1 
ATOM   6234 C  CD1 . TYR A  1  819 ? 33.726  27.589 -10.635 1.00 31.96 ? 854  TYR A CD1 1 
ATOM   6235 C  CD2 . TYR A  1  819 ? 32.436  29.448 -9.841  1.00 25.84 ? 854  TYR A CD2 1 
ATOM   6236 C  CE1 . TYR A  1  819 ? 33.337  27.880 -11.922 1.00 29.66 ? 854  TYR A CE1 1 
ATOM   6237 C  CE2 . TYR A  1  819 ? 32.042  29.740 -11.109 1.00 27.04 ? 854  TYR A CE2 1 
ATOM   6238 C  CZ  . TYR A  1  819 ? 32.497  28.957 -12.156 1.00 35.28 ? 854  TYR A CZ  1 
ATOM   6239 O  OH  . TYR A  1  819 ? 32.095  29.245 -13.431 1.00 36.97 ? 854  TYR A OH  1 
ATOM   6240 N  N   . GLU A  1  820 ? 32.299  26.179 -5.239  1.00 37.18 ? 855  GLU A N   1 
ATOM   6241 C  CA  . GLU A  1  820 ? 32.653  25.764 -3.878  1.00 41.86 ? 855  GLU A CA  1 
ATOM   6242 C  C   . GLU A  1  820 ? 32.801  24.248 -3.735  1.00 44.27 ? 855  GLU A C   1 
ATOM   6243 O  O   . GLU A  1  820 ? 33.921  23.730 -3.674  1.00 54.80 ? 855  GLU A O   1 
ATOM   6244 C  CB  . GLU A  1  820 ? 31.617  26.284 -2.884  1.00 38.17 ? 855  GLU A CB  1 
ATOM   6245 C  CG  . GLU A  1  820 ? 31.723  27.782 -2.666  1.00 33.95 ? 855  GLU A CG  1 
ATOM   6246 C  CD  . GLU A  1  820 ? 32.803  28.139 -1.669  1.00 34.25 ? 855  GLU A CD  1 
ATOM   6247 O  OE1 . GLU A  1  820 ? 32.818  27.576 -0.533  1.00 34.87 ? 855  GLU A OE1 1 
ATOM   6248 O  OE2 . GLU A  1  820 ? 33.638  28.990 -2.026  1.00 36.07 ? 855  GLU A OE2 1 
HETATM 6249 C  C1  . NAG B  2  .   ? -4.489  54.993 34.541  1.00 62.11 ? 1    NAG B C1  1 
HETATM 6250 C  C2  . NAG B  2  .   ? -5.507  56.136 34.620  1.00 60.96 ? 1    NAG B C2  1 
HETATM 6251 C  C3  . NAG B  2  .   ? -6.463  56.027 35.806  1.00 61.39 ? 1    NAG B C3  1 
HETATM 6252 C  C4  . NAG B  2  .   ? -6.993  54.608 35.966  1.00 62.23 ? 1    NAG B C4  1 
HETATM 6253 C  C5  . NAG B  2  .   ? -5.839  53.611 35.938  1.00 61.68 ? 1    NAG B C5  1 
HETATM 6254 C  C6  . NAG B  2  .   ? -6.377  52.191 36.002  1.00 60.66 ? 1    NAG B C6  1 
HETATM 6255 C  C7  . NAG B  2  .   ? -5.116  58.382 33.781  1.00 61.47 ? 1    NAG B C7  1 
HETATM 6256 C  C8  . NAG B  2  .   ? -6.392  58.237 33.000  1.00 59.57 ? 1    NAG B C8  1 
HETATM 6257 N  N2  . NAG B  2  .   ? -4.833  57.424 34.664  1.00 58.45 ? 1    NAG B N2  1 
HETATM 6258 O  O3  . NAG B  2  .   ? -7.526  56.933 35.600  1.00 61.48 ? 1    NAG B O3  1 
HETATM 6259 O  O4  . NAG B  2  .   ? -7.696  54.468 37.185  1.00 62.26 ? 1    NAG B O4  1 
HETATM 6260 O  O5  . NAG B  2  .   ? -5.095  53.735 34.744  1.00 61.53 ? 1    NAG B O5  1 
HETATM 6261 O  O6  . NAG B  2  .   ? -7.067  51.937 34.798  1.00 60.78 ? 1    NAG B O6  1 
HETATM 6262 O  O7  . NAG B  2  .   ? -4.385  59.353 33.590  1.00 63.20 ? 1    NAG B O7  1 
HETATM 6263 C  C1  . NAG B  2  .   ? -9.119  54.665 37.018  1.00 61.79 ? 2    NAG B C1  1 
HETATM 6264 C  C2  . NAG B  2  .   ? -9.851  53.976 38.171  1.00 65.06 ? 2    NAG B C2  1 
HETATM 6265 C  C3  . NAG B  2  .   ? -11.346 54.285 38.223  1.00 65.47 ? 2    NAG B C3  1 
HETATM 6266 C  C4  . NAG B  2  .   ? -11.652 55.750 37.951  1.00 65.10 ? 2    NAG B C4  1 
HETATM 6267 C  C5  . NAG B  2  .   ? -10.863 56.231 36.736  1.00 65.80 ? 2    NAG B C5  1 
HETATM 6268 C  C6  . NAG B  2  .   ? -11.127 57.705 36.427  1.00 66.86 ? 2    NAG B C6  1 
HETATM 6269 C  C7  . NAG B  2  .   ? -8.808  51.904 38.867  1.00 65.85 ? 2    NAG B C7  1 
HETATM 6270 C  C8  . NAG B  2  .   ? -8.893  50.406 38.870  1.00 61.16 ? 2    NAG B C8  1 
HETATM 6271 N  N2  . NAG B  2  .   ? -9.664  52.541 38.076  1.00 66.55 ? 2    NAG B N2  1 
HETATM 6272 O  O3  . NAG B  2  .   ? -11.842 53.955 39.499  1.00 67.20 ? 2    NAG B O3  1 
HETATM 6273 O  O4  . NAG B  2  .   ? -13.041 55.903 37.733  1.00 70.45 ? 2    NAG B O4  1 
HETATM 6274 O  O5  . NAG B  2  .   ? -9.481  56.027 36.953  1.00 62.40 ? 2    NAG B O5  1 
HETATM 6275 O  O6  . NAG B  2  .   ? -10.889 58.496 37.572  1.00 60.47 ? 2    NAG B O6  1 
HETATM 6276 O  O7  . NAG B  2  .   ? -7.978  52.494 39.561  1.00 66.80 ? 2    NAG B O7  1 
HETATM 6277 C  C1  . NAG C  3  .   ? 15.301  44.966 -6.058  1.00 18.83 ? 1    NAG C C1  1 
HETATM 6278 C  C2  . NAG C  3  .   ? 15.864  45.748 -7.254  1.00 15.94 ? 1    NAG C C2  1 
HETATM 6279 C  C3  . NAG C  3  .   ? 15.641  47.256 -7.025  1.00 19.48 ? 1    NAG C C3  1 
HETATM 6280 C  C4  . NAG C  3  .   ? 14.185  47.583 -6.632  1.00 20.70 ? 1    NAG C C4  1 
HETATM 6281 C  C5  . NAG C  3  .   ? 13.602  46.577 -5.636  1.00 20.69 ? 1    NAG C C5  1 
HETATM 6282 C  C6  . NAG C  3  .   ? 12.096  46.686 -5.440  1.00 24.00 ? 1    NAG C C6  1 
HETATM 6283 C  C7  . NAG C  3  .   ? 17.719  44.854 -8.645  1.00 20.78 ? 1    NAG C C7  1 
HETATM 6284 C  C8  . NAG C  3  .   ? 19.203  44.718 -8.839  1.00 19.86 ? 1    NAG C C8  1 
HETATM 6285 N  N2  . NAG C  3  .   ? 17.278  45.484 -7.537  1.00 19.46 ? 1    NAG C N2  1 
HETATM 6286 O  O3  . NAG C  3  .   ? 16.023  47.989 -8.182  1.00 20.99 ? 1    NAG C O3  1 
HETATM 6287 O  O4  . NAG C  3  .   ? 14.225  48.817 -5.960  1.00 20.43 ? 1    NAG C O4  1 
HETATM 6288 O  O5  . NAG C  3  .   ? 13.901  45.246 -6.006  1.00 20.61 ? 1    NAG C O5  1 
HETATM 6289 O  O6  . NAG C  3  .   ? 11.415  46.732 -6.677  1.00 24.62 ? 1    NAG C O6  1 
HETATM 6290 O  O7  . NAG C  3  .   ? 16.985  44.379 -9.513  1.00 22.82 ? 1    NAG C O7  1 
HETATM 6291 C  C1  . NAG C  3  .   ? 13.423  49.811 -6.584  1.00 25.75 ? 2    NAG C C1  1 
HETATM 6292 C  C2  . NAG C  3  .   ? 13.116  50.847 -5.504  1.00 28.48 ? 2    NAG C C2  1 
HETATM 6293 C  C3  . NAG C  3  .   ? 12.354  52.047 -6.086  1.00 33.40 ? 2    NAG C C3  1 
HETATM 6294 C  C4  . NAG C  3  .   ? 13.002  52.525 -7.386  1.00 33.77 ? 2    NAG C C4  1 
HETATM 6295 C  C5  . NAG C  3  .   ? 13.221  51.325 -8.305  1.00 33.06 ? 2    NAG C C5  1 
HETATM 6296 C  C6  . NAG C  3  .   ? 13.797  51.724 -9.656  1.00 35.11 ? 2    NAG C C6  1 
HETATM 6297 C  C7  . NAG C  3  .   ? 12.887  49.797 -3.284  1.00 27.84 ? 2    NAG C C7  1 
HETATM 6298 C  C8  . NAG C  3  .   ? 11.957  49.353 -2.190  1.00 32.30 ? 2    NAG C C8  1 
HETATM 6299 N  N2  . NAG C  3  .   ? 12.351  50.190 -4.454  1.00 26.88 ? 2    NAG C N2  1 
HETATM 6300 O  O3  . NAG C  3  .   ? 12.256  53.051 -5.085  1.00 32.09 ? 2    NAG C O3  1 
HETATM 6301 O  O4  . NAG C  3  .   ? 12.135  53.383 -8.109  1.00 41.73 ? 2    NAG C O4  1 
HETATM 6302 O  O5  . NAG C  3  .   ? 14.067  50.384 -7.682  1.00 26.57 ? 2    NAG C O5  1 
HETATM 6303 O  O6  . NAG C  3  .   ? 15.084  52.293 -9.522  1.00 38.57 ? 2    NAG C O6  1 
HETATM 6304 O  O7  . NAG C  3  .   ? 14.099  49.787 -3.068  1.00 24.15 ? 2    NAG C O7  1 
HETATM 6305 C  C1  . BMA C  3  .   ? 12.198  54.757 -7.688  1.00 41.03 ? 3    BMA C C1  1 
HETATM 6306 C  C2  . BMA C  3  .   ? 11.785  55.612 -8.872  1.00 47.85 ? 3    BMA C C2  1 
HETATM 6307 C  C3  . BMA C  3  .   ? 11.931  57.088 -8.529  1.00 50.77 ? 3    BMA C C3  1 
HETATM 6308 C  C4  . BMA C  3  .   ? 11.065  57.375 -7.307  1.00 50.20 ? 3    BMA C C4  1 
HETATM 6309 C  C5  . BMA C  3  .   ? 11.373  56.361 -6.203  1.00 43.87 ? 3    BMA C C5  1 
HETATM 6310 C  C6  . BMA C  3  .   ? 10.425  56.487 -5.022  1.00 43.75 ? 3    BMA C C6  1 
HETATM 6311 O  O2  . BMA C  3  .   ? 10.414  55.337 -9.089  1.00 44.50 ? 3    BMA C O2  1 
HETATM 6312 O  O3  . BMA C  3  .   ? 11.518  57.884 -9.621  1.00 54.66 ? 3    BMA C O3  1 
HETATM 6313 O  O4  . BMA C  3  .   ? 11.306  58.689 -6.847  1.00 53.17 ? 3    BMA C O4  1 
HETATM 6314 O  O5  . BMA C  3  .   ? 11.250  55.041 -6.690  1.00 39.90 ? 3    BMA C O5  1 
HETATM 6315 O  O6  . BMA C  3  .   ? 10.869  55.590 -4.022  1.00 42.23 ? 3    BMA C O6  1 
HETATM 6316 C  C1  . MAN C  3  .   ? 10.257  55.887 -2.747  1.00 41.02 ? 4    MAN C C1  1 
HETATM 6317 C  C2  . MAN C  3  .   ? 11.106  55.309 -1.606  1.00 41.13 ? 4    MAN C C2  1 
HETATM 6318 C  C3  . MAN C  3  .   ? 11.196  53.790 -1.761  1.00 40.18 ? 4    MAN C C3  1 
HETATM 6319 C  C4  . MAN C  3  .   ? 9.773   53.261 -1.700  1.00 38.78 ? 4    MAN C C4  1 
HETATM 6320 C  C5  . MAN C  3  .   ? 8.968   53.905 -2.830  1.00 41.47 ? 4    MAN C C5  1 
HETATM 6321 C  C6  . MAN C  3  .   ? 7.536   53.386 -2.815  1.00 43.12 ? 4    MAN C C6  1 
HETATM 6322 O  O2  . MAN C  3  .   ? 10.508  55.592 -0.357  1.00 39.91 ? 4    MAN C O2  1 
HETATM 6323 O  O3  . MAN C  3  .   ? 11.979  53.187 -0.747  1.00 36.94 ? 4    MAN C O3  1 
HETATM 6324 O  O4  . MAN C  3  .   ? 9.751   51.849 -1.791  1.00 36.30 ? 4    MAN C O4  1 
HETATM 6325 O  O5  . MAN C  3  .   ? 8.969   55.317 -2.676  1.00 41.90 ? 4    MAN C O5  1 
HETATM 6326 O  O6  . MAN C  3  .   ? 7.040   53.442 -1.491  1.00 52.16 ? 4    MAN C O6  1 
HETATM 6327 C  C1  . MAN C  3  .   ? 13.357  53.565 -0.924  1.00 37.16 ? 5    MAN C C1  1 
HETATM 6328 C  C2  . MAN C  3  .   ? 14.222  52.449 -0.343  1.00 32.88 ? 5    MAN C C2  1 
HETATM 6329 C  C3  . MAN C  3  .   ? 13.894  52.253 1.133   1.00 30.28 ? 5    MAN C C3  1 
HETATM 6330 C  C4  . MAN C  3  .   ? 14.002  53.607 1.827   1.00 35.63 ? 5    MAN C C4  1 
HETATM 6331 C  C5  . MAN C  3  .   ? 13.192  54.669 1.076   1.00 35.64 ? 5    MAN C C5  1 
HETATM 6332 C  C6  . MAN C  3  .   ? 13.198  56.034 1.767   1.00 41.50 ? 5    MAN C C6  1 
HETATM 6333 O  O2  . MAN C  3  .   ? 15.587  52.798 -0.498  1.00 33.73 ? 5    MAN C O2  1 
HETATM 6334 O  O3  . MAN C  3  .   ? 14.852  51.389 1.724   1.00 30.57 ? 5    MAN C O3  1 
HETATM 6335 O  O4  . MAN C  3  .   ? 13.545  53.471 3.153   1.00 34.66 ? 5    MAN C O4  1 
HETATM 6336 O  O5  . MAN C  3  .   ? 13.656  54.771 -0.246  1.00 37.28 ? 5    MAN C O5  1 
HETATM 6337 O  O6  . MAN C  3  .   ? 14.525  56.434 2.006   1.00 47.39 ? 5    MAN C O6  1 
HETATM 6338 C  C1  . MAN C  3  .   ? 16.158  52.039 -1.583  1.00 31.06 ? 6    MAN C C1  1 
HETATM 6339 C  C2  . MAN C  3  .   ? 17.675  52.021 -1.390  1.00 27.15 ? 6    MAN C C2  1 
HETATM 6340 C  C3  . MAN C  3  .   ? 18.195  53.430 -1.549  1.00 27.30 ? 6    MAN C C3  1 
HETATM 6341 C  C4  . MAN C  3  .   ? 17.795  53.907 -2.936  1.00 31.91 ? 6    MAN C C4  1 
HETATM 6342 C  C5  . MAN C  3  .   ? 16.269  53.888 -3.058  1.00 31.24 ? 6    MAN C C5  1 
HETATM 6343 C  C6  . MAN C  3  .   ? 15.799  54.422 -4.408  1.00 35.50 ? 6    MAN C C6  1 
HETATM 6344 O  O2  . MAN C  3  .   ? 18.345  51.252 -2.354  1.00 23.96 ? 6    MAN C O2  1 
HETATM 6345 O  O3  . MAN C  3  .   ? 19.606  53.460 -1.427  1.00 28.69 ? 6    MAN C O3  1 
HETATM 6346 O  O4  . MAN C  3  .   ? 18.299  55.209 -3.131  1.00 36.57 ? 6    MAN C O4  1 
HETATM 6347 O  O5  . MAN C  3  .   ? 15.797  52.567 -2.851  1.00 28.90 ? 6    MAN C O5  1 
HETATM 6348 O  O6  . MAN C  3  .   ? 14.438  54.787 -4.279  1.00 37.22 ? 6    MAN C O6  1 
HETATM 6349 C  C1  . NAG D  2  .   ? 51.232  53.181 4.427   1.00 31.24 ? 1    NAG D C1  1 
HETATM 6350 C  C2  . NAG D  2  .   ? 50.962  54.279 5.447   1.00 31.78 ? 1    NAG D C2  1 
HETATM 6351 C  C3  . NAG D  2  .   ? 52.230  55.127 5.648   1.00 34.55 ? 1    NAG D C3  1 
HETATM 6352 C  C4  . NAG D  2  .   ? 53.420  54.240 5.967   1.00 38.34 ? 1    NAG D C4  1 
HETATM 6353 C  C5  . NAG D  2  .   ? 53.524  53.069 5.020   1.00 36.03 ? 1    NAG D C5  1 
HETATM 6354 C  C6  . NAG D  2  .   ? 54.540  52.116 5.612   1.00 37.82 ? 1    NAG D C6  1 
HETATM 6355 C  C7  . NAG D  2  .   ? 48.701  55.171 5.698   1.00 30.64 ? 1    NAG D C7  1 
HETATM 6356 C  C8  . NAG D  2  .   ? 47.628  56.082 5.170   1.00 31.39 ? 1    NAG D C8  1 
HETATM 6357 N  N2  . NAG D  2  .   ? 49.839  55.092 5.006   1.00 28.69 ? 1    NAG D N2  1 
HETATM 6358 O  O3  . NAG D  2  .   ? 52.033  56.018 6.714   1.00 34.12 ? 1    NAG D O3  1 
HETATM 6359 O  O4  . NAG D  2  .   ? 54.642  54.944 5.844   1.00 47.45 ? 1    NAG D O4  1 
HETATM 6360 O  O5  . NAG D  2  .   ? 52.293  52.381 4.900   1.00 34.22 ? 1    NAG D O5  1 
HETATM 6361 O  O6  . NAG D  2  .   ? 54.797  51.153 4.631   1.00 37.56 ? 1    NAG D O6  1 
HETATM 6362 O  O7  . NAG D  2  .   ? 48.489  54.532 6.730   1.00 27.56 ? 1    NAG D O7  1 
HETATM 6363 C  C1  . NAG D  2  .   ? 55.090  55.489 7.097   1.00 47.56 ? 2    NAG D C1  1 
HETATM 6364 C  C2  . NAG D  2  .   ? 56.617  55.337 7.184   1.00 52.85 ? 2    NAG D C2  1 
HETATM 6365 C  C3  . NAG D  2  .   ? 57.254  56.214 8.263   1.00 54.33 ? 2    NAG D C3  1 
HETATM 6366 C  C4  . NAG D  2  .   ? 56.651  57.607 8.284   1.00 54.58 ? 2    NAG D C4  1 
HETATM 6367 C  C5  . NAG D  2  .   ? 55.135  57.484 8.353   1.00 55.77 ? 2    NAG D C5  1 
HETATM 6368 C  C6  . NAG D  2  .   ? 54.425  58.831 8.422   1.00 56.36 ? 2    NAG D C6  1 
HETATM 6369 C  C7  . NAG D  2  .   ? 57.766  53.207 6.702   1.00 48.29 ? 2    NAG D C7  1 
HETATM 6370 C  C8  . NAG D  2  .   ? 58.010  51.814 7.206   1.00 51.79 ? 2    NAG D C8  1 
HETATM 6371 N  N2  . NAG D  2  .   ? 56.962  53.953 7.462   1.00 55.44 ? 2    NAG D N2  1 
HETATM 6372 O  O3  . NAG D  2  .   ? 58.643  56.309 8.044   1.00 55.69 ? 2    NAG D O3  1 
HETATM 6373 O  O4  . NAG D  2  .   ? 57.169  58.318 9.386   1.00 61.91 ? 2    NAG D O4  1 
HETATM 6374 O  O5  . NAG D  2  .   ? 54.695  56.836 7.182   1.00 52.73 ? 2    NAG D O5  1 
HETATM 6375 O  O6  . NAG D  2  .   ? 53.276  58.769 7.594   1.00 52.20 ? 2    NAG D O6  1 
HETATM 6376 O  O7  . NAG D  2  .   ? 58.283  53.592 5.652   1.00 51.06 ? 2    NAG D O7  1 
HETATM 6377 ZN ZN  . ZN  E  4  .   ? 21.756  35.018 12.842  1.00 20.54 ? 1001 ZN  A ZN  1 
HETATM 6378 ZN ZN  . ZN  F  4  .   ? 25.705  34.892 15.136  1.00 18.13 ? 1002 ZN  A ZN  1 
HETATM 6379 CA CA  . CA  G  5  .   ? 22.719  51.781 -13.252 1.00 25.61 ? 1003 CA  A CA  1 
HETATM 6380 NA NA  . NA  H  6  .   ? 47.974  42.997 -9.089  1.00 27.34 ? 1004 NA  A NA  1 
HETATM 6381 K  K   . K   I  7  .   ? 45.433  52.714 -27.318 1.00 39.94 ? 1005 K   A K   1 
HETATM 6382 O  OAA . NKO J  8  .   ? 24.117  38.191 13.487  1.00 19.30 ? 1006 NKO A OAA 1 
HETATM 6383 O  OAB . NKO J  8  .   ? 26.108  38.229 15.079  1.00 36.69 ? 1006 NKO A OAB 1 
HETATM 6384 P  PAC . NKO J  8  .   ? 24.578  37.700 14.907  1.00 28.19 ? 1006 NKO A PAC 1 
HETATM 6385 O  OAD . NKO J  8  .   ? 24.463  36.255 15.045  1.00 33.29 ? 1006 NKO A OAD 1 
HETATM 6386 O  OAE . NKO J  8  .   ? 18.440  37.443 18.838  1.00 43.85 ? 1006 NKO A OAE 1 
HETATM 6387 O  OAF . NKO J  8  .   ? 23.808  38.336 16.162  1.00 35.07 ? 1006 NKO A OAF 1 
HETATM 6388 C  CAG . NKO J  8  .   ? 22.540  37.749 16.424  1.00 32.91 ? 1006 NKO A CAG 1 
HETATM 6389 C  CAH . NKO J  8  .   ? 22.287  37.808 17.925  1.00 40.61 ? 1006 NKO A CAH 1 
HETATM 6390 C  CAI . NKO J  8  .   ? 20.910  37.319 18.351  1.00 47.44 ? 1006 NKO A CAI 1 
HETATM 6391 O  OAJ . NKO J  8  .   ? 20.143  38.265 17.626  1.00 49.46 ? 1006 NKO A OAJ 1 
HETATM 6392 C  CAK . NKO J  8  .   ? 18.842  38.239 17.985  1.00 44.40 ? 1006 NKO A CAK 1 
HETATM 6393 C  CAL . NKO J  8  .   ? 17.953  39.226 17.246  1.00 43.29 ? 1006 NKO A CAL 1 
HETATM 6394 C  CAM . NKO J  8  .   ? 16.606  38.600 16.999  1.00 41.26 ? 1006 NKO A CAM 1 
HETATM 6395 C  CAN . NKO J  8  .   ? 15.779  39.474 16.068  1.00 40.52 ? 1006 NKO A CAN 1 
HETATM 6396 C  CAO . NKO J  8  .   ? 14.494  38.698 15.791  1.00 41.09 ? 1006 NKO A CAO 1 
HETATM 6397 C  CAP . NKO J  8  .   ? 13.395  38.547 16.840  1.00 37.40 ? 1006 NKO A CAP 1 
HETATM 6398 C  CAQ . NKO J  8  .   ? 12.593  37.481 16.130  1.00 40.21 ? 1006 NKO A CAQ 1 
HETATM 6399 C  CAR . NKO J  8  .   ? 12.369  37.828 14.670  1.00 38.08 ? 1006 NKO A CAR 1 
HETATM 6400 C  CAS . NKO J  8  .   ? 11.700  36.598 14.081  1.00 40.23 ? 1006 NKO A CAS 1 
HETATM 6401 C  CAT . NKO J  8  .   ? 11.624  36.644 12.565  1.00 38.23 ? 1006 NKO A CAT 1 
HETATM 6402 C  CAU . NKO J  8  .   ? 11.016  35.330 12.110  1.00 37.69 ? 1006 NKO A CAU 1 
HETATM 6403 C  CAV . NKO J  8  .   ? 11.089  35.119 10.591  1.00 37.71 ? 1006 NKO A CAV 1 
HETATM 6404 C  CAW . NKO J  8  .   ? 10.418  36.085 9.621   1.00 43.75 ? 1006 NKO A CAW 1 
HETATM 6405 C  CAX . NKO J  8  .   ? 10.753  35.493 8.240   1.00 33.64 ? 1006 NKO A CAX 1 
HETATM 6406 C  CAY . NKO J  8  .   ? 10.167  36.237 7.036   1.00 31.62 ? 1006 NKO A CAY 1 
HETATM 6407 C  CAZ . NKO J  8  .   ? 8.638   36.273 7.042   1.00 35.79 ? 1006 NKO A CAZ 1 
HETATM 6408 O  OBA . NKO J  8  .   ? 23.200  36.882 18.503  1.00 50.49 ? 1006 NKO A OBA 1 
HETATM 6409 C  CAS . NKO K  8  .   ? 8.392   50.708 7.789   1.00 39.04 ? 1007 NKO A CAS 1 
HETATM 6410 C  CAT . NKO K  8  .   ? 8.299   49.192 7.507   1.00 38.42 ? 1007 NKO A CAT 1 
HETATM 6411 C  CAU . NKO K  8  .   ? 7.860   48.039 8.429   1.00 37.28 ? 1007 NKO A CAU 1 
HETATM 6412 C  CAV . NKO K  8  .   ? 8.709   47.537 9.626   1.00 32.96 ? 1007 NKO A CAV 1 
HETATM 6413 C  CAW . NKO K  8  .   ? 9.107   48.348 10.852  1.00 33.31 ? 1007 NKO A CAW 1 
HETATM 6414 C  CAX . NKO K  8  .   ? 9.911   47.345 11.723  1.00 32.46 ? 1007 NKO A CAX 1 
HETATM 6415 C  CAY . NKO K  8  .   ? 10.404  47.948 13.053  1.00 36.01 ? 1007 NKO A CAY 1 
HETATM 6416 C  CAZ . NKO K  8  .   ? 11.181  46.919 13.900  1.00 35.90 ? 1007 NKO A CAZ 1 
HETATM 6417 S  S   . SCN L  9  .   ? 27.328  43.545 9.076   1.00 41.33 ? 1008 SCN A S   1 
HETATM 6418 C  C   . SCN L  9  .   ? 27.558  44.149 10.703  1.00 18.97 ? 1008 SCN A C   1 
HETATM 6419 N  N   . SCN L  9  .   ? 27.682  44.446 11.836  1.00 33.80 ? 1008 SCN A N   1 
HETATM 6420 S  S   . SCN M  9  .   ? 28.106  51.148 12.555  1.00 25.49 ? 1009 SCN A S   1 
HETATM 6421 C  C   . SCN M  9  .   ? 29.194  50.583 13.864  1.00 33.56 ? 1009 SCN A C   1 
HETATM 6422 N  N   . SCN M  9  .   ? 29.931  50.169 14.692  1.00 43.11 ? 1009 SCN A N   1 
HETATM 6423 C  C1  . EDO N  10 .   ? 11.870  37.551 -17.059 1.00 38.76 ? 1010 EDO A C1  1 
HETATM 6424 O  O1  . EDO N  10 .   ? 11.935  36.406 -17.922 1.00 36.00 ? 1010 EDO A O1  1 
HETATM 6425 C  C2  . EDO N  10 .   ? 12.524  37.208 -15.726 1.00 36.99 ? 1010 EDO A C2  1 
HETATM 6426 O  O2  . EDO N  10 .   ? 13.773  36.556 -15.996 1.00 36.69 ? 1010 EDO A O2  1 
HETATM 6427 C  C1  . EDO O  10 .   ? 4.596   17.159 3.381   1.00 32.11 ? 1011 EDO A C1  1 
HETATM 6428 O  O1  . EDO O  10 .   ? 4.875   18.177 2.411   1.00 26.67 ? 1011 EDO A O1  1 
HETATM 6429 C  C2  . EDO O  10 .   ? 4.362   15.806 2.709   1.00 33.46 ? 1011 EDO A C2  1 
HETATM 6430 O  O2  . EDO O  10 .   ? 3.109   15.714 1.964   1.00 35.45 ? 1011 EDO A O2  1 
HETATM 6431 C  C1  . EDO P  10 .   ? 39.161  39.934 -27.900 1.00 31.65 ? 1012 EDO A C1  1 
HETATM 6432 O  O1  . EDO P  10 .   ? 39.924  41.092 -27.555 1.00 40.79 ? 1012 EDO A O1  1 
HETATM 6433 C  C2  . EDO P  10 .   ? 40.122  38.818 -28.236 1.00 33.68 ? 1012 EDO A C2  1 
HETATM 6434 O  O2  . EDO P  10 .   ? 39.364  37.780 -28.837 1.00 36.76 ? 1012 EDO A O2  1 
HETATM 6435 C  C1  . EDO Q  10 .   ? 23.481  50.939 -21.374 1.00 35.15 ? 1013 EDO A C1  1 
HETATM 6436 O  O1  . EDO Q  10 .   ? 22.962  50.595 -20.075 1.00 34.28 ? 1013 EDO A O1  1 
HETATM 6437 C  C2  . EDO Q  10 .   ? 23.013  49.931 -22.429 1.00 35.96 ? 1013 EDO A C2  1 
HETATM 6438 O  O2  . EDO Q  10 .   ? 21.575  49.875 -22.433 1.00 37.15 ? 1013 EDO A O2  1 
HETATM 6439 C  C1  . EDO R  10 .   ? 20.213  14.701 1.582   1.00 32.21 ? 1014 EDO A C1  1 
HETATM 6440 O  O1  . EDO R  10 .   ? 19.348  15.342 0.624   1.00 30.57 ? 1014 EDO A O1  1 
HETATM 6441 C  C2  . EDO R  10 .   ? 19.623  13.387 2.106   1.00 35.82 ? 1014 EDO A C2  1 
HETATM 6442 O  O2  . EDO R  10 .   ? 19.652  12.379 1.085   1.00 33.25 ? 1014 EDO A O2  1 
HETATM 6443 C  C1  . EDO S  10 .   ? 34.481  51.457 -16.535 1.00 29.67 ? 1015 EDO A C1  1 
HETATM 6444 O  O1  . EDO S  10 .   ? 34.306  52.705 -15.856 1.00 36.30 ? 1015 EDO A O1  1 
HETATM 6445 C  C2  . EDO S  10 .   ? 35.929  51.313 -16.960 1.00 28.98 ? 1015 EDO A C2  1 
HETATM 6446 O  O2  . EDO S  10 .   ? 36.760  51.224 -15.797 1.00 35.57 ? 1015 EDO A O2  1 
HETATM 6447 C  C1  . EDO T  10 .   ? 38.853  37.491 0.947   1.00 28.72 ? 1016 EDO A C1  1 
HETATM 6448 O  O1  . EDO T  10 .   ? 39.511  36.218 0.786   1.00 33.64 ? 1016 EDO A O1  1 
HETATM 6449 C  C2  . EDO T  10 .   ? 38.475  38.078 -0.410  1.00 29.88 ? 1016 EDO A C2  1 
HETATM 6450 O  O2  . EDO T  10 .   ? 37.631  37.161 -1.142  1.00 32.64 ? 1016 EDO A O2  1 
HETATM 6451 C  C1  . EDO U  10 .   ? 39.619  37.638 -6.763  1.00 26.94 ? 1017 EDO A C1  1 
HETATM 6452 O  O1  . EDO U  10 .   ? 39.718  37.229 -5.381  1.00 30.47 ? 1017 EDO A O1  1 
HETATM 6453 C  C2  . EDO U  10 .   ? 40.991  37.989 -7.359  1.00 27.93 ? 1017 EDO A C2  1 
HETATM 6454 O  O2  . EDO U  10 .   ? 42.026  37.208 -6.742  1.00 35.44 ? 1017 EDO A O2  1 
HETATM 6455 C  C1  . EDO V  10 .   ? 5.863   41.690 -7.819  1.00 31.48 ? 1018 EDO A C1  1 
HETATM 6456 O  O1  . EDO V  10 .   ? 6.129   42.906 -8.555  1.00 37.36 ? 1018 EDO A O1  1 
HETATM 6457 C  C2  . EDO V  10 .   ? 7.104   41.300 -7.008  1.00 29.07 ? 1018 EDO A C2  1 
HETATM 6458 O  O2  . EDO V  10 .   ? 8.327   41.668 -7.686  1.00 23.75 ? 1018 EDO A O2  1 
HETATM 6459 C  C1  . EDO W  10 .   ? 25.930  56.219 -26.004 1.00 39.21 ? 1019 EDO A C1  1 
HETATM 6460 O  O1  . EDO W  10 .   ? 25.223  57.338 -25.462 1.00 45.61 ? 1019 EDO A O1  1 
HETATM 6461 C  C2  . EDO W  10 .   ? 27.094  56.724 -26.841 1.00 37.66 ? 1019 EDO A C2  1 
HETATM 6462 O  O2  . EDO W  10 .   ? 27.649  57.877 -26.206 1.00 42.11 ? 1019 EDO A O2  1 
HETATM 6463 C  C1  . EDO X  10 .   ? 21.819  25.142 -14.090 1.00 33.72 ? 1020 EDO A C1  1 
