data_3NSO
# 
_entry.id   3NSO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NSO         
RCSB  RCSB060230   
WWPDB D_1000060230 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3NSI . unspecified 
PDB 3NSK . unspecified 
PDB 3NSL . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3NSO 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Unno, M.'     1 
'Takahara, H.' 2 
'Kizawa, K.'   3 
# 
_citation.id                        primary 
_citation.title                     
'Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                477 
_citation.page_last                 490 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21377473 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2011.02.055 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Unno, M.'       1 
primary 'Kawasaki, T.'   2 
primary 'Takahara, H.'   3 
primary 'Heizmann, C.W.' 4 
primary 'Kizawa, K.'     5 
# 
_cell.entry_id           3NSO 
_cell.length_a           58.673 
_cell.length_b           58.673 
_cell.length_c           45.797 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NSO 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein S100-A3' 11725.416 2   ? ? ? ? 
2 water   nat water             18.015    133 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein A3, Protein S-100E' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLA
CLCLYCHEYFKDCPSEPPCSQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLA
CLCLYCHEYFKDCPSEPPCSQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   PRO n 
1 5   LEU n 
1 6   GLU n 
1 7   GLN n 
1 8   ALA n 
1 9   VAL n 
1 10  ALA n 
1 11  ALA n 
1 12  ILE n 
1 13  VAL n 
1 14  CYS n 
1 15  THR n 
1 16  PHE n 
1 17  GLN n 
1 18  GLU n 
1 19  TYR n 
1 20  ALA n 
1 21  GLY n 
1 22  ARG n 
1 23  CYS n 
1 24  GLY n 
1 25  ASP n 
1 26  LYS n 
1 27  TYR n 
1 28  LYS n 
1 29  LEU n 
1 30  CYS n 
1 31  GLN n 
1 32  ALA n 
1 33  GLU n 
1 34  LEU n 
1 35  LYS n 
1 36  GLU n 
1 37  LEU n 
1 38  LEU n 
1 39  GLN n 
1 40  LYS n 
1 41  GLU n 
1 42  LEU n 
1 43  ALA n 
1 44  THR n 
1 45  TRP n 
1 46  THR n 
1 47  PRO n 
1 48  THR n 
1 49  GLU n 
1 50  PHE n 
1 51  ARG n 
1 52  GLU n 
1 53  CYS n 
1 54  ASP n 
1 55  TYR n 
1 56  ASN n 
1 57  LYS n 
1 58  PHE n 
1 59  MET n 
1 60  SER n 
1 61  VAL n 
1 62  LEU n 
1 63  ASP n 
1 64  THR n 
1 65  ASN n 
1 66  LYS n 
1 67  ASP n 
1 68  CYS n 
1 69  GLU n 
1 70  VAL n 
1 71  ASP n 
1 72  PHE n 
1 73  VAL n 
1 74  GLU n 
1 75  TYR n 
1 76  VAL n 
1 77  ARG n 
1 78  SER n 
1 79  LEU n 
1 80  ALA n 
1 81  CYS n 
1 82  LEU n 
1 83  CYS n 
1 84  LEU n 
1 85  TYR n 
1 86  CYS n 
1 87  HIS n 
1 88  GLU n 
1 89  TYR n 
1 90  PHE n 
1 91  LYS n 
1 92  ASP n 
1 93  CYS n 
1 94  PRO n 
1 95  SER n 
1 96  GLU n 
1 97  PRO n 
1 98  PRO n 
1 99  CYS n 
1 100 SER n 
1 101 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S100A3, S100E' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            IPLB-Sf21 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A3_HUMAN 
_struct_ref.pdbx_db_accession          P33764 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLA
CLCLYCHEYFKDCPSEPPCSQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NSO A 1 ? 101 ? P33764 1 ? 101 ? 1 101 
2 1 3NSO B 1 ? 101 ? P33764 1 ? 101 ? 1 101 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3NSO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.94 
_exptl_crystal.density_percent_sol   36.62 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pdbx_details    'Ammonium Sulfate, 0.1M Bicine , pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2010-05-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NE3A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NE3A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     3NSO 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.45 
_reflns.number_obs                   30896 
_reflns.number_all                   31271 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.45 
_reflns_shell.d_res_low                   1.48 
_reflns_shell.percent_possible_all        87.9 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3NSO 
_refine.ls_number_reflns_obs                     29306 
_refine.ls_number_reflns_all                     30896 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.45 
_refine.ls_percent_reflns_obs                    98.85 
_refine.ls_R_factor_obs                          0.19980 
_refine.ls_R_factor_all                          0.19980 
_refine.ls_R_factor_R_work                       0.19859 
_refine.ls_R_factor_R_free                       0.22260 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1568 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               21.613 
_refine.aniso_B[1][1]                            0.23 
_refine.aniso_B[2][2]                            0.23 
_refine.aniso_B[3][3]                            -0.35 
_refine.aniso_B[1][2]                            0.12 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3NSI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.080 
_refine.overall_SU_ML                            0.052 
_refine.overall_SU_B                             2.973 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1505 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               1638 
_refine_hist.d_res_high                       1.45 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.022  ? 1627 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.951  1.970  ? 2219 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.652  5.000  ? 209  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.207 24.321 ? 81   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.957 15.000 ? 295  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.454 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.128  0.200  ? 241  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.012  0.021  ? 1252 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.146  1.500  ? 976  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.019  2.000  ? 1589 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.467  3.000  ? 651  'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.415  4.500  ? 619  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.450 
_refine_ls_shell.d_res_low                        1.488 
_refine_ls_shell.number_reflns_R_work             1982 
_refine_ls_shell.R_factor_R_work                  0.302 
_refine_ls_shell.percent_reflns_obs               89.83 
_refine_ls_shell.R_factor_R_free                  0.360 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3NSO 
_struct.title                     'Crystal Structure of S100A3 Protein Expressed in Insect Cell' 
_struct.pdbx_descriptor           'Protein S100-A3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NSO 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'EF-hand, Ca2+, Zn2+ binding, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 3  ? GLY A 21 ? ARG A 3  GLY A 21 1 ? 19 
HELX_P HELX_P2  2  CYS A 30 ? LEU A 42 ? CYS A 30 LEU A 42 1 ? 13 
HELX_P HELX_P3  3  ARG A 51 ? ASN A 65 ? ARG A 51 ASN A 65 1 ? 15 
HELX_P HELX_P4  4  PHE A 72 ? HIS A 87 ? PHE A 72 HIS A 87 1 ? 16 
HELX_P HELX_P5  5  GLU A 88 ? LYS A 91 ? GLU A 88 LYS A 91 5 ? 4  
HELX_P HELX_P6  6  ARG B 3  ? GLY B 21 ? ARG B 3  GLY B 21 1 ? 19 
HELX_P HELX_P7  7  CYS B 30 ? LEU B 42 ? CYS B 30 LEU B 42 1 ? 13 
HELX_P HELX_P8  8  ARG B 51 ? ASN B 65 ? ARG B 51 ASN B 65 1 ? 15 
HELX_P HELX_P9  9  PHE B 72 ? HIS B 87 ? PHE B 72 HIS B 87 1 ? 16 
HELX_P HELX_P10 10 GLU B 88 ? LYS B 91 ? GLU B 88 LYS B 91 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 30 SG A ? ? 1_555 A CYS 68 SG A ? A CYS 30 A CYS 68 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? A CYS 81 SG ? ? ? 1_555 A CYS 99 SG ? ? A CYS 81 A CYS 99 1_555 ? ? ? ? ? ? ? 2.009 ? 
disulf3 disulf ? ? B CYS 30 SG A ? ? 1_555 B CYS 68 SG A ? B CYS 30 B CYS 68 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf4 disulf ? ? B CYS 81 SG ? ? ? 1_555 B CYS 99 SG ? ? B CYS 81 B CYS 99 1_555 ? ? ? ? ? ? ? 1.977 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 28 ? LEU A 29 ? LYS A 28 LEU A 29 
A 2 VAL A 70 ? ASP A 71 ? VAL A 70 ASP A 71 
B 1 LYS B 28 ? LEU B 29 ? LYS B 28 LEU B 29 
B 2 VAL B 70 ? ASP B 71 ? VAL B 70 ASP B 71 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 29 ? N LEU A 29 O VAL A 70 ? O VAL A 70 
B 1 2 N LEU B 29 ? N LEU B 29 O VAL B 70 ? O VAL B 70 
# 
_database_PDB_matrix.entry_id          3NSO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3NSO 
_atom_sites.fract_transf_matrix[1][1]   0.017044 
_atom_sites.fract_transf_matrix[1][2]   0.009840 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019680 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021835 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2  ? 37.771 36.454 -12.683 1.00 40.57 ? 2   ALA A N   1 
ATOM   2    C CA  . ALA A 1 2  ? 37.145 36.088 -11.364 1.00 38.59 ? 2   ALA A CA  1 
ATOM   3    C C   . ALA A 1 2  ? 36.179 37.196 -10.862 1.00 35.80 ? 2   ALA A C   1 
ATOM   4    O O   . ALA A 1 2  ? 36.627 38.308 -10.479 1.00 38.25 ? 2   ALA A O   1 
ATOM   5    C CB  . ALA A 1 2  ? 38.271 35.824 -10.337 1.00 40.10 ? 2   ALA A CB  1 
ATOM   6    N N   . ARG A 1 3  ? 34.872 36.922 -10.879 1.00 30.92 ? 3   ARG A N   1 
ATOM   7    C CA  . ARG A 1 3  ? 33.890 37.922 -10.410 1.00 27.11 ? 3   ARG A CA  1 
ATOM   8    C C   . ARG A 1 3  ? 33.350 37.511 -9.065  1.00 22.93 ? 3   ARG A C   1 
ATOM   9    O O   . ARG A 1 3  ? 32.915 36.375 -8.891  1.00 21.40 ? 3   ARG A O   1 
ATOM   10   C CB  . ARG A 1 3  ? 32.748 38.112 -11.384 1.00 27.01 ? 3   ARG A CB  1 
ATOM   11   C CG  . ARG A 1 3  ? 33.089 38.622 -12.736 1.00 29.50 ? 3   ARG A CG  1 
ATOM   12   C CD  . ARG A 1 3  ? 31.902 38.502 -13.661 1.00 29.93 ? 3   ARG A CD  1 
ATOM   13   N NE  . ARG A 1 3  ? 31.936 39.578 -14.630 1.00 32.17 ? 3   ARG A NE  1 
ATOM   14   C CZ  . ARG A 1 3  ? 32.514 39.492 -15.823 1.00 34.71 ? 3   ARG A CZ  1 
ATOM   15   N NH1 . ARG A 1 3  ? 33.077 38.352 -16.205 1.00 33.36 ? 3   ARG A NH1 1 
ATOM   16   N NH2 . ARG A 1 3  ? 32.499 40.538 -16.627 1.00 33.40 ? 3   ARG A NH2 1 
ATOM   17   N N   . PRO A 1 4  ? 33.277 38.450 -8.136  1.00 20.36 ? 4   PRO A N   1 
ATOM   18   C CA  . PRO A 1 4  ? 32.982 38.064 -6.775  1.00 20.46 ? 4   PRO A CA  1 
ATOM   19   C C   . PRO A 1 4  ? 31.569 37.462 -6.671  1.00 17.44 ? 4   PRO A C   1 
ATOM   20   O O   . PRO A 1 4  ? 31.368 36.517 -5.870  1.00 18.73 ? 4   PRO A O   1 
ATOM   21   C CB  . PRO A 1 4  ? 33.118 39.360 -5.996  1.00 21.31 ? 4   PRO A CB  1 
ATOM   22   C CG  . PRO A 1 4  ? 33.552 40.424 -6.971  1.00 25.25 ? 4   PRO A CG  1 
ATOM   23   C CD  . PRO A 1 4  ? 33.854 39.808 -8.261  1.00 22.53 ? 4   PRO A CD  1 
ATOM   24   N N   . LEU A 1 5  ? 30.579 37.980 -7.414  1.00 15.48 ? 5   LEU A N   1 
ATOM   25   C CA  . LEU A 1 5  ? 29.258 37.454 -7.310  1.00 13.28 ? 5   LEU A CA  1 
ATOM   26   C C   . LEU A 1 5  ? 29.201 36.024 -7.873  1.00 13.62 ? 5   LEU A C   1 
ATOM   27   O O   . LEU A 1 5  ? 28.474 35.196 -7.330  1.00 12.72 ? 5   LEU A O   1 
ATOM   28   C CB  . LEU A 1 5  ? 28.209 38.405 -7.942  1.00 14.25 ? 5   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 5  ? 26.808 37.931 -7.586  1.00 14.85 ? 5   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 5  ? 26.541 38.085 -6.053  1.00 18.59 ? 5   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 5  ? 25.788 38.803 -8.402  1.00 17.16 ? 5   LEU A CD2 1 
ATOM   32   N N   . GLU A 1 6  ? 29.884 35.784 -8.976  1.00 13.49 ? 6   GLU A N   1 
ATOM   33   C CA  . GLU A 1 6  ? 29.922 34.438 -9.563  1.00 14.64 ? 6   GLU A CA  1 
ATOM   34   C C   . GLU A 1 6  ? 30.471 33.433 -8.585  1.00 14.23 ? 6   GLU A C   1 
ATOM   35   O O   . GLU A 1 6  ? 29.902 32.353 -8.409  1.00 14.94 ? 6   GLU A O   1 
ATOM   36   C CB  . GLU A 1 6  ? 30.729 34.371 -10.825 1.00 17.31 ? 6   GLU A CB  1 
ATOM   37   C CG  . GLU A 1 6  ? 29.987 35.066 -11.998 1.00 19.01 ? 6   GLU A CG  1 
ATOM   38   C CD  . GLU A 1 6  ? 30.740 35.005 -13.309 1.00 24.69 ? 6   GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 6  ? 31.933 34.604 -13.308 1.00 30.03 ? 6   GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 6  ? 30.176 35.390 -14.355 1.00 26.47 ? 6   GLU A OE2 1 
ATOM   41   N N   . GLN A 1 7  ? 31.572 33.777 -7.916  1.00 14.62 ? 7   GLN A N   1 
ATOM   42   C CA  . GLN A 1 7  ? 32.161 32.855 -6.965  1.00 16.21 ? 7   GLN A CA  1 
ATOM   43   C C   . GLN A 1 7  ? 31.233 32.643 -5.794  1.00 14.01 ? 7   GLN A C   1 
ATOM   44   O O   . GLN A 1 7  ? 31.070 31.528 -5.286  1.00 13.66 ? 7   GLN A O   1 
ATOM   45   C CB  . GLN A 1 7  ? 33.472 33.473 -6.443  1.00 18.48 ? 7   GLN A CB  1 
ATOM   46   C CG  . GLN A 1 7  ? 34.466 33.669 -7.511  1.00 24.87 ? 7   GLN A CG  1 
ATOM   47   C CD  . GLN A 1 7  ? 35.717 34.233 -7.004  1.00 30.49 ? 7   GLN A CD  1 
ATOM   48   O OE1 . GLN A 1 7  ? 36.421 33.597 -6.189  1.00 37.51 ? 7   GLN A OE1 1 
ATOM   49   N NE2 . GLN A 1 7  ? 36.077 35.406 -7.527  1.00 37.36 ? 7   GLN A NE2 1 
ATOM   50   N N   . ALA A 1 8  ? 30.554 33.692 -5.361  1.00 13.76 ? 8   ALA A N   1 
ATOM   51   C CA  . ALA A 1 8  ? 29.639 33.584 -4.239  1.00 12.85 ? 8   ALA A CA  1 
ATOM   52   C C   . ALA A 1 8  ? 28.462 32.683 -4.589  1.00 13.11 ? 8   ALA A C   1 
ATOM   53   O O   . ALA A 1 8  ? 28.063 31.840 -3.760  1.00 12.56 ? 8   ALA A O   1 
ATOM   54   C CB  . ALA A 1 8  ? 29.118 35.014 -3.831  1.00 13.74 ? 8   ALA A CB  1 
ATOM   55   N N   . VAL A 1 9  ? 27.842 32.915 -5.760  1.00 11.98 ? 9   VAL A N   1 
ATOM   56   C CA  . VAL A 1 9  ? 26.652 32.100 -6.075  1.00 11.90 ? 9   VAL A CA  1 
ATOM   57   C C   . VAL A 1 9  ? 27.062 30.638 -6.294  1.00 11.65 ? 9   VAL A C   1 
ATOM   58   O O   . VAL A 1 9  ? 26.373 29.712 -5.852  1.00 12.24 ? 9   VAL A O   1 
ATOM   59   C CB  . VAL A 1 9  ? 25.875 32.704 -7.228  1.00 11.96 ? 9   VAL A CB  1 
ATOM   60   C CG1 . VAL A 1 9  ? 24.677 31.904 -7.588  1.00 14.14 ? 9   VAL A CG1 1 
ATOM   61   C CG2 . VAL A 1 9  ? 25.395 34.139 -6.821  1.00 14.14 ? 9   VAL A CG2 1 
ATOM   62   N N   . ALA A 1 10 ? 28.215 30.390 -6.926  1.00 12.22 ? 10  ALA A N   1 
ATOM   63   C CA  . ALA A 1 10 ? 28.681 29.000 -7.017  1.00 12.40 ? 10  ALA A CA  1 
ATOM   64   C C   . ALA A 1 10 ? 28.895 28.383 -5.652  1.00 12.08 ? 10  ALA A C   1 
ATOM   65   O O   . ALA A 1 10 ? 28.560 27.198 -5.451  1.00 12.42 ? 10  ALA A O   1 
ATOM   66   C CB  . ALA A 1 10 ? 30.031 28.979 -7.775  1.00 14.56 ? 10  ALA A CB  1 
ATOM   67   N N   . ALA A 1 11 ? 29.404 29.168 -4.694  1.00 11.78 ? 11  ALA A N   1 
ATOM   68   C CA  . ALA A 1 11 ? 29.585 28.651 -3.317  1.00 12.99 ? 11  ALA A CA  1 
ATOM   69   C C   . ALA A 1 11 ? 28.265 28.331 -2.652  1.00 12.08 ? 11  ALA A C   1 
ATOM   70   O O   . ALA A 1 11 ? 28.149 27.316 -1.913  1.00 13.19 ? 11  ALA A O   1 
ATOM   71   C CB  . ALA A 1 11 ? 30.426 29.614 -2.485  1.00 14.86 ? 11  ALA A CB  1 
ATOM   72   N N   . ILE A 1 12 ? 27.221 29.149 -2.896  1.00 11.64 ? 12  ILE A N   1 
ATOM   73   C CA  A ILE A 1 12 ? 25.912 28.885 -2.322  0.50 11.44 ? 12  ILE A CA  1 
ATOM   74   C CA  B ILE A 1 12 ? 25.941 28.804 -2.244  0.50 12.25 ? 12  ILE A CA  1 
ATOM   75   C C   . ILE A 1 12 ? 25.375 27.506 -2.814  1.00 11.48 ? 12  ILE A C   1 
ATOM   76   O O   . ILE A 1 12 ? 24.778 26.724 -2.058  1.00 11.18 ? 12  ILE A O   1 
ATOM   77   C CB  A ILE A 1 12 ? 25.022 30.063 -2.684  0.50 11.60 ? 12  ILE A CB  1 
ATOM   78   C CB  B ILE A 1 12 ? 24.897 29.943 -2.199  0.50 12.91 ? 12  ILE A CB  1 
ATOM   79   C CG1 A ILE A 1 12 ? 25.394 31.254 -1.780  0.50 12.93 ? 12  ILE A CG1 1 
ATOM   80   C CG1 B ILE A 1 12 ? 24.281 30.225 -3.577  0.50 15.13 ? 12  ILE A CG1 1 
ATOM   81   C CG2 A ILE A 1 12 ? 23.596 29.698 -2.490  0.50 9.77  ? 12  ILE A CG2 1 
ATOM   82   C CG2 B ILE A 1 12 ? 25.536 31.179 -1.564  0.50 14.62 ? 12  ILE A CG2 1 
ATOM   83   C CD1 A ILE A 1 12 ? 24.863 32.643 -2.158  0.50 14.86 ? 12  ILE A CD1 1 
ATOM   84   C CD1 B ILE A 1 12 ? 23.101 31.227 -3.542  0.50 15.32 ? 12  ILE A CD1 1 
ATOM   85   N N   . VAL A 1 13 ? 25.624 27.190 -4.108  1.00 11.42 ? 13  VAL A N   1 
ATOM   86   C CA  . VAL A 1 13 ? 25.156 25.920 -4.656  1.00 11.63 ? 13  VAL A CA  1 
ATOM   87   C C   . VAL A 1 13 ? 26.039 24.794 -4.062  1.00 12.01 ? 13  VAL A C   1 
ATOM   88   O O   . VAL A 1 13 ? 25.495 23.739 -3.691  1.00 12.44 ? 13  VAL A O   1 
ATOM   89   C CB  . VAL A 1 13 ? 25.266 25.887 -6.193  1.00 11.82 ? 13  VAL A CB  1 
ATOM   90   C CG1 . VAL A 1 13 ? 24.980 24.479 -6.732  1.00 12.90 ? 13  VAL A CG1 1 
ATOM   91   C CG2 . VAL A 1 13 ? 24.355 26.929 -6.805  1.00 12.36 ? 13  VAL A CG2 1 
ATOM   92   N N   . CYS A 1 14 ? 27.346 25.017 -3.901  1.00 11.81 ? 14  CYS A N   1 
ATOM   93   C CA  A CYS A 1 14 ? 28.200 23.982 -3.371  0.50 12.55 ? 14  CYS A CA  1 
ATOM   94   C CA  B CYS A 1 14 ? 28.240 24.017 -3.315  0.50 13.82 ? 14  CYS A CA  1 
ATOM   95   C C   . CYS A 1 14 ? 27.736 23.560 -1.959  1.00 12.74 ? 14  CYS A C   1 
ATOM   96   O O   . CYS A 1 14 ? 27.643 22.360 -1.672  1.00 12.93 ? 14  CYS A O   1 
ATOM   97   C CB  A CYS A 1 14 ? 29.615 24.520 -3.390  0.50 12.94 ? 14  CYS A CB  1 
ATOM   98   C CB  B CYS A 1 14 ? 29.616 24.631 -3.125  0.50 14.87 ? 14  CYS A CB  1 
ATOM   99   S SG  A CYS A 1 14 ? 30.841 23.432 -2.778  0.50 14.82 ? 14  CYS A SG  1 
ATOM   100  S SG  B CYS A 1 14 ? 30.656 24.529 -4.543  0.50 22.57 ? 14  CYS A SG  1 
ATOM   101  N N   . THR A 1 15 ? 27.398 24.536 -1.106  1.00 12.55 ? 15  THR A N   1 
ATOM   102  C CA  . THR A 1 15 ? 26.979 24.194 0.232   1.00 14.61 ? 15  THR A CA  1 
ATOM   103  C C   . THR A 1 15 ? 25.653 23.421 0.158   1.00 12.98 ? 15  THR A C   1 
ATOM   104  O O   . THR A 1 15 ? 25.447 22.429 0.846   1.00 14.27 ? 15  THR A O   1 
ATOM   105  C CB  . THR A 1 15 ? 26.799 25.457 1.056   1.00 13.97 ? 15  THR A CB  1 
ATOM   106  O OG1 . THR A 1 15 ? 28.069 26.132 1.159   1.00 17.90 ? 15  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 15 ? 26.349 25.147 2.465   1.00 15.94 ? 15  THR A CG2 1 
ATOM   108  N N   . PHE A 1 16 ? 24.714 23.837 -0.699  1.00 12.38 ? 16  PHE A N   1 
ATOM   109  C CA  . PHE A 1 16 ? 23.453 23.084 -0.821  1.00 12.24 ? 16  PHE A CA  1 
ATOM   110  C C   . PHE A 1 16 ? 23.749 21.667 -1.218  1.00 13.20 ? 16  PHE A C   1 
ATOM   111  O O   . PHE A 1 16 ? 23.153 20.745 -0.638  1.00 12.76 ? 16  PHE A O   1 
ATOM   112  C CB  . PHE A 1 16 ? 22.535 23.804 -1.842  1.00 11.50 ? 16  PHE A CB  1 
ATOM   113  C CG  . PHE A 1 16 ? 21.201 23.168 -1.983  1.00 11.50 ? 16  PHE A CG  1 
ATOM   114  C CD1 . PHE A 1 16 ? 20.205 23.475 -1.072  1.00 9.88  ? 16  PHE A CD1 1 
ATOM   115  C CD2 . PHE A 1 16 ? 20.923 22.255 -3.020  1.00 12.30 ? 16  PHE A CD2 1 
ATOM   116  C CE1 . PHE A 1 16 ? 18.923 22.889 -1.193  1.00 11.79 ? 16  PHE A CE1 1 
ATOM   117  C CE2 . PHE A 1 16 ? 19.620 21.665 -3.112  1.00 12.67 ? 16  PHE A CE2 1 
ATOM   118  C CZ  . PHE A 1 16 ? 18.617 22.031 -2.229  1.00 12.59 ? 16  PHE A CZ  1 
ATOM   119  N N   . GLN A 1 17 ? 24.588 21.481 -2.214  1.00 13.77 ? 17  GLN A N   1 
ATOM   120  C CA  . GLN A 1 17 ? 24.946 20.114 -2.699  1.00 14.49 ? 17  GLN A CA  1 
ATOM   121  C C   . GLN A 1 17 ? 25.494 19.258 -1.526  1.00 16.01 ? 17  GLN A C   1 
ATOM   122  O O   . GLN A 1 17 ? 25.178 18.056 -1.404  1.00 16.11 ? 17  GLN A O   1 
ATOM   123  C CB  . GLN A 1 17 ? 25.993 20.248 -3.800  1.00 18.13 ? 17  GLN A CB  1 
ATOM   124  C CG  . GLN A 1 17 ? 26.531 18.886 -4.334  1.00 25.26 ? 17  GLN A CG  1 
ATOM   125  C CD  . GLN A 1 17 ? 27.310 19.063 -5.650  1.00 33.02 ? 17  GLN A CD  1 
ATOM   126  O OE1 . GLN A 1 17 ? 27.667 20.187 -6.036  1.00 40.35 ? 17  GLN A OE1 1 
ATOM   127  N NE2 . GLN A 1 17 ? 27.541 17.959 -6.354  1.00 39.12 ? 17  GLN A NE2 1 
ATOM   128  N N   . GLU A 1 18 ? 26.365 19.858 -0.715  1.00 15.33 ? 18  GLU A N   1 
ATOM   129  C CA  . GLU A 1 18 ? 26.994 19.165 0.439   1.00 16.41 ? 18  GLU A CA  1 
ATOM   130  C C   . GLU A 1 18 ? 25.945 18.632 1.384   1.00 14.60 ? 18  GLU A C   1 
ATOM   131  O O   . GLU A 1 18 ? 26.051 17.448 1.799   1.00 18.58 ? 18  GLU A O   1 
ATOM   132  C CB  . GLU A 1 18 ? 27.942 20.116 1.192   1.00 18.29 ? 18  GLU A CB  1 
ATOM   133  C CG  . GLU A 1 18 ? 28.594 19.633 2.470   1.00 27.03 ? 18  GLU A CG  1 
ATOM   134  C CD  . GLU A 1 18 ? 29.594 20.714 2.946   1.00 32.95 ? 18  GLU A CD  1 
ATOM   135  O OE1 . GLU A 1 18 ? 29.537 21.880 2.438   1.00 35.70 ? 18  GLU A OE1 1 
ATOM   136  O OE2 . GLU A 1 18 ? 30.429 20.418 3.833   1.00 42.49 ? 18  GLU A OE2 1 
ATOM   137  N N   . TYR A 1 19 ? 24.860 19.356 1.673   1.00 13.24 ? 19  TYR A N   1 
ATOM   138  C CA  . TYR A 1 19 ? 23.825 18.909 2.578   1.00 13.79 ? 19  TYR A CA  1 
ATOM   139  C C   . TYR A 1 19 ? 22.762 18.080 1.867   1.00 13.08 ? 19  TYR A C   1 
ATOM   140  O O   . TYR A 1 19 ? 22.369 16.967 2.330   1.00 13.31 ? 19  TYR A O   1 
ATOM   141  C CB  . TYR A 1 19 ? 23.241 20.159 3.317   1.00 14.18 ? 19  TYR A CB  1 
ATOM   142  C CG  . TYR A 1 19 ? 24.163 20.666 4.402   1.00 14.59 ? 19  TYR A CG  1 
ATOM   143  C CD1 . TYR A 1 19 ? 25.281 21.376 4.099   1.00 13.56 ? 19  TYR A CD1 1 
ATOM   144  C CD2 . TYR A 1 19 ? 23.908 20.353 5.756   1.00 17.19 ? 19  TYR A CD2 1 
ATOM   145  C CE1 . TYR A 1 19 ? 26.178 21.816 5.102   1.00 16.60 ? 19  TYR A CE1 1 
ATOM   146  C CE2 . TYR A 1 19 ? 24.787 20.819 6.743   1.00 17.09 ? 19  TYR A CE2 1 
ATOM   147  C CZ  . TYR A 1 19 ? 25.894 21.519 6.389   1.00 17.91 ? 19  TYR A CZ  1 
ATOM   148  O OH  . TYR A 1 19 ? 26.796 21.967 7.333   1.00 23.00 ? 19  TYR A OH  1 
ATOM   149  N N   . ALA A 1 20 ? 22.257 18.573 0.735   1.00 13.28 ? 20  ALA A N   1 
ATOM   150  C CA  . ALA A 1 20 ? 21.163 17.863 0.080   1.00 12.55 ? 20  ALA A CA  1 
ATOM   151  C C   . ALA A 1 20 ? 21.644 16.581 -0.570  1.00 13.58 ? 20  ALA A C   1 
ATOM   152  O O   . ALA A 1 20 ? 20.835 15.621 -0.681  1.00 13.72 ? 20  ALA A O   1 
ATOM   153  C CB  . ALA A 1 20 ? 20.551 18.861 -0.985  1.00 13.43 ? 20  ALA A CB  1 
ATOM   154  N N   . GLY A 1 21 ? 22.939 16.451 -0.894  1.00 14.71 ? 21  GLY A N   1 
ATOM   155  C CA  . GLY A 1 21 ? 23.452 15.259 -1.509  1.00 14.64 ? 21  GLY A CA  1 
ATOM   156  C C   . GLY A 1 21 ? 23.742 14.161 -0.513  1.00 14.37 ? 21  GLY A C   1 
ATOM   157  O O   . GLY A 1 21 ? 24.185 13.039 -0.873  1.00 16.28 ? 21  GLY A O   1 
ATOM   158  N N   . ARG A 1 22 ? 23.546 14.421 0.784   1.00 13.05 ? 22  ARG A N   1 
ATOM   159  C CA  . ARG A 1 22 ? 23.816 13.384 1.780   1.00 14.02 ? 22  ARG A CA  1 
ATOM   160  C C   . ARG A 1 22 ? 23.034 12.121 1.522   1.00 12.51 ? 22  ARG A C   1 
ATOM   161  O O   . ARG A 1 22 ? 23.588 11.024 1.536   1.00 13.94 ? 22  ARG A O   1 
ATOM   162  C CB  . ARG A 1 22 ? 23.499 13.825 3.202   1.00 13.63 ? 22  ARG A CB  1 
ATOM   163  C CG  . ARG A 1 22 ? 24.465 14.826 3.727   1.00 15.04 ? 22  ARG A CG  1 
ATOM   164  C CD  . ARG A 1 22 ? 23.923 15.273 5.073   1.00 18.84 ? 22  ARG A CD  1 
ATOM   165  N NE  . ARG A 1 22 ? 24.868 16.143 5.744   1.00 18.89 ? 22  ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 22 ? 24.579 16.776 6.892   1.00 18.54 ? 22  ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 22 ? 23.425 16.633 7.544   1.00 20.11 ? 22  ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 22 ? 25.501 17.530 7.409   1.00 21.60 ? 22  ARG A NH2 1 
ATOM   169  N N   . CYS A 1 23 ? 21.730 12.256 1.312   1.00 13.93 ? 23  CYS A N   1 
ATOM   170  C CA  . CYS A 1 23 ? 20.880 11.092 1.147   1.00 14.30 ? 23  CYS A CA  1 
ATOM   171  C C   . CYS A 1 23 ? 19.568 11.543 0.588   1.00 14.53 ? 23  CYS A C   1 
ATOM   172  O O   . CYS A 1 23 ? 19.194 12.690 0.693   1.00 14.41 ? 23  CYS A O   1 
ATOM   173  C CB  . CYS A 1 23 ? 20.669 10.284 2.489   1.00 14.39 ? 23  CYS A CB  1 
ATOM   174  S SG  . CYS A 1 23 ? 19.936 11.264 3.810   1.00 17.27 ? 23  CYS A SG  1 
ATOM   175  N N   . GLY A 1 24 ? 18.824 10.601 0.039   1.00 14.71 ? 24  GLY A N   1 
ATOM   176  C CA  . GLY A 1 24 ? 17.478 10.969 -0.463  1.00 12.92 ? 24  GLY A CA  1 
ATOM   177  C C   . GLY A 1 24 ? 17.553 11.865 -1.698  1.00 14.29 ? 24  GLY A C   1 
ATOM   178  O O   . GLY A 1 24 ? 18.479 11.783 -2.529  1.00 14.74 ? 24  GLY A O   1 
ATOM   179  N N   . ASP A 1 25 ? 16.535 12.714 -1.804  1.00 14.06 ? 25  ASP A N   1 
ATOM   180  C CA  . ASP A 1 25 ? 16.387 13.554 -2.975  1.00 13.90 ? 25  ASP A CA  1 
ATOM   181  C C   . ASP A 1 25 ? 17.453 14.656 -2.973  1.00 13.94 ? 25  ASP A C   1 
ATOM   182  O O   . ASP A 1 25 ? 17.467 15.484 -2.086  1.00 14.29 ? 25  ASP A O   1 
ATOM   183  C CB  . ASP A 1 25 ? 14.996 14.157 -2.869  1.00 14.88 ? 25  ASP A CB  1 
ATOM   184  C CG  . ASP A 1 25 ? 14.622 14.992 -4.075  1.00 17.37 ? 25  ASP A CG  1 
ATOM   185  O OD1 . ASP A 1 25 ? 15.505 15.462 -4.841  1.00 16.00 ? 25  ASP A OD1 1 
ATOM   186  O OD2 . ASP A 1 25 ? 13.381 15.224 -4.275  1.00 22.32 ? 25  ASP A OD2 1 
ATOM   187  N N   . LYS A 1 26 ? 18.311 14.635 -3.983  1.00 13.60 ? 26  LYS A N   1 
ATOM   188  C CA  . LYS A 1 26 ? 19.441 15.592 -4.078  1.00 14.08 ? 26  LYS A CA  1 
ATOM   189  C C   . LYS A 1 26 ? 18.990 17.018 -4.326  1.00 13.93 ? 26  LYS A C   1 
ATOM   190  O O   . LYS A 1 26 ? 19.818 17.912 -4.253  1.00 14.52 ? 26  LYS A O   1 
ATOM   191  C CB  . LYS A 1 26 ? 20.430 15.129 -5.182  1.00 17.64 ? 26  LYS A CB  1 
ATOM   192  C CG  . LYS A 1 26 ? 19.822 15.347 -6.590  1.00 20.27 ? 26  LYS A CG  1 
ATOM   193  C CD  . LYS A 1 26 ? 20.485 14.681 -7.799  1.00 27.41 ? 26  LYS A CD  1 
ATOM   194  C CE  . LYS A 1 26 ? 21.896 14.987 -8.045  1.00 31.62 ? 26  LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 26 ? 22.113 14.481 -9.465  1.00 34.77 ? 26  LYS A NZ  1 
ATOM   196  N N   . TYR A 1 27 ? 17.696 17.255 -4.557  1.00 14.33 ? 27  TYR A N   1 
ATOM   197  C CA  . TYR A 1 27 ? 17.202 18.621 -4.744  1.00 14.98 ? 27  TYR A CA  1 
ATOM   198  C C   . TYR A 1 27 ? 16.482 19.209 -3.547  1.00 16.79 ? 27  TYR A C   1 
ATOM   199  O O   . TYR A 1 27 ? 15.960 20.371 -3.620  1.00 18.81 ? 27  TYR A O   1 
ATOM   200  C CB  . TYR A 1 27 ? 16.290 18.718 -6.004  1.00 16.52 ? 27  TYR A CB  1 
ATOM   201  C CG  . TYR A 1 27 ? 16.893 18.154 -7.247  1.00 17.47 ? 27  TYR A CG  1 
ATOM   202  C CD1 . TYR A 1 27 ? 18.032 18.714 -7.814  1.00 17.97 ? 27  TYR A CD1 1 
ATOM   203  C CD2 . TYR A 1 27 ? 16.296 17.073 -7.864  1.00 21.02 ? 27  TYR A CD2 1 
ATOM   204  C CE1 . TYR A 1 27 ? 18.568 18.135 -9.019  1.00 21.04 ? 27  TYR A CE1 1 
ATOM   205  C CE2 . TYR A 1 27 ? 16.792 16.524 -9.005  1.00 25.37 ? 27  TYR A CE2 1 
ATOM   206  C CZ  . TYR A 1 27 ? 17.915 17.052 -9.582  1.00 23.55 ? 27  TYR A CZ  1 
ATOM   207  O OH  . TYR A 1 27 ? 18.394 16.397 -10.721 1.00 26.78 ? 27  TYR A OH  1 
ATOM   208  N N   . LYS A 1 28 ? 16.406 18.464 -2.435  1.00 16.72 ? 28  LYS A N   1 
ATOM   209  C CA  . LYS A 1 28 ? 15.674 18.955 -1.271  1.00 16.98 ? 28  LYS A CA  1 
ATOM   210  C C   . LYS A 1 28 ? 16.459 18.769 0.008   1.00 17.24 ? 28  LYS A C   1 
ATOM   211  O O   . LYS A 1 28 ? 17.342 17.925 0.090   1.00 17.14 ? 28  LYS A O   1 
ATOM   212  C CB  . LYS A 1 28 ? 14.399 18.158 -1.066  1.00 20.48 ? 28  LYS A CB  1 
ATOM   213  C CG  . LYS A 1 28 ? 13.623 17.904 -2.313  1.00 24.16 ? 28  LYS A CG  1 
ATOM   214  C CD  . LYS A 1 28 ? 12.170 17.762 -2.037  1.00 35.58 ? 28  LYS A CD  1 
ATOM   215  C CE  . LYS A 1 28 ? 11.575 19.141 -2.203  1.00 38.14 ? 28  LYS A CE  1 
ATOM   216  N NZ  . LYS A 1 28 ? 11.599 19.592 -3.638  1.00 40.14 ? 28  LYS A NZ  1 
ATOM   217  N N   . LEU A 1 29 ? 16.135 19.587 1.001   1.00 16.91 ? 29  LEU A N   1 
ATOM   218  C CA  . LEU A 1 29 ? 16.609 19.402 2.394   1.00 15.19 ? 29  LEU A CA  1 
ATOM   219  C C   . LEU A 1 29 ? 15.385 19.283 3.247   1.00 16.70 ? 29  LEU A C   1 
ATOM   220  O O   . LEU A 1 29 ? 14.293 19.680 2.831   1.00 18.22 ? 29  LEU A O   1 
ATOM   221  C CB  . LEU A 1 29 ? 17.295 20.693 2.876   1.00 15.85 ? 29  LEU A CB  1 
ATOM   222  C CG  . LEU A 1 29 ? 18.537 21.105 2.130   1.00 14.47 ? 29  LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 29 ? 18.979 22.483 2.619   1.00 18.30 ? 29  LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 29 ? 19.626 20.082 2.439   1.00 20.45 ? 29  LEU A CD2 1 
ATOM   225  N N   A CYS A 1 30 ? 15.575 18.677 4.429   0.50 18.93 ? 30  CYS A N   1 
ATOM   226  N N   B CYS A 1 30 ? 15.529 18.780 4.457   0.50 18.94 ? 30  CYS A N   1 
ATOM   227  C CA  A CYS A 1 30 ? 14.635 18.767 5.560   0.50 19.41 ? 30  CYS A CA  1 
ATOM   228  C CA  B CYS A 1 30 ? 14.457 19.077 5.368   0.50 19.28 ? 30  CYS A CA  1 
ATOM   229  C C   A CYS A 1 30 ? 14.926 20.117 6.327   0.50 19.50 ? 30  CYS A C   1 
ATOM   230  C C   B CYS A 1 30 ? 14.894 20.225 6.250   0.50 19.37 ? 30  CYS A C   1 
ATOM   231  O O   A CYS A 1 30 ? 16.076 20.587 6.280   0.50 18.17 ? 30  CYS A O   1 
ATOM   232  O O   B CYS A 1 30 ? 16.073 20.619 6.277   0.50 18.19 ? 30  CYS A O   1 
ATOM   233  C CB  A CYS A 1 30 ? 14.790 17.517 6.462   0.50 20.14 ? 30  CYS A CB  1 
ATOM   234  C CB  B CYS A 1 30 ? 14.071 17.889 6.205   0.50 19.29 ? 30  CYS A CB  1 
ATOM   235  S SG  A CYS A 1 30 ? 14.111 15.897 5.846   0.50 22.17 ? 30  CYS A SG  1 
ATOM   236  S SG  B CYS A 1 30 ? 15.381 17.524 7.293   0.50 18.26 ? 30  CYS A SG  1 
ATOM   237  N N   . GLN A 1 31 ? 13.935 20.769 6.985   1.00 20.33 ? 31  GLN A N   1 
ATOM   238  C CA  . GLN A 1 31 ? 14.214 21.946 7.808   1.00 20.96 ? 31  GLN A CA  1 
ATOM   239  C C   . GLN A 1 31 ? 15.267 21.628 8.865   1.00 19.77 ? 31  GLN A C   1 
ATOM   240  O O   . GLN A 1 31 ? 16.082 22.506 9.169   1.00 18.97 ? 31  GLN A O   1 
ATOM   241  C CB  . GLN A 1 31 ? 12.930 22.688 8.387   1.00 23.29 ? 31  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 31 ? 12.517 23.942 7.472   1.00 26.32 ? 31  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 31 ? 11.069 24.451 7.614   1.00 34.36 ? 31  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 31 ? 10.364 24.142 8.582   1.00 38.05 ? 31  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 31 ? 10.627 25.234 6.628   1.00 35.93 ? 31  GLN A NE2 1 
ATOM   246  N N   . ALA A 1 32 ? 15.324 20.386 9.373   1.00 20.53 ? 32  ALA A N   1 
ATOM   247  C CA  . ALA A 1 32 ? 16.385 20.059 10.325  1.00 20.07 ? 32  ALA A CA  1 
ATOM   248  C C   . ALA A 1 32 ? 17.801 20.178 9.708   1.00 19.28 ? 32  ALA A C   1 
ATOM   249  O O   . ALA A 1 32 ? 18.769 20.668 10.372  1.00 21.37 ? 32  ALA A O   1 
ATOM   250  C CB  . ALA A 1 32 ? 16.170 18.707 10.957  1.00 21.89 ? 32  ALA A CB  1 
ATOM   251  N N   . GLU A 1 33 ? 17.905 19.784 8.446   1.00 17.75 ? 33  GLU A N   1 
ATOM   252  C CA  . GLU A 1 33 ? 19.131 19.918 7.723   1.00 14.63 ? 33  GLU A CA  1 
ATOM   253  C C   . GLU A 1 33 ? 19.440 21.394 7.437   1.00 14.19 ? 33  GLU A C   1 
ATOM   254  O O   . GLU A 1 33 ? 20.604 21.788 7.516   1.00 14.33 ? 33  GLU A O   1 
ATOM   255  C CB  . GLU A 1 33 ? 19.111 19.151 6.384   1.00 14.32 ? 33  GLU A CB  1 
ATOM   256  C CG  . GLU A 1 33 ? 19.234 17.658 6.647   1.00 15.25 ? 33  GLU A CG  1 
ATOM   257  C CD  . GLU A 1 33 ? 18.944 16.838 5.427   1.00 17.45 ? 33  GLU A CD  1 
ATOM   258  O OE1 . GLU A 1 33 ? 18.012 17.199 4.643   1.00 16.94 ? 33  GLU A OE1 1 
ATOM   259  O OE2 . GLU A 1 33 ? 19.491 15.700 5.338   1.00 19.58 ? 33  GLU A OE2 1 
ATOM   260  N N   . LEU A 1 34 ? 18.416 22.170 7.077   1.00 15.20 ? 34  LEU A N   1 
ATOM   261  C CA  . LEU A 1 34 ? 18.641 23.603 6.847   1.00 13.99 ? 34  LEU A CA  1 
ATOM   262  C C   . LEU A 1 34 ? 19.059 24.260 8.148   1.00 14.44 ? 34  LEU A C   1 
ATOM   263  O O   . LEU A 1 34 ? 19.982 25.068 8.140   1.00 15.48 ? 34  LEU A O   1 
ATOM   264  C CB  . LEU A 1 34 ? 17.350 24.240 6.294   1.00 13.91 ? 34  LEU A CB  1 
ATOM   265  C CG  . LEU A 1 34 ? 17.440 25.771 6.102   1.00 13.17 ? 34  LEU A CG  1 
ATOM   266  C CD1 . LEU A 1 34 ? 18.491 26.084 5.039   1.00 13.97 ? 34  LEU A CD1 1 
ATOM   267  C CD2 . LEU A 1 34 ? 16.036 26.370 5.695   1.00 15.11 ? 34  LEU A CD2 1 
ATOM   268  N N   . LYS A 1 35 ? 18.442 23.908 9.287   1.00 17.75 ? 35  LYS A N   1 
ATOM   269  C CA  A LYS A 1 35 ? 18.953 24.554 10.508  0.50 17.96 ? 35  LYS A CA  1 
ATOM   270  C CA  B LYS A 1 35 ? 18.905 24.445 10.585  0.50 18.82 ? 35  LYS A CA  1 
ATOM   271  C C   . LYS A 1 35 ? 20.408 24.149 10.836  1.00 18.48 ? 35  LYS A C   1 
ATOM   272  O O   . LYS A 1 35 ? 21.202 25.008 11.222  1.00 19.24 ? 35  LYS A O   1 
ATOM   273  C CB  A LYS A 1 35 ? 18.030 24.372 11.714  0.50 18.92 ? 35  LYS A CB  1 
ATOM   274  C CB  B LYS A 1 35 ? 18.006 23.860 11.701  0.50 19.72 ? 35  LYS A CB  1 
ATOM   275  C CG  A LYS A 1 35 ? 18.509 25.267 12.864  0.50 18.36 ? 35  LYS A CG  1 
ATOM   276  C CG  B LYS A 1 35 ? 18.570 23.999 13.102  0.50 22.80 ? 35  LYS A CG  1 
ATOM   277  C CD  A LYS A 1 35 ? 17.582 25.138 14.058  0.50 19.36 ? 35  LYS A CD  1 
ATOM   278  C CD  B LYS A 1 35 ? 17.549 23.735 14.175  0.50 28.12 ? 35  LYS A CD  1 
ATOM   279  C CE  A LYS A 1 35 ? 17.391 26.523 14.695  0.50 23.65 ? 35  LYS A CE  1 
ATOM   280  C CE  B LYS A 1 35 ? 18.202 23.812 15.553  0.50 28.94 ? 35  LYS A CE  1 
ATOM   281  N NZ  A LYS A 1 35 ? 16.741 26.518 16.024  0.50 26.92 ? 35  LYS A NZ  1 
ATOM   282  N NZ  B LYS A 1 35 ? 18.229 22.491 16.250  0.50 28.95 ? 35  LYS A NZ  1 
ATOM   283  N N   . GLU A 1 36 ? 20.794 22.898 10.604  1.00 18.41 ? 36  GLU A N   1 
ATOM   284  C CA  . GLU A 1 36 ? 22.154 22.442 10.820  1.00 17.89 ? 36  GLU A CA  1 
ATOM   285  C C   . GLU A 1 36 ? 23.099 23.245 9.924   1.00 16.13 ? 36  GLU A C   1 
ATOM   286  O O   . GLU A 1 36 ? 24.159 23.713 10.336  1.00 17.24 ? 36  GLU A O   1 
ATOM   287  C CB  . GLU A 1 36 ? 22.265 20.941 10.494  1.00 18.13 ? 36  GLU A CB  1 
ATOM   288  C CG  . GLU A 1 36 ? 23.655 20.400 10.640  1.00 18.18 ? 36  GLU A CG  1 
ATOM   289  C CD  . GLU A 1 36 ? 23.849 18.997 10.102  1.00 21.25 ? 36  GLU A CD  1 
ATOM   290  O OE1 . GLU A 1 36 ? 22.870 18.429 9.640   1.00 23.93 ? 36  GLU A OE1 1 
ATOM   291  O OE2 . GLU A 1 36 ? 25.014 18.541 10.103  1.00 21.16 ? 36  GLU A OE2 1 
ATOM   292  N N   . LEU A 1 37 ? 22.748 23.360 8.650   1.00 14.71 ? 37  LEU A N   1 
ATOM   293  C CA  . LEU A 1 37 ? 23.521 24.119 7.688   1.00 14.12 ? 37  LEU A CA  1 
ATOM   294  C C   . LEU A 1 37 ? 23.750 25.566 8.180   1.00 14.56 ? 37  LEU A C   1 
ATOM   295  O O   . LEU A 1 37 ? 24.889 26.049 8.176   1.00 15.78 ? 37  LEU A O   1 
ATOM   296  C CB  . LEU A 1 37 ? 22.736 24.090 6.337   1.00 14.20 ? 37  LEU A CB  1 
ATOM   297  C CG  . LEU A 1 37 ? 23.472 24.615 5.088   1.00 13.75 ? 37  LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 37 ? 22.706 24.126 3.841   1.00 14.53 ? 37  LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 37 ? 23.496 26.160 5.019   1.00 12.49 ? 37  LEU A CD2 1 
ATOM   300  N N   . LEU A 1 38 ? 22.688 26.267 8.541   1.00 16.25 ? 38  LEU A N   1 
ATOM   301  C CA  . LEU A 1 38 ? 22.833 27.689 8.895   1.00 16.23 ? 38  LEU A CA  1 
ATOM   302  C C   . LEU A 1 38 ? 23.658 27.815 10.164  1.00 18.38 ? 38  LEU A C   1 
ATOM   303  O O   . LEU A 1 38 ? 24.486 28.722 10.254  1.00 19.65 ? 38  LEU A O   1 
ATOM   304  C CB  . LEU A 1 38 ? 21.479 28.346 9.034   1.00 17.16 ? 38  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 38 ? 20.525 28.289 7.820   1.00 16.39 ? 38  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 38 ? 19.126 28.796 8.104   1.00 18.43 ? 38  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 38 ? 21.216 29.200 6.780   1.00 18.29 ? 38  LEU A CD2 1 
ATOM   308  N N   . GLN A 1 39 ? 23.488 26.885 11.098  1.00 19.95 ? 39  GLN A N   1 
ATOM   309  C CA  . GLN A 1 39 ? 24.221 26.912 12.364  1.00 23.20 ? 39  GLN A CA  1 
ATOM   310  C C   . GLN A 1 39 ? 25.694 26.627 12.191  1.00 22.07 ? 39  GLN A C   1 
ATOM   311  O O   . GLN A 1 39 ? 26.548 27.266 12.833  1.00 23.47 ? 39  GLN A O   1 
ATOM   312  C CB  . GLN A 1 39 ? 23.535 25.998 13.374  1.00 25.88 ? 39  GLN A CB  1 
ATOM   313  C CG  . GLN A 1 39 ? 22.216 26.685 13.719  1.00 30.76 ? 39  GLN A CG  1 
ATOM   314  C CD  . GLN A 1 39 ? 21.519 26.150 14.954  1.00 35.88 ? 39  GLN A CD  1 
ATOM   315  O OE1 . GLN A 1 39 ? 21.321 24.943 15.121  1.00 39.62 ? 39  GLN A OE1 1 
ATOM   316  N NE2 . GLN A 1 39 ? 21.124 27.066 15.827  1.00 38.58 ? 39  GLN A NE2 1 
ATOM   317  N N   . LYS A 1 40 ? 26.031 25.670 11.338  1.00 20.21 ? 40  LYS A N   1 
ATOM   318  C CA  . LYS A 1 40 ? 27.410 25.342 11.080  1.00 19.73 ? 40  LYS A CA  1 
ATOM   319  C C   . LYS A 1 40 ? 28.111 26.271 10.073  1.00 20.05 ? 40  LYS A C   1 
ATOM   320  O O   . LYS A 1 40 ? 29.259 26.703 10.280  1.00 23.40 ? 40  LYS A O   1 
ATOM   321  C CB  . LYS A 1 40 ? 27.529 23.911 10.579  1.00 18.44 ? 40  LYS A CB  1 
ATOM   322  C CG  . LYS A 1 40 ? 27.292 22.894 11.652  1.00 23.65 ? 40  LYS A CG  1 
ATOM   323  C CD  . LYS A 1 40 ? 27.367 21.464 11.151  1.00 24.15 ? 40  LYS A CD  1 
ATOM   324  C CE  . LYS A 1 40 ? 27.076 20.521 12.299  1.00 24.94 ? 40  LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 40 ? 27.066 19.103 11.853  1.00 28.95 ? 40  LYS A NZ  1 
ATOM   326  N N   . GLU A 1 41 ? 27.391 26.635 9.015   1.00 18.81 ? 41  GLU A N   1 
ATOM   327  C CA  . GLU A 1 41 ? 28.035 27.308 7.885   1.00 19.82 ? 41  GLU A CA  1 
ATOM   328  C C   . GLU A 1 41 ? 28.056 28.796 8.013   1.00 20.30 ? 41  GLU A C   1 
ATOM   329  O O   . GLU A 1 41 ? 28.896 29.448 7.334   1.00 21.19 ? 41  GLU A O   1 
ATOM   330  C CB  . GLU A 1 41 ? 27.404 26.884 6.532   1.00 18.68 ? 41  GLU A CB  1 
ATOM   331  C CG  . GLU A 1 41 ? 27.350 25.385 6.322   1.00 22.85 ? 41  GLU A CG  1 
ATOM   332  C CD  . GLU A 1 41 ? 28.710 24.715 6.269   1.00 24.91 ? 41  GLU A CD  1 
ATOM   333  O OE1 . GLU A 1 41 ? 29.729 25.356 5.867   1.00 31.09 ? 41  GLU A OE1 1 
ATOM   334  O OE2 . GLU A 1 41 ? 28.796 23.542 6.674   1.00 26.70 ? 41  GLU A OE2 1 
ATOM   335  N N   . LEU A 1 42 ? 27.157 29.352 8.862   1.00 19.18 ? 42  LEU A N   1 
ATOM   336  C CA  . LEU A 1 42 ? 27.055 30.806 9.151   1.00 20.38 ? 42  LEU A CA  1 