HETATM 6464 O  O1  . EDO X  10 .   ? 23.174  25.367 -14.472 1.00 28.26 ? 1020 EDO A O1  1 
HETATM 6465 C  C2  . EDO X  10 .   ? 21.616  23.646 -13.866 1.00 39.29 ? 1020 EDO A C2  1 
HETATM 6466 O  O2  . EDO X  10 .   ? 22.686  23.163 -13.042 1.00 43.98 ? 1020 EDO A O2  1 
HETATM 6467 C  C1  . EDO Y  10 .   ? 13.686  47.608 -18.770 1.00 40.34 ? 1021 EDO A C1  1 
HETATM 6468 O  O1  . EDO Y  10 .   ? 13.716  48.980 -18.335 1.00 49.14 ? 1021 EDO A O1  1 
HETATM 6469 C  C2  . EDO Y  10 .   ? 14.948  46.916 -18.287 1.00 40.12 ? 1021 EDO A C2  1 
HETATM 6470 O  O2  . EDO Y  10 .   ? 16.018  47.867 -18.281 1.00 38.14 ? 1021 EDO A O2  1 
HETATM 6471 C  C1  . EDO Z  10 .   ? 52.541  44.129 6.647   1.00 37.07 ? 1022 EDO A C1  1 
HETATM 6472 O  O1  . EDO Z  10 .   ? 51.295  43.746 7.250   1.00 38.28 ? 1022 EDO A O1  1 
HETATM 6473 C  C2  . EDO Z  10 .   ? 52.297  45.389 5.821   1.00 34.59 ? 1022 EDO A C2  1 
HETATM 6474 O  O2  . EDO Z  10 .   ? 53.420  45.628 4.962   1.00 43.30 ? 1022 EDO A O2  1 
HETATM 6475 C  C1  . EDO AA 10 .   ? 40.037  42.803 -14.569 1.00 24.19 ? 1023 EDO A C1  1 
HETATM 6476 O  O1  . EDO AA 10 .   ? 38.951  43.223 -13.724 1.00 23.79 ? 1023 EDO A O1  1 
HETATM 6477 C  C2  . EDO AA 10 .   ? 40.883  44.017 -14.948 1.00 24.51 ? 1023 EDO A C2  1 
HETATM 6478 O  O2  . EDO AA 10 .   ? 40.058  44.968 -15.636 1.00 26.31 ? 1023 EDO A O2  1 
HETATM 6479 C  C1  . EDO BA 10 .   ? 18.381  54.484 3.296   1.00 30.37 ? 1024 EDO A C1  1 
HETATM 6480 O  O1  . EDO BA 10 .   ? 18.273  54.979 1.958   1.00 35.66 ? 1024 EDO A O1  1 
HETATM 6481 C  C2  . EDO BA 10 .   ? 18.286  52.956 3.353   1.00 21.24 ? 1024 EDO A C2  1 
HETATM 6482 O  O2  . EDO BA 10 .   ? 17.300  52.402 2.484   1.00 33.39 ? 1024 EDO A O2  1 
HETATM 6483 C  C1  . EDO CA 10 .   ? 16.249  26.290 20.899  1.00 31.26 ? 1025 EDO A C1  1 
HETATM 6484 O  O1  . EDO CA 10 .   ? 17.074  26.314 22.051  1.00 33.49 ? 1025 EDO A O1  1 
HETATM 6485 C  C2  . EDO CA 10 .   ? 14.821  25.893 21.265  1.00 30.25 ? 1025 EDO A C2  1 
HETATM 6486 O  O2  . EDO CA 10 .   ? 14.082  26.339 20.123  1.00 29.32 ? 1025 EDO A O2  1 
HETATM 6487 C  C1  . EDO DA 10 .   ? 9.171   36.125 -27.985 1.00 47.91 ? 1026 EDO A C1  1 
HETATM 6488 O  O1  . EDO DA 10 .   ? 8.472   34.943 -27.564 1.00 52.02 ? 1026 EDO A O1  1 
HETATM 6489 C  C2  . EDO DA 10 .   ? 10.665  35.837 -28.114 1.00 44.28 ? 1026 EDO A C2  1 
HETATM 6490 O  O2  . EDO DA 10 .   ? 11.370  36.983 -28.620 1.00 44.82 ? 1026 EDO A O2  1 
HETATM 6491 C  C1  . EDO EA 10 .   ? 48.581  46.141 -17.609 1.00 38.85 ? 1027 EDO A C1  1 
HETATM 6492 O  O1  . EDO EA 10 .   ? 48.367  44.785 -18.007 1.00 39.88 ? 1027 EDO A O1  1 
HETATM 6493 C  C2  . EDO EA 10 .   ? 47.540  47.023 -18.288 1.00 35.52 ? 1027 EDO A C2  1 
HETATM 6494 O  O2  . EDO EA 10 .   ? 47.704  48.380 -17.855 1.00 43.36 ? 1027 EDO A O2  1 
HETATM 6495 C  C1  . EDO FA 10 .   ? 16.106  23.413 -17.585 1.00 35.82 ? 1028 EDO A C1  1 
HETATM 6496 O  O1  . EDO FA 10 .   ? 16.551  24.600 -18.227 1.00 26.53 ? 1028 EDO A O1  1 
HETATM 6497 C  C2  . EDO FA 10 .   ? 14.711  23.058 -18.075 1.00 34.46 ? 1028 EDO A C2  1 
HETATM 6498 O  O2  . EDO FA 10 .   ? 14.113  22.147 -17.161 1.00 40.95 ? 1028 EDO A O2  1 
HETATM 6499 C  C1  . EDO GA 10 .   ? 3.995   16.617 -6.379  1.00 41.94 ? 1029 EDO A C1  1 
HETATM 6500 O  O1  . EDO GA 10 .   ? 3.064   17.485 -7.040  1.00 43.54 ? 1029 EDO A O1  1 
HETATM 6501 C  C2  . EDO GA 10 .   ? 3.601   16.425 -4.918  1.00 33.22 ? 1029 EDO A C2  1 
HETATM 6502 O  O2  . EDO GA 10 .   ? 4.591   15.608 -4.282  1.00 33.93 ? 1029 EDO A O2  1 
HETATM 6503 O  O   . HOH HA 11 .   ? 23.308  37.354 -7.569  1.00 19.67 ? 1    HOH A O   1 
HETATM 6504 O  O   . HOH HA 11 .   ? 8.938   43.789 0.175   1.00 18.40 ? 2    HOH A O   1 
HETATM 6505 O  O   . HOH HA 11 .   ? 17.880  33.916 -6.793  1.00 18.67 ? 3    HOH A O   1 
HETATM 6506 O  O   . HOH HA 11 .   ? 21.875  43.118 -11.374 1.00 21.43 ? 4    HOH A O   1 
HETATM 6507 O  O   . HOH HA 11 .   ? 8.897   31.748 -7.163  1.00 21.37 ? 5    HOH A O   1 
HETATM 6508 O  O   . HOH HA 11 .   ? 10.654  36.889 -3.225  1.00 17.60 ? 6    HOH A O   1 
HETATM 6509 O  O   . HOH HA 11 .   ? 31.781  49.145 3.131   1.00 16.77 ? 7    HOH A O   1 
HETATM 6510 O  O   . HOH HA 11 .   ? 47.654  46.133 -13.002 1.00 35.47 ? 8    HOH A O   1 
HETATM 6511 O  O   . HOH HA 11 .   ? 38.188  63.316 -24.147 1.00 35.95 ? 9    HOH A O   1 
HETATM 6512 O  O   . HOH HA 11 .   ? 43.409  31.340 -11.723 1.00 29.37 ? 10   HOH A O   1 
HETATM 6513 O  O   . HOH HA 11 .   ? 27.937  44.188 -4.994  1.00 18.17 ? 11   HOH A O   1 
HETATM 6514 O  O   . HOH HA 11 .   ? 38.143  46.298 15.626  1.00 23.91 ? 12   HOH A O   1 
HETATM 6515 O  O   . HOH HA 11 .   ? 22.438  44.229 -0.496  1.00 14.27 ? 13   HOH A O   1 
HETATM 6516 O  O   . HOH HA 11 .   ? 5.759   46.803 11.542  1.00 27.63 ? 14   HOH A O   1 
HETATM 6517 O  O   . HOH HA 11 .   ? -2.715  23.505 -0.505  1.00 31.07 ? 15   HOH A O   1 
HETATM 6518 O  O   . HOH HA 11 .   ? 36.441  44.572 -8.955  1.00 20.28 ? 16   HOH A O   1 
HETATM 6519 O  O   . HOH HA 11 .   ? 24.545  47.520 -6.320  1.00 18.40 ? 17   HOH A O   1 
HETATM 6520 O  O   . HOH HA 11 .   ? 43.023  34.620 -41.515 1.00 51.75 ? 18   HOH A O   1 
HETATM 6521 O  O   . HOH HA 11 .   ? 20.573  55.318 0.179   1.00 22.33 ? 19   HOH A O   1 
HETATM 6522 O  O   . HOH HA 11 .   ? 45.994  34.453 -23.223 1.00 40.09 ? 20   HOH A O   1 
HETATM 6523 O  O   . HOH HA 11 .   ? 19.536  17.893 -20.510 1.00 34.43 ? 21   HOH A O   1 
HETATM 6524 O  O   . HOH HA 11 .   ? 12.497  36.452 0.664   1.00 16.93 ? 22   HOH A O   1 
HETATM 6525 O  O   . HOH HA 11 .   ? 24.302  12.154 14.196  1.00 39.82 ? 23   HOH A O   1 
HETATM 6526 O  O   . HOH HA 11 .   ? 27.189  51.698 8.149   1.00 17.82 ? 24   HOH A O   1 
HETATM 6527 O  O   . HOH HA 11 .   ? 44.132  38.156 -4.974  1.00 24.48 ? 25   HOH A O   1 
HETATM 6528 O  O   . HOH HA 11 .   ? 31.905  58.633 9.915   1.00 29.18 ? 26   HOH A O   1 
HETATM 6529 O  O   . HOH HA 11 .   ? 33.837  37.533 2.891   1.00 18.47 ? 27   HOH A O   1 
HETATM 6530 O  O   . HOH HA 11 .   ? 15.225  30.485 -7.668  1.00 20.36 ? 28   HOH A O   1 
HETATM 6531 O  O   . HOH HA 11 .   ? 24.507  45.306 19.136  1.00 42.55 ? 29   HOH A O   1 
HETATM 6532 O  O   . HOH HA 11 .   ? 43.774  31.185 -14.452 1.00 30.72 ? 30   HOH A O   1 
HETATM 6533 O  O   . HOH HA 11 .   ? 30.816  40.780 -10.672 1.00 19.05 ? 31   HOH A O   1 
HETATM 6534 O  O   . HOH HA 11 .   ? 34.165  48.683 -13.100 1.00 34.11 ? 32   HOH A O   1 
HETATM 6535 O  O   . HOH HA 11 .   ? 18.905  46.450 -5.402  1.00 19.02 ? 33   HOH A O   1 
HETATM 6536 O  O   . HOH HA 11 .   ? 3.891   34.782 15.172  1.00 23.10 ? 34   HOH A O   1 
HETATM 6537 O  O   . HOH HA 11 .   ? 6.806   14.833 17.948  1.00 29.01 ? 35   HOH A O   1 
HETATM 6538 O  O   . HOH HA 11 .   ? -14.601 25.582 7.051   1.00 43.66 ? 867  HOH A O   1 
HETATM 6539 O  O   . HOH HA 11 .   ? 0.487   19.944 7.279   1.00 26.99 ? 868  HOH A O   1 
HETATM 6540 O  O   . HOH HA 11 .   ? 33.508  39.809 4.304   1.00 15.95 ? 869  HOH A O   1 
HETATM 6541 O  O   . HOH HA 11 .   ? 43.606  43.210 -3.991  1.00 20.60 ? 870  HOH A O   1 
HETATM 6542 O  O   . HOH HA 11 .   ? 5.728   27.285 -16.387 1.00 29.39 ? 871  HOH A O   1 
HETATM 6543 O  O   . HOH HA 11 .   ? 39.016  38.055 16.317  1.00 31.77 ? 872  HOH A O   1 
HETATM 6544 O  O   . HOH HA 11 .   ? 42.218  41.504 -11.498 1.00 20.96 ? 873  HOH A O   1 
HETATM 6545 O  O   . HOH HA 11 .   ? 15.506  52.228 4.564   1.00 29.92 ? 874  HOH A O   1 
HETATM 6546 O  O   . HOH HA 11 .   ? 23.802  39.058 -1.146  1.00 21.43 ? 875  HOH A O   1 
HETATM 6547 O  O   . HOH HA 11 .   ? 16.905  21.879 -24.655 1.00 39.55 ? 876  HOH A O   1 
HETATM 6548 O  O   . HOH HA 11 .   ? 19.852  51.814 -21.860 1.00 36.68 ? 877  HOH A O   1 
HETATM 6549 O  O   . HOH HA 11 .   ? 29.444  46.251 -6.264  1.00 17.53 ? 878  HOH A O   1 
HETATM 6550 O  O   . HOH HA 11 .   ? 47.446  41.564 10.532  1.00 27.64 ? 879  HOH A O   1 
HETATM 6551 O  O   . HOH HA 11 .   ? 28.073  27.806 -2.274  1.00 27.17 ? 880  HOH A O   1 
HETATM 6552 O  O   . HOH HA 11 .   ? 27.942  54.844 7.172   1.00 22.71 ? 881  HOH A O   1 
HETATM 6553 O  O   . HOH HA 11 .   ? 15.658  36.737 -8.390  1.00 21.16 ? 882  HOH A O   1 
HETATM 6554 O  O   . HOH HA 11 .   ? 14.939  42.546 -8.892  1.00 21.21 ? 883  HOH A O   1 
HETATM 6555 O  O   . HOH HA 11 .   ? 48.368  38.690 10.555  1.00 40.61 ? 884  HOH A O   1 
HETATM 6556 O  O   . HOH HA 11 .   ? 47.647  44.113 -15.609 1.00 33.05 ? 885  HOH A O   1 
HETATM 6557 O  O   . HOH HA 11 .   ? 31.086  47.286 -32.099 1.00 33.04 ? 886  HOH A O   1 
HETATM 6558 O  O   . HOH HA 11 .   ? 38.440  48.850 -5.337  1.00 24.88 ? 887  HOH A O   1 
HETATM 6559 O  O   . HOH HA 11 .   ? 44.621  42.893 -1.415  1.00 21.46 ? 888  HOH A O   1 
HETATM 6560 O  O   . HOH HA 11 .   ? 12.711  34.619 -20.773 1.00 31.72 ? 889  HOH A O   1 
HETATM 6561 O  O   . HOH HA 11 .   ? 31.854  45.359 -9.669  1.00 20.85 ? 890  HOH A O   1 
HETATM 6562 O  O   . HOH HA 11 .   ? 22.081  28.588 -7.255  1.00 25.99 ? 891  HOH A O   1 
HETATM 6563 O  O   . HOH HA 11 .   ? 19.590  49.077 -6.672  1.00 21.25 ? 892  HOH A O   1 
HETATM 6564 O  O   . HOH HA 11 .   ? 5.084   8.420  20.569  1.00 38.77 ? 893  HOH A O   1 
HETATM 6565 O  O   . HOH HA 11 .   ? 15.941  12.802 1.562   1.00 26.79 ? 894  HOH A O   1 
HETATM 6566 O  O   . HOH HA 11 .   ? 20.979  45.994 -23.677 1.00 30.96 ? 895  HOH A O   1 
HETATM 6567 O  O   . HOH HA 11 .   ? 38.238  38.703 -3.406  1.00 22.32 ? 896  HOH A O   1 
HETATM 6568 O  O   . HOH HA 11 .   ? 17.282  39.862 -8.471  1.00 18.84 ? 897  HOH A O   1 
HETATM 6569 O  O   . HOH HA 11 .   ? 36.488  51.282 15.106  1.00 27.93 ? 906  HOH A O   1 
HETATM 6570 O  O   . HOH HA 11 .   ? 38.942  29.408 -26.362 1.00 41.97 ? 909  HOH A O   1 
HETATM 6571 O  O   . HOH HA 11 .   ? 30.710  50.018 -39.882 1.00 44.13 ? 910  HOH A O   1 
HETATM 6572 O  O   . HOH HA 11 .   ? 26.781  35.483 -4.259  1.00 17.63 ? 911  HOH A O   1 
HETATM 6573 O  O   . HOH HA 11 .   ? 33.042  36.046 -25.876 1.00 31.90 ? 912  HOH A O   1 
HETATM 6574 O  O   . HOH HA 11 .   ? 31.518  50.238 -34.360 1.00 38.81 ? 913  HOH A O   1 
HETATM 6575 O  O   . HOH HA 11 .   ? 50.605  48.635 4.293   1.00 28.39 ? 914  HOH A O   1 
HETATM 6576 O  O   . HOH HA 11 .   ? 29.301  38.751 -9.463  1.00 19.52 ? 915  HOH A O   1 
HETATM 6577 O  O   . HOH HA 11 .   ? 11.302  44.535 -8.390  1.00 26.94 ? 916  HOH A O   1 
HETATM 6578 O  O   . HOH HA 11 .   ? 17.567  14.598 20.237  1.00 30.27 ? 917  HOH A O   1 
HETATM 6579 O  O   . HOH HA 11 .   ? 26.389  60.431 -20.457 1.00 35.92 ? 918  HOH A O   1 
HETATM 6580 O  O   . HOH HA 11 .   ? 18.252  22.877 3.803   1.00 24.02 ? 919  HOH A O   1 
HETATM 6581 O  O   . HOH HA 11 .   ? 25.670  27.592 14.711  1.00 20.03 ? 920  HOH A O   1 
HETATM 6582 O  O   . HOH HA 11 .   ? 22.495  45.567 -7.303  1.00 19.68 ? 921  HOH A O   1 
HETATM 6583 O  O   . HOH HA 11 .   ? 47.512  44.289 -6.500  1.00 30.90 ? 922  HOH A O   1 
HETATM 6584 O  O   . HOH HA 11 .   ? 20.827  36.918 -3.154  1.00 20.69 ? 923  HOH A O   1 
HETATM 6585 O  O   . HOH HA 11 .   ? 41.640  45.116 -10.257 1.00 21.05 ? 924  HOH A O   1 
HETATM 6586 O  O   . HOH HA 11 .   ? 24.536  31.606 -14.674 1.00 22.77 ? 925  HOH A O   1 
HETATM 6587 O  O   . HOH HA 11 .   ? 46.421  54.842 16.190  1.00 44.70 ? 926  HOH A O   1 
HETATM 6588 O  O   . HOH HA 11 .   ? 34.260  23.275 21.021  1.00 32.47 ? 927  HOH A O   1 
HETATM 6589 O  O   . HOH HA 11 .   ? 16.759  49.884 -4.156  1.00 20.97 ? 928  HOH A O   1 
HETATM 6590 O  O   . HOH HA 11 .   ? 24.391  31.101 -23.639 1.00 30.49 ? 929  HOH A O   1 
HETATM 6591 O  O   . HOH HA 11 .   ? 25.739  29.232 -2.292  1.00 24.09 ? 930  HOH A O   1 
HETATM 6592 O  O   . HOH HA 11 .   ? 43.966  40.339 -0.709  1.00 19.39 ? 931  HOH A O   1 
HETATM 6593 O  O   . HOH HA 11 .   ? 35.894  31.999 -5.576  1.00 34.84 ? 932  HOH A O   1 
HETATM 6594 O  O   . HOH HA 11 .   ? 23.391  51.754 -39.955 1.00 45.06 ? 933  HOH A O   1 
HETATM 6595 O  O   . HOH HA 11 .   ? 30.962  30.081 -33.619 1.00 45.51 ? 934  HOH A O   1 
HETATM 6596 O  O   . HOH HA 11 .   ? 23.346  41.776 -0.327  1.00 17.16 ? 935  HOH A O   1 
HETATM 6597 O  O   . HOH HA 11 .   ? 19.751  50.081 17.948  1.00 31.20 ? 936  HOH A O   1 
HETATM 6598 O  O   . HOH HA 11 .   ? 28.528  20.383 10.700  1.00 42.61 ? 937  HOH A O   1 
HETATM 6599 O  O   . HOH HA 11 .   ? 39.835  43.033 -11.122 1.00 23.18 ? 938  HOH A O   1 
HETATM 6600 O  O   . HOH HA 11 .   ? 1.554   15.818 9.565   1.00 28.16 ? 939  HOH A O   1 
HETATM 6601 O  O   . HOH HA 11 .   ? 30.161  31.163 -13.381 1.00 28.50 ? 940  HOH A O   1 
HETATM 6602 O  O   . HOH HA 11 .   ? 36.946  32.976 1.657   1.00 25.66 ? 941  HOH A O   1 
HETATM 6603 O  O   . HOH HA 11 .   ? 26.846  46.650 -7.389  1.00 18.72 ? 942  HOH A O   1 
HETATM 6604 O  O   . HOH HA 11 .   ? 38.213  56.414 -21.394 1.00 35.60 ? 943  HOH A O   1 
HETATM 6605 O  O   . HOH HA 11 .   ? 15.920  34.691 -25.852 1.00 33.28 ? 944  HOH A O   1 
HETATM 6606 O  O   . HOH HA 11 .   ? 20.348  35.324 -1.123  1.00 18.96 ? 945  HOH A O   1 
HETATM 6607 O  O   . HOH HA 11 .   ? 5.731   27.605 -20.133 1.00 33.81 ? 946  HOH A O   1 
HETATM 6608 O  O   . HOH HA 11 .   ? 3.868   22.786 26.401  1.00 30.13 ? 947  HOH A O   1 
HETATM 6609 O  O   . HOH HA 11 .   ? 42.926  58.776 6.172   1.00 33.29 ? 948  HOH A O   1 
HETATM 6610 O  O   . HOH HA 11 .   ? 27.157  25.967 -7.727  1.00 33.26 ? 949  HOH A O   1 
HETATM 6611 O  O   . HOH HA 11 .   ? 14.448  40.100 -18.319 1.00 32.07 ? 950  HOH A O   1 
HETATM 6612 O  O   . HOH HA 11 .   ? 19.653  59.326 -20.986 1.00 46.21 ? 951  HOH A O   1 
HETATM 6613 O  O   . HOH HA 11 .   ? 46.915  43.489 -22.419 1.00 33.73 ? 952  HOH A O   1 
HETATM 6614 O  O   . HOH HA 11 .   ? -9.399  13.419 37.061  1.00 57.34 ? 953  HOH A O   1 
HETATM 6615 O  O   . HOH HA 11 .   ? -0.170  28.384 3.884   1.00 22.50 ? 954  HOH A O   1 
HETATM 6616 O  O   . HOH HA 11 .   ? 44.527  53.756 -3.917  1.00 32.04 ? 955  HOH A O   1 
HETATM 6617 O  O   . HOH HA 11 .   ? 14.847  60.879 10.191  1.00 39.50 ? 956  HOH A O   1 
HETATM 6618 O  O   . HOH HA 11 .   ? 2.487   5.678  12.361  1.00 44.87 ? 957  HOH A O   1 
HETATM 6619 O  O   . HOH HA 11 .   ? 14.222  47.944 -10.333 1.00 25.45 ? 958  HOH A O   1 
HETATM 6620 O  O   . HOH HA 11 .   ? 33.539  25.190 8.030   1.00 35.47 ? 959  HOH A O   1 
HETATM 6621 O  O   . HOH HA 11 .   ? 10.375  33.774 -5.887  1.00 19.82 ? 960  HOH A O   1 
HETATM 6622 O  O   . HOH HA 11 .   ? 41.516  41.265 -25.449 1.00 34.69 ? 961  HOH A O   1 
HETATM 6623 O  O   . HOH HA 11 .   ? 26.769  31.437 -12.593 1.00 22.05 ? 962  HOH A O   1 
HETATM 6624 O  O   . HOH HA 11 .   ? 22.304  32.064 -27.759 1.00 37.00 ? 963  HOH A O   1 
HETATM 6625 O  O   . HOH HA 11 .   ? 31.949  39.462 12.926  1.00 25.51 ? 964  HOH A O   1 
HETATM 6626 O  O   . HOH HA 11 .   ? 15.951  60.159 4.654   1.00 40.82 ? 965  HOH A O   1 
HETATM 6627 O  O   . HOH HA 11 .   ? 22.674  57.159 17.197  1.00 31.45 ? 966  HOH A O   1 
HETATM 6628 O  O   . HOH HA 11 .   ? 18.681  33.264 5.093   1.00 19.47 ? 967  HOH A O   1 
HETATM 6629 O  O   . HOH HA 11 .   ? 29.710  48.544 -10.179 1.00 22.41 ? 968  HOH A O   1 
HETATM 6630 O  O   . HOH HA 11 .   ? 23.788  57.411 -32.137 1.00 45.28 ? 969  HOH A O   1 
HETATM 6631 O  O   . HOH HA 11 .   ? 12.604  11.307 12.470  1.00 30.24 ? 970  HOH A O   1 
HETATM 6632 O  O   . HOH HA 11 .   ? 11.487  29.023 -23.423 1.00 38.71 ? 971  HOH A O   1 
HETATM 6633 O  O   . HOH HA 11 .   ? 45.646  59.768 -24.006 1.00 47.66 ? 972  HOH A O   1 
HETATM 6634 O  O   . HOH HA 11 .   ? 13.844  29.559 25.800  1.00 36.67 ? 973  HOH A O   1 
HETATM 6635 O  O   . HOH HA 11 .   ? 15.760  48.851 -33.185 1.00 40.49 ? 974  HOH A O   1 
HETATM 6636 O  O   . HOH HA 11 .   ? 15.207  25.296 -6.153  1.00 27.40 ? 975  HOH A O   1 
HETATM 6637 O  O   . HOH HA 11 .   ? 40.733  49.825 -10.857 1.00 30.09 ? 976  HOH A O   1 
HETATM 6638 O  O   . HOH HA 11 .   ? 7.719   18.809 25.949  1.00 38.16 ? 977  HOH A O   1 
HETATM 6639 O  O   . HOH HA 11 .   ? -10.416 18.232 20.462  1.00 53.17 ? 978  HOH A O   1 
HETATM 6640 O  O   . HOH HA 11 .   ? 25.802  57.488 -13.449 1.00 33.82 ? 979  HOH A O   1 
HETATM 6641 O  O   . HOH HA 11 .   ? 24.199  48.101 -19.441 1.00 23.94 ? 980  HOH A O   1 
HETATM 6642 O  O   . HOH HA 11 .   ? 18.236  27.973 -9.450  1.00 33.64 ? 981  HOH A O   1 
HETATM 6643 O  O   . HOH HA 11 .   ? 3.597   14.156 5.053   1.00 40.00 ? 982  HOH A O   1 
HETATM 6644 O  O   . HOH HA 11 .   ? 6.570   30.521 -6.789  1.00 28.54 ? 983  HOH A O   1 
HETATM 6645 O  O   . HOH HA 11 .   ? 5.104   17.738 23.203  1.00 28.36 ? 984  HOH A O   1 
HETATM 6646 O  O   . HOH HA 11 .   ? 8.016   36.431 -12.757 1.00 34.85 ? 985  HOH A O   1 
HETATM 6647 O  O   . HOH HA 11 .   ? 46.874  45.383 -24.467 1.00 38.19 ? 986  HOH A O   1 
HETATM 6648 O  O   . HOH HA 11 .   ? 22.444  11.101 19.256  1.00 37.65 ? 987  HOH A O   1 
HETATM 6649 O  O   . HOH HA 11 .   ? 42.100  37.780 0.977   1.00 33.89 ? 988  HOH A O   1 
HETATM 6650 O  O   . HOH HA 11 .   ? 20.472  55.398 -4.438  1.00 35.61 ? 989  HOH A O   1 
HETATM 6651 O  O   . HOH HA 11 .   ? 32.647  57.252 14.343  1.00 27.42 ? 990  HOH A O   1 
HETATM 6652 O  O   . HOH HA 11 .   ? 17.176  50.296 -6.991  1.00 24.64 ? 991  HOH A O   1 
HETATM 6653 O  O   . HOH HA 11 .   ? 49.732  43.299 -12.527 1.00 40.27 ? 992  HOH A O   1 
HETATM 6654 O  O   . HOH HA 11 .   ? 30.267  42.223 -36.484 1.00 38.01 ? 993  HOH A O   1 
HETATM 6655 O  O   . HOH HA 11 .   ? 42.986  36.498 -9.408  1.00 31.20 ? 994  HOH A O   1 
HETATM 6656 O  O   . HOH HA 11 .   ? 26.964  20.098 -20.779 1.00 34.51 ? 995  HOH A O   1 
HETATM 6657 O  O   . HOH HA 11 .   ? 34.978  35.782 -0.832  1.00 30.34 ? 996  HOH A O   1 
HETATM 6658 O  O   . HOH HA 11 .   ? 34.259  23.712 15.342  1.00 33.38 ? 997  HOH A O   1 
HETATM 6659 O  O   . HOH HA 11 .   ? 4.224   44.312 -7.056  1.00 36.58 ? 998  HOH A O   1 
HETATM 6660 O  O   . HOH HA 11 .   ? 12.507  15.702 1.141   1.00 24.65 ? 999  HOH A O   1 
HETATM 6661 O  O   . HOH HA 11 .   ? 26.136  19.907 -24.020 1.00 36.51 ? 1000 HOH A O   1 
HETATM 6662 O  O   . HOH HA 11 .   ? 5.610   24.445 24.708  1.00 31.22 ? 1030 HOH A O   1 
HETATM 6663 O  O   . HOH HA 11 .   ? -5.958  30.532 10.317  1.00 32.85 ? 1031 HOH A O   1 
HETATM 6664 O  O   . HOH HA 11 .   ? 26.498  18.779 23.318  1.00 34.42 ? 1032 HOH A O   1 
HETATM 6665 O  O   . HOH HA 11 .   ? 31.956  54.585 -3.964  1.00 44.45 ? 1033 HOH A O   1 
HETATM 6666 O  O   . HOH HA 11 .   ? 28.741  55.447 1.033   1.00 25.24 ? 1034 HOH A O   1 
HETATM 6667 O  O   . HOH HA 11 .   ? 12.514  10.467 9.545   1.00 42.60 ? 1035 HOH A O   1 
HETATM 6668 O  O   . HOH HA 11 .   ? -1.379  45.103 23.714  1.00 49.29 ? 1036 HOH A O   1 
HETATM 6669 O  O   . HOH HA 11 .   ? -0.683  32.589 -11.329 1.00 38.49 ? 1037 HOH A O   1 
HETATM 6670 O  O   . HOH HA 11 .   ? 26.342  16.234 17.052  1.00 42.03 ? 1038 HOH A O   1 
HETATM 6671 O  O   . HOH HA 11 .   ? 21.799  23.771 -25.310 1.00 37.08 ? 1039 HOH A O   1 
HETATM 6672 O  O   . HOH HA 11 .   ? -1.520  24.127 23.611  1.00 37.64 ? 1040 HOH A O   1 
HETATM 6673 O  O   . HOH HA 11 .   ? 20.184  30.570 -7.115  1.00 28.66 ? 1041 HOH A O   1 
HETATM 6674 O  O   . HOH HA 11 .   ? 18.814  16.462 -23.005 1.00 41.92 ? 1042 HOH A O   1 
HETATM 6675 O  O   . HOH HA 11 .   ? 15.759  16.388 21.549  1.00 29.62 ? 1043 HOH A O   1 
HETATM 6676 O  O   . HOH HA 11 .   ? 10.435  24.824 23.320  1.00 34.16 ? 1044 HOH A O   1 
HETATM 6677 O  O   . HOH HA 11 .   ? 28.228  55.088 4.529   1.00 27.65 ? 1045 HOH A O   1 
HETATM 6678 O  O   . HOH HA 11 .   ? 23.561  37.585 -3.488  1.00 21.16 ? 1046 HOH A O   1 
HETATM 6679 O  O   . HOH HA 11 .   ? 13.544  15.606 19.979  1.00 26.28 ? 1047 HOH A O   1 
HETATM 6680 O  O   . HOH HA 11 .   ? 42.601  29.685 -39.254 1.00 61.66 ? 1048 HOH A O   1 
HETATM 6681 O  O   . HOH HA 11 .   ? 1.945   17.678 0.217   1.00 30.40 ? 1049 HOH A O   1 
HETATM 6682 O  O   . HOH HA 11 .   ? 17.429  50.967 -15.853 1.00 31.22 ? 1050 HOH A O   1 
HETATM 6683 O  O   . HOH HA 11 .   ? 39.642  34.410 -4.627  1.00 37.56 ? 1051 HOH A O   1 
HETATM 6684 O  O   . HOH HA 11 .   ? 24.163  35.658 -5.456  1.00 20.41 ? 1052 HOH A O   1 
HETATM 6685 O  O   . HOH HA 11 .   ? -1.173  33.196 -8.437  1.00 34.89 ? 1053 HOH A O   1 
HETATM 6686 O  O   . HOH HA 11 .   ? 29.729  40.992 -31.971 1.00 35.45 ? 1054 HOH A O   1 
HETATM 6687 O  O   . HOH HA 11 .   ? 15.319  10.022 7.605   1.00 42.55 ? 1055 HOH A O   1 
HETATM 6688 O  O   . HOH HA 11 .   ? 36.858  60.491 -22.593 1.00 39.30 ? 1056 HOH A O   1 
HETATM 6689 O  O   . HOH HA 11 .   ? 1.361   44.011 -3.287  1.00 34.16 ? 1057 HOH A O   1 
HETATM 6690 O  O   . HOH HA 11 .   ? -4.894  18.261 10.042  1.00 31.32 ? 1058 HOH A O   1 
HETATM 6691 O  O   . HOH HA 11 .   ? 8.771   43.567 -9.436  1.00 35.54 ? 1059 HOH A O   1 
HETATM 6692 O  O   . HOH HA 11 .   ? 38.074  32.960 -6.558  1.00 26.42 ? 1060 HOH A O   1 
HETATM 6693 O  O   . HOH HA 11 .   ? 51.361  39.978 -8.628  1.00 36.05 ? 1061 HOH A O   1 
HETATM 6694 O  O   . HOH HA 11 .   ? 30.010  50.963 -11.069 1.00 28.32 ? 1062 HOH A O   1 
HETATM 6695 O  O   . HOH HA 11 .   ? 45.653  38.389 -0.634  1.00 33.84 ? 1063 HOH A O   1 
HETATM 6696 O  O   . HOH HA 11 .   ? 2.576   23.636 33.744  1.00 38.34 ? 1064 HOH A O   1 
HETATM 6697 O  O   . HOH HA 11 .   ? 10.434  51.196 0.683   1.00 36.75 ? 1065 HOH A O   1 
HETATM 6698 O  O   . HOH HA 11 .   ? 4.232   19.944 35.148  1.00 41.24 ? 1066 HOH A O   1 
HETATM 6699 O  O   . HOH HA 11 .   ? 29.780  56.993 4.392   1.00 40.33 ? 1067 HOH A O   1 
HETATM 6700 O  O   . HOH HA 11 .   ? 0.571   44.919 -0.280  1.00 31.37 ? 1068 HOH A O   1 
HETATM 6701 O  O   . HOH HA 11 .   ? -9.360  28.271 15.848  1.00 34.24 ? 1069 HOH A O   1 
HETATM 6702 O  O   . HOH HA 11 .   ? 27.111  41.069 14.781  1.00 34.40 ? 1070 HOH A O   1 
HETATM 6703 O  O   . HOH HA 11 .   ? 13.939  40.047 -10.004 1.00 26.84 ? 1071 HOH A O   1 
HETATM 6704 O  O   . HOH HA 11 .   ? 0.697   39.901 20.701  1.00 38.22 ? 1072 HOH A O   1 
HETATM 6705 O  O   . HOH HA 11 .   ? 28.699  42.458 -34.167 1.00 36.40 ? 1073 HOH A O   1 
HETATM 6706 O  O   . HOH HA 11 .   ? 12.647  52.574 -22.519 1.00 39.23 ? 1074 HOH A O   1 
HETATM 6707 O  O   . HOH HA 11 .   ? 57.082  55.920 3.891   1.00 47.14 ? 1075 HOH A O   1 
HETATM 6708 O  O   . HOH HA 11 .   ? 40.501  48.821 -42.382 1.00 54.15 ? 1076 HOH A O   1 
HETATM 6709 O  O   . HOH HA 11 .   ? -14.342 29.362 15.811  1.00 39.01 ? 1077 HOH A O   1 
HETATM 6710 O  O   . HOH HA 11 .   ? 50.619  56.039 2.365   1.00 34.18 ? 1078 HOH A O   1 
HETATM 6711 O  O   . HOH HA 11 .   ? 28.802  38.101 14.184  1.00 32.02 ? 1079 HOH A O   1 
HETATM 6712 O  O   . HOH HA 11 .   ? -4.733  39.782 -2.058  1.00 34.02 ? 1080 HOH A O   1 
HETATM 6713 O  O   . HOH HA 11 .   ? 24.035  44.896 -23.281 1.00 33.39 ? 1081 HOH A O   1 
HETATM 6714 O  O   . HOH HA 11 .   ? -1.909  22.015 21.610  1.00 35.68 ? 1082 HOH A O   1 
HETATM 6715 O  O   . HOH HA 11 .   ? 47.927  45.460 -10.421 1.00 39.74 ? 1083 HOH A O   1 
HETATM 6716 O  O   . HOH HA 11 .   ? 18.589  10.541 9.755   1.00 38.19 ? 1084 HOH A O   1 
HETATM 6717 O  O   . HOH HA 11 .   ? -2.322  41.470 10.528  1.00 33.88 ? 1085 HOH A O   1 
HETATM 6718 O  O   . HOH HA 11 .   ? 10.156  26.359 -11.177 1.00 28.74 ? 1086 HOH A O   1 
HETATM 6719 O  O   . HOH HA 11 .   ? -7.336  44.849 1.482   1.00 29.29 ? 1087 HOH A O   1 
HETATM 6720 O  O   . HOH HA 11 .   ? 46.484  55.751 8.665   1.00 40.34 ? 1088 HOH A O   1 
HETATM 6721 O  O   . HOH HA 11 .   ? 18.461  22.937 -15.431 1.00 38.25 ? 1089 HOH A O   1 
HETATM 6722 O  O   . HOH HA 11 .   ? 45.567  36.703 -7.865  1.00 31.78 ? 1090 HOH A O   1 
HETATM 6723 O  O   . HOH HA 11 .   ? 16.839  46.562 -15.890 1.00 33.43 ? 1091 HOH A O   1 
HETATM 6724 O  O   . HOH HA 11 .   ? 45.143  48.941 -18.262 1.00 28.77 ? 1092 HOH A O   1 
HETATM 6725 O  O   . HOH HA 11 .   ? 28.716  44.841 5.753   1.00 30.56 ? 1093 HOH A O   1 
HETATM 6726 O  O   . HOH HA 11 .   ? 20.399  25.076 23.878  1.00 42.00 ? 1094 HOH A O   1 
HETATM 6727 O  O   . HOH HA 11 .   ? 15.820  27.654 -7.626  1.00 27.47 ? 1095 HOH A O   1 
HETATM 6728 O  O   . HOH HA 11 .   ? 23.658  40.669 -41.412 1.00 46.30 ? 1096 HOH A O   1 
HETATM 6729 O  O   . HOH HA 11 .   ? 28.917  19.808 15.402  1.00 34.44 ? 1097 HOH A O   1 
HETATM 6730 O  O   . HOH HA 11 .   ? 45.517  41.066 -25.385 1.00 43.29 ? 1098 HOH A O   1 
HETATM 6731 O  O   . HOH HA 11 .   ? -0.583  25.300 -9.091  1.00 40.92 ? 1099 HOH A O   1 
HETATM 6732 O  O   . HOH HA 11 .   ? 35.647  62.651 4.432   1.00 41.08 ? 1100 HOH A O   1 
HETATM 6733 O  O   . HOH HA 11 .   ? 49.426  54.824 0.525   1.00 29.82 ? 1101 HOH A O   1 
HETATM 6734 O  O   . HOH HA 11 .   ? 50.251  31.680 -8.353  1.00 51.89 ? 1102 HOH A O   1 
HETATM 6735 O  O   . HOH HA 11 .   ? 10.065  48.525 -7.974  1.00 32.19 ? 1103 HOH A O   1 
HETATM 6736 O  O   . HOH HA 11 .   ? 8.683   25.830 -24.320 1.00 42.18 ? 1104 HOH A O   1 
HETATM 6737 O  O   . HOH HA 11 .   ? 45.923  51.158 -19.406 1.00 32.50 ? 1105 HOH A O   1 
HETATM 6738 O  O   . HOH HA 11 .   ? 26.556  55.482 -1.967  1.00 34.89 ? 1106 HOH A O   1 
HETATM 6739 O  O   . HOH HA 11 .   ? 7.154   40.430 -27.128 1.00 44.91 ? 1107 HOH A O   1 
HETATM 6740 O  O   . HOH HA 11 .   ? -7.225  30.836 22.173  1.00 37.96 ? 1108 HOH A O   1 
HETATM 6741 O  O   . HOH HA 11 .   ? 25.217  44.531 -8.126  1.00 23.19 ? 1109 HOH A O   1 
HETATM 6742 O  O   . HOH HA 11 .   ? 20.476  21.402 4.823   1.00 27.24 ? 1110 HOH A O   1 
HETATM 6743 O  O   . HOH HA 11 .   ? 40.048  56.467 -42.338 1.00 52.70 ? 1111 HOH A O   1 
HETATM 6744 O  O   . HOH HA 11 .   ? 35.345  62.553 -24.342 1.00 44.43 ? 1112 HOH A O   1 
HETATM 6745 O  O   . HOH HA 11 .   ? 23.862  11.956 6.813   1.00 51.25 ? 1113 HOH A O   1 
HETATM 6746 O  O   . HOH HA 11 .   ? 23.749  54.815 -6.724  1.00 36.20 ? 1114 HOH A O   1 
HETATM 6747 O  O   . HOH HA 11 .   ? 11.410  15.829 21.655  1.00 33.88 ? 1115 HOH A O   1 
HETATM 6748 O  O   . HOH HA 11 .   ? 23.351  55.332 -2.481  1.00 34.61 ? 1116 HOH A O   1 
HETATM 6749 O  O   . HOH HA 11 .   ? 38.143  53.802 -41.934 1.00 52.52 ? 1117 HOH A O   1 
HETATM 6750 O  O   . HOH HA 11 .   ? 12.570  42.375 -14.282 1.00 44.47 ? 1118 HOH A O   1 
HETATM 6751 O  O   . HOH HA 11 .   ? -1.771  28.668 -8.621  1.00 41.13 ? 1119 HOH A O   1 
HETATM 6752 O  O   . HOH HA 11 .   ? 44.809  38.054 17.971  1.00 38.02 ? 1120 HOH A O   1 
HETATM 6753 O  O   . HOH HA 11 .   ? -6.794  36.276 8.232   1.00 31.31 ? 1121 HOH A O   1 
HETATM 6754 O  O   . HOH HA 11 .   ? 6.266   32.121 30.461  1.00 37.12 ? 1122 HOH A O   1 
HETATM 6755 O  O   . HOH HA 11 .   ? 5.053   24.962 -15.061 1.00 45.73 ? 1123 HOH A O   1 
HETATM 6756 O  O   . HOH HA 11 .   ? 45.880  37.009 -21.782 1.00 35.44 ? 1124 HOH A O   1 
HETATM 6757 O  O   . HOH HA 11 .   ? -6.317  43.974 7.646   1.00 37.19 ? 1125 HOH A O   1 
HETATM 6758 O  O   . HOH HA 11 .   ? 27.020  53.557 18.647  1.00 41.30 ? 1126 HOH A O   1 
HETATM 6759 O  O   . HOH HA 11 .   ? 39.614  30.072 -7.286  1.00 44.02 ? 1127 HOH A O   1 
HETATM 6760 O  O   . HOH HA 11 .   ? 40.633  30.194 5.323   1.00 27.92 ? 1128 HOH A O   1 
HETATM 6761 O  O   . HOH HA 11 .   ? 36.037  26.849 5.456   1.00 40.57 ? 1129 HOH A O   1 
HETATM 6762 O  O   . HOH HA 11 .   ? 35.583  24.838 -15.902 1.00 50.45 ? 1130 HOH A O   1 
HETATM 6763 O  O   . HOH HA 11 .   ? -1.644  31.682 -4.150  1.00 36.33 ? 1131 HOH A O   1 
HETATM 6764 O  O   . HOH HA 11 .   ? 19.462  14.206 7.422   1.00 33.51 ? 1132 HOH A O   1 
HETATM 6765 O  O   . HOH HA 11 .   ? 19.565  32.356 -27.569 1.00 35.50 ? 1133 HOH A O   1 
HETATM 6766 O  O   . HOH HA 11 .   ? 0.393   34.005 28.339  1.00 39.68 ? 1134 HOH A O   1 
HETATM 6767 O  O   . HOH HA 11 .   ? 13.076  14.614 -5.348  1.00 33.90 ? 1135 HOH A O   1 
HETATM 6768 O  O   . HOH HA 11 .   ? 45.290  34.130 2.031   1.00 35.42 ? 1136 HOH A O   1 
HETATM 6769 O  O   . HOH HA 11 .   ? 8.735   33.368 31.344  1.00 33.57 ? 1137 HOH A O   1 
HETATM 6770 O  O   . HOH HA 11 .   ? 18.580  53.906 -6.514  1.00 36.89 ? 1138 HOH A O   1 
HETATM 6771 O  O   . HOH HA 11 .   ? 54.019  32.747 -14.031 1.00 47.36 ? 1139 HOH A O   1 
HETATM 6772 O  O   . HOH HA 11 .   ? 17.811  41.329 -29.666 1.00 36.52 ? 1140 HOH A O   1 
HETATM 6773 O  O   . HOH HA 11 .   ? -7.350  16.132 19.453  1.00 45.35 ? 1141 HOH A O   1 
HETATM 6774 O  O   . HOH HA 11 .   ? 7.620   23.509 -14.948 1.00 42.41 ? 1142 HOH A O   1 
HETATM 6775 O  O   . HOH HA 11 .   ? 33.505  23.470 -17.896 1.00 41.89 ? 1143 HOH A O   1 
HETATM 6776 O  O   . HOH HA 11 .   ? 14.937  45.517 -11.156 1.00 31.07 ? 1144 HOH A O   1 
HETATM 6777 O  O   . HOH HA 11 .   ? 11.625  40.912 -16.496 1.00 42.87 ? 1145 HOH A O   1 
HETATM 6778 O  O   . HOH HA 11 .   ? 8.961   14.961 19.862  1.00 36.85 ? 1146 HOH A O   1 
HETATM 6779 O  O   . HOH HA 11 .   ? 25.524  58.096 15.858  1.00 37.82 ? 1147 HOH A O   1 
HETATM 6780 O  O   . HOH HA 11 .   ? 50.255  51.362 13.019  1.00 38.24 ? 1148 HOH A O   1 
HETATM 6781 O  O   . HOH HA 11 .   ? 7.582   7.023  7.981   1.00 42.88 ? 1149 HOH A O   1 
HETATM 6782 O  O   . HOH HA 11 .   ? 24.640  57.411 -29.698 1.00 40.75 ? 1150 HOH A O   1 
HETATM 6783 O  O   . HOH HA 11 .   ? 24.858  22.910 -14.131 1.00 33.26 ? 1151 HOH A O   1 
HETATM 6784 O  O   . HOH HA 11 .   ? 35.091  60.330 -20.547 1.00 34.34 ? 1152 HOH A O   1 
HETATM 6785 O  O   . HOH HA 11 .   ? 27.011  24.104 5.263   1.00 29.23 ? 1153 HOH A O   1 
HETATM 6786 O  O   . HOH HA 11 .   ? 25.827  58.370 -33.824 1.00 45.27 ? 1154 HOH A O   1 
HETATM 6787 O  O   . HOH HA 11 .   ? 19.118  33.362 -24.837 1.00 34.53 ? 1155 HOH A O   1 
HETATM 6788 O  O   . HOH HA 11 .   ? 9.285   17.444 21.743  1.00 29.96 ? 1156 HOH A O   1 
HETATM 6789 O  O   . HOH HA 11 .   ? 35.250  33.226 -1.764  1.00 42.20 ? 1157 HOH A O   1 
HETATM 6790 O  O   . HOH HA 11 .   ? 5.038   19.526 26.295  1.00 34.64 ? 1158 HOH A O   1 
HETATM 6791 O  O   . HOH HA 11 .   ? 15.032  34.081 -32.499 1.00 44.39 ? 1159 HOH A O   1 
HETATM 6792 O  O   . HOH HA 11 .   ? 7.266   20.271 33.373  1.00 46.59 ? 1160 HOH A O   1 
HETATM 6793 O  O   . HOH HA 11 .   ? 46.681  48.233 20.180  1.00 40.60 ? 1161 HOH A O   1 
HETATM 6794 O  O   . HOH HA 11 .   ? 17.764  16.500 9.471   1.00 35.01 ? 1162 HOH A O   1 
HETATM 6795 O  O   . HOH HA 11 .   ? 12.951  24.213 -12.144 1.00 33.37 ? 1163 HOH A O   1 
HETATM 6796 O  O   . HOH HA 11 .   ? -11.316 26.507 15.434  1.00 37.32 ? 1164 HOH A O   1 
HETATM 6797 O  O   . HOH HA 11 .   ? 38.922  54.421 16.008  1.00 41.72 ? 1165 HOH A O   1 
HETATM 6798 O  O   . HOH HA 11 .   ? 45.557  30.321 -30.570 1.00 58.05 ? 1166 HOH A O   1 
HETATM 6799 O  O   . HOH HA 11 .   ? 45.810  34.053 -7.837  1.00 39.16 ? 1167 HOH A O   1 
HETATM 6800 O  O   . HOH HA 11 .   ? 22.725  58.934 -28.740 1.00 44.62 ? 1168 HOH A O   1 
HETATM 6801 O  O   . HOH HA 11 .   ? 8.003   8.743  10.958  1.00 43.90 ? 1169 HOH A O   1 
HETATM 6802 O  O   . HOH HA 11 .   ? 36.844  23.474 21.235  1.00 47.16 ? 1170 HOH A O   1 
HETATM 6803 O  O   . HOH HA 11 .   ? 30.475  43.450 12.790  1.00 31.59 ? 1171 HOH A O   1 
HETATM 6804 O  O   . HOH HA 11 .   ? 10.924  22.368 27.156  1.00 36.36 ? 1172 HOH A O   1 
HETATM 6805 O  O   . HOH HA 11 .   ? 1.595   8.464  1.803   1.00 43.87 ? 1173 HOH A O   1 
HETATM 6806 O  O   . HOH HA 11 .   ? 9.539   49.835 -4.335  1.00 39.73 ? 1174 HOH A O   1 
HETATM 6807 O  O   . HOH HA 11 .   ? 21.084  62.719 14.934  1.00 35.28 ? 1175 HOH A O   1 
HETATM 6808 O  O   . HOH HA 11 .   ? 49.563  46.477 15.108  1.00 30.82 ? 1176 HOH A O   1 
HETATM 6809 O  O   . HOH HA 11 .   ? 43.297  58.326 -22.570 1.00 38.86 ? 1177 HOH A O   1 
HETATM 6810 O  O   . HOH HA 11 .   ? 48.481  51.188 -20.277 1.00 43.12 ? 1178 HOH A O   1 
HETATM 6811 O  O   . HOH HA 11 .   ? 44.732  31.052 3.895   1.00 41.38 ? 1179 HOH A O   1 
HETATM 6812 O  O   . HOH HA 11 .   ? -8.989  31.198 8.457   1.00 44.00 ? 1180 HOH A O   1 
HETATM 6813 O  O   . HOH HA 11 .   ? 26.862  62.571 8.806   1.00 39.52 ? 1181 HOH A O   1 
HETATM 6814 O  O   . HOH HA 11 .   ? 50.852  42.408 -8.953  1.00 41.34 ? 1182 HOH A O   1 
HETATM 6815 O  O   . HOH HA 11 .   ? -1.049  44.914 -4.332  1.00 44.58 ? 1183 HOH A O   1 
HETATM 6816 O  O   . HOH HA 11 .   ? 19.829  50.595 -39.473 1.00 48.06 ? 1184 HOH A O   1 
HETATM 6817 O  O   . HOH HA 11 .   ? 16.848  31.353 -32.929 1.00 45.57 ? 1185 HOH A O   1 
HETATM 6818 O  O   . HOH HA 11 .   ? 9.366   6.078  16.286  1.00 46.12 ? 1186 HOH A O   1 
HETATM 6819 O  O   . HOH HA 11 .   ? 8.713   54.604 14.215  1.00 39.30 ? 1187 HOH A O   1 
HETATM 6820 O  O   . HOH HA 11 .   ? -6.229  35.384 -2.241  1.00 44.29 ? 1188 HOH A O   1 
HETATM 6821 O  O   . HOH HA 11 .   ? 51.241  49.068 14.381  1.00 41.80 ? 1189 HOH A O   1 
HETATM 6822 O  O   . HOH HA 11 .   ? -8.655  18.679 11.116  1.00 35.78 ? 1190 HOH A O   1 
HETATM 6823 O  O   . HOH HA 11 .   ? -4.992  14.364 2.453   1.00 44.44 ? 1191 HOH A O   1 
HETATM 6824 O  O   . HOH HA 11 .   ? -0.599  28.640 28.768  1.00 36.38 ? 1192 HOH A O   1 
HETATM 6825 O  O   . HOH HA 11 .   ? 49.832  41.639 14.835  1.00 40.89 ? 1193 HOH A O   1 
HETATM 6826 O  O   . HOH HA 11 .   ? 32.101  56.834 17.106  1.00 39.61 ? 1194 HOH A O   1 
HETATM 6827 O  O   . HOH HA 11 .   ? 13.319  27.459 27.557  1.00 43.97 ? 1195 HOH A O   1 
HETATM 6828 O  O   . HOH HA 11 .   ? 5.828   38.656 -25.408 1.00 51.62 ? 1196 HOH A O   1 
HETATM 6829 O  O   . HOH HA 11 .   ? 22.123  33.780 19.238  1.00 31.81 ? 1197 HOH A O   1 
HETATM 6830 O  O   . HOH HA 11 .   ? 9.182   21.581 31.630  1.00 40.53 ? 1198 HOH A O   1 
HETATM 6831 O  O   . HOH HA 11 .   ? 50.762  35.060 -1.885  1.00 47.12 ? 1199 HOH A O   1 
HETATM 6832 O  O   . HOH HA 11 .   ? 22.730  60.525 16.849  1.00 49.60 ? 1200 HOH A O   1 
HETATM 6833 O  O   . HOH HA 11 .   ? 33.246  28.955 -34.599 1.00 49.98 ? 1201 HOH A O   1 
HETATM 6834 O  O   . HOH HA 11 .   ? 49.593  58.441 3.341   1.00 37.08 ? 1202 HOH A O   1 
HETATM 6835 O  O   . HOH HA 11 .   ? 39.757  28.643 -35.390 1.00 54.35 ? 1203 HOH A O   1 
HETATM 6836 O  O   . HOH HA 11 .   ? 6.243   27.463 -22.646 1.00 50.79 ? 1204 HOH A O   1 
HETATM 6837 O  O   . HOH HA 11 .   ? 27.110  57.342 1.955   1.00 32.45 ? 1205 HOH A O   1 
HETATM 6838 O  O   . HOH HA 11 .   ? 14.045  49.222 -12.827 1.00 34.94 ? 1206 HOH A O   1 
HETATM 6839 O  O   . HOH HA 11 .   ? 29.276  57.333 -1.705  1.00 40.87 ? 1207 HOH A O   1 
HETATM 6840 O  O   . HOH HA 11 .   ? 35.628  24.425 23.819  1.00 52.75 ? 1208 HOH A O   1 
HETATM 6841 O  O   . HOH HA 11 .   ? 49.022  34.013 -21.301 1.00 44.79 ? 1209 HOH A O   1 
HETATM 6842 O  O   . HOH HA 11 .   ? 15.948  49.067 -15.157 1.00 33.84 ? 1210 HOH A O   1 
HETATM 6843 O  O   . HOH HA 11 .   ? 40.338  51.105 -5.846  1.00 40.18 ? 1211 HOH A O   1 
HETATM 6844 O  O   . HOH HA 11 .   ? -5.352  35.551 0.711   1.00 35.73 ? 1212 HOH A O   1 
HETATM 6845 O  O   . HOH HA 11 .   ? 0.402   31.852 -6.586  1.00 36.62 ? 1213 HOH A O   1 
HETATM 6846 O  O   . HOH HA 11 .   ? 42.613  37.343 -1.893  1.00 38.07 ? 1214 HOH A O   1 
HETATM 6847 O  O   . HOH HA 11 .   ? 22.512  53.728 18.822  1.00 40.80 ? 1215 HOH A O   1 
HETATM 6848 O  O   . HOH HA 11 .   ? 39.048  33.653 -0.020  1.00 36.31 ? 1216 HOH A O   1 
HETATM 6849 O  O   . HOH HA 11 .   ? 30.472  28.950 -37.729 1.00 52.99 ? 1217 HOH A O   1 
HETATM 6850 O  O   . HOH HA 11 .   ? -3.684  33.800 37.888  1.00 57.69 ? 1218 HOH A O   1 
HETATM 6851 O  O   . HOH HA 11 .   ? 32.631  26.848 -15.462 1.00 46.14 ? 1219 HOH A O   1 
HETATM 6852 O  O   . HOH HA 11 .   ? -3.456  26.791 -7.807  1.00 49.13 ? 1220 HOH A O   1 
HETATM 6853 O  O   . HOH HA 11 .   ? 30.905  59.027 7.697   1.00 40.89 ? 1221 HOH A O   1 
HETATM 6854 O  O   . HOH HA 11 .   ? 32.140  28.499 -17.128 1.00 42.43 ? 1222 HOH A O   1 
HETATM 6855 O  O   . HOH HA 11 .   ? 6.439   11.095 26.162  1.00 44.20 ? 1223 HOH A O   1 
HETATM 6856 O  O   . HOH HA 11 .   ? 18.796  23.532 -26.828 1.00 44.42 ? 1224 HOH A O   1 
HETATM 6857 O  O   . HOH HA 11 .   ? 44.422  28.973 13.675  1.00 33.94 ? 1225 HOH A O   1 
HETATM 6858 O  O   . HOH HA 11 .   ? 42.236  29.086 7.032   1.00 36.15 ? 1226 HOH A O   1 
HETATM 6859 O  O   . HOH HA 11 .   ? -1.409  22.274 40.046  1.00 50.61 ? 1227 HOH A O   1 
HETATM 6860 O  O   . HOH HA 11 .   ? 15.003  8.675  4.844   1.00 40.88 ? 1228 HOH A O   1 
HETATM 6861 O  O   . HOH HA 11 .   ? 15.767  8.383  10.251  1.00 43.82 ? 1229 HOH A O   1 
HETATM 6862 O  O   . HOH HA 11 .   ? 31.869  26.001 -17.710 1.00 38.89 ? 1230 HOH A O   1 
HETATM 6863 O  O   . HOH HA 11 .   ? -6.895  11.486 6.720   1.00 51.02 ? 1231 HOH A O   1 
HETATM 6864 O  O   . HOH HA 11 .   ? 45.119  59.347 -20.570 1.00 39.50 ? 1232 HOH A O   1 
HETATM 6865 O  O   . HOH HA 11 .   ? 39.814  61.305 14.471  1.00 38.80 ? 1233 HOH A O   1 
HETATM 6866 O  O   . HOH HA 11 .   ? 24.109  26.840 -6.779  1.00 36.79 ? 1234 HOH A O   1 
HETATM 6867 O  O   . HOH HA 11 .   ? 11.701  48.631 -10.383 1.00 37.86 ? 1235 HOH A O   1 
HETATM 6868 O  O   . HOH HA 11 .   ? 26.114  18.887 -16.830 1.00 38.80 ? 1236 HOH A O   1 
HETATM 6869 O  O   . HOH HA 11 .   ? 30.578  57.554 12.068  1.00 34.53 ? 1237 HOH A O   1 
HETATM 6870 O  O   . HOH HA 11 .   ? 38.758  54.385 -45.796 1.00 53.86 ? 1238 HOH A O   1 
HETATM 6871 O  O   . HOH HA 11 .   ? 1.576   8.948  -1.230  1.00 47.76 ? 1239 HOH A O   1 
HETATM 6872 O  O   . HOH HA 11 .   ? 19.352  58.459 -28.337 1.00 53.87 ? 1240 HOH A O   1 
HETATM 6873 O  O   . HOH HA 11 .   ? 21.222  10.459 -21.628 1.00 46.66 ? 1241 HOH A O   1 
HETATM 6874 O  O   . HOH HA 11 .   ? 22.050  57.940 -11.003 1.00 44.05 ? 1242 HOH A O   1 
HETATM 6875 O  O   . HOH HA 11 .   ? 21.095  26.007 -7.465  1.00 32.85 ? 1243 HOH A O   1 
HETATM 6876 O  O   . HOH HA 11 .   ? 34.768  28.396 23.579  1.00 38.03 ? 1244 HOH A O   1 
HETATM 6877 O  O   . HOH HA 11 .   ? -9.425  34.767 11.419  1.00 34.87 ? 1245 HOH A O   1 
HETATM 6878 O  O   . HOH HA 11 .   ? 47.477  40.073 12.562  1.00 37.41 ? 1246 HOH A O   1 
HETATM 6879 O  O   . HOH HA 11 .   ? 53.263  36.809 5.782   1.00 36.57 ? 1247 HOH A O   1 
HETATM 6880 O  O   . HOH HA 11 .   ? 32.658  50.092 15.087  1.00 33.48 ? 1248 HOH A O   1 
HETATM 6881 O  O   . HOH HA 11 .   ? 10.034  46.805 -20.381 1.00 45.77 ? 1249 HOH A O   1 
HETATM 6882 O  O   . HOH HA 11 .   ? 41.529  25.604 -24.232 1.00 43.19 ? 1250 HOH A O   1 
HETATM 6883 O  O   . HOH HA 11 .   ? 9.822   20.995 28.867  1.00 42.42 ? 1251 HOH A O   1 
HETATM 6884 O  O   . HOH HA 11 .   ? 36.138  28.900 -5.254  1.00 45.02 ? 1252 HOH A O   1 
HETATM 6885 O  O   . HOH HA 11 .   ? 52.130  33.423 -5.286  1.00 52.89 ? 1253 HOH A O   1 
HETATM 6886 O  O   . HOH HA 11 .   ? 33.755  47.537 17.088  1.00 37.47 ? 1254 HOH A O   1 
HETATM 6887 O  O   . HOH HA 11 .   ? 15.492  21.217 -27.218 1.00 44.28 ? 1255 HOH A O   1 
HETATM 6888 O  O   . HOH HA 11 .   ? 7.068   44.128 -29.472 1.00 53.66 ? 1256 HOH A O   1 
HETATM 6889 O  O   . HOH HA 11 .   ? 5.716   37.155 -14.994 1.00 45.29 ? 1257 HOH A O   1 
HETATM 6890 O  O   . HOH HA 11 .   ? 51.620  50.486 10.996  1.00 41.12 ? 1258 HOH A O   1 
HETATM 6891 O  O   . HOH HA 11 .   ? 40.274  66.299 11.899  1.00 45.57 ? 1259 HOH A O   1 
HETATM 6892 O  O   . HOH HA 11 .   ? 27.757  58.200 -11.555 1.00 39.75 ? 1260 HOH A O   1 
HETATM 6893 O  O   . HOH HA 11 .   ? 28.275  19.849 -17.954 1.00 41.32 ? 1261 HOH A O   1 
HETATM 6894 O  O   . HOH HA 11 .   ? 44.005  54.421 -15.676 1.00 46.34 ? 1262 HOH A O   1 
HETATM 6895 O  O   . HOH HA 11 .   ? 1.233   40.237 17.844  1.00 45.11 ? 1263 HOH A O   1 
HETATM 6896 O  O   . HOH HA 11 .   ? 48.587  33.642 7.999   1.00 37.54 ? 1264 HOH A O   1 
HETATM 6897 O  O   . HOH HA 11 .   ? 52.093  44.219 -3.546  1.00 44.03 ? 1265 HOH A O   1 
HETATM 6898 O  O   . HOH HA 11 .   ? 31.589  25.677 -33.800 1.00 48.74 ? 1266 HOH A O   1 
HETATM 6899 O  O   . HOH HA 11 .   ? 44.643  60.120 9.556   1.00 44.54 ? 1267 HOH A O   1 
HETATM 6900 O  O   . HOH HA 11 .   ? 9.349   19.926 -10.448 1.00 43.04 ? 1268 HOH A O   1 
HETATM 6901 O  O   . HOH HA 11 .   ? 18.013  62.049 13.088  1.00 39.61 ? 1269 HOH A O   1 
HETATM 6902 O  O   . HOH HA 11 .   ? 2.705   5.688  15.604  1.00 46.14 ? 1270 HOH A O   1 
HETATM 6903 O  O   . HOH HA 11 .   ? 8.294   48.487 -2.139  1.00 32.04 ? 1271 HOH A O   1 
HETATM 6904 O  O   . HOH HA 11 .   ? 34.962  60.220 2.322   1.00 49.83 ? 1272 HOH A O   1 
HETATM 6905 O  O   . HOH HA 11 .   ? 48.105  59.349 -27.618 1.00 50.97 ? 1273 HOH A O   1 
HETATM 6906 O  O   . HOH HA 11 .   ? 8.990   15.487 -6.892  1.00 38.67 ? 1274 HOH A O   1 
HETATM 6907 O  O   . HOH HA 11 .   ? 20.383  27.344 24.830  1.00 46.24 ? 1275 HOH A O   1 
HETATM 6908 O  O   . HOH HA 11 .   ? 12.653  8.984  1.677   1.00 37.76 ? 1276 HOH A O   1 
HETATM 6909 O  O   . HOH HA 11 .   ? -5.821  15.580 9.996   1.00 39.00 ? 1277 HOH A O   1 
HETATM 6910 O  O   . HOH HA 11 .   ? 47.926  52.543 13.742  1.00 38.77 ? 1278 HOH A O   1 
HETATM 6911 O  O   . HOH HA 11 .   ? 33.451  53.248 -13.287 1.00 38.70 ? 1279 HOH A O   1 
HETATM 6912 O  O   . HOH HA 11 .   ? 12.800  50.513 -31.680 1.00 49.74 ? 1280 HOH A O   1 
HETATM 6913 O  O   . HOH HA 11 .   ? 8.446   16.196 32.856  1.00 49.98 ? 1281 HOH A O   1 
HETATM 6914 O  O   . HOH HA 11 .   ? 49.539  49.440 -2.931  1.00 38.32 ? 1282 HOH A O   1 
HETATM 6915 O  O   . HOH HA 11 .   ? -5.208  31.503 -0.677  1.00 42.71 ? 1283 HOH A O   1 
HETATM 6916 O  O   . HOH HA 11 .   ? 18.070  52.986 -12.953 1.00 36.63 ? 1284 HOH A O   1 
HETATM 6917 O  O   . HOH HA 11 .   ? 13.340  13.510 -0.147  1.00 30.57 ? 1285 HOH A O   1 
HETATM 6918 O  O   . HOH HA 11 .   ? 38.434  60.908 12.080  1.00 31.58 ? 1286 HOH A O   1 
HETATM 6919 O  O   . HOH HA 11 .   ? 45.419  51.161 -4.457  1.00 32.28 ? 1287 HOH A O   1 
HETATM 6920 O  O   . HOH HA 11 .   ? 45.809  59.402 6.078   1.00 41.89 ? 1288 HOH A O   1 
HETATM 6921 O  O   . HOH HA 11 .   ? 8.887   24.419 -12.495 1.00 33.16 ? 1289 HOH A O   1 
HETATM 6922 O  O   . HOH HA 11 .   ? 10.628  50.473 -12.123 1.00 51.44 ? 1290 HOH A O   1 
HETATM 6923 O  O   . HOH HA 11 .   ? 46.192  51.735 -14.850 1.00 38.99 ? 1291 HOH A O   1 
HETATM 6924 O  O   . HOH HA 11 .   ? 33.528  62.238 -20.363 1.00 37.41 ? 1292 HOH A O   1 