ATOM   337  C C   . LEU A 1 42 ? 27.200 30.996 10.637  1.00 20.60 ? 42  LEU A C   1 
ATOM   338  O O   . LEU A 1 42 ? 26.477 31.768 11.236  1.00 20.52 ? 42  LEU A O   1 
ATOM   339  C CB  . LEU A 1 42 ? 25.692 31.373 8.736   1.00 20.39 ? 42  LEU A CB  1 
ATOM   340  C CG  . LEU A 1 42 ? 25.573 31.587 7.262   1.00 20.46 ? 42  LEU A CG  1 
ATOM   341  C CD1 . LEU A 1 42 ? 24.148 32.050 6.972   1.00 23.96 ? 42  LEU A CD1 1 
ATOM   342  C CD2 . LEU A 1 42 ? 26.502 32.527 6.637   1.00 23.88 ? 42  LEU A CD2 1 
ATOM   343  N N   . ALA A 1 43 ? 28.084 30.180 11.257  1.00 20.35 ? 43  ALA A N   1 
ATOM   344  C CA  . ALA A 1 43 ? 28.181 30.111 12.724  1.00 21.89 ? 43  ALA A CA  1 
ATOM   345  C C   . ALA A 1 43 ? 28.386 31.484 13.417  1.00 23.37 ? 43  ALA A C   1 
ATOM   346  O O   . ALA A 1 43 ? 27.860 31.738 14.524  1.00 25.42 ? 43  ALA A O   1 
ATOM   347  C CB  . ALA A 1 43 ? 29.332 29.163 13.160  1.00 21.68 ? 43  ALA A CB  1 
ATOM   348  N N   . THR A 1 44 ? 29.114 32.350 12.735  1.00 21.01 ? 44  THR A N   1 
ATOM   349  C CA  . THR A 1 44 ? 29.473 33.651 13.312  1.00 22.10 ? 44  THR A CA  1 
ATOM   350  C C   . THR A 1 44 ? 28.406 34.724 13.169  1.00 19.49 ? 44  THR A C   1 
ATOM   351  O O   . THR A 1 44 ? 28.567 35.806 13.745  1.00 20.10 ? 44  THR A O   1 
ATOM   352  C CB  . THR A 1 44 ? 30.842 34.140 12.861  1.00 22.08 ? 44  THR A CB  1 
ATOM   353  O OG1 . THR A 1 44 ? 30.835 34.454 11.479  1.00 22.99 ? 44  THR A OG1 1 
ATOM   354  C CG2 . THR A 1 44 ? 31.888 33.041 13.147  1.00 24.11 ? 44  THR A CG2 1 
ATOM   355  N N   . TRP A 1 45 ? 27.333 34.476 12.423  1.00 19.88 ? 45  TRP A N   1 
ATOM   356  C CA  . TRP A 1 45 ? 26.377 35.535 12.163  1.00 18.79 ? 45  TRP A CA  1 
ATOM   357  C C   . TRP A 1 45 ? 25.333 35.619 13.261  1.00 20.40 ? 45  TRP A C   1 
ATOM   358  O O   . TRP A 1 45 ? 24.760 34.579 13.627  1.00 22.77 ? 45  TRP A O   1 
ATOM   359  C CB  . TRP A 1 45 ? 25.696 35.289 10.798  1.00 16.67 ? 45  TRP A CB  1 
ATOM   360  C CG  . TRP A 1 45 ? 26.600 35.593 9.644   1.00 14.54 ? 45  TRP A CG  1 
ATOM   361  C CD1 . TRP A 1 45 ? 27.977 35.369 9.558   1.00 14.25 ? 45  TRP A CD1 1 
ATOM   362  C CD2 . TRP A 1 45 ? 26.247 36.202 8.412   1.00 14.88 ? 45  TRP A CD2 1 
ATOM   363  N NE1 . TRP A 1 45 ? 28.429 35.786 8.372   1.00 15.38 ? 45  TRP A NE1 1 
ATOM   364  C CE2 . TRP A 1 45 ? 27.403 36.335 7.650   1.00 15.13 ? 45  TRP A CE2 1 
ATOM   365  C CE3 . TRP A 1 45 ? 25.028 36.686 7.869   1.00 20.35 ? 45  TRP A CE3 1 
ATOM   366  C CZ2 . TRP A 1 45 ? 27.396 36.929 6.376   1.00 15.41 ? 45  TRP A CZ2 1 
ATOM   367  C CZ3 . TRP A 1 45 ? 25.077 37.322 6.602   1.00 18.96 ? 45  TRP A CZ3 1 
ATOM   368  C CH2 . TRP A 1 45 ? 26.235 37.413 5.894   1.00 19.88 ? 45  TRP A CH2 1 
ATOM   369  N N   . THR A 1 46 ? 25.056 36.829 13.736  1.00 21.69 ? 46  THR A N   1 
ATOM   370  C CA  . THR A 1 46 ? 24.144 37.105 14.849  1.00 22.09 ? 46  THR A CA  1 
ATOM   371  C C   . THR A 1 46 ? 23.296 38.288 14.548  1.00 22.63 ? 46  THR A C   1 
ATOM   372  O O   . THR A 1 46 ? 23.716 39.174 13.810  1.00 20.80 ? 46  THR A O   1 
ATOM   373  C CB  . THR A 1 46 ? 24.886 37.338 16.159  1.00 25.17 ? 46  THR A CB  1 
ATOM   374  O OG1 . THR A 1 46 ? 25.819 38.414 16.008  1.00 23.95 ? 46  THR A OG1 1 
ATOM   375  C CG2 . THR A 1 46 ? 25.629 36.095 16.560  1.00 26.85 ? 46  THR A CG2 1 
ATOM   376  N N   . PRO A 1 47 ? 22.090 38.369 15.111  1.00 21.95 ? 47  PRO A N   1 
ATOM   377  C CA  . PRO A 1 47 ? 21.122 39.446 14.801  1.00 24.60 ? 47  PRO A CA  1 
ATOM   378  C C   . PRO A 1 47 ? 21.550 40.891 15.152  1.00 25.41 ? 47  PRO A C   1 
ATOM   379  O O   . PRO A 1 47 ? 22.273 41.107 16.118  1.00 27.08 ? 47  PRO A O   1 
ATOM   380  C CB  . PRO A 1 47 ? 19.861 39.013 15.576  1.00 25.62 ? 47  PRO A CB  1 
ATOM   381  C CG  . PRO A 1 47 ? 20.358 37.975 16.571  1.00 24.16 ? 47  PRO A CG  1 
ATOM   382  C CD  . PRO A 1 47 ? 21.478 37.279 15.908  1.00 24.58 ? 47  PRO A CD  1 
ATOM   383  N N   . THR A 1 48 ? 21.103 41.845 14.346  1.00 23.46 ? 48  THR A N   1 
ATOM   384  C CA  . THR A 1 48 ? 21.271 43.295 14.581  1.00 25.55 ? 48  THR A CA  1 
ATOM   385  C C   . THR A 1 48 ? 20.226 43.848 15.549  1.00 28.61 ? 48  THR A C   1 
ATOM   386  O O   . THR A 1 48 ? 19.308 43.139 15.934  1.00 29.64 ? 48  THR A O   1 
ATOM   387  C CB  . THR A 1 48 ? 21.250 44.077 13.271  1.00 23.30 ? 48  THR A CB  1 
ATOM   388  O OG1 . THR A 1 48 ? 19.996 43.881 12.598  1.00 23.32 ? 48  THR A OG1 1 
ATOM   389  C CG2 . THR A 1 48 ? 22.411 43.676 12.416  1.00 23.12 ? 48  THR A CG2 1 
ATOM   390  N N   . GLU A 1 49 ? 20.390 45.122 15.930  1.00 31.34 ? 49  GLU A N   1 
ATOM   391  C CA  . GLU A 1 49 ? 19.653 45.759 17.045  1.00 33.76 ? 49  GLU A CA  1 
ATOM   392  C C   . GLU A 1 49 ? 18.136 45.595 17.053  1.00 34.57 ? 49  GLU A C   1 
ATOM   393  O O   . GLU A 1 49 ? 17.535 45.423 18.116  1.00 36.99 ? 49  GLU A O   1 
ATOM   394  C CB  . GLU A 1 49 ? 19.997 47.267 17.096  1.00 34.13 ? 49  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 49 ? 19.177 48.087 18.140  1.00 40.84 ? 49  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 49 ? 19.739 49.486 18.427  1.00 46.14 ? 49  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 49 ? 20.586 49.973 17.646  1.00 46.72 ? 49  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 49 ? 19.327 50.105 19.448  1.00 49.90 ? 49  GLU A OE2 1 
ATOM   399  N N   . PHE A 1 50 ? 17.498 45.689 15.888  1.00 33.71 ? 50  PHE A N   1 
ATOM   400  C CA  . PHE A 1 50 ? 16.041 45.631 15.834  1.00 33.51 ? 50  PHE A CA  1 
ATOM   401  C C   . PHE A 1 50 ? 15.515 44.316 15.268  1.00 32.34 ? 50  PHE A C   1 
ATOM   402  O O   . PHE A 1 50 ? 14.318 44.220 14.934  1.00 34.35 ? 50  PHE A O   1 
ATOM   403  C CB  . PHE A 1 50 ? 15.475 46.795 15.009  1.00 33.47 ? 50  PHE A CB  1 
ATOM   404  C CG  . PHE A 1 50 ? 16.051 48.137 15.384  1.00 34.41 ? 50  PHE A CG  1 
ATOM   405  C CD1 . PHE A 1 50 ? 15.770 48.709 16.622  1.00 39.50 ? 50  PHE A CD1 1 
ATOM   406  C CD2 . PHE A 1 50 ? 16.880 48.831 14.498  1.00 34.50 ? 50  PHE A CD2 1 
ATOM   407  C CE1 . PHE A 1 50 ? 16.303 49.944 16.956  1.00 36.85 ? 50  PHE A CE1 1 
ATOM   408  C CE2 . PHE A 1 50 ? 17.426 50.064 14.833  1.00 35.04 ? 50  PHE A CE2 1 
ATOM   409  C CZ  . PHE A 1 50 ? 17.142 50.612 16.072  1.00 36.27 ? 50  PHE A CZ  1 
ATOM   410  N N   . ARG A 1 51 ? 16.374 43.297 15.179  1.00 30.31 ? 51  ARG A N   1 
ATOM   411  C CA  . ARG A 1 51 ? 15.960 42.021 14.585  1.00 28.81 ? 51  ARG A CA  1 
ATOM   412  C C   . ARG A 1 51 ? 16.095 40.761 15.441  1.00 28.94 ? 51  ARG A C   1 
ATOM   413  O O   . ARG A 1 51 ? 15.921 39.653 14.931  1.00 27.60 ? 51  ARG A O   1 
ATOM   414  C CB  . ARG A 1 51 ? 16.717 41.796 13.275  1.00 27.01 ? 51  ARG A CB  1 
ATOM   415  C CG  . ARG A 1 51 ? 16.368 42.824 12.225  1.00 27.71 ? 51  ARG A CG  1 
ATOM   416  C CD  . ARG A 1 51 ? 15.050 42.460 11.598  1.00 32.35 ? 51  ARG A CD  1 
ATOM   417  N NE  . ARG A 1 51 ? 14.584 43.595 10.837  1.00 37.33 ? 51  ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 51 ? 13.436 44.232 11.053  1.00 42.43 ? 51  ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 51 ? 12.567 43.794 11.977  1.00 42.14 ? 51  ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 51 ? 13.139 45.283 10.303  1.00 42.80 ? 51  ARG A NH2 1 
ATOM   421  N N   . GLU A 1 52 ? 16.401 40.892 16.726  1.00 30.17 ? 52  GLU A N   1 
ATOM   422  C CA  . GLU A 1 52 ? 16.590 39.679 17.541  1.00 31.74 ? 52  GLU A CA  1 
ATOM   423  C C   . GLU A 1 52 ? 15.357 38.792 17.607  1.00 32.15 ? 52  GLU A C   1 
ATOM   424  O O   . GLU A 1 52 ? 15.464 37.572 17.527  1.00 31.40 ? 52  GLU A O   1 
ATOM   425  C CB  . GLU A 1 52 ? 17.012 40.019 18.956  1.00 34.24 ? 52  GLU A CB  1 
ATOM   426  C CG  . GLU A 1 52 ? 18.205 40.916 19.016  1.00 37.09 ? 52  GLU A CG  1 
ATOM   427  C CD  . GLU A 1 52 ? 18.615 41.136 20.445  1.00 43.34 ? 52  GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 52 ? 18.417 40.195 21.250  1.00 47.34 ? 52  GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 52 ? 19.103 42.231 20.762  1.00 45.47 ? 52  GLU A OE2 1 
ATOM   430  N N   A CYS A 1 53 ? 14.192 39.401 17.723  0.50 33.45 ? 53  CYS A N   1 
ATOM   431  N N   B CYS A 1 53 ? 14.198 39.432 17.807  0.50 33.22 ? 53  CYS A N   1 
ATOM   432  C CA  A CYS A 1 53 ? 12.996 38.604 17.855  0.50 33.97 ? 53  CYS A CA  1 
ATOM   433  C CA  B CYS A 1 53 ? 12.896 38.753 17.848  0.50 33.54 ? 53  CYS A CA  1 
ATOM   434  C C   A CYS A 1 53 ? 12.522 38.018 16.536  0.50 31.96 ? 53  CYS A C   1 
ATOM   435  C C   B CYS A 1 53 ? 12.682 37.984 16.552  0.50 31.25 ? 53  CYS A C   1 
ATOM   436  O O   A CYS A 1 53 ? 11.913 36.951 16.527  0.50 31.00 ? 53  CYS A O   1 
ATOM   437  O O   B CYS A 1 53 ? 12.410 36.773 16.579  0.50 29.13 ? 53  CYS A O   1 
ATOM   438  C CB  A CYS A 1 53 ? 11.931 39.398 18.582  0.50 35.57 ? 53  CYS A CB  1 
ATOM   439  C CB  B CYS A 1 53 ? 11.759 39.771 18.073  0.50 34.50 ? 53  CYS A CB  1 
ATOM   440  S SG  A CYS A 1 53 ? 12.486 39.701 20.282  0.50 40.18 ? 53  CYS A SG  1 
ATOM   441  S SG  B CYS A 1 53 ? 10.045 39.144 18.328  0.50 39.27 ? 53  CYS A SG  1 
ATOM   442  N N   . ASP A 1 54 ? 12.830 38.676 15.420  1.00 30.51 ? 54  ASP A N   1 
ATOM   443  C CA  . ASP A 1 54 ? 12.527 38.098 14.113  1.00 28.01 ? 54  ASP A CA  1 
ATOM   444  C C   . ASP A 1 54 ? 13.440 36.909 13.873  1.00 25.28 ? 54  ASP A C   1 
ATOM   445  O O   . ASP A 1 54 ? 13.028 35.889 13.321  1.00 23.80 ? 54  ASP A O   1 
ATOM   446  C CB  . ASP A 1 54 ? 12.757 39.115 12.985  1.00 28.47 ? 54  ASP A CB  1 
ATOM   447  C CG  . ASP A 1 54 ? 11.612 40.105 12.846  1.00 30.59 ? 54  ASP A CG  1 
ATOM   448  O OD1 . ASP A 1 54 ? 10.495 39.817 13.362  1.00 35.59 ? 54  ASP A OD1 1 
ATOM   449  O OD2 . ASP A 1 54 ? 11.808 41.162 12.219  1.00 36.27 ? 54  ASP A OD2 1 
ATOM   450  N N   . TYR A 1 55 ? 14.700 37.069 14.262  1.00 24.42 ? 55  TYR A N   1 
ATOM   451  C CA  . TYR A 1 55 ? 15.720 36.042 14.097  1.00 21.88 ? 55  TYR A CA  1 
ATOM   452  C C   . TYR A 1 55 ? 15.370 34.829 14.928  1.00 23.89 ? 55  TYR A C   1 
ATOM   453  O O   . TYR A 1 55 ? 15.324 33.715 14.424  1.00 22.03 ? 55  TYR A O   1 
ATOM   454  C CB  . TYR A 1 55 ? 17.086 36.613 14.536  1.00 22.28 ? 55  TYR A CB  1 
ATOM   455  C CG  . TYR A 1 55 ? 18.200 35.628 14.521  1.00 22.63 ? 55  TYR A CG  1 
ATOM   456  C CD1 . TYR A 1 55 ? 18.902 35.353 13.363  1.00 18.49 ? 55  TYR A CD1 1 
ATOM   457  C CD2 . TYR A 1 55 ? 18.581 34.969 15.702  1.00 25.43 ? 55  TYR A CD2 1 
ATOM   458  C CE1 . TYR A 1 55 ? 19.946 34.429 13.347  1.00 21.72 ? 55  TYR A CE1 1 
ATOM   459  C CE2 . TYR A 1 55 ? 19.590 34.069 15.707  1.00 26.54 ? 55  TYR A CE2 1 
ATOM   460  C CZ  . TYR A 1 55 ? 20.278 33.784 14.549  1.00 27.36 ? 55  TYR A CZ  1 
ATOM   461  O OH  . TYR A 1 55 ? 21.308 32.883 14.611  1.00 25.42 ? 55  TYR A OH  1 
ATOM   462  N N   . ASN A 1 56 ? 15.114 35.085 16.200  1.00 26.13 ? 56  ASN A N   1 
ATOM   463  C CA  . ASN A 1 56 ? 14.779 33.964 17.082  1.00 26.54 ? 56  ASN A CA  1 
ATOM   464  C C   . ASN A 1 56 ? 13.552 33.180 16.627  1.00 27.44 ? 56  ASN A C   1 
ATOM   465  O O   . ASN A 1 56 ? 13.578 31.930 16.618  1.00 26.79 ? 56  ASN A O   1 
ATOM   466  C CB  . ASN A 1 56 ? 14.655 34.442 18.519  1.00 28.24 ? 56  ASN A CB  1 
ATOM   467  C CG  . ASN A 1 56 ? 16.010 34.883 19.100  1.00 31.88 ? 56  ASN A CG  1 
ATOM   468  O OD1 . ASN A 1 56 ? 17.062 34.354 18.727  1.00 32.20 ? 56  ASN A OD1 1 
ATOM   469  N ND2 . ASN A 1 56 ? 15.976 35.804 20.039  1.00 38.07 ? 56  ASN A ND2 1 
ATOM   470  N N   . LYS A 1 57 ? 12.526 33.898 16.167  1.00 27.72 ? 57  LYS A N   1 
ATOM   471  C CA  . LYS A 1 57 ? 11.319 33.244 15.604  1.00 27.01 ? 57  LYS A CA  1 
ATOM   472  C C   . LYS A 1 57 ? 11.627 32.459 14.345  1.00 25.50 ? 57  LYS A C   1 
ATOM   473  O O   . LYS A 1 57 ? 11.187 31.296 14.202  1.00 25.47 ? 57  LYS A O   1 
ATOM   474  C CB  . LYS A 1 57 ? 10.236 34.280 15.278  1.00 28.71 ? 57  LYS A CB  1 
ATOM   475  C CG  . LYS A 1 57 ? 9.631  34.950 16.494  1.00 34.86 ? 57  LYS A CG  1 
ATOM   476  C CD  . LYS A 1 57 ? 8.555  35.973 16.126  1.00 41.12 ? 57  LYS A CD  1 
ATOM   477  C CE  . LYS A 1 57 ? 8.280  36.871 17.316  1.00 44.97 ? 57  LYS A CE  1 
ATOM   478  N NZ  . LYS A 1 57 ? 8.211  36.045 18.570  1.00 44.86 ? 57  LYS A NZ  1 
ATOM   479  N N   . PHE A 1 58 ? 12.413 33.072 13.438  1.00 23.71 ? 58  PHE A N   1 
ATOM   480  C CA  . PHE A 1 58 ? 12.928 32.307 12.309  1.00 22.87 ? 58  PHE A CA  1 
ATOM   481  C C   . PHE A 1 58 ? 13.622 30.988 12.719  1.00 23.43 ? 58  PHE A C   1 
ATOM   482  O O   . PHE A 1 58 ? 13.342 29.927 12.142  1.00 21.62 ? 58  PHE A O   1 
ATOM   483  C CB  . PHE A 1 58 ? 13.866 33.251 11.517  1.00 22.74 ? 58  PHE A CB  1 
ATOM   484  C CG  . PHE A 1 58 ? 14.496 32.614 10.327  1.00 25.49 ? 58  PHE A CG  1 
ATOM   485  C CD1 . PHE A 1 58 ? 13.829 32.556 9.115   1.00 27.36 ? 58  PHE A CD1 1 
ATOM   486  C CD2 . PHE A 1 58 ? 15.763 32.079 10.426  1.00 32.41 ? 58  PHE A CD2 1 
ATOM   487  C CE1 . PHE A 1 58 ? 14.427 31.958 8.025   1.00 33.89 ? 58  PHE A CE1 1 
ATOM   488  C CE2 . PHE A 1 58 ? 16.366 31.461 9.331   1.00 35.27 ? 58  PHE A CE2 1 
ATOM   489  C CZ  . PHE A 1 58 ? 15.691 31.408 8.137   1.00 35.26 ? 58  PHE A CZ  1 
ATOM   490  N N   . MET A 1 59 ? 14.519 31.052 13.706  1.00 23.96 ? 59  MET A N   1 
ATOM   491  C CA  . MET A 1 59 ? 15.279 29.872 14.072  1.00 25.49 ? 59  MET A CA  1 
ATOM   492  C C   . MET A 1 59 ? 14.419 28.800 14.774  1.00 26.27 ? 59  MET A C   1 
ATOM   493  O O   . MET A 1 59 ? 14.598 27.593 14.566  1.00 26.75 ? 59  MET A O   1 
ATOM   494  C CB  . MET A 1 59 ? 16.471 30.254 14.945  1.00 26.53 ? 59  MET A CB  1 
ATOM   495  C CG  . MET A 1 59 ? 17.726 30.847 14.172  1.00 26.32 ? 59  MET A CG  1 
ATOM   496  S SD  . MET A 1 59 ? 18.248 29.798 12.766  1.00 35.46 ? 59  MET A SD  1 
ATOM   497  C CE  . MET A 1 59 ? 19.638 30.691 12.159  1.00 32.31 ? 59  MET A CE  1 
ATOM   498  N N   . SER A 1 60 ? 13.448 29.283 15.526  1.00 26.84 ? 60  SER A N   1 
ATOM   499  C CA  . SER A 1 60 ? 12.554 28.375 16.254  1.00 28.00 ? 60  SER A CA  1 
ATOM   500  C C   . SER A 1 60 ? 11.607 27.644 15.297  1.00 27.68 ? 60  SER A C   1 
ATOM   501  O O   . SER A 1 60 ? 11.297 26.480 15.534  1.00 28.56 ? 60  SER A O   1 
ATOM   502  C CB  . SER A 1 60 ? 11.824 29.153 17.310  1.00 29.75 ? 60  SER A CB  1 
ATOM   503  O OG  . SER A 1 60 ? 10.809 29.908 16.709  1.00 35.02 ? 60  SER A OG  1 
ATOM   504  N N   . VAL A 1 61 ? 11.212 28.285 14.189  1.00 28.58 ? 61  VAL A N   1 
ATOM   505  C CA  . VAL A 1 61 ? 10.352 27.600 13.201  1.00 30.63 ? 61  VAL A CA  1 
ATOM   506  C C   . VAL A 1 61 ? 11.070 26.419 12.545  1.00 30.70 ? 61  VAL A C   1 
ATOM   507  O O   . VAL A 1 61 ? 10.462 25.360 12.368  1.00 32.49 ? 61  VAL A O   1 
ATOM   508  C CB  . VAL A 1 61 ? 9.781  28.560 12.151  1.00 30.69 ? 61  VAL A CB  1 
ATOM   509  C CG1 . VAL A 1 61 ? 9.182  27.820 10.961  1.00 32.52 ? 61  VAL A CG1 1 
ATOM   510  C CG2 . VAL A 1 61 ? 8.737  29.447 12.802  1.00 33.25 ? 61  VAL A CG2 1 
ATOM   511  N N   . LEU A 1 62 ? 12.348 26.606 12.220  1.00 29.99 ? 62  LEU A N   1 
ATOM   512  C CA  . LEU A 1 62 ? 13.092 25.509 11.575  1.00 30.06 ? 62  LEU A CA  1 
ATOM   513  C C   . LEU A 1 62 ? 13.190 24.322 12.501  1.00 31.02 ? 62  LEU A C   1 
ATOM   514  O O   . LEU A 1 62 ? 12.992 23.184 12.070  1.00 31.34 ? 62  LEU A O   1 
ATOM   515  C CB  . LEU A 1 62 ? 14.479 25.951 11.191  1.00 28.51 ? 62  LEU A CB  1 
ATOM   516  C CG  . LEU A 1 62 ? 14.532 27.075 10.158  1.00 27.08 ? 62  LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 62 ? 15.977 27.293 9.888   1.00 24.47 ? 62  LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 62 ? 13.749 26.669 8.906   1.00 26.53 ? 62  LEU A CD2 1 
ATOM   519  N N   . ASP A 1 63 ? 13.427 24.608 13.780  1.00 32.47 ? 63  ASP A N   1 
ATOM   520  C CA  . ASP A 1 63 ? 13.671 23.589 14.789  1.00 32.67 ? 63  ASP A CA  1 
ATOM   521  C C   . ASP A 1 63 ? 12.407 22.823 15.119  1.00 32.86 ? 63  ASP A C   1 
ATOM   522  O O   . ASP A 1 63 ? 12.447 21.639 15.441  1.00 33.68 ? 63  ASP A O   1 
ATOM   523  C CB  . ASP A 1 63 ? 14.214 24.233 16.057  1.00 34.72 ? 63  ASP A CB  1 
ATOM   524  C CG  . ASP A 1 63 ? 15.188 23.332 16.804  1.00 40.16 ? 63  ASP A CG  1 
ATOM   525  O OD1 . ASP A 1 63 ? 15.581 22.266 16.267  1.00 42.95 ? 63  ASP A OD1 1 
ATOM   526  O OD2 . ASP A 1 63 ? 15.574 23.705 17.939  1.00 46.83 ? 63  ASP A OD2 1 
ATOM   527  N N   . THR A 1 64 ? 11.273 23.504 15.053  1.00 31.81 ? 64  THR A N   1 
ATOM   528  C CA  . THR A 1 64 ? 10.017 22.842 15.347  1.00 32.29 ? 64  THR A CA  1 
ATOM   529  C C   . THR A 1 64 ? 9.541  22.092 14.139  1.00 31.52 ? 64  THR A C   1 
ATOM   530  O O   . THR A 1 64 ? 9.084  20.940 14.230  1.00 29.99 ? 64  THR A O   1 
ATOM   531  C CB  . THR A 1 64 ? 8.955  23.869 15.739  1.00 33.32 ? 64  THR A CB  1 
ATOM   532  O OG1 . THR A 1 64 ? 9.265  24.351 17.037  1.00 34.67 ? 64  THR A OG1 1 
ATOM   533  C CG2 . THR A 1 64 ? 7.561  23.222 15.775  1.00 34.77 ? 64  THR A CG2 1 
ATOM   534  N N   . ASN A 1 65 ? 9.681  22.722 12.983  1.00 31.64 ? 65  ASN A N   1 
ATOM   535  C CA  . ASN A 1 65 ? 8.961  22.204 11.862  1.00 33.11 ? 65  ASN A CA  1 
ATOM   536  C C   . ASN A 1 65 ? 9.726  21.288 10.914  1.00 32.48 ? 65  ASN A C   1 
ATOM   537  O O   . ASN A 1 65 ? 10.337 21.707 9.980   1.00 30.82 ? 65  ASN A O   1 
ATOM   538  C CB  . ASN A 1 65 ? 8.174  23.319 11.185  1.00 34.11 ? 65  ASN A CB  1 
ATOM   539  C CG  . ASN A 1 65 ? 7.199  23.974 12.149  1.00 37.96 ? 65  ASN A CG  1 
ATOM   540  O OD1 . ASN A 1 65 ? 7.241  25.198 12.372  1.00 39.87 ? 65  ASN A OD1 1 
ATOM   541  N ND2 . ASN A 1 65 ? 6.363  23.142 12.806  1.00 35.59 ? 65  ASN A ND2 1 
ATOM   542  N N   . LYS A 1 66 ? 9.513  19.999 11.100  1.00 34.07 ? 66  LYS A N   1 
ATOM   543  C CA  . LYS A 1 66 ? 10.302 18.956 10.450  1.00 34.81 ? 66  LYS A CA  1 
ATOM   544  C C   . LYS A 1 66 ? 10.081 18.659 8.945   1.00 35.53 ? 66  LYS A C   1 
ATOM   545  O O   . LYS A 1 66 ? 10.574 17.636 8.462   1.00 35.26 ? 66  LYS A O   1 
ATOM   546  C CB  . LYS A 1 66 ? 10.238 17.703 11.319  1.00 35.89 ? 66  LYS A CB  1 
ATOM   547  C CG  . LYS A 1 66 ? 10.806 17.940 12.727  1.00 36.07 ? 66  LYS A CG  1 
ATOM   548  C CD  . LYS A 1 66 ? 12.218 18.512 12.707  1.00 34.23 ? 66  LYS A CD  1 
ATOM   549  C CE  . LYS A 1 66 ? 12.567 18.992 14.100  1.00 31.12 ? 66  LYS A CE  1 
ATOM   550  N NZ  . LYS A 1 66 ? 13.934 19.563 14.227  1.00 35.81 ? 66  LYS A NZ  1 
ATOM   551  N N   . ASP A 1 67 ? 9.451  19.584 8.196   1.00 36.08 ? 67  ASP A N   1 
ATOM   552  C CA  . ASP A 1 67 ? 9.128  19.380 6.749   1.00 36.37 ? 67  ASP A CA  1 
ATOM   553  C C   . ASP A 1 67 ? 10.301 19.285 5.765   1.00 34.25 ? 67  ASP A C   1 
ATOM   554  O O   . ASP A 1 67 ? 11.192 20.194 5.676   1.00 35.30 ? 67  ASP A O   1 
ATOM   555  C CB  . ASP A 1 67 ? 8.127  20.410 6.168   1.00 37.49 ? 67  ASP A CB  1 
ATOM   556  C CG  . ASP A 1 67 ? 6.952  20.713 7.088   1.00 35.83 ? 67  ASP A CG  1 
ATOM   557  O OD1 . ASP A 1 67 ? 5.838  20.090 6.998   1.00 40.79 ? 67  ASP A OD1 1 
ATOM   558  O OD2 . ASP A 1 67 ? 7.146  21.598 7.907   1.00 27.47 ? 67  ASP A OD2 1 
ATOM   559  N N   A CYS A 1 68 ? 10.229 18.236 4.952   0.50 32.64 ? 68  CYS A N   1 
ATOM   560  C CA  A CYS A 1 68 ? 11.331 17.868 4.071   0.50 29.52 ? 68  CYS A CA  1 
ATOM   561  C C   A CYS A 1 68 ? 11.074 18.263 2.637   0.50 29.51 ? 68  CYS A C   1 
ATOM   562  O O   A CYS A 1 68 ? 11.419 17.577 1.671   0.50 29.65 ? 68  CYS A O   1 
ATOM   563  C CB  A CYS A 1 68 ? 11.671 16.413 4.248   0.50 28.85 ? 68  CYS A CB  1 
ATOM   564  S SG  A CYS A 1 68 ? 12.109 16.178 5.965   0.50 25.64 ? 68  CYS A SG  1 
ATOM   565  N N   . GLU A 1 69 ? 10.480 19.435 2.561   1.00 30.46 ? 69  GLU A N   1 
ATOM   566  C CA  . GLU A 1 69 ? 10.311 20.175 1.374   1.00 30.50 ? 69  GLU A CA  1 
ATOM   567  C C   . GLU A 1 69 ? 10.964 21.548 1.737   1.00 29.39 ? 69  GLU A C   1 
ATOM   568  O O   . GLU A 1 69 ? 10.296 22.504 2.154   1.00 32.38 ? 69  GLU A O   1 
ATOM   569  C CB  . GLU A 1 69 ? 8.827  20.305 1.043   1.00 32.83 ? 69  GLU A CB  1 
ATOM   570  N N   . VAL A 1 70 ? 12.282 21.593 1.703   1.00 24.17 ? 70  VAL A N   1 
ATOM   571  C CA  . VAL A 1 70 ? 12.986 22.844 1.494   1.00 22.06 ? 70  VAL A CA  1 
ATOM   572  C C   . VAL A 1 70 ? 13.713 22.667 0.170   1.00 19.71 ? 70  VAL A C   1 
ATOM   573  O O   . VAL A 1 70 ? 14.625 21.828 0.073   1.00 21.11 ? 70  VAL A O   1 
ATOM   574  C CB  . VAL A 1 70 ? 14.037 23.081 2.597   1.00 21.44 ? 70  VAL A CB  1 
ATOM   575  C CG1 . VAL A 1 70 ? 14.782 24.323 2.340   1.00 19.90 ? 70  VAL A CG1 1 
ATOM   576  C CG2 . VAL A 1 70 ? 13.325 23.182 3.965   1.00 26.19 ? 70  VAL A CG2 1 
ATOM   577  N N   . ASP A 1 71 ? 13.326 23.400 -0.859  1.00 17.73 ? 71  ASP A N   1 
ATOM   578  C CA  . ASP A 1 71 ? 14.051 23.308 -2.117  1.00 15.36 ? 71  ASP A CA  1 
ATOM   579  C C   . ASP A 1 71 ? 15.156 24.368 -2.168  1.00 14.78 ? 71  ASP A C   1 
ATOM   580  O O   . ASP A 1 71 ? 15.365 25.115 -1.214  1.00 13.15 ? 71  ASP A O   1 
ATOM   581  C CB  . ASP A 1 71 ? 13.106 23.401 -3.324  1.00 15.57 ? 71  ASP A CB  1 
ATOM   582  C CG  . ASP A 1 71 ? 12.336 24.718 -3.390  1.00 20.42 ? 71  ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 71 ? 12.652 25.719 -2.689  1.00 16.91 ? 71  ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 71 ? 11.387 24.751 -4.226  1.00 24.01 ? 71  ASP A OD2 1 
ATOM   585  N N   . PHE A 1 72 ? 15.869 24.375 -3.285  1.00 14.30 ? 72  PHE A N   1 
ATOM   586  C CA  . PHE A 1 72 ? 16.979 25.333 -3.399  1.00 12.80 ? 72  PHE A CA  1 
ATOM   587  C C   . PHE A 1 72 ? 16.543 26.793 -3.207  1.00 13.15 ? 72  PHE A C   1 
ATOM   588  O O   . PHE A 1 72 ? 17.195 27.540 -2.475  1.00 12.66 ? 72  PHE A O   1 
ATOM   589  C CB  . PHE A 1 72 ? 17.673 25.173 -4.746  1.00 14.02 ? 72  PHE A CB  1 
ATOM   590  C CG  . PHE A 1 72 ? 18.846 26.072 -4.911  1.00 12.99 ? 72  PHE A CG  1 
ATOM   591  C CD1 . PHE A 1 72 ? 20.002 25.887 -4.154  1.00 11.73 ? 72  PHE A CD1 1 
ATOM   592  C CD2 . PHE A 1 72 ? 18.800 27.188 -5.780  1.00 13.37 ? 72  PHE A CD2 1 
ATOM   593  C CE1 . PHE A 1 72 ? 21.067 26.722 -4.304  1.00 12.76 ? 72  PHE A CE1 1 
ATOM   594  C CE2 . PHE A 1 72 ? 19.873 27.996 -5.941  1.00 13.10 ? 72  PHE A CE2 1 
ATOM   595  C CZ  . PHE A 1 72 ? 21.056 27.805 -5.182  1.00 13.32 ? 72  PHE A CZ  1 
ATOM   596  N N   . VAL A 1 73 ? 15.409 27.165 -3.833  1.00 13.69 ? 73  VAL A N   1 
ATOM   597  C CA  . VAL A 1 73 ? 14.928 28.539 -3.726  1.00 15.98 ? 73  VAL A CA  1 
ATOM   598  C C   . VAL A 1 73 ? 14.605 28.874 -2.286  1.00 14.26 ? 73  VAL A C   1 
ATOM   599  O O   . VAL A 1 73 ? 14.939 29.985 -1.851  1.00 15.18 ? 73  VAL A O   1 
ATOM   600  C CB  . VAL A 1 73 ? 13.758 28.730 -4.680  1.00 17.77 ? 73  VAL A CB  1 
ATOM   601  C CG1 . VAL A 1 73 ? 13.005 30.060 -4.406  1.00 20.71 ? 73  VAL A CG1 1 
ATOM   602  C CG2 . VAL A 1 73 ? 14.248 28.674 -6.131  1.00 20.55 ? 73  VAL A CG2 1 
ATOM   603  N N   . GLU A 1 74 ? 14.018 27.963 -1.515  1.00 13.34 ? 74  GLU A N   1 
ATOM   604  C CA  A GLU A 1 74 ? 13.712 28.182 -0.126  0.38 14.05 ? 74  GLU A CA  1 
ATOM   605  C CA  C GLU A 1 74 ? 13.733 28.257 -0.139  0.62 13.63 ? 74  GLU A CA  1 
ATOM   606  C C   . GLU A 1 74 ? 14.993 28.323 0.714   1.00 13.38 ? 74  GLU A C   1 
ATOM   607  O O   . GLU A 1 74 ? 15.079 29.150 1.641   1.00 13.68 ? 74  GLU A O   1 
ATOM   608  C CB  A GLU A 1 74 ? 12.849 27.010 0.366   0.38 15.51 ? 74  GLU A CB  1 
ATOM   609  C CB  C GLU A 1 74 ? 12.758 27.248 0.462   0.62 15.73 ? 74  GLU A CB  1 
ATOM   610  C CG  A GLU A 1 74 ? 12.347 27.146 1.792   0.38 18.80 ? 74  GLU A CG  1 
ATOM   611  C CG  C GLU A 1 74 ? 12.262 27.648 1.869   0.62 18.50 ? 74  GLU A CG  1 
ATOM   612  C CD  A GLU A 1 74 ? 11.640 28.467 2.044   0.38 23.01 ? 74  GLU A CD  1 
ATOM   613  C CD  C GLU A 1 74 ? 11.274 26.649 2.468   0.62 24.61 ? 74  GLU A CD  1 
ATOM   614  O OE1 A GLU A 1 74 ? 11.213 29.126 1.064   0.38 24.75 ? 74  GLU A OE1 1 
ATOM   615  O OE1 C GLU A 1 74 ? 10.884 25.676 1.788   0.62 29.44 ? 74  GLU A OE1 1 
ATOM   616  O OE2 A GLU A 1 74 ? 11.495 28.845 3.226   0.38 26.41 ? 74  GLU A OE2 1 
ATOM   617  O OE2 C GLU A 1 74 ? 10.866 26.895 3.623   0.62 29.39 ? 74  GLU A OE2 1 
ATOM   618  N N   . TYR A 1 75 ? 15.983 27.478 0.407   1.00 12.13 ? 75  TYR A N   1 
ATOM   619  C CA  . TYR A 1 75 ? 17.243 27.577 1.072   1.00 11.50 ? 75  TYR A CA  1 
ATOM   620  C C   . TYR A 1 75 ? 17.861 28.962 0.840   1.00 11.78 ? 75  TYR A C   1 
ATOM   621  O O   . TYR A 1 75 ? 18.353 29.588 1.774   1.00 11.57 ? 75  TYR A O   1 
ATOM   622  C CB  . TYR A 1 75 ? 18.143 26.425 0.564   1.00 11.90 ? 75  TYR A CB  1 
ATOM   623  C CG  . TYR A 1 75 ? 19.649 26.718 0.564   1.00 11.10 ? 75  TYR A CG  1 
ATOM   624  C CD1 . TYR A 1 75 ? 20.399 26.709 1.759   1.00 10.68 ? 75  TYR A CD1 1 
ATOM   625  C CD2 . TYR A 1 75 ? 20.320 26.961 -0.658  1.00 12.23 ? 75  TYR A CD2 1 
ATOM   626  C CE1 . TYR A 1 75 ? 21.784 26.950 1.724   1.00 11.41 ? 75  TYR A CE1 1 
ATOM   627  C CE2 . TYR A 1 75 ? 21.707 27.186 -0.715  1.00 12.04 ? 75  TYR A CE2 1 
ATOM   628  C CZ  . TYR A 1 75 ? 22.415 27.179 0.481   1.00 10.63 ? 75  TYR A CZ  1 
ATOM   629  O OH  . TYR A 1 75 ? 23.767 27.316 0.424   1.00 10.85 ? 75  TYR A OH  1 
ATOM   630  N N   . VAL A 1 76 ? 17.798 29.462 -0.405  1.00 12.20 ? 76  VAL A N   1 
ATOM   631  C CA  . VAL A 1 76 ? 18.436 30.737 -0.652  1.00 13.02 ? 76  VAL A CA  1 
ATOM   632  C C   . VAL A 1 76 ? 17.639 31.832 0.019   1.00 12.80 ? 76  VAL A C   1 
ATOM   633  O O   . VAL A 1 76 ? 18.235 32.792 0.529   1.00 13.98 ? 76  VAL A O   1 
ATOM   634  C CB  . VAL A 1 76 ? 18.636 30.973 -2.188  1.00 12.76 ? 76  VAL A CB  1 
ATOM   635  C CG1 . VAL A 1 76 ? 19.245 32.319 -2.435  1.00 18.23 ? 76  VAL A CG1 1 
ATOM   636  C CG2 . VAL A 1 76 ? 19.570 29.880 -2.795  1.00 13.48 ? 76  VAL A CG2 1 
ATOM   637  N N   . ARG A 1 77 ? 16.311 31.672 0.075   1.00 13.86 ? 77  ARG A N   1 
ATOM   638  C CA  A ARG A 1 77 ? 15.498 32.666 0.792   0.50 13.52 ? 77  ARG A CA  1 
ATOM   639  C CA  B ARG A 1 77 ? 15.501 32.656 0.797   0.50 13.48 ? 77  ARG A CA  1 
ATOM   640  C C   . ARG A 1 77 ? 15.893 32.705 2.261   1.00 14.80 ? 77  ARG A C   1 
ATOM   641  O O   . ARG A 1 77 ? 15.939 33.774 2.882   1.00 14.68 ? 77  ARG A O   1 
ATOM   642  C CB  A ARG A 1 77 ? 14.022 32.321 0.665   0.50 15.37 ? 77  ARG A CB  1 
ATOM   643  C CB  B ARG A 1 77 ? 14.046 32.268 0.717   0.50 15.26 ? 77  ARG A CB  1 
ATOM   644  C CG  A ARG A 1 77 ? 13.076 33.371 1.347   0.50 17.42 ? 77  ARG A CG  1 
ATOM   645  C CG  B ARG A 1 77 ? 13.164 33.280 1.471   0.50 16.99 ? 77  ARG A CG  1 
ATOM   646  C CD  A ARG A 1 77 ? 11.589 33.062 0.942   0.50 20.88 ? 77  ARG A CD  1 
ATOM   647  C CD  B ARG A 1 77 ? 11.685 32.916 1.251   0.50 21.09 ? 77  ARG A CD  1 
ATOM   648  N NE  A ARG A 1 77 ? 10.585 33.643 1.827   0.50 26.33 ? 77  ARG A NE  1 
ATOM   649  N NE  B ARG A 1 77 ? 11.233 31.918 2.201   0.50 25.52 ? 77  ARG A NE  1 
ATOM   650  C CZ  A ARG A 1 77 ? 10.019 34.836 1.674   0.50 28.82 ? 77  ARG A CZ  1 
ATOM   651  C CZ  B ARG A 1 77 ? 10.809 32.221 3.425   0.50 28.26 ? 77  ARG A CZ  1 
ATOM   652  N NH1 A ARG A 1 77 ? 10.363 35.640 0.668   0.50 24.89 ? 77  ARG A NH1 1 
ATOM   653  N NH1 B ARG A 1 77 ? 10.850 33.482 3.838   0.50 27.96 ? 77  ARG A NH1 1 
ATOM   654  N NH2 A ARG A 1 77 ? 9.096  35.243 2.547   0.50 31.51 ? 77  ARG A NH2 1 
ATOM   655  N NH2 B ARG A 1 77 ? 10.386 31.279 4.244   0.50 28.23 ? 77  ARG A NH2 1 
ATOM   656  N N   . SER A 1 78 ? 16.199 31.553 2.859   1.00 13.53 ? 78  SER A N   1 
ATOM   657  C CA  A SER A 1 78 ? 16.625 31.571 4.244   0.50 14.17 ? 78  SER A CA  1 
ATOM   658  C CA  B SER A 1 78 ? 16.654 31.556 4.260   0.50 13.39 ? 78  SER A CA  1 
ATOM   659  C C   . SER A 1 78 ? 17.938 32.349 4.433   1.00 13.49 ? 78  SER A C   1 
ATOM   660  O O   . SER A 1 78 ? 18.101 33.073 5.427   1.00 14.25 ? 78  SER A O   1 
ATOM   661  C CB  A SER A 1 78 ? 16.738 30.142 4.786   0.50 14.86 ? 78  SER A CB  1 
ATOM   662  C CB  B SER A 1 78 ? 16.853 30.140 4.863   0.50 13.57 ? 78  SER A CB  1 
ATOM   663  O OG  A SER A 1 78 ? 15.491 29.472 4.612   0.50 17.48 ? 78  SER A OG  1 
ATOM   664  O OG  B SER A 1 78 ? 18.078 29.528 4.484   0.50 11.15 ? 78  SER A OG  1 
ATOM   665  N N   . LEU A 1 79 ? 18.897 32.213 3.487   1.00 12.83 ? 79  LEU A N   1 
ATOM   666  C CA  . LEU A 1 79 ? 20.121 33.051 3.541   1.00 13.22 ? 79  LEU A CA  1 
ATOM   667  C C   . LEU A 1 79 ? 19.797 34.539 3.475   1.00 12.84 ? 79  LEU A C   1 
ATOM   668  O O   . LEU A 1 79 ? 20.397 35.341 4.212   1.00 13.88 ? 79  LEU A O   1 
ATOM   669  C CB  . LEU A 1 79 ? 21.059 32.689 2.368   1.00 13.21 ? 79  LEU A CB  1 
ATOM   670  C CG  . LEU A 1 79 ? 21.485 31.190 2.348   1.00 13.46 ? 79  LEU A CG  1 
ATOM   671  C CD1 . LEU A 1 79 ? 22.372 30.994 1.104   1.00 14.00 ? 79  LEU A CD1 1 
ATOM   672  C CD2 . LEU A 1 79 ? 22.228 30.811 3.613   1.00 14.77 ? 79  LEU A CD2 1 
ATOM   673  N N   . ALA A 1 80 ? 18.862 34.882 2.569   1.00 11.97 ? 80  ALA A N   1 
ATOM   674  C CA  . ALA A 1 80 ? 18.464 36.297 2.422   1.00 13.56 ? 80  ALA A CA  1 
ATOM   675  C C   . ALA A 1 80 ? 17.892 36.788 3.744   1.00 12.93 ? 80  ALA A C   1 
ATOM   676  O O   . ALA A 1 80 ? 18.225 37.890 4.203   1.00 13.53 ? 80  ALA A O   1 
ATOM   677  C CB  . ALA A 1 80 ? 17.451 36.500 1.296   1.00 14.42 ? 80  ALA A CB  1 
ATOM   678  N N   . CYS A 1 81 ? 17.010 35.994 4.379   1.00 12.54 ? 81  CYS A N   1 
ATOM   679  C CA  . CYS A 1 81 ? 16.485 36.383 5.673   1.00 13.07 ? 81  CYS A CA  1 
ATOM   680  C C   . CYS A 1 81 ? 17.528 36.551 6.763   1.00 13.60 ? 81  CYS A C   1 
ATOM   681  O O   . CYS A 1 81 ? 17.502 37.512 7.511   1.00 14.11 ? 81  CYS A O   1 
ATOM   682  C CB  . CYS A 1 81 ? 15.456 35.342 6.133   1.00 14.55 ? 81  CYS A CB  1 
ATOM   683  S SG  . CYS A 1 81 ? 13.946 35.414 5.067   1.00 18.56 ? 81  CYS A SG  1 
ATOM   684  N N   . LEU A 1 82 ? 18.513 35.652 6.798   1.00 15.35 ? 82  LEU A N   1 
ATOM   685  C CA  . LEU A 1 82 ? 19.604 35.809 7.736   1.00 15.23 ? 82  LEU A CA  1 
ATOM   686  C C   . LEU A 1 82 ? 20.383 37.113 7.479   1.00 15.65 ? 82  LEU A C   1 
ATOM   687  O O   . LEU A 1 82 ? 20.859 37.733 8.432   1.00 15.48 ? 82  LEU A O   1 
ATOM   688  C CB  . LEU A 1 82 ? 20.520 34.593 7.617   1.00 17.00 ? 82  LEU A CB  1 
ATOM   689  C CG  . LEU A 1 82 ? 20.059 33.472 8.524   1.00 22.03 ? 82  LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 82 ? 20.715 33.661 9.838   1.00 25.12 ? 82  LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 82 ? 18.613 33.231 8.656   1.00 27.23 ? 82  LEU A CD2 1 
ATOM   692  N N   . CYS A 1 83 ? 20.518 37.571 6.227   1.00 13.59 ? 83  CYS A N   1 
ATOM   693  C CA  . CYS A 1 83 ? 21.122 38.892 5.933   1.00 15.04 ? 83  CYS A CA  1 
ATOM   694  C C   . CYS A 1 83 ? 20.310 39.962 6.572   1.00 15.78 ? 83  CYS A C   1 
ATOM   695  O O   . CYS A 1 83 ? 20.833 40.891 7.208   1.00 15.80 ? 83  CYS A O   1 
ATOM   696  C CB  . CYS A 1 83 ? 21.183 39.203 4.449   1.00 14.85 ? 83  CYS A CB  1 
ATOM   697  S SG  . CYS A 1 83 ? 22.458 38.147 3.657   1.00 16.77 ? 83  CYS A SG  1 
ATOM   698  N N   . LEU A 1 84 ? 19.001 39.972 6.301   1.00 14.28 ? 84  LEU A N   1 
ATOM   699  C CA  . LEU A 1 84 ? 18.176 41.013 6.871   1.00 15.15 ? 84  LEU A CA  1 
ATOM   700  C C   . LEU A 1 84 ? 18.283 41.055 8.358   1.00 16.71 ? 84  LEU A C   1 
ATOM   701  O O   . LEU A 1 84 ? 18.199 42.101 9.011   1.00 18.16 ? 84  LEU A O   1 
ATOM   702  C CB  . LEU A 1 84 ? 16.689 40.844 6.545   1.00 17.32 ? 84  LEU A CB  1 
ATOM   703  C CG  . LEU A 1 84 ? 16.399 40.902 5.092   1.00 17.72 ? 84  LEU A CG  1 
ATOM   704  C CD1 . LEU A 1 84 ? 14.893 40.768 4.896   1.00 18.04 ? 84  LEU A CD1 1 
ATOM   705  C CD2 . LEU A 1 84 ? 16.882 42.239 4.547   1.00 17.72 ? 84  LEU A CD2 1 
ATOM   706  N N   . TYR A 1 85 ? 18.399 39.880 8.967   1.00 14.44 ? 85  TYR A N   1 
ATOM   707  C CA  . TYR A 1 85 ? 18.516 39.865 10.400  1.00 16.72 ? 85  TYR A CA  1 
ATOM   708  C C   . TYR A 1 85 ? 19.864 40.201 10.966  1.00 15.55 ? 85  TYR A C   1 
ATOM   709  O O   . TYR A 1 85 ? 19.915 40.726 12.062  1.00 18.18 ? 85  TYR A O   1 
ATOM   710  C CB  . TYR A 1 85 ? 18.206 38.482 10.968  1.00 17.81 ? 85  TYR A CB  1 
ATOM   711  C CG  . TYR A 1 85 ? 16.860 37.943 10.608  1.00 22.20 ? 85  TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 85 ? 15.757 38.759 10.429  1.00 22.96 ? 85  TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 85 ? 16.722 36.578 10.375  1.00 20.90 ? 85  TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 85 ? 14.468 38.159 10.103  1.00 29.64 ? 85  TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 85 ? 15.504 36.006 10.044  1.00 25.90 ? 85  TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 85 ? 14.404 36.810 9.891   1.00 25.60 ? 85  TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 85 ? 13.247 36.115 9.528   1.00 29.72 ? 85  TYR A OH  1 
ATOM   718  N N   . CYS A 1 86 ? 20.938 39.819 10.261  1.00 14.45 ? 86  CYS A N   1 
ATOM   719  C CA  . CYS A 1 86 ? 22.261 39.790 10.888  1.00 13.98 ? 86  CYS A CA  1 
ATOM   720  C C   . CYS A 1 86 ? 23.306 40.694 10.255  1.00 14.27 ? 86  CYS A C   1 
ATOM   721  O O   . CYS A 1 86 ? 24.405 40.856 10.806  1.00 16.22 ? 86  CYS A O   1 
ATOM   722  C CB  . CYS A 1 86 ? 22.799 38.372 10.835  1.00 13.15 ? 86  CYS A CB  1 
ATOM   723  S SG  . CYS A 1 86 ? 21.909 37.142 11.752  1.00 16.51 ? 86  CYS A SG  1 
ATOM   724  N N   . HIS A 1 87 ? 23.007 41.284 9.101   1.00 12.54 ? 87  HIS A N   1 
ATOM   725  C CA  . HIS A 1 87 ? 23.999 42.112 8.429   1.00 12.65 ? 87  HIS A CA  1 
ATOM   726  C C   . HIS A 1 87 ? 23.648 43.570 8.714   1.00 12.91 ? 87  HIS A C   1 
ATOM   727  O O   . HIS A 1 87 ? 22.501 44.022 8.516   1.00 13.90 ? 87  HIS A O   1 
ATOM   728  C CB  . HIS A 1 87 ? 24.004 41.793 6.930   1.00 10.55 ? 87  HIS A CB  1 
ATOM   729  C CG  . HIS A 1 87 ? 25.093 42.460 6.186   1.00 12.79 ? 87  HIS A CG  1 
ATOM   730  N ND1 . HIS A 1 87 ? 26.122 41.795 5.558   1.00 13.99 ? 87  HIS A ND1 1 
ATOM   731  C CD2 . HIS A 1 87 ? 25.376 43.777 6.108   1.00 10.17 ? 87  HIS A CD2 1 
ATOM   732  C CE1 . HIS A 1 87 ? 26.967 42.707 5.055   1.00 9.82  ? 87  HIS A CE1 1 
ATOM   733  N NE2 . HIS A 1 87 ? 26.516 43.904 5.363   1.00 15.32 ? 87  HIS A NE2 1 
ATOM   734  N N   . GLU A 1 88 ? 24.671 44.316 9.132   1.00 13.08 ? 88  GLU A N   1 
ATOM   735  C CA  . GLU A 1 88 ? 24.465 45.744 9.518   1.00 13.31 ? 88  GLU A CA  1 
ATOM   736  C C   . GLU A 1 88 ? 23.900 46.589 8.399   1.00 13.96 ? 88  GLU A C   1 
ATOM   737  O O   . GLU A 1 88 ? 23.248 47.606 8.679   1.00 15.44 ? 88  GLU A O   1 
ATOM   738  C CB  . GLU A 1 88 ? 25.766 46.338 10.040  1.00 14.22 ? 88  GLU A CB  1 
ATOM   739  C CG  . GLU A 1 88 ? 25.530 47.596 10.944  1.00 20.98 ? 88  GLU A CG  1 
ATOM   740  C CD  . GLU A 1 88 ? 24.737 47.268 12.231  1.00 28.16 ? 88  GLU A CD  1 
ATOM   741  O OE1 . GLU A 1 88 ? 24.725 46.122 12.711  1.00 32.72 ? 88  GLU A OE1 1 
ATOM   742  O OE2 . GLU A 1 88 ? 24.143 48.228 12.785  1.00 41.09 ? 88  GLU A OE2 1 
ATOM   743  N N   . TYR A 1 89 ? 24.116 46.227 7.148   1.00 12.83 ? 89  TYR A N   1 
ATOM   744  C CA  . TYR A 1 89 ? 23.571 47.058 6.070   1.00 14.23 ? 89  TYR A CA  1 
ATOM   745  C C   . TYR A 1 89 ? 22.067 47.228 6.210   1.00 14.53 ? 89  TYR A C   1 
ATOM   746  O O   . TYR A 1 89 ? 21.491 48.293 5.875   1.00 15.46 ? 89  TYR A O   1 
ATOM   747  C CB  . TYR A 1 89 ? 23.921 46.489 4.705   1.00 13.92 ? 89  TYR A CB  1 
ATOM   748  C CG  . TYR A 1 89 ? 23.474 47.410 3.584   1.00 14.18 ? 89  TYR A CG  1 
ATOM   749  C CD1 . TYR A 1 89 ? 22.330 47.144 2.861   1.00 15.85 ? 89  TYR A CD1 1 
ATOM   750  C CD2 . TYR A 1 89 ? 24.244 48.514 3.229   1.00 17.47 ? 89  TYR A CD2 1 
ATOM   751  C CE1 . TYR A 1 89 ? 21.897 47.956 1.830   1.00 16.95 ? 89  TYR A CE1 1 
ATOM   752  C CE2 . TYR A 1 89 ? 23.829 49.296 2.188   1.00 18.61 ? 89  TYR A CE2 1 
ATOM   753  C CZ  . TYR A 1 89 ? 22.693 49.020 1.512   1.00 17.30 ? 89  TYR A CZ  1 
ATOM   754  O OH  . TYR A 1 89 ? 22.345 49.834 0.443   1.00 18.88 ? 89  TYR A OH  1 
ATOM   755  N N   . PHE A 1 90 ? 21.370 46.204 6.727   1.00 13.54 ? 90  PHE A N   1 
ATOM   756  C CA  . PHE A 1 90 ? 19.913 46.205 6.822   1.00 14.60 ? 90  PHE A CA  1 
ATOM   757  C C   . PHE A 1 90 ? 19.394 46.584 8.188   1.00 16.94 ? 90  PHE A C   1 
ATOM   758  O O   . PHE A 1 90 ? 18.206 46.443 8.446   1.00 18.49 ? 90  PHE A O   1 
ATOM   759  C CB  . PHE A 1 90 ? 19.407 44.832 6.406   1.00 15.05 ? 90  PHE A CB  1 
ATOM   760  C CG  . PHE A 1 90 ? 19.731 44.517 4.987   1.00 13.98 ? 90  PHE A CG  1 
ATOM   761  C CD1 . PHE A 1 90 ? 19.011 45.124 3.959   1.00 15.63 ? 90  PHE A CD1 1 
ATOM   762  C CD2 . PHE A 1 90 ? 20.781 43.640 4.666   1.00 15.17 ? 90  PHE A CD2 1 
ATOM   763  C CE1 . PHE A 1 90 ? 19.301 44.886 2.637   1.00 17.95 ? 90  PHE A CE1 1 
ATOM   764  C CE2 . PHE A 1 90 ? 21.062 43.413 3.283   1.00 15.68 ? 90  PHE A CE2 1 
ATOM   765  C CZ  . PHE A 1 90 ? 20.314 44.037 2.304   1.00 15.96 ? 90  PHE A CZ  1 
ATOM   766  N N   . LYS A 1 91 ? 20.260 47.096 9.066   1.00 18.88 ? 91  LYS A N   1 
ATOM   767  C CA  . LYS A 1 91 ? 19.847 47.411 10.464  1.00 22.79 ? 91  LYS A CA  1 
ATOM   768  C C   . LYS A 1 91 ? 18.515 48.185 10.484  1.00 22.70 ? 91  LYS A C   1 
ATOM   769  O O   . LYS A 1 91 ? 17.623 47.803 11.243  1.00 23.48 ? 91  LYS A O   1 
ATOM   770  C CB  . LYS A 1 91 ? 20.978 48.196 11.190  1.00 24.52 ? 91  LYS A CB  1 
ATOM   771  C CG  . LYS A 1 91 ? 20.551 48.860 12.535  1.00 29.51 ? 91  LYS A CG  1 
ATOM   772  C CD  . LYS A 1 91 ? 21.532 49.969 12.912  1.00 34.26 ? 91  LYS A CD  1 
ATOM   773  C CE  . LYS A 1 91 ? 21.226 50.537 14.302  1.00 40.42 ? 91  LYS A CE  1 
ATOM   774  N NZ  . LYS A 1 91 ? 21.700 49.591 15.347  1.00 40.49 ? 91  LYS A NZ  1 
ATOM   775  N N   . ASP A 1 92 ? 18.397 49.185 9.592   1.00 22.44 ? 92  ASP A N   1 
ATOM   776  C CA  . ASP A 1 92 ? 17.231 50.102 9.493   1.00 24.88 ? 92  ASP A CA  1 
ATOM   777  C C   . ASP A 1 92 ? 16.249 49.821 8.340   1.00 25.80 ? 92  ASP A C   1 
ATOM   778  O O   . ASP A 1 92 ? 15.307 50.611 8.059   1.00 26.25 ? 92  ASP A O   1 
ATOM   779  C CB  . ASP A 1 92 ? 17.777 51.518 9.398   1.00 26.83 ? 92  ASP A CB  1 
ATOM   780  C CG  . ASP A 1 92 ? 18.535 51.915 10.645  1.00 28.38 ? 92  ASP A CG  1 
ATOM   781  O OD1 . ASP A 1 92 ? 18.070 51.568 11.754  1.00 33.91 ? 92  ASP A OD1 1 
ATOM   782  O OD2 . ASP A 1 92 ? 19.617 52.508 10.499  1.00 31.58 ? 92  ASP A OD2 1 
ATOM   783  N N   . CYS A 1 93 ? 16.385 48.682 7.708   1.00 23.79 ? 93  CYS A N   1 
ATOM   784  C CA  . CYS A 1 93 ? 15.506 48.370 6.621   1.00 24.84 ? 93  CYS A CA  1 
ATOM   785  C C   . CYS A 1 93 ? 14.059 48.043 7.056   1.00 27.42 ? 93  CYS A C   1 
ATOM   786  O O   . CYS A 1 93 ? 13.857 47.254 7.997   1.00 29.77 ? 93  CYS A O   1 
ATOM   787  C CB  . CYS A 1 93 ? 16.103 47.190 5.850   1.00 21.10 ? 93  CYS A CB  1 
ATOM   788  S SG  . CYS A 1 93 ? 14.996 46.644 4.434   1.00 25.79 ? 93  CYS A SG  1 
ATOM   789  N N   . PRO A 1 94 ? 13.048 48.580 6.328   1.00 29.34 ? 94  PRO A N   1 
ATOM   790  C CA  . PRO A 1 94 ? 11.677 48.207 6.739   1.00 31.92 ? 94  PRO A CA  1 
ATOM   791  C C   . PRO A 1 94 ? 11.172 47.022 5.933   1.00 33.46 ? 94  PRO A C   1 
ATOM   792  O O   . PRO A 1 94 ? 10.009 46.665 6.089   1.00 37.50 ? 94  PRO A O   1 
ATOM   793  C CB  . PRO A 1 94 ? 10.864 49.471 6.461   1.00 34.07 ? 94  PRO A CB  1 
ATOM   794  C CG  . PRO A 1 94 ? 11.595 50.184 5.411   1.00 30.69 ? 94  PRO A CG  1 
ATOM   795  C CD  . PRO A 1 94 ? 13.065 49.806 5.503   1.00 29.88 ? 94  PRO A CD  1 
ATOM   796  S SG  . CYS A 1 99 ? 13.160 37.240 5.358   1.00 40.15 ? 99  CYS A SG  1 
ATOM   797  N N   . ARG B 1 3  ? 34.871 30.811 6.408   1.00 27.17 ? 3   ARG B N   1 
ATOM   798  C CA  . ARG B 1 3  ? 33.879 29.781 5.936   1.00 25.78 ? 3   ARG B CA  1 
ATOM   799  C C   . ARG B 1 3  ? 33.336 30.220 4.595   1.00 22.53 ? 3   ARG B C   1 
ATOM   800  O O   . ARG B 1 3  ? 32.916 31.365 4.441   1.00 20.24 ? 3   ARG B O   1 
ATOM   801  C CB  . ARG B 1 3  ? 32.708 29.604 6.890   1.00 26.27 ? 3   ARG B CB  1 
ATOM   802  C CG  . ARG B 1 3  ? 33.019 29.042 8.212   1.00 28.75 ? 3   ARG B CG  1 
ATOM   803  C CD  . ARG B 1 3  ? 31.845 29.197 9.165   1.00 30.62 ? 3   ARG B CD  1 
ATOM   804  N NE  . ARG B 1 3  ? 31.918 28.169 10.184  1.00 31.52 ? 3   ARG B NE  1 
ATOM   805  C CZ  . ARG B 1 3  ? 32.551 28.302 11.350  1.00 34.82 ? 3   ARG B CZ  1 
ATOM   806  N NH1 . ARG B 1 3  ? 33.123 29.460 11.671  1.00 32.96 ? 3   ARG B NH1 1 
ATOM   807  N NH2 . ARG B 1 3  ? 32.578 27.286 12.201  1.00 34.30 ? 3   ARG B NH2 1 
ATOM   808  N N   . PRO B 1 4  ? 33.271 29.301 3.647   1.00 20.42 ? 4   PRO B N   1 
ATOM   809  C CA  . PRO B 1 4  ? 32.998 29.681 2.286   1.00 20.50 ? 4   PRO B CA  1 
ATOM   810  C C   . PRO B 1 4  ? 31.594 30.293 2.186   1.00 17.18 ? 4   PRO B C   1 
ATOM   811  O O   . PRO B 1 4  ? 31.400 31.260 1.406   1.00 18.27 ? 4   PRO B O   1 
ATOM   812  C CB  . PRO B 1 4  ? 33.147 28.375 1.499   1.00 21.37 ? 4   PRO B CB  1 
ATOM   813  C CG  . PRO B 1 4  ? 33.478 27.307 2.497   1.00 25.76 ? 4   PRO B CG  1 
ATOM   814  C CD  . PRO B 1 4  ? 33.844 27.933 3.760   1.00 21.42 ? 4   PRO B CD  1 
ATOM   815  N N   . LEU B 1 5  ? 30.603 29.759 2.920   1.00 15.74 ? 5   LEU B N   1 
ATOM   816  C CA  . LEU B 1 5  ? 29.268 30.300 2.832   1.00 13.78 ? 5   LEU B CA  1 
ATOM   817  C C   . LEU B 1 5  ? 29.211 31.730 3.402   1.00 13.89 ? 5   LEU B C   1 
ATOM   818  O O   . LEU B 1 5  ? 28.494 32.558 2.842   1.00 13.63 ? 5   LEU B O   1 
ATOM   819  C CB  . LEU B 1 5  ? 28.211 29.331 3.451   1.00 14.34 ? 5   LEU B CB  1 
ATOM   820  C CG  . LEU B 1 5  ? 26.797 29.777 3.103   1.00 15.53 ? 5   LEU B CG  1 
ATOM   821  C CD1 . LEU B 1 5  ? 26.522 29.676 1.589   1.00 18.32 ? 5   LEU B CD1 1 
ATOM   822  C CD2 . LEU B 1 5  ? 25.767 28.966 3.933   1.00 16.65 ? 5   LEU B CD2 1 
ATOM   823  N N   . GLU B 1 6  ? 29.915 31.991 4.504   1.00 14.19 ? 6   GLU B N   1 
ATOM   824  C CA  . GLU B 1 6  ? 29.924 33.320 5.101   1.00 13.99 ? 6   GLU B CA  1 
ATOM   825  C C   . GLU B 1 6  ? 30.478 34.312 4.112   1.00 14.97 ? 6   GLU B C   1 
ATOM   826  O O   . GLU B 1 6  ? 29.891 35.405 3.939   1.00 14.47 ? 6   GLU B O   1 
ATOM   827  C CB  . GLU B 1 6  ? 30.742 33.373 6.378   1.00 16.53 ? 6   GLU B CB  1 
ATOM   828  C CG  . GLU B 1 6  ? 30.038 32.612 7.495   1.00 19.26 ? 6   GLU B CG  1 
ATOM   829  C CD  . GLU B 1 6  ? 30.754 32.747 8.812   1.00 26.77 ? 6   GLU B CD  1 
ATOM   830  O OE1 . GLU B 1 6  ? 31.941 33.164 8.831   1.00 31.03 ? 6   GLU B OE1 1 
ATOM   831  O OE2 . GLU B 1 6  ? 30.156 32.383 9.841   1.00 25.06 ? 6   GLU B OE2 1 
ATOM   832  N N   . GLN B 1 7  ? 31.587 33.973 3.438   1.00 14.96 ? 7   GLN B N   1 
ATOM   833  C CA  . GLN B 1 7  ? 32.176 34.903 2.480   1.00 16.32 ? 7   GLN B CA  1 
ATOM   834  C C   . GLN B 1 7  ? 31.236 35.114 1.310   1.00 13.91 ? 7   GLN B C   1 
ATOM   835  O O   . GLN B 1 7  ? 31.088 36.226 0.817   1.00 13.70 ? 7   GLN B O   1 
ATOM   836  C CB  . GLN B 1 7  ? 33.477 34.277 1.942   1.00 17.68 ? 7   GLN B CB  1 
ATOM   837  C CG  . GLN B 1 7  ? 34.487 34.055 3.019   1.00 24.58 ? 7   GLN B CG  1 
ATOM   838  C CD  . GLN B 1 7  ? 35.709 33.476 2.508   1.00 29.38 ? 7   GLN B CD  1 
ATOM   839  O OE1 . GLN B 1 7  ? 36.451 34.136 1.744   1.00 37.90 ? 7   GLN B OE1 1 
ATOM   840  N NE2 . GLN B 1 7  ? 36.021 32.262 2.973   1.00 35.29 ? 7   GLN B NE2 1 
ATOM   841  N N   . ALA B 1 8  ? 30.567 34.061 0.880   1.00 13.33 ? 8   ALA B N   1 
ATOM   842  C CA  . ALA B 1 8  ? 29.642 34.165 -0.234  1.00 12.29 ? 8   ALA B CA  1 
ATOM   843  C C   . ALA B 1 8  ? 28.453 35.075 0.099   1.00 13.10 ? 8   ALA B C   1 
ATOM   844  O O   . ALA B 1 8  ? 28.059 35.922 -0.722  1.00 12.42 ? 8   ALA B O   1 
ATOM   845  C CB  . ALA B 1 8  ? 29.126 32.745 -0.675  1.00 13.52 ? 8   ALA B CB  1 
ATOM   846  N N   . VAL B 1 9  ? 27.839 34.834 1.269   1.00 12.23 ? 9   VAL B N   1 
ATOM   847  C CA  . VAL B 1 9  ? 26.665 35.668 1.597   1.00 11.85 ? 9   VAL B CA  1 
ATOM   848  C C   . VAL B 1 9  ? 27.081 37.123 1.813   1.00 11.88 ? 9   VAL B C   1 
ATOM   849  O O   . VAL B 1 9  ? 26.390 38.034 1.373   1.00 12.42 ? 9   VAL B O   1 
ATOM   850  C CB  . VAL B 1 9  ? 25.866 35.052 2.757   1.00 12.74 ? 9   VAL B CB  1 
ATOM   851  C CG1 . VAL B 1 9  ? 24.663 35.846 3.071   1.00 15.12 ? 9   VAL B CG1 1 
ATOM   852  C CG2 . VAL B 1 9  ? 25.424 33.600 2.397   1.00 14.15 ? 9   VAL B CG2 1 
ATOM   853  N N   . ALA B 1 10 ? 28.240 37.390 2.438   1.00 12.41 ? 10  ALA B N   1 
ATOM   854  C CA  . ALA B 1 10 ? 28.670 38.769 2.532   1.00 12.22 ? 10  ALA B CA  1 
ATOM   855  C C   . ALA B 1 10 ? 28.909 39.367 1.152   1.00 12.02 ? 10  ALA B C   1 
ATOM   856  O O   . ALA B 1 10 ? 28.560 40.550 0.952   1.00 12.15 ? 10  ALA B O   1 
ATOM   857  C CB  . ALA B 1 10 ? 30.023 38.787 3.323   1.00 15.41 ? 10  ALA B CB  1 
ATOM   858  N N   . ALA B 1 11 ? 29.398 38.591 0.174   1.00 11.58 ? 11  ALA B N   1 
ATOM   859  C CA  . ALA B 1 11 ? 29.582 39.116 -1.185  1.00 12.36 ? 11  ALA B CA  1 
ATOM   860  C C   . ALA B 1 11 ? 28.260 39.428 -1.836  1.00 11.88 ? 11  ALA B C   1 
ATOM   861  O O   . ALA B 1 11 ? 28.142 40.437 -2.573  1.00 12.61 ? 11  ALA B O   1 
ATOM   862  C CB  . ALA B 1 11 ? 30.394 38.169 -2.046  1.00 13.90 ? 11  ALA B CB  1 
ATOM   863  N N   . ILE B 1 12 ? 27.228 38.627 -1.579  1.00 11.23 ? 12  ILE B N   1 
ATOM   864  C CA  A ILE B 1 12 ? 25.948 38.965 -2.240  0.50 12.03 ? 12  ILE B CA  1 
ATOM   865  C CA  B ILE B 1 12 ? 25.915 38.888 -2.169  0.50 11.32 ? 12  ILE B CA  1 
ATOM   866  C C   . ILE B 1 12 ? 25.387 40.274 -1.685  1.00 11.96 ? 12  ILE B C   1 
ATOM   867  O O   . ILE B 1 12 ? 24.782 41.038 -2.440  1.00 11.18 ? 12  ILE B O   1 
ATOM   868  C CB  A ILE B 1 12 ? 24.909 37.829 -2.265  0.50 12.35 ? 12  ILE B CB  1 
ATOM   869  C CB  B ILE B 1 12 ? 25.034 37.698 -1.810  0.50 11.35 ? 12  ILE B CB  1 
ATOM   870  C CG1 A ILE B 1 12 ? 24.319 37.527 -0.886  0.50 15.61 ? 12  ILE B CG1 1 
ATOM   871  C CG1 B ILE B 1 12 ? 25.429 36.511 -2.704  0.50 11.88 ? 12  ILE B CG1 1 
ATOM   872  C CG2 A ILE B 1 12 ? 25.525 36.597 -2.885  0.50 13.54 ? 12  ILE B CG2 1 
ATOM   873  C CG2 B ILE B 1 12 ? 23.568 38.029 -1.916  0.50 10.77 ? 12  ILE B CG2 1 
ATOM   874  C CD1 A ILE B 1 12 ? 23.132 36.533 -0.916  0.50 15.19 ? 12  ILE B CD1 1 
ATOM   875  C CD1 B ILE B 1 12 ? 24.876 35.123 -2.326  0.50 14.19 ? 12  ILE B CD1 1 
ATOM   876  N N   . VAL B 1 13 ? 25.619 40.567 -0.386  1.00 11.56 ? 13  VAL B N   1 
ATOM   877  C CA  . VAL B 1 13 ? 25.168 41.831 0.162   1.00 12.02 ? 13  VAL B CA  1 
ATOM   878  C C   . VAL B 1 13 ? 26.045 42.958 -0.410  1.00 12.06 ? 13  VAL B C   1 
ATOM   879  O O   . VAL B 1 13 ? 25.500 44.015 -0.762  1.00 12.70 ? 13  VAL B O   1 
ATOM   880  C CB  . VAL B 1 13 ? 25.272 41.840 1.684   1.00 11.32 ? 13  VAL B CB  1 
ATOM   881  C CG1 . VAL B 1 13 ? 24.965 43.219 2.253   1.00 12.42 ? 13  VAL B CG1 1 
ATOM   882  C CG2 . VAL B 1 13 ? 24.362 40.806 2.237   1.00 12.07 ? 13  VAL B CG2 1 
ATOM   883  N N   . CYS B 1 14 ? 27.357 42.740 -0.559  1.00 11.94 ? 14  CYS B N   1 
ATOM   884  C CA  A CYS B 1 14 ? 28.208 43.782 -1.122  0.50 12.66 ? 14  CYS B CA  1 
ATOM   885  C CA  B CYS B 1 14 ? 28.240 43.753 -1.173  0.50 13.89 ? 14  CYS B CA  1 
ATOM   886  C C   . CYS B 1 14 ? 27.734 44.195 -2.532  1.00 13.33 ? 14  CYS B C   1 
ATOM   887  O O   . CYS B 1 14 ? 27.651 45.397 -2.846  1.00 13.42 ? 14  CYS B O   1 
ATOM   888  C CB  A CYS B 1 14 ? 29.618 43.239 -1.106  0.50 12.61 ? 14  CYS B CB  1 
ATOM   889  C CB  B CYS B 1 14 ? 29.615 43.151 -1.356  0.50 14.69 ? 14  CYS B CB  1 
ATOM   890  S SG  A CYS B 1 14 ? 30.858 44.279 -1.799  0.50 14.83 ? 14  CYS B SG  1 
ATOM   891  S SG  B CYS B 1 14 ? 30.617 43.254 0.071   0.50 22.58 ? 14  CYS B SG  1 
ATOM   892  N N   . THR B 1 15 ? 27.390 43.209 -3.364  1.00 12.97 ? 15  THR B N   1 
ATOM   893  C CA  . THR B 1 15 ? 26.964 43.540 -4.701  1.00 14.13 ? 15  THR B CA  1 
ATOM   894  C C   . THR B 1 15 ? 25.653 44.331 -4.650  1.00 12.68 ? 15  THR B C   1 
ATOM   895  O O   . THR B 1 15 ? 25.444 45.323 -5.346  1.00 13.59 ? 15  THR B O   1 
ATOM   896  C CB  . THR B 1 15 ? 26.797 42.287 -5.535  1.00 13.86 ? 15  THR B CB  1 
ATOM   897  O OG1 . THR B 1 15 ? 28.070 41.615 -5.625  1.00 17.78 ? 15  THR B OG1 1 
ATOM   898  C CG2 . THR B 1 15 ? 26.361 42.637 -6.957  1.00 17.11 ? 15  THR B CG2 1 
ATOM   899  N N   . PHE B 1 16 ? 24.717 43.909 -3.795  1.00 11.55 ? 16  PHE B N   1 
ATOM   900  C CA  . PHE B 1 16 ? 23.471 44.661 -3.672  1.00 11.73 ? 16  PHE B CA  1 
ATOM   901  C C   . PHE B 1 16 ? 23.750 46.082 -3.272  1.00 13.19 ? 16  PHE B C   1 
ATOM   902  O O   . PHE B 1 16 ? 23.167 46.995 -3.879  1.00 12.69 ? 16  PHE B O   1 
ATOM   903  C CB  . PHE B 1 16 ? 22.539 43.949 -2.647  1.00 11.14 ? 16  PHE B CB  1 
ATOM   904  C CG  . PHE B 1 16 ? 21.206 44.593 -2.503  1.00 11.32 ? 16  PHE B CG  1 
ATOM   905  C CD1 . PHE B 1 16 ? 20.202 44.271 -3.433  1.00 9.59  ? 16  PHE B CD1 1 
ATOM   906  C CD2 . PHE B 1 16 ? 20.915 45.511 -1.454  1.00 11.87 ? 16  PHE B CD2 1 
ATOM   907  C CE1 . PHE B 1 16 ? 18.917 44.860 -3.323  1.00 11.40 ? 16  PHE B CE1 1 
ATOM   908  C CE2 . PHE B 1 16 ? 19.648 46.108 -1.382  1.00 11.80 ? 16  PHE B CE2 1 
ATOM   909  C CZ  . PHE B 1 16 ? 18.635 45.725 -2.271  1.00 12.39 ? 16  PHE B CZ  1 
ATOM   910  N N   . GLN B 1 17 ? 24.597 46.274 -2.277  1.00 13.56 ? 17  GLN B N   1 
ATOM   911  C CA  . GLN B 1 17 ? 24.924 47.651 -1.796  1.00 14.16 ? 17  GLN B CA  1 
ATOM   912  C C   . GLN B 1 17 ? 25.491 48.497 -2.936  1.00 15.15 ? 17  GLN B C   1 
ATOM   913  O O   . GLN B 1 17 ? 25.183 49.698 -3.069  1.00 15.43 ? 17  GLN B O   1 
ATOM   914  C CB  . GLN B 1 17 ? 25.945 47.498 -0.675  1.00 17.62 ? 17  GLN B CB  1 
ATOM   915  C CG  . GLN B 1 17 ? 26.590 48.799 -0.150  1.00 24.44 ? 17  GLN B CG  1 
ATOM   916  C CD  . GLN B 1 17 ? 27.506 48.487 1.054   1.00 31.49 ? 17  GLN B CD  1 
ATOM   917  O OE1 . GLN B 1 17 ? 27.943 47.344 1.229   1.00 39.53 ? 17  GLN B OE1 1 
ATOM   918  N NE2 . GLN B 1 17 ? 27.778 49.492 1.884   1.00 38.92 ? 17  GLN B NE2 1 
ATOM   919  N N   . GLU B 1 18 ? 26.338 47.892 -3.761  1.00 15.09 ? 18  GLU B N   1 
ATOM   920  C CA  . GLU B 1 18 ? 26.979 48.588 -4.910  1.00 16.19 ? 18  GLU B CA  1 
ATOM   921  C C   . GLU B 1 18 ? 25.941 49.116 -5.864  1.00 14.50 ? 18  GLU B C   1 
ATOM   922  O O   . GLU B 1 18 ? 26.058 50.279 -6.312  1.00 18.23 ? 18  GLU B O   1 
ATOM   923  C CB  . GLU B 1 18 ? 27.914 47.644 -5.673  1.00 18.56 ? 18  GLU B CB  1 
ATOM   924  C CG  . GLU B 1 18 ? 28.531 48.166 -6.974  1.00 25.63 ? 18  GLU B CG  1 
ATOM   925  C CD  . GLU B 1 18 ? 29.528 47.113 -7.527  1.00 33.08 ? 18  GLU B CD  1 
ATOM   926  O OE1 . GLU B 1 18 ? 29.543 45.946 -7.027  1.00 35.14 ? 18  GLU B OE1 1 
ATOM   927  O OE2 . GLU B 1 18 ? 30.285 47.443 -8.464  1.00 42.87 ? 18  GLU B OE2 1 
ATOM   928  N N   . TYR B 1 19 ? 24.868 48.402 -6.162  1.00 13.24 ? 19  TYR B N   1 
ATOM   929  C CA  . TYR B 1 19 ? 23.832 48.855 -7.071  1.00 13.57 ? 19  TYR B CA  1 
ATOM   930  C C   . TYR B 1 19 ? 22.773 49.679 -6.367  1.00 13.02 ? 19  TYR B C   1 
ATOM   931  O O   . TYR B 1 19 ? 22.392 50.768 -6.834  1.00 13.14 ? 19  TYR B O   1 
ATOM   932  C CB  . TYR B 1 19 ? 23.211 47.640 -7.840  1.00 14.56 ? 19  TYR B CB  1 
ATOM   933  C CG  . TYR B 1 19 ? 24.158 47.115 -8.915  1.00 14.72 ? 19  TYR B CG  1 
ATOM   934  C CD1 . TYR B 1 19 ? 25.272 46.391 -8.590  1.00 13.65 ? 19  TYR B CD1 1 
ATOM   935  C CD2 . TYR B 1 19 ? 23.926 47.422 -10.265 1.00 15.78 ? 19  TYR B CD2 1 
ATOM   936  C CE1 . TYR B 1 19 ? 26.176 45.931 -9.570  1.00 16.41 ? 19  TYR B CE1 1 
ATOM   937  C CE2 . TYR B 1 19 ? 24.806 46.935 -11.242 1.00 16.31 ? 19  TYR B CE2 1 
ATOM   938  C CZ  . TYR B 1 19 ? 25.907 46.228 -10.871 1.00 18.90 ? 19  TYR B CZ  1 
ATOM   939  O OH  . TYR B 1 19 ? 26.783 45.754 -11.823 1.00 23.54 ? 19  TYR B OH  1 
ATOM   940  N N   . ALA B 1 20 ? 22.242 49.180 -5.249  1.00 13.02 ? 20  ALA B N   1 
ATOM   941  C CA  . ALA B 1 20 ? 21.150 49.891 -4.576  1.00 11.97 ? 20  ALA B CA  1 
ATOM   942  C C   . ALA B 1 20 ? 21.644 51.169 -3.925  1.00 12.80 ? 20  ALA B C   1 
ATOM   943  O O   . ALA B 1 20 ? 20.829 52.121 -3.793  1.00 13.93 ? 20  ALA B O   1 
ATOM   944  C CB  . ALA B 1 20 ? 20.536 48.881 -3.510  1.00 13.81 ? 20  ALA B CB  1 
ATOM   945  N N   . GLY B 1 21 ? 22.941 51.301 -3.600  1.00 14.17 ? 21  GLY B N   1 
ATOM   946  C CA  . GLY B 1 21 ? 23.419 52.497 -2.994  1.00 14.78 ? 21  GLY B CA  1 
ATOM   947  C C   . GLY B 1 21 ? 23.720 53.589 -3.984  1.00 14.14 ? 21  GLY B C   1 
ATOM   948  O O   . GLY B 1 21 ? 24.156 54.693 -3.632  1.00 16.31 ? 21  GLY B O   1 
ATOM   949  N N   . ARG B 1 22 ? 23.545 53.334 -5.283  1.00 12.96 ? 22  ARG B N   1 
ATOM   950  C CA  . ARG B 1 22 ? 23.814 54.376 -6.267  1.00 13.62 ? 22  ARG B CA  1 
ATOM   951  C C   . ARG B 1 22 ? 23.032 55.626 -6.013  1.00 12.63 ? 22  ARG B C   1 
ATOM   952  O O   . ARG B 1 22 ? 23.594 56.723 -6.039  1.00 13.91 ? 22  ARG B O   1 
ATOM   953  C CB  . ARG B 1 22 ? 23.505 53.948 -7.706  1.00 13.65 ? 22  ARG B CB  1 
ATOM   954  C CG  . ARG B 1 22 ? 24.469 52.935 -8.216  1.00 15.44 ? 22  ARG B CG  1 
ATOM   955  C CD  . ARG B 1 22 ? 23.945 52.510 -9.582  1.00 18.99 ? 22  ARG B CD  1 
ATOM   956  N NE  . ARG B 1 22 ? 24.870 51.593 -10.229 1.00 17.95 ? 22  ARG B NE  1 
ATOM   957  C CZ  . ARG B 1 22 ? 24.578 50.935 -11.362 1.00 16.97 ? 22  ARG B CZ  1 
ATOM   958  N NH1 . ARG B 1 22 ? 23.429 51.085 -12.022 1.00 18.96 ? 22  ARG B NH1 1 
ATOM   959  N NH2 . ARG B 1 22 ? 25.498 50.174 -11.865 1.00 20.35 ? 22  ARG B NH2 1 
ATOM   960  N N   . CYS B 1 23 ? 21.726 55.467 -5.817  1.00 13.85 ? 23  CYS B N   1 
ATOM   961  C CA  . CYS B 1 23 ? 20.874 56.630 -5.628  1.00 14.15 ? 23  CYS B CA  1 
ATOM   962  C C   . CYS B 1 23 ? 19.571 56.206 -5.063  1.00 14.45 ? 23  CYS B C   1 
ATOM   963  O O   . CYS B 1 23 ? 19.189 55.048 -5.138  1.00 14.62 ? 23  CYS B O   1 
ATOM   964  C CB  . CYS B 1 23 ? 20.638 57.445 -6.947  1.00 14.12 ? 23  CYS B CB  1 
ATOM   965  S SG  . CYS B 1 23 ? 19.934 56.489 -8.298  1.00 16.87 ? 23  CYS B SG  1 
ATOM   966  N N   . GLY B 1 24 ? 18.842 57.163 -4.518  1.00 14.96 ? 24  GLY B N   1 
ATOM   967  C CA  . GLY B 1 24 ? 17.496 56.800 -4.013  1.00 13.65 ? 24  GLY B CA  1 
ATOM   968  C C   . GLY B 1 24 ? 17.560 55.892 -2.781  1.00 14.17 ? 24  GLY B C   1 
ATOM   969  O O   . GLY B 1 24 ? 18.469 55.971 -1.948  1.00 14.84 ? 24  GLY B O   1 
ATOM   970  N N   . ASP B 1 25 ? 16.544 55.050 -2.684  1.00 13.48 ? 25  ASP B N   1 
ATOM   971  C CA  . ASP B 1 25 ? 16.376 54.188 -1.523  1.00 14.08 ? 25  ASP B CA  1 
ATOM   972  C C   . ASP B 1 25 ? 17.450 53.085 -1.541  1.00 13.45 ? 25  ASP B C   1 
ATOM   973  O O   . ASP B 1 25 ? 17.457 52.252 -2.432  1.00 14.58 ? 25  ASP B O   1 
ATOM   974  C CB  . ASP B 1 25 ? 14.993 53.576 -1.627  1.00 14.93 ? 25  ASP B CB  1 
ATOM   975  C CG  . ASP B 1 25 ? 14.615 52.757 -0.427  1.00 17.44 ? 25  ASP B CG  1 
ATOM   976  O OD1 . ASP B 1 25 ? 15.514 52.328 0.352   1.00 15.84 ? 25  ASP B OD1 1 
ATOM   977  O OD2 . ASP B 1 25 ? 13.379 52.523 -0.258  1.00 23.13 ? 25  ASP B OD2 1 
ATOM   978  N N   . LYS B 1 26 ? 18.287 53.099 -0.519  1.00 13.46 ? 26  LYS B N   1 
ATOM   979  C CA  . LYS B 1 26 ? 19.425 52.184 -0.420  1.00 14.40 ? 26  LYS B CA  1 
ATOM   980  C C   . LYS B 1 26 ? 18.993 50.731 -0.195  1.00 13.99 ? 26  LYS B C   1 
ATOM   981  O O   . LYS B 1 26 ? 19.833 49.837 -0.246  1.00 14.68 ? 26  LYS B O   1 
ATOM   982  C CB  . LYS B 1 26 ? 20.402 52.674 0.694   1.00 18.18 ? 26  LYS B CB  1 
ATOM   983  C CG  . LYS B 1 26 ? 19.836 52.413 2.105   1.00 21.16 ? 26  LYS B CG  1 
ATOM   984  C CD  . LYS B 1 26 ? 20.508 53.110 3.273   1.00 28.23 ? 26  LYS B CD  1 
ATOM   985  C CE  . LYS B 1 26 ? 21.884 52.709 3.588   1.00 34.20 ? 26  LYS B CE  1 
ATOM   986  N NZ  . LYS B 1 26 ? 22.060 53.143 5.030   1.00 37.06 ? 26  LYS B NZ  1 
ATOM   987  N N   . TYR B 1 27 ? 17.699 50.484 0.033   1.00 14.25 ? 27  TYR B N   1 
ATOM   988  C CA  . TYR B 1 27 ? 17.204 49.103 0.240   1.00 14.95 ? 27  TYR B CA  1 
ATOM   989  C C   . TYR B 1 27 ? 16.451 48.522 -0.954  1.00 17.03 ? 27  TYR B C   1 
ATOM   990  O O   . TYR B 1 27 ? 15.953 47.361 -0.877  1.00 18.76 ? 27  TYR B O   1 
ATOM   991  C CB  . TYR B 1 27 ? 16.281 49.045 1.485   1.00 15.80 ? 27  TYR B CB  1 
ATOM   992  C CG  . TYR B 1 27 ? 16.878 49.605 2.729   1.00 17.36 ? 27  TYR B CG  1 
ATOM   993  C CD1 . TYR B 1 27 ? 17.994 49.035 3.312   1.00 17.96 ? 27  TYR B CD1 1 
ATOM   994  C CD2 . TYR B 1 27 ? 16.305 50.719 3.326   1.00 21.65 ? 27  TYR B CD2 1 
ATOM   995  C CE1 . TYR B 1 27 ? 18.535 49.605 4.512   1.00 20.59 ? 27  TYR B CE1 1 
ATOM   996  C CE2 . TYR B 1 27 ? 16.822 51.283 4.475   1.00 24.38 ? 27  TYR B CE2 1 
ATOM   997  C CZ  . TYR B 1 27 ? 17.923 50.725 5.060   1.00 23.66 ? 27  TYR B CZ  1 
ATOM   998  O OH  . TYR B 1 27 ? 18.403 51.348 6.216   1.00 26.25 ? 27  TYR B OH  1 
ATOM   999  N N   . LYS B 1 28 ? 16.410 49.253 -2.077  1.00 16.52 ? 28  LYS B N   1 
ATOM   1000 C CA  . LYS B 1 28 ? 15.649 48.835 -3.246  1.00 17.36 ? 28  LYS B CA  1 
ATOM   1001 C C   . LYS B 1 28 ? 16.437 49.014 -4.521  1.00 17.28 ? 28  LYS B C   1 
ATOM   1002 O O   . LYS B 1 28 ? 17.336 49.849 -4.591  1.00 17.56 ? 28  LYS B O   1 
ATOM   1003 C CB  . LYS B 1 28 ? 14.380 49.679 -3.414  1.00 20.35 ? 28  LYS B CB  1 
ATOM   1004 C CG  . LYS B 1 28 ? 13.537 49.736 -2.184  1.00 24.17 ? 28  LYS B CG  1 
ATOM   1005 C CD  . LYS B 1 28 ? 12.151 50.274 -2.459  1.00 31.18 ? 28  LYS B CD  1 
ATOM   1006 C CE  . LYS B 1 28 ? 11.255 49.966 -1.260  1.00 35.70 ? 28  LYS B CE  1 
ATOM   1007 N NZ  . LYS B 1 28 ? 11.337 48.519 -0.831  1.00 36.56 ? 28  LYS B NZ  1 
ATOM   1008 N N   . LEU B 1 29 ? 16.136 48.184 -5.507  1.00 17.47 ? 29  LEU B N   1 
ATOM   1009 C CA  . LEU B 1 29 ? 16.602 48.347 -6.900  1.00 14.90 ? 29  LEU B CA  1 
ATOM   1010 C C   . LEU B 1 29 ? 15.363 48.466 -7.744  1.00 16.60 ? 29  LEU B C   1 
ATOM   1011 O O   . LEU B 1 29 ? 14.283 48.091 -7.311  1.00 17.87 ? 29  LEU B O   1 
ATOM   1012 C CB  . LEU B 1 29 ? 17.286 47.056 -7.378  1.00 14.78 ? 29  LEU B CB  1 
ATOM   1013 C CG  . LEU B 1 29 ? 18.530 46.660 -6.614  1.00 13.98 ? 29  LEU B CG  1 
ATOM   1014 C CD1 . LEU B 1 29 ? 18.957 45.302 -7.077  1.00 18.17 ? 29  LEU B CD1 1 
ATOM   1015 C CD2 . LEU B 1 29 ? 19.643 47.709 -6.924  1.00 20.78 ? 29  LEU B CD2 1 
ATOM   1016 N N   A CYS B 1 30 ? 15.539 49.071 -8.927  0.60 18.81 ? 30  CYS B N   1 
ATOM   1017 N N   B CYS B 1 30 ? 15.498 48.930 -8.966  0.40 18.13 ? 30  CYS B N   1 
ATOM   1018 C CA  A CYS B 1 30 ? 14.613 48.978 -10.069 0.60 19.21 ? 30  CYS B CA  1 
ATOM   1019 C CA  B CYS B 1 30 ? 14.422 48.641 -9.866  0.40 18.35 ? 30  CYS B CA  1 
ATOM   1020 C C   A CYS B 1 30 ? 14.914 47.636 -10.834 0.60 19.50 ? 30  CYS B C   1 
ATOM   1021 C C   B CYS B 1 30 ? 14.878 47.515 -10.750 0.40 18.92 ? 30  CYS B C   1 
ATOM   1022 O O   A CYS B 1 30 ? 16.070 47.157 -10.779 0.60 18.52 ? 30  CYS B O   1 
ATOM   1023 O O   B CYS B 1 30 ? 16.067 47.135 -10.765 0.40 18.29 ? 30  CYS B O   1 
ATOM   1024 C CB  A CYS B 1 30 ? 14.799 50.225 -10.964 0.60 19.86 ? 30  CYS B CB  1 
ATOM   1025 C CB  B CYS B 1 30 ? 14.060 49.836 -10.698 0.40 17.96 ? 30  CYS B CB  1 
ATOM   1026 S SG  A CYS B 1 30 ? 14.118 51.834 -10.325 0.60 23.82 ? 30  CYS B SG  1 
ATOM   1027 S SG  B CYS B 1 30 ? 15.374 50.232 -11.786 0.40 16.59 ? 30  CYS B SG  1 
ATOM   1028 N N   . GLN B 1 31 ? 13.937 46.991 -11.520 1.00 19.76 ? 31  GLN B N   1 
ATOM   1029 C CA  . GLN B 1 31 ? 14.222 45.816 -12.309 1.00 20.96 ? 31  GLN B CA  1 
ATOM   1030 C C   . GLN B 1 31 ? 15.257 46.095 -13.377 1.00 19.20 ? 31  GLN B C   1 
ATOM   1031 O O   . GLN B 1 31 ? 16.018 45.178 -13.699 1.00 19.12 ? 31  GLN B O   1 
ATOM   1032 C CB  . GLN B 1 31 ? 12.935 45.059 -12.851 1.00 23.27 ? 31  GLN B CB  1 
ATOM   1033 C CG  . GLN B 1 31 ? 12.547 43.848 -11.872 1.00 25.97 ? 31  GLN B CG  1 
ATOM   1034 C CD  . GLN B 1 31 ? 11.149 43.258 -12.071 1.00 36.31 ? 31  GLN B CD  1 
ATOM   1035 O OE1 . GLN B 1 31 ? 10.467 43.575 -13.034 1.00 39.96 ? 31  GLN B OE1 1 
ATOM   1036 N NE2 . GLN B 1 31 ? 10.732 42.378 -11.150 1.00 37.65 ? 31  GLN B NE2 1 
ATOM   1037 N N   . ALA B 1 32 ? 15.348 47.341 -13.878 1.00 20.01 ? 32  ALA B N   1 
ATOM   1038 C CA  . ALA B 1 32 ? 16.401 47.652 -14.850 1.00 19.87 ? 32  ALA B CA  1 
ATOM   1039 C C   . ALA B 1 32 ? 17.801 47.479 -14.234 1.00 19.06 ? 32  ALA B C   1 
ATOM   1040 O O   . ALA B 1 32 ? 18.738 46.943 -14.884 1.00 20.73 ? 32  ALA B O   1 
ATOM   1041 C CB  . ALA B 1 32 ? 16.240 49.032 -15.423 1.00 21.69 ? 32  ALA B CB  1 
ATOM   1042 N N   . GLU B 1 33 ? 17.915 47.897 -12.975 1.00 17.40 ? 33  GLU B N   1 
ATOM   1043 C CA  . GLU B 1 33 ? 19.172 47.818 -12.258 1.00 14.53 ? 33  GLU B CA  1 
ATOM   1044 C C   . GLU B 1 33 ? 19.470 46.352 -11.937 1.00 13.88 ? 33  GLU B C   1 
ATOM   1045 O O   . GLU B 1 33 ? 20.639 45.953 -11.993 1.00 14.49 ? 33  GLU B O   1 
ATOM   1046 C CB  . GLU B 1 33 ? 19.148 48.596 -10.930 1.00 14.08 ? 33  GLU B CB  1 
ATOM   1047 C CG  . GLU B 1 33 ? 19.250 50.094 -11.160 1.00 14.71 ? 33  GLU B CG  1 
ATOM   1048 C CD  . GLU B 1 33 ? 18.917 50.908 -9.934  1.00 17.32 ? 33  GLU B CD  1 
ATOM   1049 O OE1 . GLU B 1 33 ? 17.991 50.545 -9.161  1.00 17.53 ? 33  GLU B OE1 1 
ATOM   1050 O OE2 . GLU B 1 33 ? 19.467 52.021 -9.802  1.00 20.18 ? 33  GLU B OE2 1 
ATOM   1051 N N   . LEU B 1 34 ? 18.441 45.569 -11.571 1.00 14.73 ? 34  LEU B N   1 
ATOM   1052 C CA  . LEU B 1 34 ? 18.639 44.140 -11.335 1.00 13.28 ? 34  LEU B CA  1 
ATOM   1053 C C   . LEU B 1 34 ? 19.079 43.490 -12.631 1.00 14.54 ? 34  LEU B C   1 
ATOM   1054 O O   . LEU B 1 34 ? 20.005 42.663 -12.620 1.00 14.57 ? 34  LEU B O   1 
ATOM   1055 C CB  . LEU B 1 34 ? 17.335 43.516 -10.817 1.00 13.38 ? 34  LEU B CB  1 
ATOM   1056 C CG  . LEU B 1 34 ? 17.420 41.985 -10.605 1.00 13.02 ? 34  LEU B CG  1 
ATOM   1057 C CD1 . LEU B 1 34 ? 18.470 41.698 -9.518  1.00 14.09 ? 34  LEU B CD1 1 
ATOM   1058 C CD2 . LEU B 1 34 ? 16.036 41.430 -10.212 1.00 15.87 ? 34  LEU B CD2 1 
ATOM   1059 N N   . LYS B 1 35 ? 18.449 43.869 -13.763 1.00 17.41 ? 35  LYS B N   1 
ATOM   1060 C CA  . LYS B 1 35 ? 18.952 43.245 -15.025 1.00 18.77 ? 35  LYS B CA  1 
ATOM   1061 C C   . LYS B 1 35 ? 20.406 43.619 -15.306 1.00 18.42 ? 35  LYS B C   1 
ATOM   1062 O O   . LYS B 1 35 ? 21.199 42.772 -15.678 1.00 19.08 ? 35  LYS B O   1 
ATOM   1063 C CB  . LYS B 1 35 ? 18.058 43.615 -16.238 1.00 21.56 ? 35  LYS B CB  1 
ATOM   1064 C CG  . LYS B 1 35 ? 18.457 42.676 -17.416 1.00 27.32 ? 35  LYS B CG  1 
ATOM   1065 C CD  . LYS B 1 35 ? 17.536 42.872 -18.586 1.00 29.98 ? 35  LYS B CD  1 
ATOM   1066 C CE  . LYS B 1 35 ? 18.074 43.905 -19.586 1.00 37.08 ? 35  LYS B CE  1 
ATOM   1067 N NZ  . LYS B 1 35 ? 18.784 43.188 -20.690 1.00 40.73 ? 35  LYS B NZ  1 
ATOM   1068 N N   . GLU B 1 36 ? 20.790 44.863 -15.043 1.00 18.78 ? 36  GLU B N   1 
ATOM   1069 C CA  . GLU B 1 36 ? 22.141 45.285 -15.285 1.00 18.29 ? 36  GLU B CA  1 
ATOM   1070 C C   . GLU B 1 36 ? 23.087 44.518 -14.378 1.00 16.67 ? 36  GLU B C   1 
ATOM   1071 O O   . GLU B 1 36 ? 24.130 44.030 -14.810 1.00 17.31 ? 36  GLU B O   1 
ATOM   1072 C CB  . GLU B 1 36 ? 22.254 46.797 -15.034 1.00 17.95 ? 36  GLU B CB  1 
ATOM   1073 C CG  . GLU B 1 36 ? 23.714 47.328 -15.123 1.00 17.10 ? 36  GLU B CG  1 
ATOM   1074 C CD  . GLU B 1 36 ? 23.905 48.745 -14.591 1.00 21.02 ? 36  GLU B CD  1 
ATOM   1075 O OE1 . GLU B 1 36 ? 22.907 49.322 -14.183 1.00 23.45 ? 36  GLU B OE1 1 
ATOM   1076 O OE2 . GLU B 1 36 ? 25.066 49.239 -14.576 1.00 20.68 ? 36  GLU B OE2 1 
ATOM   1077 N N   . LEU B 1 37 ? 22.743 44.399 -13.109 1.00 15.34 ? 37  LEU B N   1 
ATOM   1078 C CA  . LEU B 1 37 ? 23.517 43.628 -12.147 1.00 15.04 ? 37  LEU B CA  1 
ATOM   1079 C C   . LEU B 1 37 ? 23.738 42.186 -12.631 1.00 14.01 ? 37  LEU B C   1 
ATOM   1080 O O   . LEU B 1 37 ? 24.870 41.708 -12.630 1.00 16.02 ? 37  LEU B O   1 
ATOM   1081 C CB  . LEU B 1 37 ? 22.742 43.668 -10.803 1.00 13.73 ? 37  LEU B CB  1 
ATOM   1082 C CG  . LEU B 1 37 ? 23.494 43.142 -9.584  1.00 13.68 ? 37  LEU B CG  1 
ATOM   1083 C CD1 . LEU B 1 37 ? 22.714 43.623 -8.371  1.00 13.58 ? 37  LEU B CD1 1 
ATOM   1084 C CD2 . LEU B 1 37 ? 23.493 41.581 -9.512  1.00 12.92 ? 37  LEU B CD2 1 
ATOM   1085 N N   . LEU B 1 38 ? 22.684 41.510 -13.031 1.00 16.20 ? 38  LEU B N   1 
ATOM   1086 C CA  . LEU B 1 38 ? 22.841 40.088 -13.399 1.00 15.79 ? 38  LEU B CA  1 
ATOM   1087 C C   . LEU B 1 38 ? 23.657 39.975 -14.664 1.00 19.20 ? 38  LEU B C   1 
ATOM   1088 O O   . LEU B 1 38 ? 24.487 39.046 -14.792 1.00 20.25 ? 38  LEU B O   1 
ATOM   1089 C CB  . LEU B 1 38 ? 21.472 39.467 -13.561 1.00 17.78 ? 38  LEU B CB  1 
ATOM   1090 C CG  . LEU B 1 38 ? 20.563 39.485 -12.329 1.00 16.47 ? 38  LEU B CG  1 
ATOM   1091 C CD1 . LEU B 1 38 ? 19.171 39.011 -12.629 1.00 18.10 ? 38  LEU B CD1 1 
ATOM   1092 C CD2 . LEU B 1 38 ? 21.231 38.580 -11.287 1.00 18.73 ? 38  LEU B CD2 1 
ATOM   1093 N N   . GLN B 1 39 ? 23.461 40.908 -15.587 1.00 20.15 ? 39  GLN B N   1 
ATOM   1094 C CA  . GLN B 1 39 ? 24.187 40.862 -16.847 1.00 23.01 ? 39  GLN B CA  1 
ATOM   1095 C C   . GLN B 1 39 ? 25.664 41.131 -16.675 1.00 21.48 ? 39  GLN B C   1 
ATOM   1096 O O   . GLN B 1 39 ? 26.504 40.492 -17.320 1.00 23.11 ? 39  GLN B O   1 
ATOM   1097 C CB  . GLN B 1 39 ? 23.502 41.745 -17.868 1.00 25.62 ? 39  GLN B CB  1 
ATOM   1098 C CG  . GLN B 1 39 ? 22.209 41.013 -18.196 1.00 30.30 ? 39  GLN B CG  1 
ATOM   1099 C CD  . GLN B 1 39 ? 21.541 41.437 -19.487 1.00 35.48 ? 39  GLN B CD  1 
ATOM   1100 O OE1 . GLN B 1 39 ? 21.397 42.621 -19.787 1.00 39.43 ? 39  GLN B OE1 1 
ATOM   1101 N NE2 . GLN B 1 39 ? 21.110 40.447 -20.258 1.00 38.00 ? 39  GLN B NE2 1 
ATOM   1102 N N   . LYS B 1 40 ? 26.009 42.063 -15.802 1.00 20.05 ? 40  LYS B N   1 
ATOM   1103 C CA  . LYS B 1 40 ? 27.392 42.407 -15.561 1.00 19.31 ? 40  LYS B CA  1 
ATOM   1104 C C   . LYS B 1 40 ? 28.108 41.474 -14.562 1.00 19.92 ? 40  LYS B C   1 
ATOM   1105 O O   . LYS B 1 40 ? 29.269 41.067 -14.784 1.00 23.19 ? 40  LYS B O   1 
ATOM   1106 C CB  . LYS B 1 40 ? 27.498 43.831 -15.057 1.00 19.06 ? 40  LYS B CB  1 
ATOM   1107 C CG  . LYS B 1 40 ? 27.205 44.825 -16.121 1.00 23.59 ? 40  LYS B CG  1 
ATOM   1108 C CD  . LYS B 1 40 ? 27.374 46.249 -15.636 1.00 24.29 ? 40  LYS B CD  1 
ATOM   1109 C CE  . LYS B 1 40 ? 27.044 47.203 -16.775 1.00 22.53 ? 40  LYS B CE  1 
ATOM   1110 N NZ  . LYS B 1 40 ? 26.998 48.620 -16.295 1.00 27.35 ? 40  LYS B NZ  1 
ATOM   1111 N N   . GLU B 1 41 ? 27.393 41.099 -13.502 1.00 18.55 ? 41  GLU B N   1 
ATOM   1112 C CA  . GLU B 1 41 ? 28.032 40.432 -12.359 1.00 20.41 ? 41  GLU B CA  1 
ATOM   1113 C C   . GLU B 1 41 ? 28.060 38.939 -12.471 1.00 20.99 ? 41  GLU B C   1 
ATOM   1114 O O   . GLU B 1 41 ? 28.877 38.298 -11.757 1.00 21.03 ? 41  GLU B O   1 
ATOM   1115 C CB  . GLU B 1 41 ? 27.401 40.852 -11.025 1.00 19.00 ? 41  GLU B CB  1 
ATOM   1116 C CG  . GLU B 1 41 ? 27.382 42.345 -10.768 1.00 22.94 ? 41  GLU B CG  1 
ATOM   1117 C CD  . GLU B 1 41 ? 28.733 43.013 -10.758 1.00 24.70 ? 41  GLU B CD  1 
ATOM   1118 O OE1 . GLU B 1 41 ? 29.761 42.383 -10.383 1.00 28.59 ? 41  GLU B OE1 1 
ATOM   1119 O OE2 . GLU B 1 41 ? 28.798 44.195 -11.170 1.00 25.83 ? 41  GLU B OE2 1 
ATOM   1120 N N   . LEU B 1 42 ? 27.194 38.389 -13.350 1.00 19.83 ? 42  LEU B N   1 
ATOM   1121 C CA  . LEU B 1 42 ? 27.088 36.930 -13.632 1.00 20.25 ? 42  LEU B CA  1 
ATOM   1122 C C   . LEU B 1 42 ? 27.202 36.745 -15.101 1.00 20.56 ? 42  LEU B C   1 
ATOM   1123 O O   . LEU B 1 42 ? 26.464 35.976 -15.698 1.00 20.70 ? 42  LEU B O   1 
ATOM   1124 C CB  . LEU B 1 42 ? 25.726 36.375 -13.197 1.00 20.76 ? 42  LEU B CB  1 
ATOM   1125 C CG  . LEU B 1 42 ? 25.549 36.207 -11.717 1.00 22.07 ? 42  LEU B CG  1 
ATOM   1126 C CD1 . LEU B 1 42 ? 24.134 35.755 -11.425 1.00 25.98 ? 42  LEU B CD1 1 
ATOM   1127 C CD2 . LEU B 1 42 ? 26.508 35.255 -11.083 1.00 23.98 ? 42  LEU B CD2 1 
ATOM   1128 N N   . ALA B 1 43 ? 28.092 37.551 -15.716 1.00 19.93 ? 43  ALA B N   1 
ATOM   1129 C CA  . ALA B 1 43 ? 28.188 37.629 -17.188 1.00 21.52 ? 43  ALA B CA  1 
ATOM   1130 C C   . ALA B 1 43 ? 28.417 36.256 -17.868 1.00 23.07 ? 43  ALA B C   1 
ATOM   1131 O O   . ALA B 1 43 ? 27.914 36.011 -18.982 1.00 25.67 ? 43  ALA B O   1 
ATOM   1132 C CB  . ALA B 1 43 ? 29.296 38.611 -17.640 1.00 21.74 ? 43  ALA B CB  1 
ATOM   1133 N N   . THR B 1 44 ? 29.153 35.384 -17.195 1.00 21.35 ? 44  THR B N   1 
ATOM   1134 C CA  . THR B 1 44 ? 29.507 34.093 -17.788 1.00 22.02 ? 44  THR B CA  1 
ATOM   1135 C C   . THR B 1 44 ? 28.418 33.012 -17.612 1.00 20.23 ? 44  THR B C   1 
ATOM   1136 O O   . THR B 1 44 ? 28.566 31.920 -18.168 1.00 20.74 ? 44  THR B O   1 
ATOM   1137 C CB  . THR B 1 44 ? 30.881 33.622 -17.328 1.00 22.37 ? 44  THR B CB  1 
ATOM   1138 O OG1 . THR B 1 44 ? 30.861 33.281 -15.948 1.00 22.93 ? 44  THR B OG1 1 
ATOM   1139 C CG2 . THR B 1 44 ? 31.888 34.739 -17.591 1.00 24.25 ? 44  THR B CG2 1 
ATOM   1140 N N   . TRP B 1 45 ? 27.329 33.285 -16.901 1.00 20.02 ? 45  TRP B N   1 
ATOM   1141 C CA  . TRP B 1 45 ? 26.376 32.216 -16.647 1.00 20.04 ? 45  TRP B CA  1 
ATOM   1142 C C   . TRP B 1 45 ? 25.323 32.128 -17.761 1.00 21.30 ? 45  TRP B C   1 
ATOM   1143 O O   . TRP B 1 45 ? 24.714 33.163 -18.103 1.00 23.93 ? 45  TRP B O   1 
ATOM   1144 C CB  . TRP B 1 45 ? 25.702 32.458 -15.283 1.00 17.97 ? 45  TRP B CB  1 
ATOM   1145 C CG  . TRP B 1 45 ? 26.610 32.160 -14.127 1.00 14.43 ? 45  TRP B CG  1 
ATOM   1146 C CD1 . TRP B 1 45 ? 27.965 32.385 -14.040 1.00 14.26 ? 45  TRP B CD1 1 
ATOM   1147 C CD2 . TRP B 1 45 ? 26.243 31.540 -12.886 1.00 15.58 ? 45  TRP B CD2 1 
ATOM   1148 N NE1 . TRP B 1 45 ? 28.421 31.956 -12.863 1.00 16.00 ? 45  TRP B NE1 1 
ATOM   1149 C CE2 . TRP B 1 45 ? 27.398 31.411 -12.129 1.00 15.80 ? 45  TRP B CE2 1 
ATOM   1150 C CE3 . TRP B 1 45 ? 25.028 31.055 -12.352 1.00 19.80 ? 45  TRP B CE3 1 
ATOM   1151 C CZ2 . TRP B 1 45 ? 27.402 30.832 -10.854 1.00 15.99 ? 45  TRP B CZ2 1 
ATOM   1152 C CZ3 . TRP B 1 45 ? 25.076 30.417 -11.087 1.00 19.41 ? 45  TRP B CZ3 1 
ATOM   1153 C CH2 . TRP B 1 45 ? 26.240 30.326 -10.378 1.00 20.25 ? 45  TRP B CH2 1 
ATOM   1154 N N   . THR B 1 46 ? 25.047 30.922 -18.257 1.00 22.07 ? 46  THR B N   1 
ATOM   1155 C CA  . THR B 1 46 ? 24.138 30.669 -19.376 1.00 22.32 ? 46  THR B CA  1 
ATOM   1156 C C   . THR B 1 46 ? 23.284 29.482 -19.056 1.00 22.74 ? 46  THR B C   1 
ATOM   1157 O O   . THR B 1 46 ? 23.724 28.608 -18.304 1.00 20.47 ? 46  THR B O   1 
ATOM   1158 C CB  . THR B 1 46 ? 24.911 30.403 -20.683 1.00 24.74 ? 46  THR B CB  1 
ATOM   1159 O OG1 . THR B 1 46 ? 25.804 29.294 -20.519 1.00 24.65 ? 46  THR B OG1 1 
ATOM   1160 C CG2 . THR B 1 46 ? 25.701 31.626 -21.079 1.00 27.55 ? 46  THR B CG2 1 
ATOM   1161 N N   . PRO B 1 47 ? 22.076 29.368 -19.626 1.00 21.90 ? 47  PRO B N   1 
ATOM   1162 C CA  . PRO B 1 47 ? 21.117 28.285 -19.302 1.00 24.21 ? 47  PRO B CA  1 
ATOM   1163 C C   . PRO B 1 47 ? 21.556 26.851 -19.651 1.00 24.84 ? 47  PRO B C   1 
ATOM   1164 O O   . PRO B 1 47 ? 22.314 26.642 -20.598 1.00 27.59 ? 47  PRO B O   1 
ATOM   1165 C CB  . PRO B 1 47 ? 19.842 28.713 -20.069 1.00 25.51 ? 47  PRO B CB  1 
ATOM   1166 C CG  . PRO B 1 47 ? 20.329 29.717 -21.047 1.00 24.98 ? 47  PRO B CG  1 
ATOM   1167 C CD  . PRO B 1 47 ? 21.448 30.437 -20.425 1.00 25.44 ? 47  PRO B CD  1 
ATOM   1168 N N   . THR B 1 48 ? 21.083 25.894 -18.870 1.00 22.73 ? 48  THR B N   1 
ATOM   1169 C CA  . THR B 1 48 ? 21.291 24.454 -19.099 1.00 25.81 ? 48  THR B CA  1 
ATOM   1170 C C   . THR B 1 48 ? 20.244 23.932 -20.066 1.00 28.51 ? 48  THR B C   1 
ATOM   1171 O O   . THR B 1 48 ? 19.410 24.701 -20.544 1.00 30.78 ? 48  THR B O   1 
ATOM   1172 C CB  . THR B 1 48 ? 21.280 23.666 -17.780 1.00 23.40 ? 48  THR B CB  1 
ATOM   1173 O OG1 . THR B 1 48 ? 20.035 23.869 -17.082 1.00 22.84 ? 48  THR B OG1 1 
ATOM   1174 C CG2 . THR B 1 48 ? 22.471 24.091 -16.931 1.00 24.06 ? 48  THR B CG2 1 
ATOM   1175 N N   . GLU B 1 49 ? 20.312 22.633 -20.356 1.00 31.35 ? 49  GLU B N   1 
ATOM   1176 C CA  . GLU B 1 49 ? 19.615 22.008 -21.491 1.00 33.72 ? 49  GLU B CA  1 
ATOM   1177 C C   . GLU B 1 49 ? 18.102 22.175 -21.489 1.00 34.81 ? 49  GLU B C   1 
ATOM   1178 O O   . GLU B 1 49 ? 17.496 22.436 -22.537 1.00 36.47 ? 49  GLU B O   1 
ATOM   1179 C CB  . GLU B 1 49 ? 19.993 20.511 -21.572 1.00 33.92 ? 49  GLU B CB  1 
ATOM   1180 C CG  . GLU B 1 49 ? 19.293 19.753 -22.716 1.00 41.00 ? 49  GLU B CG  1 
ATOM   1181 C CD  . GLU B 1 49 ? 19.872 18.368 -22.963 1.00 45.47 ? 49  GLU B CD  1 
ATOM   1182 O OE1 . GLU B 1 49 ? 20.777 17.961 -22.207 1.00 46.38 ? 49  GLU B OE1 1 
ATOM   1183 O OE2 . GLU B 1 49 ? 19.429 17.684 -23.926 1.00 49.28 ? 49  GLU B OE2 1 
ATOM   1184 N N   . PHE B 1 50 ? 17.473 22.019 -20.325 1.00 34.10 ? 50  PHE B N   1 
ATOM   1185 C CA  . PHE B 1 50 ? 16.015 22.096 -20.273 1.00 33.99 ? 50  PHE B CA  1 
ATOM   1186 C C   . PHE B 1 50 ? 15.505 23.408 -19.691 1.00 33.00 ? 50  PHE B C   1 
ATOM   1187 O O   . PHE B 1 50 ? 14.324 23.499 -19.306 1.00 35.52 ? 50  PHE B O   1 
ATOM   1188 C CB  . PHE B 1 50 ? 15.411 20.909 -19.499 1.00 34.02 ? 50  PHE B CB  1 
ATOM   1189 C CG  . PHE B 1 50 ? 16.028 19.580 -19.855 1.00 34.69 ? 50  PHE B CG  1 
ATOM   1190 C CD1 . PHE B 1 50 ? 15.804 19.006 -21.104 1.00 39.85 ? 50  PHE B CD1 1 
ATOM   1191 C CD2 . PHE B 1 50 ? 16.836 18.894 -18.936 1.00 34.13 ? 50  PHE B CD2 1 
ATOM   1192 C CE1 . PHE B 1 50 ? 16.367 17.783 -21.418 1.00 38.13 ? 50  PHE B CE1 1 
ATOM   1193 C CE2 . PHE B 1 50 ? 17.416 17.671 -19.258 1.00 34.73 ? 50  PHE B CE2 1 
ATOM   1194 C CZ  . PHE B 1 50 ? 17.186 17.128 -20.504 1.00 37.15 ? 50  PHE B CZ  1 
ATOM   1195 N N   . ARG B 1 51 ? 16.357 24.439 -19.663 1.00 31.07 ? 51  ARG B N   1 
ATOM   1196 C CA  . ARG B 1 51 ? 15.965 25.719 -19.044 1.00 29.06 ? 51  ARG B CA  1 
ATOM   1197 C C   . ARG B 1 51 ? 16.126 26.997 -19.898 1.00 29.17 ? 51  ARG B C   1 
ATOM   1198 O O   . ARG B 1 51 ? 15.934 28.098 -19.395 1.00 26.73 ? 51  ARG B O   1 
ATOM   1199 C CB  . ARG B 1 51 ? 16.668 25.893 -17.683 1.00 26.61 ? 51  ARG B CB  1 
ATOM   1200 C CG  . ARG B 1 51 ? 16.282 24.821 -16.617 1.00 29.01 ? 51  ARG B CG  1 
ATOM   1201 C CD  . ARG B 1 51 ? 14.850 24.948 -16.040 1.00 31.96 ? 51  ARG B CD  1 
ATOM   1202 N NE  . ARG B 1 51 ? 14.761 24.355 -14.687 1.00 34.16 ? 51  ARG B NE  1 
ATOM   1203 C CZ  . ARG B 1 51 ? 13.778 24.551 -13.781 1.00 36.91 ? 51  ARG B CZ  1 
ATOM   1204 N NH1 . ARG B 1 51 ? 12.704 25.323 -14.048 1.00 38.31 ? 51  ARG B NH1 1 
ATOM   1205 N NH2 . ARG B 1 51 ? 13.868 23.948 -12.583 1.00 33.60 ? 51  ARG B NH2 1 
ATOM   1206 N N   . GLU B 1 52 ? 16.433 26.878 -21.191 1.00 30.53 ? 52  GLU B N   1 
ATOM   1207 C CA  . GLU B 1 52 ? 16.593 28.086 -22.042 1.00 32.01 ? 52  GLU B CA  1 
ATOM   1208 C C   . GLU B 1 52 ? 15.344 28.956 -22.103 1.00 32.84 ? 52  GLU B C   1 
ATOM   1209 O O   . GLU B 1 52 ? 15.440 30.179 -22.044 1.00 32.03 ? 52  GLU B O   1 
ATOM   1210 C CB  . GLU B 1 52 ? 17.006 27.705 -23.466 1.00 34.69 ? 52  GLU B CB  1 
ATOM   1211 C CG  . GLU B 1 52 ? 18.217 26.801 -23.467 1.00 37.79 ? 52  GLU B CG  1 
ATOM   1212 C CD  . GLU B 1 52 ? 18.531 26.193 -24.830 1.00 44.46 ? 52  GLU B CD  1 
ATOM   1213 O OE1 . GLU B 1 52 ? 17.672 26.201 -25.733 1.00 50.06 ? 52  GLU B OE1 1 
ATOM   1214 O OE2 . GLU B 1 52 ? 19.653 25.673 -24.989 1.00 48.76 ? 52  GLU B OE2 1 
ATOM   1215 N N   . CYS B 1 53 ? 14.194 28.302 -22.252 1.00 34.86 ? 53  CYS B N   1 
ATOM   1216 C CA  . CYS B 1 53 ? 12.902 28.985 -22.324 1.00 35.71 ? 53  CYS B CA  1 
ATOM   1217 C C   . CYS B 1 53 ? 12.652 29.744 -21.050 1.00 32.71 ? 53  CYS B C   1 