HETATM 6925 O  O   . HOH HA 11 .   ? -5.208  31.781 -3.285  1.00 50.40 ? 1293 HOH A O   1 
HETATM 6926 O  O   . HOH HA 11 .   ? 20.384  15.588 5.176   1.00 31.15 ? 1294 HOH A O   1 
HETATM 6927 O  O   . HOH HA 11 .   ? 25.878  20.459 -14.373 1.00 35.90 ? 1295 HOH A O   1 
HETATM 6928 O  O   . HOH HA 11 .   ? -12.701 26.715 13.115  1.00 39.02 ? 1296 HOH A O   1 
HETATM 6929 O  O   . HOH HA 11 .   ? 52.141  51.192 8.878   1.00 39.75 ? 1297 HOH A O   1 
HETATM 6930 O  O   . HOH HA 11 .   ? 15.418  42.740 -15.095 1.00 37.73 ? 1298 HOH A O   1 
HETATM 6931 O  O   . HOH HA 11 .   ? 37.422  53.403 -5.970  1.00 42.39 ? 1299 HOH A O   1 
HETATM 6932 O  O   . HOH HA 11 .   ? 18.461  60.584 15.540  1.00 43.35 ? 1300 HOH A O   1 
HETATM 6933 O  O   . HOH HA 11 .   ? 29.567  16.071 16.495  1.00 44.39 ? 1301 HOH A O   1 
HETATM 6934 O  O   . HOH HA 11 .   ? 20.053  18.021 3.794   1.00 35.95 ? 1302 HOH A O   1 
HETATM 6935 O  O   . HOH HA 11 .   ? -9.513  22.011 19.236  1.00 52.43 ? 1303 HOH A O   1 
HETATM 6936 O  O   . HOH HA 11 .   ? 52.197  53.249 13.458  1.00 48.45 ? 1304 HOH A O   1 
HETATM 6937 O  O   . HOH HA 11 .   ? 42.734  44.077 -34.452 1.00 48.87 ? 1305 HOH A O   1 
HETATM 6938 O  O   . HOH HA 11 .   ? 41.288  22.830 -23.470 1.00 44.77 ? 1306 HOH A O   1 
HETATM 6939 O  O   . HOH HA 11 .   ? 30.325  43.096 -43.725 1.00 51.24 ? 1307 HOH A O   1 
HETATM 6940 O  O   . HOH HA 11 .   ? 14.532  54.689 -30.148 1.00 48.52 ? 1308 HOH A O   1 
HETATM 6941 O  O   . HOH HA 11 .   ? 34.433  26.597 25.068  1.00 45.36 ? 1309 HOH A O   1 
HETATM 6942 O  O   . HOH HA 11 .   ? 36.941  29.141 23.092  1.00 42.84 ? 1310 HOH A O   1 
HETATM 6943 O  O   . HOH HA 11 .   ? 31.163  59.374 0.953   1.00 48.28 ? 1311 HOH A O   1 
HETATM 6944 O  O   . HOH HA 11 .   ? 47.960  50.293 -4.821  1.00 43.16 ? 1312 HOH A O   1 
HETATM 6945 O  O   . HOH HA 11 .   ? 9.545   19.169 -15.233 1.00 53.57 ? 1313 HOH A O   1 
HETATM 6946 O  O   . HOH HA 11 .   ? 6.230   23.666 -11.080 1.00 38.13 ? 1314 HOH A O   1 
HETATM 6947 O  O   . HOH HA 11 .   ? 30.298  14.670 19.116  1.00 41.21 ? 1315 HOH A O   1 
HETATM 6948 O  O   . HOH HA 11 .   ? 5.058   43.153 34.397  1.00 43.19 ? 1316 HOH A O   1 
HETATM 6949 O  O   . HOH HA 11 .   ? 3.831   41.606 36.369  1.00 45.79 ? 1317 HOH A O   1 
HETATM 6950 O  O   . HOH HA 11 .   ? 0.458   15.413 22.744  1.00 37.52 ? 1318 HOH A O   1 
HETATM 6951 O  O   . HOH HA 11 .   ? 5.921   13.604 26.668  1.00 40.82 ? 1319 HOH A O   1 
HETATM 6952 O  O   . HOH HA 11 .   ? 8.026   14.927 25.753  1.00 41.40 ? 1320 HOH A O   1 
HETATM 6953 O  O   . HOH HA 11 .   ? 9.394   12.910 21.674  1.00 40.33 ? 1321 HOH A O   1 
HETATM 6954 O  O   . HOH HA 11 .   ? 9.601   10.230 20.780  1.00 41.56 ? 1322 HOH A O   1 
HETATM 6955 O  O   . HOH HA 11 .   ? 12.225  14.924 24.181  1.00 50.35 ? 1323 HOH A O   1 
HETATM 6956 O  O   . HOH HA 11 .   ? 2.451   12.069 10.076  1.00 41.29 ? 1324 HOH A O   1 
HETATM 6957 O  O   . HOH HA 11 .   ? 0.565   13.279 8.404   1.00 39.51 ? 1325 HOH A O   1 
HETATM 6958 O  O   . HOH HA 11 .   ? -13.487 39.749 18.556  1.00 41.43 ? 1326 HOH A O   1 
HETATM 6959 O  O   . HOH HA 11 .   ? 19.085  25.177 21.363  1.00 31.84 ? 1327 HOH A O   1 
HETATM 6960 O  O   . HOH HA 11 .   ? 13.922  23.003 23.960  1.00 40.17 ? 1328 HOH A O   1 
HETATM 6961 O  O   . HOH HA 11 .   ? 45.330  34.743 19.947  1.00 36.26 ? 1329 HOH A O   1 
HETATM 6962 O  O   . HOH HA 11 .   ? 46.880  36.216 18.557  1.00 35.12 ? 1330 HOH A O   1 
HETATM 6963 O  O   . HOH HA 11 .   ? 37.169  41.364 15.050  1.00 19.72 ? 1331 HOH A O   1 
HETATM 6964 O  O   . HOH HA 11 .   ? 37.147  43.972 16.597  1.00 33.10 ? 1332 HOH A O   1 
HETATM 6965 O  O   . HOH HA 11 .   ? 42.870  47.489 -4.375  1.00 30.26 ? 1333 HOH A O   1 
HETATM 6966 O  O   . HOH HA 11 .   ? 41.742  45.192 -3.998  1.00 22.36 ? 1334 HOH A O   1 
HETATM 6967 O  O   . HOH HA 11 .   ? 24.468  43.985 -10.441 1.00 30.58 ? 1335 HOH A O   1 
HETATM 6968 O  O   . HOH HA 11 .   ? 37.481  25.163 17.576  1.00 39.07 ? 1336 HOH A O   1 
HETATM 6969 O  O   . HOH HA 11 .   ? 4.835   38.653 -8.922  1.00 32.86 ? 1337 HOH A O   1 
HETATM 6970 O  O   . HOH HA 11 .   ? 6.639   38.991 -11.211 1.00 33.20 ? 1338 HOH A O   1 
HETATM 6971 O  O   . HOH HA 11 .   ? 9.326   38.460 -10.290 1.00 27.06 ? 1339 HOH A O   1 
HETATM 6972 O  O   . HOH HA 11 .   ? 13.399  35.057 -29.119 1.00 40.26 ? 1340 HOH A O   1 
HETATM 6973 O  O   . HOH HA 11 .   ? 18.686  53.817 -23.425 1.00 39.22 ? 1341 HOH A O   1 
HETATM 6974 O  O   . HOH HA 11 .   ? 46.794  51.564 -24.307 1.00 42.05 ? 1342 HOH A O   1 
HETATM 6975 O  O   . HOH HA 11 .   ? 44.466  50.565 -29.776 1.00 50.89 ? 1343 HOH A O   1 
HETATM 6976 O  O   . HOH HA 11 .   ? 22.001  32.343 -23.066 1.00 35.65 ? 1344 HOH A O   1 
HETATM 6977 O  O   . HOH HA 11 .   ? 50.949  39.519 -3.192  1.00 36.36 ? 1345 HOH A O   1 
HETATM 6978 O  O   . HOH HA 11 .   ? 36.678  26.905 15.945  1.00 30.80 ? 1346 HOH A O   1 
HETATM 6979 O  O   . HOH HA 11 .   ? 39.586  26.321 14.424  1.00 38.35 ? 1347 HOH A O   1 
HETATM 6980 O  O   . HOH HA 11 .   ? 34.309  54.756 3.367   1.00 21.68 ? 1348 HOH A O   1 
HETATM 6981 O  O   . HOH HA 11 .   ? 31.924  56.098 2.542   1.00 27.37 ? 1349 HOH A O   1 
HETATM 6982 O  O   . HOH HA 11 .   ? 15.299  34.887 21.119  1.00 31.65 ? 1350 HOH A O   1 
HETATM 6983 O  O   . HOH HA 11 .   ? 52.456  50.055 3.091   1.00 36.88 ? 1351 HOH A O   1 
HETATM 6984 O  O   . HOH HA 11 .   ? 50.608  60.846 6.218   1.00 43.97 ? 1352 HOH A O   1 
HETATM 6985 O  O   . HOH HA 11 .   ? 12.968  43.954 -10.287 1.00 35.45 ? 1353 HOH A O   1 
HETATM 6986 O  O   . HOH HA 11 .   ? 10.549  38.616 -12.430 1.00 42.43 ? 1354 HOH A O   1 
HETATM 6987 O  O   . HOH HA 11 .   ? 24.258  59.292 -12.777 1.00 46.13 ? 1355 HOH A O   1 
HETATM 6988 O  O   . HOH HA 11 .   ? 33.312  26.933 3.822   1.00 27.96 ? 1356 HOH A O   1 
HETATM 6989 O  O   . HOH HA 11 .   ? 4.981   41.809 13.845  1.00 35.12 ? 1357 HOH A O   1 
HETATM 6990 O  O   . HOH HA 11 .   ? 2.688   41.498 13.052  1.00 39.97 ? 1358 HOH A O   1 
HETATM 6991 O  O   . HOH HA 11 .   ? 17.577  31.412 -6.253  1.00 19.97 ? 1359 HOH A O   1 
HETATM 6992 O  O   . HOH HA 11 .   ? 9.578   39.322 -7.749  1.00 23.35 ? 1360 HOH A O   1 
HETATM 6993 O  O   . HOH HA 11 .   ? 48.801  39.877 -1.160  1.00 29.02 ? 1361 HOH A O   1 
HETATM 6994 O  O   . HOH HA 11 .   ? 13.867  57.337 -3.884  1.00 42.42 ? 1362 HOH A O   1 
HETATM 6995 O  O   . HOH HA 11 .   ? 8.997   46.000 -1.498  1.00 20.80 ? 1363 HOH A O   1 
HETATM 6996 O  O   . HOH HA 11 .   ? 15.636  24.037 -25.195 1.00 38.97 ? 1364 HOH A O   1 
HETATM 6997 O  O   . HOH HA 11 .   ? 36.245  48.240 15.334  1.00 28.75 ? 1365 HOH A O   1 
HETATM 6998 O  O   . HOH HA 11 .   ? 20.811  37.572 -6.283  1.00 19.23 ? 1366 HOH A O   1 
HETATM 6999 O  O   . HOH HA 11 .   ? -11.301 20.455 33.667  1.00 52.66 ? 1367 HOH A O   1 
HETATM 7000 O  O   . HOH HA 11 .   ? 20.029  54.530 -35.350 1.00 45.83 ? 1368 HOH A O   1 
HETATM 7001 O  O   . HOH HA 11 .   ? 20.390  52.873 -13.930 1.00 30.05 ? 1369 HOH A O   1 
HETATM 7002 O  O   . HOH HA 11 .   ? 31.951  34.838 -38.964 1.00 47.79 ? 1370 HOH A O   1 
HETATM 7003 O  O   . HOH HA 11 .   ? -2.686  20.920 -1.580  1.00 38.29 ? 1371 HOH A O   1 
HETATM 7004 O  O   . HOH HA 11 .   ? 50.709  36.709 -40.745 1.00 58.09 ? 1372 HOH A O   1 
HETATM 7005 O  O   . HOH HA 11 .   ? 18.722  53.763 -26.062 1.00 39.71 ? 1373 HOH A O   1 
HETATM 7006 O  O   . HOH HA 11 .   ? 48.300  48.993 -10.637 1.00 41.72 ? 1374 HOH A O   1 
HETATM 7007 O  O   . HOH HA 11 .   ? 43.688  28.881 -15.705 1.00 37.32 ? 1375 HOH A O   1 
HETATM 7008 O  O   . HOH HA 11 .   ? 42.539  31.127 19.074  1.00 39.32 ? 1376 HOH A O   1 
HETATM 7009 O  O   . HOH HA 11 .   ? -1.414  26.798 24.190  1.00 35.64 ? 1377 HOH A O   1 
HETATM 7010 O  O   . HOH HA 11 .   ? 26.777  24.049 1.378   1.00 39.50 ? 1378 HOH A O   1 
HETATM 7011 O  O   . HOH HA 11 .   ? 7.711   4.815  15.021  1.00 49.23 ? 1379 HOH A O   1 
HETATM 7012 O  O   . HOH HA 11 .   ? 20.519  32.505 -45.611 1.00 46.52 ? 1380 HOH A O   1 
HETATM 7013 O  O   . HOH HA 11 .   ? 35.377  34.706 1.703   1.00 25.82 ? 1381 HOH A O   1 
HETATM 7014 O  O   . HOH HA 11 .   ? 17.875  56.251 -27.407 1.00 50.88 ? 1382 HOH A O   1 
HETATM 7015 O  O   . HOH HA 11 .   ? 5.062   22.583 -9.088  1.00 33.34 ? 1383 HOH A O   1 
HETATM 7016 O  O   . HOH HA 11 .   ? 0.094   5.655  21.001  1.00 50.09 ? 1384 HOH A O   1 
HETATM 7017 O  O   . HOH HA 11 .   ? 17.209  57.226 -1.480  1.00 42.71 ? 1385 HOH A O   1 
HETATM 7018 O  O   . HOH HA 11 .   ? 41.251  56.022 -18.789 1.00 43.06 ? 1386 HOH A O   1 
HETATM 7019 O  O   . HOH HA 11 .   ? 43.930  49.540 -5.988  1.00 37.53 ? 1387 HOH A O   1 
HETATM 7020 O  O   . HOH HA 11 .   ? 35.287  57.393 -0.172  1.00 39.58 ? 1388 HOH A O   1 
HETATM 7021 O  O   . HOH HA 11 .   ? 33.716  66.568 9.959   1.00 44.86 ? 1389 HOH A O   1 
HETATM 7022 O  O   . HOH HA 11 .   ? 12.669  11.590 1.318   1.00 36.71 ? 1390 HOH A O   1 
HETATM 7023 O  O   . HOH HA 11 .   ? 1.400   10.051 -5.124  1.00 50.64 ? 1391 HOH A O   1 
HETATM 7024 O  O   . HOH HA 11 .   ? -3.642  23.603 35.813  1.00 47.44 ? 1392 HOH A O   1 
HETATM 7025 O  O   . HOH HA 11 .   ? 44.840  61.876 6.693   1.00 43.69 ? 1393 HOH A O   1 
HETATM 7026 O  O   . HOH HA 11 .   ? 20.085  22.243 -28.416 1.00 41.62 ? 1394 HOH A O   1 
HETATM 7027 O  O   . HOH HA 11 .   ? 44.404  52.168 -11.909 1.00 42.30 ? 1395 HOH A O   1 
HETATM 7028 O  O   . HOH HA 11 .   ? 35.061  54.051 16.303  1.00 39.44 ? 1396 HOH A O   1 
HETATM 7029 O  O   . HOH HA 11 .   ? 13.818  41.947 23.520  1.00 46.06 ? 1397 HOH A O   1 
HETATM 7030 O  O   . HOH HA 11 .   ? 0.605   12.491 12.478  1.00 36.82 ? 1398 HOH A O   1 
HETATM 7031 O  O   . HOH HA 11 .   ? 25.319  26.987 -4.573  1.00 37.35 ? 1399 HOH A O   1 
HETATM 7032 O  O   . HOH HA 11 .   ? 36.785  25.630 8.651   1.00 36.09 ? 1400 HOH A O   1 
HETATM 7033 O  O   . HOH HA 11 .   ? 0.786   7.522  24.942  1.00 46.46 ? 1401 HOH A O   1 
HETATM 7034 O  O   . HOH HA 11 .   ? 16.632  52.529 -7.890  1.00 37.68 ? 1402 HOH A O   1 
HETATM 7035 O  O   . HOH HA 11 .   ? 1.266   6.849  5.758   1.00 49.50 ? 1403 HOH A O   1 
HETATM 7036 O  O   . HOH HA 11 .   ? 20.106  57.496 17.759  1.00 44.36 ? 1404 HOH A O   1 
HETATM 7037 O  O   . HOH HA 11 .   ? 43.918  56.003 8.967   1.00 43.19 ? 1405 HOH A O   1 
HETATM 7038 O  O   . HOH HA 11 .   ? 37.095  67.238 9.499   1.00 45.38 ? 1406 HOH A O   1 
HETATM 7039 O  O   . HOH HA 11 .   ? 19.101  56.594 -33.982 1.00 47.58 ? 1407 HOH A O   1 
HETATM 7040 O  O   . HOH HA 11 .   ? 19.863  59.457 -13.531 1.00 46.52 ? 1408 HOH A O   1 
HETATM 7041 O  O   . HOH HA 11 .   ? 0.592   31.987 26.054  1.00 35.17 ? 1409 HOH A O   1 
HETATM 7042 O  O   . HOH HA 11 .   ? -6.015  30.130 7.605   1.00 32.93 ? 1410 HOH A O   1 
HETATM 7043 O  O   . HOH HA 11 .   ? 48.317  36.718 9.747   1.00 33.13 ? 1411 HOH A O   1 
HETATM 7044 O  O   . HOH HA 11 .   ? 25.315  25.805 -43.522 1.00 58.55 ? 1412 HOH A O   1 
HETATM 7045 O  O   . HOH HA 11 .   ? -13.830 20.056 12.281  1.00 45.22 ? 1413 HOH A O   1 
HETATM 7046 O  O   . HOH HA 11 .   ? 16.042  24.840 -14.297 1.00 40.41 ? 1414 HOH A O   1 
HETATM 7047 O  O   . HOH HA 11 .   ? 3.816   13.079 -4.821  1.00 43.56 ? 1415 HOH A O   1 
HETATM 7048 O  O   . HOH HA 11 .   ? -0.430  34.769 -12.477 1.00 45.75 ? 1416 HOH A O   1 
HETATM 7049 O  O   . HOH HA 11 .   ? 9.450   20.495 -19.582 1.00 49.78 ? 1417 HOH A O   1 
HETATM 7050 O  O   . HOH HA 11 .   ? 23.181  65.622 13.679  1.00 46.31 ? 1418 HOH A O   1 
HETATM 7051 O  O   . HOH HA 11 .   ? 41.643  18.815 -38.073 1.00 56.80 ? 1419 HOH A O   1 
HETATM 7052 O  O   . HOH HA 11 .   ? 2.138   41.577 -7.084  1.00 35.41 ? 1420 HOH A O   1 
HETATM 7053 O  O   . HOH HA 11 .   ? 37.711  62.347 3.041   1.00 44.55 ? 1421 HOH A O   1 
HETATM 7054 O  O   . HOH HA 11 .   ? 1.219   47.650 -1.023  1.00 48.27 ? 1422 HOH A O   1 
HETATM 7055 O  O   . HOH HA 11 .   ? 6.162   14.320 31.167  1.00 48.10 ? 1423 HOH A O   1 
HETATM 7056 O  O   . HOH HA 11 .   ? -4.661  48.035 1.551   1.00 40.76 ? 1424 HOH A O   1 
HETATM 7057 O  O   . HOH HA 11 .   ? 9.873   38.847 -29.000 1.00 52.93 ? 1425 HOH A O   1 
HETATM 7058 O  O   . HOH HA 11 .   ? -11.921 23.316 6.188   1.00 46.98 ? 1426 HOH A O   1 
HETATM 7059 O  O   . HOH HA 11 .   ? 51.408  58.391 5.304   1.00 42.47 ? 1427 HOH A O   1 
HETATM 7060 O  O   . HOH HA 11 .   ? 26.976  24.919 -13.725 1.00 37.65 ? 1428 HOH A O   1 
HETATM 7061 O  O   . HOH HA 11 .   ? 20.276  59.923 0.594   1.00 39.06 ? 1429 HOH A O   1 
HETATM 7062 O  O   . HOH HA 11 .   ? 0.497   8.665  9.862   1.00 46.57 ? 1430 HOH A O   1 
HETATM 7063 O  O   . HOH HA 11 .   ? 10.475  10.267 8.105   1.00 42.41 ? 1431 HOH A O   1 
HETATM 7064 O  O   . HOH HA 11 .   ? 7.572   16.991 23.749  1.00 40.24 ? 1432 HOH A O   1 
HETATM 7065 O  O   . HOH HA 11 .   ? 2.553   22.035 -9.953  1.00 44.99 ? 1433 HOH A O   1 
HETATM 7066 O  O   . HOH HA 11 .   ? 39.415  46.089 -5.453  1.00 27.34 ? 1434 HOH A O   1 
HETATM 7067 O  O   . HOH HA 11 .   ? 33.902  60.132 4.489   1.00 39.29 ? 1435 HOH A O   1 
HETATM 7068 O  O   . HOH HA 11 .   ? 2.065   39.390 -8.623  1.00 35.70 ? 1436 HOH A O   1 
HETATM 7069 O  O   . HOH HA 11 .   ? 38.630  65.133 2.433   1.00 35.11 ? 1437 HOH A O   1 
HETATM 7070 O  O   . HOH HA 11 .   ? 15.918  16.340 24.162  1.00 37.02 ? 1438 HOH A O   1 
HETATM 7071 O  O   . HOH HA 11 .   ? 53.752  59.275 4.190   1.00 37.90 ? 1439 HOH A O   1 
HETATM 7072 O  O   . HOH HA 11 .   ? 21.215  57.979 -32.478 1.00 45.60 ? 1440 HOH A O   1 
HETATM 7073 O  O   . HOH HA 11 .   ? 3.862   28.934 -17.463 1.00 41.38 ? 1441 HOH A O   1 
HETATM 7074 O  O   . HOH HA 11 .   ? 0.557   37.261 -7.427  1.00 36.10 ? 1442 HOH A O   1 
HETATM 7075 O  O   . HOH HA 11 .   ? 10.912  22.272 -12.485 1.00 39.79 ? 1443 HOH A O   1 
HETATM 7076 O  O   . HOH HA 11 .   ? 32.546  58.675 -31.705 1.00 41.80 ? 1444 HOH A O   1 
HETATM 7077 O  O   . HOH HA 11 .   ? 47.393  59.969 3.685   1.00 35.37 ? 1445 HOH A O   1 
HETATM 7078 O  O   . HOH HA 11 .   ? 17.122  20.337 4.357   1.00 33.90 ? 1446 HOH A O   1 
HETATM 7079 O  O   . HOH HA 11 .   ? 14.889  46.218 -40.964 1.00 46.39 ? 1447 HOH A O   1 
HETATM 7080 O  O   . HOH HA 11 .   ? 1.358   35.513 -5.383  1.00 36.30 ? 1448 HOH A O   1 
HETATM 7081 O  O   . HOH HA 11 .   ? 8.199   17.133 -8.827  1.00 45.18 ? 1449 HOH A O   1 
HETATM 7082 O  O   . HOH HA 11 .   ? 16.317  56.850 0.507   1.00 45.71 ? 1450 HOH A O   1 
HETATM 7083 O  O   . HOH HA 11 .   ? 52.667  40.329 -1.254  1.00 39.73 ? 1451 HOH A O   1 
HETATM 7084 O  O   . HOH HA 11 .   ? 16.735  25.686 -27.346 1.00 42.05 ? 1452 HOH A O   1 
HETATM 7085 O  O   . HOH HA 11 .   ? 16.781  55.151 -29.994 1.00 45.73 ? 1453 HOH A O   1 
HETATM 7086 O  O   . HOH HA 11 .   ? 5.995   7.270  3.306   1.00 46.20 ? 1454 HOH A O   1 
HETATM 7087 O  O   . HOH HA 11 .   ? 26.361  62.389 -18.491 1.00 46.67 ? 1455 HOH A O   1 
HETATM 7088 O  O   . HOH HA 11 .   ? 42.371  50.070 -7.940  1.00 38.93 ? 1456 HOH A O   1 
HETATM 7089 O  O   . HOH HA 11 .   ? -8.450  19.805 19.754  1.00 46.12 ? 1457 HOH A O   1 
HETATM 7090 O  O   . HOH HA 11 .   ? -11.086 15.013 35.609  1.00 60.31 ? 1458 HOH A O   1 
HETATM 7091 O  O   . HOH HA 11 .   ? 44.001  30.577 7.080   1.00 39.04 ? 1459 HOH A O   1 
HETATM 7092 O  O   . HOH HA 11 .   ? 10.680  50.677 -21.606 1.00 49.72 ? 1460 HOH A O   1 
HETATM 7093 O  O   . HOH HA 11 .   ? 32.907  50.764 -11.981 1.00 38.92 ? 1461 HOH A O   1 
HETATM 7094 O  O   . HOH HA 11 .   ? 49.125  44.195 -20.897 1.00 47.33 ? 1462 HOH A O   1 
HETATM 7095 O  O   . HOH HA 11 .   ? 19.027  16.034 -18.264 1.00 40.24 ? 1463 HOH A O   1 
HETATM 7096 O  O   . HOH HA 11 .   ? 21.348  14.850 -16.971 1.00 42.22 ? 1464 HOH A O   1 
HETATM 7097 O  O   . HOH HA 11 .   ? 19.627  51.768 23.385  1.00 43.87 ? 1465 HOH A O   1 
HETATM 7098 O  O   . HOH HA 11 .   ? -4.405  29.823 0.666   1.00 44.38 ? 1466 HOH A O   1 
HETATM 7099 O  O   . HOH HA 11 .   ? 37.909  27.507 13.838  1.00 37.38 ? 1467 HOH A O   1 
HETATM 7100 O  O   . HOH HA 11 .   ? 1.152   32.897 30.920  1.00 41.03 ? 1468 HOH A O   1 
HETATM 7101 O  O   . HOH HA 11 .   ? 8.626   37.754 34.250  1.00 49.04 ? 1469 HOH A O   1 
HETATM 7102 O  O   . HOH HA 11 .   ? 20.480  51.965 20.060  1.00 39.87 ? 1470 HOH A O   1 
HETATM 7103 O  O   . HOH HA 11 .   ? 27.239  60.572 14.991  1.00 35.32 ? 1471 HOH A O   1 
HETATM 7104 O  O   . HOH HA 11 .   ? 28.228  64.163 15.137  1.00 48.36 ? 1472 HOH A O   1 
HETATM 7105 O  O   . HOH HA 11 .   ? 15.265  57.140 17.292  1.00 42.12 ? 1473 HOH A O   1 
HETATM 7106 O  O   . HOH HA 11 .   ? 8.388   35.478 -31.523 1.00 56.05 ? 1474 HOH A O   1 
HETATM 7107 O  O   . HOH HA 11 .   ? 42.397  35.602 0.849   1.00 38.37 ? 1475 HOH A O   1 
HETATM 7108 O  O   . HOH HA 11 .   ? -6.779  14.276 17.769  1.00 51.46 ? 1476 HOH A O   1 
HETATM 7109 O  O   . HOH HA 11 .   ? 3.341   12.848 7.242   1.00 40.74 ? 1477 HOH A O   1 
HETATM 7110 O  O   . HOH HA 11 .   ? 23.660  64.793 8.694   1.00 46.04 ? 1478 HOH A O   1 
HETATM 7111 O  O   . HOH HA 11 .   ? 13.981  54.273 18.821  1.00 42.20 ? 1479 HOH A O   1 
HETATM 7112 O  O   . HOH HA 11 .   ? 21.791  31.639 -14.039 1.00 22.77 ? 1480 HOH A O   1 
HETATM 7113 O  O   . HOH HA 11 .   ? 29.222  58.393 14.116  1.00 36.95 ? 1481 HOH A O   1 
HETATM 7114 O  O   . HOH HA 11 .   ? 28.815  65.006 12.550  1.00 48.16 ? 1482 HOH A O   1 
HETATM 7115 O  O   . HOH HA 11 .   ? 9.050   9.374  23.090  1.00 45.30 ? 1483 HOH A O   1 
HETATM 7116 O  O   . HOH HA 11 .   ? -5.078  36.488 29.274  1.00 47.50 ? 1484 HOH A O   1 
HETATM 7117 O  O   . HOH HA 11 .   ? 49.778  31.066 -25.284 1.00 57.63 ? 1485 HOH A O   1 
HETATM 7118 O  O   . HOH HA 11 .   ? 20.760  10.417 11.850  1.00 43.57 ? 1486 HOH A O   1 
HETATM 7119 O  O   . HOH HA 11 .   ? 28.663  55.967 14.475  1.00 36.22 ? 1487 HOH A O   1 
HETATM 7120 O  O   . HOH HA 11 .   ? 11.018  56.806 -11.962 1.00 51.41 ? 1488 HOH A O   1 
HETATM 7121 O  O   . HOH HA 11 .   ? -1.632  27.258 0.315   1.00 37.89 ? 1489 HOH A O   1 
HETATM 7122 O  O   . HOH HA 11 .   ? 3.598   31.235 37.409  1.00 48.85 ? 1490 HOH A O   1 
HETATM 7123 O  O   . HOH HA 11 .   ? -3.160  33.996 32.802  1.00 55.34 ? 1491 HOH A O   1 
HETATM 7124 O  O   . HOH HA 11 .   ? 10.334  19.500 -7.971  1.00 42.30 ? 1492 HOH A O   1 
HETATM 7125 O  O   . HOH HA 11 .   ? 13.044  60.111 13.698  1.00 44.26 ? 1493 HOH A O   1 
HETATM 7126 O  O   . HOH HA 11 .   ? 48.051  58.155 8.230   1.00 46.33 ? 1494 HOH A O   1 
HETATM 7127 O  O   . HOH HA 11 .   ? 19.565  29.346 -39.115 1.00 57.57 ? 1495 HOH A O   1 
HETATM 7128 O  O   . HOH HA 11 .   ? 26.759  17.714 10.943  1.00 42.28 ? 1496 HOH A O   1 
HETATM 7129 O  O   . HOH HA 11 .   ? 13.786  41.864 -16.715 1.00 43.34 ? 1497 HOH A O   1 
HETATM 7130 O  O   . HOH HA 11 .   ? 25.026  45.304 16.517  1.00 33.28 ? 1498 HOH A O   1 
HETATM 7131 O  O   . HOH HA 11 .   ? -10.720 26.393 20.248  1.00 47.62 ? 1499 HOH A O   1 
HETATM 7132 O  O   . HOH HA 11 .   ? 4.247   38.391 -23.442 1.00 55.66 ? 1500 HOH A O   1 
HETATM 7133 O  O   . HOH HA 11 .   ? 47.299  28.904 -35.425 1.00 62.55 ? 1501 HOH A O   1 
HETATM 7134 O  O   . HOH HA 11 .   ? 22.862  24.824 25.114  1.00 45.78 ? 1502 HOH A O   1 
HETATM 7135 O  O   . HOH HA 11 .   ? 15.562  12.859 -30.832 1.00 59.26 ? 1503 HOH A O   1 
HETATM 7136 O  O   . HOH HA 11 .   ? 50.434  37.124 -3.387  1.00 48.73 ? 1504 HOH A O   1 
HETATM 7137 O  O   . HOH HA 11 .   ? -6.492  12.597 31.870  1.00 52.43 ? 1505 HOH A O   1 
HETATM 7138 O  O   . HOH HA 11 .   ? 15.621  21.656 25.366  1.00 41.67 ? 1506 HOH A O   1 
HETATM 7139 O  O   . HOH HA 11 .   ? 16.919  19.169 24.942  1.00 44.06 ? 1507 HOH A O   1 
HETATM 7140 O  O   . HOH HA 11 .   ? 39.651  44.247 -5.497  1.00 30.82 ? 1508 HOH A O   1 
HETATM 7141 O  O   . HOH HA 11 .   ? 18.608  52.736 -38.726 1.00 53.96 ? 1509 HOH A O   1 
HETATM 7142 O  O   . HOH HA 11 .   ? 42.456  64.045 12.485  1.00 46.72 ? 1510 HOH A O   1 
HETATM 7143 O  O   . HOH HA 11 .   ? 4.589   24.627 -12.394 1.00 42.68 ? 1511 HOH A O   1 
HETATM 7144 O  O   . HOH HA 11 .   ? 12.843  19.590 -24.071 1.00 45.25 ? 1512 HOH A O   1 
HETATM 7145 O  O   . HOH HA 11 .   ? 5.843   48.978 4.612   1.00 32.85 ? 1513 HOH A O   1 
HETATM 7146 O  O   . HOH HA 11 .   ? -7.611  43.974 31.493  1.00 47.39 ? 1514 HOH A O   1 
HETATM 7147 O  O   . HOH HA 11 .   ? -3.799  10.538 1.123   1.00 54.77 ? 1515 HOH A O   1 
HETATM 7148 O  O   . HOH HA 11 .   ? -7.370  14.917 31.528  1.00 51.02 ? 1516 HOH A O   1 
HETATM 7149 O  O   . HOH HA 11 .   ? 10.973  59.688 -12.211 1.00 54.61 ? 1517 HOH A O   1 
HETATM 7150 O  O   . HOH HA 11 .   ? 40.202  60.358 9.190   1.00 32.73 ? 1518 HOH A O   1 
HETATM 7151 O  O   . HOH HA 11 .   ? 40.173  47.135 17.595  1.00 32.82 ? 1519 HOH A O   1 
HETATM 7152 O  O   . HOH HA 11 .   ? 1.685   43.406 39.844  1.00 55.93 ? 1520 HOH A O   1 
HETATM 7153 O  O   . HOH HA 11 .   ? -0.228  14.268 20.079  1.00 42.86 ? 1521 HOH A O   1 
HETATM 7154 O  O   . HOH HA 11 .   ? 18.986  56.030 -22.612 1.00 45.55 ? 1522 HOH A O   1 
HETATM 7155 O  O   . HOH HA 11 .   ? 51.247  53.099 -1.338  1.00 48.19 ? 1523 HOH A O   1 
HETATM 7156 O  O   . HOH HA 11 .   ? 15.216  54.112 -23.622 1.00 43.64 ? 1524 HOH A O   1 
HETATM 7157 O  O   . HOH HA 11 .   ? 22.724  23.588 -34.455 1.00 54.20 ? 1525 HOH A O   1 
HETATM 7158 O  O   . HOH HA 11 .   ? 15.057  37.261 20.257  1.00 45.09 ? 1526 HOH A O   1 
HETATM 7159 O  O   . HOH HA 11 .   ? -4.110  10.409 8.140   1.00 49.63 ? 1527 HOH A O   1 
HETATM 7160 O  O   . HOH HA 11 .   ? 11.425  40.744 -35.188 1.00 54.35 ? 1528 HOH A O   1 
HETATM 7161 O  O   . HOH HA 11 .   ? 6.917   20.720 -11.043 1.00 46.24 ? 1529 HOH A O   1 
HETATM 7162 O  O   . HOH HA 11 .   ? 10.566  57.595 12.279  1.00 42.17 ? 1530 HOH A O   1 
HETATM 7163 O  O   . HOH HA 11 .   ? 30.853  53.791 -10.247 1.00 37.25 ? 1531 HOH A O   1 
HETATM 7164 O  O   . HOH HA 11 .   ? 40.030  28.406 -38.548 1.00 56.94 ? 1532 HOH A O   1 
HETATM 7165 O  O   . HOH HA 11 .   ? -6.856  41.141 -0.419  1.00 40.26 ? 1533 HOH A O   1 
HETATM 7166 O  O   . HOH HA 11 .   ? 27.092  26.594 27.096  1.00 51.48 ? 1534 HOH A O   1 
HETATM 7167 O  O   . HOH HA 11 .   ? 3.983   49.532 3.013   1.00 41.72 ? 1535 HOH A O   1 
HETATM 7168 O  O   . HOH HA 11 .   ? -13.932 30.869 8.639   1.00 43.02 ? 1536 HOH A O   1 
HETATM 7169 O  O   . HOH HA 11 .   ? 15.614  56.366 4.281   1.00 44.74 ? 1537 HOH A O   1 
HETATM 7170 O  O   . HOH HA 11 .   ? 53.017  48.881 8.106   1.00 44.18 ? 1538 HOH A O   1 
HETATM 7171 O  O   . HOH HA 11 .   ? -9.048  20.591 1.335   1.00 47.97 ? 1539 HOH A O   1 
HETATM 7172 O  O   . HOH HA 11 .   ? 49.095  31.472 -20.350 1.00 49.34 ? 1540 HOH A O   1 
HETATM 7173 O  O   . HOH HA 11 .   ? -11.568 20.239 26.835  1.00 51.37 ? 1541 HOH A O   1 
HETATM 7174 O  O   . HOH HA 11 .   ? -6.253  39.131 20.236  1.00 50.23 ? 1542 HOH A O   1 
HETATM 7175 O  O   . HOH HA 11 .   ? 17.619  14.377 -30.427 1.00 52.88 ? 1543 HOH A O   1 
HETATM 7176 O  O   . HOH HA 11 .   ? 23.668  61.424 -14.206 1.00 48.59 ? 1544 HOH A O   1 
HETATM 7177 O  O   . HOH HA 11 .   ? -2.970  40.508 14.213  1.00 48.02 ? 1545 HOH A O   1 
HETATM 7178 O  O   . HOH HA 11 .   ? 35.887  25.325 -39.619 1.00 54.62 ? 1546 HOH A O   1 
HETATM 7179 O  O   . HOH HA 11 .   ? 50.526  46.584 -3.144  1.00 41.56 ? 1547 HOH A O   1 
HETATM 7180 O  O   . HOH HA 11 .   ? 7.278   49.403 -28.291 1.00 53.81 ? 1548 HOH A O   1 
HETATM 7181 O  O   . HOH HA 11 .   ? 4.192   41.125 -19.422 1.00 54.04 ? 1549 HOH A O   1 
HETATM 7182 O  O   . HOH HA 11 .   ? 29.995  58.075 -45.463 1.00 57.32 ? 1550 HOH A O   1 
HETATM 7183 O  O   . HOH HA 11 .   ? -5.936  48.010 36.477  1.00 53.42 ? 1551 HOH A O   1 
HETATM 7184 O  O   . HOH HA 11 .   ? 13.117  41.670 27.172  1.00 50.15 ? 1552 HOH A O   1 
HETATM 7185 O  O   . HOH HA 11 .   ? 7.678   34.892 34.584  1.00 47.61 ? 1553 HOH A O   1 
HETATM 7186 O  O   . HOH HA 11 .   ? 44.887  21.885 -36.760 1.00 63.75 ? 1554 HOH A O   1 
HETATM 7187 O  O   . HOH HA 11 .   ? 21.828  42.430 -41.068 1.00 52.15 ? 1555 HOH A O   1 
HETATM 7188 O  O   . HOH HA 11 .   ? -10.823 40.884 26.227  1.00 54.80 ? 1556 HOH A O   1 
HETATM 7189 O  O   . HOH HA 11 .   ? 8.865   22.131 36.532  1.00 51.30 ? 1557 HOH A O   1 
HETATM 7190 O  O   . HOH HA 11 .   ? 52.809  37.275 -7.226  1.00 42.71 ? 1558 HOH A O   1 
HETATM 7191 O  O   . HOH HA 11 .   ? 39.843  45.850 21.468  1.00 52.69 ? 1559 HOH A O   1 
HETATM 7192 O  O   . HOH HA 11 .   ? -1.503  7.342  17.869  1.00 51.78 ? 1560 HOH A O   1 
HETATM 7193 O  O   . HOH HA 11 .   ? -5.852  37.112 32.268  1.00 53.43 ? 1561 HOH A O   1 
HETATM 7194 O  O   . HOH HA 11 .   ? 31.563  45.322 -44.205 1.00 51.57 ? 1562 HOH A O   1 
HETATM 7195 O  O   . HOH HA 11 .   ? 30.127  25.876 -37.851 1.00 58.24 ? 1563 HOH A O   1 
HETATM 7196 O  O   . HOH HA 11 .   ? 41.577  47.281 -46.097 1.00 55.11 ? 1564 HOH A O   1 
HETATM 7197 O  O   . HOH HA 11 .   ? -3.463  13.496 18.744  1.00 48.65 ? 1565 HOH A O   1 
HETATM 7198 O  O   . HOH HA 11 .   ? 40.885  59.117 18.210  1.00 46.28 ? 1566 HOH A O   1 
HETATM 7199 O  O   . HOH HA 11 .   ? 39.006  58.516 -8.812  1.00 49.05 ? 1567 HOH A O   1 
HETATM 7200 O  O   . HOH HA 11 .   ? 23.533  29.851 -44.335 1.00 63.45 ? 1568 HOH A O   1 
HETATM 7201 O  O   . HOH HA 11 .   ? 15.310  44.074 -17.284 1.00 44.48 ? 1569 HOH A O   1 
HETATM 7202 O  O   . HOH HA 11 .   ? 30.615  18.801 -17.537 1.00 52.79 ? 1570 HOH A O   1 
HETATM 7203 O  O   . HOH HA 11 .   ? 37.720  27.360 -6.826  1.00 52.35 ? 1571 HOH A O   1 
HETATM 7204 O  O   . HOH HA 11 .   ? 0.562   25.477 40.599  1.00 52.35 ? 1572 HOH A O   1 
HETATM 7205 O  O   . HOH HA 11 .   ? 43.648  20.569 -38.518 1.00 63.39 ? 1573 HOH A O   1 
HETATM 7206 O  O   . HOH HA 11 .   ? 26.410  22.782 24.666  1.00 48.29 ? 1574 HOH A O   1 
HETATM 7207 O  O   . HOH HA 11 .   ? 41.349  37.113 -50.578 1.00 51.25 ? 1575 HOH A O   1 
HETATM 7208 O  O   . HOH HA 11 .   ? 9.557   30.867 -22.274 1.00 50.77 ? 1576 HOH A O   1 
HETATM 7209 O  O   . HOH HA 11 .   ? 0.851   27.573 42.423  1.00 53.78 ? 1577 HOH A O   1 
HETATM 7210 O  O   . HOH HA 11 .   ? 49.081  46.765 -6.116  1.00 41.57 ? 1578 HOH A O   1 
HETATM 7211 O  O   . HOH HA 11 .   ? 0.727   23.519 42.103  1.00 56.48 ? 1579 HOH A O   1 
HETATM 7212 O  O   . HOH HA 11 .   ? 39.548  46.724 -44.611 1.00 55.21 ? 1580 HOH A O   1 
HETATM 7213 O  O   . HOH HA 11 .   ? 43.453  37.065 -52.092 1.00 51.50 ? 1581 HOH A O   1 
HETATM 7214 O  O   . HOH HA 11 .   ? 36.785  29.561 -15.502 1.00 41.48 ? 1582 HOH A O   1 
HETATM 7215 O  O   . HOH HA 11 .   ? 32.164  35.406 17.490  1.00 33.20 ? 1583 HOH A O   1 
HETATM 7216 O  O   . HOH HA 11 .   ? 11.401  53.565 4.146   1.00 35.92 ? 1584 HOH A O   1 
HETATM 7217 O  O   . HOH HA 11 .   ? 18.772  13.652 -21.586 1.00 47.54 ? 1585 HOH A O   1 
HETATM 7218 O  O   . HOH HA 11 .   ? -9.494  56.152 33.504  1.00 57.47 ? 1586 HOH A O   1 
HETATM 7219 O  O   . HOH HA 11 .   ? 4.715   10.815 33.187  1.00 56.25 ? 1587 HOH A O   1 
HETATM 7220 O  O   . HOH HA 11 .   ? -8.950  24.490 20.608  1.00 50.02 ? 1588 HOH A O   1 
HETATM 7221 O  O   . HOH HA 11 .   ? 12.795  19.729 -7.900  1.00 38.74 ? 1589 HOH A O   1 
HETATM 7222 O  O   . HOH HA 11 .   ? 18.202  29.951 -43.364 1.00 51.72 ? 1590 HOH A O   1 
HETATM 7223 O  O   . HOH HA 11 .   ? 0.208   40.919 14.687  1.00 45.34 ? 1591 HOH A O   1 
HETATM 7224 O  O   . HOH HA 11 .   ? 4.863   17.800 37.043  1.00 49.99 ? 1592 HOH A O   1 
HETATM 7225 O  O   . HOH HA 11 .   ? 25.720  13.068 16.772  1.00 47.43 ? 1593 HOH A O   1 
HETATM 7226 O  O   . HOH HA 11 .   ? 46.204  45.526 -40.097 1.00 56.25 ? 1594 HOH A O   1 
HETATM 7227 O  O   . HOH HA 11 .   ? 5.457   58.173 25.653  1.00 64.87 ? 1595 HOH A O   1 
HETATM 7228 O  O   . HOH HA 11 .   ? 8.344   55.224 9.098   1.00 51.74 ? 1596 HOH A O   1 
HETATM 7229 O  O   . HOH HA 11 .   ? 1.819   1.474  9.772   1.00 58.41 ? 1597 HOH A O   1 
HETATM 7230 O  O   . HOH HA 11 .   ? 18.907  27.972 -44.641 1.00 50.91 ? 1598 HOH A O   1 
HETATM 7231 O  O   . HOH HA 11 .   ? 10.065  57.002 9.059   1.00 48.15 ? 1599 HOH A O   1 
HETATM 7232 O  O   . HOH HA 11 .   ? 9.956   52.704 7.105   1.00 22.34 ? 1600 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   36  ?   ?   ?   A . n 
A 1 2   GLU 2   37  ?   ?   ?   A . n 
A 1 3   TRP 3   38  ?   ?   ?   A . n 
A 1 4   ASP 4   39  ?   ?   ?   A . n 
A 1 5   GLU 5   40  ?   ?   ?   A . n 
A 1 6   GLY 6   41  ?   ?   ?   A . n 
A 1 7   PRO 7   42  ?   ?   ?   A . n 
A 1 8   PRO 8   43  ?   ?   ?   A . n 
A 1 9   THR 9   44  ?   ?   ?   A . n 
A 1 10  VAL 10  45  ?   ?   ?   A . n 
A 1 11  LEU 11  46  ?   ?   ?   A . n 
A 1 12  SER 12  47  ?   ?   ?   A . n 
A 1 13  ASP 13  48  ?   ?   ?   A . n 
A 1 14  SER 14  49  ?   ?   ?   A . n 
A 1 15  PRO 15  50  ?   ?   ?   A . n 
A 1 16  TRP 16  51  51  TRP TRP A . n 
A 1 17  THR 17  52  52  THR THR A . n 
A 1 18  ASN 18  53  53  ASN ASN A . n 
A 1 19  THR 19  54  54  THR THR A . n 
A 1 20  SER 20  55  55  SER SER A . n 
A 1 21  GLY 21  56  56  GLY GLY A . n 
A 1 22  SER 22  57  57  SER SER A . n 
A 1 23  CYS 23  58  58  CYS CYS A . n 
A 1 24  LYS 24  59  59  LYS LYS A . n 
A 1 25  GLY 25  60  60  GLY GLY A . n 
A 1 26  ARG 26  61  61  ARG ARG A . n 
A 1 27  CYS 27  62  62  CYS CYS A . n 
A 1 28  PHE 28  63  63  PHE PHE A . n 
A 1 29  GLU 29  64  64  GLU GLU A . n 
A 1 30  LEU 30  65  65  LEU LEU A . n 
A 1 31  GLN 31  66  66  GLN GLN A . n 
A 1 32  GLU 32  67  67  GLU GLU A . n 
A 1 33  VAL 33  68  68  VAL VAL A . n 
A 1 34  GLY 34  69  69  GLY GLY A . n 
A 1 35  PRO 35  70  70  PRO PRO A . n 
A 1 36  PRO 36  71  71  PRO PRO A . n 
A 1 37  ASP 37  72  72  ASP ASP A . n 
A 1 38  CYS 38  73  73  CYS CYS A . n 
A 1 39  ARG 39  74  74  ARG ARG A . n 
A 1 40  CYS 40  75  75  CYS CYS A . n 
A 1 41  ASP 41  76  76  ASP ASP A . n 
A 1 42  ASN 42  77  77  ASN ASN A . n 
A 1 43  LEU 43  78  78  LEU LEU A . n 
A 1 44  CYS 44  79  79  CYS CYS A . n 
A 1 45  LYS 45  80  80  LYS LYS A . n 
A 1 46  SER 46  81  81  SER SER A . n 
A 1 47  TYR 47  82  82  TYR TYR A . n 
A 1 48  SER 48  83  83  SER SER A . n 
A 1 49  SER 49  84  84  SER SER A . n 
A 1 50  CYS 50  85  85  CYS CYS A . n 
A 1 51  CYS 51  86  86  CYS CYS A . n 
A 1 52  HIS 52  87  87  HIS HIS A . n 
A 1 53  ASP 53  88  88  ASP ASP A . n 
A 1 54  PHE 54  89  89  PHE PHE A . n 
A 1 55  ASP 55  90  90  ASP ASP A . n 
A 1 56  GLU 56  91  91  GLU GLU A . n 
A 1 57  LEU 57  92  92  LEU LEU A . n 
A 1 58  CYS 58  93  93  CYS CYS A . n 
A 1 59  LEU 59  94  94  LEU LEU A . n 
A 1 60  LYS 60  95  95  LYS LYS A . n 
A 1 61  THR 61  96  96  THR THR A . n 
A 1 62  ALA 62  97  97  ALA ALA A . n 
A 1 63  ARG 63  98  98  ARG ARG A . n 
A 1 64  GLY 64  99  99  GLY GLY A . n 
A 1 65  TRP 65  100 100 TRP TRP A . n 
A 1 66  GLU 66  101 101 GLU GLU A . n 
A 1 67  CYS 67  102 102 CYS CYS A . n 
A 1 68  THR 68  103 103 THR THR A . n 
A 1 69  LYS 69  104 104 LYS LYS A . n 
A 1 70  ASP 70  105 105 ASP ASP A . n 
A 1 71  ARG 71  106 106 ARG ARG A . n 
A 1 72  CYS 72  107 107 CYS CYS A . n 
A 1 73  GLY 73  108 108 GLY GLY A . n 
A 1 74  GLU 74  109 109 GLU GLU A . n 
A 1 75  VAL 75  110 110 VAL VAL A . n 
A 1 76  ARG 76  111 111 ARG ARG A . n 
A 1 77  ASN 77  112 112 ASN ASN A . n 
A 1 78  GLU 78  113 113 GLU GLU A . n 
A 1 79  GLU 79  114 114 GLU GLU A . n 
A 1 80  ASN 80  115 115 ASN ASN A . n 
A 1 81  ALA 81  116 116 ALA ALA A . n 
A 1 82  CYS 82  117 117 CYS CYS A . n 
A 1 83  HIS 83  118 118 HIS HIS A . n 
A 1 84  CYS 84  119 119 CYS CYS A . n 
A 1 85  SER 85  120 120 SER SER A . n 
A 1 86  GLU 86  121 121 GLU GLU A . n 
A 1 87  ASP 87  122 122 ASP ASP A . n 
A 1 88  CYS 88  123 123 CYS CYS A . n 
A 1 89  LEU 89  124 124 LEU LEU A . n 
A 1 90  SER 90  125 125 SER SER A . n 
A 1 91  ARG 91  126 126 ARG ARG A . n 
A 1 92  GLY 92  127 127 GLY GLY A . n 
A 1 93  ASP 93  128 128 ASP ASP A . n 
A 1 94  CYS 94  129 129 CYS CYS A . n 
A 1 95  CYS 95  130 130 CYS CYS A . n 
A 1 96  THR 96  131 131 THR THR A . n 
A 1 97  ASN 97  132 132 ASN ASN A . n 
A 1 98  TYR 98  133 133 TYR TYR A . n 
A 1 99  GLN 99  134 134 GLN GLN A . n 
A 1 100 VAL 100 135 135 VAL VAL A . n 
A 1 101 VAL 101 136 136 VAL VAL A . n 
A 1 102 CYS 102 137 137 CYS CYS A . n 
A 1 103 LYS 103 138 138 LYS LYS A . n 
A 1 104 GLY 104 139 139 GLY GLY A . n 
A 1 105 GLU 105 140 140 GLU GLU A . n 
A 1 106 SER 106 141 141 SER SER A . n 
A 1 107 HIS 107 142 142 HIS HIS A . n 
A 1 108 TRP 108 143 143 TRP TRP A . n 
A 1 109 VAL 109 144 144 VAL VAL A . n 
A 1 110 ASP 110 145 145 ASP ASP A . n 
A 1 111 ASP 111 146 146 ASP ASP A . n 
A 1 112 ASP 112 147 147 ASP ASP A . n 
A 1 113 CYS 113 148 148 CYS CYS A . n 
A 1 114 GLU 114 149 149 GLU GLU A . n 
A 1 115 GLU 115 150 150 GLU GLU A . n 
A 1 116 ILE 116 151 151 ILE ILE A . n 
A 1 117 ARG 117 152 152 ARG ARG A . n 
A 1 118 VAL 118 153 153 VAL VAL A . n 
A 1 119 PRO 119 154 154 PRO PRO A . n 
A 1 120 GLU 120 155 155 GLU GLU A . n 
A 1 121 CYS 121 156 156 CYS CYS A . n 
A 1 122 PRO 122 157 157 PRO PRO A . n 
A 1 123 ALA 123 158 158 ALA ALA A . n 
A 1 124 GLY 124 159 159 GLY GLY A . n 
A 1 125 PHE 125 160 160 PHE PHE A . n 
A 1 126 VAL 126 161 161 VAL VAL A . n 
A 1 127 ARG 127 162 162 ARG ARG A . n 
A 1 128 PRO 128 163 163 PRO PRO A . n 
A 1 129 PRO 129 164 164 PRO PRO A . n 
A 1 130 LEU 130 165 165 LEU LEU A . n 
A 1 131 ILE 131 166 166 ILE ILE A . n 
A 1 132 ILE 132 167 167 ILE ILE A . n 
A 1 133 PHE 133 168 168 PHE PHE A . n 
A 1 134 SER 134 169 169 SER SER A . n 
A 1 135 VAL 135 170 170 VAL VAL A . n 
A 1 136 ASP 136 171 171 ASP ASP A . n 
A 1 137 GLY 137 172 172 GLY GLY A . n 
A 1 138 PHE 138 173 173 PHE PHE A . n 
A 1 139 ARG 139 174 174 ARG ARG A . n 
A 1 140 ALA 140 175 175 ALA ALA A . n 
A 1 141 SER 141 176 176 SER SER A . n 
A 1 142 TYR 142 177 177 TYR TYR A . n 
A 1 143 MET 143 178 178 MET MET A . n 
A 1 144 LYS 144 179 179 LYS LYS A . n 
A 1 145 LYS 145 180 180 LYS LYS A . n 
A 1 146 GLY 146 181 181 GLY GLY A . n 
A 1 147 SER 147 182 182 SER SER A . n 
A 1 148 LYS 148 183 183 LYS LYS A . n 
A 1 149 VAL 149 184 184 VAL VAL A . n 
A 1 150 MET 150 185 185 MET MET A . n 
A 1 151 PRO 151 186 186 PRO PRO A . n 
A 1 152 ASN 152 187 187 ASN ASN A . n 
A 1 153 ILE 153 188 188 ILE ILE A . n 
A 1 154 GLU 154 189 189 GLU GLU A . n 
A 1 155 LYS 155 190 190 LYS LYS A . n 
A 1 156 LEU 156 191 191 LEU LEU A . n 
A 1 157 ARG 157 192 192 ARG ARG A . n 
A 1 158 SER 158 193 193 SER SER A . n 
A 1 159 CYS 159 194 194 CYS CYS A . n 
A 1 160 GLY 160 195 195 GLY GLY A . n 
A 1 161 THR 161 196 196 THR THR A . n 
A 1 162 HIS 162 197 197 HIS HIS A . n 
A 1 163 ALA 163 198 198 ALA ALA A . n 
A 1 164 PRO 164 199 199 PRO PRO A . n 
A 1 165 TYR 165 200 200 TYR TYR A . n 
A 1 166 MET 166 201 201 MET MET A . n 
A 1 167 ARG 167 202 202 ARG ARG A . n 
A 1 168 PRO 168 203 203 PRO PRO A . n 
A 1 169 VAL 169 204 204 VAL VAL A . n 
A 1 170 TYR 170 205 205 TYR TYR A . n 
A 1 171 PRO 171 206 206 PRO PRO A . n 
A 1 172 THR 172 207 207 THR THR A . n 
A 1 173 LYS 173 208 208 LYS LYS A . n 
A 1 174 THR 174 209 209 THR THR A . n 
A 1 175 PHE 175 210 210 PHE PHE A . n 
A 1 176 PRO 176 211 211 PRO PRO A . n 
A 1 177 ASN 177 212 212 ASN ASN A . n 
A 1 178 LEU 178 213 213 LEU LEU A . n 
A 1 179 TYR 179 214 214 TYR TYR A . n 
A 1 180 THR 180 215 215 THR THR A . n 
A 1 181 LEU 181 216 216 LEU LEU A . n 
A 1 182 ALA 182 217 217 ALA ALA A . n 
A 1 183 THR 183 218 218 THR THR A . n 
A 1 184 GLY 184 219 219 GLY GLY A . n 
A 1 185 LEU 185 220 220 LEU LEU A . n 
A 1 186 TYR 186 221 221 TYR TYR A . n 
A 1 187 PRO 187 222 222 PRO PRO A . n 
A 1 188 GLU 188 223 223 GLU GLU A . n 
A 1 189 SER 189 224 224 SER SER A . n 
A 1 190 HIS 190 225 225 HIS HIS A . n 
A 1 191 GLY 191 226 226 GLY GLY A . n 
A 1 192 ILE 192 227 227 ILE ILE A . n 
A 1 193 VAL 193 228 228 VAL VAL A . n 
A 1 194 GLY 194 229 229 GLY GLY A . n 
A 1 195 ASN 195 230 230 ASN ASN A . n 
A 1 196 SER 196 231 231 SER SER A . n 
A 1 197 MET 197 232 232 MET MET A . n 
A 1 198 TYR 198 233 233 TYR TYR A . n 
A 1 199 ASP 199 234 234 ASP ASP A . n 
A 1 200 PRO 200 235 235 PRO PRO A . n 
A 1 201 VAL 201 236 236 VAL VAL A . n 
A 1 202 PHE 202 237 237 PHE PHE A . n 
A 1 203 ASP 203 238 238 ASP ASP A . n 
A 1 204 ALA 204 239 239 ALA ALA A . n 
A 1 205 THR 205 240 240 THR THR A . n 
A 1 206 PHE 206 241 241 PHE PHE A . n 
A 1 207 HIS 207 242 242 HIS HIS A . n 
A 1 208 LEU 208 243 243 LEU LEU A . n 
A 1 209 ARG 209 244 244 ARG ARG A . n 
A 1 210 GLY 210 245 245 GLY GLY A . n 
A 1 211 ARG 211 246 246 ARG ARG A . n 
A 1 212 GLU 212 247 247 GLU GLU A . n 
A 1 213 LYS 213 248 248 LYS LYS A . n 
A 1 214 PHE 214 249 249 PHE PHE A . n 
A 1 215 ASN 215 250 250 ASN ASN A . n 
A 1 216 HIS 216 251 251 HIS HIS A . n 
A 1 217 ARG 217 252 252 ARG ARG A . n 
A 1 218 TRP 218 253 253 TRP TRP A . n 
A 1 219 TRP 219 254 254 TRP TRP A . n 
A 1 220 GLY 220 255 255 GLY GLY A . n 
A 1 221 GLY 221 256 256 GLY GLY A . n 
A 1 222 GLN 222 257 257 GLN GLN A . n 
A 1 223 PRO 223 258 258 PRO PRO A . n 
A 1 224 LEU 224 259 259 LEU LEU A . n 
A 1 225 TRP 225 260 260 TRP TRP A . n 
A 1 226 ILE 226 261 261 ILE ILE A . n 
A 1 227 THR 227 262 262 THR THR A . n 
A 1 228 ALA 228 263 263 ALA ALA A . n 
A 1 229 THR 229 264 264 THR THR A . n 
A 1 230 LYS 230 265 265 LYS LYS A . n 
A 1 231 GLN 231 266 266 GLN GLN A . n 
A 1 232 GLY 232 267 267 GLY GLY A . n 
A 1 233 VAL 233 268 268 VAL VAL A . n 
A 1 234 ARG 234 269 269 ARG ARG A . n 
A 1 235 ALA 235 270 270 ALA ALA A . n 
A 1 236 GLY 236 271 271 GLY GLY A . n 
A 1 237 THR 237 272 272 THR THR A . n 
A 1 238 PHE 238 273 273 PHE PHE A . n 
A 1 239 PHE 239 274 274 PHE PHE A . n 
A 1 240 TRP 240 275 275 TRP TRP A . n 
A 1 241 SER 241 276 276 SER SER A . n 
A 1 242 VAL 242 277 277 VAL VAL A . n 
A 1 243 SER 243 278 278 SER SER A . n 
A 1 244 ILE 244 279 279 ILE ILE A . n 
A 1 245 PRO 245 280 280 PRO PRO A . n 
A 1 246 HIS 246 281 281 HIS HIS A . n 
A 1 247 GLU 247 282 282 GLU GLU A . n 
A 1 248 ARG 248 283 283 ARG ARG A . n 
A 1 249 ARG 249 284 284 ARG ARG A . n 
A 1 250 ILE 250 285 285 ILE ILE A . n 
A 1 251 LEU 251 286 286 LEU LEU A . n 
A 1 252 THR 252 287 287 THR THR A . n 
A 1 253 ILE 253 288 288 ILE ILE A . n 
A 1 254 LEU 254 289 289 LEU LEU A . n 
A 1 255 GLN 255 290 290 GLN GLN A . n 
A 1 256 TRP 256 291 291 TRP TRP A . n 
A 1 257 LEU 257 292 292 LEU LEU A . n 
A 1 258 SER 258 293 293 SER SER A . n 
A 1 259 LEU 259 294 294 LEU LEU A . n 
A 1 260 PRO 260 295 295 PRO PRO A . n 
A 1 261 ASP 261 296 296 ASP ASP A . n 
A 1 262 ASN 262 297 297 ASN ASN A . n 
A 1 263 GLU 263 298 298 GLU GLU A . n 
A 1 264 ARG 264 299 299 ARG ARG A . n 
A 1 265 PRO 265 300 300 PRO PRO A . n 
A 1 266 SER 266 301 301 SER SER A . n 
A 1 267 VAL 267 302 302 VAL VAL A . n 
A 1 268 TYR 268 303 303 TYR TYR A . n 
A 1 269 ALA 269 304 304 ALA ALA A . n 
A 1 270 PHE 270 305 305 PHE PHE A . n 
A 1 271 TYR 271 306 306 TYR TYR A . n 
A 1 272 SER 272 307 307 SER SER A . n 
A 1 273 GLU 273 308 308 GLU GLU A . n 
A 1 274 GLN 274 309 309 GLN GLN A . n 
A 1 275 PRO 275 310 310 PRO PRO A . n 
A 1 276 ASP 276 311 311 ASP ASP A . n 
A 1 277 PHE 277 312 312 PHE PHE A . n 
A 1 278 SER 278 313 313 SER SER A . n 
A 1 279 GLY 279 314 314 GLY GLY A . n 
A 1 280 HIS 280 315 315 HIS HIS A . n 
A 1 281 LYS 281 316 316 LYS LYS A . n 
A 1 282 TYR 282 317 317 TYR TYR A . n 
A 1 283 GLY 283 318 318 GLY GLY A . n 
A 1 284 PRO 284 319 319 PRO PRO A . n 
A 1 285 PHE 285 320 320 PHE PHE A . n 
A 1 286 GLY 286 321 321 GLY GLY A . n 
A 1 287 PRO 287 322 322 PRO PRO A . n 
A 1 288 GLU 288 323 323 GLU GLU A . n 
A 1 289 MET 289 324 324 MET MET A . n 
A 1 290 THR 290 325 325 THR THR A . n 
A 1 291 ASN 291 326 326 ASN ASN A . n 
A 1 292 PRO 292 327 327 PRO PRO A . n 
A 1 293 LEU 293 328 328 LEU LEU A . n 
A 1 294 ARG 294 329 329 ARG ARG A . n 
A 1 295 GLU 295 330 330 GLU GLU A . n 
A 1 296 ILE 296 331 331 ILE ILE A . n 
A 1 297 ASP 297 332 332 ASP ASP A . n 
A 1 298 LYS 298 333 333 LYS LYS A . n 
A 1 299 THR 299 334 334 THR THR A . n 
A 1 300 VAL 300 335 335 VAL VAL A . n 
A 1 301 GLY 301 336 336 GLY GLY A . n 
A 1 302 GLN 302 337 337 GLN GLN A . n 
A 1 303 LEU 303 338 338 LEU LEU A . n 
A 1 304 MET 304 339 339 MET MET A . n 
A 1 305 ASP 305 340 340 ASP ASP A . n 
A 1 306 GLY 306 341 341 GLY GLY A . n 
A 1 307 LEU 307 342 342 LEU LEU A . n 
A 1 308 LYS 308 343 343 LYS LYS A . n 
A 1 309 GLN 309 344 344 GLN GLN A . n 
A 1 310 LEU 310 345 345 LEU LEU A . n 
A 1 311 LYS 311 346 346 LYS LYS A . n 
A 1 312 LEU 312 347 347 LEU LEU A . n 
A 1 313 HIS 313 348 348 HIS HIS A . n 
A 1 314 ARG 314 349 349 ARG ARG A . n 
A 1 315 CYS 315 350 350 CYS CYS A . n 
A 1 316 VAL 316 351 351 VAL VAL A . n 
A 1 317 ASN 317 352 352 ASN ASN A . n 
A 1 318 VAL 318 353 353 VAL VAL A . n 
A 1 319 ILE 319 354 354 ILE ILE A . n 
A 1 320 PHE 320 355 355 PHE PHE A . n 
A 1 321 VAL 321 356 356 VAL VAL A . n 
A 1 322 GLY 322 357 357 GLY GLY A . n 
A 1 323 ASP 323 358 358 ASP ASP A . n 
A 1 324 HIS 324 359 359 HIS HIS A . n 
A 1 325 GLY 325 360 360 GLY GLY A . n 
A 1 326 MET 326 361 361 MET MET A . n 
A 1 327 GLU 327 362 362 GLU GLU A . n 
A 1 328 ASP 328 363 363 ASP ASP A . n 
A 1 329 VAL 329 364 364 VAL VAL A . n 
A 1 330 THR 330 365 365 THR THR A . n 
A 1 331 CYS 331 366 366 CYS CYS A . n 
A 1 332 ASP 332 367 367 ASP ASP A . n 
A 1 333 ARG 333 368 368 ARG ARG A . n 
A 1 334 THR 334 369 369 THR THR A . n 
A 1 335 GLU 335 370 370 GLU GLU A . n 
A 1 336 PHE 336 371 371 PHE PHE A . n 
A 1 337 LEU 337 372 372 LEU LEU A . n 
A 1 338 SER 338 373 373 SER SER A . n 
A 1 339 ASN 339 374 374 ASN ASN A . n 
A 1 340 TYR 340 375 375 TYR TYR A . n 
A 1 341 LEU 341 376 376 LEU LEU A . n 
A 1 342 THR 342 377 377 THR THR A . n 
A 1 343 ASN 343 378 378 ASN ASN A . n 
A 1 344 VAL 344 379 379 VAL VAL A . n 
A 1 345 ASP 345 380 380 ASP ASP A . n 
A 1 346 ASP 346 381 381 ASP ASP A . n 
A 1 347 ILE 347 382 382 ILE ILE A . n 
A 1 348 THR 348 383 383 THR THR A . n 
A 1 349 LEU 349 384 384 LEU LEU A . n 
A 1 350 VAL 350 385 385 VAL VAL A . n 
A 1 351 PRO 351 386 386 PRO PRO A . n 
A 1 352 GLY 352 387 387 GLY GLY A . n 
A 1 353 THR 353 388 388 THR THR A . n 
A 1 354 LEU 354 389 389 LEU LEU A . n 
A 1 355 GLY 355 390 390 GLY GLY A . n 