ATOM   1218 O O   . CYS B 1 53 ? 12.248 30.911 -21.090 1.00 30.70 ? 53  CYS B O   1 
ATOM   1219 C CB  . CYS B 1 53 ? 11.778 27.971 -22.527 1.00 37.14 ? 53  CYS B CB  1 
ATOM   1220 S SG  . CYS B 1 53 ? 10.165 28.613 -22.999 1.00 47.69 ? 53  CYS B SG  1 
ATOM   1221 N N   . ASP B 1 54 ? 12.882 29.094 -19.906 1.00 30.46 ? 54  ASP B N   1 
ATOM   1222 C CA  . ASP B 1 54 ? 12.547 29.686 -18.625 1.00 27.51 ? 54  ASP B CA  1 
ATOM   1223 C C   . ASP B 1 54 ? 13.473 30.859 -18.374 1.00 25.44 ? 54  ASP B C   1 
ATOM   1224 O O   . ASP B 1 54 ? 13.067 31.869 -17.814 1.00 23.74 ? 54  ASP B O   1 
ATOM   1225 C CB  . ASP B 1 54 ? 12.715 28.663 -17.479 1.00 28.32 ? 54  ASP B CB  1 
ATOM   1226 C CG  . ASP B 1 54 ? 11.563 27.663 -17.396 1.00 32.31 ? 54  ASP B CG  1 
ATOM   1227 O OD1 . ASP B 1 54 ? 10.456 27.942 -17.940 1.00 36.62 ? 54  ASP B OD1 1 
ATOM   1228 O OD2 . ASP B 1 54 ? 11.757 26.602 -16.771 1.00 35.13 ? 54  ASP B OD2 1 
ATOM   1229 N N   . TYR B 1 55 ? 14.744 30.704 -18.751 1.00 23.89 ? 55  TYR B N   1 
ATOM   1230 C CA  . TYR B 1 55 ? 15.735 31.739 -18.587 1.00 21.72 ? 55  TYR B CA  1 
ATOM   1231 C C   . TYR B 1 55 ? 15.383 32.953 -19.419 1.00 23.39 ? 55  TYR B C   1 
ATOM   1232 O O   . TYR B 1 55 ? 15.318 34.052 -18.911 1.00 21.41 ? 55  TYR B O   1 
ATOM   1233 C CB  . TYR B 1 55 ? 17.112 31.174 -19.005 1.00 21.88 ? 55  TYR B CB  1 
ATOM   1234 C CG  . TYR B 1 55 ? 18.207 32.158 -19.021 1.00 21.21 ? 55  TYR B CG  1 
ATOM   1235 C CD1 . TYR B 1 55 ? 18.946 32.413 -17.882 1.00 19.33 ? 55  TYR B CD1 1 
ATOM   1236 C CD2 . TYR B 1 55 ? 18.579 32.798 -20.221 1.00 24.60 ? 55  TYR B CD2 1 
ATOM   1237 C CE1 . TYR B 1 55 ? 19.992 33.326 -17.890 1.00 22.57 ? 55  TYR B CE1 1 
ATOM   1238 C CE2 . TYR B 1 55 ? 19.588 33.718 -20.241 1.00 27.70 ? 55  TYR B CE2 1 
ATOM   1239 C CZ  . TYR B 1 55 ? 20.296 33.988 -19.089 1.00 26.49 ? 55  TYR B CZ  1 
ATOM   1240 O OH  . TYR B 1 55 ? 21.325 34.879 -19.144 1.00 26.14 ? 55  TYR B OH  1 
ATOM   1241 N N   . ASN B 1 56 ? 15.123 32.697 -20.691 1.00 25.98 ? 56  ASN B N   1 
ATOM   1242 C CA  . ASN B 1 56 ? 14.752 33.788 -21.589 1.00 26.75 ? 56  ASN B CA  1 
ATOM   1243 C C   . ASN B 1 56 ? 13.528 34.556 -21.115 1.00 27.56 ? 56  ASN B C   1 
ATOM   1244 O O   . ASN B 1 56 ? 13.545 35.812 -21.134 1.00 26.80 ? 56  ASN B O   1 
ATOM   1245 C CB  . ASN B 1 56 ? 14.591 33.282 -23.006 1.00 29.53 ? 56  ASN B CB  1 
ATOM   1246 C CG  . ASN B 1 56 ? 15.921 32.847 -23.625 1.00 33.70 ? 56  ASN B CG  1 
ATOM   1247 O OD1 . ASN B 1 56 ? 16.994 33.373 -23.287 1.00 34.72 ? 56  ASN B OD1 1 
ATOM   1248 N ND2 . ASN B 1 56 ? 15.846 31.930 -24.557 1.00 38.19 ? 56  ASN B ND2 1 
ATOM   1249 N N   . LYS B 1 57 ? 12.519 33.837 -20.610 1.00 27.50 ? 57  LYS B N   1 
ATOM   1250 C CA  . LYS B 1 57 ? 11.316 34.493 -20.046 1.00 27.70 ? 57  LYS B CA  1 
ATOM   1251 C C   . LYS B 1 57 ? 11.613 35.303 -18.798 1.00 25.78 ? 57  LYS B C   1 
ATOM   1252 O O   . LYS B 1 57 ? 11.140 36.438 -18.631 1.00 26.20 ? 57  LYS B O   1 
ATOM   1253 C CB  . LYS B 1 57 ? 10.222 33.467 -19.717 1.00 29.92 ? 57  LYS B CB  1 
ATOM   1254 C CG  . LYS B 1 57 ? 9.739  32.669 -20.899 1.00 35.52 ? 57  LYS B CG  1 
ATOM   1255 C CD  . LYS B 1 57 ? 8.506  31.822 -20.573 1.00 40.97 ? 57  LYS B CD  1 
ATOM   1256 C CE  . LYS B 1 57 ? 8.195  30.901 -21.735 1.00 45.47 ? 57  LYS B CE  1 
ATOM   1257 N NZ  . LYS B 1 57 ? 8.260  31.665 -23.017 1.00 45.56 ? 57  LYS B NZ  1 
ATOM   1258 N N   . PHE B 1 58 ? 12.420 34.711 -17.913 1.00 23.23 ? 58  PHE B N   1 
ATOM   1259 C CA  . PHE B 1 58 ? 12.901 35.463 -16.772 1.00 22.27 ? 58  PHE B CA  1 
ATOM   1260 C C   . PHE B 1 58 ? 13.623 36.774 -17.184 1.00 22.94 ? 58  PHE B C   1 
ATOM   1261 O O   . PHE B 1 58 ? 13.374 37.847 -16.612 1.00 21.96 ? 58  PHE B O   1 
ATOM   1262 C CB  . PHE B 1 58 ? 13.836 34.491 -15.986 1.00 21.86 ? 58  PHE B CB  1 
ATOM   1263 C CG  . PHE B 1 58 ? 14.511 35.120 -14.839 1.00 24.72 ? 58  PHE B CG  1 
ATOM   1264 C CD1 . PHE B 1 58 ? 13.864 35.280 -13.631 1.00 27.48 ? 58  PHE B CD1 1 
ATOM   1265 C CD2 . PHE B 1 58 ? 15.820 35.534 -14.968 1.00 30.30 ? 58  PHE B CD2 1 
ATOM   1266 C CE1 . PHE B 1 58 ? 14.533 35.889 -12.568 1.00 33.25 ? 58  PHE B CE1 1 
ATOM   1267 C CE2 . PHE B 1 58 ? 16.492 36.144 -13.910 1.00 32.92 ? 58  PHE B CE2 1 
ATOM   1268 C CZ  . PHE B 1 58 ? 15.842 36.312 -12.713 1.00 34.76 ? 58  PHE B CZ  1 
ATOM   1269 N N   . MET B 1 59 ? 14.516 36.683 -18.170 1.00 23.34 ? 59  MET B N   1 
ATOM   1270 C CA  . MET B 1 59 ? 15.272 37.864 -18.581 1.00 25.10 ? 59  MET B CA  1 
ATOM   1271 C C   . MET B 1 59 ? 14.398 38.911 -19.306 1.00 25.82 ? 59  MET B C   1 
ATOM   1272 O O   . MET B 1 59 ? 14.587 40.133 -19.120 1.00 26.21 ? 59  MET B O   1 
ATOM   1273 C CB  . MET B 1 59 ? 16.475 37.488 -19.442 1.00 26.12 ? 59  MET B CB  1 
ATOM   1274 C CG  . MET B 1 59 ? 17.742 36.918 -18.648 1.00 25.15 ? 59  MET B CG  1 
ATOM   1275 S SD  . MET B 1 59 ? 18.264 38.036 -17.295 1.00 35.28 ? 59  MET B SD  1 
ATOM   1276 C CE  . MET B 1 59 ? 19.687 37.204 -16.682 1.00 32.17 ? 59  MET B CE  1 
ATOM   1277 N N   . SER B 1 60 ? 13.402 38.406 -20.034 1.00 25.76 ? 60  SER B N   1 
ATOM   1278 C CA  . SER B 1 60 ? 12.430 39.271 -20.732 1.00 26.81 ? 60  SER B CA  1 
ATOM   1279 C C   . SER B 1 60 ? 11.609 40.096 -19.743 1.00 26.68 ? 60  SER B C   1 
ATOM   1280 O O   . SER B 1 60 ? 11.389 41.293 -19.972 1.00 27.43 ? 60  SER B O   1 
ATOM   1281 C CB  . SER B 1 60 ? 11.505 38.447 -21.605 1.00 25.94 ? 60  SER B CB  1 
ATOM   1282 O OG  . SER B 1 60 ? 10.620 39.340 -22.297 1.00 34.18 ? 60  SER B OG  1 
ATOM   1283 N N   . VAL B 1 61 ? 11.148 39.465 -18.656 1.00 28.32 ? 61  VAL B N   1 
ATOM   1284 C CA  . VAL B 1 61 ? 10.320 40.168 -17.658 1.00 30.61 ? 61  VAL B CA  1 
ATOM   1285 C C   . VAL B 1 61 ? 11.067 41.331 -17.004 1.00 30.73 ? 61  VAL B C   1 
ATOM   1286 O O   . VAL B 1 61 ? 10.473 42.386 -16.790 1.00 32.90 ? 61  VAL B O   1 
ATOM   1287 C CB  . VAL B 1 61 ? 9.756  39.207 -16.593 1.00 30.40 ? 61  VAL B CB  1 
ATOM   1288 C CG1 . VAL B 1 61 ? 9.149  39.963 -15.415 1.00 33.27 ? 61  VAL B CG1 1 
ATOM   1289 C CG2 . VAL B 1 61 ? 8.759  38.283 -17.229 1.00 32.20 ? 61  VAL B CG2 1 
ATOM   1290 N N   . LEU B 1 62 ? 12.350 41.127 -16.709 1.00 30.62 ? 62  LEU B N   1 
ATOM   1291 C CA  . LEU B 1 62 ? 13.135 42.190 -16.056 1.00 30.83 ? 62  LEU B CA  1 
ATOM   1292 C C   . LEU B 1 62 ? 13.239 43.368 -16.979 1.00 31.75 ? 62  LEU B C   1 
ATOM   1293 O O   . LEU B 1 62 ? 13.017 44.503 -16.554 1.00 32.56 ? 62  LEU B O   1 
ATOM   1294 C CB  . LEU B 1 62 ? 14.517 41.714 -15.686 1.00 29.87 ? 62  LEU B CB  1 
ATOM   1295 C CG  . LEU B 1 62 ? 14.548 40.638 -14.599 1.00 27.60 ? 62  LEU B CG  1 
ATOM   1296 C CD1 . LEU B 1 62 ? 15.966 40.440 -14.334 1.00 25.26 ? 62  LEU B CD1 1 
ATOM   1297 C CD2 . LEU B 1 62 ? 13.793 41.109 -13.335 1.00 27.12 ? 62  LEU B CD2 1 
ATOM   1298 N N   . ASP B 1 63 ? 13.499 43.078 -18.253 1.00 32.99 ? 63  ASP B N   1 
ATOM   1299 C CA  . ASP B 1 63 ? 13.687 44.110 -19.261 1.00 33.22 ? 63  ASP B CA  1 
ATOM   1300 C C   . ASP B 1 63 ? 12.418 44.885 -19.613 1.00 33.34 ? 63  ASP B C   1 
ATOM   1301 O O   . ASP B 1 63 ? 12.470 46.075 -19.938 1.00 34.31 ? 63  ASP B O   1 
ATOM   1302 C CB  . ASP B 1 63 ? 14.268 43.497 -20.530 1.00 34.82 ? 63  ASP B CB  1 
ATOM   1303 C CG  . ASP B 1 63 ? 14.930 44.521 -21.403 1.00 40.88 ? 63  ASP B CG  1 
ATOM   1304 O OD1 . ASP B 1 63 ? 15.785 45.280 -20.879 1.00 42.94 ? 63  ASP B OD1 1 
ATOM   1305 O OD2 . ASP B 1 63 ? 14.563 44.590 -22.601 1.00 45.20 ? 63  ASP B OD2 1 
ATOM   1306 N N   . THR B 1 64 ? 11.273 44.218 -19.576 1.00 32.23 ? 64  THR B N   1 
ATOM   1307 C CA  . THR B 1 64 ? 10.011 44.914 -19.848 1.00 32.82 ? 64  THR B CA  1 
ATOM   1308 C C   . THR B 1 64 ? 9.523  45.653 -18.616 1.00 31.83 ? 64  THR B C   1 
ATOM   1309 O O   . THR B 1 64 ? 9.092  46.823 -18.674 1.00 30.18 ? 64  THR B O   1 
ATOM   1310 C CB  . THR B 1 64 ? 8.929  43.908 -20.261 1.00 33.82 ? 64  THR B CB  1 
ATOM   1311 O OG1 . THR B 1 64 ? 9.228  43.424 -21.563 1.00 36.54 ? 64  THR B OG1 1 
ATOM   1312 C CG2 . THR B 1 64 ? 7.580  44.573 -20.281 1.00 36.02 ? 64  THR B CG2 1 
ATOM   1313 N N   . ASN B 1 65 ? 9.578  44.933 -17.506 1.00 32.20 ? 65  ASN B N   1 
ATOM   1314 C CA  . ASN B 1 65 ? 9.166  45.386 -16.216 1.00 34.00 ? 65  ASN B CA  1 
ATOM   1315 C C   . ASN B 1 65 ? 10.062 46.543 -15.753 1.00 33.31 ? 65  ASN B C   1 
ATOM   1316 O O   . ASN B 1 65 ? 11.289 46.449 -15.755 1.00 34.37 ? 65  ASN B O   1 
ATOM   1317 C CB  . ASN B 1 65 ? 9.295  44.196 -15.246 1.00 33.97 ? 65  ASN B CB  1 
ATOM   1318 C CG  . ASN B 1 65 ? 8.668  44.471 -13.910 1.00 36.53 ? 65  ASN B CG  1 
ATOM   1319 O OD1 . ASN B 1 65 ? 7.861  43.668 -13.413 1.00 41.49 ? 65  ASN B OD1 1 
ATOM   1320 N ND2 . ASN B 1 65 ? 9.026  45.612 -13.303 1.00 34.72 ? 65  ASN B ND2 1 
ATOM   1321 N N   . LYS B 1 66 ? 9.430  47.658 -15.403 1.00 34.69 ? 66  LYS B N   1 
ATOM   1322 C CA  . LYS B 1 66 ? 10.157 48.854 -14.958 1.00 35.59 ? 66  LYS B CA  1 
ATOM   1323 C C   . LYS B 1 66 ? 9.578  49.383 -13.668 1.00 36.47 ? 66  LYS B C   1 
ATOM   1324 O O   . LYS B 1 66 ? 9.230  50.614 -13.574 1.00 37.78 ? 66  LYS B O   1 
ATOM   1325 C CB  . LYS B 1 66 ? 10.083 49.950 -16.016 1.00 35.48 ? 66  LYS B CB  1 
ATOM   1326 C CG  . LYS B 1 66 ? 10.674 49.575 -17.364 1.00 35.65 ? 66  LYS B CG  1 
ATOM   1327 C CD  . LYS B 1 66 ? 12.166 49.314 -17.294 1.00 33.01 ? 66  LYS B CD  1 
ATOM   1328 C CE  . LYS B 1 66 ? 12.593 48.738 -18.613 1.00 31.31 ? 66  LYS B CE  1 
ATOM   1329 N NZ  . LYS B 1 66 ? 13.942 48.128 -18.611 1.00 34.00 ? 66  LYS B NZ  1 
ATOM   1330 N N   . ASP B 1 67 ? 9.424  48.461 -12.702 1.00 36.74 ? 67  ASP B N   1 
ATOM   1331 C CA  . ASP B 1 67 ? 8.913  48.817 -11.381 1.00 36.47 ? 67  ASP B CA  1 
ATOM   1332 C C   . ASP B 1 67 ? 10.205 48.977 -10.622 1.00 33.94 ? 67  ASP B C   1 
ATOM   1333 O O   . ASP B 1 67 ? 11.290 48.649 -11.155 1.00 32.39 ? 67  ASP B O   1 
ATOM   1334 C CB  . ASP B 1 67 ? 8.071  47.708 -10.718 1.00 37.03 ? 67  ASP B CB  1 
ATOM   1335 C CG  . ASP B 1 67 ? 6.925  47.195 -11.600 1.00 36.49 ? 67  ASP B CG  1 
ATOM   1336 O OD1 . ASP B 1 67 ? 7.153  46.206 -12.304 1.00 26.50 ? 67  ASP B OD1 1 
ATOM   1337 O OD2 . ASP B 1 67 ? 5.795  47.772 -11.579 1.00 40.56 ? 67  ASP B OD2 1 
ATOM   1338 N N   A CYS B 1 68 ? 10.113 49.474 -9.393  0.50 32.20 ? 68  CYS B N   1 
ATOM   1339 C CA  A CYS B 1 68 ? 11.302 49.845 -8.626  0.50 29.53 ? 68  CYS B CA  1 
ATOM   1340 C C   A CYS B 1 68 ? 11.154 49.520 -7.169  0.50 29.41 ? 68  CYS B C   1 
ATOM   1341 O O   A CYS B 1 68 ? 11.590 50.246 -6.273  0.50 29.84 ? 68  CYS B O   1 
ATOM   1342 C CB  A CYS B 1 68 ? 11.613 51.305 -8.831  0.50 28.90 ? 68  CYS B CB  1 
ATOM   1343 S SG  A CYS B 1 68 ? 12.117 51.565 -10.501 0.50 26.62 ? 68  CYS B SG  1 
ATOM   1344 N N   . GLU B 1 69 ? 10.555 48.370 -6.971  1.00 30.43 ? 69  GLU B N   1 
ATOM   1345 C CA  . GLU B 1 69 ? 10.317 47.853 -5.667  1.00 31.46 ? 69  GLU B CA  1 
ATOM   1346 C C   . GLU B 1 69 ? 11.030 46.497 -5.490  1.00 29.70 ? 69  GLU B C   1 
ATOM   1347 O O   . GLU B 1 69 ? 10.522 45.689 -4.712  1.00 31.77 ? 69  GLU B O   1 
ATOM   1348 C CB  . GLU B 1 69 ? 8.801  47.663 -5.447  1.00 33.81 ? 69  GLU B CB  1 
ATOM   1349 C CG  . GLU B 1 69 ? 7.947  48.940 -5.342  1.00 39.41 ? 69  GLU B CG  1 
ATOM   1350 C CD  . GLU B 1 69 ? 8.105  49.668 -4.007  1.00 45.20 ? 69  GLU B CD  1 
ATOM   1351 O OE1 . GLU B 1 69 ? 7.106  49.735 -3.242  1.00 47.77 ? 69  GLU B OE1 1 
ATOM   1352 O OE2 . GLU B 1 69 ? 9.215  50.175 -3.723  1.00 47.15 ? 69  GLU B OE2 1 
ATOM   1353 N N   . VAL B 1 70 ? 12.168 46.224 -6.179  1.00 25.22 ? 70  VAL B N   1 
ATOM   1354 C CA  . VAL B 1 70 ? 12.920 44.975 -5.960  1.00 22.44 ? 70  VAL B CA  1 
ATOM   1355 C C   . VAL B 1 70 ? 13.692 45.120 -4.661  1.00 19.63 ? 70  VAL B C   1 
ATOM   1356 O O   . VAL B 1 70 ? 14.619 45.951 -4.582  1.00 20.85 ? 70  VAL B O   1 
ATOM   1357 C CB  . VAL B 1 70 ? 13.997 44.742 -7.071  1.00 21.64 ? 70  VAL B CB  1 
ATOM   1358 C CG1 . VAL B 1 70 ? 14.769 43.514 -6.864  1.00 20.22 ? 70  VAL B CG1 1 
ATOM   1359 C CG2 . VAL B 1 70 ? 13.302 44.671 -8.455  1.00 25.59 ? 70  VAL B CG2 1 
ATOM   1360 N N   . ASP B 1 71 ? 13.336 44.348 -3.645  1.00 17.22 ? 71  ASP B N   1 
ATOM   1361 C CA  . ASP B 1 71 ? 14.051 44.430 -2.388  1.00 15.49 ? 71  ASP B CA  1 
ATOM   1362 C C   . ASP B 1 71 ? 15.155 43.364 -2.332  1.00 13.93 ? 71  ASP B C   1 
ATOM   1363 O O   . ASP B 1 71 ? 15.367 42.622 -3.298  1.00 13.13 ? 71  ASP B O   1 
ATOM   1364 C CB  . ASP B 1 71 ? 13.117 44.340 -1.188  1.00 15.78 ? 71  ASP B CB  1 
ATOM   1365 C CG  . ASP B 1 71 ? 12.345 43.039 -1.106  1.00 20.66 ? 71  ASP B CG  1 
ATOM   1366 O OD1 . ASP B 1 71 ? 12.654 42.045 -1.806  1.00 17.09 ? 71  ASP B OD1 1 
ATOM   1367 O OD2 . ASP B 1 71 ? 11.392 43.022 -0.255  1.00 25.04 ? 71  ASP B OD2 1 
ATOM   1368 N N   . PHE B 1 72 ? 15.895 43.364 -1.234  1.00 14.14 ? 72  PHE B N   1 
ATOM   1369 C CA  . PHE B 1 72 ? 16.982 42.414 -1.105  1.00 12.45 ? 72  PHE B CA  1 
ATOM   1370 C C   . PHE B 1 72 ? 16.539 40.956 -1.276  1.00 12.58 ? 72  PHE B C   1 
ATOM   1371 O O   . PHE B 1 72 ? 17.183 40.210 -2.013  1.00 12.51 ? 72  PHE B O   1 
ATOM   1372 C CB  . PHE B 1 72 ? 17.656 42.570 0.264   1.00 13.76 ? 72  PHE B CB  1 
ATOM   1373 C CG  . PHE B 1 72 ? 18.842 41.678 0.421   1.00 14.19 ? 72  PHE B CG  1 
ATOM   1374 C CD1 . PHE B 1 72 ? 20.003 41.882 -0.353  1.00 12.49 ? 72  PHE B CD1 1 
ATOM   1375 C CD2 . PHE B 1 72 ? 18.807 40.579 1.295   1.00 13.51 ? 72  PHE B CD2 1 
ATOM   1376 C CE1 . PHE B 1 72 ? 21.066 41.020 -0.199  1.00 12.90 ? 72  PHE B CE1 1 
ATOM   1377 C CE2 . PHE B 1 72 ? 19.907 39.753 1.454   1.00 12.90 ? 72  PHE B CE2 1 
ATOM   1378 C CZ  . PHE B 1 72 ? 21.050 39.968 0.702   1.00 12.95 ? 72  PHE B CZ  1 
ATOM   1379 N N   . VAL B 1 73 ? 15.423 40.569 -0.634  1.00 13.31 ? 73  VAL B N   1 
ATOM   1380 C CA  . VAL B 1 73 ? 14.943 39.208 -0.765  1.00 15.19 ? 73  VAL B CA  1 
ATOM   1381 C C   . VAL B 1 73 ? 14.612 38.861 -2.218  1.00 14.76 ? 73  VAL B C   1 
ATOM   1382 O O   . VAL B 1 73 ? 14.950 37.768 -2.686  1.00 14.58 ? 73  VAL B O   1 
ATOM   1383 C CB  . VAL B 1 73 ? 13.772 39.028 0.222   1.00 17.35 ? 73  VAL B CB  1 
ATOM   1384 C CG1 . VAL B 1 73 ? 13.026 37.719 0.014   1.00 19.98 ? 73  VAL B CG1 1 
ATOM   1385 C CG2 . VAL B 1 73 ? 14.289 39.107 1.643   1.00 19.82 ? 73  VAL B CG2 1 
ATOM   1386 N N   . GLU B 1 74 ? 14.034 39.777 -2.977  1.00 13.16 ? 74  GLU B N   1 
ATOM   1387 C CA  A GLU B 1 74 ? 13.703 39.545 -4.366  0.30 14.66 ? 74  GLU B CA  1 
ATOM   1388 C CA  B GLU B 1 74 ? 13.707 39.504 -4.356  0.70 14.73 ? 74  GLU B CA  1 
ATOM   1389 C C   . GLU B 1 74 ? 14.977 39.438 -5.206  1.00 14.07 ? 74  GLU B C   1 
ATOM   1390 O O   . GLU B 1 74 ? 15.068 38.612 -6.143  1.00 13.79 ? 74  GLU B O   1 
ATOM   1391 C CB  A GLU B 1 74 ? 12.821 40.691 -4.875  0.30 15.66 ? 74  GLU B CB  1 
ATOM   1392 C CB  B GLU B 1 74 ? 12.755 40.567 -4.920  0.70 16.30 ? 74  GLU B CB  1 
ATOM   1393 C CG  A GLU B 1 74 ? 12.454 40.590 -6.333  0.30 18.37 ? 74  GLU B CG  1 
ATOM   1394 C CG  B GLU B 1 74 ? 12.201 40.221 -6.302  0.70 19.61 ? 74  GLU B CG  1 
ATOM   1395 C CD  A GLU B 1 74 ? 11.738 39.298 -6.657  0.30 21.33 ? 74  GLU B CD  1 
ATOM   1396 C CD  B GLU B 1 74 ? 11.224 41.262 -6.846  0.70 24.66 ? 74  GLU B CD  1 
ATOM   1397 O OE1 A GLU B 1 74 ? 11.225 38.632 -5.720  0.30 23.34 ? 74  GLU B OE1 1 
ATOM   1398 O OE1 B GLU B 1 74 ? 10.771 42.166 -6.096  0.70 30.22 ? 74  GLU B OE1 1 
ATOM   1399 O OE2 A GLU B 1 74 ? 11.662 38.953 -7.853  0.30 25.68 ? 74  GLU B OE2 1 
ATOM   1400 O OE2 B GLU B 1 74 ? 10.896 41.145 -8.045  0.70 30.39 ? 74  GLU B OE2 1 
ATOM   1401 N N   . TYR B 1 75 ? 15.966 40.292 -4.900  1.00 12.69 ? 75  TYR B N   1 
ATOM   1402 C CA  . TYR B 1 75 ? 17.234 40.179 -5.569  1.00 12.05 ? 75  TYR B CA  1 
ATOM   1403 C C   . TYR B 1 75 ? 17.857 38.799 -5.315  1.00 11.55 ? 75  TYR B C   1 
ATOM   1404 O O   . TYR B 1 75 ? 18.355 38.168 -6.250  1.00 11.50 ? 75  TYR B O   1 
ATOM   1405 C CB  . TYR B 1 75 ? 18.151 41.342 -5.078  1.00 11.84 ? 75  TYR B CB  1 
ATOM   1406 C CG  . TYR B 1 75 ? 19.658 41.028 -5.080  1.00 10.99 ? 75  TYR B CG  1 
ATOM   1407 C CD1 . TYR B 1 75 ? 20.389 41.020 -6.250  1.00 10.35 ? 75  TYR B CD1 1 
ATOM   1408 C CD2 . TYR B 1 75 ? 20.304 40.821 -3.870  1.00 11.15 ? 75  TYR B CD2 1 
ATOM   1409 C CE1 . TYR B 1 75 ? 21.747 40.799 -6.210  1.00 11.63 ? 75  TYR B CE1 1 
ATOM   1410 C CE2 . TYR B 1 75 ? 21.662 40.565 -3.775  1.00 11.63 ? 75  TYR B CE2 1 
ATOM   1411 C CZ  . TYR B 1 75 ? 22.394 40.589 -4.975  1.00 10.49 ? 75  TYR B CZ  1 
ATOM   1412 O OH  . TYR B 1 75 ? 23.761 40.433 -4.936  1.00 10.89 ? 75  TYR B OH  1 
ATOM   1413 N N   . VAL B 1 76 ? 17.807 38.288 -4.066  1.00 12.24 ? 76  VAL B N   1 
ATOM   1414 C CA  . VAL B 1 76 ? 18.456 37.008 -3.822  1.00 13.79 ? 76  VAL B CA  1 
ATOM   1415 C C   . VAL B 1 76 ? 17.630 35.926 -4.505  1.00 13.08 ? 76  VAL B C   1 
ATOM   1416 O O   . VAL B 1 76 ? 18.218 34.957 -5.010  1.00 13.95 ? 76  VAL B O   1 
ATOM   1417 C CB  . VAL B 1 76 ? 18.611 36.793 -2.290  1.00 13.65 ? 76  VAL B CB  1 
ATOM   1418 C CG1 . VAL B 1 76 ? 19.193 35.434 -2.014  1.00 19.34 ? 76  VAL B CG1 1 
ATOM   1419 C CG2 . VAL B 1 76 ? 19.548 37.884 -1.709  1.00 14.35 ? 76  VAL B CG2 1 
ATOM   1420 N N   . ARG B 1 77 ? 16.312 36.086 -4.559  1.00 13.67 ? 77  ARG B N   1 
ATOM   1421 C CA  A ARG B 1 77 ? 15.516 35.064 -5.262  0.70 12.78 ? 77  ARG B CA  1 
ATOM   1422 C CA  B ARG B 1 77 ? 15.444 35.139 -5.289  0.30 13.98 ? 77  ARG B CA  1 
ATOM   1423 C C   . ARG B 1 77 ? 15.886 35.045 -6.735  1.00 14.74 ? 77  ARG B C   1 
ATOM   1424 O O   . ARG B 1 77 ? 15.956 33.973 -7.337  1.00 14.83 ? 77  ARG B O   1 
ATOM   1425 C CB  A ARG B 1 77 ? 14.066 35.406 -5.124  0.70 14.54 ? 77  ARG B CB  1 
ATOM   1426 C CB  B ARG B 1 77 ? 14.007 35.641 -5.266  0.30 14.89 ? 77  ARG B CB  1 
ATOM   1427 C CG  A ARG B 1 77 ? 13.183 34.353 -5.867  0.70 15.72 ? 77  ARG B CG  1 
ATOM   1428 C CG  B ARG B 1 77 ? 13.024 34.730 -6.036  0.30 16.57 ? 77  ARG B CG  1 
ATOM   1429 C CD  A ARG B 1 77 ? 11.686 34.701 -5.694  0.70 21.33 ? 77  ARG B CD  1 
ATOM   1430 C CD  B ARG B 1 77 ? 11.612 34.797 -5.414  0.30 17.58 ? 77  ARG B CD  1 
ATOM   1431 N NE  A ARG B 1 77 ? 11.265 35.913 -6.399  0.70 29.27 ? 77  ARG B NE  1 
ATOM   1432 N NE  B ARG B 1 77 ? 10.579 34.206 -6.262  0.30 21.18 ? 77  ARG B NE  1 
ATOM   1433 C CZ  A ARG B 1 77 ? 10.695 35.915 -7.605  0.70 33.74 ? 77  ARG B CZ  1 
ATOM   1434 C CZ  B ARG B 1 77 ? 10.021 33.014 -6.081  0.30 23.39 ? 77  ARG B CZ  1 
ATOM   1435 N NH1 A ARG B 1 77 ? 10.546 34.774 -8.268  0.70 37.21 ? 77  ARG B NH1 1 
ATOM   1436 N NH1 B ARG B 1 77 ? 10.398 32.228 -5.079  0.30 21.69 ? 77  ARG B NH1 1 
ATOM   1437 N NH2 A ARG B 1 77 ? 10.316 37.055 -8.163  0.70 36.31 ? 77  ARG B NH2 1 
ATOM   1438 N NH2 B ARG B 1 77 ? 9.079  32.593 -6.919  0.30 25.83 ? 77  ARG B NH2 1 
ATOM   1439 N N   . SER B 1 78 ? 16.211 36.196 -7.345  1.00 13.23 ? 78  SER B N   1 
ATOM   1440 C CA  A SER B 1 78 ? 16.660 36.195 -8.753  0.60 13.68 ? 78  SER B CA  1 
ATOM   1441 C CA  B SER B 1 78 ? 16.634 36.205 -8.727  0.40 13.93 ? 78  SER B CA  1 
ATOM   1442 C C   . SER B 1 78 ? 17.940 35.398 -8.915  1.00 13.73 ? 78  SER B C   1 
ATOM   1443 O O   . SER B 1 78 ? 18.104 34.670 -9.900  1.00 14.16 ? 78  SER B O   1 
ATOM   1444 C CB  A SER B 1 78 ? 16.884 37.610 -9.364  0.60 14.28 ? 78  SER B CB  1 
ATOM   1445 C CB  B SER B 1 78 ? 16.767 37.660 -9.207  0.40 14.75 ? 78  SER B CB  1 
ATOM   1446 O OG  A SER B 1 78 ? 18.110 38.215 -8.993  0.60 13.00 ? 78  SER B OG  1 
ATOM   1447 O OG  B SER B 1 78 ? 15.492 38.324 -9.148  0.40 14.66 ? 78  SER B OG  1 
ATOM   1448 N N   . LEU B 1 79 ? 18.889 35.528 -7.959  1.00 12.44 ? 79  LEU B N   1 
ATOM   1449 C CA  . LEU B 1 79 ? 20.090 34.708 -8.008  1.00 13.22 ? 79  LEU B CA  1 
ATOM   1450 C C   . LEU B 1 79 ? 19.786 33.219 -7.938  1.00 13.05 ? 79  LEU B C   1 
ATOM   1451 O O   . LEU B 1 79 ? 20.395 32.417 -8.702  1.00 13.92 ? 79  LEU B O   1 
ATOM   1452 C CB  . LEU B 1 79 ? 21.048 35.072 -6.853  1.00 12.94 ? 79  LEU B CB  1 
ATOM   1453 C CG  . LEU B 1 79 ? 21.480 36.559 -6.833  1.00 13.55 ? 79  LEU B CG  1 
ATOM   1454 C CD1 . LEU B 1 79 ? 22.384 36.767 -5.628  1.00 13.78 ? 79  LEU B CD1 1 
ATOM   1455 C CD2 . LEU B 1 79 ? 22.249 36.913 -8.108  1.00 15.83 ? 79  LEU B CD2 1 
ATOM   1456 N N   . ALA B 1 80 ? 18.850 32.863 -7.029  1.00 12.25 ? 80  ALA B N   1 
ATOM   1457 C CA  . ALA B 1 80 ? 18.428 31.443 -6.914  1.00 13.53 ? 80  ALA B CA  1 
ATOM   1458 C C   . ALA B 1 80 ? 17.876 30.963 -8.242  1.00 13.08 ? 80  ALA B C   1 
ATOM   1459 O O   . ALA B 1 80 ? 18.213 29.849 -8.680  1.00 13.43 ? 80  ALA B O   1 
ATOM   1460 C CB  . ALA B 1 80 ? 17.443 31.203 -5.769  1.00 14.44 ? 80  ALA B CB  1 
ATOM   1461 N N   . CYS B 1 81 ? 17.002 31.760 -8.871  1.00 12.65 ? 81  CYS B N   1 
ATOM   1462 C CA  . CYS B 1 81 ? 16.490 31.392 -10.165 1.00 13.73 ? 81  CYS B CA  1 
ATOM   1463 C C   . CYS B 1 81 ? 17.537 31.204 -11.245 1.00 14.36 ? 81  CYS B C   1 
ATOM   1464 O O   . CYS B 1 81 ? 17.501 30.260 -11.999 1.00 14.15 ? 81  CYS B O   1 
ATOM   1465 C CB  . CYS B 1 81 ? 15.455 32.427 -10.617 1.00 14.68 ? 81  CYS B CB  1 
ATOM   1466 S SG  . CYS B 1 81 ? 13.939 32.334 -9.562  1.00 18.79 ? 81  CYS B SG  1 
ATOM   1467 N N   . LEU B 1 82 ? 18.518 32.115 -11.295 1.00 15.47 ? 82  LEU B N   1 
ATOM   1468 C CA  . LEU B 1 82 ? 19.617 31.941 -12.234 1.00 15.89 ? 82  LEU B CA  1 
ATOM   1469 C C   . LEU B 1 82 ? 20.396 30.638 -11.978 1.00 16.78 ? 82  LEU B C   1 
ATOM   1470 O O   . LEU B 1 82 ? 20.859 30.009 -12.923 1.00 16.22 ? 82  LEU B O   1 
ATOM   1471 C CB  . LEU B 1 82 ? 20.563 33.152 -12.169 1.00 17.77 ? 82  LEU B CB  1 
ATOM   1472 C CG  . LEU B 1 82 ? 20.242 34.107 -13.330 1.00 21.81 ? 82  LEU B CG  1 
ATOM   1473 C CD1 . LEU B 1 82 ? 18.886 34.610 -13.174 1.00 25.17 ? 82  LEU B CD1 1 
ATOM   1474 C CD2 . LEU B 1 82 ? 21.241 35.285 -13.434 1.00 23.19 ? 82  LEU B CD2 1 
ATOM   1475 N N   . CYS B 1 83 ? 20.542 30.192 -10.728 1.00 14.41 ? 83  CYS B N   1 
ATOM   1476 C CA  . CYS B 1 83 ? 21.127 28.863 -10.454 1.00 15.95 ? 83  CYS B CA  1 
ATOM   1477 C C   . CYS B 1 83 ? 20.335 27.789 -11.088 1.00 16.14 ? 83  CYS B C   1 
ATOM   1478 O O   . CYS B 1 83 ? 20.870 26.843 -11.694 1.00 15.64 ? 83  CYS B O   1 
ATOM   1479 C CB  . CYS B 1 83 ? 21.191 28.535 -8.965  1.00 15.48 ? 83  CYS B CB  1 
ATOM   1480 S SG  . CYS B 1 83 ? 22.465 29.615 -8.149  1.00 16.67 ? 83  CYS B SG  1 
ATOM   1481 N N   . LEU B 1 84 ? 19.019 27.806 -10.837 1.00 14.62 ? 84  LEU B N   1 
ATOM   1482 C CA  . LEU B 1 84 ? 18.190 26.782 -11.384 1.00 15.52 ? 84  LEU B CA  1 
ATOM   1483 C C   . LEU B 1 84 ? 18.291 26.703 -12.878 1.00 16.79 ? 84  LEU B C   1 
ATOM   1484 O O   . LEU B 1 84 ? 18.181 25.642 -13.508 1.00 18.28 ? 84  LEU B O   1 
ATOM   1485 C CB  . LEU B 1 84 ? 16.714 26.965 -11.020 1.00 16.75 ? 84  LEU B CB  1 
ATOM   1486 C CG  . LEU B 1 84 ? 16.417 26.827 -9.564  1.00 18.34 ? 84  LEU B CG  1 
ATOM   1487 C CD1 . LEU B 1 84 ? 14.909 26.993 -9.406  1.00 17.98 ? 84  LEU B CD1 1 
ATOM   1488 C CD2 . LEU B 1 84 ? 16.852 25.411 -9.104  1.00 18.31 ? 84  LEU B CD2 1 
ATOM   1489 N N   . TYR B 1 85 ? 18.419 27.869 -13.501 1.00 14.42 ? 85  TYR B N   1 
ATOM   1490 C CA  . TYR B 1 85 ? 18.510 27.900 -14.925 1.00 17.06 ? 85  TYR B CA  1 
ATOM   1491 C C   . TYR B 1 85 ? 19.867 27.576 -15.466 1.00 16.07 ? 85  TYR B C   1 
ATOM   1492 O O   . TYR B 1 85 ? 19.934 27.047 -16.567 1.00 18.36 ? 85  TYR B O   1 
ATOM   1493 C CB  . TYR B 1 85 ? 18.170 29.294 -15.468 1.00 17.84 ? 85  TYR B CB  1 
ATOM   1494 C CG  . TYR B 1 85 ? 16.820 29.812 -15.100 1.00 21.96 ? 85  TYR B CG  1 
ATOM   1495 C CD1 . TYR B 1 85 ? 15.696 28.999 -14.958 1.00 25.23 ? 85  TYR B CD1 1 
ATOM   1496 C CD2 . TYR B 1 85 ? 16.698 31.171 -14.850 1.00 22.17 ? 85  TYR B CD2 1 
ATOM   1497 C CE1 . TYR B 1 85 ? 14.411 29.625 -14.619 1.00 29.42 ? 85  TYR B CE1 1 
ATOM   1498 C CE2 . TYR B 1 85 ? 15.503 31.759 -14.511 1.00 26.60 ? 85  TYR B CE2 1 
ATOM   1499 C CZ  . TYR B 1 85 ? 14.387 30.978 -14.379 1.00 26.21 ? 85  TYR B CZ  1 
ATOM   1500 O OH  . TYR B 1 85 ? 13.269 31.723 -14.013 1.00 29.31 ? 85  TYR B OH  1 
ATOM   1501 N N   . CYS B 1 86 ? 20.937 27.908 -14.721 1.00 14.98 ? 86  CYS B N   1 
ATOM   1502 C CA  . CYS B 1 86 ? 22.258 27.956 -15.354 1.00 14.63 ? 86  CYS B CA  1 
ATOM   1503 C C   . CYS B 1 86 ? 23.303 27.054 -14.729 1.00 15.02 ? 86  CYS B C   1 
ATOM   1504 O O   . CYS B 1 86 ? 24.389 26.878 -15.290 1.00 16.20 ? 86  CYS B O   1 
ATOM   1505 C CB  . CYS B 1 86 ? 22.810 29.387 -15.342 1.00 13.77 ? 86  CYS B CB  1 
ATOM   1506 S SG  . CYS B 1 86 ? 21.903 30.611 -16.212 1.00 16.68 ? 86  CYS B SG  1 
ATOM   1507 N N   . HIS B 1 87 ? 23.011 26.477 -13.579 1.00 12.70 ? 87  HIS B N   1 
ATOM   1508 C CA  . HIS B 1 87 ? 24.004 25.636 -12.915 1.00 12.46 ? 87  HIS B CA  1 
ATOM   1509 C C   . HIS B 1 87 ? 23.642 24.180 -13.214 1.00 12.64 ? 87  HIS B C   1 
ATOM   1510 O O   . HIS B 1 87 ? 22.491 23.703 -13.018 1.00 13.88 ? 87  HIS B O   1 
ATOM   1511 C CB  . HIS B 1 87 ? 23.959 25.913 -11.399 1.00 11.41 ? 87  HIS B CB  1 
ATOM   1512 C CG  . HIS B 1 87 ? 25.117 25.338 -10.645 1.00 12.80 ? 87  HIS B CG  1 
ATOM   1513 N ND1 . HIS B 1 87 ? 25.392 23.983 -10.569 1.00 12.18 ? 87  HIS B ND1 1 
ATOM   1514 C CD2 . HIS B 1 87 ? 26.131 25.971 -10.021 1.00 11.11 ? 87  HIS B CD2 1 
ATOM   1515 C CE1 . HIS B 1 87 ? 26.508 23.808 -9.862  1.00 11.81 ? 87  HIS B CE1 1 
ATOM   1516 N NE2 . HIS B 1 87 ? 26.982 25.001 -9.529  1.00 11.38 ? 87  HIS B NE2 1 
ATOM   1517 N N   . GLU B 1 88 ? 24.677 23.438 -13.620 1.00 12.95 ? 88  GLU B N   1 
ATOM   1518 C CA  . GLU B 1 88 ? 24.463 22.028 -14.001 1.00 13.50 ? 88  GLU B CA  1 
ATOM   1519 C C   . GLU B 1 88 ? 23.902 21.171 -12.882 1.00 13.54 ? 88  GLU B C   1 
ATOM   1520 O O   . GLU B 1 88 ? 23.238 20.150 -13.156 1.00 14.98 ? 88  GLU B O   1 
ATOM   1521 C CB  . GLU B 1 88 ? 25.773 21.439 -14.477 1.00 14.98 ? 88  GLU B CB  1 
ATOM   1522 C CG  . GLU B 1 88 ? 25.583 20.183 -15.350 1.00 21.94 ? 88  GLU B CG  1 
ATOM   1523 C CD  . GLU B 1 88 ? 24.813 20.452 -16.668 1.00 28.61 ? 88  GLU B CD  1 
ATOM   1524 O OE1 . GLU B 1 88 ? 24.720 21.602 -17.159 1.00 32.38 ? 88  GLU B OE1 1 
ATOM   1525 O OE2 . GLU B 1 88 ? 24.339 19.438 -17.234 1.00 39.97 ? 88  GLU B OE2 1 
ATOM   1526 N N   . TYR B 1 89 ? 24.129 21.523 -11.628 1.00 12.46 ? 89  TYR B N   1 
ATOM   1527 C CA  . TYR B 1 89 ? 23.584 20.691 -10.554 1.00 13.66 ? 89  TYR B CA  1 
ATOM   1528 C C   . TYR B 1 89 ? 22.075 20.516 -10.720 1.00 14.03 ? 89  TYR B C   1 
ATOM   1529 O O   . TYR B 1 89 ? 21.495 19.459 -10.353 1.00 15.79 ? 89  TYR B O   1 
ATOM   1530 C CB  . TYR B 1 89 ? 23.888 21.267 -9.192  1.00 14.75 ? 89  TYR B CB  1 
ATOM   1531 C CG  . TYR B 1 89 ? 23.452 20.340 -8.087  1.00 13.91 ? 89  TYR B CG  1 
ATOM   1532 C CD1 . TYR B 1 89 ? 22.331 20.616 -7.341  1.00 14.74 ? 89  TYR B CD1 1 
ATOM   1533 C CD2 . TYR B 1 89 ? 24.247 19.238 -7.762  1.00 15.59 ? 89  TYR B CD2 1 
ATOM   1534 C CE1 . TYR B 1 89 ? 21.911 19.786 -6.301  1.00 16.25 ? 89  TYR B CE1 1 
ATOM   1535 C CE2 . TYR B 1 89 ? 23.848 18.444 -6.747  1.00 17.33 ? 89  TYR B CE2 1 
ATOM   1536 C CZ  . TYR B 1 89 ? 22.717 18.734 -6.022  1.00 15.72 ? 89  TYR B CZ  1 
ATOM   1537 O OH  . TYR B 1 89 ? 22.346 17.897 -4.955  1.00 18.10 ? 89  TYR B OH  1 
ATOM   1538 N N   . PHE B 1 90 ? 21.378 21.533 -11.223 1.00 13.19 ? 90  PHE B N   1 
ATOM   1539 C CA  . PHE B 1 90 ? 19.926 21.529 -11.317 1.00 14.97 ? 90  PHE B CA  1 
ATOM   1540 C C   . PHE B 1 90 ? 19.402 21.145 -12.686 1.00 17.67 ? 90  PHE B C   1 
ATOM   1541 O O   . PHE B 1 90 ? 18.224 21.321 -12.959 1.00 18.87 ? 90  PHE B O   1 
ATOM   1542 C CB  . PHE B 1 90 ? 19.402 22.903 -10.881 1.00 16.39 ? 90  PHE B CB  1 
ATOM   1543 C CG  . PHE B 1 90 ? 19.721 23.211 -9.447  1.00 13.61 ? 90  PHE B CG  1 
ATOM   1544 C CD1 . PHE B 1 90 ? 19.008 22.606 -8.418  1.00 15.27 ? 90  PHE B CD1 1 
ATOM   1545 C CD2 . PHE B 1 90 ? 20.766 24.109 -9.129  1.00 15.54 ? 90  PHE B CD2 1 
ATOM   1546 C CE1 . PHE B 1 90 ? 19.304 22.855 -7.100  1.00 17.52 ? 90  PHE B CE1 1 
ATOM   1547 C CE2 . PHE B 1 90 ? 21.053 24.329 -7.750  1.00 16.15 ? 90  PHE B CE2 1 
ATOM   1548 C CZ  . PHE B 1 90 ? 20.316 23.702 -6.777  1.00 16.78 ? 90  PHE B CZ  1 
ATOM   1549 N N   . LYS B 1 91 ? 20.260 20.619 -13.554 1.00 19.23 ? 91  LYS B N   1 
ATOM   1550 C CA  . LYS B 1 91 ? 19.832 20.338 -14.940 1.00 22.61 ? 91  LYS B CA  1 
ATOM   1551 C C   . LYS B 1 91 ? 18.505 19.564 -14.934 1.00 22.89 ? 91  LYS B C   1 
ATOM   1552 O O   . LYS B 1 91 ? 17.599 19.930 -15.694 1.00 24.01 ? 91  LYS B O   1 
ATOM   1553 C CB  . LYS B 1 91 ? 20.941 19.541 -15.665 1.00 23.91 ? 91  LYS B CB  1 
ATOM   1554 C CG  . LYS B 1 91 ? 20.497 18.841 -16.954 1.00 27.90 ? 91  LYS B CG  1 
ATOM   1555 C CD  . LYS B 1 91 ? 21.480 17.739 -17.328 1.00 33.14 ? 91  LYS B CD  1 
ATOM   1556 C CE  . LYS B 1 91 ? 22.330 18.134 -18.519 1.00 38.96 ? 91  LYS B CE  1 
ATOM   1557 N NZ  . LYS B 1 91 ? 21.594 17.957 -19.810 1.00 41.81 ? 91  LYS B NZ  1 
ATOM   1558 N N   . ASP B 1 92 ? 18.383 18.587 -14.023 1.00 23.19 ? 92  ASP B N   1 
ATOM   1559 C CA  . ASP B 1 92 ? 17.238 17.643 -13.960 1.00 24.87 ? 92  ASP B CA  1 
ATOM   1560 C C   . ASP B 1 92 ? 16.254 17.917 -12.813 1.00 25.47 ? 92  ASP B C   1 
ATOM   1561 O O   . ASP B 1 92 ? 15.318 17.132 -12.535 1.00 25.64 ? 92  ASP B O   1 
ATOM   1562 C CB  . ASP B 1 92 ? 17.796 16.231 -13.884 1.00 27.19 ? 92  ASP B CB  1 
ATOM   1563 C CG  . ASP B 1 92 ? 18.567 15.856 -15.144 1.00 29.78 ? 92  ASP B CG  1 
ATOM   1564 O OD1 . ASP B 1 92 ? 18.086 16.204 -16.256 1.00 33.64 ? 92  ASP B OD1 1 
ATOM   1565 O OD2 . ASP B 1 92 ? 19.656 15.273 -15.001 1.00 33.01 ? 92  ASP B OD2 1 
ATOM   1566 N N   . CYS B 1 93 ? 16.382 19.063 -12.193 1.00 23.67 ? 93  CYS B N   1 
ATOM   1567 C CA  . CYS B 1 93 ? 15.524 19.396 -11.110 1.00 25.25 ? 93  CYS B CA  1 
ATOM   1568 C C   . CYS B 1 93 ? 14.088 19.719 -11.565 1.00 27.59 ? 93  CYS B C   1 
ATOM   1569 O O   . CYS B 1 93 ? 13.899 20.501 -12.501 1.00 30.44 ? 93  CYS B O   1 
ATOM   1570 C CB  . CYS B 1 93 ? 16.126 20.583 -10.343 1.00 21.10 ? 93  CYS B CB  1 
ATOM   1571 S SG  . CYS B 1 93 ? 14.977 21.086 -8.942  1.00 26.75 ? 93  CYS B SG  1 
ATOM   1572 N N   . PRO B 1 94 ? 13.067 19.173 -10.865 1.00 29.75 ? 94  PRO B N   1 
ATOM   1573 C CA  . PRO B 1 94 ? 11.706 19.487 -11.338 1.00 31.45 ? 94  PRO B CA  1 
ATOM   1574 C C   . PRO B 1 94 ? 11.152 20.683 -10.577 1.00 32.79 ? 94  PRO B C   1 
ATOM   1575 O O   . PRO B 1 94 ? 9.945  20.760 -10.392 1.00 36.25 ? 94  PRO B O   1 
ATOM   1576 C CB  . PRO B 1 94 ? 10.924 18.200 -11.052 1.00 33.78 ? 94  PRO B CB  1 
ATOM   1577 C CG  . PRO B 1 94 ? 11.656 17.520 -9.959  1.00 31.64 ? 94  PRO B CG  1 
ATOM   1578 C CD  . PRO B 1 94 ? 13.102 17.981 -9.984  1.00 29.51 ? 94  PRO B CD  1 
ATOM   1579 S SG  . CYS B 1 99 ? 12.694 31.232 -10.631 1.00 40.01 ? 99  CYS B SG  1 
HETATM 1580 O O   . HOH C 2 .  ? 13.511 23.868 -8.450  1.00 25.83 ? 102 HOH A O   1 
HETATM 1581 O O   . HOH C 2 .  ? 16.409 43.372 18.682  1.00 18.70 ? 103 HOH A O   1 
HETATM 1582 O O   . HOH C 2 .  ? 20.456 17.771 10.451  1.00 18.62 ? 104 HOH A O   1 
HETATM 1583 O O   . HOH C 2 .  ? 21.218 11.149 -5.537  1.00 21.52 ? 105 HOH A O   1 
HETATM 1584 O O   . HOH C 2 .  ? 23.019 17.033 -10.307 1.00 17.23 ? 106 HOH A O   1 
HETATM 1585 O O   . HOH C 2 .  ? 18.262 15.312 0.554   1.00 6.64  ? 107 HOH A O   1 
HETATM 1586 O O   . HOH C 2 .  ? 20.268 15.227 2.676   1.00 7.81  ? 108 HOH A O   1 
HETATM 1587 O O   . HOH C 2 .  ? 21.056 14.850 7.265   1.00 7.55  ? 109 HOH A O   1 
HETATM 1588 O O   . HOH C 2 .  ? 20.505 8.413  -1.005  1.00 7.12  ? 110 HOH A O   1 
HETATM 1589 O O   . HOH C 2 .  ? 18.443 12.346 -5.845  1.00 12.31 ? 111 HOH A O   1 
HETATM 1590 O O   . HOH C 2 .  ? 20.930 13.088 -2.100  1.00 9.02  ? 112 HOH A O   1 
HETATM 1591 O O   . HOH C 2 .  ? 10.606 24.691 -0.319  1.00 20.77 ? 113 HOH A O   1 
HETATM 1592 O O   . HOH C 2 .  ? 15.874 22.402 -5.344  1.00 13.69 ? 114 HOH A O   1 
HETATM 1593 O O   . HOH C 2 .  ? 12.621 26.602 5.485   1.00 26.61 ? 115 HOH A O   1 
HETATM 1594 O O   . HOH C 2 .  ? 23.000 46.537 14.921  1.00 21.36 ? 116 HOH A O   1 
HETATM 1595 O O   . HOH C 2 .  ? 20.099 43.776 9.967   1.00 6.63  ? 117 HOH A O   1 
HETATM 1596 O O   . HOH C 2 .  ? 12.518 16.502 -6.367  1.00 20.49 ? 118 HOH A O   1 
HETATM 1597 O O   . HOH C 2 .  ? 14.163 25.435 -6.080  1.00 15.05 ? 119 HOH A O   1 
HETATM 1598 O O   . HOH C 2 .  ? 14.807 32.691 -2.958  1.00 12.31 ? 120 HOH A O   1 
HETATM 1599 O O   . HOH C 2 .  ? 13.899 43.865 7.755   1.00 21.30 ? 121 HOH A O   1 
HETATM 1600 O O   . HOH C 2 .  ? 20.377 50.023 7.592   1.00 14.13 ? 122 HOH A O   1 
HETATM 1601 O O   . HOH C 2 .  ? 22.862 32.927 12.520  1.00 14.07 ? 123 HOH A O   1 
HETATM 1602 O O   . HOH C 2 .  ? 16.467 44.231 8.549   1.00 11.19 ? 124 HOH A O   1 
HETATM 1603 O O   . HOH C 2 .  ? 25.343 41.513 14.405  1.00 17.25 ? 125 HOH A O   1 
HETATM 1604 O O   . HOH C 2 .  ? 16.720 15.494 2.987   1.00 15.09 ? 126 HOH A O   1 
HETATM 1605 O O   . HOH C 2 .  ? 31.326 36.563 7.878   1.00 18.74 ? 127 HOH A O   1 
HETATM 1606 O O   . HOH C 2 .  ? 20.060 9.687  -3.299  1.00 12.70 ? 128 HOH A O   1 
HETATM 1607 O O   . HOH C 2 .  ? 28.618 22.538 -6.844  1.00 10.47 ? 129 HOH A O   1 
HETATM 1608 O O   . HOH C 2 .  ? 29.410 20.317 -2.513  1.00 12.91 ? 130 HOH A O   1 
HETATM 1609 O O   . HOH C 2 .  ? 33.256 29.723 -5.151  1.00 16.76 ? 131 HOH A O   1 
HETATM 1610 O O   . HOH C 2 .  ? 27.126 15.083 0.863   1.00 19.18 ? 132 HOH A O   1 
HETATM 1611 O O   . HOH C 2 .  ? 34.131 33.987 -11.568 1.00 21.13 ? 133 HOH A O   1 
HETATM 1612 O O   . HOH C 2 .  ? 29.964 36.439 15.914  1.00 12.68 ? 134 HOH A O   1 
HETATM 1613 O O   . HOH C 2 .  ? 12.687 41.624 15.487  1.00 19.97 ? 135 HOH A O   1 
HETATM 1614 O O   . HOH C 2 .  ? 25.189 17.307 14.066  1.00 23.08 ? 136 HOH A O   1 
HETATM 1615 O O   . HOH C 2 .  ? 10.815 35.872 11.512  1.00 22.43 ? 138 HOH A O   1 
HETATM 1616 O O   . HOH C 2 .  ? 19.590 15.256 9.565   1.00 19.92 ? 139 HOH A O   1 
HETATM 1617 O O   . HOH C 2 .  ? 29.172 35.703 18.197  1.00 32.08 ? 140 HOH A O   1 
HETATM 1618 O O   . HOH C 2 .  ? 25.530 15.728 10.382  1.00 14.30 ? 141 HOH A O   1 
HETATM 1619 O O   . HOH C 2 .  ? 13.208 29.511 5.417   1.00 36.10 ? 142 HOH A O   1 
HETATM 1620 O O   . HOH C 2 .  ? 11.396 14.181 -3.048  1.00 20.38 ? 143 HOH A O   1 
HETATM 1621 O O   . HOH C 2 .  ? 30.604 26.693 -0.301  1.00 19.92 ? 144 HOH A O   1 
HETATM 1622 O O   . HOH C 2 .  ? 11.054 30.273 -1.291  1.00 20.90 ? 145 HOH A O   1 
HETATM 1623 O O   . HOH C 2 .  ? 33.946 36.056 -14.873 1.00 18.37 ? 146 HOH A O   1 
HETATM 1624 O O   . HOH C 2 .  ? 28.392 16.721 13.304  1.00 24.28 ? 147 HOH A O   1 
HETATM 1625 O O   . HOH C 2 .  ? 19.030 20.635 13.106  1.00 18.24 ? 148 HOH A O   1 
HETATM 1626 O O   . HOH C 2 .  ? 17.920 31.282 18.393  1.00 26.82 ? 149 HOH A O   1 
HETATM 1627 O O   . HOH C 2 .  ? 27.532 20.635 -8.848  1.00 13.84 ? 150 HOH A O   1 
HETATM 1628 O O   . HOH C 2 .  ? 27.376 16.929 4.811   1.00 35.41 ? 151 HOH A O   1 
HETATM 1629 O O   . HOH C 2 .  ? 11.924 35.055 -1.560  1.00 15.93 ? 152 HOH A O   1 
HETATM 1630 O O   . HOH C 2 .  ? 17.151 12.871 -8.280  1.00 20.21 ? 153 HOH A O   1 
HETATM 1631 O O   . HOH C 2 .  ? 12.676 19.164 -6.983  1.00 24.62 ? 154 HOH A O   1 
HETATM 1632 O O   . HOH C 2 .  ? 23.408 30.404 12.276  1.00 20.19 ? 155 HOH A O   1 
HETATM 1633 O O   . HOH C 2 .  ? 11.798 13.909 -0.558  1.00 27.59 ? 156 HOH A O   1 
HETATM 1634 O O   . HOH C 2 .  ? 18.140 45.802 13.250  1.00 14.57 ? 157 HOH A O   1 
HETATM 1635 O O   . HOH C 2 .  ? 26.953 45.368 13.801  1.00 21.53 ? 158 HOH A O   1 
HETATM 1636 O O   . HOH C 2 .  ? 15.085 13.849 -7.073  1.00 15.56 ? 159 HOH A O   1 
HETATM 1637 O O   . HOH C 2 .  ? 12.906 18.793 9.398   1.00 14.51 ? 160 HOH A O   1 
HETATM 1638 O O   . HOH C 2 .  ? 30.810 22.079 0.531   1.00 25.49 ? 161 HOH A O   1 
HETATM 1639 O O   . HOH C 2 .  ? 23.146 12.972 -4.009  1.00 26.32 ? 162 HOH A O   1 
HETATM 1640 O O   . HOH C 2 .  ? 10.401 22.782 -5.376  1.00 24.24 ? 163 HOH A O   1 
HETATM 1641 O O   . HOH D 2 .  ? 20.109 23.972 -14.415 1.00 7.63  ? 102 HOH B O   1 
HETATM 1642 O O   . HOH D 2 .  ? 21.068 52.895 -11.745 1.00 6.67  ? 103 HOH B O   1 
HETATM 1643 O O   . HOH D 2 .  ? 28.931 25.295 -7.582  1.00 5.10  ? 104 HOH B O   1 
HETATM 1644 O O   . HOH D 2 .  ? 33.073 36.419 -3.539  1.00 17.56 ? 105 HOH B O   1 
HETATM 1645 O O   . HOH D 2 .  ? 18.277 52.429 -5.029  1.00 6.82  ? 106 HOH B O   1 
HETATM 1646 O O   . HOH D 2 .  ? 20.537 59.363 -3.488  1.00 7.58  ? 107 HOH B O   1 
HETATM 1647 O O   . HOH D 2 .  ? 20.290 52.521 -7.171  1.00 7.88  ? 108 HOH B O   1 
HETATM 1648 O O   . HOH D 2 .  ? 15.883 45.365 0.826   1.00 12.50 ? 109 HOH B O   1 
HETATM 1649 O O   . HOH D 2 .  ? 29.996 31.337 -20.396 1.00 12.28 ? 110 HOH B O   1 
HETATM 1650 O O   . HOH D 2 .  ? 24.093 15.453 -4.999  1.00 17.87 ? 111 HOH B O   1 
HETATM 1651 O O   . HOH D 2 .  ? 22.919 21.184 -19.516 1.00 24.72 ? 112 HOH B O   1 
HETATM 1652 O O   . HOH D 2 .  ? 20.940 54.659 -2.389  1.00 8.92  ? 113 HOH B O   1 
HETATM 1653 O O   . HOH D 2 .  ? 14.143 42.273 1.592   1.00 15.76 ? 114 HOH B O   1 
HETATM 1654 O O   . HOH D 2 .  ? 18.448 55.415 1.350   1.00 12.77 ? 115 HOH B O   1 
HETATM 1655 O O   . HOH D 2 .  ? 33.297 37.955 0.648   1.00 17.25 ? 116 HOH B O   1 
HETATM 1656 O O   . HOH D 2 .  ? 10.589 43.139 -4.106  1.00 20.90 ? 117 HOH B O   1 
HETATM 1657 O O   . HOH D 2 .  ? 30.543 39.720 -9.774  1.00 17.05 ? 118 HOH B O   1 
HETATM 1658 O O   . HOH D 2 .  ? 23.083 50.754 5.833   1.00 16.98 ? 119 HOH B O   1 
HETATM 1659 O O   . HOH D 2 .  ? 29.767 42.921 -7.400  1.00 25.57 ? 120 HOH B O   1 