A 1 356 ARG 356 391 391 ARG ARG A . n 
A 1 357 ILE 357 392 392 ILE ILE A . n 
A 1 358 ARG 358 393 393 ARG ARG A . n 
A 1 359 PRO 359 394 394 PRO PRO A . n 
A 1 360 LYS 360 395 395 LYS LYS A . n 
A 1 361 ILE 361 396 396 ILE ILE A . n 
A 1 362 PRO 362 397 397 PRO PRO A . n 
A 1 363 ASN 363 398 398 ASN ASN A . n 
A 1 364 ASN 364 399 399 ASN ASN A . n 
A 1 365 LEU 365 400 400 LEU LEU A . n 
A 1 366 LYS 366 401 401 LYS LYS A . n 
A 1 367 TYR 367 402 402 TYR TYR A . n 
A 1 368 ASP 368 403 403 ASP ASP A . n 
A 1 369 PRO 369 404 404 PRO PRO A . n 
A 1 370 LYS 370 405 405 LYS LYS A . n 
A 1 371 ALA 371 406 406 ALA ALA A . n 
A 1 372 ILE 372 407 407 ILE ILE A . n 
A 1 373 ILE 373 408 408 ILE ILE A . n 
A 1 374 ALA 374 409 409 ALA ALA A . n 
A 1 375 ASN 375 410 410 ASN ASN A . n 
A 1 376 LEU 376 411 411 LEU LEU A . n 
A 1 377 THR 377 412 412 THR THR A . n 
A 1 378 CYS 378 413 413 CYS CYS A . n 
A 1 379 LYS 379 414 414 LYS LYS A . n 
A 1 380 LYS 380 415 415 LYS LYS A . n 
A 1 381 PRO 381 416 416 PRO PRO A . n 
A 1 382 ASP 382 417 417 ASP ASP A . n 
A 1 383 GLN 383 418 418 GLN GLN A . n 
A 1 384 HIS 384 419 419 HIS HIS A . n 
A 1 385 PHE 385 420 420 PHE PHE A . n 
A 1 386 LYS 386 421 421 LYS LYS A . n 
A 1 387 PRO 387 422 422 PRO PRO A . n 
A 1 388 TYR 388 423 423 TYR TYR A . n 
A 1 389 MET 389 424 424 MET MET A . n 
A 1 390 LYS 390 425 425 LYS LYS A . n 
A 1 391 GLN 391 426 426 GLN GLN A . n 
A 1 392 HIS 392 427 427 HIS HIS A . n 
A 1 393 LEU 393 428 428 LEU LEU A . n 
A 1 394 PRO 394 429 429 PRO PRO A . n 
A 1 395 LYS 395 430 430 LYS LYS A . n 
A 1 396 ARG 396 431 431 ARG ARG A . n 
A 1 397 LEU 397 432 432 LEU LEU A . n 
A 1 398 HIS 398 433 433 HIS HIS A . n 
A 1 399 TYR 399 434 434 TYR TYR A . n 
A 1 400 ALA 400 435 435 ALA ALA A . n 
A 1 401 ASN 401 436 436 ASN ASN A . n 
A 1 402 ASN 402 437 437 ASN ASN A . n 
A 1 403 ARG 403 438 438 ARG ARG A . n 
A 1 404 ARG 404 439 439 ARG ARG A . n 
A 1 405 ILE 405 440 440 ILE ILE A . n 
A 1 406 GLU 406 441 441 GLU GLU A . n 
A 1 407 ASP 407 442 442 ASP ASP A . n 
A 1 408 LEU 408 443 443 LEU LEU A . n 
A 1 409 HIS 409 444 444 HIS HIS A . n 
A 1 410 LEU 410 445 445 LEU LEU A . n 
A 1 411 LEU 411 446 446 LEU LEU A . n 
A 1 412 VAL 412 447 447 VAL VAL A . n 
A 1 413 GLU 413 448 448 GLU GLU A . n 
A 1 414 ARG 414 449 449 ARG ARG A . n 
A 1 415 ARG 415 450 450 ARG ARG A . n 
A 1 416 TRP 416 451 451 TRP TRP A . n 
A 1 417 HIS 417 452 452 HIS HIS A . n 
A 1 418 VAL 418 453 453 VAL VAL A . n 
A 1 419 ALA 419 454 454 ALA ALA A . n 
A 1 420 ARG 420 455 455 ARG ARG A . n 
A 1 421 LYS 421 456 456 LYS LYS A . n 
A 1 422 PRO 422 457 457 PRO PRO A . n 
A 1 423 LEU 423 458 458 LEU LEU A . n 
A 1 424 ASP 424 459 ?   ?   ?   A . n 
A 1 425 VAL 425 460 ?   ?   ?   A . n 
A 1 426 TYR 426 461 ?   ?   ?   A . n 
A 1 427 LYS 427 462 ?   ?   ?   A . n 
A 1 428 LYS 428 463 ?   ?   ?   A . n 
A 1 429 PRO 429 464 ?   ?   ?   A . n 
A 1 430 SER 430 465 ?   ?   ?   A . n 
A 1 431 GLY 431 466 ?   ?   ?   A . n 
A 1 432 LYS 432 467 ?   ?   ?   A . n 
A 1 433 CYS 433 468 468 CYS CYS A . n 
A 1 434 PHE 434 469 469 PHE PHE A . n 
A 1 435 PHE 435 470 470 PHE PHE A . n 
A 1 436 GLN 436 471 471 GLN GLN A . n 
A 1 437 GLY 437 472 472 GLY GLY A . n 
A 1 438 ASP 438 473 473 ASP ASP A . n 
A 1 439 HIS 439 474 474 HIS HIS A . n 
A 1 440 GLY 440 475 475 GLY GLY A . n 
A 1 441 PHE 441 476 476 PHE PHE A . n 
A 1 442 ASP 442 477 477 ASP ASP A . n 
A 1 443 ASN 443 478 478 ASN ASN A . n 
A 1 444 LYS 444 479 479 LYS LYS A . n 
A 1 445 VAL 445 480 480 VAL VAL A . n 
A 1 446 ASN 446 481 481 ASN ASN A . n 
A 1 447 SER 447 482 482 SER SER A . n 
A 1 448 MET 448 483 483 MET MET A . n 
A 1 449 GLN 449 484 484 GLN GLN A . n 
A 1 450 THR 450 485 485 THR THR A . n 
A 1 451 VAL 451 486 486 VAL VAL A . n 
A 1 452 PHE 452 487 487 PHE PHE A . n 
A 1 453 VAL 453 488 488 VAL VAL A . n 
A 1 454 GLY 454 489 489 GLY GLY A . n 
A 1 455 TYR 455 490 490 TYR TYR A . n 
A 1 456 GLY 456 491 491 GLY GLY A . n 
A 1 457 PRO 457 492 492 PRO PRO A . n 
A 1 458 THR 458 493 493 THR THR A . n 
A 1 459 PHE 459 494 494 PHE PHE A . n 
A 1 460 LYS 460 495 495 LYS LYS A . n 
A 1 461 TYR 461 496 496 TYR TYR A . n 
A 1 462 ARG 462 497 497 ARG ARG A . n 
A 1 463 THR 463 498 498 THR THR A . n 
A 1 464 LYS 464 499 499 LYS LYS A . n 
A 1 465 VAL 465 500 500 VAL VAL A . n 
A 1 466 PRO 466 501 501 PRO PRO A . n 
A 1 467 PRO 467 502 502 PRO PRO A . n 
A 1 468 PHE 468 503 503 PHE PHE A . n 
A 1 469 GLU 469 504 504 GLU GLU A . n 
A 1 470 ASN 470 505 505 ASN ASN A . n 
A 1 471 ILE 471 506 506 ILE ILE A . n 
A 1 472 GLU 472 507 507 GLU GLU A . n 
A 1 473 LEU 473 508 508 LEU LEU A . n 
A 1 474 TYR 474 509 509 TYR TYR A . n 
A 1 475 ASN 475 510 510 ASN ASN A . n 
A 1 476 VAL 476 511 511 VAL VAL A . n 
A 1 477 MET 477 512 512 MET MET A . n 
A 1 478 CYS 478 513 513 CYS CYS A . n 
A 1 479 ASP 479 514 514 ASP ASP A . n 
A 1 480 LEU 480 515 515 LEU LEU A . n 
A 1 481 LEU 481 516 516 LEU LEU A . n 
A 1 482 GLY 482 517 517 GLY GLY A . n 
A 1 483 LEU 483 518 518 LEU LEU A . n 
A 1 484 LYS 484 519 519 LYS LYS A . n 
A 1 485 PRO 485 520 520 PRO PRO A . n 
A 1 486 ALA 486 521 521 ALA ALA A . n 
A 1 487 PRO 487 522 522 PRO PRO A . n 
A 1 488 ASN 488 523 523 ASN ASN A . n 
A 1 489 ASN 489 524 524 ASN ASN A . n 
A 1 490 GLY 490 525 525 GLY GLY A . n 
A 1 491 THR 491 526 526 THR THR A . n 
A 1 492 HIS 492 527 527 HIS HIS A . n 
A 1 493 GLY 493 528 528 GLY GLY A . n 
A 1 494 SER 494 529 529 SER SER A . n 
A 1 495 LEU 495 530 530 LEU LEU A . n 
A 1 496 ASN 496 531 531 ASN ASN A . n 
A 1 497 HIS 497 532 532 HIS HIS A . n 
A 1 498 LEU 498 533 533 LEU LEU A . n 
A 1 499 LEU 499 534 534 LEU LEU A . n 
A 1 500 ARG 500 535 535 ARG ARG A . n 
A 1 501 THR 501 536 536 THR THR A . n 
A 1 502 ASN 502 537 537 ASN ASN A . n 
A 1 503 THR 503 538 538 THR THR A . n 
A 1 504 PHE 504 539 539 PHE PHE A . n 
A 1 505 ARG 505 540 540 ARG ARG A . n 
A 1 506 PRO 506 541 541 PRO PRO A . n 
A 1 507 THR 507 542 542 THR THR A . n 
A 1 508 LEU 508 543 543 LEU LEU A . n 
A 1 509 PRO 509 544 544 PRO PRO A . n 
A 1 510 GLU 510 545 545 GLU GLU A . n 
A 1 511 GLU 511 546 546 GLU GLU A . n 
A 1 512 VAL 512 547 547 VAL VAL A . n 
A 1 513 SER 513 548 548 SER SER A . n 
A 1 514 ARG 514 549 549 ARG ARG A . n 
A 1 515 PRO 515 550 550 PRO PRO A . n 
A 1 516 ASN 516 551 551 ASN ASN A . n 
A 1 517 TYR 517 552 552 TYR TYR A . n 
A 1 518 PRO 518 553 553 PRO PRO A . n 
A 1 519 GLY 519 554 554 GLY GLY A . n 
A 1 520 ILE 520 555 555 ILE ILE A . n 
A 1 521 MET 521 556 556 MET MET A . n 
A 1 522 TYR 522 557 557 TYR TYR A . n 
A 1 523 LEU 523 558 558 LEU LEU A . n 
A 1 524 GLN 524 559 559 GLN GLN A . n 
A 1 525 SER 525 560 560 SER SER A . n 
A 1 526 ASP 526 561 561 ASP ASP A . n 
A 1 527 PHE 527 562 562 PHE PHE A . n 
A 1 528 ASP 528 563 563 ASP ASP A . n 
A 1 529 LEU 529 564 564 LEU LEU A . n 
A 1 530 GLY 530 565 565 GLY GLY A . n 
A 1 531 CYS 531 566 566 CYS CYS A . n 
A 1 532 THR 532 567 567 THR THR A . n 
A 1 533 CYS 533 568 568 CYS CYS A . n 
A 1 534 ASP 534 569 569 ASP ASP A . n 
A 1 535 ASP 535 570 ?   ?   ?   A . n 
A 1 536 LYS 536 571 ?   ?   ?   A . n 
A 1 537 ASN 537 572 ?   ?   ?   A . n 
A 1 538 LYS 538 573 ?   ?   ?   A . n 
A 1 539 LEU 539 574 ?   ?   ?   A . n 
A 1 540 GLU 540 575 ?   ?   ?   A . n 
A 1 541 GLU 541 576 ?   ?   ?   A . n 
A 1 542 LEU 542 577 ?   ?   ?   A . n 
A 1 543 ASN 543 578 ?   ?   ?   A . n 
A 1 544 LYS 544 579 ?   ?   ?   A . n 
A 1 545 ARG 545 580 ?   ?   ?   A . n 
A 1 546 LEU 546 581 ?   ?   ?   A . n 
A 1 547 HIS 547 582 ?   ?   ?   A . n 
A 1 548 THR 548 583 ?   ?   ?   A . n 
A 1 549 LYS 549 584 ?   ?   ?   A . n 
A 1 550 GLY 550 585 585 GLY GLY A . n 
A 1 551 SER 551 586 586 SER SER A . n 
A 1 552 THR 552 587 587 THR THR A . n 
A 1 553 GLU 553 588 588 GLU GLU A . n 
A 1 554 GLU 554 589 589 GLU GLU A . n 
A 1 555 ARG 555 590 590 ARG ARG A . n 
A 1 556 HIS 556 591 591 HIS HIS A . n 
A 1 557 LEU 557 592 592 LEU LEU A . n 
A 1 558 LEU 558 593 593 LEU LEU A . n 
A 1 559 TYR 559 594 594 TYR TYR A . n 
A 1 560 GLY 560 595 595 GLY GLY A . n 
A 1 561 ARG 561 596 596 ARG ARG A . n 
A 1 562 PRO 562 597 597 PRO PRO A . n 
A 1 563 ALA 563 598 598 ALA ALA A . n 
A 1 564 VAL 564 599 599 VAL VAL A . n 
A 1 565 LEU 565 600 600 LEU LEU A . n 
A 1 566 TYR 566 601 601 TYR TYR A . n 
A 1 567 ARG 567 602 602 ARG ARG A . n 
A 1 568 THR 568 603 603 THR THR A . n 
A 1 569 SER 569 604 604 SER SER A . n 
A 1 570 TYR 570 605 605 TYR TYR A . n 
A 1 571 ASP 571 606 606 ASP ASP A . n 
A 1 572 ILE 572 607 607 ILE ILE A . n 
A 1 573 LEU 573 608 608 LEU LEU A . n 
A 1 574 TYR 574 609 609 TYR TYR A . n 
A 1 575 HIS 575 610 610 HIS HIS A . n 
A 1 576 THR 576 611 611 THR THR A . n 
A 1 577 ASP 577 612 612 ASP ASP A . n 
A 1 578 PHE 578 613 613 PHE PHE A . n 
A 1 579 GLU 579 614 614 GLU GLU A . n 
A 1 580 SER 580 615 615 SER SER A . n 
A 1 581 GLY 581 616 616 GLY GLY A . n 
A 1 582 TYR 582 617 617 TYR TYR A . n 
A 1 583 SER 583 618 618 SER SER A . n 
A 1 584 GLU 584 619 619 GLU GLU A . n 
A 1 585 ILE 585 620 620 ILE ILE A . n 
A 1 586 PHE 586 621 621 PHE PHE A . n 
A 1 587 LEU 587 622 622 LEU LEU A . n 
A 1 588 MET 588 623 623 MET MET A . n 
A 1 589 PRO 589 624 624 PRO PRO A . n 
A 1 590 LEU 590 625 625 LEU LEU A . n 
A 1 591 TRP 591 626 626 TRP TRP A . n 
A 1 592 THR 592 627 627 THR THR A . n 
A 1 593 SER 593 628 628 SER SER A . n 
A 1 594 TYR 594 629 629 TYR TYR A . n 
A 1 595 THR 595 630 630 THR THR A . n 
A 1 596 ILE 596 631 631 ILE ILE A . n 
A 1 597 SER 597 632 632 SER SER A . n 
A 1 598 LYS 598 633 633 LYS LYS A . n 
A 1 599 GLN 599 634 634 GLN GLN A . n 
A 1 600 ALA 600 635 635 ALA ALA A . n 
A 1 601 GLU 601 636 636 GLU GLU A . n 
A 1 602 VAL 602 637 637 VAL VAL A . n 
A 1 603 SER 603 638 638 SER SER A . n 
A 1 604 SER 604 639 639 SER SER A . n 
A 1 605 ILE 605 640 640 ILE ILE A . n 
A 1 606 PRO 606 641 641 PRO PRO A . n 
A 1 607 GLU 607 642 642 GLU GLU A . n 
A 1 608 HIS 608 643 643 HIS HIS A . n 
A 1 609 LEU 609 644 644 LEU LEU A . n 
A 1 610 THR 610 645 645 THR THR A . n 
A 1 611 ASN 611 646 646 ASN ASN A . n 
A 1 612 CYS 612 647 647 CYS CYS A . n 
A 1 613 VAL 613 648 648 VAL VAL A . n 
A 1 614 ARG 614 649 649 ARG ARG A . n 
A 1 615 PRO 615 650 650 PRO PRO A . n 
A 1 616 ASP 616 651 651 ASP ASP A . n 
A 1 617 VAL 617 652 652 VAL VAL A . n 
A 1 618 ARG 618 653 653 ARG ARG A . n 
A 1 619 VAL 619 654 654 VAL VAL A . n 
A 1 620 SER 620 655 655 SER SER A . n 
A 1 621 PRO 621 656 656 PRO PRO A . n 
A 1 622 GLY 622 657 657 GLY GLY A . n 
A 1 623 PHE 623 658 658 PHE PHE A . n 
A 1 624 SER 624 659 659 SER SER A . n 
A 1 625 GLN 625 660 660 GLN GLN A . n 
A 1 626 ASN 626 661 661 ASN ASN A . n 
A 1 627 CYS 627 662 662 CYS CYS A . n 
A 1 628 LEU 628 663 663 LEU LEU A . n 
A 1 629 ALA 629 664 664 ALA ALA A . n 
A 1 630 TYR 630 665 665 TYR TYR A . n 
A 1 631 LYS 631 666 666 LYS LYS A . n 
A 1 632 ASN 632 667 667 ASN ASN A . n 
A 1 633 ASP 633 668 668 ASP ASP A . n 
A 1 634 LYS 634 669 669 LYS LYS A . n 
A 1 635 GLN 635 670 670 GLN GLN A . n 
A 1 636 MET 636 671 671 MET MET A . n 
A 1 637 SER 637 672 672 SER SER A . n 
A 1 638 TYR 638 673 673 TYR TYR A . n 
A 1 639 GLY 639 674 674 GLY GLY A . n 
A 1 640 PHE 640 675 675 PHE PHE A . n 
A 1 641 LEU 641 676 676 LEU LEU A . n 
A 1 642 PHE 642 677 677 PHE PHE A . n 
A 1 643 PRO 643 678 678 PRO PRO A . n 
A 1 644 PRO 644 679 679 PRO PRO A . n 
A 1 645 TYR 645 680 680 TYR TYR A . n 
A 1 646 LEU 646 681 681 LEU LEU A . n 
A 1 647 SER 647 682 682 SER SER A . n 
A 1 648 SER 648 683 683 SER SER A . n 
A 1 649 SER 649 684 684 SER SER A . n 
A 1 650 PRO 650 685 685 PRO PRO A . n 
A 1 651 GLU 651 686 686 GLU GLU A . n 
A 1 652 ALA 652 687 687 ALA ALA A . n 
A 1 653 LYS 653 688 688 LYS LYS A . n 
A 1 654 TYR 654 689 689 TYR TYR A . n 
A 1 655 ASP 655 690 690 ASP ASP A . n 
A 1 656 ALA 656 691 691 ALA ALA A . n 
A 1 657 PHE 657 692 692 PHE PHE A . n 
A 1 658 LEU 658 693 693 LEU LEU A . n 
A 1 659 VAL 659 694 694 VAL VAL A . n 
A 1 660 THR 660 695 695 THR THR A . n 
A 1 661 ASN 661 696 696 ASN ASN A . n 
A 1 662 MET 662 697 697 MET MET A . n 
A 1 663 VAL 663 698 698 VAL VAL A . n 
A 1 664 PRO 664 699 699 PRO PRO A . n 
A 1 665 MET 665 700 700 MET MET A . n 
A 1 666 TYR 666 701 701 TYR TYR A . n 
A 1 667 PRO 667 702 702 PRO PRO A . n 
A 1 668 ALA 668 703 703 ALA ALA A . n 
A 1 669 PHE 669 704 704 PHE PHE A . n 
A 1 670 LYS 670 705 705 LYS LYS A . n 
A 1 671 ARG 671 706 706 ARG ARG A . n 
A 1 672 VAL 672 707 707 VAL VAL A . n 
A 1 673 TRP 673 708 708 TRP TRP A . n 
A 1 674 THR 674 709 709 THR THR A . n 
A 1 675 TYR 675 710 710 TYR TYR A . n 
A 1 676 PHE 676 711 711 PHE PHE A . n 
A 1 677 GLN 677 712 712 GLN GLN A . n 
A 1 678 ARG 678 713 713 ARG ARG A . n 
A 1 679 VAL 679 714 714 VAL VAL A . n 
A 1 680 LEU 680 715 715 LEU LEU A . n 
A 1 681 VAL 681 716 716 VAL VAL A . n 
A 1 682 LYS 682 717 717 LYS LYS A . n 
A 1 683 LYS 683 718 718 LYS LYS A . n 
A 1 684 TYR 684 719 719 TYR TYR A . n 
A 1 685 ALA 685 720 720 ALA ALA A . n 
A 1 686 SER 686 721 721 SER SER A . n 
A 1 687 GLU 687 722 722 GLU GLU A . n 
A 1 688 ARG 688 723 723 ARG ARG A . n 
A 1 689 ASN 689 724 724 ASN ASN A . n 
A 1 690 GLY 690 725 725 GLY GLY A . n 
A 1 691 VAL 691 726 726 VAL VAL A . n 
A 1 692 ASN 692 727 727 ASN ASN A . n 
A 1 693 VAL 693 728 728 VAL VAL A . n 
A 1 694 ILE 694 729 729 ILE ILE A . n 
A 1 695 SER 695 730 730 SER SER A . n 
A 1 696 GLY 696 731 731 GLY GLY A . n 
A 1 697 PRO 697 732 732 PRO PRO A . n 
A 1 698 ILE 698 733 733 ILE ILE A . n 
A 1 699 PHE 699 734 734 PHE PHE A . n 
A 1 700 ASP 700 735 735 ASP ASP A . n 
A 1 701 TYR 701 736 736 TYR TYR A . n 
A 1 702 ASN 702 737 737 ASN ASN A . n 
A 1 703 TYR 703 738 738 TYR TYR A . n 
A 1 704 ASN 704 739 739 ASN ASN A . n 
A 1 705 GLY 705 740 740 GLY GLY A . n 
A 1 706 LEU 706 741 741 LEU LEU A . n 
A 1 707 ARG 707 742 742 ARG ARG A . n 
A 1 708 ASP 708 743 743 ASP ASP A . n 
A 1 709 ILE 709 744 744 ILE ILE A . n 
A 1 710 GLU 710 745 745 GLU GLU A . n 
A 1 711 ASP 711 746 746 ASP ASP A . n 
A 1 712 GLU 712 747 747 GLU GLU A . n 
A 1 713 ILE 713 748 748 ILE ILE A . n 
A 1 714 LYS 714 749 749 LYS LYS A . n 
A 1 715 GLN 715 750 750 GLN GLN A . n 
A 1 716 TYR 716 751 751 TYR TYR A . n 
A 1 717 VAL 717 752 752 VAL VAL A . n 
A 1 718 GLU 718 753 753 GLU GLU A . n 
A 1 719 GLY 719 754 754 GLY GLY A . n 
A 1 720 SER 720 755 755 SER SER A . n 
A 1 721 SER 721 756 756 SER SER A . n 
A 1 722 ILE 722 757 757 ILE ILE A . n 
A 1 723 PRO 723 758 758 PRO PRO A . n 
A 1 724 VAL 724 759 759 VAL VAL A . n 
A 1 725 PRO 725 760 760 PRO PRO A . n 
A 1 726 THR 726 761 761 THR THR A . n 
A 1 727 HIS 727 762 762 HIS HIS A . n 
A 1 728 TYR 728 763 763 TYR TYR A . n 
A 1 729 TYR 729 764 764 TYR TYR A . n 
A 1 730 SER 730 765 765 SER SER A . n 
A 1 731 ILE 731 766 766 ILE ILE A . n 
A 1 732 ILE 732 767 767 ILE ILE A . n 
A 1 733 THR 733 768 768 THR THR A . n 
A 1 734 SER 734 769 769 SER SER A . n 
A 1 735 CYS 735 770 770 CYS CYS A . n 
A 1 736 LEU 736 771 771 LEU LEU A . n 
A 1 737 ASP 737 772 772 ASP ASP A . n 
A 1 738 PHE 738 773 773 PHE PHE A . n 
A 1 739 THR 739 774 774 THR THR A . n 
A 1 740 GLN 740 775 775 GLN GLN A . n 
A 1 741 PRO 741 776 776 PRO PRO A . n 
A 1 742 ALA 742 777 777 ALA ALA A . n 
A 1 743 ASP 743 778 778 ASP ASP A . n 
A 1 744 LYS 744 779 779 LYS LYS A . n 
A 1 745 CYS 745 780 780 CYS CYS A . n 
A 1 746 ASP 746 781 781 ASP ASP A . n 
A 1 747 GLY 747 782 782 GLY GLY A . n 
A 1 748 PRO 748 783 783 PRO PRO A . n 
A 1 749 LEU 749 784 784 LEU LEU A . n 
A 1 750 SER 750 785 785 SER SER A . n 
A 1 751 VAL 751 786 786 VAL VAL A . n 
A 1 752 SER 752 787 787 SER SER A . n 
A 1 753 SER 753 788 788 SER SER A . n 
A 1 754 PHE 754 789 789 PHE PHE A . n 
A 1 755 ILE 755 790 790 ILE ILE A . n 
A 1 756 LEU 756 791 791 LEU LEU A . n 
A 1 757 PRO 757 792 792 PRO PRO A . n 
A 1 758 HIS 758 793 793 HIS HIS A . n 
A 1 759 ARG 759 794 794 ARG ARG A . n 
A 1 760 PRO 760 795 795 PRO PRO A . n 
A 1 761 ASP 761 796 796 ASP ASP A . n 
A 1 762 ASN 762 797 797 ASN ASN A . n 
A 1 763 ASP 763 798 798 ASP ASP A . n 
A 1 764 GLU 764 799 799 GLU GLU A . n 
A 1 765 SER 765 800 800 SER SER A . n 
A 1 766 CYS 766 801 801 CYS CYS A . n 
A 1 767 ASN 767 802 802 ASN ASN A . n 
A 1 768 SER 768 803 803 SER SER A . n 
A 1 769 SER 769 804 804 SER SER A . n 
A 1 770 GLU 770 805 805 GLU GLU A . n 
A 1 771 ASP 771 806 806 ASP ASP A . n 
A 1 772 GLU 772 807 807 GLU GLU A . n 
A 1 773 SER 773 808 808 SER SER A . n 
A 1 774 LYS 774 809 809 LYS LYS A . n 
A 1 775 TRP 775 810 810 TRP TRP A . n 
A 1 776 VAL 776 811 811 VAL VAL A . n 
A 1 777 GLU 777 812 812 GLU GLU A . n 
A 1 778 GLU 778 813 813 GLU GLU A . n 
A 1 779 LEU 779 814 814 LEU LEU A . n 
A 1 780 MET 780 815 815 MET MET A . n 
A 1 781 LYS 781 816 816 LYS LYS A . n 
A 1 782 MET 782 817 817 MET MET A . n 
A 1 783 HIS 783 818 818 HIS HIS A . n 
A 1 784 THR 784 819 819 THR THR A . n 
A 1 785 ALA 785 820 820 ALA ALA A . n 
A 1 786 ARG 786 821 821 ARG ARG A . n 
A 1 787 VAL 787 822 822 VAL VAL A . n 
A 1 788 ARG 788 823 823 ARG ARG A . n 
A 1 789 ASP 789 824 824 ASP ASP A . n 
A 1 790 ILE 790 825 825 ILE ILE A . n 
A 1 791 GLU 791 826 826 GLU GLU A . n 
A 1 792 HIS 792 827 827 HIS HIS A . n 
A 1 793 LEU 793 828 828 LEU LEU A . n 
A 1 794 THR 794 829 829 THR THR A . n 
A 1 795 GLY 795 830 830 GLY GLY A . n 
A 1 796 LEU 796 831 831 LEU LEU A . n 
A 1 797 ASP 797 832 832 ASP ASP A . n 
A 1 798 PHE 798 833 833 PHE PHE A . n 
A 1 799 TYR 799 834 834 TYR TYR A . n 
A 1 800 ARG 800 835 835 ARG ARG A . n 
A 1 801 LYS 801 836 836 LYS LYS A . n 
A 1 802 THR 802 837 837 THR THR A . n 
A 1 803 SER 803 838 838 SER SER A . n 
A 1 804 ARG 804 839 839 ARG ARG A . n 
A 1 805 SER 805 840 840 SER SER A . n 
A 1 806 TYR 806 841 841 TYR TYR A . n 
A 1 807 SER 807 842 842 SER SER A . n 
A 1 808 GLU 808 843 843 GLU GLU A . n 
A 1 809 ILE 809 844 844 ILE ILE A . n 
A 1 810 LEU 810 845 845 LEU LEU A . n 
A 1 811 THR 811 846 846 THR THR A . n 
A 1 812 LEU 812 847 847 LEU LEU A . n 
A 1 813 LYS 813 848 848 LYS LYS A . n 
A 1 814 THR 814 849 849 THR THR A . n 
A 1 815 TYR 815 850 850 TYR TYR A . n 
A 1 816 LEU 816 851 851 LEU LEU A . n 
A 1 817 HIS 817 852 852 HIS HIS A . n 
A 1 818 THR 818 853 853 THR THR A . n 
A 1 819 TYR 819 854 854 TYR TYR A . n 
A 1 820 GLU 820 855 855 GLU GLU A . n 
A 1 821 SER 821 856 ?   ?   ?   A . n 
A 1 822 GLU 822 857 ?   ?   ?   A . n 
A 1 823 ILE 823 858 ?   ?   ?   A . n 
A 1 824 SER 824 859 ?   ?   ?   A . n 
A 1 825 ARG 825 860 ?   ?   ?   A . n 
A 1 826 GLU 826 861 ?   ?   ?   A . n 
A 1 827 ASN 827 862 ?   ?   ?   A . n 
A 1 828 LEU 828 863 ?   ?   ?   A . n 
A 1 829 TYR 829 864 ?   ?   ?   A . n 
A 1 830 PHE 830 865 ?   ?   ?   A . n 
A 1 831 GLN 831 866 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E  4  ZN  1   1001 1001 ZN  ZN  A . 
F  4  ZN  1   1002 1002 ZN  ZN  A . 
G  5  CA  1   1003 1003 CA  CA  A . 
H  6  NA  1   1004 1004 NA  NA  A . 
I  7  K   1   1005 1005 K   K   A . 
J  8  NKO 1   1006 1006 NKO DRG A . 
K  8  NKO 1   1007 1007 NKO DRG A . 
L  9  SCN 1   1008 1008 SCN SCN A . 
M  9  SCN 1   1009 1009 SCN SCN A . 
N  10 EDO 1   1010 1010 EDO EDO A . 
O  10 EDO 1   1011 1011 EDO EDO A . 
P  10 EDO 1   1012 1012 EDO EDO A . 
Q  10 EDO 1   1013 1013 EDO EDO A . 
R  10 EDO 1   1014 1014 EDO EDO A . 
S  10 EDO 1   1015 1015 EDO EDO A . 
T  10 EDO 1   1016 1016 EDO EDO A . 
U  10 EDO 1   1017 1017 EDO EDO A . 
V  10 EDO 1   1018 1018 EDO EDO A . 
W  10 EDO 1   1019 1019 EDO EDO A . 
X  10 EDO 1   1020 1020 EDO EDO A . 
Y  10 EDO 1   1021 1021 EDO EDO A . 
Z  10 EDO 1   1022 1022 EDO EDO A . 
AA 10 EDO 1   1023 1023 EDO EDO A . 
BA 10 EDO 1   1024 1024 EDO EDO A . 
CA 10 EDO 1   1025 1025 EDO EDO A . 
DA 10 EDO 1   1026 1026 EDO EDO A . 
EA 10 EDO 1   1027 1027 EDO EDO A . 
FA 10 EDO 1   1028 1028 EDO EDO A . 
GA 10 EDO 1   1029 1029 EDO EDO A . 
HA 11 HOH 1   1    1    HOH HOH A . 
HA 11 HOH 2   2    2    HOH HOH A . 
HA 11 HOH 3   3    3    HOH HOH A . 
HA 11 HOH 4   4    4    HOH HOH A . 
HA 11 HOH 5   5    5    HOH HOH A . 
HA 11 HOH 6   6    6    HOH HOH A . 
HA 11 HOH 7   7    7    HOH HOH A . 
HA 11 HOH 8   8    8    HOH HOH A . 
HA 11 HOH 9   9    9    HOH HOH A . 
HA 11 HOH 10  10   10   HOH HOH A . 
HA 11 HOH 11  11   11   HOH HOH A . 
HA 11 HOH 12  12   12   HOH HOH A . 
HA 11 HOH 13  13   13   HOH HOH A . 
HA 11 HOH 14  14   14   HOH HOH A . 
HA 11 HOH 15  15   15   HOH HOH A . 
HA 11 HOH 16  16   16   HOH HOH A . 
HA 11 HOH 17  17   17   HOH HOH A . 
HA 11 HOH 18  18   18   HOH HOH A . 
HA 11 HOH 19  19   19   HOH HOH A . 
HA 11 HOH 20  20   20   HOH HOH A . 
HA 11 HOH 21  21   21   HOH HOH A . 
HA 11 HOH 22  22   22   HOH HOH A . 
HA 11 HOH 23  23   23   HOH HOH A . 
HA 11 HOH 24  24   24   HOH HOH A . 
HA 11 HOH 25  25   25   HOH HOH A . 
HA 11 HOH 26  26   26   HOH HOH A . 
HA 11 HOH 27  27   27   HOH HOH A . 
HA 11 HOH 28  28   28   HOH HOH A . 
HA 11 HOH 29  29   29   HOH HOH A . 
HA 11 HOH 30  30   30   HOH HOH A . 
HA 11 HOH 31  31   31   HOH HOH A . 
HA 11 HOH 32  32   32   HOH HOH A . 
HA 11 HOH 33  33   33   HOH HOH A . 
HA 11 HOH 34  34   34   HOH HOH A . 
HA 11 HOH 35  35   35   HOH HOH A . 