HETATM 1660 O O   . HOH D 2 .  ? 14.744 35.084 -1.544  1.00 13.26 ? 121 HOH B O   1 
HETATM 1661 O O   . HOH D 2 .  ? 7.327  42.529 -17.333 1.00 29.87 ? 122 HOH B O   1 
HETATM 1662 O O   . HOH D 2 .  ? 26.983 54.257 -10.891 1.00 13.77 ? 123 HOH B O   1 
HETATM 1663 O O   . HOH D 2 .  ? 18.149 21.933 -17.689 1.00 12.32 ? 124 HOH B O   1 
HETATM 1664 O O   . HOH D 2 .  ? 30.613 41.164 -4.077  1.00 21.05 ? 125 HOH B O   1 
HETATM 1665 O O   . HOH D 2 .  ? 26.189 25.049 -16.540 1.00 13.96 ? 126 HOH B O   1 
HETATM 1666 O O   . HOH D 2 .  ? 31.747 47.379 -3.441  1.00 28.75 ? 127 HOH B O   1 
HETATM 1667 O O   . HOH D 2 .  ? 12.926 48.995 -13.886 1.00 13.27 ? 128 HOH B O   1 
HETATM 1668 O O   . HOH D 2 .  ? 30.569 28.063 5.263   1.00 18.39 ? 129 HOH B O   1 
HETATM 1669 O O   . HOH D 2 .  ? 20.417 17.717 -12.098 1.00 13.20 ? 130 HOH B O   1 
HETATM 1670 O O   . HOH D 2 .  ? 32.606 33.814 -2.221  1.00 36.60 ? 131 HOH B O   1 
HETATM 1671 O O   . HOH D 2 .  ? 23.981 57.654 -3.186  1.00 15.53 ? 132 HOH B O   1 
HETATM 1672 O O   . HOH D 2 .  ? 16.724 52.211 -7.533  1.00 14.28 ? 133 HOH B O   1 
HETATM 1673 O O   . HOH D 2 .  ? 33.006 31.836 -14.748 1.00 11.99 ? 134 HOH B O   1 
HETATM 1674 O O   . HOH D 2 .  ? 31.303 31.114 -12.320 1.00 17.46 ? 135 HOH B O   1 
HETATM 1675 O O   . HOH D 2 .  ? 22.829 34.830 -16.969 1.00 12.65 ? 136 HOH B O   1 
HETATM 1676 O O   . HOH D 2 .  ? 21.251 56.549 1.112   1.00 21.22 ? 137 HOH B O   1 
HETATM 1677 O O   . HOH D 2 .  ? 12.604 26.122 -19.877 1.00 17.73 ? 138 HOH B O   1 
HETATM 1678 O O   . HOH D 2 .  ? 17.805 36.235 -22.853 1.00 30.23 ? 139 HOH B O   1 
HETATM 1679 O O   . HOH D 2 .  ? 12.785 28.155 -24.919 1.00 21.26 ? 140 HOH B O   1 
HETATM 1680 O O   . HOH D 2 .  ? 33.992 38.641 -2.138  1.00 22.15 ? 141 HOH B O   1 
HETATM 1681 O O   . HOH D 2 .  ? 20.346 50.023 -14.855 1.00 15.64 ? 142 HOH B O   1 
HETATM 1682 O O   . HOH D 2 .  ? 14.601 55.038 -4.997  1.00 15.84 ? 143 HOH B O   1 
HETATM 1683 O O   . HOH D 2 .  ? 11.948 32.691 -2.935  1.00 16.98 ? 144 HOH B O   1 
HETATM 1684 O O   . HOH D 2 .  ? 19.052 47.187 -17.664 1.00 19.53 ? 145 HOH B O   1 
HETATM 1685 O O   . HOH D 2 .  ? 25.209 26.170 -18.954 1.00 16.42 ? 146 HOH B O   1 
HETATM 1686 O O   . HOH D 2 .  ? 32.570 41.019 -2.312  1.00 23.45 ? 147 HOH B O   1 
HETATM 1687 O O   . HOH D 2 .  ? 17.128 53.602 -10.458 1.00 19.03 ? 148 HOH B O   1 
HETATM 1688 O O   . HOH D 2 .  ? 33.075 31.362 -0.961  1.00 18.33 ? 149 HOH B O   1 
HETATM 1689 O O   . HOH D 2 .  ? 20.054 58.080 -1.200  1.00 12.54 ? 150 HOH B O   1 
HETATM 1690 O O   . HOH D 2 .  ? 15.047 53.870 2.602   1.00 17.17 ? 151 HOH B O   1 
HETATM 1691 O O   . HOH D 2 .  ? 28.144 54.250 -8.169  1.00 20.93 ? 152 HOH B O   1 
HETATM 1692 O O   . HOH D 2 .  ? 16.483 23.533 -13.023 1.00 10.53 ? 153 HOH B O   1 
HETATM 1693 O O   . HOH D 2 .  ? 12.996 38.869 -10.041 1.00 33.97 ? 154 HOH B O   1 
HETATM 1694 O O   . HOH D 2 .  ? 32.547 26.788 -2.476  1.00 22.60 ? 155 HOH B O   1 
HETATM 1695 O O   . HOH D 2 .  ? 29.382 47.468 -1.942  1.00 13.81 ? 156 HOH B O   1 
HETATM 1696 O O   . HOH D 2 .  ? 28.945 42.452 3.099   1.00 7.23  ? 157 HOH B O   1 
HETATM 1697 O O   . HOH D 2 .  ? 19.570 52.626 -13.918 1.00 17.84 ? 158 HOH B O   1 
HETATM 1698 O O   . HOH D 2 .  ? 34.172 33.782 7.081   1.00 22.19 ? 159 HOH B O   1 
HETATM 1699 O O   . HOH D 2 .  ? 17.326 54.937 3.836   1.00 22.47 ? 160 HOH B O   1 
HETATM 1700 O O   . HOH D 2 .  ? 28.339 51.094 -17.757 1.00 26.07 ? 161 HOH B O   1 
HETATM 1701 O O   . HOH D 2 .  ? 10.372 44.891 0.911   1.00 26.13 ? 162 HOH B O   1 
HETATM 1702 O O   . HOH D 2 .  ? 23.147 54.879 -0.463  1.00 27.56 ? 163 HOH B O   1 
HETATM 1703 O O   . HOH D 2 .  ? 11.031 37.474 -3.224  1.00 18.59 ? 164 HOH B O   1 
HETATM 1704 O O   . HOH D 2 .  ? 28.638 45.195 2.299   1.00 11.93 ? 165 HOH B O   1 
HETATM 1705 O O   . HOH D 2 .  ? 11.350 53.421 -1.531  1.00 20.72 ? 166 HOH B O   1 
HETATM 1706 O O   . HOH D 2 .  ? 13.535 43.814 3.882   1.00 23.48 ? 167 HOH B O   1 
HETATM 1707 O O   . HOH D 2 .  ? 30.738 45.687 -4.836  1.00 25.14 ? 168 HOH B O   1 
HETATM 1708 O O   . HOH D 2 .  ? 10.518 40.027 -1.912  1.00 19.39 ? 169 HOH B O   1 
HETATM 1709 O O   . HOH D 2 .  ? 25.472 51.989 -14.874 1.00 15.67 ? 170 HOH B O   1 
HETATM 1710 O O   . HOH D 2 .  ? 27.024 19.599 -11.657 1.00 23.87 ? 171 HOH B O   1 
HETATM 1711 O O   . HOH D 2 .  ? 34.013 29.100 -2.206  1.00 22.59 ? 172 HOH B O   1 
HETATM 1712 O O   . HOH D 2 .  ? 27.175 52.641 -5.551  1.00 17.87 ? 173 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 2  ? 0.4498 0.3754 0.7163 -0.0010 0.1752  0.0542  2  ALA A N   
2    C CA  . ALA A 2  ? 0.4134 0.3605 0.6922 0.0020  0.1504  0.0556  2  ALA A CA  
3    C C   . ALA A 2  ? 0.3832 0.3354 0.6415 0.0002  0.1298  0.0567  2  ALA A C   
4    O O   . ALA A 2  ? 0.4065 0.3669 0.6800 -0.0016 0.1253  0.0600  2  ALA A O   
5    C CB  . ALA A 2  ? 0.4068 0.3760 0.7408 0.0045  0.1472  0.0599  2  ALA A CB  
6    N N   . ARG A 3  ? 0.3340 0.2807 0.5599 0.0004  0.1180  0.0539  3  ARG A N   
7    C CA  . ARG A 3  ? 0.2897 0.2411 0.4993 -0.0007 0.0999  0.0544  3  ARG A CA  
8    C C   . ARG A 3  ? 0.2261 0.1960 0.4490 0.0015  0.0820  0.0547  3  ARG A C   
9    O O   . ARG A 3  ? 0.2076 0.1783 0.4271 0.0033  0.0798  0.0528  3  ARG A O   
10   C CB  . ARG A 3  ? 0.3095 0.2409 0.4757 -0.0027 0.0980  0.0516  3  ARG A CB  
11   C CG  . ARG A 3  ? 0.3573 0.2644 0.4994 -0.0064 0.1133  0.0513  3  ARG A CG  
12   C CD  . ARG A 3  ? 0.3850 0.2695 0.4827 -0.0088 0.1082  0.0490  3  ARG A CD  
13   N NE  . ARG A 3  ? 0.4293 0.2924 0.5007 -0.0134 0.1129  0.0501  3  ARG A NE  
14   C CZ  . ARG A 3  ? 0.4779 0.3143 0.5267 -0.0176 0.1320  0.0493  3  ARG A CZ  
15   N NH1 . ARG A 3  ? 0.4630 0.2912 0.5135 -0.0171 0.1490  0.0468  3  ARG A NH1 
16   N NH2 . ARG A 3  ? 0.4769 0.2927 0.4997 -0.0225 0.1345  0.0508  3  ARG A NH2 
17   N N   . PRO A 4  ? 0.1862 0.1679 0.4194 0.0009  0.0692  0.0568  4  PRO A N   
18   C CA  . PRO A 4  ? 0.1783 0.1746 0.4246 0.0019  0.0545  0.0574  4  PRO A CA  
19   C C   . PRO A 4  ? 0.1486 0.1428 0.3711 0.0029  0.0465  0.0538  4  PRO A C   
20   O O   . PRO A 4  ? 0.1600 0.1616 0.3900 0.0037  0.0403  0.0534  4  PRO A O   
21   C CB  . PRO A 4  ? 0.1842 0.1874 0.4382 0.0001  0.0444  0.0598  4  PRO A CB  
22   C CG  . PRO A 4  ? 0.2391 0.2330 0.4873 -0.0016 0.0539  0.0608  4  PRO A CG  
23   C CD  . PRO A 4  ? 0.2120 0.1929 0.4511 -0.0014 0.0709  0.0595  4  PRO A CD  
24   N N   . LEU A 5  ? 0.1361 0.1202 0.3319 0.0023  0.0452  0.0515  5  LEU A N   
25   C CA  . LEU A 5  ? 0.1141 0.0974 0.2931 0.0029  0.0370  0.0486  5  LEU A CA  
26   C C   . LEU A 5  ? 0.1230 0.0993 0.2951 0.0036  0.0436  0.0469  5  LEU A C   
27   O O   . LEU A 5  ? 0.1104 0.0919 0.2810 0.0042  0.0368  0.0453  5  LEU A O   
28   C CB  . LEU A 5  ? 0.1368 0.1110 0.2936 0.0021  0.0314  0.0474  5  LEU A CB  
29   C CG  . LEU A 5  ? 0.1460 0.1237 0.2945 0.0028  0.0211  0.0448  5  LEU A CG  
30   C CD1 . LEU A 5  ? 0.1825 0.1764 0.3474 0.0034  0.0130  0.0443  5  LEU A CD1 
31   C CD2 . LEU A 5  ? 0.1852 0.1519 0.3148 0.0021  0.0148  0.0443  5  LEU A CD2 
32   N N   . GLU A 6  ? 0.1283 0.0908 0.2935 0.0031  0.0574  0.0469  6  GLU A N   
33   C CA  . GLU A 6  ? 0.1488 0.1014 0.3059 0.0036  0.0657  0.0449  6  GLU A CA  
34   C C   . GLU A 6  ? 0.1301 0.0967 0.3137 0.0058  0.0647  0.0457  6  GLU A C   
35   O O   . GLU A 6  ? 0.1412 0.1075 0.3190 0.0065  0.0611  0.0439  6  GLU A O   
36   C CB  . GLU A 6  ? 0.1926 0.1261 0.3392 0.0023  0.0839  0.0444  6  GLU A CB  
37   C CG  . GLU A 6  ? 0.2340 0.1454 0.3430 -0.0011 0.0836  0.0433  6  GLU A CG  
38   C CD  . GLU A 6  ? 0.3204 0.2067 0.4110 -0.0038 0.1033  0.0424  6  GLU A CD  
39   O OE1 . GLU A 6  ? 0.3798 0.2686 0.4927 -0.0025 0.1194  0.0426  6  GLU A OE1 
40   O OE2 . GLU A 6  ? 0.3630 0.2254 0.4173 -0.0078 0.1033  0.0417  6  GLU A OE2 
41   N N   . GLN A 7  ? 0.1213 0.0995 0.3346 0.0066  0.0662  0.0488  7  GLN A N   
42   C CA  . GLN A 7  ? 0.1288 0.1184 0.3686 0.0082  0.0628  0.0506  7  GLN A CA  
43   C C   . GLN A 7  ? 0.0991 0.0984 0.3348 0.0075  0.0461  0.0503  7  GLN A C   
44   O O   . GLN A 7  ? 0.0926 0.0944 0.3322 0.0081  0.0423  0.0500  7  GLN A O   
45   C CB  . GLN A 7  ? 0.1432 0.1425 0.4165 0.0082  0.0640  0.0550  7  GLN A CB  
46   C CG  . GLN A 7  ? 0.2238 0.2147 0.5064 0.0086  0.0827  0.0553  7  GLN A CG  
47   C CD  . GLN A 7  ? 0.2791 0.2806 0.5988 0.0083  0.0832  0.0600  7  GLN A CD  
48   O OE1 . GLN A 7  ? 0.3541 0.3658 0.7054 0.0095  0.0777  0.0631  7  GLN A OE1 
49   N NE2 . GLN A 7  ? 0.3679 0.3658 0.6860 0.0063  0.0898  0.0610  7  GLN A NE2 
50   N N   . ALA A 8  ? 0.0979 0.1010 0.3241 0.0059  0.0370  0.0501  8  ALA A N   
51   C CA  . ALA A 8  ? 0.0856 0.0959 0.3068 0.0047  0.0239  0.0493  8  ALA A CA  
52   C C   . ALA A 8  ? 0.0969 0.1024 0.2989 0.0049  0.0230  0.0459  8  ALA A C   
53   O O   . ALA A 8  ? 0.0879 0.0978 0.2915 0.0041  0.0168  0.0455  8  ALA A O   
54   C CB  . ALA A 8  ? 0.0982 0.1113 0.3128 0.0033  0.0171  0.0490  8  ALA A CB  
55   N N   . VAL A 9  ? 0.0923 0.0877 0.2750 0.0050  0.0273  0.0437  9  VAL A N   
56   C CA  . VAL A 9  ? 0.0988 0.0892 0.2643 0.0045  0.0238  0.0410  9  VAL A CA  
57   C C   . VAL A 9  ? 0.0966 0.0822 0.2638 0.0052  0.0295  0.0405  9  VAL A C   
58   O O   . VAL A 9  ? 0.1044 0.0922 0.2684 0.0045  0.0243  0.0393  9  VAL A O   
59   C CB  . VAL A 9  ? 0.1107 0.0891 0.2548 0.0036  0.0236  0.0396  9  VAL A CB  
60   C CG1 . VAL A 9  ? 0.1453 0.1179 0.2742 0.0024  0.0180  0.0375  9  VAL A CG1 
61   C CG2 . VAL A 9  ? 0.1353 0.1202 0.2818 0.0034  0.0163  0.0400  9  VAL A CG2 
62   N N   . ALA A 10 ? 0.1038 0.0827 0.2780 0.0066  0.0412  0.0415  10 ALA A N   
63   C CA  . ALA A 10 ? 0.1054 0.0801 0.2855 0.0079  0.0472  0.0410  10 ALA A CA  
64   C C   . ALA A 10 ? 0.0902 0.0782 0.2906 0.0082  0.0385  0.0430  10 ALA A C   
65   O O   . ALA A 10 ? 0.0962 0.0821 0.2936 0.0082  0.0365  0.0420  10 ALA A O   
66   C CB  . ALA A 10 ? 0.1313 0.0984 0.3235 0.0097  0.0632  0.0418  10 ALA A CB  
67   N N   . ALA A 11 ? 0.0768 0.0759 0.2947 0.0077  0.0322  0.0460  11 ALA A N   
68   C CA  . ALA A 11 ? 0.0846 0.0922 0.3168 0.0065  0.0216  0.0484  11 ALA A CA  
69   C C   . ALA A 11 ? 0.0783 0.0874 0.2932 0.0039  0.0125  0.0463  11 ALA A C   
70   O O   . ALA A 11 ? 0.0915 0.1010 0.3084 0.0026  0.0071  0.0470  11 ALA A O   
71   C CB  . ALA A 11 ? 0.0995 0.1147 0.3505 0.0054  0.0157  0.0523  11 ALA A CB  
72   N N   . ILE A 12 ? 0.0780 0.0874 0.2768 0.0028  0.0108  0.0438  12 ILE A N   
73   C CA  A ILE A 12 ? 0.0790 0.0904 0.2655 0.0004  0.0043  0.0414  12 ILE A CA  
74   C CA  B ILE A 12 ? 0.0889 0.1005 0.2761 0.0003  0.0040  0.0416  12 ILE A CA  
75   C C   . ILE A 12 ? 0.0843 0.0899 0.2619 0.0003  0.0060  0.0397  12 ILE A C   
76   O O   . ILE A 12 ? 0.0810 0.0882 0.2558 -0.0021 0.0011  0.0392  12 ILE A O   
77   C CB  A ILE A 12 ? 0.0837 0.0962 0.2608 0.0002  0.0032  0.0394  12 ILE A CB  
78   C CB  B ILE A 12 ? 0.0992 0.1138 0.2776 -0.0007 0.0010  0.0394  12 ILE A CB  
79   C CG1 A ILE A 12 ? 0.0961 0.1142 0.2809 -0.0008 -0.0004 0.0408  12 ILE A CG1 
80   C CG1 B ILE A 12 ? 0.1334 0.1416 0.2998 0.0007  0.0043  0.0376  12 ILE A CG1 
81   C CG2 A ILE A 12 ? 0.0632 0.0769 0.2310 -0.0017 -0.0008 0.0366  12 ILE A CG2 
82   C CG2 B ILE A 12 ? 0.1168 0.1354 0.3034 -0.0011 -0.0010 0.0412  12 ILE A CG2 
83   C CD1 A ILE A 12 ? 0.1220 0.1407 0.3020 -0.0001 -0.0006 0.0394  12 ILE A CD1 
84   C CD1 B ILE A 12 ? 0.1364 0.1477 0.2980 0.0000  -0.0005 0.0357  12 ILE A CD1 
85   N N   . VAL A 13 ? 0.0889 0.0851 0.2598 0.0023  0.0137  0.0388  13 VAL A N   
86   C CA  . VAL A 13 ? 0.0983 0.0858 0.2580 0.0019  0.0153  0.0370  13 VAL A CA  
87   C C   . VAL A 13 ? 0.0983 0.0863 0.2719 0.0029  0.0165  0.0388  13 VAL A C   
88   O O   . VAL A 13 ? 0.1058 0.0922 0.2746 0.0013  0.0125  0.0381  13 VAL A O   
89   C CB  . VAL A 13 ? 0.1109 0.0831 0.2552 0.0029  0.0239  0.0353  13 VAL A CB  
90   C CG1 . VAL A 13 ? 0.1326 0.0928 0.2647 0.0023  0.0262  0.0335  13 VAL A CG1 
91   C CG2 . VAL A 13 ? 0.1237 0.0928 0.2533 0.0015  0.0198  0.0343  13 VAL A CG2 
92   N N   . CYS A 14 ? 0.0885 0.0788 0.2813 0.0053  0.0207  0.0414  14 CYS A N   
93   C CA  A CYS A 14 ? 0.0922 0.0825 0.3022 0.0065  0.0202  0.0438  14 CYS A CA  
94   C CA  B CYS A 14 ? 0.1078 0.0986 0.3188 0.0065  0.0199  0.0440  14 CYS A CA  
95   C C   . CYS A 14 ? 0.0926 0.0885 0.3031 0.0030  0.0074  0.0455  14 CYS A C   
96   O O   . CYS A 14 ? 0.0965 0.0883 0.3064 0.0023  0.0049  0.0458  14 CYS A O   
97   C CB  A CYS A 14 ? 0.0876 0.0814 0.3228 0.0092  0.0252  0.0469  14 CYS A CB  
98   C CB  B CYS A 14 ? 0.1107 0.1065 0.3477 0.0086  0.0226  0.0476  14 CYS A CB  
99   S SG  A CYS A 14 ? 0.1010 0.0956 0.3663 0.0113  0.0234  0.0509  14 CYS A SG  
100  S SG  B CYS A 14 ? 0.2080 0.1948 0.4547 0.0129  0.0411  0.0464  14 CYS A SG  
101  N N   . THR A 15 ? 0.0885 0.0912 0.2971 0.0001  0.0001  0.0464  15 THR A N   
102  C CA  . THR A 15 ? 0.1156 0.1194 0.3200 -0.0043 -0.0101 0.0477  15 THR A CA  
103  C C   . THR A 15 ? 0.1019 0.1029 0.2882 -0.0067 -0.0102 0.0444  15 THR A C   
104  O O   . THR A 15 ? 0.1206 0.1180 0.3035 -0.0096 -0.0150 0.0453  15 THR A O   
105  C CB  . THR A 15 ? 0.1071 0.1151 0.3086 -0.0072 -0.0153 0.0483  15 THR A CB  
106  O OG1 . THR A 15 ? 0.1501 0.1603 0.3699 -0.0057 -0.0167 0.0520  15 THR A OG1 
107  C CG2 . THR A 15 ? 0.1364 0.1410 0.3282 -0.0130 -0.0241 0.0492  15 THR A CG2 
108  N N   . PHE A 16 ? 0.0978 0.0996 0.2730 -0.0061 -0.0058 0.0409  16 PHE A N   
109  C CA  . PHE A 16 ? 0.1012 0.1007 0.2632 -0.0087 -0.0070 0.0382  16 PHE A CA  
110  C C   . PHE A 16 ? 0.1164 0.1080 0.2772 -0.0079 -0.0055 0.0385  16 PHE A C   
111  O O   . PHE A 16 ? 0.1133 0.1029 0.2685 -0.0113 -0.0094 0.0383  16 PHE A O   
112  C CB  . PHE A 16 ? 0.0945 0.0945 0.2481 -0.0080 -0.0046 0.0353  16 PHE A CB  
113  C CG  . PHE A 16 ? 0.0978 0.0966 0.2424 -0.0110 -0.0074 0.0331  16 PHE A CG  
114  C CD1 . PHE A 16 ? 0.0744 0.0803 0.2205 -0.0146 -0.0104 0.0320  16 PHE A CD1 
115  C CD2 . PHE A 16 ? 0.1144 0.1036 0.2493 -0.0108 -0.0065 0.0321  16 PHE A CD2 
116  C CE1 . PHE A 16 ? 0.0996 0.1059 0.2423 -0.0178 -0.0126 0.0302  16 PHE A CE1 
117  C CE2 . PHE A 16 ? 0.1214 0.1099 0.2502 -0.0145 -0.0109 0.0305  16 PHE A CE2 
118  C CZ  . PHE A 16 ? 0.1149 0.1133 0.2501 -0.0178 -0.0140 0.0298  16 PHE A CZ  
119  N N   . GLN A 17 ? 0.1243 0.1099 0.2890 -0.0038 0.0013  0.0386  17 GLN A N   
120  C CA  . GLN A 17 ? 0.1372 0.1127 0.3008 -0.0023 0.0049  0.0383  17 GLN A CA  
121  C C   . GLN A 17 ? 0.1521 0.1287 0.3276 -0.0035 -0.0015 0.0415  17 GLN A C   
122  O O   . GLN A 17 ? 0.1574 0.1276 0.3272 -0.0050 -0.0036 0.0412  17 GLN A O   
123  C CB  . GLN A 17 ? 0.1836 0.1520 0.3532 0.0024  0.0160  0.0378  17 GLN A CB  
124  C CG  . GLN A 17 ? 0.2776 0.2337 0.4485 0.0047  0.0226  0.0370  17 GLN A CG  
125  C CD  . GLN A 17 ? 0.3801 0.3246 0.5499 0.0085  0.0375  0.0350  17 GLN A CD  
126  O OE1 . GLN A 17 ? 0.4712 0.4184 0.6436 0.0095  0.0424  0.0352  17 GLN A OE1 
127  N NE2 . GLN A 17 ? 0.4645 0.3940 0.6280 0.0101  0.0457  0.0328  17 GLN A NE2 
128  N N   . GLU A 18 ? 0.1362 0.1187 0.3276 -0.0031 -0.0055 0.0450  18 GLU A N   
129  C CA  . GLU A 18 ? 0.1467 0.1276 0.3492 -0.0049 -0.0146 0.0493  18 GLU A CA  
130  C C   . GLU A 18 ? 0.1304 0.1087 0.3157 -0.0112 -0.0222 0.0490  18 GLU A C   
131  O O   . GLU A 18 ? 0.1833 0.1545 0.3683 -0.0127 -0.0268 0.0507  18 GLU A O   
132  C CB  . GLU A 18 ? 0.1633 0.1495 0.3822 -0.0051 -0.0204 0.0534  18 GLU A CB  
133  C CG  . GLU A 18 ? 0.2723 0.2542 0.5004 -0.0084 -0.0335 0.0588  18 GLU A CG  
134  C CD  . GLU A 18 ? 0.3399 0.3263 0.5857 -0.0083 -0.0391 0.0628  18 GLU A CD  
135  O OE1 . GLU A 18 ? 0.3726 0.3657 0.6182 -0.0067 -0.0327 0.0608  18 GLU A OE1 
136  O OE2 . GLU A 18 ? 0.4577 0.4396 0.7171 -0.0104 -0.0512 0.0684  18 GLU A OE2 
137  N N   . TYR A 19 ? 0.1164 0.0992 0.2874 -0.0149 -0.0225 0.0465  19 TYR A N   
138  C CA  . TYR A 19 ? 0.1294 0.1094 0.2853 -0.0214 -0.0269 0.0458  19 TYR A CA  
139  C C   . TYR A 19 ? 0.1243 0.1024 0.2702 -0.0221 -0.0231 0.0424  19 TYR A C   
140  O O   . TYR A 19 ? 0.1318 0.1035 0.2704 -0.0260 -0.0263 0.0430  19 TYR A O   
141  C CB  . TYR A 19 ? 0.1348 0.1198 0.2842 -0.0250 -0.0274 0.0446  19 TYR A CB  
142  C CG  . TYR A 19 ? 0.1403 0.1213 0.2927 -0.0274 -0.0347 0.0485  19 TYR A CG  
143  C CD1 . TYR A 19 ? 0.1209 0.1055 0.2889 -0.0231 -0.0358 0.0509  19 TYR A CD1 
144  C CD2 . TYR A 19 ? 0.1814 0.1525 0.3193 -0.0349 -0.0412 0.0502  19 TYR A CD2 
145  C CE1 . TYR A 19 ? 0.1596 0.1392 0.3318 -0.0260 -0.0451 0.0554  19 TYR A CE1 
146  C CE2 . TYR A 19 ? 0.1828 0.1463 0.3202 -0.0381 -0.0503 0.0544  19 TYR A CE2 
147  C CZ  . TYR A 19 ? 0.1855 0.1539 0.3411 -0.0335 -0.0530 0.0571  19 TYR A CZ  
148  O OH  . TYR A 19 ? 0.2522 0.2124 0.4092 -0.0371 -0.0642 0.0619  19 TYR A OH  
149  N N   . ALA A 20 ? 0.1262 0.1081 0.2704 -0.0193 -0.0175 0.0393  20 ALA A N   
150  C CA  . ALA A 20 ? 0.1213 0.1001 0.2554 -0.0211 -0.0164 0.0366  20 ALA A CA  
151  C C   . ALA A 20 ? 0.1386 0.1068 0.2706 -0.0191 -0.0151 0.0369  20 ALA A C   
152  O O   . ALA A 20 ? 0.1452 0.1082 0.2680 -0.0224 -0.0169 0.0357  20 ALA A O   
153  C CB  . ALA A 20 ? 0.1319 0.1147 0.2638 -0.0191 -0.0133 0.0339  20 ALA A CB  
154  N N   . GLY A 21 ? 0.1510 0.1151 0.2928 -0.0141 -0.0119 0.0385  21 GLY A N   
155  C CA  . GLY A 21 ? 0.1539 0.1067 0.2955 -0.0115 -0.0087 0.0382  21 GLY A CA  
156  C C   . GLY A 21 ? 0.1505 0.0991 0.2964 -0.0137 -0.0151 0.0412  21 GLY A C   
157  O O   . GLY A 21 ? 0.1775 0.1159 0.3251 -0.0116 -0.0133 0.0413  21 GLY A O   
158  N N   . ARG A 22 ? 0.1320 0.0856 0.2782 -0.0184 -0.0229 0.0437  22 ARG A N   
159  C CA  . ARG A 22 ? 0.1467 0.0928 0.2931 -0.0217 -0.0307 0.0472  22 ARG A CA  
160  C C   . ARG A 22 ? 0.1347 0.0723 0.2684 -0.0245 -0.0308 0.0455  22 ARG A C   
161  O O   . ARG A 22 ? 0.1547 0.0827 0.2923 -0.0231 -0.0330 0.0473  22 ARG A O   
162  C CB  . ARG A 22 ? 0.1437 0.0911 0.2832 -0.0284 -0.0383 0.0496  22 ARG A CB  
163  C CG  . ARG A 22 ? 0.1563 0.1076 0.3077 -0.0269 -0.0420 0.0527  22 ARG A CG  
164  C CD  . ARG A 22 ? 0.2104 0.1587 0.3468 -0.0350 -0.0480 0.0539  22 ARG A CD  
165  N NE  . ARG A 22 ? 0.2085 0.1565 0.3527 -0.0351 -0.0544 0.0576  22 ARG A NE  
166  C CZ  . ARG A 22 ? 0.2109 0.1535 0.3402 -0.0421 -0.0591 0.0585  22 ARG A CZ  
167  N NH1 . ARG A 22 ? 0.2397 0.1770 0.3473 -0.0493 -0.0564 0.0561  22 ARG A NH1 
168  N NH2 . ARG A 22 ? 0.2480 0.1886 0.3843 -0.0422 -0.0663 0.0622  22 ARG A NH2 
169  N N   . CYS A 23 ? 0.1561 0.0968 0.2765 -0.0287 -0.0290 0.0424  23 CYS A N   
170  C CA  . CYS A 23 ? 0.1671 0.1002 0.2759 -0.0328 -0.0303 0.0412  23 CYS A CA  
171  C C   . CYS A 23 ? 0.1706 0.1096 0.2719 -0.0357 -0.0279 0.0377  23 CYS A C   
172  O O   . CYS A 23 ? 0.1646 0.1139 0.2692 -0.0360 -0.0263 0.0368  23 CYS A O   
173  C CB  . CYS A 23 ? 0.1726 0.0994 0.2748 -0.0397 -0.0373 0.0443  23 CYS A CB  
174  S SG  . CYS A 23 ? 0.2088 0.1427 0.3046 -0.0472 -0.0385 0.0447  23 CYS A SG  
175  N N   . GLY A 24 ? 0.1783 0.1101 0.2705 -0.0384 -0.0288 0.0362  24 GLY A N   
176  C CA  . GLY A 24 ? 0.1551 0.0924 0.2436 -0.0421 -0.0291 0.0337  24 GLY A CA  
177  C C   . GLY A 24 ? 0.1720 0.1104 0.2604 -0.0374 -0.0265 0.0317  24 GLY A C   
178  O O   . GLY A 24 ? 0.1818 0.1113 0.2670 -0.0319 -0.0227 0.0311  24 GLY A O   
179  N N   . ASP A 25 ? 0.1647 0.1128 0.2568 -0.0399 -0.0280 0.0306  25 ASP A N   
180  C CA  . ASP A 25 ? 0.1638 0.1109 0.2535 -0.0369 -0.0280 0.0291  25 ASP A CA  
181  C C   . ASP A 25 ? 0.1607 0.1127 0.2561 -0.0310 -0.0229 0.0295  25 ASP A C   
182  O O   . ASP A 25 ? 0.1578 0.1219 0.2634 -0.0311 -0.0221 0.0302  25 ASP A O   
183  C CB  . ASP A 25 ? 0.1699 0.1277 0.2679 -0.0413 -0.0324 0.0285  25 ASP A CB  
184  C CG  . ASP A 25 ? 0.2032 0.1583 0.2983 -0.0396 -0.0359 0.0277  25 ASP A CG  
185  O OD1 . ASP A 25 ? 0.1913 0.1387 0.2778 -0.0348 -0.0328 0.0274  25 ASP A OD1 
186  O OD2 . ASP A 25 ? 0.2617 0.2218 0.3644 -0.0435 -0.0424 0.0277  25 ASP A OD2 
187  N N   . LYS A 26 ? 0.1627 0.1035 0.2505 -0.0265 -0.0188 0.0288  26 LYS A N   
188  C CA  . LYS A 26 ? 0.1654 0.1095 0.2602 -0.0210 -0.0128 0.0294  26 LYS A CA  
189  C C   . LYS A 26 ? 0.1596 0.1124 0.2573 -0.0206 -0.0139 0.0289  26 LYS A C   
190  O O   . LYS A 26 ? 0.1631 0.1206 0.2679 -0.0168 -0.0098 0.0296  26 LYS A O   
191  C CB  . LYS A 26 ? 0.2190 0.1464 0.3048 -0.0168 -0.0052 0.0282  26 LYS A CB  
192  C CG  . LYS A 26 ? 0.2639 0.1769 0.3294 -0.0182 -0.0055 0.0260  26 LYS A CG  
193  C CD  . LYS A 26 ? 0.3683 0.2575 0.4156 -0.0163 0.0028  0.0239  26 LYS A CD  
194  C CE  . LYS A 26 ? 0.4203 0.3061 0.4750 -0.0106 0.0154  0.0236  26 LYS A CE  
195  N NZ  . LYS A 26 ? 0.4782 0.3359 0.5068 -0.0109 0.0240  0.0205  26 LYS A NZ  
196  N N   . TYR A 27 ? 0.1645 0.1201 0.2598 -0.0244 -0.0201 0.0281  27 TYR A N   
197  C CA  . TYR A 27 ? 0.1679 0.1320 0.2691 -0.0238 -0.0223 0.0279  27 TYR A CA  
198  C C   . TYR A 27 ? 0.1799 0.1609 0.2971 -0.0260 -0.0238 0.0280  27 TYR A C   
199  O O   . TYR A 27 ? 0.2002 0.1890 0.3254 -0.0254 -0.0254 0.0276  27 TYR A O   
200  C CB  . TYR A 27 ? 0.1949 0.1484 0.2846 -0.0261 -0.0292 0.0274  27 TYR A CB  
201  C CG  . TYR A 27 ? 0.2217 0.1530 0.2890 -0.0252 -0.0268 0.0267  27 TYR A CG  
202  C CD1 . TYR A 27 ? 0.2330 0.1566 0.2932 -0.0209 -0.0184 0.0264  27 TYR A CD1 
203  C CD2 . TYR A 27 ? 0.2764 0.1930 0.3292 -0.0293 -0.0321 0.0262  27 TYR A CD2 
204  C CE1 . TYR A 27 ? 0.2880 0.1869 0.3245 -0.0208 -0.0133 0.0251  27 TYR A CE1 
205  C CE2 . TYR A 27 ? 0.3478 0.2401 0.3760 -0.0293 -0.0289 0.0250  27 TYR A CE2 
206  C CZ  . TYR A 27 ? 0.3309 0.2137 0.3503 -0.0251 -0.0187 0.0242  27 TYR A CZ  
207  O OH  . TYR A 27 ? 0.3901 0.2451 0.3825 -0.0257 -0.0128 0.0223  27 TYR A OH  
208  N N   . LYS A 28 ? 0.1764 0.1614 0.2976 -0.0290 -0.0227 0.0284  28 LYS A N   
209  C CA  . LYS A 28 ? 0.1720 0.1689 0.3044 -0.0323 -0.0216 0.0279  28 LYS A CA  
210  C C   . LYS A 28 ? 0.1754 0.1728 0.3069 -0.0333 -0.0183 0.0291  28 LYS A C   
211  O O   . LYS A 28 ? 0.1788 0.1683 0.3042 -0.0325 -0.0187 0.0307  28 LYS A O   
212  C CB  . LYS A 28 ? 0.2145 0.2130 0.3506 -0.0381 -0.0242 0.0272  28 LYS A CB  
213  C CG  . LYS A 28 ? 0.2632 0.2568 0.3978 -0.0388 -0.0311 0.0270  28 LYS A CG  
214  C CD  . LYS A 28 ? 0.4004 0.4018 0.5496 -0.0441 -0.0339 0.0264  28 LYS A CD  
215  C CE  . LYS A 28 ? 0.4240 0.4357 0.5893 -0.0421 -0.0349 0.0258  28 LYS A CE  
216  N NZ  . LYS A 28 ? 0.4544 0.4578 0.6129 -0.0393 -0.0436 0.0267  28 LYS A NZ  
217  N N   . LEU A 29 ? 0.1669 0.1716 0.3041 -0.0353 -0.0153 0.0283  29 LEU A N   
218  C CA  . LEU A 29 ? 0.1481 0.1494 0.2799 -0.0389 -0.0135 0.0294  29 LEU A CA  
219  C C   . LEU A 29 ? 0.1658 0.1696 0.2989 -0.0454 -0.0093 0.0275  29 LEU A C   
220  O O   . LEU A 29 ? 0.1788 0.1905 0.3232 -0.0458 -0.0075 0.0252  29 LEU A O   
221  C CB  . LEU A 29 ? 0.1548 0.1589 0.2886 -0.0366 -0.0118 0.0297  29 LEU A CB  
222  C CG  . LEU A 29 ? 0.1367 0.1400 0.2730 -0.0304 -0.0140 0.0316  29 LEU A CG  
223  C CD1 . LEU A 29 ? 0.1829 0.1899 0.3225 -0.0290 -0.0127 0.0317  29 LEU A CD1 
224  C CD2 . LEU A 29 ? 0.2165 0.2112 0.3492 -0.0304 -0.0174 0.0348  29 LEU A CD2 
225  N N   A CYS A 30 ? 0.2007 0.1961 0.3227 -0.0511 -0.0081 0.0285  30 CYS A N   
226  N N   B CYS A 30 ? 0.2003 0.1963 0.3229 -0.0511 -0.0076 0.0283  30 CYS A N   
227  C CA  A CYS A 30 ? 0.2083 0.2021 0.3272 -0.0584 -0.0008 0.0264  30 CYS A CA  
228  C CA  B CYS A 30 ? 0.2039 0.2013 0.3274 -0.0572 0.0001  0.0257  30 CYS A CA  
229  C C   A CYS A 30 ? 0.2105 0.2038 0.3265 -0.0582 0.0038  0.0251  30 CYS A C   
230  C C   B CYS A 30 ? 0.2079 0.2024 0.3255 -0.0577 0.0040  0.0249  30 CYS A C   
231  O O   A CYS A 30 ? 0.1959 0.1864 0.3080 -0.0544 -0.0013 0.0273  30 CYS A O   
232  O O   B CYS A 30 ? 0.1961 0.1868 0.3084 -0.0544 -0.0012 0.0273  30 CYS A O   
233  C CB  A CYS A 30 ? 0.2276 0.2077 0.3300 -0.0654 -0.0020 0.0285  30 CYS A CB  
234  C CB  B CYS A 30 ? 0.2112 0.1987 0.3230 -0.0651 0.0019  0.0264  30 CYS A CB  
235  S SG  A CYS A 30 ? 0.2532 0.2318 0.3572 -0.0682 -0.0051 0.0293  30 CYS A SG  
236  S SG  B CYS A 30 ? 0.2113 0.1816 0.3010 -0.0683 -0.0032 0.0301  30 CYS A SG  
237  N N   . GLN A 31 ? 0.2192 0.2146 0.3388 -0.0622 0.0138  0.0215  31 GLN A N   
238  C CA  . GLN A 31 ? 0.2312 0.2218 0.3435 -0.0630 0.0189  0.0199  31 GLN A CA  
239  C C   . GLN A 31 ? 0.2306 0.2028 0.3177 -0.0680 0.0143  0.0230  31 GLN A C   
240  O O   . GLN A 31 ? 0.2241 0.1918 0.3049 -0.0664 0.0113  0.0239  31 GLN A O   
241  C CB  . GLN A 31 ? 0.2568 0.2504 0.3777 -0.0665 0.0332  0.0147  31 GLN A CB  
242  C CG  . GLN A 31 ? 0.2816 0.2913 0.4271 -0.0587 0.0341  0.0125  31 GLN A CG  
243  C CD  . GLN A 31 ? 0.3733 0.3916 0.5406 -0.0601 0.0463  0.0078  31 GLN A CD  
244  O OE1 . GLN A 31 ? 0.4239 0.4352 0.5867 -0.0672 0.0585  0.0051  31 GLN A OE1 
245  N NE2 . GLN A 31 ? 0.3803 0.4127 0.5721 -0.0533 0.0431  0.0071  31 GLN A NE2 
246  N N   . ALA A 32 ? 0.2487 0.2094 0.3218 -0.0740 0.0117  0.0252  32 ALA A N   
247  C CA  . ALA A 32 ? 0.2571 0.1985 0.3069 -0.0788 0.0037  0.0293  32 ALA A CA  
248  C C   . ALA A 32 ? 0.2435 0.1882 0.3010 -0.0716 -0.0093 0.0337  32 ALA A C   
249  O O   . ALA A 32 ? 0.2772 0.2107 0.3238 -0.0732 -0.0162 0.0366  32 ALA A O   
250  C CB  . ALA A 32 ? 0.2904 0.2175 0.3238 -0.0867 0.0023  0.0312  32 ALA A CB  
251  N N   . GLU A 33 ? 0.2133 0.1718 0.2894 -0.0641 -0.0120 0.0342  33 GLU A N   
252  C CA  . GLU A 33 ? 0.1687 0.1314 0.2556 -0.0569 -0.0202 0.0375  33 GLU A CA  
253  C C   . GLU A 33 ? 0.1577 0.1285 0.2530 -0.0522 -0.0183 0.0362  33 GLU A C   
254  O O   . GLU A 33 ? 0.1595 0.1275 0.2575 -0.0499 -0.0250 0.0395  33 GLU A O   
255  C CB  . GLU A 33 ? 0.1572 0.1290 0.2578 -0.0507 -0.0211 0.0375  33 GLU A CB  
256  C CG  . GLU A 33 ? 0.1748 0.1365 0.2680 -0.0542 -0.0258 0.0400  33 GLU A CG  
257  C CD  . GLU A 33 ? 0.1980 0.1652 0.2997 -0.0500 -0.0250 0.0390  33 GLU A CD  
258  O OE1 . GLU A 33 ? 0.1862 0.1630 0.2944 -0.0483 -0.0199 0.0356  33 GLU A OE1 
259  O OE2 . GLU A 33 ? 0.2282 0.1874 0.3282 -0.0497 -0.0300 0.0416  33 GLU A OE2 
260  N N   . LEU A 34 ? 0.1648 0.1456 0.2670 -0.0509 -0.0098 0.0318  34 LEU A N   
261  C CA  . LEU A 34 ? 0.1451 0.1321 0.2542 -0.0468 -0.0080 0.0305  34 LEU A CA  
262  C C   . LEU A 34 ? 0.1606 0.1344 0.2537 -0.0523 -0.0087 0.0310  34 LEU A C   
263  O O   . LEU A 34 ? 0.1733 0.1464 0.2685 -0.0497 -0.0136 0.0330  34 LEU A O   
264  C CB  . LEU A 34 ? 0.1363 0.1349 0.2571 -0.0448 0.0002  0.0258  34 LEU A CB  
265  C CG  . LEU A 34 ? 0.1228 0.1270 0.2507 -0.0408 0.0025  0.0241  34 LEU A CG  
266  C CD1 . LEU A 34 ? 0.1285 0.1378 0.2644 -0.0339 -0.0040 0.0271  34 LEU A CD1 
267  C CD2 . LEU A 34 ? 0.1391 0.1536 0.2815 -0.0393 0.0100  0.0197  34 LEU A CD2 
268  N N   . LYS A 35 ? 0.2129 0.1737 0.2879 -0.0607 -0.0041 0.0295  35 LYS A N   
269  C CA  A LYS A 35 ? 0.2285 0.1714 0.2825 -0.0668 -0.0061 0.0303  35 LYS A CA  
270  C CA  B LYS A 35 ? 0.2404 0.1820 0.2927 -0.0676 -0.0059 0.0303  35 LYS A CA  
271  C C   . LYS A 35 ? 0.2410 0.1728 0.2885 -0.0680 -0.0215 0.0369  35 LYS A C   
272  O O   . LYS A 35 ? 0.2543 0.1795 0.2973 -0.0685 -0.0275 0.0389  35 LYS A O   
273  C CB  A LYS A 35 ? 0.2541 0.1801 0.2847 -0.0767 0.0038  0.0270  35 LYS A CB  
274  C CB  B LYS A 35 ? 0.2648 0.1899 0.2945 -0.0777 0.0024  0.0279  35 LYS A CB  
275  C CG  A LYS A 35 ? 0.2623 0.1672 0.2680 -0.0831 0.0027  0.0270  35 LYS A CG  
276  C CG  B LYS A 35 ? 0.3240 0.2213 0.3211 -0.0873 -0.0022 0.0300  35 LYS A CG  
277  C CD  A LYS A 35 ? 0.2910 0.1752 0.2695 -0.0937 0.0155  0.0229  35 LYS A CD  
278  C CD  B LYS A 35 ? 0.4058 0.2847 0.3778 -0.0977 0.0109  0.0260  35 LYS A CD  
279  C CE  A LYS A 35 ? 0.3532 0.2264 0.3189 -0.0961 0.0245  0.0185  35 LYS A CE  
280  C CE  B LYS A 35 ? 0.4405 0.2858 0.3733 -0.1086 0.0041  0.0287  35 LYS A CE  
281  N NZ  A LYS A 35 ? 0.4156 0.2605 0.3468 -0.1079 0.0373  0.0146  35 LYS A NZ  
282  N NZ  B LYS A 35 ? 0.4551 0.2803 0.3646 -0.1177 -0.0012 0.0323  35 LYS A NZ  
283  N N   . GLU A 36 ? 0.2393 0.1702 0.2901 -0.0677 -0.0286 0.0406  36 GLU A N   
284  C CA  . GLU A 36 ? 0.2350 0.1574 0.2872 -0.0677 -0.0436 0.0472  36 GLU A CA  
285  C C   . GLU A 36 ? 0.2001 0.1366 0.2762 -0.0591 -0.0472 0.0490  36 GLU A C   
286  O O   . GLU A 36 ? 0.2159 0.1455 0.2936 -0.0600 -0.0574 0.0532  36 GLU A O   
287  C CB  . GLU A 36 ? 0.2364 0.1586 0.2937 -0.0670 -0.0481 0.0499  36 GLU A CB  
288  C CG  . GLU A 36 ? 0.2368 0.1516 0.3022 -0.0660 -0.0634 0.0569  36 GLU A CG  
289  C CD  . GLU A 36 ? 0.2715 0.1883 0.3476 -0.0631 -0.0667 0.0591  36 GLU A CD  
290  O OE1 . GLU A 36 ? 0.3043 0.2268 0.3781 -0.0626 -0.0576 0.0553  36 GLU A OE1 
291  O OE2 . GLU A 36 ? 0.2673 0.1801 0.3567 -0.0608 -0.0783 0.0647  36 GLU A OE2 
292  N N   . LEU A 37 ? 0.1695 0.1246 0.2646 -0.0511 -0.0395 0.0461  37 LEU A N   
293  C CA  . LEU A 37 ? 0.1513 0.1186 0.2668 -0.0434 -0.0400 0.0470  37 LEU A CA  
294  C C   . LEU A 37 ? 0.1590 0.1239 0.2702 -0.0448 -0.0405 0.0465  37 LEU A C   
295  O O   . LEU A 37 ? 0.1712 0.1356 0.2926 -0.0431 -0.0480 0.0505  37 LEU A O   
296  C CB  . LEU A 37 ? 0.1434 0.1257 0.2703 -0.0370 -0.0303 0.0429  37 LEU A CB  
297  C CG  . LEU A 37 ? 0.1282 0.1208 0.2734 -0.0291 -0.0287 0.0437  37 LEU A CG  
298  C CD1 . LEU A 37 ? 0.1344 0.1342 0.2833 -0.0251 -0.0222 0.0406  37 LEU A CD1 
299  C CD2 . LEU A 37 ? 0.1099 0.1072 0.2575 -0.0275 -0.0263 0.0422  37 LEU A CD2 
300  N N   . LEU A 38 ? 0.1847 0.1487 0.2840 -0.0475 -0.0321 0.0416  38 LEU A N   
301  C CA  . LEU A 38 ? 0.1866 0.1482 0.2820 -0.0480 -0.0311 0.0403  38 LEU A CA  
302  C C   . LEU A 38 ? 0.2263 0.1679 0.3042 -0.0556 -0.0418 0.0443  38 LEU A C   
303  O O   . LEU A 38 ? 0.2416 0.1813 0.3235 -0.0550 -0.0479 0.0466  38 LEU A O   
304  C CB  . LEU A 38 ? 0.1999 0.1636 0.2886 -0.0491 -0.0187 0.0338  38 LEU A CB  
305  C CG  . LEU A 38 ? 0.1783 0.1600 0.2846 -0.0426 -0.0105 0.0303  38 LEU A CG  
306  C CD1 . LEU A 38 ? 0.2043 0.1875 0.3086 -0.0443 0.0011  0.0244  38 LEU A CD1 
307  C CD2 . LEU A 38 ? 0.1934 0.1858 0.3158 -0.0353 -0.0130 0.0317  38 LEU A CD2 
308  N N   . GLN A 39 ? 0.2583 0.1835 0.3164 -0.0632 -0.0455 0.0457  39 GLN A N   
309  C CA  . GLN A 39 ? 0.3149 0.2158 0.3509 -0.0721 -0.0581 0.0501  39 GLN A CA  
310  C C   . GLN A 39 ? 0.2944 0.1959 0.3484 -0.0699 -0.0748 0.0578  39 GLN A C   
311  O O   . GLN A 39 ? 0.3182 0.2069 0.3665 -0.0740 -0.0867 0.0618  39 GLN A O   
312  C CB  . GLN A 39 ? 0.3653 0.2460 0.3721 -0.0816 -0.0565 0.0492  39 GLN A CB  
313  C CG  . GLN A 39 ? 0.4335 0.3112 0.4242 -0.0846 -0.0387 0.0414  39 GLN A CG  
314  C CD  . GLN A 39 ? 0.5189 0.3704 0.4738 -0.0963 -0.0336 0.0396  39 GLN A CD  
315  O OE1 . GLN A 39 ? 0.5702 0.4165 0.5189 -0.0997 -0.0355 0.0414  39 GLN A OE1 
316  N NE2 . GLN A 39 ? 0.5679 0.4008 0.4973 -0.1028 -0.0258 0.0356  39 GLN A NE2 
317  N N   . LYS A 40 ? 0.2585 0.1735 0.3357 -0.0637 -0.0762 0.0600  40 LYS A N   
318  C CA  . LYS A 40 ? 0.2436 0.1612 0.3449 -0.0605 -0.0895 0.0670  40 LYS A CA  
319  C C   . LYS A 40 ? 0.2320 0.1677 0.3622 -0.0523 -0.0865 0.0673  40 LYS A C   
320  O O   . LYS A 40 ? 0.2705 0.2035 0.4151 -0.0527 -0.0980 0.0728  40 LYS A O   
321  C CB  . LYS A 40 ? 0.2211 0.1436 0.3358 -0.0571 -0.0904 0.0689  40 LYS A CB  
322  C CG  . LYS A 40 ? 0.3022 0.2038 0.3927 -0.0658 -0.0991 0.0714  40 LYS A CG  
323  C CD  . LYS A 40 ? 0.3029 0.2086 0.4063 -0.0623 -0.0999 0.0731  40 LYS A CD  
324  C CE  . LYS A 40 ? 0.3301 0.2122 0.4054 -0.0722 -0.1089 0.0758  40 LYS A CE  
325  N NZ  . LYS A 40 ? 0.3764 0.2611 0.4622 -0.0692 -0.1095 0.0771  40 LYS A NZ  
326  N N   . GLU A 41 ? 0.2084 0.1606 0.3459 -0.0457 -0.0715 0.0617  41 GLU A N   
327  C CA  . GLU A 41 ? 0.2072 0.1752 0.3708 -0.0378 -0.0670 0.0620  41 GLU A CA  
328  C C   . GLU A 41 ? 0.2142 0.1829 0.3741 -0.0384 -0.0657 0.0606  41 GLU A C   
329  O O   . GLU A 41 ? 0.2154 0.1930 0.3966 -0.0339 -0.0656 0.0627  41 GLU A O   
330  C CB  . GLU A 41 ? 0.1849 0.1673 0.3577 -0.0305 -0.0537 0.0577  41 GLU A CB  
331  C CG  . GLU A 41 ? 0.2371 0.2181 0.4129 -0.0297 -0.0541 0.0587  41 GLU A CG  
332  C CD  . GLU A 41 ? 0.2561 0.2356 0.4548 -0.0275 -0.0623 0.0647  41 GLU A CD  
333  O OE1 . GLU A 41 ? 0.3250 0.3104 0.5459 -0.0240 -0.0633 0.0675  41 GLU A OE1 
334  O OE2 . GLU A 41 ? 0.2818 0.2539 0.4788 -0.0296 -0.0682 0.0670  41 GLU A OE2 
335  N N   . LEU A 42 ? 0.2123 0.1706 0.3458 -0.0441 -0.0635 0.0568  42 LEU A N   
336  C CA  . LEU A 42 ? 0.2312 0.1864 0.3566 -0.0456 -0.0618 0.0547  42 LEU A CA  
337  C C   . LEU A 42 ? 0.2507 0.1824 0.3497 -0.0556 -0.0716 0.0565  42 LEU A C   
338  O O   . LEU A 42 ? 0.2603 0.1819 0.3375 -0.0595 -0.0659 0.0521  42 LEU A O   
339  C CB  . LEU A 42 ? 0.2316 0.1940 0.3492 -0.0429 -0.0471 0.0473  42 LEU A CB  
340  C CG  . LEU A 42 ? 0.2191 0.2004 0.3579 -0.0342 -0.0394 0.0458  42 LEU A CG  
341  C CD1 . LEU A 42 ? 0.2638 0.2503 0.3961 -0.0325 -0.0281 0.0393  42 LEU A CD1 
342  C CD2 . LEU A 42 ? 0.2549 0.2425 0.4098 -0.0303 -0.0415 0.0483  42 LEU A CD2 
343  N N   . ALA A 43 ? 0.2513 0.1714 0.3505 -0.0602 -0.0865 0.0630  43 ALA A N   
344  C CA  . ALA A 43 ? 0.2908 0.1826 0.3584 -0.0715 -0.0981 0.0655  43 ALA A CA  
345  C C   . ALA A 43 ? 0.3203 0.1973 0.3704 -0.0768 -0.1021 0.0649  43 ALA A C   
346  O O   . ALA A 43 ? 0.3669 0.2190 0.3799 -0.0860 -0.1020 0.0625  43 ALA A O   
347  C CB  . ALA A 43 ? 0.2883 0.1703 0.3654 -0.0750 -0.1179 0.0743  43 ALA A CB  
348  N N   . THR A 44 ? 0.2774 0.1683 0.3527 -0.0713 -0.1042 0.0668  44 THR A N   
349  C CA  . THR A 44 ? 0.3000 0.1774 0.3624 -0.0761 -0.1101 0.0673  44 THR A CA  
350  C C   . THR A 44 ? 0.2711 0.1506 0.3190 -0.0741 -0.0932 0.0589  44 THR A C   
351  O O   . THR A 44 ? 0.2890 0.1538 0.3208 -0.0787 -0.0965 0.0582  44 THR A O   
352  C CB  . THR A 44 ? 0.2859 0.1728 0.3804 -0.0733 -0.1225 0.0741  44 THR A CB  
353  O OG1 . THR A 44 ? 0.2779 0.1923 0.4034 -0.0626 -0.1098 0.0718  44 THR A OG1 
354  C CG2 . THR A 44 ? 0.3074 0.1899 0.4186 -0.0758 -0.1405 0.0828  44 THR A CG2 
355  N N   . TRP A 45 ? 0.2684 0.1645 0.3226 -0.0676 -0.0761 0.0528  45 TRP A N   
356  C CA  . TRP A 45 ? 0.2548 0.1554 0.3037 -0.0644 -0.0613 0.0455  45 TRP A CA  
357  C C   . TRP A 45 ? 0.2940 0.1730 0.3079 -0.0719 -0.0524 0.0397  45 TRP A C   
358  O O   . TRP A 45 ? 0.3297 0.2032 0.3321 -0.0752 -0.0487 0.0385  45 TRP A O   
359  C CB  . TRP A 45 ? 0.2105 0.1380 0.2848 -0.0542 -0.0488 0.0422  45 TRP A CB  
360  C CG  . TRP A 45 ? 0.1676 0.1132 0.2717 -0.0470 -0.0525 0.0461  45 TRP A CG  
361  C CD1 . TRP A 45 ? 0.1582 0.1048 0.2786 -0.0474 -0.0653 0.0533  45 TRP A CD1 
362  C CD2 . TRP A 45 ? 0.1601 0.1235 0.2818 -0.0388 -0.0433 0.0435  45 TRP A CD2 
363  N NE1 . TRP A 45 ? 0.1584 0.1220 0.3039 -0.0402 -0.0616 0.0544  45 TRP A NE1 
364  C CE2 . TRP A 45 ? 0.1526 0.1254 0.2967 -0.0352 -0.0489 0.0486  45 TRP A CE2 
365  C CE3 . TRP A 45 ? 0.2268 0.1981 0.3484 -0.0345 -0.0312 0.0373  45 TRP A CE3 
366  C CZ2 . TRP A 45 ? 0.1460 0.1329 0.3066 -0.0282 -0.0419 0.0476  45 TRP A CZ2 
367  C CZ3 . TRP A 45 ? 0.1985 0.1839 0.3379 -0.0274 -0.0274 0.0372  45 TRP A CZ3 
368  C CH2 . TRP A 45 ? 0.2027 0.1943 0.3583 -0.0248 -0.0323 0.0421  45 TRP A CH2 
369  N N   . THR A 46 ? 0.3199 0.1863 0.3177 -0.0745 -0.0474 0.0356  46 THR A N   
370  C CA  . THR A 46 ? 0.3452 0.1865 0.3075 -0.0823 -0.0367 0.0294  46 THR A CA  
371  C C   . THR A 46 ? 0.3485 0.1958 0.3156 -0.0774 -0.0211 0.0221  46 THR A C   
372  O O   . THR A 46 ? 0.3141 0.1751 0.3012 -0.0710 -0.0242 0.0232  46 THR A O   
373  C CB  . THR A 46 ? 0.4082 0.2140 0.3340 -0.0944 -0.0500 0.0328  46 THR A CB  
374  O OG1 . THR A 46 ? 0.3905 0.1956 0.3239 -0.0935 -0.0612 0.0361  46 THR A OG1 
375  C CG2 . THR A 46 ? 0.4345 0.2313 0.3546 -0.1001 -0.0666 0.0402  46 THR A CG2 
376  N N   . PRO A 47 ? 0.3492 0.1856 0.2993 -0.0802 -0.0036 0.0145  47 PRO A N   
377  C CA  . PRO A 47 ? 0.3770 0.2204 0.3373 -0.0745 0.0130  0.0070  47 PRO A CA  
378  C C   . PRO A 47 ? 0.3965 0.2248 0.3443 -0.0759 0.0110  0.0056  47 PRO A C   
379  O O   . PRO A 47 ? 0.4374 0.2377 0.3538 -0.0852 0.0015  0.0079  47 PRO A O   
380  C CB  . PRO A 47 ? 0.4003 0.2301 0.3429 -0.0796 0.0321  -0.0001 47 PRO A CB  
381  C CG  . PRO A 47 ? 0.4012 0.2063 0.3105 -0.0908 0.0235  0.0038  47 PRO A CG  
382  C CD  . PRO A 47 ? 0.3952 0.2162 0.3227 -0.0877 0.0029  0.0128  47 PRO A CD  
383  N N   . THR A 48 ? 0.3579 0.2035 0.3300 -0.0671 0.0184  0.0022  48 THR A N   
384  C CA  . THR A 48 ? 0.3913 0.2244 0.3549 -0.0671 0.0198  -0.0005 48 THR A CA  
385  C C   . THR A 48 ? 0.4460 0.2554 0.3858 -0.0715 0.0394  -0.0098 48 THR A C   
386  O O   . THR A 48 ? 0.4618 0.2679 0.3965 -0.0738 0.0532  -0.0142 48 THR A O   
387  C CB  . THR A 48 ? 0.3419 0.2021 0.3413 -0.0558 0.0188  0.0002  48 THR A CB  
388  O OG1 . THR A 48 ? 0.3274 0.2070 0.3515 -0.0484 0.0328  -0.0046 48 THR A OG1 
389  C CG2 . THR A 48 ? 0.3278 0.2052 0.3455 -0.0529 0.0017  0.0088  48 THR A CG2 
390  N N   . GLU A 49 ? 0.4909 0.2830 0.4168 -0.0729 0.0412  -0.0128 49 GLU A N   
391  C CA  . GLU A 49 ? 0.5427 0.3031 0.4371 -0.0792 0.0591  -0.0215 49 GLU A CA  
392  C C   . GLU A 49 ? 0.5457 0.3129 0.4547 -0.0752 0.0844  -0.0302 49 GLU A C   
393  O O   . GLU A 49 ? 0.5956 0.3353 0.4745 -0.0833 0.1006  -0.0364 49 GLU A O   
394  C CB  . GLU A 49 ? 0.5533 0.3018 0.4418 -0.0779 0.0574  -0.0235 49 GLU A CB  
395  C CG  . GLU A 49 ? 0.6594 0.3746 0.5179 -0.0829 0.0789  -0.0338 49 GLU A CG  
396  C CD  . GLU A 49 ? 0.7393 0.4336 0.5803 -0.0848 0.0739  -0.0349 49 GLU A CD  
397  O OE1 . GLU A 49 ? 0.7342 0.4458 0.5951 -0.0799 0.0563  -0.0285 49 GLU A OE1 
398  O OE2 . GLU A 49 ? 0.8106 0.4691 0.6163 -0.0916 0.0886  -0.0426 49 GLU A OE2 