HA 11 HOH 36  867  36   HOH HOH A . 
HA 11 HOH 37  868  37   HOH HOH A . 
HA 11 HOH 38  869  38   HOH HOH A . 
HA 11 HOH 39  870  39   HOH HOH A . 
HA 11 HOH 40  871  40   HOH HOH A . 
HA 11 HOH 41  872  41   HOH HOH A . 
HA 11 HOH 42  873  42   HOH HOH A . 
HA 11 HOH 43  874  43   HOH HOH A . 
HA 11 HOH 44  875  44   HOH HOH A . 
HA 11 HOH 45  876  45   HOH HOH A . 
HA 11 HOH 46  877  46   HOH HOH A . 
HA 11 HOH 47  878  47   HOH HOH A . 
HA 11 HOH 48  879  48   HOH HOH A . 
HA 11 HOH 49  880  49   HOH HOH A . 
HA 11 HOH 50  881  50   HOH HOH A . 
HA 11 HOH 51  882  51   HOH HOH A . 
HA 11 HOH 52  883  52   HOH HOH A . 
HA 11 HOH 53  884  53   HOH HOH A . 
HA 11 HOH 54  885  54   HOH HOH A . 
HA 11 HOH 55  886  55   HOH HOH A . 
HA 11 HOH 56  887  56   HOH HOH A . 
HA 11 HOH 57  888  57   HOH HOH A . 
HA 11 HOH 58  889  58   HOH HOH A . 
HA 11 HOH 59  890  59   HOH HOH A . 
HA 11 HOH 60  891  60   HOH HOH A . 
HA 11 HOH 61  892  61   HOH HOH A . 
HA 11 HOH 62  893  62   HOH HOH A . 
HA 11 HOH 63  894  63   HOH HOH A . 
HA 11 HOH 64  895  64   HOH HOH A . 
HA 11 HOH 65  896  65   HOH HOH A . 
HA 11 HOH 66  897  66   HOH HOH A . 
HA 11 HOH 67  906  67   HOH HOH A . 
HA 11 HOH 68  909  68   HOH HOH A . 
HA 11 HOH 69  910  69   HOH HOH A . 
HA 11 HOH 70  911  70   HOH HOH A . 
HA 11 HOH 71  912  71   HOH HOH A . 
HA 11 HOH 72  913  72   HOH HOH A . 
HA 11 HOH 73  914  73   HOH HOH A . 
HA 11 HOH 74  915  74   HOH HOH A . 
HA 11 HOH 75  916  75   HOH HOH A . 
HA 11 HOH 76  917  76   HOH HOH A . 
HA 11 HOH 77  918  77   HOH HOH A . 
HA 11 HOH 78  919  78   HOH HOH A . 
HA 11 HOH 79  920  79   HOH HOH A . 
HA 11 HOH 80  921  80   HOH HOH A . 
HA 11 HOH 81  922  81   HOH HOH A . 
HA 11 HOH 82  923  82   HOH HOH A . 
HA 11 HOH 83  924  83   HOH HOH A . 
HA 11 HOH 84  925  84   HOH HOH A . 
HA 11 HOH 85  926  85   HOH HOH A . 
HA 11 HOH 86  927  86   HOH HOH A . 
HA 11 HOH 87  928  87   HOH HOH A . 
HA 11 HOH 88  929  88   HOH HOH A . 
HA 11 HOH 89  930  89   HOH HOH A . 
HA 11 HOH 90  931  90   HOH HOH A . 
HA 11 HOH 91  932  91   HOH HOH A . 
HA 11 HOH 92  933  92   HOH HOH A . 
HA 11 HOH 93  934  93   HOH HOH A . 
HA 11 HOH 94  935  94   HOH HOH A . 
HA 11 HOH 95  936  95   HOH HOH A . 
HA 11 HOH 96  937  96   HOH HOH A . 
HA 11 HOH 97  938  97   HOH HOH A . 
HA 11 HOH 98  939  98   HOH HOH A . 
HA 11 HOH 99  940  99   HOH HOH A . 
HA 11 HOH 100 941  100  HOH HOH A . 
HA 11 HOH 101 942  101  HOH HOH A . 
HA 11 HOH 102 943  102  HOH HOH A . 
HA 11 HOH 103 944  103  HOH HOH A . 
HA 11 HOH 104 945  104  HOH HOH A . 
HA 11 HOH 105 946  105  HOH HOH A . 
HA 11 HOH 106 947  106  HOH HOH A . 
HA 11 HOH 107 948  107  HOH HOH A . 
HA 11 HOH 108 949  108  HOH HOH A . 
HA 11 HOH 109 950  109  HOH HOH A . 
HA 11 HOH 110 951  110  HOH HOH A . 
HA 11 HOH 111 952  111  HOH HOH A . 
HA 11 HOH 112 953  112  HOH HOH A . 
HA 11 HOH 113 954  113  HOH HOH A . 
HA 11 HOH 114 955  114  HOH HOH A . 
HA 11 HOH 115 956  115  HOH HOH A . 
HA 11 HOH 116 957  116  HOH HOH A . 
HA 11 HOH 117 958  117  HOH HOH A . 
HA 11 HOH 118 959  118  HOH HOH A . 
HA 11 HOH 119 960  119  HOH HOH A . 
HA 11 HOH 120 961  120  HOH HOH A . 
HA 11 HOH 121 962  121  HOH HOH A . 
HA 11 HOH 122 963  122  HOH HOH A . 
HA 11 HOH 123 964  123  HOH HOH A . 
HA 11 HOH 124 965  124  HOH HOH A . 
HA 11 HOH 125 966  125  HOH HOH A . 
HA 11 HOH 126 967  126  HOH HOH A . 
HA 11 HOH 127 968  127  HOH HOH A . 
HA 11 HOH 128 969  128  HOH HOH A . 
HA 11 HOH 129 970  129  HOH HOH A . 
HA 11 HOH 130 971  130  HOH HOH A . 
HA 11 HOH 131 972  131  HOH HOH A . 
HA 11 HOH 132 973  132  HOH HOH A . 
HA 11 HOH 133 974  133  HOH HOH A . 
HA 11 HOH 134 975  134  HOH HOH A . 
HA 11 HOH 135 976  135  HOH HOH A . 
HA 11 HOH 136 977  136  HOH HOH A . 
HA 11 HOH 137 978  137  HOH HOH A . 
HA 11 HOH 138 979  138  HOH HOH A . 
HA 11 HOH 139 980  139  HOH HOH A . 
HA 11 HOH 140 981  140  HOH HOH A . 
HA 11 HOH 141 982  141  HOH HOH A . 
HA 11 HOH 142 983  142  HOH HOH A . 
HA 11 HOH 143 984  143  HOH HOH A . 
HA 11 HOH 144 985  144  HOH HOH A . 
HA 11 HOH 145 986  145  HOH HOH A . 
HA 11 HOH 146 987  146  HOH HOH A . 
HA 11 HOH 147 988  147  HOH HOH A . 
HA 11 HOH 148 989  148  HOH HOH A . 
HA 11 HOH 149 990  149  HOH HOH A . 
HA 11 HOH 150 991  150  HOH HOH A . 
HA 11 HOH 151 992  151  HOH HOH A . 
HA 11 HOH 152 993  152  HOH HOH A . 
HA 11 HOH 153 994  153  HOH HOH A . 
HA 11 HOH 154 995  154  HOH HOH A . 
HA 11 HOH 155 996  155  HOH HOH A . 
HA 11 HOH 156 997  156  HOH HOH A . 
HA 11 HOH 157 998  157  HOH HOH A . 
HA 11 HOH 158 999  158  HOH HOH A . 
HA 11 HOH 159 1000 159  HOH HOH A . 
HA 11 HOH 160 1030 160  HOH HOH A . 
HA 11 HOH 161 1031 161  HOH HOH A . 
HA 11 HOH 162 1032 162  HOH HOH A . 
HA 11 HOH 163 1033 163  HOH HOH A . 
HA 11 HOH 164 1034 164  HOH HOH A . 
HA 11 HOH 165 1035 165  HOH HOH A . 
HA 11 HOH 166 1036 166  HOH HOH A . 
HA 11 HOH 167 1037 167  HOH HOH A . 
HA 11 HOH 168 1038 168  HOH HOH A . 
HA 11 HOH 169 1039 169  HOH HOH A . 
HA 11 HOH 170 1040 170  HOH HOH A . 
HA 11 HOH 171 1041 171  HOH HOH A . 
HA 11 HOH 172 1042 172  HOH HOH A . 
HA 11 HOH 173 1043 173  HOH HOH A . 
HA 11 HOH 174 1044 174  HOH HOH A . 
HA 11 HOH 175 1045 175  HOH HOH A . 
HA 11 HOH 176 1046 176  HOH HOH A . 
HA 11 HOH 177 1047 177  HOH HOH A . 
HA 11 HOH 178 1048 178  HOH HOH A . 
HA 11 HOH 179 1049 179  HOH HOH A . 
HA 11 HOH 180 1050 180  HOH HOH A . 
HA 11 HOH 181 1051 181  HOH HOH A . 
HA 11 HOH 182 1052 182  HOH HOH A . 
HA 11 HOH 183 1053 183  HOH HOH A . 
HA 11 HOH 184 1054 184  HOH HOH A . 
HA 11 HOH 185 1055 185  HOH HOH A . 
HA 11 HOH 186 1056 186  HOH HOH A . 
HA 11 HOH 187 1057 187  HOH HOH A . 
HA 11 HOH 188 1058 188  HOH HOH A . 
HA 11 HOH 189 1059 189  HOH HOH A . 
HA 11 HOH 190 1060 190  HOH HOH A . 
HA 11 HOH 191 1061 191  HOH HOH A . 
HA 11 HOH 192 1062 192  HOH HOH A . 
HA 11 HOH 193 1063 193  HOH HOH A . 
HA 11 HOH 194 1064 194  HOH HOH A . 
HA 11 HOH 195 1065 195  HOH HOH A . 
HA 11 HOH 196 1066 196  HOH HOH A . 
HA 11 HOH 197 1067 197  HOH HOH A . 
HA 11 HOH 198 1068 198  HOH HOH A . 
HA 11 HOH 199 1069 199  HOH HOH A . 
HA 11 HOH 200 1070 200  HOH HOH A . 
HA 11 HOH 201 1071 201  HOH HOH A . 
HA 11 HOH 202 1072 202  HOH HOH A . 
HA 11 HOH 203 1073 203  HOH HOH A . 
HA 11 HOH 204 1074 204  HOH HOH A . 
HA 11 HOH 205 1075 205  HOH HOH A . 
HA 11 HOH 206 1076 206  HOH HOH A . 
HA 11 HOH 207 1077 207  HOH HOH A . 
HA 11 HOH 208 1078 208  HOH HOH A . 
HA 11 HOH 209 1079 209  HOH HOH A . 
HA 11 HOH 210 1080 210  HOH HOH A . 
HA 11 HOH 211 1081 211  HOH HOH A . 
HA 11 HOH 212 1082 212  HOH HOH A . 
HA 11 HOH 213 1083 213  HOH HOH A . 
HA 11 HOH 214 1084 214  HOH HOH A . 
HA 11 HOH 215 1085 215  HOH HOH A . 
HA 11 HOH 216 1086 216  HOH HOH A . 
HA 11 HOH 217 1087 217  HOH HOH A . 
HA 11 HOH 218 1088 218  HOH HOH A . 
HA 11 HOH 219 1089 219  HOH HOH A . 
HA 11 HOH 220 1090 220  HOH HOH A . 
HA 11 HOH 221 1091 221  HOH HOH A . 
HA 11 HOH 222 1092 222  HOH HOH A . 
HA 11 HOH 223 1093 223  HOH HOH A . 
HA 11 HOH 224 1094 224  HOH HOH A . 
HA 11 HOH 225 1095 225  HOH HOH A . 
HA 11 HOH 226 1096 226  HOH HOH A . 
HA 11 HOH 227 1097 227  HOH HOH A . 
HA 11 HOH 228 1098 228  HOH HOH A . 
HA 11 HOH 229 1099 229  HOH HOH A . 
HA 11 HOH 230 1100 230  HOH HOH A . 
HA 11 HOH 231 1101 231  HOH HOH A . 
HA 11 HOH 232 1102 232  HOH HOH A . 
HA 11 HOH 233 1103 233  HOH HOH A . 
HA 11 HOH 234 1104 234  HOH HOH A . 
HA 11 HOH 235 1105 235  HOH HOH A . 
HA 11 HOH 236 1106 236  HOH HOH A . 
HA 11 HOH 237 1107 237  HOH HOH A . 
HA 11 HOH 238 1108 238  HOH HOH A . 
HA 11 HOH 239 1109 239  HOH HOH A . 
HA 11 HOH 240 1110 240  HOH HOH A . 
HA 11 HOH 241 1111 241  HOH HOH A . 
HA 11 HOH 242 1112 242  HOH HOH A . 
HA 11 HOH 243 1113 243  HOH HOH A . 
HA 11 HOH 244 1114 244  HOH HOH A . 
HA 11 HOH 245 1115 245  HOH HOH A . 
HA 11 HOH 246 1116 246  HOH HOH A . 
HA 11 HOH 247 1117 247  HOH HOH A . 
HA 11 HOH 248 1118 248  HOH HOH A . 
HA 11 HOH 249 1119 249  HOH HOH A . 
HA 11 HOH 250 1120 250  HOH HOH A . 
HA 11 HOH 251 1121 251  HOH HOH A . 
HA 11 HOH 252 1122 252  HOH HOH A . 
HA 11 HOH 253 1123 253  HOH HOH A . 
HA 11 HOH 254 1124 254  HOH HOH A . 
HA 11 HOH 255 1125 255  HOH HOH A . 
HA 11 HOH 256 1126 256  HOH HOH A . 
HA 11 HOH 257 1127 257  HOH HOH A . 
HA 11 HOH 258 1128 258  HOH HOH A . 
HA 11 HOH 259 1129 259  HOH HOH A . 
HA 11 HOH 260 1130 260  HOH HOH A . 
HA 11 HOH 261 1131 261  HOH HOH A . 
HA 11 HOH 262 1132 262  HOH HOH A . 
HA 11 HOH 263 1133 263  HOH HOH A . 
HA 11 HOH 264 1134 264  HOH HOH A . 
HA 11 HOH 265 1135 265  HOH HOH A . 
HA 11 HOH 266 1136 266  HOH HOH A . 
HA 11 HOH 267 1137 267  HOH HOH A . 
HA 11 HOH 268 1138 268  HOH HOH A . 
HA 11 HOH 269 1139 269  HOH HOH A . 
HA 11 HOH 270 1140 270  HOH HOH A . 
HA 11 HOH 271 1141 271  HOH HOH A . 
HA 11 HOH 272 1142 272  HOH HOH A . 
HA 11 HOH 273 1143 273  HOH HOH A . 
HA 11 HOH 274 1144 274  HOH HOH A . 
HA 11 HOH 275 1145 275  HOH HOH A . 
HA 11 HOH 276 1146 276  HOH HOH A . 
HA 11 HOH 277 1147 277  HOH HOH A . 
HA 11 HOH 278 1148 278  HOH HOH A . 
HA 11 HOH 279 1149 279  HOH HOH A . 
HA 11 HOH 280 1150 280  HOH HOH A . 
HA 11 HOH 281 1151 281  HOH HOH A . 
HA 11 HOH 282 1152 282  HOH HOH A . 
HA 11 HOH 283 1153 283  HOH HOH A . 
HA 11 HOH 284 1154 284  HOH HOH A . 
HA 11 HOH 285 1155 285  HOH HOH A . 
HA 11 HOH 286 1156 286  HOH HOH A . 
HA 11 HOH 287 1157 287  HOH HOH A . 
HA 11 HOH 288 1158 288  HOH HOH A . 
HA 11 HOH 289 1159 289  HOH HOH A . 
HA 11 HOH 290 1160 290  HOH HOH A . 
HA 11 HOH 291 1161 291  HOH HOH A . 
HA 11 HOH 292 1162 292  HOH HOH A . 
HA 11 HOH 293 1163 293  HOH HOH A . 
HA 11 HOH 294 1164 294  HOH HOH A . 
HA 11 HOH 295 1165 295  HOH HOH A . 
HA 11 HOH 296 1166 296  HOH HOH A . 
HA 11 HOH 297 1167 297  HOH HOH A . 
HA 11 HOH 298 1168 298  HOH HOH A . 
HA 11 HOH 299 1169 299  HOH HOH A . 
HA 11 HOH 300 1170 300  HOH HOH A . 
HA 11 HOH 301 1171 301  HOH HOH A . 
HA 11 HOH 302 1172 302  HOH HOH A . 
HA 11 HOH 303 1173 303  HOH HOH A . 
HA 11 HOH 304 1174 304  HOH HOH A . 
HA 11 HOH 305 1175 305  HOH HOH A . 
HA 11 HOH 306 1176 306  HOH HOH A . 
HA 11 HOH 307 1177 307  HOH HOH A . 
HA 11 HOH 308 1178 308  HOH HOH A . 
HA 11 HOH 309 1179 309  HOH HOH A . 
HA 11 HOH 310 1180 310  HOH HOH A . 
HA 11 HOH 311 1181 311  HOH HOH A . 
HA 11 HOH 312 1182 312  HOH HOH A . 
HA 11 HOH 313 1183 313  HOH HOH A . 
HA 11 HOH 314 1184 314  HOH HOH A . 
HA 11 HOH 315 1185 315  HOH HOH A . 
HA 11 HOH 316 1186 316  HOH HOH A . 
HA 11 HOH 317 1187 317  HOH HOH A . 
HA 11 HOH 318 1188 318  HOH HOH A . 
HA 11 HOH 319 1189 319  HOH HOH A . 
HA 11 HOH 320 1190 320  HOH HOH A . 
HA 11 HOH 321 1191 321  HOH HOH A . 
HA 11 HOH 322 1192 322  HOH HOH A . 
HA 11 HOH 323 1193 323  HOH HOH A . 
HA 11 HOH 324 1194 324  HOH HOH A . 
HA 11 HOH 325 1195 325  HOH HOH A . 
HA 11 HOH 326 1196 326  HOH HOH A . 
HA 11 HOH 327 1197 327  HOH HOH A . 
HA 11 HOH 328 1198 328  HOH HOH A . 
HA 11 HOH 329 1199 329  HOH HOH A . 
HA 11 HOH 330 1200 330  HOH HOH A . 
HA 11 HOH 331 1201 331  HOH HOH A . 
HA 11 HOH 332 1202 332  HOH HOH A . 
HA 11 HOH 333 1203 333  HOH HOH A . 
HA 11 HOH 334 1204 334  HOH HOH A . 
HA 11 HOH 335 1205 335  HOH HOH A . 
HA 11 HOH 336 1206 336  HOH HOH A . 
HA 11 HOH 337 1207 337  HOH HOH A . 
HA 11 HOH 338 1208 338  HOH HOH A . 
HA 11 HOH 339 1209 339  HOH HOH A . 
HA 11 HOH 340 1210 340  HOH HOH A . 
HA 11 HOH 341 1211 341  HOH HOH A . 
HA 11 HOH 342 1212 342  HOH HOH A . 
HA 11 HOH 343 1213 343  HOH HOH A . 
HA 11 HOH 344 1214 344  HOH HOH A . 
HA 11 HOH 345 1215 345  HOH HOH A . 
HA 11 HOH 346 1216 346  HOH HOH A . 
HA 11 HOH 347 1217 347  HOH HOH A . 
HA 11 HOH 348 1218 348  HOH HOH A . 
HA 11 HOH 349 1219 349  HOH HOH A . 
HA 11 HOH 350 1220 350  HOH HOH A . 
HA 11 HOH 351 1221 351  HOH HOH A . 
HA 11 HOH 352 1222 352  HOH HOH A . 
HA 11 HOH 353 1223 353  HOH HOH A . 
HA 11 HOH 354 1224 354  HOH HOH A . 
HA 11 HOH 355 1225 355  HOH HOH A . 
HA 11 HOH 356 1226 356  HOH HOH A . 
HA 11 HOH 357 1227 357  HOH HOH A . 
HA 11 HOH 358 1228 358  HOH HOH A . 
HA 11 HOH 359 1229 359  HOH HOH A . 
HA 11 HOH 360 1230 360  HOH HOH A . 
HA 11 HOH 361 1231 361  HOH HOH A . 
HA 11 HOH 362 1232 362  HOH HOH A . 
HA 11 HOH 363 1233 363  HOH HOH A . 
HA 11 HOH 364 1234 364  HOH HOH A . 
HA 11 HOH 365 1235 365  HOH HOH A . 
HA 11 HOH 366 1236 366  HOH HOH A . 
HA 11 HOH 367 1237 367  HOH HOH A . 
HA 11 HOH 368 1238 368  HOH HOH A . 
HA 11 HOH 369 1239 369  HOH HOH A . 
HA 11 HOH 370 1240 370  HOH HOH A . 
HA 11 HOH 371 1241 371  HOH HOH A . 
HA 11 HOH 372 1242 372  HOH HOH A . 
HA 11 HOH 373 1243 373  HOH HOH A . 
HA 11 HOH 374 1244 374  HOH HOH A . 
HA 11 HOH 375 1245 375  HOH HOH A . 
HA 11 HOH 376 1246 376  HOH HOH A . 
HA 11 HOH 377 1247 377  HOH HOH A . 
HA 11 HOH 378 1248 378  HOH HOH A . 
HA 11 HOH 379 1249 379  HOH HOH A . 
HA 11 HOH 380 1250 380  HOH HOH A . 
HA 11 HOH 381 1251 381  HOH HOH A . 
HA 11 HOH 382 1252 382  HOH HOH A . 
HA 11 HOH 383 1253 383  HOH HOH A . 
HA 11 HOH 384 1254 384  HOH HOH A . 
HA 11 HOH 385 1255 385  HOH HOH A . 
HA 11 HOH 386 1256 386  HOH HOH A . 
HA 11 HOH 387 1257 387  HOH HOH A . 
HA 11 HOH 388 1258 388  HOH HOH A . 
HA 11 HOH 389 1259 389  HOH HOH A . 
HA 11 HOH 390 1260 390  HOH HOH A . 
HA 11 HOH 391 1261 391  HOH HOH A . 
HA 11 HOH 392 1262 392  HOH HOH A . 
HA 11 HOH 393 1263 393  HOH HOH A . 
HA 11 HOH 394 1264 394  HOH HOH A . 
HA 11 HOH 395 1265 395  HOH HOH A . 
HA 11 HOH 396 1266 396  HOH HOH A . 
HA 11 HOH 397 1267 397  HOH HOH A . 
HA 11 HOH 398 1268 398  HOH HOH A . 
HA 11 HOH 399 1269 399  HOH HOH A . 
HA 11 HOH 400 1270 400  HOH HOH A . 
HA 11 HOH 401 1271 401  HOH HOH A . 
HA 11 HOH 402 1272 402  HOH HOH A . 
HA 11 HOH 403 1273 403  HOH HOH A . 
HA 11 HOH 404 1274 404  HOH HOH A . 
HA 11 HOH 405 1275 405  HOH HOH A . 
HA 11 HOH 406 1276 406  HOH HOH A . 
HA 11 HOH 407 1277 407  HOH HOH A . 
HA 11 HOH 408 1278 408  HOH HOH A . 
HA 11 HOH 409 1279 409  HOH HOH A . 
HA 11 HOH 410 1280 410  HOH HOH A . 
HA 11 HOH 411 1281 411  HOH HOH A . 
HA 11 HOH 412 1282 412  HOH HOH A . 
HA 11 HOH 413 1283 413  HOH HOH A . 
HA 11 HOH 414 1284 414  HOH HOH A . 
HA 11 HOH 415 1285 415  HOH HOH A . 
HA 11 HOH 416 1286 416  HOH HOH A . 
HA 11 HOH 417 1287 417  HOH HOH A . 
HA 11 HOH 418 1288 418  HOH HOH A . 
HA 11 HOH 419 1289 419  HOH HOH A . 
HA 11 HOH 420 1290 420  HOH HOH A . 
HA 11 HOH 421 1291 421  HOH HOH A . 
HA 11 HOH 422 1292 422  HOH HOH A . 
HA 11 HOH 423 1293 423  HOH HOH A . 
HA 11 HOH 424 1294 424  HOH HOH A . 
HA 11 HOH 425 1295 425  HOH HOH A . 
HA 11 HOH 426 1296 426  HOH HOH A . 
HA 11 HOH 427 1297 427  HOH HOH A . 
HA 11 HOH 428 1298 428  HOH HOH A . 
HA 11 HOH 429 1299 429  HOH HOH A . 
HA 11 HOH 430 1300 430  HOH HOH A . 
HA 11 HOH 431 1301 431  HOH HOH A . 
HA 11 HOH 432 1302 432  HOH HOH A . 
HA 11 HOH 433 1303 433  HOH HOH A . 
HA 11 HOH 434 1304 434  HOH HOH A . 
HA 11 HOH 435 1305 435  HOH HOH A . 
HA 11 HOH 436 1306 436  HOH HOH A . 
HA 11 HOH 437 1307 437  HOH HOH A . 
HA 11 HOH 438 1308 438  HOH HOH A . 
HA 11 HOH 439 1309 439  HOH HOH A . 
HA 11 HOH 440 1310 440  HOH HOH A . 
HA 11 HOH 441 1311 441  HOH HOH A . 
HA 11 HOH 442 1312 442  HOH HOH A . 
HA 11 HOH 443 1313 443  HOH HOH A . 
HA 11 HOH 444 1314 444  HOH HOH A . 
HA 11 HOH 445 1315 445  HOH HOH A . 
HA 11 HOH 446 1316 446  HOH HOH A . 
HA 11 HOH 447 1317 447  HOH HOH A . 
HA 11 HOH 448 1318 448  HOH HOH A . 
HA 11 HOH 449 1319 449  HOH HOH A . 
HA 11 HOH 450 1320 450  HOH HOH A . 
HA 11 HOH 451 1321 451  HOH HOH A . 
HA 11 HOH 452 1322 452  HOH HOH A . 
HA 11 HOH 453 1323 453  HOH HOH A . 
HA 11 HOH 454 1324 454  HOH HOH A . 
HA 11 HOH 455 1325 455  HOH HOH A . 
HA 11 HOH 456 1326 456  HOH HOH A . 
HA 11 HOH 457 1327 457  HOH HOH A . 
HA 11 HOH 458 1328 458  HOH HOH A . 
HA 11 HOH 459 1329 459  HOH HOH A . 
HA 11 HOH 460 1330 460  HOH HOH A . 
HA 11 HOH 461 1331 461  HOH HOH A . 
HA 11 HOH 462 1332 462  HOH HOH A . 
HA 11 HOH 463 1333 463  HOH HOH A . 
HA 11 HOH 464 1334 464  HOH HOH A . 
HA 11 HOH 465 1335 465  HOH HOH A . 
HA 11 HOH 466 1336 466  HOH HOH A . 
HA 11 HOH 467 1337 467  HOH HOH A . 
HA 11 HOH 468 1338 468  HOH HOH A . 
HA 11 HOH 469 1339 469  HOH HOH A . 
HA 11 HOH 470 1340 471  HOH HOH A . 
HA 11 HOH 471 1341 472  HOH HOH A . 
HA 11 HOH 472 1342 473  HOH HOH A . 
HA 11 HOH 473 1343 474  HOH HOH A . 
HA 11 HOH 474 1344 475  HOH HOH A . 
HA 11 HOH 475 1345 476  HOH HOH A . 
HA 11 HOH 476 1346 477  HOH HOH A . 
HA 11 HOH 477 1347 478  HOH HOH A . 
HA 11 HOH 478 1348 479  HOH HOH A . 
HA 11 HOH 479 1349 480  HOH HOH A . 
HA 11 HOH 480 1350 481  HOH HOH A . 
HA 11 HOH 481 1351 482  HOH HOH A . 
HA 11 HOH 482 1352 483  HOH HOH A . 
HA 11 HOH 483 1353 484  HOH HOH A . 
HA 11 HOH 484 1354 485  HOH HOH A . 
HA 11 HOH 485 1355 486  HOH HOH A . 
HA 11 HOH 486 1356 487  HOH HOH A . 
HA 11 HOH 487 1357 488  HOH HOH A . 
HA 11 HOH 488 1358 489  HOH HOH A . 
HA 11 HOH 489 1359 490  HOH HOH A . 
HA 11 HOH 490 1360 491  HOH HOH A . 
HA 11 HOH 491 1361 492  HOH HOH A . 
HA 11 HOH 492 1362 493  HOH HOH A . 
HA 11 HOH 493 1363 494  HOH HOH A . 
HA 11 HOH 494 1364 495  HOH HOH A . 
HA 11 HOH 495 1365 496  HOH HOH A . 
HA 11 HOH 496 1366 497  HOH HOH A . 
HA 11 HOH 497 1367 498  HOH HOH A . 
HA 11 HOH 498 1368 499  HOH HOH A . 
HA 11 HOH 499 1369 500  HOH HOH A . 
HA 11 HOH 500 1370 501  HOH HOH A . 
HA 11 HOH 501 1371 502  HOH HOH A . 
HA 11 HOH 502 1372 503  HOH HOH A . 
HA 11 HOH 503 1373 504  HOH HOH A . 
HA 11 HOH 504 1374 505  HOH HOH A . 
HA 11 HOH 505 1375 506  HOH HOH A . 
HA 11 HOH 506 1376 507  HOH HOH A . 
HA 11 HOH 507 1377 508  HOH HOH A . 
HA 11 HOH 508 1378 509  HOH HOH A . 
HA 11 HOH 509 1379 510  HOH HOH A . 
HA 11 HOH 510 1380 511  HOH HOH A . 
HA 11 HOH 511 1381 512  HOH HOH A . 
HA 11 HOH 512 1382 513  HOH HOH A . 
HA 11 HOH 513 1383 514  HOH HOH A . 
HA 11 HOH 514 1384 515  HOH HOH A . 
HA 11 HOH 515 1385 516  HOH HOH A . 
HA 11 HOH 516 1386 517  HOH HOH A . 
HA 11 HOH 517 1387 518  HOH HOH A . 
HA 11 HOH 518 1388 519  HOH HOH A . 
HA 11 HOH 519 1389 520  HOH HOH A . 
HA 11 HOH 520 1390 521  HOH HOH A . 
HA 11 HOH 521 1391 522  HOH HOH A . 
HA 11 HOH 522 1392 523  HOH HOH A . 
HA 11 HOH 523 1393 524  HOH HOH A . 
HA 11 HOH 524 1394 525  HOH HOH A . 
HA 11 HOH 525 1395 526  HOH HOH A . 
HA 11 HOH 526 1396 527  HOH HOH A . 
HA 11 HOH 527 1397 528  HOH HOH A . 
HA 11 HOH 528 1398 529  HOH HOH A . 
HA 11 HOH 529 1399 530  HOH HOH A . 
HA 11 HOH 530 1400 531  HOH HOH A . 
HA 11 HOH 531 1401 532  HOH HOH A . 
HA 11 HOH 532 1402 533  HOH HOH A . 
HA 11 HOH 533 1403 534  HOH HOH A . 
HA 11 HOH 534 1404 535  HOH HOH A . 
HA 11 HOH 535 1405 536  HOH HOH A . 
HA 11 HOH 536 1406 537  HOH HOH A . 
HA 11 HOH 537 1407 538  HOH HOH A . 
HA 11 HOH 538 1408 539  HOH HOH A . 
HA 11 HOH 539 1409 540  HOH HOH A . 
HA 11 HOH 540 1410 541  HOH HOH A . 
HA 11 HOH 541 1411 542  HOH HOH A . 
HA 11 HOH 542 1412 543  HOH HOH A . 
HA 11 HOH 543 1413 544  HOH HOH A . 
HA 11 HOH 544 1414 545  HOH HOH A . 
HA 11 HOH 545 1415 546  HOH HOH A . 
HA 11 HOH 546 1416 547  HOH HOH A . 
HA 11 HOH 547 1417 548  HOH HOH A . 
HA 11 HOH 548 1418 549  HOH HOH A . 
HA 11 HOH 549 1419 550  HOH HOH A . 
HA 11 HOH 550 1420 551  HOH HOH A . 
HA 11 HOH 551 1421 552  HOH HOH A . 
HA 11 HOH 552 1422 553  HOH HOH A . 
HA 11 HOH 553 1423 554  HOH HOH A . 
HA 11 HOH 554 1424 555  HOH HOH A . 
HA 11 HOH 555 1425 556  HOH HOH A . 
HA 11 HOH 556 1426 557  HOH HOH A . 
HA 11 HOH 557 1427 558  HOH HOH A . 
HA 11 HOH 558 1428 559  HOH HOH A . 
HA 11 HOH 559 1429 560  HOH HOH A . 
HA 11 HOH 560 1430 561  HOH HOH A . 
HA 11 HOH 561 1431 562  HOH HOH A . 
HA 11 HOH 562 1432 563  HOH HOH A . 
HA 11 HOH 563 1433 564  HOH HOH A . 
HA 11 HOH 564 1434 565  HOH HOH A . 
HA 11 HOH 565 1435 566  HOH HOH A . 
HA 11 HOH 566 1436 567  HOH HOH A . 
HA 11 HOH 567 1437 568  HOH HOH A . 
HA 11 HOH 568 1438 569  HOH HOH A . 
HA 11 HOH 569 1439 570  HOH HOH A . 
HA 11 HOH 570 1440 571  HOH HOH A . 
HA 11 HOH 571 1441 572  HOH HOH A . 
HA 11 HOH 572 1442 573  HOH HOH A . 
HA 11 HOH 573 1443 574  HOH HOH A . 
HA 11 HOH 574 1444 575  HOH HOH A . 
HA 11 HOH 575 1445 576  HOH HOH A . 
HA 11 HOH 576 1446 577  HOH HOH A . 
HA 11 HOH 577 1447 578  HOH HOH A . 
HA 11 HOH 578 1448 579  HOH HOH A . 
HA 11 HOH 579 1449 580  HOH HOH A . 
HA 11 HOH 580 1450 581  HOH HOH A . 
HA 11 HOH 581 1451 582  HOH HOH A . 
HA 11 HOH 582 1452 583  HOH HOH A . 
HA 11 HOH 583 1453 584  HOH HOH A . 
HA 11 HOH 584 1454 585  HOH HOH A . 
HA 11 HOH 585 1455 586  HOH HOH A . 
HA 11 HOH 586 1456 587  HOH HOH A . 
HA 11 HOH 587 1457 588  HOH HOH A . 
HA 11 HOH 588 1458 589  HOH HOH A . 
HA 11 HOH 589 1459 590  HOH HOH A . 
HA 11 HOH 590 1460 591  HOH HOH A . 
HA 11 HOH 591 1461 592  HOH HOH A . 
HA 11 HOH 592 1462 593  HOH HOH A . 
HA 11 HOH 593 1463 594  HOH HOH A . 
HA 11 HOH 594 1464 595  HOH HOH A . 
HA 11 HOH 595 1465 596  HOH HOH A . 
HA 11 HOH 596 1466 597  HOH HOH A . 
HA 11 HOH 597 1467 598  HOH HOH A . 
HA 11 HOH 598 1468 599  HOH HOH A . 
HA 11 HOH 599 1469 600  HOH HOH A . 
HA 11 HOH 600 1470 601  HOH HOH A . 
HA 11 HOH 601 1471 602  HOH HOH A . 
HA 11 HOH 602 1472 603  HOH HOH A . 
HA 11 HOH 603 1473 604  HOH HOH A . 
HA 11 HOH 604 1474 605  HOH HOH A . 
HA 11 HOH 605 1475 606  HOH HOH A . 
HA 11 HOH 606 1476 607  HOH HOH A . 
HA 11 HOH 607 1477 608  HOH HOH A . 
HA 11 HOH 608 1478 609  HOH HOH A . 
HA 11 HOH 609 1479 610  HOH HOH A . 
HA 11 HOH 610 1480 611  HOH HOH A . 
HA 11 HOH 611 1481 612  HOH HOH A . 
HA 11 HOH 612 1482 613  HOH HOH A . 
HA 11 HOH 613 1483 614  HOH HOH A . 
HA 11 HOH 614 1484 615  HOH HOH A . 
HA 11 HOH 615 1485 616  HOH HOH A . 
HA 11 HOH 616 1486 617  HOH HOH A . 
HA 11 HOH 617 1487 618  HOH HOH A . 
HA 11 HOH 618 1488 619  HOH HOH A . 
HA 11 HOH 619 1489 620  HOH HOH A . 
HA 11 HOH 620 1490 621  HOH HOH A . 
HA 11 HOH 621 1491 622  HOH HOH A . 
HA 11 HOH 622 1492 623  HOH HOH A . 
HA 11 HOH 623 1493 624  HOH HOH A . 
HA 11 HOH 624 1494 625  HOH HOH A . 
HA 11 HOH 625 1495 626  HOH HOH A . 
HA 11 HOH 626 1496 627  HOH HOH A . 
HA 11 HOH 627 1497 628  HOH HOH A . 
HA 11 HOH 628 1498 629  HOH HOH A . 
HA 11 HOH 629 1499 630  HOH HOH A . 
HA 11 HOH 630 1500 631  HOH HOH A . 
HA 11 HOH 631 1501 632  HOH HOH A . 
HA 11 HOH 632 1502 633  HOH HOH A . 
HA 11 HOH 633 1503 634  HOH HOH A . 
HA 11 HOH 634 1504 635  HOH HOH A . 
HA 11 HOH 635 1505 636  HOH HOH A . 
HA 11 HOH 636 1506 637  HOH HOH A . 
HA 11 HOH 637 1507 638  HOH HOH A . 
HA 11 HOH 638 1508 639  HOH HOH A . 
HA 11 HOH 639 1509 640  HOH HOH A . 
HA 11 HOH 640 1510 641  HOH HOH A . 
HA 11 HOH 641 1511 642  HOH HOH A . 
HA 11 HOH 642 1512 643  HOH HOH A . 
HA 11 HOH 643 1513 644  HOH HOH A . 
HA 11 HOH 644 1514 645  HOH HOH A . 
HA 11 HOH 645 1515 646  HOH HOH A . 
HA 11 HOH 646 1516 647  HOH HOH A . 
HA 11 HOH 647 1517 648  HOH HOH A . 
HA 11 HOH 648 1518 649  HOH HOH A . 
HA 11 HOH 649 1519 650  HOH HOH A . 
HA 11 HOH 650 1520 651  HOH HOH A . 
HA 11 HOH 651 1521 652  HOH HOH A . 
HA 11 HOH 652 1522 653  HOH HOH A . 
HA 11 HOH 653 1523 654  HOH HOH A . 
HA 11 HOH 654 1524 655  HOH HOH A . 
HA 11 HOH 655 1525 657  HOH HOH A . 
HA 11 HOH 656 1526 658  HOH HOH A . 
HA 11 HOH 657 1527 659  HOH HOH A . 
HA 11 HOH 658 1528 660  HOH HOH A . 
HA 11 HOH 659 1529 661  HOH HOH A . 
HA 11 HOH 660 1530 662  HOH HOH A . 
HA 11 HOH 661 1531 663  HOH HOH A . 
HA 11 HOH 662 1532 664  HOH HOH A . 
HA 11 HOH 663 1533 665  HOH HOH A . 
HA 11 HOH 664 1534 666  HOH HOH A . 
HA 11 HOH 665 1535 667  HOH HOH A . 
HA 11 HOH 666 1536 668  HOH HOH A . 
HA 11 HOH 667 1537 669  HOH HOH A . 
HA 11 HOH 668 1538 670  HOH HOH A . 
HA 11 HOH 669 1539 672  HOH HOH A . 
HA 11 HOH 670 1540 673  HOH HOH A . 
HA 11 HOH 671 1541 674  HOH HOH A . 
HA 11 HOH 672 1542 675  HOH HOH A . 
HA 11 HOH 673 1543 676  HOH HOH A . 
HA 11 HOH 674 1544 677  HOH HOH A . 
HA 11 HOH 675 1545 678  HOH HOH A . 
HA 11 HOH 676 1546 679  HOH HOH A . 
HA 11 HOH 677 1547 680  HOH HOH A . 
HA 11 HOH 678 1548 681  HOH HOH A . 
HA 11 HOH 679 1549 683  HOH HOH A . 
HA 11 HOH 680 1550 684  HOH HOH A . 
HA 11 HOH 681 1551 685  HOH HOH A . 
HA 11 HOH 682 1552 686  HOH HOH A . 
HA 11 HOH 683 1553 687  HOH HOH A . 
HA 11 HOH 684 1554 688  HOH HOH A . 
HA 11 HOH 685 1555 689  HOH HOH A . 
HA 11 HOH 686 1556 690  HOH HOH A . 
HA 11 HOH 687 1557 691  HOH HOH A . 
HA 11 HOH 688 1558 692  HOH HOH A . 
HA 11 HOH 689 1559 693  HOH HOH A . 
HA 11 HOH 690 1560 694  HOH HOH A . 
HA 11 HOH 691 1561 695  HOH HOH A . 
HA 11 HOH 692 1562 696  HOH HOH A . 
HA 11 HOH 693 1563 697  HOH HOH A . 
HA 11 HOH 694 1564 698  HOH HOH A . 
HA 11 HOH 695 1565 699  HOH HOH A . 
HA 11 HOH 696 1566 700  HOH HOH A . 
HA 11 HOH 697 1567 701  HOH HOH A . 
HA 11 HOH 698 1568 702  HOH HOH A . 
HA 11 HOH 699 1569 703  HOH HOH A . 
HA 11 HOH 700 1570 704  HOH HOH A . 
HA 11 HOH 701 1571 705  HOH HOH A . 
HA 11 HOH 702 1572 706  HOH HOH A . 
HA 11 HOH 703 1573 707  HOH HOH A . 
HA 11 HOH 704 1574 708  HOH HOH A . 
HA 11 HOH 705 1575 709  HOH HOH A . 
HA 11 HOH 706 1576 710  HOH HOH A . 
HA 11 HOH 707 1577 711  HOH HOH A . 
HA 11 HOH 708 1578 712  HOH HOH A . 
HA 11 HOH 709 1579 713  HOH HOH A . 
HA 11 HOH 710 1580 714  HOH HOH A . 
HA 11 HOH 711 1581 715  HOH HOH A . 
HA 11 HOH 712 1582 717  HOH HOH A . 
HA 11 HOH 713 1583 718  HOH HOH A . 
HA 11 HOH 714 1584 719  HOH HOH A . 
HA 11 HOH 715 1585 721  HOH HOH A . 
HA 11 HOH 716 1586 722  HOH HOH A . 
HA 11 HOH 717 1587 723  HOH HOH A . 
HA 11 HOH 718 1588 724  HOH HOH A . 
HA 11 HOH 719 1589 725  HOH HOH A . 
HA 11 HOH 720 1590 726  HOH HOH A . 
HA 11 HOH 721 1591 727  HOH HOH A . 
HA 11 HOH 722 1592 728  HOH HOH A . 
HA 11 HOH 723 1593 729  HOH HOH A . 
HA 11 HOH 724 1594 730  HOH HOH A . 
HA 11 HOH 725 1595 731  HOH HOH A . 
HA 11 HOH 726 1596 732  HOH HOH A . 
HA 11 HOH 727 1597 733  HOH HOH A . 
HA 11 HOH 728 1598 734  HOH HOH A . 
HA 11 HOH 729 1599 735  HOH HOH A . 
HA 11 HOH 730 1600 736  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 18  A ASN 53  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 489 A ASN 524 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 375 A ASN 410 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A  ASP 136 ? A ASP 171  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 OG1 ? A  THR 174 ? A THR 209  ? 1_555 128.0 ? 
2  OD1 ? A  ASP 136 ? A ASP 171  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 OD2 ? A  ASP 323 ? A ASP 358  ? 1_555 108.6 ? 
3  OG1 ? A  THR 174 ? A THR 209  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 OD2 ? A  ASP 323 ? A ASP 358  ? 1_555 102.5 ? 
4  OD1 ? A  ASP 136 ? A ASP 171  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 NE2 ? A  HIS 324 ? A HIS 359  ? 1_555 107.4 ? 
5  OG1 ? A  THR 174 ? A THR 209  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 NE2 ? A  HIS 324 ? A HIS 359  ? 1_555 110.4 ? 
6  OD2 ? A  ASP 323 ? A ASP 358  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 NE2 ? A  HIS 324 ? A HIS 359  ? 1_555 94.7  ? 
7  OD1 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 OD2 ? A  ASP 276 ? A ASP 311  ? 1_555 56.9  ? 
8  OD1 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 NE2 ? A  HIS 280 ? A HIS 315  ? 1_555 103.6 ? 
9  OD2 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 NE2 ? A  HIS 280 ? A HIS 315  ? 1_555 93.6  ? 
10 OD1 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 NE2 ? A  HIS 439 ? A HIS 474  ? 1_555 93.1  ? 
11 OD2 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 NE2 ? A  HIS 439 ? A HIS 474  ? 1_555 148.6 ? 
12 NE2 ? A  HIS 280 ? A HIS 315  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 NE2 ? A  HIS 439 ? A HIS 474  ? 1_555 103.4 ? 
13 OD1 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 OAD ? J  NKO .   ? A NKO 1006 ? 1_555 109.4 ? 
14 OD2 ? A  ASP 276 ? A ASP 311  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 OAD ? J  NKO .   ? A NKO 1006 ? 1_555 83.3  ? 
15 NE2 ? A  HIS 280 ? A HIS 315  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 OAD ? J  NKO .   ? A NKO 1006 ? 1_555 137.7 ? 
16 NE2 ? A  HIS 439 ? A HIS 474  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 OAD ? J  NKO .   ? A NKO 1006 ? 1_555 100.5 ? 
17 O   ? A  TYR 630 ? A TYR 665  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? A  ASP 633 ? A ASP 668  ? 1_555 67.1  ? 
18 O   ? A  TYR 630 ? A TYR 665  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? A  MET 636 ? A MET 671  ? 1_555 87.8  ? 
19 O   ? A  ASP 633 ? A ASP 668  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? A  MET 636 ? A MET 671  ? 1_555 75.9  ? 
20 O   ? A  TYR 630 ? A TYR 665  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1342 ? 1_555 153.4 ? 
21 O   ? A  ASP 633 ? A ASP 668  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1342 ? 1_555 86.5  ? 
22 O   ? A  MET 636 ? A MET 671  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1342 ? 1_555 82.5  ? 
23 O   ? A  TYR 630 ? A TYR 665  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1343 ? 1_555 83.3  ? 
24 O   ? A  ASP 633 ? A ASP 668  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1343 ? 1_555 148.2 ? 
25 O   ? A  MET 636 ? A MET 671  ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1343 ? 1_555 92.2  ? 
26 O   ? HA HOH .   ? A HOH 1342 ? 1_555 K  ? I K  . ? A K  1005 ? 1_555 O   ? HA HOH .   ? A HOH 1343 ? 1_555 121.6 ? 
27 OD1 ? A  ASP 700 ? A ASP 735  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASN 702 ? A ASN 737  ? 1_555 76.4  ? 
28 OD1 ? A  ASP 700 ? A ASP 735  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASN 704 ? A ASN 739  ? 1_555 78.0  ? 
29 OD1 ? A  ASN 702 ? A ASN 737  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASN 704 ? A ASN 739  ? 1_555 80.7  ? 
30 OD1 ? A  ASP 700 ? A ASP 735  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? A  LEU 706 ? A LEU 741  ? 1_555 88.6  ? 
31 OD1 ? A  ASN 702 ? A ASN 737  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? A  LEU 706 ? A LEU 741  ? 1_555 159.4 ? 
32 OD1 ? A  ASN 704 ? A ASN 739  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? A  LEU 706 ? A LEU 741  ? 1_555 82.4  ? 
33 OD1 ? A  ASP 700 ? A ASP 735  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASP 708 ? A ASP 743  ? 1_555 99.8  ? 
34 OD1 ? A  ASN 702 ? A ASN 737  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASP 708 ? A ASP 743  ? 1_555 88.4  ? 
35 OD1 ? A  ASN 704 ? A ASN 739  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASP 708 ? A ASP 743  ? 1_555 169.0 ? 
36 O   ? A  LEU 706 ? A LEU 741  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 OD1 ? A  ASP 708 ? A ASP 743  ? 1_555 108.4 ? 
37 OD1 ? A  ASP 700 ? A ASP 735  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? HA HOH .   ? A HOH 1369 ? 1_555 166.3 ? 
38 OD1 ? A  ASN 702 ? A ASN 737  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? HA HOH .   ? A HOH 1369 ? 1_555 101.7 ? 
39 OD1 ? A  ASN 704 ? A ASN 739  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? HA HOH .   ? A HOH 1369 ? 1_555 88.3  ? 
40 O   ? A  LEU 706 ? A LEU 741  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? HA HOH .   ? A HOH 1369 ? 1_555 89.4  ? 
41 OD1 ? A  ASP 708 ? A ASP 743  ? 1_555 CA ? G CA . ? A CA 1003 ? 1_555 O   ? HA HOH .   ? A HOH 1369 ? 1_555 93.7  ? 
42 O   ? A  ASN 762 ? A ASN 797  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? A  SER 765 ? A SER 800  ? 1_555 68.6  ? 
43 O   ? A  ASN 762 ? A ASN 797  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 OG  ? A  SER 768 ? A SER 803  ? 1_555 79.5  ? 
44 O   ? A  SER 765 ? A SER 800  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 OG  ? A  SER 768 ? A SER 803  ? 1_555 70.4  ? 
45 O   ? A  ASN 762 ? A ASN 797  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 922  ? 1_555 95.4  ? 
46 O   ? A  SER 765 ? A SER 800  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 922  ? 1_555 98.5  ? 
47 OG  ? A  SER 768 ? A SER 803  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 922  ? 1_555 168.8 ? 
48 O   ? A  ASN 762 ? A ASN 797  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1083 ? 1_555 78.6  ? 
49 O   ? A  SER 765 ? A SER 800  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1083 ? 1_555 146.3 ? 
50 OG  ? A  SER 768 ? A SER 803  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1083 ? 1_555 96.9  ? 
51 O   ? HA HOH .   ? A HOH 922  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1083 ? 1_555 91.7  ? 
52 O   ? A  ASN 762 ? A ASN 797  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1182 ? 1_555 162.9 ? 
53 O   ? A  SER 765 ? A SER 800  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1182 ? 1_555 106.8 ? 
54 OG  ? A  SER 768 ? A SER 803  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1182 ? 1_555 83.5  ? 
55 O   ? HA HOH .   ? A HOH 922  ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1182 ? 1_555 101.6 ? 
56 O   ? HA HOH .   ? A HOH 1083 ? 1_555 NA ? H NA . ? A NA 1004 ? 1_555 O   ? HA HOH .   ? A HOH 1182 ? 1_555 102.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-01-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-02-19 
4 'Structure model' 1 3 2017-11-08 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' Advisory                    
5 5 'Structure model' 'Atomic model'              
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Database references'       
8 5 'Structure model' 'Derived calculations'      
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software                      
2  5 'Structure model' atom_site                     
3  5 'Structure model' chem_comp                     
4  5 'Structure model' entity                        
5  5 'Structure model' pdbx_branch_scheme            
6  5 'Structure model' pdbx_chem_comp_identifier     
7  5 'Structure model' pdbx_entity_branch            
8  5 'Structure model' pdbx_entity_branch_descriptor 
9  5 'Structure model' pdbx_entity_branch_link       
10 5 'Structure model' pdbx_entity_branch_list       
11 5 'Structure model' pdbx_entity_nonpoly           
12 5 'Structure model' pdbx_nonpoly_scheme           
13 5 'Structure model' pdbx_struct_assembly_gen      
14 5 'Structure model' pdbx_struct_conn_angle        
15 5 'Structure model' pdbx_unobs_or_zero_occ_atoms  
16 5 'Structure model' struct_asym                   
17 5 'Structure model' struct_conn                   
18 5 'Structure model' struct_ref_seq_dif            
19 5 'Structure model' struct_site                   
20 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.classification'                    
2  4 'Structure model' '_software.contact_author'                    
3  4 'Structure model' '_software.contact_author_email'              
4  4 'Structure model' '_software.date'                              
5  4 'Structure model' '_software.language'                          
6  4 'Structure model' '_software.location'                          
7  4 'Structure model' '_software.name'                              
8  4 'Structure model' '_software.type'                              
9  4 'Structure model' '_software.version'                           
10 5 'Structure model' '_atom_site.auth_asym_id'                     
11 5 'Structure model' '_atom_site.auth_seq_id'                      
12 5 'Structure model' '_atom_site.label_asym_id'                    
13 5 'Structure model' '_atom_site.label_entity_id'                  
14 5 'Structure model' '_chem_comp.name'                             
15 5 'Structure model' '_chem_comp.type'                             
16 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
27 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
28 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
29 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
30 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
31 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
32 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
33 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
34 5 'Structure model' '_pdbx_struct_conn_angle.value'               
35 5 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 
36 5 'Structure model' '_struct_conn.pdbx_dist_value'                
37 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
38 5 'Structure model' '_struct_conn.pdbx_role'                      
39 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
40 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
41 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
42 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
43 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
44 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
45 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
46 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
47 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
48 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
49 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
50 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
51 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
52 5 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .       ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK   .       ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 PHENIX      1.6_289 ?               package 'Paul D. Adams'      PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.10    'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
# 
_pdbx_entry_details.entry_id                 3NKO 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;PROTEIN USED IN THIS STRUCTURE IS AN ISOFORM OF ANTOTAXIN FROM MOUSE, WHICH IS LACK OF RESIDUES KVEP (UNP RESDIUES 571-574 OF DATABASE ENPP2_MOUSE).
;
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A HOH 1434 ? ? O  A HOH 1508 ? ? 1.86 
2 1 SG A CYS 366  ? ? CB A CYS 468  ? ? 2.04 
3 1 O  A HOH 884  ? ? O  A HOH 1411 ? ? 2.13 
4 1 O  A HOH 1347 ? ? O  A HOH 1467 ? ? 2.14 
5 1 O  A CYS 468  ? ? O  A HOH 1310 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 76  ? ? -106.42 -164.90 
2  1 GLU A 113 ? ? -69.40  1.26    
3  1 ARG A 368 ? ? -113.04 65.53   
4  1 ASP A 403 ? ? -118.24 78.90   
5  1 ALA A 435 ? ? -154.26 -35.31  
6  1 ARG A 450 ? ? 79.73   -1.22   
7  1 ASP A 477 ? ? -26.69  124.60  
8  1 MET A 556 ? ? -154.43 7.29    
9  1 LEU A 592 ? ? -115.36 74.40   
10 1 VAL A 652 ? ? -63.42  2.56    
11 1 SER A 672 ? ? -104.27 -153.52 
12 1 SER A 684 ? ? -177.15 148.26  
13 1 ASN A 724 ? ? 72.09   54.67   
14 1 TRP A 810 ? ? -149.86 -24.73  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 59   ? CG  ? A LYS 24  CG  
2   1 Y 1 A LYS 59   ? CD  ? A LYS 24  CD  
3   1 Y 1 A LYS 59   ? CE  ? A LYS 24  CE  
4   1 Y 1 A LYS 59   ? NZ  ? A LYS 24  NZ  
5   1 Y 1 A GLU 67   ? CG  ? A GLU 32  CG  
6   1 Y 1 A GLU 67   ? CD  ? A GLU 32  CD  
7   1 Y 1 A GLU 67   ? OE1 ? A GLU 32  OE1 
8   1 Y 1 A GLU 67   ? OE2 ? A GLU 32  OE2 
9   1 Y 1 A LEU 78   ? CG  ? A LEU 43  CG  
10  1 Y 1 A LEU 78   ? CD1 ? A LEU 43  CD1 
11  1 Y 1 A LEU 78   ? CD2 ? A LEU 43  CD2 
12  1 Y 1 A LYS 104  ? CG  ? A LYS 69  CG  
13  1 Y 1 A LYS 104  ? CD  ? A LYS 69  CD  
14  1 Y 1 A LYS 104  ? CE  ? A LYS 69  CE  
15  1 Y 1 A LYS 104  ? NZ  ? A LYS 69  NZ  
16  1 Y 1 A ARG 162  ? CG  ? A ARG 127 CG  
17  1 Y 1 A ARG 162  ? CD  ? A ARG 127 CD  
18  1 Y 1 A ARG 162  ? NE  ? A ARG 127 NE  
19  1 Y 1 A ARG 162  ? CZ  ? A ARG 127 CZ  
20  1 Y 1 A ARG 162  ? NH1 ? A ARG 127 NH1 
21  1 Y 1 A ARG 162  ? NH2 ? A ARG 127 NH2 
22  1 Y 1 A ARG 244  ? CG  ? A ARG 209 CG  
23  1 Y 1 A ARG 244  ? CD  ? A ARG 209 CD  
24  1 Y 1 A ARG 244  ? NE  ? A ARG 209 NE  
25  1 Y 1 A ARG 244  ? CZ  ? A ARG 209 CZ  
26  1 Y 1 A ARG 244  ? NH1 ? A ARG 209 NH1 
27  1 Y 1 A ARG 244  ? NH2 ? A ARG 209 NH2 
28  1 Y 1 A ARG 246  ? CG  ? A ARG 211 CG  
29  1 Y 1 A ARG 246  ? CD  ? A ARG 211 CD  
30  1 Y 1 A ARG 246  ? NE  ? A ARG 211 NE  
31  1 Y 1 A ARG 246  ? CZ  ? A ARG 211 CZ  
32  1 Y 1 A ARG 246  ? NH1 ? A ARG 211 NH1 
33  1 Y 1 A ARG 246  ? NH2 ? A ARG 211 NH2 
34  1 Y 1 A PHE 274  ? CG  ? A PHE 239 CG  
35  1 Y 1 A PHE 274  ? CD1 ? A PHE 239 CD1 
36  1 Y 1 A PHE 274  ? CD2 ? A PHE 239 CD2 
37  1 Y 1 A PHE 274  ? CE1 ? A PHE 239 CE1 
38  1 Y 1 A PHE 274  ? CE2 ? A PHE 239 CE2 
39  1 Y 1 A PHE 274  ? CZ  ? A PHE 239 CZ  
40  1 Y 1 A LEU 458  ? CG  ? A LEU 423 CG  
41  1 Y 1 A LEU 458  ? CD1 ? A LEU 423 CD1 
42  1 Y 1 A LEU 458  ? CD2 ? A LEU 423 CD2 
43  1 Y 1 A ARG 549  ? CG  ? A ARG 514 CG  
44  1 Y 1 A ARG 549  ? CD  ? A ARG 514 CD  
45  1 Y 1 A ARG 549  ? NE  ? A ARG 514 NE  
46  1 Y 1 A ARG 549  ? CZ  ? A ARG 514 CZ  
47  1 Y 1 A ARG 549  ? NH1 ? A ARG 514 NH1 
48  1 Y 1 A ARG 549  ? NH2 ? A ARG 514 NH2 
49  1 Y 1 A MET 556  ? CG  ? A MET 521 CG  
50  1 Y 1 A MET 556  ? SD  ? A MET 521 SD  
51  1 Y 1 A MET 556  ? CE  ? A MET 521 CE  
52  1 Y 1 A GLN 559  ? CG  ? A GLN 524 CG  
53  1 Y 1 A GLN 559  ? CD  ? A GLN 524 CD  
54  1 Y 1 A GLN 559  ? OE1 ? A GLN 524 OE1 
55  1 Y 1 A GLN 559  ? NE2 ? A GLN 524 NE2 
56  1 Y 1 A GLU 589  ? CG  ? A GLU 554 CG  
57  1 Y 1 A GLU 589  ? CD  ? A GLU 554 CD  
58  1 Y 1 A GLU 589  ? OE1 ? A GLU 554 OE1 
59  1 Y 1 A GLU 589  ? OE2 ? A GLU 554 OE2 
60  1 Y 1 A ARG 602  ? CG  ? A ARG 567 CG  
61  1 Y 1 A ARG 602  ? CD  ? A ARG 567 CD  
62  1 Y 1 A ARG 602  ? NE  ? A ARG 567 NE  
63  1 Y 1 A ARG 602  ? CZ  ? A ARG 567 CZ  
64  1 Y 1 A ARG 602  ? NH1 ? A ARG 567 NH1 
65  1 Y 1 A ARG 602  ? NH2 ? A ARG 567 NH2 
66  1 Y 1 A GLU 636  ? CG  ? A GLU 601 CG  
67  1 Y 1 A GLU 636  ? CD  ? A GLU 601 CD  
68  1 Y 1 A GLU 636  ? OE1 ? A GLU 601 OE1 
69  1 Y 1 A GLU 636  ? OE2 ? A GLU 601 OE2 
70  1 Y 1 A GLU 642  ? CG  ? A GLU 607 CG  
71  1 Y 1 A GLU 642  ? CD  ? A GLU 607 CD  
72  1 Y 1 A GLU 642  ? OE1 ? A GLU 607 OE1 
73  1 Y 1 A GLU 642  ? OE2 ? A GLU 607 OE2 
74  1 Y 1 A LYS 666  ? CG  ? A LYS 631 CG  
75  1 Y 1 A LYS 666  ? CD  ? A LYS 631 CD  
76  1 Y 1 A LYS 666  ? CE  ? A LYS 631 CE  
77  1 Y 1 A LYS 666  ? NZ  ? A LYS 631 NZ  
78  1 Y 1 A LYS 669  ? CG  ? A LYS 634 CG  
79  1 Y 1 A LYS 669  ? CD  ? A LYS 634 CD  
80  1 Y 1 A LYS 669  ? CE  ? A LYS 634 CE  
81  1 Y 1 A LYS 669  ? NZ  ? A LYS 634 NZ  
82  1 Y 1 A LYS 779  ? CG  ? A LYS 744 CG  
83  1 Y 1 A LYS 779  ? CD  ? A LYS 744 CD  
84  1 Y 1 A LYS 779  ? CE  ? A LYS 744 CE  
85  1 Y 1 A LYS 779  ? NZ  ? A LYS 744 NZ  
86  1 N 1 A NKO 1007 ? OAA ? K NKO 1   OAA 
87  1 N 1 A NKO 1007 ? OAB ? K NKO 1   OAB 
88  1 N 1 A NKO 1007 ? PAC ? K NKO 1   PAC 
89  1 N 1 A NKO 1007 ? OAD ? K NKO 1   OAD 
90  1 N 1 A NKO 1007 ? OAE ? K NKO 1   OAE 
91  1 N 1 A NKO 1007 ? OAF ? K NKO 1   OAF 
92  1 N 1 A NKO 1007 ? CAG ? K NKO 1   CAG 
93  1 N 1 A NKO 1007 ? CAH ? K NKO 1   CAH 
94  1 N 1 A NKO 1007 ? CAI ? K NKO 1   CAI 
95  1 N 1 A NKO 1007 ? OAJ ? K NKO 1   OAJ 
96  1 N 1 A NKO 1007 ? CAK ? K NKO 1   CAK 
97  1 N 1 A NKO 1007 ? CAL ? K NKO 1   CAL 
98  1 N 1 A NKO 1007 ? CAM ? K NKO 1   CAM 
99  1 N 1 A NKO 1007 ? CAN ? K NKO 1   CAN 
100 1 N 1 A NKO 1007 ? CAO ? K NKO 1   CAO 
101 1 N 1 A NKO 1007 ? CAP ? K NKO 1   CAP 
102 1 N 1 A NKO 1007 ? CAQ ? K NKO 1   CAQ 
103 1 N 1 A NKO 1007 ? CAR ? K NKO 1   CAR 
104 1 N 1 A NKO 1007 ? OBA ? K NKO 1   OBA 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 36  ? A ALA 1   
2  1 Y 1 A GLU 37  ? A GLU 2   
3  1 Y 1 A TRP 38  ? A TRP 3   
4  1 Y 1 A ASP 39  ? A ASP 4   
5  1 Y 1 A GLU 40  ? A GLU 5   
6  1 Y 1 A GLY 41  ? A GLY 6   
7  1 Y 1 A PRO 42  ? A PRO 7   
8  1 Y 1 A PRO 43  ? A PRO 8   
9  1 Y 1 A THR 44  ? A THR 9   
10 1 Y 1 A VAL 45  ? A VAL 10  
11 1 Y 1 A LEU 46  ? A LEU 11  
12 1 Y 1 A SER 47  ? A SER 12  
13 1 Y 1 A ASP 48  ? A ASP 13  
14 1 Y 1 A SER 49  ? A SER 14  
15 1 Y 1 A PRO 50  ? A PRO 15  
16 1 Y 1 A ASP 459 ? A ASP 424 
17 1 Y 1 A VAL 460 ? A VAL 425 
18 1 Y 1 A TYR 461 ? A TYR 426 
19 1 Y 1 A LYS 462 ? A LYS 427 
20 1 Y 1 A LYS 463 ? A LYS 428 
21 1 Y 1 A PRO 464 ? A PRO 429 
22 1 Y 1 A SER 465 ? A SER 430 
23 1 Y 1 A GLY 466 ? A GLY 431 
24 1 Y 1 A LYS 467 ? A LYS 432 
25 1 Y 1 A ASP 570 ? A ASP 535 
26 1 Y 1 A LYS 571 ? A LYS 536 
27 1 Y 1 A ASN 572 ? A ASN 537 
28 1 Y 1 A LYS 573 ? A LYS 538 
29 1 Y 1 A LEU 574 ? A LEU 539 
30 1 Y 1 A GLU 575 ? A GLU 540 
31 1 Y 1 A GLU 576 ? A GLU 541 
32 1 Y 1 A LEU 577 ? A LEU 542 
33 1 Y 1 A ASN 578 ? A ASN 543 
34 1 Y 1 A LYS 579 ? A LYS 544 
35 1 Y 1 A ARG 580 ? A ARG 545 
36 1 Y 1 A LEU 581 ? A LEU 546 
37 1 Y 1 A HIS 582 ? A HIS 547 
38 1 Y 1 A THR 583 ? A THR 548 
39 1 Y 1 A LYS 584 ? A LYS 549 
40 1 Y 1 A SER 856 ? A SER 821 
41 1 Y 1 A GLU 857 ? A GLU 822 
42 1 Y 1 A ILE 858 ? A ILE 823 
43 1 Y 1 A SER 859 ? A SER 824 
44 1 Y 1 A ARG 860 ? A ARG 825 
45 1 Y 1 A GLU 861 ? A GLU 826 
46 1 Y 1 A ASN 862 ? A ASN 827 
47 1 Y 1 A LEU 863 ? A LEU 828 
48 1 Y 1 A TYR 864 ? A TYR 829 
49 1 Y 1 A PHE 865 ? A PHE 830 
50 1 Y 1 A GLN 866 ? A GLN 831 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 898 n 
B 2 NAG 2 B NAG 2 A NAG 899 n 
C 3 NAG 1 C NAG 1 A NAG 900 n 
C 3 NAG 2 C NAG 2 A NAG 901 n 
C 3 BMA 3 C BMA 3 A BMA 902 n 
C 3 MAN 4 C MAN 4 A MAN 903 n 
C 3 MAN 5 C MAN 5 A MAN 904 n 
C 3 MAN 6 C MAN 6 A MAN 905 n 
D 2 NAG 1 D NAG 1 A NAG 907 n 
D 2 NAG 2 D NAG 2 A NAG 908 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                                                                                                        
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1'                                                                          
WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'                                                                             
LINUCS                      PDB-CARE   ?     
4 3 DManpa1-2DManpa1-3DManpa1-6DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                                                    
'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/3,6,5/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1122h-1a_1-5]/1-1-2-3-3-3/a4-b1_b4-c1_c6-d1_d3-e1_e2-f1'            
WURCS                       PDB2Glycan 1.1.0 
6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(6+1)][a-D-Manp]{[(3+1)][a-D-Manp]{[(2+1)][a-D-Manp]{}}}}}}}' 
LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
3 3 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
4 3 4 MAN C1 O1 3 BMA O6 HO6 sing ? 
5 3 5 MAN C1 O1 4 MAN O3 HO3 sing ? 
6 3 6 MAN C1 O1 5 MAN O2 HO2 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
3 NAG 1 n 
3 NAG 2 n 
3 BMA 3 n 
3 MAN 4 n 
3 MAN 5 n 
3 MAN 6 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4  'ZINC ION'                                            ZN  
5  'CALCIUM ION'                                         CA  
6  'SODIUM ION'                                          NA  
7  'POTASSIUM ION'                                       K   
8  '(2R)-2-hydroxy-3-(phosphonooxy)propyl hexadecanoate' NKO 
9  'THIOCYANATE ION'                                     SCN 
10 1,2-ETHANEDIOL                                        EDO 
11 water                                                 HOH 
#