399  N N   . PHE A 50 ? 0.5082 0.3098 0.4629 -0.0634 0.0883  -0.0307 50 PHE A N   
400  C CA  . PHE A 50 ? 0.4955 0.3057 0.4719 -0.0590 0.1108  -0.0385 50 PHE A CA  
401  C C   . PHE A 50 ? 0.4646 0.2991 0.4652 -0.0564 0.1111  -0.0360 50 PHE A C   
402  O O   . PHE A 50 ? 0.4750 0.3247 0.5055 -0.0510 0.1261  -0.0408 50 PHE A O   
403  C CB  . PHE A 50 ? 0.4774 0.3050 0.4895 -0.0479 0.1159  -0.0417 50 PHE A CB  
404  C CG  . PHE A 50 ? 0.5027 0.3096 0.4952 -0.0492 0.1134  -0.0433 50 PHE A CG  
405  C CD1 . PHE A 50 ? 0.5907 0.3618 0.5483 -0.0568 0.1296  -0.0509 50 PHE A CD1 
406  C CD2 . PHE A 50 ? 0.4944 0.3152 0.5011 -0.0435 0.0956  -0.0374 50 PHE A CD2 
407  C CE1 . PHE A 50 ? 0.5707 0.3209 0.5086 -0.0583 0.1265  -0.0525 50 PHE A CE1 
408  C CE2 . PHE A 50 ? 0.5136 0.3151 0.5026 -0.0451 0.0924  -0.0386 50 PHE A CE2 
409  C CZ  . PHE A 50 ? 0.5525 0.3187 0.5068 -0.0525 0.1072  -0.0461 50 PHE A CZ  
410  N N   . ARG A 51 ? 0.4416 0.2791 0.4311 -0.0603 0.0948  -0.0287 51 ARG A N   
411  C CA  . ARG A 51 ? 0.4079 0.2676 0.4190 -0.0579 0.0934  -0.0260 51 ARG A CA  
412  C C   . ARG A 51 ? 0.4247 0.2678 0.4069 -0.0680 0.0937  -0.0244 51 ARG A C   
413  O O   . ARG A 51 ? 0.3966 0.2573 0.3946 -0.0664 0.0897  -0.0212 51 ARG A O   
414  C CB  . ARG A 51 ? 0.3674 0.2545 0.4045 -0.0502 0.0739  -0.0181 51 ARG A CB  
415  C CG  . ARG A 51 ? 0.3589 0.2654 0.4285 -0.0399 0.0739  -0.0192 51 ARG A CG  
416  C CD  . ARG A 51 ? 0.3998 0.3265 0.5029 -0.0339 0.0843  -0.0224 51 ARG A CD  
417  N NE  . ARG A 51 ? 0.4499 0.3883 0.5803 -0.0254 0.0855  -0.0243 51 ARG A NE  
418  C CZ  . ARG A 51 ? 0.5087 0.4465 0.6569 -0.0224 0.1014  -0.0311 51 ARG A CZ  
419  N NH1 . ARG A 51 ? 0.5102 0.4375 0.6532 -0.0274 0.1199  -0.0372 51 ARG A NH1 
420  N NH2 . ARG A 51 ? 0.5017 0.4494 0.6749 -0.0144 0.0990  -0.0317 51 ARG A NH2 
421  N N   . GLU A 52 ? 0.4670 0.2744 0.4050 -0.0791 0.0975  -0.0265 52 GLU A N   
422  C CA  . GLU A 52 ? 0.5035 0.2919 0.4106 -0.0896 0.0953  -0.0241 52 GLU A CA  
423  C C   . GLU A 52 ? 0.5021 0.2981 0.4213 -0.0903 0.1137  -0.0286 52 GLU A C   
424  O O   . GLU A 52 ? 0.4911 0.2926 0.4095 -0.0930 0.1069  -0.0244 52 GLU A O   
425  C CB  . GLU A 52 ? 0.5686 0.3115 0.4210 -0.1028 0.0970  -0.0260 52 GLU A CB  
426  C CG  . GLU A 52 ? 0.6130 0.3448 0.4516 -0.1037 0.0784  -0.0216 52 GLU A CG  
427  C CD  . GLU A 52 ? 0.7280 0.4107 0.5079 -0.1184 0.0776  -0.0228 52 GLU A CD  
428  O OE1 . GLU A 52 ? 0.7964 0.4567 0.5457 -0.1285 0.0813  -0.0228 52 GLU A OE1 
429  O OE2 . GLU A 52 ? 0.7668 0.4314 0.5296 -0.1204 0.0732  -0.0236 52 GLU A OE2 
430  N N   A CYS A 53 ? 0.5134 0.3104 0.4471 -0.0876 0.1367  -0.0370 53 CYS A N   
431  N N   B CYS A 53 ? 0.5124 0.3068 0.4431 -0.0883 0.1374  -0.0373 53 CYS A N   
432  C CA  A CYS A 53 ? 0.5133 0.3165 0.4609 -0.0891 0.1556  -0.0414 53 CYS A CA  
433  C CA  B CYS A 53 ? 0.5070 0.3105 0.4570 -0.0884 0.1578  -0.0424 53 CYS A CA  
434  C C   A CYS A 53 ? 0.4572 0.3015 0.4558 -0.0787 0.1492  -0.0382 53 CYS A C   
435  C C   B CYS A 53 ? 0.4497 0.2928 0.4448 -0.0791 0.1467  -0.0373 53 CYS A C   
436  O O   A CYS A 53 ? 0.4397 0.2912 0.4468 -0.0811 0.1551  -0.0381 53 CYS A O   
437  O O   B CYS A 53 ? 0.4213 0.2687 0.4167 -0.0828 0.1470  -0.0353 53 CYS A O   
438  C CB  A CYS A 53 ? 0.5404 0.3264 0.4849 -0.0913 0.1844  -0.0517 53 CYS A CB  
439  C CB  B CYS A 53 ? 0.5143 0.3150 0.4816 -0.0851 0.1836  -0.0521 53 CYS A CB  
440  S SG  A CYS A 53 ? 0.6428 0.3707 0.5130 -0.1076 0.1920  -0.0552 53 CYS A SG  
441  S SG  B CYS A 53 ? 0.5634 0.3710 0.5578 -0.0864 0.2144  -0.0598 53 CYS A SG  
442  N N   . ASP A 54 ? 0.4202 0.2892 0.4498 -0.0679 0.1364  -0.0351 54 ASP A N   
443  C CA  . ASP A 54 ? 0.3633 0.2666 0.4343 -0.0592 0.1268  -0.0310 54 ASP A CA  
444  C C   . ASP A 54 ? 0.3323 0.2385 0.3899 -0.0621 0.1087  -0.0234 54 ASP A C   
445  O O   . ASP A 54 ? 0.3019 0.2245 0.3777 -0.0606 0.1064  -0.0212 54 ASP A O   
446  C CB  . ASP A 54 ? 0.3528 0.2762 0.4527 -0.0483 0.1161  -0.0291 54 ASP A CB  
447  C CG  . ASP A 54 ? 0.3675 0.2977 0.4971 -0.0425 0.1320  -0.0358 54 ASP A CG  
448  O OD1 . ASP A 54 ? 0.4282 0.3559 0.5683 -0.0452 0.1513  -0.0415 54 ASP A OD1 
449  O OD2 . ASP A 54 ? 0.4319 0.3697 0.5766 -0.0354 0.1256  -0.0352 54 ASP A OD2 
450  N N   . TYR A 55 ? 0.3365 0.2267 0.3648 -0.0661 0.0950  -0.0191 55 TYR A N   
451  C CA  . TYR A 55 ? 0.3078 0.1987 0.3250 -0.0686 0.0768  -0.0114 55 TYR A CA  
452  C C   . TYR A 55 ? 0.3455 0.2213 0.3408 -0.0779 0.0828  -0.0118 55 TYR A C   
453  O O   . TYR A 55 ? 0.3135 0.2028 0.3208 -0.0767 0.0769  -0.0083 55 TYR A O   
454  C CB  . TYR A 55 ? 0.3273 0.2004 0.3188 -0.0721 0.0619  -0.0071 55 TYR A CB  
455  C CG  . TYR A 55 ? 0.3358 0.2065 0.3173 -0.0753 0.0433  0.0008  55 TYR A CG  
456  C CD1 . TYR A 55 ? 0.2668 0.1611 0.2748 -0.0675 0.0295  0.0066  55 TYR A CD1 
457  C CD2 . TYR A 55 ? 0.3935 0.2353 0.3375 -0.0868 0.0395  0.0027  55 TYR A CD2 
458  C CE1 . TYR A 55 ? 0.3099 0.2022 0.3131 -0.0698 0.0135  0.0138  55 TYR A CE1 
459  C CE2 . TYR A 55 ? 0.4102 0.2495 0.3486 -0.0894 0.0214  0.0103  55 TYR A CE2 
460  C CZ  . TYR A 55 ? 0.4015 0.2667 0.3712 -0.0807 0.0088  0.0157  55 TYR A CZ  
461  O OH  . TYR A 55 ? 0.3793 0.2408 0.3459 -0.0832 -0.0082 0.0232  55 TYR A OH  
462  N N   . ASN A 56 ? 0.3955 0.2408 0.3566 -0.0875 0.0953  -0.0163 56 ASN A N   
463  C CA  . ASN A 56 ? 0.4161 0.2419 0.3506 -0.0980 0.1021  -0.0168 56 ASN A CA  
464  C C   . ASN A 56 ? 0.4109 0.2570 0.3748 -0.0953 0.1157  -0.0198 56 ASN A C   
465  O O   . ASN A 56 ? 0.4035 0.2510 0.3634 -0.0990 0.1104  -0.0161 56 ASN A O   
466  C CB  . ASN A 56 ? 0.4665 0.2516 0.3548 -0.1098 0.1154  -0.0218 56 ASN A CB  
467  C CG  . ASN A 56 ? 0.5333 0.2926 0.3853 -0.1156 0.0963  -0.0167 56 ASN A CG  
468  O OD1 . ASN A 56 ? 0.5341 0.3006 0.3888 -0.1144 0.0733  -0.0085 56 ASN A OD1 
469  N ND2 . ASN A 56 ? 0.6333 0.3612 0.4519 -0.1225 0.1059  -0.0216 56 ASN A ND2 
470  N N   . LYS A 57 ? 0.3978 0.2609 0.3946 -0.0885 0.1309  -0.0256 57 LYS A N   
471  C CA  . LYS A 57 ? 0.3690 0.2548 0.4022 -0.0851 0.1417  -0.0278 57 LYS A CA  
472  C C   . LYS A 57 ? 0.3317 0.2455 0.3918 -0.0778 0.1228  -0.0212 57 LYS A C   
473  O O   . LYS A 57 ? 0.3268 0.2472 0.3938 -0.0804 0.1233  -0.0196 57 LYS A O   
474  C CB  . LYS A 57 ? 0.3740 0.2736 0.4431 -0.0782 0.1582  -0.0344 57 LYS A CB  
475  C CG  . LYS A 57 ? 0.4678 0.3404 0.5163 -0.0852 0.1834  -0.0427 57 LYS A CG  
476  C CD  . LYS A 57 ? 0.5279 0.4159 0.6186 -0.0772 0.1998  -0.0492 57 LYS A CD  
477  C CE  . LYS A 57 ? 0.5961 0.4527 0.6599 -0.0833 0.2231  -0.0575 57 LYS A CE  
478  N NZ  . LYS A 57 ? 0.6207 0.4446 0.6390 -0.0976 0.2372  -0.0598 57 LYS A NZ  
479  N N   . PHE A 58 ? 0.3001 0.2279 0.3730 -0.0694 0.1065  -0.0173 58 PHE A N   
480  C CA  . PHE A 58 ? 0.2773 0.2250 0.3666 -0.0638 0.0887  -0.0108 58 PHE A CA  
481  C C   . PHE A 58 ? 0.2965 0.2327 0.3610 -0.0706 0.0793  -0.0059 58 PHE A C   
482  O O   . PHE A 58 ? 0.2650 0.2136 0.3428 -0.0696 0.0752  -0.0036 58 PHE A O   
483  C CB  . PHE A 58 ? 0.2702 0.2266 0.3671 -0.0561 0.0749  -0.0076 58 PHE A CB  
484  C CG  . PHE A 58 ? 0.2947 0.2680 0.4058 -0.0504 0.0586  -0.0015 58 PHE A CG  
485  C CD1 . PHE A 58 ? 0.3009 0.2957 0.4432 -0.0432 0.0566  -0.0014 58 PHE A CD1 
486  C CD2 . PHE A 58 ? 0.3909 0.3567 0.4839 -0.0525 0.0453  0.0040  58 PHE A CD2 
487  C CE1 . PHE A 58 ? 0.3773 0.3832 0.5273 -0.0388 0.0431  0.0037  58 PHE A CE1 
488  C CE2 . PHE A 58 ? 0.4181 0.3976 0.5242 -0.0472 0.0330  0.0090  58 PHE A CE2 
489  C CZ  . PHE A 58 ? 0.4031 0.4014 0.5352 -0.0406 0.0329  0.0085  58 PHE A CZ  
490  N N   . MET A 59 ? 0.3236 0.2348 0.3521 -0.0778 0.0746  -0.0041 59 MET A N   
491  C CA  . MET A 59 ? 0.3541 0.2535 0.3609 -0.0838 0.0627  0.0014  59 MET A CA  
492  C C   . MET A 59 ? 0.3722 0.2603 0.3658 -0.0924 0.0742  -0.0007 59 MET A C   
493  O O   . MET A 59 ? 0.3773 0.2683 0.3707 -0.0939 0.0661  0.0034  59 MET A O   
494  C CB  . MET A 59 ? 0.3869 0.2609 0.3601 -0.0899 0.0516  0.0048  59 MET A CB  
495  C CG  . MET A 59 ? 0.3757 0.2615 0.3628 -0.0823 0.0337  0.0102  59 MET A CG  
496  S SD  . MET A 59 ? 0.4720 0.3850 0.4902 -0.0735 0.0202  0.0162  59 MET A SD  
497  C CE  . MET A 59 ? 0.4262 0.3459 0.4554 -0.0673 0.0054  0.0210  59 MET A CE  
498  N N   . SER A 60 ? 0.3859 0.2622 0.3718 -0.0974 0.0945  -0.0075 60 SER A N   
499  C CA  . SER A 60 ? 0.4089 0.2726 0.3822 -0.1065 0.1092  -0.0103 60 SER A CA  
500  C C   . SER A 60 ? 0.3822 0.2744 0.3951 -0.1010 0.1128  -0.0106 60 SER A C   
501  O O   . SER A 60 ? 0.3972 0.2849 0.4030 -0.1070 0.1144  -0.0092 60 SER A O   
502  C CB  . SER A 60 ? 0.4448 0.2862 0.3992 -0.1134 0.1322  -0.0178 60 SER A CB  
503  O OG  . SER A 60 ? 0.4907 0.3546 0.4853 -0.1055 0.1465  -0.0234 60 SER A OG  
504  N N   . VAL A 61 ? 0.3709 0.2910 0.4239 -0.0902 0.1116  -0.0118 61 VAL A N   
505  C CA  . VAL A 61 ? 0.3760 0.3215 0.4662 -0.0854 0.1112  -0.0112 61 VAL A CA  
506  C C   . VAL A 61 ? 0.3759 0.3276 0.4630 -0.0842 0.0926  -0.0045 61 VAL A C   
507  O O   . VAL A 61 ? 0.3938 0.3509 0.4896 -0.0869 0.0942  -0.0038 61 VAL A O   
508  C CB  . VAL A 61 ? 0.3549 0.3250 0.4861 -0.0750 0.1114  -0.0132 61 VAL A CB  
509  C CG1 . VAL A 61 ? 0.3590 0.3528 0.5238 -0.0701 0.1032  -0.0106 61 VAL A CG1 
510  C CG2 . VAL A 61 ? 0.3848 0.3508 0.5278 -0.0767 0.1336  -0.0205 61 VAL A CG2 
511  N N   . LEU A 62 ? 0.3713 0.3212 0.4470 -0.0803 0.0760  0.0001  62 LEU A N   
512  C CA  . LEU A 62 ? 0.3708 0.3258 0.4457 -0.0784 0.0598  0.0061  62 LEU A CA  
513  C C   . LEU A 62 ? 0.3984 0.3339 0.4463 -0.0882 0.0601  0.0080  62 LEU A C   
514  O O   . LEU A 62 ? 0.3982 0.3397 0.4528 -0.0887 0.0557  0.0103  62 LEU A O   
515  C CB  . LEU A 62 ? 0.3531 0.3077 0.4223 -0.0732 0.0446  0.0105  62 LEU A CB  
516  C CG  . LEU A 62 ? 0.3209 0.2934 0.4144 -0.0635 0.0422  0.0096  62 LEU A CG  
517  C CD1 . LEU A 62 ? 0.2912 0.2611 0.3775 -0.0601 0.0282  0.0145  62 LEU A CD1 
518  C CD2 . LEU A 62 ? 0.2974 0.2907 0.4199 -0.0577 0.0411  0.0094  62 LEU A CD2 
519  N N   . ASP A 63 ? 0.4361 0.3460 0.4516 -0.0968 0.0658  0.0068  63 ASP A N   
520  C CA  . ASP A 63 ? 0.4582 0.3430 0.4402 -0.1077 0.0640  0.0093  63 ASP A CA  
521  C C   . ASP A 63 ? 0.4603 0.3435 0.4445 -0.1142 0.0800  0.0058  63 ASP A C   
522  O O   . ASP A 63 ? 0.4794 0.3518 0.4485 -0.1206 0.0762  0.0088  63 ASP A O   
523  C CB  . ASP A 63 ? 0.5075 0.3612 0.4505 -0.1161 0.0655  0.0088  63 ASP A CB  
524  C CG  . ASP A 63 ? 0.5964 0.4244 0.5052 -0.1243 0.0500  0.0153  63 ASP A CG  
525  O OD1 . ASP A 63 ? 0.6255 0.4622 0.5443 -0.1218 0.0374  0.0202  63 ASP A OD1 
526  O OD2 . ASP A 63 ? 0.7040 0.5007 0.5747 -0.1337 0.0496  0.0155  63 ASP A OD2 
527  N N   . THR A 64 ? 0.4367 0.3303 0.4418 -0.1129 0.0982  -0.0004 64 THR A N   
528  C CA  . THR A 64 ? 0.4398 0.3338 0.4533 -0.1191 0.1151  -0.0040 64 THR A CA  
529  C C   . THR A 64 ? 0.4088 0.3302 0.4588 -0.1126 0.1077  -0.0018 64 THR A C   
530  O O   . THR A 64 ? 0.3905 0.3098 0.4392 -0.1182 0.1093  -0.0005 64 THR A O   
531  C CB  . THR A 64 ? 0.4477 0.3428 0.4755 -0.1199 0.1386  -0.0116 64 THR A CB  
532  O OG1 . THR A 64 ? 0.4900 0.3521 0.4753 -0.1290 0.1487  -0.0143 64 THR A OG1 
533  C CG2 . THR A 64 ? 0.4553 0.3589 0.5069 -0.1242 0.1562  -0.0150 64 THR A CG2 
534  N N   . ASN A 65 ? 0.3924 0.3373 0.4723 -0.1014 0.0984  -0.0011 65 ASN A N   
535  C CA  . ASN A 65 ? 0.3915 0.3599 0.5066 -0.0963 0.0942  -0.0002 65 ASN A CA  
536  C C   . ASN A 65 ? 0.3814 0.3565 0.4963 -0.0919 0.0743  0.0056  65 ASN A C   
537  O O   . ASN A 65 ? 0.3535 0.3394 0.4784 -0.0834 0.0623  0.0077  65 ASN A O   
538  C CB  . ASN A 65 ? 0.3851 0.3735 0.5374 -0.0888 0.0999  -0.0038 65 ASN A CB  
539  C CG  . ASN A 65 ? 0.4344 0.4160 0.5921 -0.0941 0.1234  -0.0102 65 ASN A CG  
540  O OD1 . ASN A 65 ? 0.4582 0.4383 0.6184 -0.0907 0.1303  -0.0136 65 ASN A OD1 
541  N ND2 . ASN A 65 ? 0.4071 0.3817 0.5636 -0.1031 0.1372  -0.0121 65 ASN A ND2 
542  N N   . LYS A 66 ? 0.4064 0.3752 0.5129 -0.0980 0.0730  0.0076  66 LYS A N   
543  C CA  . LYS A 66 ? 0.4181 0.3868 0.5176 -0.0956 0.0563  0.0128  66 LYS A CA  
544  C C   . LYS A 66 ? 0.4117 0.4000 0.5382 -0.0877 0.0457  0.0144  66 LYS A C   
545  O O   . LYS A 66 ? 0.4115 0.3970 0.5312 -0.0870 0.0349  0.0179  66 LYS A O   
546  C CB  . LYS A 66 ? 0.4459 0.3963 0.5215 -0.1057 0.0585  0.0145  66 LYS A CB  
547  C CG  . LYS A 66 ? 0.4690 0.3934 0.5082 -0.1137 0.0633  0.0145  66 LYS A CG  
548  C CD  . LYS A 66 ? 0.4524 0.3706 0.4777 -0.1086 0.0496  0.0178  66 LYS A CD  
549  C CE  . LYS A 66 ? 0.4334 0.3248 0.4240 -0.1174 0.0552  0.0171  66 LYS A CE  
550  N NZ  . LYS A 66 ? 0.5002 0.3832 0.4772 -0.1141 0.0408  0.0209  66 LYS A NZ  
551  N N   . ASP A 67 ? 0.4039 0.4090 0.5580 -0.0818 0.0475  0.0120  67 ASP A N   
552  C CA  . ASP A 67 ? 0.3951 0.4149 0.5719 -0.0757 0.0366  0.0136  67 ASP A CA  
553  C C   . ASP A 67 ? 0.3716 0.3905 0.5391 -0.0686 0.0221  0.0170  67 ASP A C   
554  O O   . ASP A 67 ? 0.3871 0.4054 0.5487 -0.0633 0.0197  0.0174  67 ASP A O   
555  C CB  . ASP A 67 ? 0.3930 0.4289 0.6025 -0.0717 0.0398  0.0110  67 ASP A CB  
556  C CG  . ASP A 67 ? 0.3656 0.4041 0.5916 -0.0774 0.0570  0.0069  67 ASP A CG  
557  O OD1 . ASP A 67 ? 0.4190 0.4642 0.6665 -0.0818 0.0607  0.0064  67 ASP A OD1 
558  O OD2 . ASP A 67 ? 0.2643 0.2971 0.4822 -0.0778 0.0676  0.0040  67 ASP A OD2 
559  N N   A CYS A 68 ? 0.3510 0.3698 0.5193 -0.0685 0.0134  0.0193  68 CYS A N   
560  C CA  A CYS A 68 ? 0.3168 0.3309 0.4737 -0.0630 0.0025  0.0221  68 CYS A CA  
561  C C   A CYS A 68 ? 0.3099 0.3313 0.4799 -0.0573 -0.0052 0.0223  68 CYS A C   
562  O O   A CYS A 68 ? 0.3157 0.3318 0.4789 -0.0552 -0.0133 0.0241  68 CYS A O   
563  C CB  A CYS A 68 ? 0.3171 0.3202 0.4588 -0.0669 -0.0012 0.0244  68 CYS A CB  
564  S SG  A CYS A 68 ? 0.2875 0.2776 0.4091 -0.0740 0.0057  0.0249  68 CYS A SG  
565  N N   . GLU A 69 ? 0.3130 0.3443 0.5000 -0.0552 -0.0022 0.0205  69 GLU A N   
566  C CA  . GLU A 69 ? 0.3082 0.3448 0.5061 -0.0499 -0.0095 0.0208  69 GLU A CA  
567  C C   . GLU A 69 ? 0.2935 0.3328 0.4906 -0.0453 -0.0049 0.0197  69 GLU A C   
568  O O   . GLU A 69 ? 0.3234 0.3705 0.5365 -0.0451 0.0010  0.0174  69 GLU A O   
569  C CB  . GLU A 69 ? 0.3256 0.3718 0.5500 -0.0523 -0.0112 0.0200  69 GLU A CB  
570  N N   . VAL A 70 ? 0.2356 0.2678 0.4151 -0.0421 -0.0065 0.0212  70 VAL A N   
571  C CA  . VAL A 70 ? 0.2083 0.2422 0.3876 -0.0368 -0.0065 0.0212  70 VAL A CA  
572  C C   . VAL A 70 ? 0.1830 0.2116 0.3543 -0.0323 -0.0141 0.0234  70 VAL A C   
573  O O   . VAL A 70 ? 0.2078 0.2283 0.3660 -0.0320 -0.0153 0.0250  70 VAL A O   
574  C CB  . VAL A 70 ? 0.2066 0.2351 0.3728 -0.0375 -0.0019 0.0216  70 VAL A CB  
575  C CG1 . VAL A 70 ? 0.1864 0.2165 0.3532 -0.0325 -0.0025 0.0219  70 VAL A CG1 
576  C CG2 . VAL A 70 ? 0.2667 0.2947 0.4335 -0.0435 0.0073  0.0191  70 VAL A CG2 
577  N N   . ASP A 71 ? 0.1549 0.1855 0.3331 -0.0293 -0.0191 0.0234  71 ASP A N   
578  C CA  . ASP A 71 ? 0.1323 0.1534 0.2978 -0.0259 -0.0244 0.0252  71 ASP A CA  
579  C C   . ASP A 71 ? 0.1265 0.1471 0.2879 -0.0214 -0.0213 0.0257  71 ASP A C   
580  O O   . ASP A 71 ? 0.1018 0.1288 0.2691 -0.0210 -0.0167 0.0249  71 ASP A O   
581  C CB  . ASP A 71 ? 0.1349 0.1528 0.3038 -0.0264 -0.0336 0.0257  71 ASP A CB  
582  C CG  . ASP A 71 ? 0.1875 0.2140 0.3742 -0.0249 -0.0361 0.0252  71 ASP A CG  
583  O OD1 . ASP A 71 ? 0.1386 0.1722 0.3319 -0.0224 -0.0300 0.0241  71 ASP A OD1 
584  O OD2 . ASP A 71 ? 0.2312 0.2557 0.4252 -0.0262 -0.0459 0.0263  71 ASP A OD2 
585  N N   . PHE A 72 ? 0.1276 0.1384 0.2772 -0.0186 -0.0234 0.0270  72 PHE A N   
586  C CA  . PHE A 72 ? 0.1099 0.1197 0.2569 -0.0147 -0.0196 0.0278  72 PHE A CA  
587  C C   . PHE A 72 ? 0.1081 0.1258 0.2657 -0.0132 -0.0205 0.0271  72 PHE A C   
588  O O   . PHE A 72 ? 0.0993 0.1214 0.2605 -0.0118 -0.0163 0.0271  72 PHE A O   
589  C CB  . PHE A 72 ? 0.1349 0.1307 0.2669 -0.0127 -0.0197 0.0288  72 PHE A CB  
590  C CG  . PHE A 72 ? 0.1227 0.1172 0.2538 -0.0093 -0.0145 0.0297  72 PHE A CG  
591  C CD1 . PHE A 72 ? 0.1038 0.1017 0.2404 -0.0078 -0.0089 0.0307  72 PHE A CD1 
592  C CD2 . PHE A 72 ? 0.1307 0.1204 0.2571 -0.0078 -0.0161 0.0302  72 PHE A CD2 
593  C CE1 . PHE A 72 ? 0.1160 0.1134 0.2553 -0.0051 -0.0045 0.0320  72 PHE A CE1 
594  C CE2 . PHE A 72 ? 0.1279 0.1160 0.2539 -0.0052 -0.0107 0.0312  72 PHE A CE2 
595  C CZ  . PHE A 72 ? 0.1262 0.1193 0.2605 -0.0037 -0.0043 0.0321  72 PHE A CZ  
596  N N   . VAL A 73 ? 0.1128 0.1311 0.2763 -0.0138 -0.0268 0.0267  73 VAL A N   
597  C CA  . VAL A 73 ? 0.1354 0.1604 0.3114 -0.0119 -0.0282 0.0261  73 VAL A CA  
598  C C   . VAL A 73 ? 0.1053 0.1416 0.2950 -0.0129 -0.0215 0.0239  73 VAL A C   
599  O O   . VAL A 73 ? 0.1147 0.1540 0.3081 -0.0107 -0.0183 0.0232  73 VAL A O   
600  C CB  . VAL A 73 ? 0.1568 0.1791 0.3393 -0.0127 -0.0385 0.0269  73 VAL A CB  
601  C CG1 . VAL A 73 ? 0.1843 0.2155 0.3871 -0.0107 -0.0402 0.0261  73 VAL A CG1 
602  C CG2 . VAL A 73 ? 0.2049 0.2100 0.3660 -0.0125 -0.0446 0.0292  73 VAL A CG2 
603  N N   . GLU A 74 ? 0.0908 0.1309 0.2852 -0.0165 -0.0186 0.0226  74 GLU A N   
604  C CA  A GLU A 74 ? 0.0952 0.1414 0.2972 -0.0188 -0.0104 0.0201  74 GLU A CA  
605  C CA  C GLU A 74 ? 0.0899 0.1361 0.2919 -0.0186 -0.0104 0.0201  74 GLU A CA  
606  C C   . GLU A 74 ? 0.0929 0.1345 0.2809 -0.0189 -0.0058 0.0206  74 GLU A C   
607  O O   . GLU A 74 ? 0.0960 0.1385 0.2851 -0.0195 -0.0004 0.0190  74 GLU A O   
608  C CB  A GLU A 74 ? 0.1115 0.1597 0.3182 -0.0238 -0.0083 0.0191  74 GLU A CB  
609  C CB  C GLU A 74 ? 0.1130 0.1623 0.3222 -0.0235 -0.0074 0.0187  74 GLU A CB  
610  C CG  A GLU A 74 ? 0.1504 0.2015 0.3625 -0.0276 0.0023  0.0160  74 GLU A CG  
611  C CG  C GLU A 74 ? 0.1447 0.1974 0.3608 -0.0266 0.0036  0.0153  74 GLU A CG  
612  C CD  A GLU A 74 ? 0.1956 0.2532 0.4256 -0.0255 0.0071  0.0133  74 GLU A CD  
613  C CD  C GLU A 74 ? 0.2190 0.2737 0.4423 -0.0323 0.0087  0.0138  74 GLU A CD  
614  O OE1 A GLU A 74 ? 0.2116 0.2736 0.4554 -0.0216 0.0001  0.0141  74 GLU A OE1 
615  O OE1 C GLU A 74 ? 0.2792 0.3343 0.5051 -0.0337 0.0023  0.0155  74 GLU A OE1 
616  O OE2 A GLU A 74 ? 0.2395 0.2955 0.4685 -0.0281 0.0178  0.0103  74 GLU A OE2 
617  O OE2 C GLU A 74 ? 0.2790 0.3332 0.5045 -0.0358 0.0199  0.0107  74 GLU A OE2 
618  N N   . TYR A 75 ? 0.0832 0.1187 0.2589 -0.0187 -0.0082 0.0231  75 TYR A N   
619  C CA  . TYR A 75 ? 0.0795 0.1107 0.2466 -0.0187 -0.0066 0.0247  75 TYR A CA  
620  C C   . TYR A 75 ? 0.0821 0.1143 0.2513 -0.0151 -0.0066 0.0251  75 TYR A C   
621  O O   . TYR A 75 ? 0.0806 0.1114 0.2475 -0.0162 -0.0046 0.0251  75 TYR A O   
622  C CB  . TYR A 75 ? 0.0892 0.1143 0.2487 -0.0181 -0.0091 0.0273  75 TYR A CB  
623  C CG  . TYR A 75 ? 0.0809 0.1025 0.2385 -0.0155 -0.0093 0.0300  75 TYR A CG  
624  C CD1 . TYR A 75 ? 0.0771 0.0961 0.2327 -0.0180 -0.0101 0.0317  75 TYR A CD1 
625  C CD2 . TYR A 75 ? 0.0961 0.1150 0.2537 -0.0113 -0.0090 0.0313  75 TYR A CD2 
626  C CE1 . TYR A 75 ? 0.0858 0.1025 0.2450 -0.0158 -0.0119 0.0348  75 TYR A CE1 
627  C CE2 . TYR A 75 ? 0.0934 0.1100 0.2541 -0.0090 -0.0077 0.0338  75 TYR A CE2 
628  C CZ  . TYR A 75 ? 0.0743 0.0913 0.2385 -0.0111 -0.0098 0.0358  75 TYR A CZ  
629  O OH  . TYR A 75 ? 0.0748 0.0902 0.2470 -0.0090 -0.0099 0.0389  75 TYR A OH  
630  N N   . VAL A 76 ? 0.0865 0.1188 0.2581 -0.0114 -0.0094 0.0257  76 VAL A N   
631  C CA  . VAL A 76 ? 0.0966 0.1287 0.2692 -0.0084 -0.0093 0.0265  76 VAL A CA  
632  C C   . VAL A 76 ? 0.0896 0.1265 0.2705 -0.0086 -0.0075 0.0239  76 VAL A C   
633  O O   . VAL A 76 ? 0.1051 0.1411 0.2850 -0.0079 -0.0058 0.0239  76 VAL A O   
634  C CB  . VAL A 76 ? 0.0966 0.1234 0.2650 -0.0054 -0.0124 0.0280  76 VAL A CB  
635  C CG1 . VAL A 76 ? 0.1659 0.1918 0.3350 -0.0029 -0.0119 0.0290  76 VAL A CG1 
636  C CG2 . VAL A 76 ? 0.1112 0.1306 0.2703 -0.0052 -0.0109 0.0300  76 VAL A CG2 
637  N N   . ARG A 77 ? 0.0983 0.1397 0.2887 -0.0097 -0.0072 0.0215  77 ARG A N   
638  C CA  A ARG A 77 ? 0.0887 0.1344 0.2904 -0.0097 -0.0028 0.0184  77 ARG A CA  
639  C CA  B ARG A 77 ? 0.0882 0.1339 0.2899 -0.0097 -0.0028 0.0184  77 ARG A CA  
640  C C   . ARG A 77 ? 0.1091 0.1509 0.3023 -0.0133 0.0043  0.0167  77 ARG A C   
641  O O   . ARG A 77 ? 0.1082 0.1481 0.3016 -0.0130 0.0083  0.0147  77 ARG A O   
642  C CB  A ARG A 77 ? 0.1046 0.1565 0.3229 -0.0106 -0.0026 0.0163  77 ARG A CB  
643  C CB  B ARG A 77 ? 0.1035 0.1552 0.3211 -0.0109 -0.0023 0.0163  77 ARG A CB  
644  C CG  A ARG A 77 ? 0.1232 0.1798 0.3589 -0.0100 0.0041  0.0125  77 ARG A CG  
645  C CG  B ARG A 77 ? 0.1187 0.1747 0.3522 -0.0105 0.0048  0.0124  77 ARG A CG  
646  C CD  A ARG A 77 ? 0.1562 0.2208 0.4166 -0.0102 0.0022  0.0115  77 ARG A CD  
647  C CD  B ARG A 77 ? 0.1601 0.2239 0.4173 -0.0112 0.0048  0.0109  77 ARG A CD  
648  N NE  A ARG A 77 ? 0.2167 0.2863 0.4974 -0.0107 0.0128  0.0071  77 ARG A NE  
649  N NE  B ARG A 77 ? 0.2163 0.2806 0.4729 -0.0165 0.0134  0.0088  77 ARG A NE  
650  C CZ  A ARG A 77 ? 0.2404 0.3137 0.5409 -0.0067 0.0132  0.0055  77 ARG A CZ  
651  C CZ  B ARG A 77 ? 0.2504 0.3134 0.5101 -0.0193 0.0265  0.0046  77 ARG A CZ  
652  N NH1 A ARG A 77 ? 0.1912 0.2630 0.4916 -0.0023 0.0023  0.0084  77 ARG A NH1 
653  N NH1 B ARG A 77 ? 0.2461 0.3072 0.5091 -0.0169 0.0322  0.0021  77 ARG A NH1 
654  N NH2 A ARG A 77 ? 0.2666 0.3435 0.5869 -0.0074 0.0257  0.0008  77 ARG A NH2 
655  N NH2 B ARG A 77 ? 0.2517 0.3127 0.5082 -0.0250 0.0348  0.0029  77 ARG A NH2 
656  N N   . SER A 78 ? 0.0977 0.1357 0.2808 -0.0174 0.0054  0.0175  78 SER A N   
657  C CA  A SER A 78 ? 0.1130 0.1427 0.2829 -0.0221 0.0099  0.0166  78 SER A CA  
658  C CA  B SER A 78 ? 0.1032 0.1327 0.2728 -0.0222 0.0099  0.0166  78 SER A CA  
659  C C   . SER A 78 ? 0.1091 0.1331 0.2704 -0.0211 0.0061  0.0190  78 SER A C   
660  O O   . SER A 78 ? 0.1241 0.1405 0.2769 -0.0239 0.0092  0.0175  78 SER A O   
661  C CB  A SER A 78 ? 0.1268 0.1514 0.2865 -0.0270 0.0097  0.0178  78 SER A CB  
662  C CB  B SER A 78 ? 0.1113 0.1349 0.2695 -0.0273 0.0094  0.0180  78 SER A CB  
663  O OG  A SER A 78 ? 0.1549 0.1849 0.3242 -0.0285 0.0134  0.0156  78 SER A OG  
664  O OG  B SER A 78 ? 0.0835 0.1044 0.2358 -0.0261 0.0021  0.0224  78 SER A OG  
665  N N   . LEU A 79 ? 0.0994 0.1256 0.2627 -0.0175 -0.0002 0.0228  79 LEU A N   
666  C CA  . LEU A 79 ? 0.1063 0.1290 0.2670 -0.0163 -0.0036 0.0255  79 LEU A CA  
667  C C   . LEU A 79 ? 0.0997 0.1235 0.2645 -0.0140 -0.0014 0.0233  79 LEU A C   
668  O O   . LEU A 79 ? 0.1171 0.1345 0.2756 -0.0158 -0.0020 0.0236  79 LEU A O   
669  C CB  . LEU A 79 ? 0.1036 0.1289 0.2694 -0.0125 -0.0073 0.0292  79 LEU A CB  
670  C CG  . LEU A 79 ? 0.1082 0.1315 0.2718 -0.0139 -0.0091 0.0314  79 LEU A CG  
671  C CD1 . LEU A 79 ? 0.1129 0.1370 0.2821 -0.0097 -0.0094 0.0341  79 LEU A CD1 
672  C CD2 . LEU A 79 ? 0.1293 0.1454 0.2866 -0.0185 -0.0127 0.0336  79 LEU A CD2 
673  N N   . ALA A 80 ? 0.0831 0.1136 0.2583 -0.0103 -0.0003 0.0215  80 ALA A N   
674  C CA  . ALA A 80 ? 0.1007 0.1322 0.2824 -0.0075 0.0009  0.0195  80 ALA A CA  
675  C C   . ALA A 80 ? 0.0953 0.1220 0.2738 -0.0108 0.0079  0.0153  80 ALA A C   
676  O O   . ALA A 80 ? 0.1062 0.1273 0.2806 -0.0108 0.0091  0.0144  80 ALA A O   
677  C CB  . ALA A 80 ? 0.1052 0.1428 0.2999 -0.0037 -0.0012 0.0188  80 ALA A CB  
678  N N   . CYS A 81 ? 0.0903 0.1170 0.2691 -0.0141 0.0137  0.0125  81 CYS A N   
679  C CA  . CYS A 81 ? 0.1020 0.1204 0.2740 -0.0182 0.0232  0.0081  81 CYS A CA  
680  C C   . CYS A 81 ? 0.1214 0.1249 0.2704 -0.0234 0.0221  0.0092  81 CYS A C   
681  O O   . CYS A 81 ? 0.1340 0.1275 0.2745 -0.0252 0.0270  0.0063  81 CYS A O   
682  C CB  . CYS A 81 ? 0.1194 0.1391 0.2944 -0.0219 0.0304  0.0054  81 CYS A CB  
683  S SG  . CYS A 81 ? 0.1539 0.1897 0.3614 -0.0166 0.0317  0.0035  81 CYS A SG  
684  N N   . LEU A 82 ? 0.1478 0.1484 0.2871 -0.0258 0.0144  0.0137  82 LEU A N   
685  C CA  . LEU A 82 ? 0.1574 0.1435 0.2777 -0.0310 0.0094  0.0162  82 LEU A CA  
686  C C   . LEU A 82 ? 0.1624 0.1474 0.2850 -0.0282 0.0048  0.0177  82 LEU A C   
687  O O   . LEU A 82 ? 0.1705 0.1407 0.2770 -0.0329 0.0034  0.0175  82 LEU A O   
688  C CB  . LEU A 82 ? 0.1807 0.1668 0.2984 -0.0326 0.0005  0.0215  82 LEU A CB  
689  C CG  . LEU A 82 ? 0.2524 0.2290 0.3558 -0.0391 0.0033  0.0206  82 LEU A CG  
690  C CD1 . LEU A 82 ? 0.3067 0.2622 0.3857 -0.0469 -0.0008 0.0219  82 LEU A CD1 
691  C CD2 . LEU A 82 ? 0.3162 0.2959 0.4225 -0.0399 0.0151  0.0152  82 LEU A CD2 
692  N N   . CYS A 83 ? 0.1263 0.1240 0.2659 -0.0216 0.0023  0.0192  83 CYS A N   
693  C CA  . CYS A 83 ? 0.1442 0.1408 0.2866 -0.0191 -0.0006 0.0203  83 CYS A CA  
694  C C   . CYS A 83 ? 0.1573 0.1469 0.2953 -0.0197 0.0067  0.0150  83 CYS A C   
695  O O   . CYS A 83 ? 0.1649 0.1431 0.2921 -0.0222 0.0052  0.0147  83 CYS A O   
696  C CB  . CYS A 83 ? 0.1325 0.1410 0.2908 -0.0125 -0.0028 0.0222  83 CYS A CB  
697  S SG  . CYS A 83 ? 0.1537 0.1669 0.3165 -0.0118 -0.0092 0.0284  83 CYS A SG  
698  N N   . LEU A 84 ? 0.1322 0.1286 0.2816 -0.0167 0.0145  0.0106  84 LEU A N   
699  C CA  . LEU A 84 ? 0.1452 0.1353 0.2951 -0.0164 0.0234  0.0051  84 LEU A CA  
700  C C   . LEU A 84 ? 0.1793 0.1502 0.3052 -0.0239 0.0294  0.0021  84 LEU A C   
701  O O   . LEU A 84 ? 0.2052 0.1634 0.3215 -0.0253 0.0346  -0.0014 84 LEU A O   
702  C CB  . LEU A 84 ? 0.1628 0.1627 0.3325 -0.0131 0.0318  0.0008  84 LEU A CB  
703  C CG  . LEU A 84 ? 0.1558 0.1706 0.3469 -0.0065 0.0247  0.0035  84 LEU A CG  
704  C CD1 . LEU A 84 ? 0.1495 0.1727 0.3632 -0.0040 0.0312  -0.0003 84 LEU A CD1 
705  C CD2 . LEU A 84 ? 0.1554 0.1687 0.3492 -0.0025 0.0197  0.0048  84 LEU A CD2 
706  N N   . TYR A 85 ? 0.1568 0.1221 0.2695 -0.0295 0.0294  0.0032  85 TYR A N   
707  C CA  . TYR A 85 ? 0.2030 0.1451 0.2870 -0.0381 0.0341  0.0008  85 TYR A CA  
708  C C   . TYR A 85 ? 0.2004 0.1269 0.2634 -0.0432 0.0223  0.0052  85 TYR A C   
709  O O   . TYR A 85 ? 0.2497 0.1535 0.2876 -0.0497 0.0259  0.0024  85 TYR A O   
710  C CB  . TYR A 85 ? 0.2222 0.1594 0.2951 -0.0439 0.0370  0.0009  85 TYR A CB  
711  C CG  . TYR A 85 ? 0.2669 0.2173 0.3592 -0.0411 0.0485  -0.0031 85 TYR A CG  
712  C CD1 . TYR A 85 ? 0.2685 0.2249 0.3790 -0.0368 0.0606  -0.0088 85 TYR A CD1 
713  C CD2 . TYR A 85 ? 0.2469 0.2046 0.3426 -0.0425 0.0459  -0.0007 85 TYR A CD2 
714  C CE1 . TYR A 85 ? 0.3411 0.3106 0.4746 -0.0348 0.0701  -0.0119 85 TYR A CE1 
715  C CE2 . TYR A 85 ? 0.3000 0.2696 0.4145 -0.0407 0.0549  -0.0037 85 TYR A CE2 
716  C CZ  . TYR A 85 ? 0.2874 0.2634 0.4219 -0.0369 0.0663  -0.0090 85 TYR A CZ  
717  O OH  . TYR A 85 ? 0.3277 0.3166 0.4848 -0.0357 0.0730  -0.0109 85 TYR A OH  
718  N N   . CYS A 86 ? 0.1798 0.1165 0.2527 -0.0409 0.0087  0.0120  86 CYS A N   
719  C CA  . CYS A 86 ? 0.1840 0.1063 0.2408 -0.0470 -0.0045 0.0175  86 CYS A CA  
720  C C   . CYS A 86 ? 0.1815 0.1099 0.2507 -0.0435 -0.0141 0.0218  86 CYS A C   
721  O O   . CYS A 86 ? 0.2137 0.1297 0.2729 -0.0487 -0.0259 0.0265  86 CYS A O   
722  C CB  . CYS A 86 ? 0.1717 0.0976 0.2303 -0.0490 -0.0127 0.0226  86 CYS A CB  
723  S SG  . CYS A 86 ? 0.2248 0.1387 0.2636 -0.0557 -0.0053 0.0196  86 CYS A SG  
724  N N   . HIS A 87 ? 0.1465 0.0923 0.2375 -0.0354 -0.0103 0.0208  87 HIS A N   
725  C CA  . HIS A 87 ? 0.1422 0.0934 0.2449 -0.0325 -0.0181 0.0251  87 HIS A CA  
726  C C   . HIS A 87 ? 0.1510 0.0930 0.2467 -0.0322 -0.0137 0.0210  87 HIS A C   
727  O O   . HIS A 87 ? 0.1609 0.1062 0.2609 -0.0282 -0.0033 0.0154  87 HIS A O   
728  C CB  . HIS A 87 ? 0.1006 0.0727 0.2274 -0.0248 -0.0173 0.0272  87 HIS A CB  
729  C CG  . HIS A 87 ? 0.1235 0.1004 0.2622 -0.0226 -0.0235 0.0320  87 HIS A CG  
730  N ND1 . HIS A 87 ? 0.1316 0.1164 0.2837 -0.0217 -0.0287 0.0376  87 HIS A ND1 
731  C CD2 . HIS A 87 ? 0.0917 0.0644 0.2303 -0.0221 -0.0248 0.0320  87 HIS A CD2 
732  C CE1 . HIS A 87 ? 0.0752 0.0614 0.2364 -0.0206 -0.0318 0.0408  87 HIS A CE1 
733  N NE2 . HIS A 87 ? 0.1501 0.1292 0.3026 -0.0208 -0.0302 0.0376  87 HIS A NE2 
734  N N   . GLU A 88 ? 0.1594 0.0901 0.2473 -0.0361 -0.0227 0.0244  88 GLU A N   
735  C CA  . GLU A 88 ? 0.1700 0.0880 0.2476 -0.0368 -0.0197 0.0207  88 GLU A CA  
736  C C   . GLU A 88 ? 0.1670 0.0994 0.2640 -0.0284 -0.0138 0.0185  88 GLU A C   
737  O O   . GLU A 88 ? 0.1904 0.1143 0.2818 -0.0273 -0.0071 0.0135  88 GLU A O   
738  C CB  . GLU A 88 ? 0.1892 0.0935 0.2574 -0.0429 -0.0328 0.0258  88 GLU A CB  
739  C CG  . GLU A 88 ? 0.2904 0.1714 0.3352 -0.0473 -0.0302 0.0212  88 GLU A CG  
740  C CD  . GLU A 88 ? 0.3994 0.2573 0.4134 -0.0539 -0.0220 0.0152  88 GLU A CD  
741  O OE1 . GLU A 88 ? 0.4615 0.3155 0.4660 -0.0583 -0.0236 0.0165  88 GLU A OE1 
742  O OE2 . GLU A 88 ? 0.5742 0.4154 0.5718 -0.0552 -0.0131 0.0090  88 GLU A OE2 
743  N N   . TYR A 89 ? 0.1395 0.0907 0.2575 -0.0228 -0.0160 0.0222  89 TYR A N   
744  C CA  . TYR A 89 ? 0.1490 0.1098 0.2817 -0.0157 -0.0123 0.0207  89 TYR A CA  
745  C C   . TYR A 89 ? 0.1519 0.1131 0.2869 -0.0124 -0.0020 0.0139  89 TYR A C   
746  O O   . TYR A 89 ? 0.1616 0.1223 0.3035 -0.0082 0.0012  0.0111  89 TYR A O   
747  C CB  . TYR A 89 ? 0.1343 0.1111 0.2837 -0.0113 -0.0151 0.0253  89 TYR A CB  
748  C CG  . TYR A 89 ? 0.1324 0.1143 0.2921 -0.0055 -0.0139 0.0248  89 TYR A CG  
749  C CD1 . TYR A 89 ? 0.1479 0.1376 0.3168 -0.0007 -0.0103 0.0223  89 TYR A CD1 
750  C CD2 . TYR A 89 ? 0.1753 0.1530 0.3356 -0.0056 -0.0179 0.0277  89 TYR A CD2 
751  C CE1 . TYR A 89 ? 0.1583 0.1501 0.3354 0.0040  -0.0117 0.0227  89 TYR A CE1 
752  C CE2 . TYR A 89 ? 0.1866 0.1668 0.3540 -0.0009 -0.0177 0.0277  89 TYR A CE2 
753  C CZ  . TYR A 89 ? 0.1654 0.1517 0.3401 0.0037  -0.0153 0.0254  89 TYR A CZ  
754  O OH  . TYR A 89 ? 0.1839 0.1696 0.3640 0.0076  -0.0179 0.0265  89 TYR A OH  
755  N N   . PHE A 90 ? 0.1402 0.1022 0.2719 -0.0141 0.0038  0.0111  90 PHE A N   
756  C CA  . PHE A 90 ? 0.1500 0.1147 0.2900 -0.0111 0.0147  0.0049  90 PHE A CA  
757  C C   . PHE A 90 ? 0.1914 0.1380 0.3144 -0.0158 0.0250  -0.0014 90 PHE A C   
758  O O   . PHE A 90 ? 0.2082 0.1558 0.3387 -0.0143 0.0366  -0.0069 90 PHE A O   
759  C CB  . PHE A 90 ? 0.1483 0.1257 0.2979 -0.0101 0.0158  0.0057  90 PHE A CB  
760  C CG  . PHE A 90 ? 0.1251 0.1169 0.2893 -0.0054 0.0080  0.0107  90 PHE A CG  
761  C CD1 . PHE A 90 ? 0.1377 0.1374 0.3188 0.0006  0.0073  0.0101  90 PHE A CD1 
762  C CD2 . PHE A 90 ? 0.1404 0.1355 0.3006 -0.0074 0.0011  0.0160  90 PHE A CD2 
763  C CE1 . PHE A 90 ? 0.1619 0.1696 0.3504 0.0038  0.0003  0.0146  90 PHE A CE1 
764  C CE2 . PHE A 90 ? 0.1399 0.1449 0.3110 -0.0033 -0.0036 0.0200  90 PHE A CE2 
765  C CZ  . PHE A 90 ? 0.1382 0.1479 0.3204 0.0017  -0.0039 0.0191  90 PHE A CZ  
766  N N   . LYS A 91 ? 0.2299 0.1579 0.3296 -0.0219 0.0213  -0.0007 91 LYS A N   
767  C CA  . LYS A 91 ? 0.2959 0.1997 0.3705 -0.0282 0.0316  -0.0069 91 LYS A CA  
768  C C   . LYS A 91 ? 0.2904 0.1941 0.3781 -0.0232 0.0471  -0.0146 91 LYS A C   
769  O O   . LYS A 91 ? 0.3052 0.2004 0.3866 -0.0259 0.0613  -0.0205 91 LYS A O   
770  C CB  . LYS A 91 ? 0.3334 0.2156 0.3826 -0.0348 0.0227  -0.0046 91 LYS A CB  
771  C CG  . LYS A 91 ? 0.4168 0.2686 0.4358 -0.0413 0.0338  -0.0117 91 LYS A CG  
772  C CD  . LYS A 91 ? 0.4893 0.3225 0.4900 -0.0455 0.0240  -0.0096 91 LYS A CD  
773  C CE  . LYS A 91 ? 0.5917 0.3890 0.5550 -0.0538 0.0340  -0.0164 91 LYS A CE  
774  N NZ  . LYS A 91 ? 0.6109 0.3866 0.5409 -0.0650 0.0286  -0.0142 91 LYS A NZ  
775  N N   . ASP A 92 ? 0.2770 0.1906 0.3850 -0.0159 0.0441  -0.0141 92 ASP A N   
776  C CA  . ASP A 92 ? 0.3017 0.2157 0.4278 -0.0098 0.0561  -0.0206 92 ASP A CA  
777  C C   . ASP A 92 ? 0.2931 0.2310 0.4562 -0.0014 0.0562  -0.0201 92 ASP A C   
778  O O   . ASP A 92 ? 0.2901 0.2313 0.4758 0.0047  0.0626  -0.0240 92 ASP A O   
779  C CB  . ASP A 92 ? 0.3316 0.2355 0.4525 -0.0083 0.0512  -0.0203 92 ASP A CB  
780  C CG  . ASP A 92 ? 0.3727 0.2488 0.4568 -0.0172 0.0520  -0.0219 92 ASP A CG  
781  O OD1 . ASP A 92 ? 0.4552 0.3138 0.5194 -0.0229 0.0645  -0.0275 92 ASP A OD1 
782  O OD2 . ASP A 92 ? 0.4184 0.2890 0.4924 -0.0193 0.0395  -0.0172 92 ASP A OD2 
783  N N   . CYS A 93 ? 0.2601 0.2132 0.4304 -0.0013 0.0491  -0.0154 93 CYS A N   
784  C CA  . CYS A 93 ? 0.2568 0.2292 0.4580 0.0053  0.0467  -0.0142 93 CYS A CA  
785  C C   . CYS A 93 ? 0.2817 0.2576 0.5026 0.0067  0.0613  -0.0205 93 CYS A C   
786  O O   . CYS A 93 ? 0.3181 0.2872 0.5258 0.0010  0.0716  -0.0237 93 CYS A O   
787  C CB  . CYS A 93 ? 0.2059 0.1903 0.4056 0.0042  0.0356  -0.0077 93 CYS A CB  
788  S SG  . CYS A 93 ? 0.2474 0.2521 0.4805 0.0108  0.0301  -0.0056 93 CYS A SG  
789  N N   . PRO A 94 ? 0.2913 0.2779 0.5454 0.0138  0.0614  -0.0217 94 PRO A N   
790  C CA  . PRO A 94 ? 0.3140 0.3058 0.5929 0.0150  0.0757  -0.0273 94 PRO A CA  
791  C C   . PRO A 94 ? 0.3211 0.3308 0.6193 0.0159  0.0683  -0.0234 94 PRO A C   
792  O O   . PRO A 94 ? 0.3609 0.3780 0.6858 0.0171  0.0777  -0.0269 94 PRO A O   
793  C CB  . PRO A 94 ? 0.3312 0.3238 0.6395 0.0222  0.0790  -0.0306 94 PRO A CB  
794  C CG  . PRO A 94 ? 0.2885 0.2832 0.5942 0.0259  0.0609  -0.0244 94 PRO A CG  
795  C CD  . PRO A 94 ? 0.2930 0.2810 0.5613 0.0201  0.0527  -0.0199 94 PRO A CD  
796  S SG  . CYS A 99 ? 0.4219 0.4573 0.6462 -0.0127 0.0405  -0.0018 99 CYS A SG  
797  N N   . ARG B 3  ? 0.2894 0.2285 0.5143 0.0029  -0.1204 0.0503  3  ARG B N   
798  C CA  . ARG B 3  ? 0.2760 0.2198 0.4837 0.0035  -0.1018 0.0512  3  ARG B CA  
799  C C   . ARG B 3  ? 0.2236 0.1873 0.4453 0.0006  -0.0835 0.0518  3  ARG B C   
800  O O   . ARG B 3  ? 0.1950 0.1601 0.4139 -0.0011 -0.0814 0.0502  3  ARG B O   
801  C CB  . ARG B 3  ? 0.3039 0.2274 0.4670 0.0054  -0.0993 0.0490  3  ARG B CB  
802  C CG  . ARG B 3  ? 0.3522 0.2502 0.4901 0.0097  -0.1141 0.0486  3  ARG B CG  
803  C CD  . ARG B 3  ? 0.3989 0.2733 0.4912 0.0122  -0.1092 0.0468  3  ARG B CD  
804  N NE  . ARG B 3  ? 0.4278 0.2780 0.4919 0.0171  -0.1153 0.0477  3  ARG B NE  
805  C CZ  . ARG B 3  ? 0.4859 0.3087 0.5284 0.0218  -0.1356 0.0465  3  ARG B CZ  
806  N NH1 . ARG B 3  ? 0.4630 0.2795 0.5100 0.0216  -0.1524 0.0439  3  ARG B NH1 
807  N NH2 . ARG B 3  ? 0.4966 0.2959 0.5109 0.0270  -0.1396 0.0477  3  ARG B NH2 
808  N N   . PRO B 4  ? 0.1890 0.1651 0.4216 0.0008  -0.0706 0.0539  4  PRO B N   
809  C CA  . PRO B 4  ? 0.1800 0.1719 0.4269 -0.0007 -0.0557 0.0547  4  PRO B CA  
810  C C   . PRO B 4  ? 0.1464 0.1368 0.3694 -0.0019 -0.0474 0.0518  4  PRO B C   
811  O O   . PRO B 4  ? 0.1549 0.1533 0.3859 -0.0030 -0.0412 0.0515  4  PRO B O   
812  C CB  . PRO B 4  ? 0.1863 0.1850 0.4409 0.0008  -0.0457 0.0569  4  PRO B CB  
813  C CG  . PRO B 4  ? 0.2484 0.2362 0.4941 0.0027  -0.0552 0.0574  4  PRO B CG  
814  C CD  . PRO B 4  ? 0.2004 0.1750 0.4385 0.0031  -0.0725 0.0561  4  PRO B CD  
815  N N   . LEU B 5  ? 0.1409 0.1207 0.3364 -0.0014 -0.0460 0.0499  5  LEU B N   
816  C CA  . LEU B 5  ? 0.1220 0.1014 0.3001 -0.0023 -0.0374 0.0475  5  LEU B CA  
817  C C   . LEU B 5  ? 0.1280 0.1006 0.2994 -0.0026 -0.0441 0.0460  5  LEU B C   
818  O O   . LEU B 5  ? 0.1227 0.1016 0.2934 -0.0035 -0.0370 0.0447  5  LEU B O   
819  C CB  . LEU B 5  ? 0.1399 0.1098 0.2951 -0.0016 -0.0316 0.0467  5  LEU B CB  
820  C CG  . LEU B 5  ? 0.1564 0.1305 0.3033 -0.0027 -0.0208 0.0446  5  LEU B CG  
821  C CD1 . LEU B 5  ? 0.1805 0.1714 0.3440 -0.0038 -0.0127 0.0441  5  LEU B CD1 
822  C CD2 . LEU B 5  ? 0.1812 0.1434 0.3080 -0.0021 -0.0143 0.0442  5  LEU B CD2 
823  N N   . GLU B 6  ? 0.1388 0.0970 0.3035 -0.0016 -0.0583 0.0458  6  GLU B N   
824  C CA  . GLU B 6  ? 0.1424 0.0907 0.2986 -0.0017 -0.0664 0.0438  6  GLU B CA  
825  C C   . GLU B 6  ? 0.1405 0.1039 0.3244 -0.0040 -0.0653 0.0445  6  GLU B C   
826  O O   . GLU B 6  ? 0.1361 0.0998 0.3141 -0.0047 -0.0614 0.0430  6  GLU B O   
827  C CB  . GLU B 6  ? 0.1849 0.1128 0.3302 0.0002  -0.0852 0.0431  6  GLU B CB  
828  C CG  . GLU B 6  ? 0.2393 0.1451 0.3474 0.0038  -0.0847 0.0425  6  GLU B CG  
829  C CD  . GLU B 6  ? 0.3498 0.2291 0.4384 0.0071  -0.1047 0.0412  6  GLU B CD  
830  O OE1 . GLU B 6  ? 0.3957 0.2769 0.5066 0.0062  -0.1213 0.0409  6  GLU B OE1 
831  O OE2 . GLU B 6  ? 0.3488 0.2034 0.3999 0.0111  -0.1041 0.0407  6  GLU B OE2 
832  N N   . GLN B 7  ? 0.1263 0.1014 0.3407 -0.0049 -0.0670 0.0472  7  GLN B N   
833  C CA  . GLN B 7  ? 0.1304 0.1176 0.3722 -0.0066 -0.0633 0.0487  7  GLN B CA  
834  C C   . GLN B 7  ? 0.0979 0.0955 0.3353 -0.0064 -0.0463 0.0488  7  GLN B C   
835  O O   . GLN B 7  ? 0.0928 0.0933 0.3346 -0.0072 -0.0424 0.0486  7  GLN B O   
836  C CB  . GLN B 7  ? 0.1330 0.1299 0.4088 -0.0066 -0.0644 0.0524  7  GLN B CB  
837  C CG  . GLN B 7  ? 0.2204 0.2079 0.5057 -0.0064 -0.0836 0.0523  7  GLN B CG  
838  C CD  . GLN B 7  ? 0.2654 0.2634 0.5876 -0.0060 -0.0840 0.0562  7  GLN B CD  
839  O OE1 . GLN B 7  ? 0.3588 0.3671 0.7140 -0.0075 -0.0793 0.0589  7  GLN B OE1 
840  N NE2 . GLN B 7  ? 0.3425 0.3365 0.6620 -0.0038 -0.0897 0.0569  7  GLN B NE2 
841  N N   . ALA B 8  ? 0.0925 0.0938 0.3201 -0.0052 -0.0371 0.0488  8  ALA B N   
842  C CA  . ALA B 8  ? 0.0785 0.0875 0.3009 -0.0045 -0.0238 0.0482  8  ALA B CA  
843  C C   . ALA B 8  ? 0.0966 0.1014 0.2997 -0.0046 -0.0226 0.0452  8  ALA B C   
844  O O   . ALA B 8  ? 0.0859 0.0954 0.2907 -0.0041 -0.0164 0.0449  8  ALA B O   
845  C CB  . ALA B 8  ? 0.0953 0.1072 0.3111 -0.0034 -0.0167 0.0481  8  ALA B CB  
846  N N   . VAL B 9  ? 0.0956 0.0900 0.2791 -0.0046 -0.0270 0.0434  9  VAL B N   
847  C CA  . VAL B 9  ? 0.0981 0.0879 0.2644 -0.0040 -0.0235 0.0410  9  VAL B CA  
848  C C   . VAL B 9  ? 0.0992 0.0845 0.2675 -0.0045 -0.0294 0.0406  9  VAL B C   
849  O O   . VAL B 9  ? 0.1062 0.0943 0.2714 -0.0039 -0.0240 0.0395  9  VAL B O   
850  C CB  . VAL B 9  ? 0.1209 0.0981 0.2649 -0.0031 -0.0231 0.0399  9  VAL B CB  
851  C CG1 . VAL B 9  ? 0.1575 0.1301 0.2870 -0.0020 -0.0173 0.0381  9  VAL B CG1 
852  C CG2 . VAL B 9  ? 0.1362 0.1191 0.2821 -0.0033 -0.0162 0.0404  9  VAL B CG2 
853  N N   . ALA B 10 ? 0.1059 0.0841 0.2817 -0.0055 -0.0413 0.0412  10 ALA B N   
854  C CA  . ALA B 10 ? 0.1028 0.0773 0.2843 -0.0065 -0.0471 0.0407  10 ALA B CA  
855  C C   . ALA B 10 ? 0.0886 0.0770 0.2912 -0.0071 -0.0382 0.0426  10 ALA B C   
856  O O   . ALA B 10 ? 0.0919 0.0786 0.2912 -0.0071 -0.0361 0.0418  10 ALA B O   
857  C CB  . ALA B 10 ? 0.1421 0.1080 0.3354 -0.0078 -0.0636 0.0410  10 ALA B CB  
858  N N   . ALA B 11 ? 0.0735 0.0729 0.2935 -0.0069 -0.0315 0.0453  11 ALA B N   
859  C CA  . ALA B 11 ? 0.0758 0.0837 0.3100 -0.0061 -0.0209 0.0476  11 ALA B CA  
860  C C   . ALA B 11 ? 0.0751 0.0848 0.2915 -0.0038 -0.0119 0.0457  11 ALA B C   
861  O O   . ALA B 11 ? 0.0836 0.0938 0.3018 -0.0026 -0.0064 0.0464  11 ALA B O   
862  C CB  . ALA B 11 ? 0.0867 0.1019 0.3395 -0.0051 -0.0145 0.0510  11 ALA B CB  
863  N N   . ILE B 12 ? 0.0722 0.0821 0.2724 -0.0028 -0.0104 0.0435  12 ILE B N   
864  C CA  A ILE B 12 ? 0.0854 0.0979 0.2738 -0.0005 -0.0035 0.0415  12 ILE B CA  
865  C CA  B ILE B 12 ? 0.0767 0.0890 0.2644 -0.0006 -0.0037 0.0414  12 ILE B CA  
866  C C   . ILE B 12 ? 0.0896 0.0965 0.2684 -0.0003 -0.0055 0.0399  12 ILE B C   
867  O O   . ILE B 12 ? 0.0801 0.0888 0.2559 0.0019  -0.0007 0.0394  12 ILE B O   
868  C CB  A ILE B 12 ? 0.0915 0.1068 0.2708 0.0002  -0.0006 0.0396  12 ILE B CB  
869  C CB  B ILE B 12 ? 0.0798 0.0932 0.2582 -0.0006 -0.0027 0.0396  12 ILE B CB  
870  C CG1 A ILE B 12 ? 0.1389 0.1479 0.3064 -0.0010 -0.0039 0.0380  12 ILE B CG1 
871  C CG1 B ILE B 12 ? 0.0822 0.1008 0.2683 0.0001  0.0009  0.0408  12 ILE B CG1 
872  C CG2 A ILE B 12 ? 0.1026 0.1216 0.2901 0.0003  0.0015  0.0411  12 ILE B CG2 
873  C CG2 B ILE B 12 ? 0.0755 0.0902 0.2437 0.0010  0.0012  0.0369  12 ILE B CG2 
874  C CD1 A ILE B 12 ? 0.1342 0.1462 0.2967 -0.0006 0.0010  0.0362  12 ILE B CD1 
875  C CD1 B ILE B 12 ? 0.1130 0.1321 0.2941 -0.0007 0.0012  0.0396  12 ILE B CD1 
876  N N   . VAL B 13 ? 0.0899 0.0875 0.2620 -0.0020 -0.0133 0.0390  13 VAL B N   
877  C CA  . VAL B 13 ? 0.1020 0.0915 0.2632 -0.0014 -0.0151 0.0374  13 VAL B CA  
878  C C   . VAL B 13 ? 0.0979 0.0876 0.2727 -0.0023 -0.0164 0.0390  13 VAL B C   
879  O O   . VAL B 13 ? 0.1082 0.0966 0.2779 -0.0007 -0.0127 0.0384  13 VAL B O   
880  C CB  . VAL B 13 ? 0.1033 0.0776 0.2492 -0.0020 -0.0236 0.0360  13 VAL B CB  
881  C CG1 . VAL B 13 ? 0.1255 0.0880 0.2586 -0.0010 -0.0262 0.0343  13 VAL B CG1 
882  C CG2 . VAL B 13 ? 0.1183 0.0901 0.2502 -0.0006 -0.0193 0.0352  13 VAL B CG2 
883  N N   . CYS B 14 ? 0.0893 0.0809 0.2835 -0.0046 -0.0206 0.0414  14 CYS B N   
884  C CA  A CYS B 14 ? 0.0925 0.0844 0.3042 -0.0057 -0.0198 0.0435  14 CYS B CA  
885  C CA  B CYS B 14 ? 0.1076 0.0999 0.3202 -0.0057 -0.0195 0.0437  14 CYS B CA  
886  C C   . CYS B 14 ? 0.0992 0.0966 0.3107 -0.0026 -0.0069 0.0452  14 CYS B C   
887  O O   . CYS B 14 ? 0.1018 0.0953 0.3127 -0.0020 -0.0042 0.0455  14 CYS B O   
888  C CB  A CYS B 14 ? 0.0823 0.0772 0.3196 -0.0083 -0.0246 0.0462  14 CYS B CB  
889  C CB  B CYS B 14 ? 0.1075 0.1043 0.3464 -0.0079 -0.0221 0.0468  14 CYS B CB  
890  S SG  A CYS B 14 ? 0.0996 0.0959 0.3680 -0.0103 -0.0217 0.0500  14 CYS B SG  
891  S SG  B CYS B 14 ? 0.2073 0.1949 0.4556 -0.0115 -0.0407 0.0454  14 CYS B SG  
892  N N   . THR B 15 ? 0.0933 0.0971 0.3025 -0.0002 0.0003  0.0459  15 THR B N   
893  C CA  . THR B 15 ? 0.1092 0.1139 0.3137 0.0039  0.0106  0.0471  15 THR B CA  
894  C C   . THR B 15 ? 0.0978 0.1000 0.2840 0.0064  0.0106  0.0441  15 THR B C   
895  O O   . THR B 15 ? 0.1119 0.1103 0.2941 0.0092  0.0153  0.0449  15 THR B O   
896  C CB  . THR B 15 ? 0.1054 0.1140 0.3072 0.0065  0.0160  0.0476  15 THR B CB  
897  O OG1 . THR B 15 ? 0.1483 0.1587 0.3687 0.0049  0.0176  0.0511  15 THR B OG1 
898  C CG2 . THR B 15 ? 0.1514 0.1558 0.3429 0.0120  0.0250  0.0486  15 THR B CG2 
899  N N   . PHE B 16 ? 0.0867 0.0901 0.2621 0.0059  0.0060  0.0408  16 PHE B N   
900  C CA  . PHE B 16 ? 0.0940 0.0955 0.2562 0.0085  0.0069  0.0384  16 PHE B CA  
901  C C   . PHE B 16 ? 0.1155 0.1094 0.2762 0.0080  0.0052  0.0386  16 PHE B C   
902  O O   . PHE B 16 ? 0.1118 0.1038 0.2666 0.0113  0.0090  0.0385  16 PHE B O   
903  C CB  . PHE B 16 ? 0.0889 0.0913 0.2429 0.0078  0.0045  0.0357  16 PHE B CB  
904  C CG  . PHE B 16 ? 0.0945 0.0962 0.2395 0.0109  0.0069  0.0336  16 PHE B CG  
905  C CD1 . PHE B 16 ? 0.0697 0.0786 0.2162 0.0142  0.0099  0.0323  16 PHE B CD1 
906  C CD2 . PHE B 16 ? 0.1077 0.1002 0.2430 0.0110  0.0058  0.0326  16 PHE B CD2 
907  C CE1 . PHE B 16 ? 0.0935 0.1031 0.2366 0.0175  0.0117  0.0304  16 PHE B CE1 
908  C CE2 . PHE B 16 ? 0.1089 0.1012 0.2383 0.0146  0.0099  0.0311  16 PHE B CE2 
909  C CZ  . PHE B 16 ? 0.1110 0.1132 0.2467 0.0176  0.0129  0.0301  16 PHE B CZ  
910  N N   . GLN B 17 ? 0.1207 0.1087 0.2857 0.0042  -0.0015 0.0388  17 GLN B N   
911  C CA  . GLN B 17 ? 0.1320 0.1103 0.2956 0.0031  -0.0052 0.0385  17 GLN B CA  
912  C C   . GLN B 17 ? 0.1407 0.1195 0.3156 0.0039  0.0010  0.0415  17 GLN B C   
913  O O   . GLN B 17 ? 0.1482 0.1208 0.3172 0.0055  0.0029  0.0412  17 GLN B O   
914  C CB  . GLN B 17 ? 0.1763 0.1474 0.3459 -0.0012 -0.0162 0.0381  17 GLN B CB  
915  C CG  . GLN B 17 ? 0.2655 0.2250 0.4382 -0.0035 -0.0233 0.0375  17 GLN B CG  
916  C CD  . GLN B 17 ? 0.3568 0.3069 0.5329 -0.0071 -0.0380 0.0361  17 GLN B CD  
917  O OE1 . GLN B 17 ? 0.4547 0.4096 0.6378 -0.0081 -0.0414 0.0368  17 GLN B OE1 
918  N NE2 . GLN B 17 ? 0.4581 0.3929 0.6277 -0.0084 -0.0479 0.0338  17 GLN B NE2 
919  N N   . GLU B 18 ? 0.1328 0.1171 0.3234 0.0034  0.0055  0.0447  18 GLU B N   
920  C CA  . GLU B 18 ? 0.1439 0.1259 0.3451 0.0049  0.0147  0.0486  18 GLU B CA  
921  C C   . GLU B 18 ? 0.1295 0.1086 0.3128 0.0109  0.0222  0.0484  18 GLU B C   
922  O O   . GLU B 18 ? 0.1794 0.1512 0.3618 0.0125  0.0269  0.0501  18 GLU B O   
923  C CB  . GLU B 18 ? 0.1670 0.1536 0.3845 0.0049  0.0210  0.0524  18 GLU B CB  
924  C CG  . GLU B 18 ? 0.2557 0.2371 0.4811 0.0080  0.0346  0.0574  18 GLU B CG  
925  C CD  . GLU B 18 ? 0.3431 0.3280 0.5858 0.0080  0.0414  0.0614  18 GLU B CD  
926  O OE1 . GLU B 18 ? 0.3661 0.3582 0.6109 0.0063  0.0352  0.0597  18 GLU B OE1 
927  O OE2 . GLU B 18 ? 0.4653 0.4445 0.7191 0.0102  0.0543  0.0665  18 GLU B OE2 
928  N N   . TYR B 19 ? 0.1169 0.1004 0.2860 0.0145  0.0224  0.0460  19 TYR B N   
929  C CA  . TYR B 19 ? 0.1274 0.1076 0.2805 0.0208  0.0264  0.0452  19 TYR B CA  
930  C C   . TYR B 19 ? 0.1242 0.1032 0.2673 0.0219  0.0221  0.0420  19 TYR B C   
931  O O   . TYR B 19 ? 0.1305 0.1030 0.2656 0.0257  0.0250  0.0425  19 TYR B O   
932  C CB  . TYR B 19 ? 0.1410 0.1256 0.2868 0.0245  0.0271  0.0439  19 TYR B CB  
933  C CG  . TYR B 19 ? 0.1436 0.1234 0.2924 0.0265  0.0348  0.0477  19 TYR B CG  
934  C CD1 . TYR B 19 ? 0.1233 0.1070 0.2885 0.0221  0.0361  0.0500  19 TYR B CD1 
935  C CD2 . TYR B 19 ? 0.1658 0.1345 0.2992 0.0337  0.0413  0.0492  19 TYR B CD2 
936  C CE1 . TYR B 19 ? 0.1586 0.1368 0.3280 0.0245  0.0457  0.0542  19 TYR B CE1 
937  C CE2 . TYR B 19 ? 0.1756 0.1359 0.3082 0.0366  0.0508  0.0531  19 TYR B CE2 
938  C CZ  . TYR B 19 ? 0.2001 0.1660 0.3519 0.0319  0.0538  0.0557  19 TYR B CZ  
939  O OH  . TYR B 19 ? 0.2616 0.2185 0.4141 0.0353  0.0653  0.0602  19 TYR B OH  
940  N N   . ALA B 20 ? 0.1230 0.1067 0.2650 0.0193  0.0164  0.0391  20 ALA B N   
941  C CA  . ALA B 20 ? 0.1138 0.0951 0.2459 0.0213  0.0148  0.0365  20 ALA B CA  
942  C C   . ALA B 20 ? 0.1284 0.0995 0.2583 0.0194  0.0134  0.0369  20 ALA B C   
943  O O   . ALA B 20 ? 0.1475 0.1137 0.2679 0.0228  0.0147  0.0357  20 ALA B O   
944  C CB  . ALA B 20 ? 0.1359 0.1220 0.2668 0.0193  0.0118  0.0341  20 ALA B CB  
945  N N   . GLY B 21 ? 0.1439 0.1108 0.2839 0.0146  0.0105  0.0386  21 GLY B N   
946  C CA  . GLY B 21 ? 0.1554 0.1114 0.2947 0.0124  0.0073  0.0384  21 GLY B CA  
947  C C   . GLY B 21 ? 0.1478 0.0990 0.2905 0.0145  0.0136  0.0411  21 GLY B C   
948  O O   . GLY B 21 ? 0.1780 0.1194 0.3222 0.0126  0.0117  0.0413  21 GLY B O   
949  N N   . ARG B 22 ? 0.1317 0.0868 0.2741 0.0187  0.0214  0.0434  22 ARG B N   
950  C CA  . ARG B 22 ? 0.1430 0.0898 0.2845 0.0218  0.0290  0.0466  22 ARG B CA  
951  C C   . ARG B 22 ? 0.1376 0.0763 0.2659 0.0248  0.0285  0.0449  22 ARG B C   
952  O O   . ARG B 22 ? 0.1559 0.0849 0.2877 0.0235  0.0308  0.0467  22 ARG B O   
953  C CB  . ARG B 22 ? 0.1460 0.0929 0.2796 0.0283  0.0369  0.0487  22 ARG B CB  
954  C CG  . ARG B 22 ? 0.1635 0.1138 0.3094 0.0264  0.0411  0.0517  22 ARG B CG  
955  C CD  . ARG B 22 ? 0.2153 0.1612 0.3452 0.0342  0.0473  0.0528  22 ARG B CD  
956  N NE  . ARG B 22 ? 0.1995 0.1450 0.3374 0.0340  0.0541  0.0561  22 ARG B NE  
957  C CZ  . ARG B 22 ? 0.1944 0.1337 0.3168 0.0406  0.0586  0.0568  22 ARG B CZ  
958  N NH1 . ARG B 22 ? 0.2290 0.1623 0.3289 0.0479  0.0555  0.0543  22 ARG B NH1 
959  N NH2 . ARG B 22 ? 0.2355 0.1725 0.3652 0.0405  0.0663  0.0603  22 ARG B NH2 
960  N N   . CYS B 23 ? 0.1562 0.0988 0.2714 0.0291  0.0263  0.0419  23 CYS B N   
961  C CA  . CYS B 23 ? 0.1665 0.1016 0.2695 0.0332  0.0268  0.0405  23 CYS B CA  
962  C C   . CYS B 23 ? 0.1704 0.1120 0.2665 0.0362  0.0241  0.0372  23 CYS B C   
963  O O   . CYS B 23 ? 0.1678 0.1198 0.2678 0.0363  0.0226  0.0361  23 CYS B O   
964  C CB  . CYS B 23 ? 0.1713 0.0991 0.2660 0.0400  0.0334  0.0431  23 CYS B CB  
965  S SG  . CYS B 23 ? 0.2066 0.1399 0.2943 0.0472  0.0347  0.0433  23 CYS B SG  
966  N N   . GLY B 24 ? 0.1823 0.1171 0.2693 0.0391  0.0244  0.0357  24 GLY B N   
967  C CA  . GLY B 24 ? 0.1645 0.1055 0.2484 0.0429  0.0243  0.0331  24 GLY B CA  
968  C C   . GLY B 24 ? 0.1700 0.1132 0.2552 0.0383  0.0221  0.0315  24 GLY B C   
969  O O   . GLY B 24 ? 0.1823 0.1170 0.2646 0.0332  0.0187  0.0313  24 GLY B O   
970  N N   . ASP B 25 ? 0.1565 0.1096 0.2460 0.0407  0.0237  0.0302  25 ASP B N   
971  C CA  . ASP B 25 ? 0.1645 0.1177 0.2529 0.0379  0.0241  0.0291  25 ASP B CA  
972  C C   . ASP B 25 ? 0.1530 0.1107 0.2474 0.0319  0.0196  0.0297  25 ASP B C   
973  O O   . ASP B 25 ? 0.1601 0.1294 0.2646 0.0318  0.0190  0.0302  25 ASP B O   
974  C CB  . ASP B 25 ? 0.1687 0.1329 0.2659 0.0420  0.0282  0.0282  25 ASP B CB  
975  C CG  . ASP B 25 ? 0.2017 0.1638 0.2970 0.0404  0.0322  0.0277  25 ASP B CG  
976  O OD1 . ASP B 25 ? 0.1872 0.1410 0.2736 0.0358  0.0295  0.0278  25 ASP B OD1 
977  O OD2 . ASP B 25 ? 0.2691 0.2369 0.3729 0.0442  0.0383  0.0274  25 ASP B OD2 
978  N N   . LYS B 26 ? 0.1592 0.1060 0.2463 0.0276  0.0159  0.0294  26 LYS B N   
979  C CA  . LYS B 26 ? 0.1679 0.1173 0.2619 0.0221  0.0104  0.0301  26 LYS B CA  
980  C C   . LYS B 26 ? 0.1584 0.1168 0.2564 0.0215  0.0118  0.0297  26 LYS B C   
981  O O   . LYS B 26 ? 0.1635 0.1259 0.2684 0.0177  0.0079  0.0304  26 LYS B O   
982  C CB  . LYS B 26 ? 0.2244 0.1571 0.3094 0.0184  0.0030  0.0293  26 LYS B CB  
983  C CG  . LYS B 26 ? 0.2731 0.1922 0.3388 0.0199  0.0030  0.0274  26 LYS B CG  
984  C CD  . LYS B 26 ? 0.3761 0.2722 0.4245 0.0185  -0.0054 0.0256  26 LYS B CD  
985  C CE  . LYS B 26 ? 0.4508 0.3427 0.5059 0.0131  -0.0176 0.0253  26 LYS B CE  
986  N NZ  . LYS B 26 ? 0.5051 0.3693 0.5336 0.0141  -0.0259 0.0226  26 LYS B NZ  
987  N N   . TYR B 27 ? 0.1612 0.1230 0.2573 0.0252  0.0178  0.0288  27 TYR B N   
988  C CA  . TYR B 27 ? 0.1653 0.1353 0.2675 0.0243  0.0203  0.0286  27 TYR B CA  
989  C C   . TYR B 27 ? 0.1807 0.1674 0.2989 0.0263  0.0218  0.0283  27 TYR B C   
990  O O   . TYR B 27 ? 0.1974 0.1917 0.3239 0.0254  0.0237  0.0279  27 TYR B O   
991  C CB  . TYR B 27 ? 0.1829 0.1430 0.2743 0.0268  0.0273  0.0282  27 TYR B CB  
992  C CG  . TYR B 27 ? 0.2174 0.1557 0.2866 0.0263  0.0250  0.0279  27 TYR B CG  
993  C CD1 . TYR B 27 ? 0.2303 0.1602 0.2921 0.0223  0.0172  0.0278  27 TYR B CD1 
994  C CD2 . TYR B 27 ? 0.2812 0.2054 0.3359 0.0305  0.0297  0.0274  27 TYR B CD2 
995  C CE1 . TYR B 27 ? 0.2795 0.1851 0.3177 0.0226  0.0120  0.0268  27 TYR B CE1 
996  C CE2 . TYR B 27 ? 0.3322 0.2321 0.3622 0.0308  0.0263  0.0265  27 TYR B CE2 
997  C CZ  . TYR B 27 ? 0.3292 0.2193 0.3506 0.0269  0.0166  0.0260  27 TYR B CZ  
998  O OH  . TYR B 27 ? 0.3802 0.2426 0.3745 0.0280  0.0107  0.0245  27 TYR B OH  
999  N N   . LYS B 28 ? 0.1720 0.1623 0.2936 0.0291  0.0202  0.0284  28 LYS B N   
1000 C CA  . LYS B 28 ? 0.1753 0.1767 0.3077 0.0324  0.0191  0.0275  28 LYS B CA  
1001 C C   . LYS B 28 ? 0.1750 0.1759 0.3055 0.0333  0.0157  0.0285  28 LYS B C   
1002 O O   . LYS B 28 ? 0.1836 0.1764 0.3074 0.0325  0.0161  0.0303  28 LYS B O   
1003 C CB  . LYS B 28 ? 0.2117 0.2145 0.3472 0.0383  0.0212  0.0265  28 LYS B CB  
1004 C CG  . LYS B 28 ? 0.2603 0.2607 0.3971 0.0389  0.0280  0.0263  28 LYS B CG  
1005 C CD  . LYS B 28 ? 0.3435 0.3493 0.4918 0.0449  0.0305  0.0254  28 LYS B CD  
1006 C CE  . LYS B 28 ? 0.3991 0.4037 0.5536 0.0454  0.0403  0.0259  28 LYS B CE  
1007 N NZ  . LYS B 28 ? 0.4060 0.4153 0.5676 0.0408  0.0422  0.0260  28 LYS B NZ  
1008 N N   . LEU B 29 ? 0.1734 0.1809 0.3094 0.0351  0.0128  0.0276  29 LEU B N   
1009 C CA  . LEU B 29 ? 0.1444 0.1476 0.2741 0.0385  0.0108  0.0285  29 LEU B CA  
1010 C C   . LEU B 29 ? 0.1648 0.1702 0.2957 0.0450  0.0061  0.0260  29 LEU B C   
1011 O O   . LEU B 29 ? 0.1741 0.1879 0.3169 0.0453  0.0042  0.0237  29 LEU B O   
1012 C CB  . LEU B 29 ? 0.1414 0.1469 0.2732 0.0360  0.0097  0.0288  29 LEU B CB  
1013 C CG  . LEU B 29 ? 0.1304 0.1354 0.2652 0.0298  0.0123  0.0311  29 LEU B CG  
1014 C CD1 . LEU B 29 ? 0.1814 0.1896 0.3195 0.0282  0.0114  0.0311  29 LEU B CD1 
1015 C CD2 . LEU B 29 ? 0.2212 0.2169 0.3515 0.0298  0.0159  0.0343  29 LEU B CD2 
1016 N N   A CYS B 30 ? 0.2000 0.1959 0.3187 0.0506  0.0045  0.0268  30 CYS B N   
1017 N N   B CYS B 30 ? 0.1910 0.1876 0.3103 0.0506  0.0039  0.0265  30 CYS B N   
1018 C CA  A CYS B 30 ? 0.2073 0.2005 0.3220 0.0580  -0.0033 0.0242  30 CYS B CA  
1019 C CA  B CYS B 30 ? 0.1932 0.1906 0.3133 0.0567  -0.0043 0.0234  30 CYS B CA  
1020 C C   A CYS B 30 ? 0.2123 0.2043 0.3242 0.0576  -0.0075 0.0230  30 CYS B C   
1021 C C   B CYS B 30 ? 0.2038 0.1973 0.3176 0.0570  -0.0077 0.0228  30 CYS B C   
1022 O O   A CYS B 30 ? 0.2021 0.1914 0.3102 0.0536  -0.0018 0.0255  30 CYS B O   
1023 O O   B CYS B 30 ? 0.1991 0.1886 0.3074 0.0535  -0.0018 0.0255  30 CYS B O   
1024 C CB  A CYS B 30 ? 0.2265 0.2048 0.3231 0.0649  -0.0023 0.0261  30 CYS B CB  
1025 C CB  B CYS B 30 ? 0.1963 0.1828 0.3034 0.0646  -0.0066 0.0237  30 CYS B CB  
1026 S SG  A CYS B 30 ? 0.2765 0.2541 0.3747 0.0678  0.0001  0.0265  30 CYS B SG  
1027 S SG  B CYS B 30 ? 0.1932 0.1607 0.2763 0.0677  -0.0011 0.0276  30 CYS B SG  
1028 N N   . GLN B 31 ? 0.2142 0.2075 0.3293 0.0617  -0.0178 0.0190  31 GLN B N   
1029 C CA  . GLN B 31 ? 0.2334 0.2214 0.3416 0.0622  -0.0225 0.0175  31 GLN B CA  
1030 C C   . GLN B 31 ? 0.2264 0.1948 0.3081 0.0671  -0.0180 0.0205  31 GLN B C   
1031 O O   . GLN B 31 ? 0.2290 0.1927 0.3046 0.0655  -0.0151 0.0214  31 GLN B O   
1032 C CB  . GLN B 31 ? 0.2583 0.2497 0.3762 0.0656  -0.0370 0.0120  31 GLN B CB  
1033 C CG  . GLN B 31 ? 0.2778 0.2869 0.4222 0.0574  -0.0368 0.0102  31 GLN B CG  
1034 C CD  . GLN B 31 ? 0.3989 0.4160 0.5647 0.0588  -0.0495 0.0051  31 GLN B CD  
1035 O OE1 . GLN B 31 ? 0.4496 0.4587 0.6101 0.0660  -0.0620 0.0019  31 GLN B OE1 
1036 N NE2 . GLN B 31 ? 0.4026 0.4345 0.5935 0.0520  -0.0467 0.0043  31 GLN B NE2 
1037 N N   . ALA B 32 ? 0.2460 0.2020 0.3123 0.0731  -0.0154 0.0226  32 ALA B N   
1038 C CA  . ALA B 32 ? 0.2595 0.1946 0.3009 0.0779  -0.0073 0.0266  32 ALA B CA  
1039 C C   . ALA B 32 ? 0.2451 0.1843 0.2947 0.0704  0.0062  0.0313  32 ALA B C   
1040 O O   . ALA B 32 ? 0.2737 0.2014 0.3124 0.0718  0.0132  0.0341  32 ALA B O   
1041 C CB  . ALA B 32 ? 0.2932 0.2135 0.3175 0.0854  -0.0056 0.0284  32 ALA B CB  
1042 N N   . GLU B 33 ? 0.2125 0.1669 0.2817 0.0631  0.0092  0.0321  33 GLU B N   
1043 C CA  . GLU B 33 ? 0.1710 0.1298 0.2513 0.0559  0.0184  0.0360  33 GLU B CA  
1044 C C   . GLU B 33 ? 0.1565 0.1243 0.2467 0.0510  0.0168  0.0348  33 GLU B C   
1045 O O   . GLU B 33 ? 0.1641 0.1292 0.2573 0.0483  0.0241  0.0383  33 GLU B O   
1046 C CB  . GLU B 33 ? 0.1571 0.1261 0.2517 0.0500  0.0192  0.0362  33 GLU B CB  
1047 C CG  . GLU B 33 ? 0.1713 0.1300 0.2576 0.0535  0.0235  0.0384  33 GLU B CG  
1048 C CD  . GLU B 33 ? 0.1990 0.1647 0.2945 0.0495  0.0222  0.0375  33 GLU B CD  
1049 O OE1 . GLU B 33 ? 0.1956 0.1719 0.2986 0.0479  0.0169  0.0342  33 GLU B OE1 
1050 O OE2 . GLU B 33 ? 0.2383 0.1964 0.3319 0.0490  0.0270  0.0400  33 GLU B OE2 
1051 N N   . LEU B 34 ? 0.1612 0.1396 0.2590 0.0496  0.0081  0.0304  34 LEU B N   
1052 C CA  . LEU B 34 ? 0.1378 0.1231 0.2436 0.0454  0.0065  0.0292  34 LEU B CA  
1053 C C   . LEU B 34 ? 0.1642 0.1351 0.2533 0.0507  0.0075  0.0298  34 LEU B C   
1054 O O   . LEU B 34 ? 0.1638 0.1341 0.2555 0.0480  0.0128  0.0319  34 LEU B O   
1055 C CB  . LEU B 34 ? 0.1311 0.1284 0.2491 0.0437  -0.0021 0.0246  34 LEU B CB  
1056 C CG  . LEU B 34 ? 0.1218 0.1251 0.2478 0.0395  -0.0041 0.0231  34 LEU B CG  
1057 C CD1 . LEU B 34 ? 0.1305 0.1396 0.2652 0.0326  0.0030  0.0263  34 LEU B CD1 
1058 C CD2 . LEU B 34 ? 0.1493 0.1633 0.2904 0.0382  -0.0116 0.0187  34 LEU B CD2 
1059 N N   . LYS B 35 ? 0.2116 0.1683 0.2817 0.0592  0.0025  0.0279  35 LYS B N   
1060 C CA  . LYS B 35 ? 0.2429 0.1799 0.2905 0.0655  0.0047  0.0287  35 LYS B CA  
1061 C C   . LYS B 35 ? 0.2440 0.1703 0.2855 0.0661  0.0205  0.0353  35 LYS B C   
1062 O O   . LYS B 35 ? 0.2560 0.1756 0.2935 0.0664  0.0269  0.0373  35 LYS B O   
1063 C CB  . LYS B 35 ? 0.2929 0.2110 0.3153 0.0759  -0.0049 0.0255  35 LYS B CB  
1064 C CG  . LYS B 35 ? 0.3820 0.2777 0.3785 0.0824  -0.0046 0.0251  35 LYS B CG  
1065 C CD  . LYS B 35 ? 0.4323 0.3061 0.4009 0.0932  -0.0177 0.0208  35 LYS B CD  
1066 C CE  . LYS B 35 ? 0.5425 0.3880 0.4783 0.1032  -0.0080 0.0254  35 LYS B CE  
1067 N NZ  . LYS B 35 ? 0.6092 0.4256 0.5126 0.1107  -0.0013 0.0271  35 LYS B NZ  
1068 N N   . GLU B 36 ? 0.2477 0.1735 0.2925 0.0656  0.0275  0.0388  36 GLU B N   
1069 C CA  . GLU B 36 ? 0.2443 0.1609 0.2896 0.0656  0.0429  0.0453  36 GLU B CA  
1070 C C   . GLU B 36 ? 0.2104 0.1421 0.2809 0.0569  0.0470  0.0473  36 GLU B C   
1071 O O   . GLU B 36 ? 0.2207 0.1449 0.2922 0.0577  0.0576  0.0514  36 GLU B O   
1072 C CB  . GLU B 36 ? 0.2397 0.1546 0.2878 0.0655  0.0475  0.0480  36 GLU B CB  
1073 C CG  . GLU B 36 ? 0.2280 0.1360 0.2857 0.0638  0.0639  0.0551  36 GLU B CG  
1074 C CD  . GLU B 36 ? 0.2737 0.1837 0.3415 0.0610  0.0670  0.0573  36 GLU B CD  
1075 O OE1 . GLU B 36 ? 0.3037 0.2192 0.3680 0.0612  0.0575  0.0535  36 GLU B OE1 
1076 O OE2 . GLU B 36 ? 0.2662 0.1721 0.3475 0.0585  0.0792  0.0628  36 GLU B OE2 
1077 N N   . LEU B 37 ? 0.1804 0.1318 0.2708 0.0492  0.0393  0.0447  37 LEU B N   
1078 C CA  . LEU B 37 ? 0.1650 0.1295 0.2769 0.0414  0.0400  0.0458  37 LEU B CA  
1079 C C   . LEU B 37 ? 0.1540 0.1161 0.2621 0.0426  0.0407  0.0453  37 LEU B C   
1080 O O   . LEU B 37 ? 0.1763 0.1378 0.2945 0.0409  0.0485  0.0492  37 LEU B O   
1081 C CB  . LEU B 37 ? 0.1391 0.1196 0.2631 0.0353  0.0302  0.0420  37 LEU B CB  
1082 C CG  . LEU B 37 ? 0.1285 0.1199 0.2716 0.0277  0.0291  0.0430  37 LEU B CG  
1083 C CD1 . LEU B 37 ? 0.1233 0.1226 0.2702 0.0240  0.0222  0.0401  37 LEU B CD1 
1084 C CD2 . LEU B 37 ? 0.1162 0.1125 0.2621 0.0260  0.0266  0.0416  37 LEU B CD2 
1085 N N   . LEU B 38 ? 0.1865 0.1470 0.2820 0.0456  0.0322  0.0405  38 LEU B N   
1086 C CA  . LEU B 38 ? 0.1834 0.1412 0.2753 0.0461  0.0315  0.0394  38 LEU B CA  
1087 C C   . LEU B 38 ? 0.2398 0.1765 0.3133 0.0535  0.0425  0.0432  38 LEU B C   
1088 O O   . LEU B 38 ? 0.2526 0.1869 0.3299 0.0529  0.0490  0.0455  38 LEU B O   
1089 C CB  . LEU B 38 ? 0.2104 0.1701 0.2952 0.0474  0.0186  0.0330  38 LEU B CB  
1090 C CG  . LEU B 38 ? 0.1810 0.1600 0.2848 0.0409  0.0104  0.0297  38 LEU B CG  
1091 C CD1 . LEU B 38 ? 0.2020 0.1823 0.3035 0.0428  -0.0014 0.0238  38 LEU B CD1 
1092 C CD2 . LEU B 38 ? 0.2001 0.1906 0.3208 0.0336  0.0131  0.0312  38 LEU B CD2 
1093 N N   . GLN B 39 ? 0.2644 0.1840 0.3171 0.0609  0.0458  0.0442  39 GLN B N   
1094 C CA  . GLN B 39 ? 0.3168 0.2108 0.3465 0.0696  0.0585  0.0483  39 GLN B CA  
1095 C C   . GLN B 39 ? 0.2913 0.1859 0.3391 0.0672  0.0758  0.0559  39 GLN B C   
1096 O O   . GLN B 39 ? 0.3183 0.1996 0.3601 0.0711  0.0879  0.0598  39 GLN B O   
1097 C CB  . GLN B 39 ? 0.3674 0.2398 0.3663 0.0792  0.0565  0.0473  39 GLN B CB  
1098 C CG  . GLN B 39 ? 0.4327 0.3022 0.4163 0.0821  0.0383  0.0395  39 GLN B CG  
1099 C CD  . GLN B 39 ? 0.5208 0.3613 0.4658 0.0941  0.0329  0.0374  39 GLN B CD  
1100 O OE1 . GLN B 39 ? 0.5776 0.4089 0.5118 0.0987  0.0355  0.0393  39 GLN B OE1 
1101 N NE2 . GLN B 39 ? 0.5658 0.3897 0.4882 0.0997  0.0240  0.0330  39 GLN B NE2 
1102 N N   . LYS B 40 ? 0.2603 0.1694 0.3320 0.0609  0.0771  0.0581  40 LYS B N   
1103 C CA  . LYS B 40 ? 0.2422 0.1536 0.3378 0.0577  0.0912  0.0649  40 LYS B CA  
1104 C C   . LYS B 40 ? 0.2335 0.1639 0.3594 0.0496  0.0885  0.0654  40 LYS B C   
1105 O O   . LYS B 40 ? 0.2710 0.1984 0.4118 0.0499  0.1008  0.0707  40 LYS B O   
1106 C CB  . LYS B 40 ? 0.2330 0.1495 0.3416 0.0544  0.0920  0.0667  40 LYS B CB  
1107 C CG  . LYS B 40 ? 0.3065 0.2011 0.3887 0.0630  0.0998  0.0687  40 LYS B CG  
1108 C CD  . LYS B 40 ? 0.3095 0.2079 0.4054 0.0596  0.1017  0.0707  40 LYS B CD  
1109 C CE  . LYS B 40 ? 0.3056 0.1791 0.3712 0.0694  0.1101  0.0730  40 LYS B CE  
1110 N NZ  . LYS B 40 ? 0.3622 0.2390 0.4379 0.0663  0.1100  0.0740  40 LYS B NZ  
1111 N N   . GLU B 41 ? 0.2075 0.1557 0.3417 0.0432  0.0732  0.0601  41 GLU B N   
1112 C CA  . GLU B 41 ? 0.2163 0.1814 0.3779 0.0354  0.0687  0.0604  41 GLU B CA  
1113 C C   . GLU B 41 ? 0.2243 0.1903 0.3829 0.0359  0.0673  0.0590  41 GLU B C   
1114 O O   . GLU B 41 ? 0.2141 0.1899 0.3950 0.0312  0.0668  0.0609  41 GLU B O   
1115 C CB  . GLU B 41 ? 0.1903 0.1704 0.3613 0.0286  0.0551  0.0564  41 GLU B CB  
1116 C CG  . GLU B 41 ? 0.2393 0.2184 0.4138 0.0275  0.0553  0.0573  41 GLU B CG  
1117 C CD  . GLU B 41 ? 0.2547 0.2319 0.4519 0.0256  0.0642  0.0631  41 GLU B CD  
1118 O OE1 . GLU B 41 ? 0.2945 0.2774 0.5143 0.0223  0.0658  0.0658  41 GLU B OE1 
1119 O OE2 . GLU B 41 ? 0.2727 0.2419 0.4670 0.0277  0.0702  0.0652  41 GLU B OE2 
1120 N N   . LEU B 42 ? 0.2223 0.1771 0.3540 0.0416  0.0653  0.0556  42 LEU B N   
1121 C CA  . LEU B 42 ? 0.2313 0.1830 0.3552 0.0430  0.0635  0.0536  42 LEU B CA  
1122 C C   . LEU B 42 ? 0.2523 0.1797 0.3490 0.0526  0.0732  0.0551  42 LEU B C   
1123 O O   . LEU B 42 ? 0.2648 0.1822 0.3396 0.0565  0.0670  0.0507  42 LEU B O   
1124 C CB  . LEU B 42 ? 0.2375 0.1972 0.3541 0.0403  0.0484  0.0465  42 LEU B CB  
1125 C CG  . LEU B 42 ? 0.2403 0.2199 0.3784 0.0318  0.0402  0.0449  42 LEU B CG  
1126 C CD1 . LEU B 42 ? 0.2900 0.2751 0.4218 0.0301  0.0286  0.0387  42 LEU B CD1 
1127 C CD2 . LEU B 42 ? 0.2566 0.2429 0.4117 0.0278  0.0425  0.0475  42 LEU B CD2 
1128 N N   . ALA B 43 ? 0.2485 0.1638 0.3451 0.0570  0.0884  0.0613  43 ALA B N   
1129 C CA  . ALA B 43 ? 0.2893 0.1750 0.3533 0.0681  0.1002  0.0636  43 ALA B CA  
1130 C C   . ALA B 43 ? 0.3195 0.1904 0.3667 0.0732  0.1045  0.0632  43 ALA B C   
1131 O O   . ALA B 43 ? 0.3736 0.2186 0.3831 0.0824  0.1047  0.0610  43 ALA B O   
1132 C CB  . ALA B 43 ? 0.2931 0.1680 0.3650 0.0715  0.1202  0.0718  43 ALA B CB  
1133 N N   . THR B 44 ? 0.2841 0.1695 0.3574 0.0678  0.1068  0.0651  44 THR B N   
1134 C CA  . THR B 44 ? 0.3016 0.1731 0.3618 0.0725  0.1128  0.0656  44 THR B CA  
1135 C C   . THR B 44 ? 0.2825 0.1572 0.3290 0.0704  0.0949  0.0574  44 THR B C   
1136 O O   . THR B 44 ? 0.2989 0.1592 0.3297 0.0748  0.0978  0.0567  44 THR B O   
1137 C CB  . THR B 44 ? 0.2916 0.1733 0.3852 0.0695  0.1255  0.0721  44 THR B CB  
1138 O OG1 . THR B 44 ? 0.2786 0.1889 0.4037 0.0591  0.1123  0.0698  44 THR B OG1 
1139 C CG2 . THR B 44 ? 0.3112 0.1886 0.4214 0.0716  0.1434  0.0801  44 THR B CG2 
1140 N N   . TRP B 45 ? 0.2726 0.1637 0.3245 0.0644  0.0776  0.0515  45 TRP B N   
1141 C CA  . TRP B 45 ? 0.2728 0.1688 0.3197 0.0614  0.0624  0.0446  45 TRP B CA  
1142 C C   . TRP B 45 ? 0.3084 0.1816 0.3191 0.0690  0.0532  0.0388  45 TRP B C   
1143 O O   . TRP B 45 ? 0.3475 0.2153 0.3465 0.0722  0.0488  0.0374  45 TRP B O   
1144 C CB  . TRP B 45 ? 0.2287 0.1525 0.3015 0.0514  0.0498  0.0415  45 TRP B CB  
1145 C CG  . TRP B 45 ? 0.1675 0.1101 0.2708 0.0442  0.0537  0.0453  45 TRP B CG  
1146 C CD1 . TRP B 45 ? 0.1596 0.1031 0.2791 0.0445  0.0665  0.0521  45 TRP B CD1 
1147 C CD2 . TRP B 45 ? 0.1697 0.1309 0.2912 0.0361  0.0442  0.0427  45 TRP B CD2 
1148 N NE1 . TRP B 45 ? 0.1672 0.1282 0.3124 0.0375  0.0628  0.0532  45 TRP B NE1 
1149 C CE2 . TRP B 45 ? 0.1618 0.1326 0.3060 0.0326  0.0498  0.0477  45 TRP B CE2 
1150 C CE3 . TRP B 45 ? 0.2205 0.1899 0.3420 0.0320  0.0318  0.0369  45 TRP B CE3 
1151 C CZ2 . TRP B 45 ? 0.1536 0.1390 0.3148 0.0257  0.0428  0.0468  45 TRP B CZ2 
1152 C CZ3 . TRP B 45 ? 0.2045 0.1886 0.3442 0.0250  0.0280  0.0368  45 TRP B CZ3 
1153 C CH2 . TRP B 45 ? 0.2076 0.1980 0.3637 0.0224  0.0331  0.0416  45 TRP B CH2 
1154 N N   . THR B 46 ? 0.3281 0.1882 0.3223 0.0717  0.0481  0.0350  46 THR B N   
1155 C CA  . THR B 46 ? 0.3520 0.1860 0.3100 0.0797  0.0371  0.0289  46 THR B CA  
1156 C C   . THR B 46 ? 0.3529 0.1941 0.3169 0.0747  0.0211  0.0218  46 THR B C   
1157 O O   . THR B 46 ? 0.3122 0.1681 0.2973 0.0683  0.0245  0.0232  46 THR B O   
1158 C CB  . THR B 46 ? 0.4073 0.2046 0.3282 0.0917  0.0511  0.0322  46 THR B CB  
1159 O OG1 . THR B 46 ? 0.4033 0.2007 0.3324 0.0905  0.0617  0.0353  46 THR B OG1 
1160 C CG2 . THR B 46 ? 0.4481 0.2356 0.3630 0.0973  0.0687  0.0397  46 THR B CG2 
1161 N N   . PRO B 47 ? 0.3519 0.1815 0.2987 0.0777  0.0031  0.0142  47 PRO B N   
1162 C CA  . PRO B 47 ? 0.3748 0.2124 0.3328 0.0721  -0.0138 0.0070  47 PRO B CA  
1163 C C   . PRO B 47 ? 0.3918 0.2144 0.3377 0.0734  -0.0116 0.0058  47 PRO B C   
1164 O O   . PRO B 47 ? 0.4466 0.2408 0.3610 0.0826  -0.0014 0.0083  47 PRO B O   
1165 C CB  . PRO B 47 ? 0.4019 0.2253 0.3422 0.0773  -0.0335 -0.0004 47 PRO B CB  
1166 C CG  . PRO B 47 ? 0.4149 0.2128 0.3214 0.0883  -0.0251 0.0032  47 PRO B CG  
1167 C CD  . PRO B 47 ? 0.4101 0.2231 0.3333 0.0854  -0.0040 0.0121  47 PRO B CD  
1168 N N   . THR B 48 ? 0.3510 0.1913 0.3212 0.0647  -0.0196 0.0024  48 THR B N   
1169 C CA  . THR B 48 ? 0.3970 0.2249 0.3589 0.0647  -0.0205 0.0001  48 THR B CA  
1170 C C   . THR B 48 ? 0.4470 0.2509 0.3852 0.0694  -0.0404 -0.0089 48 THR B C   
1171 O O   . THR B 48 ? 0.4809 0.2784 0.4101 0.0730  -0.0533 -0.0130 48 THR B O   
1172 C CB  . THR B 48 ? 0.3447 0.2009 0.3434 0.0533  -0.0193 0.0010  48 THR B CB  
1173 O OG1 . THR B 48 ? 0.3222 0.1990 0.3467 0.0458  -0.0332 -0.0037 48 THR B OG1 
1174 C CG2 . THR B 48 ? 0.3412 0.2149 0.3581 0.0504  -0.0015 0.0097  48 THR B CG2 
1175 N N   . GLU B 49 ? 0.4912 0.2807 0.4192 0.0697  -0.0437 -0.0122 49 GLU B N   
1176 C CA  . GLU B 49 ? 0.5430 0.2995 0.4386 0.0765  -0.0614 -0.0206 49 GLU B CA  
1177 C C   . GLU B 49 ? 0.5493 0.3129 0.4604 0.0727  -0.0868 -0.0292 49 GLU B C   
1178 O O   . GLU B 49 ? 0.5893 0.3256 0.4708 0.0811  -0.1030 -0.0352 49 GLU B O   
1179 C CB  . GLU B 49 ? 0.5520 0.2961 0.4407 0.0755  -0.0594 -0.0221 49 GLU B CB  
1180 C CG  . GLU B 49 ? 0.6656 0.3727 0.5196 0.0822  -0.0794 -0.0316 49 GLU B CG  
1181 C CD  . GLU B 49 ? 0.7340 0.4217 0.5719 0.0837  -0.0739 -0.0322 49 GLU B CD  
1182 O OE1 . GLU B 49 ? 0.7333 0.4387 0.5903 0.0791  -0.0551 -0.0252 49 GLU B OE1 
1183 O OE2 . GLU B 49 ? 0.8048 0.4578 0.6097 0.0900  -0.0894 -0.0398 49 GLU B OE2 
1184 N N   . PHE B 50 ? 0.5132 0.3117 0.4706 0.0607  -0.0905 -0.0299 50 PHE B N   
1185 C CA  . PHE B 50 ? 0.5014 0.3087 0.4812 0.0566  -0.1132 -0.0377 50 PHE B CA  
1186 C C   . PHE B 50 ? 0.4725 0.3045 0.4767 0.0539  -0.1130 -0.0354 50 PHE B C   
1187 O O   . PHE B 50 ? 0.4883 0.3370 0.5243 0.0483  -0.1273 -0.0401 50 PHE B O   
1188 C CB  . PHE B 50 ? 0.4842 0.3085 0.4997 0.0456  -0.1193 -0.0411 50 PHE B CB  
1189 C CG  . PHE B 50 ? 0.5062 0.3101 0.5017 0.0469  -0.1161 -0.0422 50 PHE B CG  
1190 C CD1 . PHE B 50 ? 0.5960 0.3629 0.5553 0.0549  -0.1318 -0.0494 50 PHE B CD1 
1191 C CD2 . PHE B 50 ? 0.4888 0.3081 0.4997 0.0406  -0.0980 -0.0361 50 PHE B CD2 
1192 C CE1 . PHE B 50 ? 0.5875 0.3342 0.5272 0.0564  -0.1282 -0.0504 50 PHE B CE1 
1193 C CE2 . PHE B 50 ? 0.5087 0.3091 0.5017 0.0422  -0.0944 -0.0368 50 PHE B CE2 
1194 C CZ  . PHE B 50 ? 0.5633 0.3276 0.5207 0.0500  -0.1087 -0.0438 50 PHE B CZ  
1195 N N   . ARG B 51 ? 0.4522 0.2854 0.4428 0.0583  -0.0970 -0.0284 51 ARG B N   
1196 C CA  . ARG B 51 ? 0.4117 0.2679 0.4244 0.0558  -0.0951 -0.0257 51 ARG B CA  
1197 C C   . ARG B 51 ? 0.4291 0.2676 0.4117 0.0661  -0.0950 -0.0242 51 ARG B C   
1198 O O   . ARG B 51 ? 0.3871 0.2431 0.3853 0.0645  -0.0914 -0.0213 51 ARG B O   
1199 C CB  . ARG B 51 ? 0.3616 0.2470 0.4024 0.0473  -0.0756 -0.0180 51 ARG B CB  
1200 C CG  . ARG B 51 ? 0.3738 0.2797 0.4488 0.0365  -0.0758 -0.0190 51 ARG B CG  
1201 C CD  . ARG B 51 ? 0.3928 0.3181 0.5034 0.0301  -0.0883 -0.0236 51 ARG B CD  
1202 N NE  . ARG B 51 ? 0.4021 0.3503 0.5456 0.0200  -0.0789 -0.0207 51 ARG B NE  
1203 C CZ  . ARG B 51 ? 0.4182 0.3874 0.5970 0.0134  -0.0802 -0.0213 51 ARG B CZ  
1204 N NH1 . ARG B 51 ? 0.4296 0.4036 0.6222 0.0151  -0.0920 -0.0251 51 ARG B NH1 
1205 N NH2 . ARG B 51 ? 0.3641 0.3480 0.5646 0.0057  -0.0689 -0.0178 51 ARG B NH2 
1206 N N   . GLU B 52 ? 0.4737 0.2752 0.4111 0.0773  -0.0990 -0.0263 52 GLU B N   
1207 C CA  . GLU B 52 ? 0.5105 0.2908 0.4150 0.0882  -0.0976 -0.0244 52 GLU B CA  
1208 C C   . GLU B 52 ? 0.5143 0.3020 0.4314 0.0891  -0.1167 -0.0294 52 GLU B C   
1209 O O   . GLU B 52 ? 0.5031 0.2955 0.4182 0.0920  -0.1103 -0.0254 52 GLU B O   
1210 C CB  . GLU B 52 ? 0.5788 0.3119 0.4275 0.1015  -0.0998 -0.0264 52 GLU B CB  
1211 C CG  . GLU B 52 ? 0.6250 0.3490 0.4619 0.1016  -0.0803 -0.0214 52 GLU B CG  
1212 C CD  . GLU B 52 ? 0.7445 0.4191 0.5255 0.1146  -0.0827 -0.0242 52 GLU B CD  
1213 O OE1 . GLU B 52 ? 0.8344 0.4811 0.5867 0.1223  -0.1048 -0.0320 52 GLU B OE1 
1214 O OE2 . GLU B 52 ? 0.8084 0.4705 0.5739 0.1176  -0.0625 -0.0186 52 GLU B OE2 
1215 N N   . CYS B 53 ? 0.5352 0.3230 0.4663 0.0868  -0.1403 -0.0380 53 CYS B N   
1216 C CA  . CYS B 53 ? 0.5373 0.3329 0.4867 0.0875  -0.1613 -0.0435 53 CYS B CA  
1217 C C   . CYS B 53 ? 0.4706 0.3065 0.4656 0.0782  -0.1508 -0.0389 53 CYS B C   
1218 O O   . CYS B 53 ? 0.4430 0.2832 0.4402 0.0818  -0.1537 -0.0381 53 CYS B O   
1219 C CB  . CYS B 53 ? 0.5498 0.3434 0.5180 0.0843  -0.1870 -0.0532 53 CYS B CB  
1220 S SG  . CYS B 53 ? 0.6780 0.4707 0.6635 0.0882  -0.2192 -0.0619 53 CYS B SG  
1221 N N   . ASP B 54 ? 0.4217 0.2848 0.4508 0.0669  -0.1385 -0.0359 54 ASP B N   
1222 C CA  . ASP B 54 ? 0.3588 0.2569 0.4297 0.0582  -0.1294 -0.0321 54 ASP B CA  
1223 C C   . ASP B 54 ? 0.3362 0.2372 0.3932 0.0609  -0.1108 -0.0244 54 ASP B C   
1224 O O   . ASP B 54 ? 0.3030 0.2208 0.3783 0.0593  -0.1086 -0.0224 54 ASP B O   
1225 C CB  . ASP B 54 ? 0.3511 0.2714 0.4536 0.0468  -0.1190 -0.0300 54 ASP B CB  
1226 C CG  . ASP B 54 ? 0.3897 0.3160 0.5218 0.0414  -0.1356 -0.0371 54 ASP B CG  
1227 O OD1 . ASP B 54 ? 0.4422 0.3649 0.5842 0.0445  -0.1557 -0.0433 54 ASP B OD1 
1228 O OD2 . ASP B 54 ? 0.4175 0.3522 0.5653 0.0340  -0.1290 -0.0363 54 ASP B OD2 
1229 N N   . TYR B 55 ? 0.3320 0.2167 0.3590 0.0646  -0.0966 -0.0197 55 TYR B N   
1230 C CA  . TYR B 55 ? 0.3082 0.1935 0.3237 0.0670  -0.0785 -0.0122 55 TYR B CA  
1231 C C   . TYR B 55 ? 0.3424 0.2114 0.3351 0.0765  -0.0849 -0.0129 55 TYR B C   
1232 O O   . TYR B 55 ? 0.3085 0.1914 0.3134 0.0753  -0.0793 -0.0096 55 TYR B O   
1233 C CB  . TYR B 55 ? 0.3246 0.1923 0.3145 0.0702  -0.0630 -0.0074 55 TYR B CB  
1234 C CG  . TYR B 55 ? 0.3210 0.1853 0.2994 0.0735  -0.0445 0.0003  55 TYR B CG  
1235 C CD1 . TYR B 55 ? 0.2805 0.1687 0.2852 0.0656  -0.0299 0.0063  55 TYR B CD1 
1236 C CD2 . TYR B 55 ? 0.3874 0.2208 0.3267 0.0852  -0.0410 0.0019  55 TYR B CD2 
1237 C CE1 . TYR B 55 ? 0.3245 0.2099 0.3232 0.0680  -0.0137 0.0133  55 TYR B CE1 
1238 C CE2 . TYR B 55 ? 0.4300 0.2601 0.3624 0.0878  -0.0225 0.0094  55 TYR B CE2 
1239 C CZ  . TYR B 55 ? 0.3952 0.2522 0.3594 0.0789  -0.0093 0.0150  55 TYR B CZ  
1240 O OH  . TYR B 55 ? 0.3931 0.2461 0.3538 0.0812  0.0081  0.0223  55 TYR B OH  
1241 N N   . ASN B 56 ? 0.3974 0.2347 0.3552 0.0864  -0.0978 -0.0176 56 ASN B N   
1242 C CA  . ASN B 56 ? 0.4234 0.2395 0.3536 0.0971  -0.1058 -0.0187 56 ASN B CA  
1243 C C   . ASN B 56 ? 0.4164 0.2537 0.3771 0.0944  -0.1198 -0.0220 56 ASN B C   
1244 O O   . ASN B 56 ? 0.4086 0.2461 0.3636 0.0984  -0.1149 -0.0187 56 ASN B O   
1245 C CB  . ASN B 56 ? 0.4877 0.2623 0.3721 0.1088  -0.1201 -0.0240 56 ASN B CB  
1246 C CG  . ASN B 56 ? 0.5624 0.3096 0.4085 0.1148  -0.1012 -0.0189 56 ASN B CG  
1247 O OD1 . ASN B 56 ? 0.5732 0.3264 0.4198 0.1136  -0.0774 -0.0105 56 ASN B OD1 
1248 N ND2 . ASN B 56 ? 0.6409 0.3562 0.4540 0.1217  -0.1119 -0.0239 56 ASN B ND2 
1249 N N   . LYS B 57 ? 0.3974 0.2538 0.3936 0.0873  -0.1344 -0.0277 57 LYS B N   
1250 C CA  . LYS B 57 ? 0.3799 0.2594 0.4130 0.0841  -0.1455 -0.0304 57 LYS B CA  
1251 C C   . LYS B 57 ? 0.3371 0.2455 0.3971 0.0768  -0.1264 -0.0237 57 LYS B C   
1252 O O   . LYS B 57 ? 0.3373 0.2529 0.4052 0.0792  -0.1276 -0.0226 57 LYS B O   
1253 C CB  . LYS B 57 ? 0.3906 0.2848 0.4614 0.0772  -0.1622 -0.0371 57 LYS B CB  
1254 C CG  . LYS B 57 ? 0.4782 0.3443 0.5273 0.0839  -0.1860 -0.0453 57 LYS B CG  
1255 C CD  . LYS B 57 ? 0.5264 0.4091 0.6210 0.0768  -0.2048 -0.0523 57 LYS B CD  
1256 C CE  . LYS B 57 ? 0.6022 0.4537 0.6719 0.0828  -0.2289 -0.0607 57 LYS B CE  
1257 N NZ  . LYS B 57 ? 0.6325 0.4475 0.6512 0.0976  -0.2419 -0.0630 57 LYS B NZ  
1258 N N   . PHE B 58 ? 0.2958 0.2186 0.3680 0.0683  -0.1094 -0.0192 58 PHE B N   
1259 C CA  . PHE B 58 ? 0.2708 0.2148 0.3604 0.0625  -0.0916 -0.0128 58 PHE B CA  
1260 C C   . PHE B 58 ? 0.2924 0.2238 0.3553 0.0693  -0.0820 -0.0079 58 PHE B C   
1261 O O   . PHE B 58 ? 0.2716 0.2155 0.3473 0.0683  -0.0777 -0.0055 58 PHE B O   
1262 C CB  . PHE B 58 ? 0.2599 0.2132 0.3574 0.0544  -0.0773 -0.0091 58 PHE B CB  
1263 C CG  . PHE B 58 ? 0.2863 0.2564 0.3967 0.0488  -0.0605 -0.0028 58 PHE B CG  
1264 C CD1 . PHE B 58 ? 0.3033 0.2958 0.4450 0.0420  -0.0581 -0.0024 58 PHE B CD1 
1265 C CD2 . PHE B 58 ? 0.3664 0.3278 0.4572 0.0508  -0.0469 0.0028  58 PHE B CD2 
1266 C CE1 . PHE B 58 ? 0.3706 0.3741 0.5187 0.0376  -0.0440 0.0031  58 PHE B CE1 
1267 C CE2 . PHE B 58 ? 0.3909 0.3662 0.4939 0.0456  -0.0339 0.0082  58 PHE B CE2 
1268 C CZ  . PHE B 58 ? 0.3988 0.3939 0.5280 0.0393  -0.0335 0.0079  58 PHE B CZ  
1269 N N   . MET B 59 ? 0.3184 0.2238 0.3446 0.0763  -0.0774 -0.0061 59 MET B N   
1270 C CA  . MET B 59 ? 0.3533 0.2450 0.3554 0.0826  -0.0657 -0.0007 59 MET B CA  
1271 C C   . MET B 59 ? 0.3716 0.2504 0.3591 0.0916  -0.0783 -0.0035 59 MET B C   
1272 O O   . MET B 59 ? 0.3764 0.2574 0.3622 0.0934  -0.0702 0.0005  59 MET B O   
1273 C CB  . MET B 59 ? 0.3864 0.2519 0.3541 0.0885  -0.0540 0.0030  59 MET B CB  
1274 C CG  . MET B 59 ? 0.3648 0.2435 0.3474 0.0805  -0.0351 0.0089  59 MET B CG  
1275 S SD  . MET B 59 ? 0.4741 0.3799 0.4866 0.0722  -0.0212 0.0150  59 MET B SD  
1276 C CE  . MET B 59 ? 0.4283 0.3416 0.4525 0.0657  -0.0053 0.0204  59 MET B CE  
1277 N N   . SER B 60 ? 0.3770 0.2440 0.3579 0.0966  -0.0995 -0.0107 60 SER B N   
1278 C CA  . SER B 60 ? 0.3981 0.2527 0.3680 0.1056  -0.1162 -0.0145 60 SER B CA  
1279 C C   . SER B 60 ? 0.3736 0.2577 0.3825 0.1002  -0.1175 -0.0142 60 SER B C   
1280 O O   . SER B 60 ? 0.3882 0.2665 0.3876 0.1063  -0.1180 -0.0127 60 SER B O   
1281 C CB  . SER B 60 ? 0.3956 0.2332 0.3566 0.1110  -0.1417 -0.0230 60 SER B CB  
1282 O OG  . SER B 60 ? 0.5087 0.3324 0.4577 0.1208  -0.1591 -0.0265 60 SER B OG  
1283 N N   . VAL B 61 ? 0.3705 0.2840 0.4216 0.0896  -0.1171 -0.0155 61 VAL B N   
1284 C CA  . VAL B 61 ? 0.3781 0.3181 0.4668 0.0848  -0.1163 -0.0150 61 VAL B CA  
1285 C C   . VAL B 61 ? 0.3790 0.3253 0.4635 0.0834  -0.0971 -0.0081 61 VAL B C   
1286 O O   . VAL B 61 ? 0.4014 0.3537 0.4950 0.0860  -0.0987 -0.0076 61 VAL B O   
1287 C CB  . VAL B 61 ? 0.3523 0.3187 0.4841 0.0741  -0.1158 -0.0167 61 VAL B CB  
1288 C CG1 . VAL B 61 ? 0.3690 0.3600 0.5349 0.0693  -0.1078 -0.0143 61 VAL B CG1 
1289 C CG2 . VAL B 61 ? 0.3724 0.3345 0.5164 0.0757  -0.1377 -0.0243 61 VAL B CG2 
1290 N N   . LEU B 62 ? 0.3824 0.3265 0.4545 0.0794  -0.0802 -0.0030 62 LEU B N   
1291 C CA  . LEU B 62 ? 0.3837 0.3332 0.4543 0.0772  -0.0634 0.0033  62 LEU B CA  
1292 C C   . LEU B 62 ? 0.4119 0.3406 0.4539 0.0872  -0.0641 0.0048  62 LEU B C   
1293 O O   . LEU B 62 ? 0.4179 0.3528 0.4664 0.0877  -0.0602 0.0068  62 LEU B O   
1294 C CB  . LEU B 62 ? 0.3735 0.3229 0.4385 0.0719  -0.0476 0.0081  62 LEU B CB  
1295 C CG  . LEU B 62 ? 0.3292 0.2987 0.4209 0.0618  -0.0447 0.0076  62 LEU B CG  
1296 C CD1 . LEU B 62 ? 0.3029 0.2698 0.3872 0.0584  -0.0303 0.0128  62 LEU B CD1 
1297 C CD2 . LEU B 62 ? 0.3060 0.2973 0.4270 0.0561  -0.0431 0.0076  62 LEU B CD2 
1298 N N   . ASP B 63 ? 0.4478 0.3493 0.4563 0.0957  -0.0694 0.0036  63 ASP B N   
1299 C CA  . ASP B 63 ? 0.4712 0.3461 0.4450 0.1067  -0.0687 0.0056  63 ASP B CA  
1300 C C   . ASP B 63 ? 0.4732 0.3454 0.4482 0.1138  -0.0857 0.0014  63 ASP B C   
1301 O O   . ASP B 63 ? 0.4950 0.3553 0.4533 0.1203  -0.0821 0.0042  63 ASP B O   
1302 C CB  . ASP B 63 ? 0.5160 0.3579 0.4492 0.1152  -0.0692 0.0054  63 ASP B CB  
1303 C CG  . ASP B 63 ? 0.6152 0.4278 0.5103 0.1252  -0.0585 0.0104  63 ASP B CG  
1304 O OD1 . ASP B 63 ? 0.6364 0.4563 0.5387 0.1212  -0.0397 0.0169  63 ASP B OD1 
1305 O OD2 . ASP B 63 ? 0.6929 0.4737 0.5509 0.1374  -0.0695 0.0077  63 ASP B OD2 
1306 N N   . THR B 64 ? 0.4486 0.3310 0.4449 0.1129  -0.1047 -0.0052 64 THR B N   
1307 C CA  . THR B 64 ? 0.4530 0.3358 0.4581 0.1194  -0.1223 -0.0093 64 THR B CA  
1308 C C   . THR B 64 ? 0.4179 0.3303 0.4613 0.1127  -0.1150 -0.0072 64 THR B C   
1309 O O   . THR B 64 ? 0.3983 0.3085 0.4399 0.1183  -0.1165 -0.0062 64 THR B O   
1310 C CB  . THR B 64 ? 0.4605 0.3439 0.4805 0.1207  -0.1466 -0.0173 64 THR B CB  
1311 O OG1 . THR B 64 ? 0.5212 0.3696 0.4975 0.1301  -0.1571 -0.0201 64 THR B OG1 
1312 C CG2 . THR B 64 ? 0.4778 0.3696 0.5213 0.1253  -0.1643 -0.0213 64 THR B CG2 
1313 N N   . ASN B 65 ? 0.4033 0.3410 0.4793 0.1014  -0.1069 -0.0067 65 ASN B N   
1314 C CA  . ASN B 65 ? 0.4058 0.3696 0.5166 0.0944  -0.0979 -0.0047 65 ASN B CA  
1315 C C   . ASN B 65 ? 0.4026 0.3639 0.4990 0.0937  -0.0799 0.0016  65 ASN B C   
1316 O O   . ASN B 65 ? 0.4250 0.3783 0.5026 0.0911  -0.0673 0.0055  65 ASN B O   
1317 C CB  . ASN B 65 ? 0.3900 0.3732 0.5274 0.0834  -0.0912 -0.0048 65 ASN B CB  
1318 C CG  . ASN B 65 ? 0.4025 0.4097 0.5759 0.0770  -0.0830 -0.0035 65 ASN B CG  
1319 O OD1 . ASN B 65 ? 0.4495 0.4720 0.6550 0.0724  -0.0870 -0.0061 65 ASN B OD1 
1320 N ND2 . ASN B 65 ? 0.3808 0.3896 0.5489 0.0770  -0.0705 0.0009  65 ASN B ND2 
1321 N N   . LYS B 66 ? 0.4148 0.3819 0.5214 0.0966  -0.0796 0.0023  66 LYS B N   
1322 C CA  . LYS B 66 ? 0.4313 0.3950 0.5258 0.0962  -0.0645 0.0076  66 LYS B CA  
1323 C C   . LYS B 66 ? 0.4262 0.4100 0.5497 0.0913  -0.0575 0.0086  66 LYS B C   
1324 O O   . LYS B 66 ? 0.4444 0.4254 0.5656 0.0959  -0.0556 0.0100  66 LYS B O   
1325 C CB  . LYS B 66 ? 0.4469 0.3884 0.5129 0.1073  -0.0696 0.0083  66 LYS B CB  
1326 C CG  . LYS B 66 ? 0.4703 0.3847 0.4994 0.1145  -0.0744 0.0081  66 LYS B CG  
1327 C CD  . LYS B 66 ? 0.4447 0.3520 0.4577 0.1095  -0.0570 0.0131  66 LYS B CD  
1328 C CE  . LYS B 66 ? 0.4438 0.3237 0.4223 0.1172  -0.0615 0.0124  66 LYS B CE  
1329 N NZ  . LYS B 66 ? 0.4830 0.3574 0.4515 0.1125  -0.0460 0.0166  66 LYS B NZ  
1330 N N   . ASP B 67 ? 0.4154 0.4168 0.5640 0.0828  -0.0534 0.0080  67 ASP B N   
1331 C CA  . ASP B 67 ? 0.3984 0.4157 0.5716 0.0783  -0.0442 0.0093  67 ASP B CA  
1332 C C   . ASP B 67 ? 0.3721 0.3863 0.5311 0.0719  -0.0297 0.0135  67 ASP B C   
1333 O O   . ASP B 67 ? 0.3623 0.3666 0.5016 0.0707  -0.0282 0.0149  67 ASP B O   
1334 C CB  . ASP B 67 ? 0.3887 0.4232 0.5952 0.0731  -0.0458 0.0069  67 ASP B CB  
1335 C CG  . ASP B 67 ? 0.3748 0.4123 0.5995 0.0780  -0.0636 0.0018  67 ASP B CG  
1336 O OD1 . ASP B 67 ? 0.2521 0.2846 0.4703 0.0773  -0.0728 -0.0009 67 ASP B OD1 
1337 O OD2 . ASP B 67 ? 0.4167 0.4609 0.6633 0.0828  -0.0691 0.0004  67 ASP B OD2 
1338 N N   A CYS B 68 ? 0.3446 0.3656 0.5133 0.0682  -0.0193 0.0155  68 CYS B N   
1339 C CA  A CYS B 68 ? 0.3171 0.3328 0.4720 0.0630  -0.0083 0.0190  68 CYS B CA  
1340 C C   A CYS B 68 ? 0.3087 0.3323 0.4764 0.0570  0.0004  0.0198  68 CYS B C   
1341 O O   A CYS B 68 ? 0.3187 0.3370 0.4782 0.0551  0.0082  0.0220  68 CYS B O   
1342 C CB  A CYS B 68 ? 0.3184 0.3227 0.4570 0.0673  -0.0053 0.0212  68 CYS B CB  
1343 S SG  A CYS B 68 ? 0.3022 0.2911 0.4181 0.0740  -0.0119 0.0215  68 CYS B SG  
1344 N N   . GLU B 69 ? 0.3121 0.3460 0.4980 0.0545  -0.0015 0.0180  69 GLU B N   
1345 C CA  . GLU B 69 ? 0.3196 0.3589 0.5168 0.0497  0.0075  0.0189  69 GLU B CA  
1346 C C   . GLU B 69 ? 0.2967 0.3382 0.4934 0.0433  0.0075  0.0190  69 GLU B C   
1347 O O   . GLU B 69 ? 0.3162 0.3637 0.5274 0.0402  0.0125  0.0189  69 GLU B O   
1348 C CB  . GLU B 69 ? 0.3363 0.3864 0.5618 0.0523  0.0081  0.0174  69 GLU B CB  
1349 C CG  . GLU B 69 ? 0.4058 0.4549 0.6368 0.0587  0.0106  0.0178  69 GLU B CG  
1350 C CD  . GLU B 69 ? 0.4852 0.5263 0.7058 0.0579  0.0247  0.0208  69 GLU B CD  
1351 O OE1 . GLU B 69 ? 0.5106 0.5554 0.7490 0.0598  0.0339  0.0216  69 GLU B OE1 
1352 O OE2 . GLU B 69 ? 0.5221 0.5518 0.7174 0.0557  0.0268  0.0222  69 GLU B OE2 
1353 N N   . VAL B 70 ? 0.2469 0.2829 0.4283 0.0418  0.0035  0.0195  70 VAL B N   
1354 C CA  . VAL B 70 ? 0.2116 0.2489 0.3923 0.0362  0.0042  0.0199  70 VAL B CA  
1355 C C   . VAL B 70 ? 0.1804 0.2127 0.3529 0.0317  0.0121  0.0225  70 VAL B C   
1356 O O   . VAL B 70 ? 0.2031 0.2273 0.3618 0.0315  0.0131  0.0243  70 VAL B O   
1357 C CB  . VAL B 70 ? 0.2084 0.2391 0.3748 0.0369  -0.0004 0.0203  70 VAL B CB  
1358 C CG1 . VAL B 70 ? 0.1898 0.2219 0.3566 0.0318  0.0006  0.0210  70 VAL B CG1 
1359 C CG2 . VAL B 70 ? 0.2589 0.2881 0.4251 0.0429  -0.0100 0.0174  70 VAL B CG2 
1360 N N   . ASP B 71 ? 0.1464 0.1815 0.3265 0.0285  0.0172  0.0227  71 ASP B N   
1361 C CA  . ASP B 71 ? 0.1316 0.1576 0.2992 0.0252  0.0229  0.0248  71 ASP B CA  
1362 C C   . ASP B 71 ? 0.1136 0.1386 0.2770 0.0206  0.0203  0.0257  71 ASP B C   
1363 O O   . ASP B 71 ? 0.0996 0.1305 0.2687 0.0201  0.0156  0.0248  71 ASP B O   
1364 C CB  . ASP B 71 ? 0.1348 0.1583 0.3066 0.0257  0.0321  0.0254  71 ASP B CB  
1365 C CG  . ASP B 71 ? 0.1878 0.2197 0.3776 0.0239  0.0352  0.0248  71 ASP B CG  
1366 O OD1 . ASP B 71 ? 0.1382 0.1766 0.3346 0.0213  0.0292  0.0237  71 ASP B OD1 
1367 O OD2 . ASP B 71 ? 0.2411 0.2713 0.4388 0.0252  0.0452  0.0258  71 ASP B OD2 
1368 N N   . PHE B 72 ? 0.1234 0.1388 0.2750 0.0180  0.0224  0.0273  72 PHE B N   
1369 C CA  . PHE B 72 ? 0.1035 0.1173 0.2523 0.0142  0.0192  0.0282  72 PHE B CA  
1370 C C   . PHE B 72 ? 0.0990 0.1204 0.2585 0.0124  0.0204  0.0275  72 PHE B C   
1371 O O   . PHE B 72 ? 0.0956 0.1210 0.2586 0.0109  0.0163  0.0275  72 PHE B O   
1372 C CB  . PHE B 72 ? 0.1297 0.1295 0.2634 0.0125  0.0196  0.0295  72 PHE B CB  
1373 C CG  . PHE B 72 ? 0.1362 0.1341 0.2688 0.0090  0.0145  0.0306  72 PHE B CG  
1374 C CD1 . PHE B 72 ? 0.1119 0.1129 0.2498 0.0077  0.0089  0.0315  72 PHE B CD1 
1375 C CD2 . PHE B 72 ? 0.1309 0.1236 0.2587 0.0075  0.0164  0.0312  72 PHE B CD2 
1376 C CE1 . PHE B 72 ? 0.1165 0.1167 0.2571 0.0049  0.0048  0.0328  72 PHE B CE1 
1377 C CE2 . PHE B 72 ? 0.1241 0.1147 0.2514 0.0049  0.0110  0.0322  72 PHE B CE2 
1378 C CZ  . PHE B 72 ? 0.1204 0.1157 0.2557 0.0036  0.0047  0.0330  72 PHE B CZ  
1379 N N   . VAL B 73 ? 0.1059 0.1281 0.2717 0.0128  0.0269  0.0272  73 VAL B N   
1380 C CA  . VAL B 73 ? 0.1233 0.1521 0.3019 0.0107  0.0285  0.0265  73 VAL B CA  
1381 C C   . VAL B 73 ? 0.1095 0.1495 0.3020 0.0114  0.0215  0.0239  73 VAL B C   
1382 O O   . VAL B 73 ? 0.1051 0.1478 0.3011 0.0093  0.0182  0.0233  73 VAL B O   
1383 C CB  . VAL B 73 ? 0.1492 0.1754 0.3344 0.0114  0.0391  0.0273  73 VAL B CB  
1384 C CG1 . VAL B 73 ? 0.1732 0.2076 0.3783 0.0091  0.0417  0.0264  73 VAL B CG1 
1385 C CG2 . VAL B 73 ? 0.1937 0.2025 0.3570 0.0113  0.0452  0.0298  73 VAL B CG2 
1386 N N   . GLU B 74 ? 0.0863 0.1302 0.2835 0.0151  0.0183  0.0224  74 GLU B N   
1387 C CA  A GLU B 74 ? 0.1008 0.1505 0.3057 0.0173  0.0098  0.0196  74 GLU B CA  
1388 C CA  B GLU B 74 ? 0.1016 0.1514 0.3067 0.0172  0.0098  0.0196  74 GLU B CA  
1389 C C   . GLU B 74 ? 0.1000 0.1445 0.2902 0.0175  0.0052  0.0203  74 GLU B C   
1390 O O   . GLU B 74 ? 0.0960 0.1408 0.2871 0.0180  -0.0002 0.0186  74 GLU B O   
1391 C CB  A GLU B 74 ? 0.1110 0.1630 0.3210 0.0224  0.0070  0.0182  74 GLU B CB  
1392 C CB  B GLU B 74 ? 0.1183 0.1710 0.3300 0.0222  0.0066  0.0179  74 GLU B CB  
1393 C CG  A GLU B 74 ? 0.1438 0.1973 0.3568 0.0262  -0.0039 0.0149  74 GLU B CG  
1394 C CG  B GLU B 74 ? 0.1566 0.2125 0.3758 0.0254  -0.0045 0.0143  74 GLU B CG  
1395 C CD  A GLU B 74 ? 0.1732 0.2329 0.4042 0.0242  -0.0092 0.0119  74 GLU B CD  
1396 C CD  B GLU B 74 ? 0.2176 0.2755 0.4440 0.0311  -0.0096 0.0124  74 GLU B CD  
1397 O OE1 A GLU B 74 ? 0.1915 0.2569 0.4386 0.0203  -0.0025 0.0125  74 GLU B OE1 
1398 O OE1 B GLU B 74 ? 0.2860 0.3453 0.5167 0.0324  -0.0029 0.0140  74 GLU B OE1 
1399 O OE2 A GLU B 74 ? 0.2304 0.2872 0.4584 0.0270  -0.0199 0.0089  74 GLU B OE2 
1400 O OE2 B GLU B 74 ? 0.2908 0.3468 0.5170 0.0350  -0.0210 0.0093  74 GLU B OE2 
1401 N N   . TYR B 75 ? 0.0888 0.1271 0.2661 0.0175  0.0076  0.0229  75 TYR B N   
1402 C CA  . TYR B 75 ? 0.0854 0.1188 0.2535 0.0175  0.0061  0.0246  75 TYR B CA  
1403 C C   . TYR B 75 ? 0.0780 0.1122 0.2485 0.0137  0.0065  0.0252  75 TYR B C   
1404 O O   . TYR B 75 ? 0.0789 0.1113 0.2468 0.0147  0.0045  0.0251  75 TYR B O   
1405 C CB  . TYR B 75 ? 0.0874 0.1148 0.2475 0.0171  0.0086  0.0273  75 TYR B CB  
1406 C CG  . TYR B 75 ? 0.0786 0.1021 0.2367 0.0146  0.0091  0.0301  75 TYR B CG  
1407 C CD1 . TYR B 75 ? 0.0724 0.0928 0.2281 0.0169  0.0099  0.0316  75 TYR B CD1 
1408 C CD2 . TYR B 75 ? 0.0813 0.1025 0.2397 0.0106  0.0090  0.0315  75 TYR B CD2 
1409 C CE1 . TYR B 75 ? 0.0883 0.1061 0.2474 0.0148  0.0119  0.0347  75 TYR B CE1 
1410 C CE2 . TYR B 75 ? 0.0874 0.1060 0.2487 0.0083  0.0079  0.0340  75 TYR B CE2 
1411 C CZ  . TYR B 75 ? 0.0719 0.0902 0.2364 0.0102  0.0100  0.0358  75 TYR B CZ  
1412 O OH  . TYR B 75 ? 0.0749 0.0915 0.2475 0.0083  0.0103  0.0389  75 TYR B OH  
1413 N N   . VAL B 76 ? 0.0858 0.1204 0.2589 0.0100  0.0096  0.0260  76 VAL B N   
1414 C CA  . VAL B 76 ? 0.1052 0.1393 0.2793 0.0070  0.0097  0.0269  76 VAL B CA  
1415 C C   . VAL B 76 ? 0.0918 0.1307 0.2745 0.0069  0.0078  0.0242  76 VAL B C   
1416 O O   . VAL B 76 ? 0.1036 0.1412 0.2853 0.0062  0.0063  0.0242  76 VAL B O   
1417 C CB  . VAL B 76 ? 0.1066 0.1356 0.2766 0.0042  0.0130  0.0286  76 VAL B CB  
1418 C CG1 . VAL B 76 ? 0.1790 0.2065 0.3495 0.0015  0.0128  0.0296  76 VAL B CG1 
1419 C CG2 . VAL B 76 ? 0.1210 0.1427 0.2816 0.0043  0.0114  0.0306  76 VAL B CG2 
1420 N N   . ARG B 77 ? 0.0944 0.1381 0.2870 0.0080  0.0074  0.0217  77 ARG B N   
1421 C CA  A ARG B 77 ? 0.0779 0.1257 0.2821 0.0076  0.0031  0.0185  77 ARG B CA  
1422 C CA  B ARG B 77 ? 0.0928 0.1409 0.2974 0.0079  0.0030  0.0183  77 ARG B CA  
1423 C C   . ARG B 77 ? 0.1070 0.1505 0.3024 0.0114  -0.0043 0.0166  77 ARG B C   
1424 O O   . ARG B 77 ? 0.1088 0.1501 0.3044 0.0109  -0.0080 0.0148  77 ARG B O   
1425 C CB  A ARG B 77 ? 0.0923 0.1466 0.3133 0.0085  0.0030  0.0163  77 ARG B CB  
1426 C CB  B ARG B 77 ? 0.0969 0.1513 0.3174 0.0094  0.0020  0.0160  77 ARG B CB  
1427 C CG  A ARG B 77 ? 0.1004 0.1590 0.3381 0.0078  -0.0041 0.0122  77 ARG B CG  
1428 C CG  B ARG B 77 ? 0.1109 0.1700 0.3487 0.0092  -0.0055 0.0118  77 ARG B CG  
1429 C CD  A ARG B 77 ? 0.1604 0.2273 0.4228 0.0085  -0.0045 0.0102  77 ARG B CD  
1430 C CD  B ARG B 77 ? 0.1122 0.1797 0.3760 0.0082  -0.0019 0.0109  77 ARG B CD  
1431 N NE  A ARG B 77 ? 0.2612 0.3287 0.5221 0.0139  -0.0110 0.0086  77 ARG B NE  
1432 N NE  B ARG B 77 ? 0.1488 0.2215 0.4343 0.0086  -0.0122 0.0062  77 ARG B NE  
1433 C CZ  A ARG B 77 ? 0.3163 0.3835 0.5823 0.0176  -0.0243 0.0043  77 ARG B CZ  
1434 C CZ  B ARG B 77 ? 0.1689 0.2454 0.4746 0.0044  -0.0121 0.0048  77 ARG B CZ  
1435 N NH1 A ARG B 77 ? 0.3589 0.4244 0.6303 0.0162  -0.0329 0.0009  77 ARG B NH1 
1436 N NH1 B ARG B 77 ? 0.1483 0.2230 0.4528 -0.0002 -0.0007 0.0080  77 ARG B NH1 
1437 N NH2 A ARG B 77 ? 0.3502 0.4164 0.6131 0.0231  -0.0299 0.0033  77 ARG B NH2 
1438 N NH2 B ARG B 77 ? 0.1913 0.2718 0.5183 0.0049  -0.0243 -0.0001 77 ARG B NH2 
1439 N N   . SER B 78 ? 0.0929 0.1323 0.2776 0.0156  -0.0056 0.0173  78 SER B N   
1440 C CA  A SER B 78 ? 0.1063 0.1365 0.2770 0.0204  -0.0103 0.0163  78 SER B CA  
1441 C CA  B SER B 78 ? 0.1093 0.1397 0.2804 0.0203  -0.0103 0.0163  78 SER B CA  
1442 C C   . SER B 78 ? 0.1116 0.1361 0.2740 0.0191  -0.0062 0.0189  78 SER B C   
1443 O O   . SER B 78 ? 0.1227 0.1391 0.2763 0.0218  -0.0094 0.0174  78 SER B O   
1444 C CB  A SER B 78 ? 0.1201 0.1439 0.2785 0.0256  -0.0100 0.0176  78 SER B CB  
1445 C CB  B SER B 78 ? 0.1248 0.1502 0.2854 0.0251  -0.0099 0.0175  78 SER B CB  
1446 O OG  A SER B 78 ? 0.1070 0.1279 0.2592 0.0245  -0.0025 0.0221  78 SER B OG  
1447 O OG  B SER B 78 ? 0.1190 0.1495 0.2887 0.0272  -0.0146 0.0149  78 SER B OG  
1448 N N   . LEU B 79 ? 0.0937 0.1207 0.2581 0.0156  0.0002  0.0228  79 LEU B N   
1449 C CA  . LEU B 79 ? 0.1057 0.1290 0.2675 0.0143  0.0037  0.0255  79 LEU B CA  
1450 C C   . LEU B 79 ? 0.1018 0.1262 0.2679 0.0119  0.0017  0.0235  79 LEU B C   
1451 O O   . LEU B 79 ? 0.1173 0.1348 0.2767 0.0137  0.0023  0.0237  79 LEU B O   
1452 C CB  . LEU B 79 ? 0.0998 0.1257 0.2664 0.0108  0.0077  0.0293  79 LEU B CB  
1453 C CG  . LEU B 79 ? 0.1089 0.1329 0.2732 0.0123  0.0094  0.0314  79 LEU B CG  
1454 C CD1 . LEU B 79 ? 0.1096 0.1344 0.2794 0.0084  0.0100  0.0342  79 LEU B CD1 
1455 C CD2 . LEU B 79 ? 0.1426 0.1588 0.3002 0.0168  0.0131  0.0335  79 LEU B CD2 
1456 N N   . ALA B 80 ? 0.0857 0.1171 0.2626 0.0082  0.0008  0.0217  80 ALA B N   
1457 C CA  . ALA B 80 ? 0.0994 0.1317 0.2830 0.0053  -0.0006 0.0198  80 ALA B CA  
1458 C C   . ALA B 80 ? 0.0965 0.1237 0.2767 0.0085  -0.0077 0.0156  80 ALA B C   
1459 O O   . ALA B 80 ? 0.1041 0.1257 0.2805 0.0083  -0.0089 0.0147  80 ALA B O   
1460 C CB  . ALA B 80 ? 0.1044 0.1431 0.3013 0.0013  0.0019  0.0192  80 ALA B CB  
1461 N N   . CYS B 81 ? 0.0909 0.1182 0.2716 0.0118  -0.0137 0.0126  81 CYS B N   
1462 C CA  . CYS B 81 ? 0.1098 0.1284 0.2836 0.0160  -0.0233 0.0081  81 CYS B CA  
1463 C C   . CYS B 81 ? 0.1308 0.1338 0.2810 0.0211  -0.0223 0.0092  81 CYS B C   
1464 O O   . CYS B 81 ? 0.1343 0.1271 0.2761 0.0229  -0.0273 0.0064  81 CYS B O   
1465 C CB  . CYS B 81 ? 0.1203 0.1402 0.2973 0.0197  -0.0309 0.0052  81 CYS B CB  
1466 S SG  . CYS B 81 ? 0.1556 0.1923 0.3661 0.0145  -0.0323 0.0030  81 CYS B SG  
1467 N N   . LEU B 82 ? 0.1494 0.1492 0.2893 0.0237  -0.0146 0.0137  82 LEU B N   
1468 C CA  . LEU B 82 ? 0.1662 0.1508 0.2866 0.0287  -0.0094 0.0162  82 LEU B CA  
1469 C C   . LEU B 82 ? 0.1770 0.1606 0.2998 0.0259  -0.0047 0.0178  82 LEU B C   
1470 O O   . LEU B 82 ? 0.1804 0.1489 0.2870 0.0305  -0.0034 0.0176  82 LEU B O   
1471 C CB  . LEU B 82 ? 0.1917 0.1753 0.3082 0.0307  -0.0002 0.0215  82 LEU B CB  
1472 C CG  . LEU B 82 ? 0.2541 0.2234 0.3510 0.0386  -0.0027 0.0204  82 LEU B CG  
1473 C CD1 . LEU B 82 ? 0.2921 0.2684 0.3958 0.0382  -0.0132 0.0159  82 LEU B CD1 
1474 C CD2 . LEU B 82 ? 0.2745 0.2397 0.3669 0.0410  0.0082  0.0261  82 LEU B CD2 
1475 N N   . CYS B 83 ? 0.1369 0.1337 0.2771 0.0193  -0.0020 0.0195  83 CYS B N   
1476 C CA  . CYS B 83 ? 0.1559 0.1514 0.2987 0.0168  0.0009  0.0205  83 CYS B CA  
1477 C C   . CYS B 83 ? 0.1621 0.1505 0.3005 0.0172  -0.0065 0.0154  83 CYS B C   
1478 O O   . CYS B 83 ? 0.1631 0.1402 0.2910 0.0195  -0.0050 0.0153  83 CYS B O   
1479 C CB  . CYS B 83 ? 0.1404 0.1483 0.2994 0.0102  0.0032  0.0225  83 CYS B CB  
1480 S SG  . CYS B 83 ? 0.1523 0.1651 0.3159 0.0096  0.0098  0.0286  83 CYS B SG  
1481 N N   . LEU B 84 ? 0.1368 0.1322 0.2867 0.0144  -0.0145 0.0111  84 LEU B N   
1482 C CA  . LEU B 84 ? 0.1497 0.1391 0.3007 0.0140  -0.0235 0.0056  84 LEU B CA  
1483 C C   . LEU B 84 ? 0.1807 0.1501 0.3073 0.0215  -0.0298 0.0025  84 LEU B C   
1484 O O   . LEU B 84 ? 0.2066 0.1635 0.3245 0.0227  -0.0353 -0.0010 84 LEU B O   
1485 C CB  . LEU B 84 ? 0.1549 0.1549 0.3267 0.0105  -0.0316 0.0014  84 LEU B CB  
1486 C CG  . LEU B 84 ? 0.1628 0.1779 0.3563 0.0037  -0.0243 0.0040  84 LEU B CG  
1487 C CD1 . LEU B 84 ? 0.1477 0.1714 0.3641 0.0014  -0.0311 0.0000  84 LEU B CD1 
1488 C CD2 . LEU B 84 ? 0.1623 0.1750 0.3583 -0.0003 -0.0200 0.0051  84 LEU B CD2 
1489 N N   . TYR B 85 ? 0.1573 0.1204 0.2701 0.0273  -0.0298 0.0034  85 TYR B N   
1490 C CA  . TYR B 85 ? 0.2083 0.1477 0.2923 0.0360  -0.0349 0.0009  85 TYR B CA  
1491 C C   . TYR B 85 ? 0.2080 0.1317 0.2709 0.0408  -0.0228 0.0055  85 TYR B C   
1492 O O   . TYR B 85 ? 0.2534 0.1537 0.2907 0.0474  -0.0263 0.0028  85 TYR B O   
1493 C CB  . TYR B 85 ? 0.2233 0.1579 0.2965 0.0417  -0.0382 0.0008  85 TYR B CB  
1494 C CG  . TYR B 85 ? 0.2643 0.2124 0.3576 0.0389  -0.0499 -0.0035 85 TYR B CG  
1495 C CD1 . TYR B 85 ? 0.2977 0.2516 0.4095 0.0348  -0.0626 -0.0093 85 TYR B CD1 
1496 C CD2 . TYR B 85 ? 0.2634 0.2190 0.3600 0.0403  -0.0471 -0.0011 85 TYR B CD2 
1497 C CE1 . TYR B 85 ? 0.3381 0.3058 0.4738 0.0329  -0.0721 -0.0125 85 TYR B CE1 
1498 C CE2 . TYR B 85 ? 0.3090 0.2768 0.4248 0.0387  -0.0560 -0.0042 85 TYR B CE2 
1499 C CZ  . TYR B 85 ? 0.2951 0.2695 0.4314 0.0350  -0.0678 -0.0096 85 TYR B CZ  
1500 O OH  . TYR B 85 ? 0.3226 0.3101 0.4811 0.0341  -0.0741 -0.0116 85 TYR B OH  
1501 N N   . CYS B 86 ? 0.1869 0.1217 0.2605 0.0381  -0.0090 0.0122  86 CYS B N   
1502 C CA  . CYS B 86 ? 0.1930 0.1129 0.2499 0.0441  0.0044  0.0176  86 CYS B CA  
1503 C C   . CYS B 86 ? 0.1918 0.1179 0.2612 0.0406  0.0141  0.0219  86 CYS B C   
1504 O O   . CYS B 86 ? 0.2144 0.1277 0.2733 0.0458  0.0258  0.0264  86 CYS B O   
1505 C CB  . CYS B 86 ? 0.1811 0.1036 0.2386 0.0465  0.0130  0.0226  86 CYS B CB  
1506 S SG  . CYS B 86 ? 0.2283 0.1390 0.2665 0.0530  0.0052  0.0194  86 CYS B SG  
1507 N N   . HIS B 87 ? 0.1490 0.0931 0.2405 0.0325  0.0104  0.0211  87 HIS B N   
1508 C CA  . HIS B 87 ? 0.1403 0.0898 0.2434 0.0296  0.0181  0.0253  87 HIS B CA  
1509 C C   . HIS B 87 ? 0.1480 0.0882 0.2439 0.0293  0.0135  0.0214  87 HIS B C   
1510 O O   . HIS B 87 ? 0.1611 0.1048 0.2616 0.0254  0.0029  0.0158  87 HIS B O   
1511 C CB  . HIS B 87 ? 0.1117 0.0827 0.2392 0.0219  0.0171  0.0272  87 HIS B CB  
1512 C CG  . HIS B 87 ? 0.1235 0.0996 0.2632 0.0198  0.0237  0.0322  87 HIS B CG  
1513 N ND1 . HIS B 87 ? 0.1172 0.0889 0.2567 0.0192  0.0248  0.0321  87 HIS B ND1 
1514 C CD2 . HIS B 87 ? 0.0951 0.0789 0.2480 0.0190  0.0289  0.0375  87 HIS B CD2 
1515 C CE1 . HIS B 87 ? 0.1062 0.0836 0.2588 0.0181  0.0300  0.0373  87 HIS B CE1 
1516 N NE2 . HIS B 87 ? 0.0953 0.0800 0.2571 0.0179  0.0319  0.0404  87 HIS B NE2 
1517 N N   . GLU B 88 ? 0.1583 0.0873 0.2466 0.0332  0.0225  0.0247  88 GLU B N   
1518 C CA  . GLU B 88 ? 0.1728 0.0893 0.2509 0.0338  0.0192  0.0212  88 GLU B CA  
1519 C C   . GLU B 88 ? 0.1620 0.0931 0.2596 0.0253  0.0132  0.0192  88 GLU B C   
1520 O O   . GLU B 88 ? 0.1847 0.1074 0.2769 0.0241  0.0062  0.0142  88 GLU B O   
1521 C CB  . GLU B 88 ? 0.1988 0.1022 0.2684 0.0395  0.0322  0.0262  88 GLU B CB  
1522 C CG  . GLU B 88 ? 0.3020 0.1826 0.3490 0.0437  0.0299  0.0221  88 GLU B CG  
1523 C CD  . GLU B 88 ? 0.4051 0.2614 0.4205 0.0506  0.0220  0.0163  88 GLU B CD  
1524 O OE1 . GLU B 88 ? 0.4577 0.3096 0.4632 0.0548  0.0228  0.0171  88 GLU B OE1 
1525 O OE2 . GLU B 88 ? 0.5606 0.3992 0.5590 0.0523  0.0144  0.0109  88 GLU B OE2 
1526 N N   . TYR B 89 ? 0.1350 0.0850 0.2536 0.0197  0.0156  0.0227  89 TYR B N   
1527 C CA  . TYR B 89 ? 0.1421 0.1017 0.2751 0.0127  0.0119  0.0214  89 TYR B CA  
1528 C C   . TYR B 89 ? 0.1459 0.1059 0.2812 0.0094  0.0015  0.0147  89 TYR B C   
1529 O O   . TYR B 89 ? 0.1659 0.1256 0.3084 0.0050  -0.0016 0.0121  89 TYR B O   
1530 C CB  . TYR B 89 ? 0.1452 0.1207 0.2947 0.0083  0.0146  0.0256  89 TYR B CB  
1531 C CG  . TYR B 89 ? 0.1295 0.1099 0.2889 0.0026  0.0134  0.0253  89 TYR B CG  
1532 C CD1 . TYR B 89 ? 0.1342 0.1227 0.3030 -0.0023 0.0102  0.0231  89 TYR B CD1 
1533 C CD2 . TYR B 89 ? 0.1524 0.1281 0.3117 0.0028  0.0173  0.0280  89 TYR B CD2 
1534 C CE1 . TYR B 89 ? 0.1503 0.1404 0.3268 -0.0070 0.0118  0.0235  89 TYR B CE1 
1535 C CE2 . TYR B 89 ? 0.1717 0.1493 0.3374 -0.0019 0.0171  0.0281  89 TYR B CE2 
1536 C CZ  . TYR B 89 ? 0.1466 0.1307 0.3200 -0.0066 0.0151  0.0261  89 TYR B CZ  
1537 O OH  . TYR B 89 ? 0.1755 0.1585 0.3536 -0.0107 0.0176  0.0272  89 TYR B OH  
1538 N N   . PHE B 90 ? 0.1359 0.0968 0.2684 0.0112  -0.0041 0.0119  90 PHE B N   
1539 C CA  . PHE B 90 ? 0.1547 0.1185 0.2958 0.0081  -0.0150 0.0059  90 PHE B CA  
1540 C C   . PHE B 90 ? 0.2006 0.1460 0.3248 0.0128  -0.0255 -0.0004 90 PHE B C   
1541 O O   . PHE B 90 ? 0.2129 0.1594 0.3447 0.0115  -0.0371 -0.0058 90 PHE B O   
1542 C CB  . PHE B 90 ? 0.1649 0.1418 0.3161 0.0071  -0.0159 0.0066  90 PHE B CB  
1543 C CG  . PHE B 90 ? 0.1199 0.1114 0.2857 0.0023  -0.0078 0.0115  90 PHE B CG  
1544 C CD1 . PHE B 90 ? 0.1327 0.1321 0.3154 -0.0038 -0.0069 0.0111  90 PHE B CD1 
1545 C CD2 . PHE B 90 ? 0.1447 0.1395 0.3063 0.0045  -0.0010 0.0168  90 PHE B CD2 
1546 C CE1 . PHE B 90 ? 0.1562 0.1636 0.3460 -0.0069 0.0004  0.0156  90 PHE B CE1 
1547 C CE2 . PHE B 90 ? 0.1456 0.1502 0.3177 0.0004  0.0040  0.0207  90 PHE B CE2 
1548 C CZ  . PHE B 90 ? 0.1484 0.1576 0.3314 -0.0046 0.0045  0.0199  90 PHE B CZ  
1549 N N   . LYS B 91 ? 0.2344 0.1611 0.3353 0.0188  -0.0221 0.0004  91 LYS B N   
1550 C CA  . LYS B 91 ? 0.2934 0.1961 0.3697 0.0252  -0.0327 -0.0057 91 LYS B CA  
1551 C C   . LYS B 91 ? 0.2921 0.1953 0.3825 0.0200  -0.0481 -0.0132 91 LYS B C   
1552 O O   . LYS B 91 ? 0.3111 0.2056 0.3958 0.0228  -0.0625 -0.0193 91 LYS B O   
1553 C CB  . LYS B 91 ? 0.3257 0.2065 0.3764 0.0316  -0.0243 -0.0035 91 LYS B CB  
1554 C CG  . LYS B 91 ? 0.3956 0.2467 0.4178 0.0377  -0.0358 -0.0105 91 LYS B CG  
1555 C CD  . LYS B 91 ? 0.4743 0.3069 0.4780 0.0418  -0.0261 -0.0083 91 LYS B CD  
1556 C CE  . LYS B 91 ? 0.5698 0.3744 0.5361 0.0539  -0.0173 -0.0057 91 LYS B CE  
1557 N NZ  . LYS B 91 ? 0.6283 0.4004 0.5598 0.0614  -0.0325 -0.0137 91 LYS B NZ  
1558 N N   . ASP B 92 ? 0.2854 0.1992 0.3966 0.0125  -0.0449 -0.0126 92 ASP B N   
1559 C CA  . ASP B 92 ? 0.3009 0.2145 0.4297 0.0066  -0.0569 -0.0190 92 ASP B CA  
1560 C C   . ASP B 92 ? 0.2881 0.2257 0.4540 -0.0019 -0.0567 -0.0186 92 ASP B C   
1561 O O   . ASP B 92 ? 0.2815 0.2226 0.4703 -0.0081 -0.0631 -0.0225 92 ASP B O   
1562 C CB  . ASP B 92 ? 0.3359 0.2389 0.4585 0.0052  -0.0522 -0.0185 92 ASP B CB  
1563 C CG  . ASP B 92 ? 0.3905 0.2654 0.4757 0.0143  -0.0532 -0.0200 92 ASP B CG  
1564 O OD1 . ASP B 92 ? 0.4518 0.3089 0.5174 0.0202  -0.0661 -0.0256 92 ASP B OD1 
1565 O OD2 . ASP B 92 ? 0.4368 0.3062 0.5113 0.0164  -0.0408 -0.0152 92 ASP B OD2 
1566 N N   . CYS B 93 ? 0.2579 0.2107 0.4309 -0.0019 -0.0496 -0.0141 93 CYS B N   
1567 C CA  . CYS B 93 ? 0.2611 0.2334 0.4648 -0.0085 -0.0467 -0.0130 93 CYS B CA  
1568 C C   . CYS B 93 ? 0.2830 0.2587 0.5067 -0.0097 -0.0614 -0.0195 93 CYS B C   
1569 O O   . CYS B 93 ? 0.3257 0.2944 0.5363 -0.0038 -0.0718 -0.0227 93 CYS B O   
1570 C CB  . CYS B 93 ? 0.2052 0.1895 0.4070 -0.0073 -0.0355 -0.0066 93 CYS B CB  
1571 S SG  . CYS B 93 ? 0.2585 0.2633 0.4948 -0.0142 -0.0298 -0.0048 93 CYS B SG  
1572 N N   . PRO B 94 ? 0.2955 0.2819 0.5528 -0.0170 -0.0617 -0.0210 94 PRO B N   
1573 C CA  . PRO B 94 ? 0.3075 0.2981 0.5895 -0.0179 -0.0769 -0.0272 94 PRO B CA  
1574 C C   . PRO B 94 ? 0.3115 0.3204 0.6139 -0.0188 -0.0701 -0.0239 94 PRO B C   
1575 O O   . PRO B 94 ? 0.3405 0.3594 0.6773 -0.0224 -0.0754 -0.0267 94 PRO B O   
1576 C CB  . PRO B 94 ? 0.3270 0.3183 0.6382 -0.0254 -0.0798 -0.0304 94 PRO B CB  
1577 C CG  . PRO B 94 ? 0.2998 0.2939 0.6083 -0.0294 -0.0608 -0.0237 94 PRO B CG  
1578 C CD  . PRO B 94 ? 0.2872 0.2756 0.5585 -0.0236 -0.0520 -0.0186 94 PRO B CD  
1579 S SG  . CYS B 99 ? 0.4211 0.4539 0.6451 0.0152  -0.0497 -0.0048 99 CYS B SG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?  ?   ?   A . n 
A 1 2   ALA 2   2   2  ALA ALA A . n 
A 1 3   ARG 3   3   3  ARG ARG A . n 
A 1 4   PRO 4   4   4  PRO PRO A . n 
A 1 5   LEU 5   5   5  LEU LEU A . n 
A 1 6   GLU 6   6   6  GLU GLU A . n 
A 1 7   GLN 7   7   7  GLN GLN A . n 
A 1 8   ALA 8   8   8  ALA ALA A . n 
A 1 9   VAL 9   9   9  VAL VAL A . n 
A 1 10  ALA 10  10  10 ALA ALA A . n 
A 1 11  ALA 11  11  11 ALA ALA A . n 
A 1 12  ILE 12  12  12 ILE ILE A . n 
A 1 13  VAL 13  13  13 VAL VAL A . n 
A 1 14  CYS 14  14  14 CYS CYS A . n 
A 1 15  THR 15  15  15 THR THR A . n 
A 1 16  PHE 16  16  16 PHE PHE A . n 
A 1 17  GLN 17  17  17 GLN GLN A . n 
A 1 18  GLU 18  18  18 GLU GLU A . n 
A 1 19  TYR 19  19  19 TYR TYR A . n 
A 1 20  ALA 20  20  20 ALA ALA A . n 
A 1 21  GLY 21  21  21 GLY GLY A . n 
A 1 22  ARG 22  22  22 ARG ARG A . n 
A 1 23  CYS 23  23  23 CYS CYS A . n 
A 1 24  GLY 24  24  24 GLY GLY A . n 
A 1 25  ASP 25  25  25 ASP ASP A . n 
A 1 26  LYS 26  26  26 LYS LYS A . n 
A 1 27  TYR 27  27  27 TYR TYR A . n 
A 1 28  LYS 28  28  28 LYS LYS A . n 
A 1 29  LEU 29  29  29 LEU LEU A . n 
A 1 30  CYS 30  30  30 CYS CYS A . n 
A 1 31  GLN 31  31  31 GLN GLN A . n 
A 1 32  ALA 32  32  32 ALA ALA A . n 
A 1 33  GLU 33  33  33 GLU GLU A . n 
A 1 34  LEU 34  34  34 LEU LEU A . n 
A 1 35  LYS 35  35  35 LYS LYS A . n 
A 1 36  GLU 36  36  36 GLU GLU A . n 
A 1 37  LEU 37  37  37 LEU LEU A . n 
A 1 38  LEU 38  38  38 LEU LEU A . n 
A 1 39  GLN 39  39  39 GLN GLN A . n 
A 1 40  LYS 40  40  40 LYS LYS A . n 
A 1 41  GLU 41  41  41 GLU GLU A . n 
A 1 42  LEU 42  42  42 LEU LEU A . n 
A 1 43  ALA 43  43  43 ALA ALA A . n 
A 1 44  THR 44  44  44 THR THR A . n 
A 1 45  TRP 45  45  45 TRP TRP A . n 
A 1 46  THR 46  46  46 THR THR A . n 
A 1 47  PRO 47  47  47 PRO PRO A . n 
A 1 48  THR 48  48  48 THR THR A . n 
A 1 49  GLU 49  49  49 GLU GLU A . n 
A 1 50  PHE 50  50  50 PHE PHE A . n 
A 1 51  ARG 51  51  51 ARG ARG A . n 
A 1 52  GLU 52  52  52 GLU GLU A . n 
A 1 53  CYS 53  53  53 CYS CYS A . n 
A 1 54  ASP 54  54  54 ASP ASP A . n 
A 1 55  TYR 55  55  55 TYR TYR A . n 
A 1 56  ASN 56  56  56 ASN ASN A . n 
A 1 57  LYS 57  57  57 LYS LYS A . n 
A 1 58  PHE 58  58  58 PHE PHE A . n 
A 1 59  MET 59  59  59 MET MET A . n 
A 1 60  SER 60  60  60 SER SER A . n 
A 1 61  VAL 61  61  61 VAL VAL A . n 
A 1 62  LEU 62  62  62 LEU LEU A . n 
A 1 63  ASP 63  63  63 ASP ASP A . n 
A 1 64  THR 64  64  64 THR THR A . n 
A 1 65  ASN 65  65  65 ASN ASN A . n 
A 1 66  LYS 66  66  66 LYS LYS A . n 
A 1 67  ASP 67  67  67 ASP ASP A . n 
A 1 68  CYS 68  68  68 CYS CYS A . n 
A 1 69  GLU 69  69  69 GLU GLU A . n 
A 1 70  VAL 70  70  70 VAL VAL A . n 
A 1 71  ASP 71  71  71 ASP ASP A . n 
A 1 72  PHE 72  72  72 PHE PHE A . n 
A 1 73  VAL 73  73  73 VAL VAL A . n 
A 1 74  GLU 74  74  74 GLU GLU A . n 
A 1 75  TYR 75  75  75 TYR TYR A . n 
A 1 76  VAL 76  76  76 VAL VAL A . n 
A 1 77  ARG 77  77  77 ARG ARG A . n 
A 1 78  SER 78  78  78 SER SER A . n 
A 1 79  LEU 79  79  79 LEU LEU A . n 
A 1 80  ALA 80  80  80 ALA ALA A . n 
A 1 81  CYS 81  81  81 CYS CYS A . n 
A 1 82  LEU 82  82  82 LEU LEU A . n 
A 1 83  CYS 83  83  83 CYS CYS A . n 
A 1 84  LEU 84  84  84 LEU LEU A . n 
A 1 85  TYR 85  85  85 TYR TYR A . n 
A 1 86  CYS 86  86  86 CYS CYS A . n 
A 1 87  HIS 87  87  87 HIS HIS A . n 
A 1 88  GLU 88  88  88 GLU GLU A . n 
A 1 89  TYR 89  89  89 TYR TYR A . n 
A 1 90  PHE 90  90  90 PHE PHE A . n 
A 1 91  LYS 91  91  91 LYS LYS A . n 
A 1 92  ASP 92  92  92 ASP ASP A . n 
A 1 93  CYS 93  93  93 CYS CYS A . n 
A 1 94  PRO 94  94  94 PRO PRO A . n 
A 1 95  SER 95  95  ?  ?   ?   A . n 
A 1 96  GLU 96  96  ?  ?   ?   A . n 
A 1 97  PRO 97  97  ?  ?   ?   A . n 
A 1 98  PRO 98  98  ?  ?   ?   A . n 
A 1 99  CYS 99  99  99 CYS CYS A . n 
A 1 100 SER 100 100 ?  ?   ?   A . n 
A 1 101 GLN 101 101 ?  ?   ?   A . n 
B 1 1   MET 1   1   ?  ?   ?   B . n 
B 1 2   ALA 2   2   ?  ?   ?   B . n 
B 1 3   ARG 3   3   3  ARG ARG B . n 
B 1 4   PRO 4   4   4  PRO PRO B . n 
B 1 5   LEU 5   5   5  LEU LEU B . n 
B 1 6   GLU 6   6   6  GLU GLU B . n 
B 1 7   GLN 7   7   7  GLN GLN B . n 
B 1 8   ALA 8   8   8  ALA ALA B . n 
B 1 9   VAL 9   9   9  VAL VAL B . n 
B 1 10  ALA 10  10  10 ALA ALA B . n 
B 1 11  ALA 11  11  11 ALA ALA B . n 
B 1 12  ILE 12  12  12 ILE ILE B . n 
B 1 13  VAL 13  13  13 VAL VAL B . n 
B 1 14  CYS 14  14  14 CYS CYS B . n 
B 1 15  THR 15  15  15 THR THR B . n 
B 1 16  PHE 16  16  16 PHE PHE B . n 
B 1 17  GLN 17  17  17 GLN GLN B . n 
B 1 18  GLU 18  18  18 GLU GLU B . n 
B 1 19  TYR 19  19  19 TYR TYR B . n 
B 1 20  ALA 20  20  20 ALA ALA B . n 
B 1 21  GLY 21  21  21 GLY GLY B . n 
B 1 22  ARG 22  22  22 ARG ARG B . n 
B 1 23  CYS 23  23  23 CYS CYS B . n 
B 1 24  GLY 24  24  24 GLY GLY B . n 
B 1 25  ASP 25  25  25 ASP ASP B . n 
B 1 26  LYS 26  26  26 LYS LYS B . n 
B 1 27  TYR 27  27  27 TYR TYR B . n 
B 1 28  LYS 28  28  28 LYS LYS B . n 
B 1 29  LEU 29  29  29 LEU LEU B . n 
B 1 30  CYS 30  30  30 CYS CYS B . n 
B 1 31  GLN 31  31  31 GLN GLN B . n 
B 1 32  ALA 32  32  32 ALA ALA B . n 
B 1 33  GLU 33  33  33 GLU GLU B . n 
B 1 34  LEU 34  34  34 LEU LEU B . n 
B 1 35  LYS 35  35  35 LYS LYS B . n 
B 1 36  GLU 36  36  36 GLU GLU B . n 
B 1 37  LEU 37  37  37 LEU LEU B . n 
B 1 38  LEU 38  38  38 LEU LEU B . n 
B 1 39  GLN 39  39  39 GLN GLN B . n 
B 1 40  LYS 40  40  40 LYS LYS B . n 
B 1 41  GLU 41  41  41 GLU GLU B . n 
B 1 42  LEU 42  42  42 LEU LEU B . n 
B 1 43  ALA 43  43  43 ALA ALA B . n 
B 1 44  THR 44  44  44 THR THR B . n 
B 1 45  TRP 45  45  45 TRP TRP B . n 
B 1 46  THR 46  46  46 THR THR B . n 
B 1 47  PRO 47  47  47 PRO PRO B . n 
B 1 48  THR 48  48  48 THR THR B . n 
B 1 49  GLU 49  49  49 GLU GLU B . n 
B 1 50  PHE 50  50  50 PHE PHE B . n 
B 1 51  ARG 51  51  51 ARG ARG B . n 
B 1 52  GLU 52  52  52 GLU GLU B . n 
B 1 53  CYS 53  53  53 CYS CYS B . n 
B 1 54  ASP 54  54  54 ASP ASP B . n 
B 1 55  TYR 55  55  55 TYR TYR B . n 
B 1 56  ASN 56  56  56 ASN ASN B . n 
B 1 57  LYS 57  57  57 LYS LYS B . n 
B 1 58  PHE 58  58  58 PHE PHE B . n 
B 1 59  MET 59  59  59 MET MET B . n 
B 1 60  SER 60  60  60 SER SER B . n 
B 1 61  VAL 61  61  61 VAL VAL B . n 
B 1 62  LEU 62  62  62 LEU LEU B . n 
B 1 63  ASP 63  63  63 ASP ASP B . n 
B 1 64  THR 64  64  64 THR THR B . n 
B 1 65  ASN 65  65  65 ASN ASN B . n 
B 1 66  LYS 66  66  66 LYS LYS B . n 
B 1 67  ASP 67  67  67 ASP ASP B . n 
B 1 68  CYS 68  68  68 CYS CYS B . n 
B 1 69  GLU 69  69  69 GLU GLU B . n 
B 1 70  VAL 70  70  70 VAL VAL B . n 
B 1 71  ASP 71  71  71 ASP ASP B . n 
B 1 72  PHE 72  72  72 PHE PHE B . n 
B 1 73  VAL 73  73  73 VAL VAL B . n 
B 1 74  GLU 74  74  74 GLU GLU B . n 
B 1 75  TYR 75  75  75 TYR TYR B . n 
B 1 76  VAL 76  76  76 VAL VAL B . n 
B 1 77  ARG 77  77  77 ARG ARG B . n 
B 1 78  SER 78  78  78 SER SER B . n 
B 1 79  LEU 79  79  79 LEU LEU B . n 
B 1 80  ALA 80  80  80 ALA ALA B . n 
B 1 81  CYS 81  81  81 CYS CYS B . n 
B 1 82  LEU 82  82  82 LEU LEU B . n 
B 1 83  CYS 83  83  83 CYS CYS B . n 
B 1 84  LEU 84  84  84 LEU LEU B . n 
B 1 85  TYR 85  85  85 TYR TYR B . n 
B 1 86  CYS 86  86  86 CYS CYS B . n 
B 1 87  HIS 87  87  87 HIS HIS B . n 
B 1 88  GLU 88  88  88 GLU GLU B . n 
B 1 89  TYR 89  89  89 TYR TYR B . n 
B 1 90  PHE 90  90  90 PHE PHE B . n 
B 1 91  LYS 91  91  91 LYS LYS B . n 
B 1 92  ASP 92  92  92 ASP ASP B . n 
B 1 93  CYS 93  93  93 CYS CYS B . n 
B 1 94  PRO 94  94  94 PRO PRO B . n 
B 1 95  SER 95  95  ?  ?   ?   B . n 
B 1 96  GLU 96  96  ?  ?   ?   B . n 
B 1 97  PRO 97  97  ?  ?   ?   B . n 
B 1 98  PRO 98  98  ?  ?   ?   B . n 
B 1 99  CYS 99  99  99 CYS CYS B . n 
B 1 100 SER 100 100 ?  ?   ?   B . n 
B 1 101 GLN 101 101 ?  ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3450 ? 
1 MORE         -37  ? 
1 'SSA (A^2)'  9260 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-06-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 20.5290 30.3970 4.9630  0.0342 0.0454 0.1781 -0.0254 -0.0070 0.0284 0.4225 3.1037 0.5809 0.6761  
0.1188  -0.1824 0.1079 -0.0600 0.0217  0.2676  -0.1438 0.0109 0.0282  -0.0749 0.0359 
'X-RAY DIFFRACTION' 2 ? refined 20.2470 37.4650 -9.7880 0.0392 0.0481 0.1795 0.0254  0.0056  0.0272 0.3957 3.1787 0.5919 -0.6896 
-0.1013 -0.1289 0.1091 0.0586  -0.0308 -0.2965 -0.1457 0.0293 -0.0293 -0.0830 0.0366 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 2 ? ? A 99 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 3 ? ? B 99 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum  ? 1 
CNS      refinement        .        ? 2 
REFMAC   refinement        5.5.0102 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
CNS      phasing           .        ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    31 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CG 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ASN 
_pdbx_validate_close_contact.auth_seq_id_2    65 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH1 A ARG 22 ? ? 123.64 120.30 3.34 0.50 N 
2 1 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.37 120.30 3.07 0.50 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    CYS 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     68 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    A 
_pdbx_validate_torsion.phi             -142.66 
_pdbx_validate_torsion.psi             39.94 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 69 ? CG  ? A GLU 69 CG  
2  1 Y 1 A GLU 69 ? CD  ? A GLU 69 CD  
3  1 Y 1 A GLU 69 ? OE1 ? A GLU 69 OE1 
4  1 Y 1 A GLU 69 ? OE2 ? A GLU 69 OE2 
5  1 Y 1 A CYS 99 ? N   ? A CYS 99 N   
6  1 Y 1 A CYS 99 ? CA  ? A CYS 99 CA  
7  1 Y 1 A CYS 99 ? C   ? A CYS 99 C   
8  1 Y 1 A CYS 99 ? O   ? A CYS 99 O   
9  1 Y 1 A CYS 99 ? CB  ? A CYS 99 CB  
10 1 Y 1 B CYS 99 ? N   ? B CYS 99 N   
11 1 Y 1 B CYS 99 ? CA  ? B CYS 99 CA  
12 1 Y 1 B CYS 99 ? C   ? B CYS 99 C   
13 1 Y 1 B CYS 99 ? O   ? B CYS 99 O   
14 1 Y 1 B CYS 99 ? CB  ? B CYS 99 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 95  ? A SER 95  
3  1 Y 1 A GLU 96  ? A GLU 96  
4  1 Y 1 A PRO 97  ? A PRO 97  
5  1 Y 1 A PRO 98  ? A PRO 98  
6  1 Y 1 A SER 100 ? A SER 100 
7  1 Y 1 A GLN 101 ? A GLN 101 
8  1 Y 1 B MET 1   ? B MET 1   
9  1 Y 1 B ALA 2   ? B ALA 2   
10 1 Y 1 B SER 95  ? B SER 95  
11 1 Y 1 B GLU 96  ? B GLU 96  
12 1 Y 1 B PRO 97  ? B PRO 97  
13 1 Y 1 B PRO 98  ? B PRO 98  
14 1 Y 1 B SER 100 ? B SER 100 
15 1 Y 1 B GLN 101 ? B GLN 101 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  102 102 HOH HOH A . 
C 2 HOH 2  103 103 HOH HOH A . 
C 2 HOH 3  104 104 HOH HOH A . 
C 2 HOH 4  105 71  HOH HOH A . 
C 2 HOH 5  106 106 HOH HOH A . 
C 2 HOH 6  107 4   HOH HOH A . 
C 2 HOH 7  108 5   HOH HOH A . 
C 2 HOH 8  109 8   HOH HOH A . 
C 2 HOH 9  110 10  HOH HOH A . 
C 2 HOH 10 111 14  HOH HOH A . 
C 2 HOH 11 112 16  HOH HOH A . 
C 2 HOH 12 113 113 HOH HOH A . 
C 2 HOH 13 114 18  HOH HOH A . 
C 2 HOH 14 115 115 HOH HOH A . 
C 2 HOH 15 116 116 HOH HOH A . 
C 2 HOH 16 117 19  HOH HOH A . 
C 2 HOH 17 118 118 HOH HOH A . 
C 2 HOH 18 119 20  HOH HOH A . 
C 2 HOH 19 120 24  HOH HOH A . 
C 2 HOH 20 121 121 HOH HOH A . 
C 2 HOH 21 122 29  HOH HOH A . 
C 2 HOH 22 123 31  HOH HOH A . 
C 2 HOH 23 124 32  HOH HOH A . 
C 2 HOH 24 125 35  HOH HOH A . 
C 2 HOH 25 126 37  HOH HOH A . 
C 2 HOH 26 127 40  HOH HOH A . 
C 2 HOH 27 128 41  HOH HOH A . 
C 2 HOH 28 129 42  HOH HOH A . 
C 2 HOH 29 130 43  HOH HOH A . 
C 2 HOH 30 131 45  HOH HOH A . 
C 2 HOH 31 132 49  HOH HOH A . 
C 2 HOH 32 133 56  HOH HOH A . 
C 2 HOH 33 134 57  HOH HOH A . 
C 2 HOH 34 135 135 HOH HOH A . 
C 2 HOH 35 136 59  HOH HOH A . 
C 2 HOH 36 138 138 HOH HOH A . 
C 2 HOH 37 139 63  HOH HOH A . 
C 2 HOH 38 140 140 HOH HOH A . 
C 2 HOH 39 141 64  HOH HOH A . 
C 2 HOH 40 142 142 HOH HOH A . 
C 2 HOH 41 143 143 HOH HOH A . 
C 2 HOH 42 144 70  HOH HOH A . 
C 2 HOH 43 145 74  HOH HOH A . 
C 2 HOH 44 146 146 HOH HOH A . 
C 2 HOH 45 147 75  HOH HOH A . 
C 2 HOH 46 148 148 HOH HOH A . 
C 2 HOH 47 149 149 HOH HOH A . 
C 2 HOH 48 150 150 HOH HOH A . 
C 2 HOH 49 151 151 HOH HOH A . 
C 2 HOH 50 152 76  HOH HOH A . 
C 2 HOH 51 153 77  HOH HOH A . 
C 2 HOH 52 154 81  HOH HOH A . 
C 2 HOH 53 155 90  HOH HOH A . 
C 2 HOH 54 156 156 HOH HOH A . 
C 2 HOH 55 157 157 HOH HOH A . 
C 2 HOH 56 158 158 HOH HOH A . 
C 2 HOH 57 159 92  HOH HOH A . 
C 2 HOH 58 160 160 HOH HOH A . 
C 2 HOH 59 161 93  HOH HOH A . 
C 2 HOH 60 162 99  HOH HOH A . 
C 2 HOH 61 163 100 HOH HOH A . 
D 2 HOH 1  102 1   HOH HOH B . 
D 2 HOH 2  103 2   HOH HOH B . 
D 2 HOH 3  104 3   HOH HOH B . 
D 2 HOH 4  105 105 HOH HOH B . 
D 2 HOH 5  106 7   HOH HOH B . 
D 2 HOH 6  107 11  HOH HOH B . 
D 2 HOH 7  108 12  HOH HOH B . 
D 2 HOH 8  109 13  HOH HOH B . 
D 2 HOH 9  110 110 HOH HOH B . 
D 2 HOH 10 111 111 HOH HOH B . 
D 2 HOH 11 112 112 HOH HOH B . 
D 2 HOH 12 113 15  HOH HOH B . 
D 2 HOH 13 114 17  HOH HOH B . 
D 2 HOH 14 115 21  HOH HOH B . 
D 2 HOH 15 116 22  HOH HOH B . 
D 2 HOH 16 117 117 HOH HOH B . 
D 2 HOH 17 118 23  HOH HOH B . 
D 2 HOH 18 119 119 HOH HOH B . 
D 2 HOH 19 120 120 HOH HOH B . 
D 2 HOH 20 121 25  HOH HOH B . 
D 2 HOH 21 122 122 HOH HOH B . 
D 2 HOH 22 123 26  HOH HOH B . 
D 2 HOH 23 124 27  HOH HOH B . 
D 2 HOH 24 125 125 HOH HOH B . 
D 2 HOH 25 126 28  HOH HOH B . 
D 2 HOH 26 127 127 HOH HOH B . 
D 2 HOH 27 128 30  HOH HOH B . 
D 2 HOH 28 129 33  HOH HOH B . 
D 2 HOH 29 130 34  HOH HOH B . 
D 2 HOH 30 131 131 HOH HOH B . 
D 2 HOH 31 132 36  HOH HOH B . 
D 2 HOH 32 133 38  HOH HOH B . 
D 2 HOH 33 134 39  HOH HOH B . 
D 2 HOH 34 135 44  HOH HOH B . 
D 2 HOH 35 136 46  HOH HOH B . 
D 2 HOH 36 137 137 HOH HOH B . 
D 2 HOH 37 138 48  HOH HOH B . 
D 2 HOH 38 139 139 HOH HOH B . 
D 2 HOH 39 140 50  HOH HOH B . 
D 2 HOH 40 141 141 HOH HOH B . 
D 2 HOH 41 142 51  HOH HOH B . 
D 2 HOH 42 143 53  HOH HOH B . 
D 2 HOH 43 144 54  HOH HOH B . 
D 2 HOH 44 145 55  HOH HOH B . 
D 2 HOH 45 146 58  HOH HOH B . 
D 2 HOH 46 147 147 HOH HOH B . 
D 2 HOH 47 148 60  HOH HOH B . 
D 2 HOH 48 149 62  HOH HOH B . 
D 2 HOH 49 150 65  HOH HOH B . 
D 2 HOH 50 151 66  HOH HOH B . 
D 2 HOH 51 152 67  HOH HOH B . 
D 2 HOH 52 153 153 HOH HOH B . 
D 2 HOH 53 154 154 HOH HOH B . 
D 2 HOH 54 155 155 HOH HOH B . 
D 2 HOH 55 156 69  HOH HOH B . 
D 2 HOH 56 157 6   HOH HOH B . 
D 2 HOH 57 158 73  HOH HOH B . 
D 2 HOH 58 159 159 HOH HOH B . 
D 2 HOH 59 160 78  HOH HOH B . 
D 2 HOH 60 161 79  HOH HOH B . 
D 2 HOH 61 162 80  HOH HOH B . 
D 2 HOH 62 163 82  HOH HOH B . 
D 2 HOH 63 164 83  HOH HOH B . 
D 2 HOH 64 165 84  HOH HOH B . 
D 2 HOH 65 166 86  HOH HOH B . 
D 2 HOH 66 167 87  HOH HOH B . 
D 2 HOH 67 168 88  HOH HOH B . 
D 2 HOH 68 169 89  HOH HOH B . 
D 2 HOH 69 170 91  HOH HOH B . 
D 2 HOH 70 171 97  HOH HOH B . 
D 2 HOH 71 172 101 HOH HOH B . 
D 2 HOH 72 173 47  HOH HOH B . 
#