data_3NTY
# 
_entry.id   3NTY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NTY         
RCSB  RCSB060276   
WWPDB D_1000060276 
# 
_pdbx_database_status.entry_id                        3NTY 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-06 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dhagat, U.'     1 
'El-Kabbani, O.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Probing the inhibitor selectivity pocket of human 20 alpha-hydroxysteroid dehydrogenase (AKR1C1) with X-ray crystallography and site-directed mutagenesis
;
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            21 
_citation.page_first                2564 
_citation.page_last                 2567 
_citation.year                      2011 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21414777 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2011.01.076 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'El-Kabbani, O.' 1 
primary 'Dhagat, U.'     2 
primary 'Soda, M.'       3 
primary 'Endo, S.'       4 
primary 'Matsunaga, T.'  5 
primary 'Hara, A.'       6 
# 
_cell.length_a           39.607 
_cell.length_b           84.052 
_cell.length_c           49.051 
_cell.angle_alpha        90.000 
_cell.angle_beta         91.410 
_cell.angle_gamma        90.000 
_cell.entry_id           3NTY 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3NTY 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Aldo-keto reductase family 1 member C1'           36839.332 1   '1.1.1.-, 1.1.1.149, 1.3.1.20, 1.1.1.112' ? ? ? 
2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   1   ?                                         ? ? ? 
3 non-polymer syn '5-chloro-4-hydroxybiphenyl-3-carboxylic acid'     248.662   1   ?                                         ? ? ? 
4 non-polymer syn 'ZINC ION'                                         65.409    1   ?                                         ? ? ? 
5 water       nat water                                              18.015    379 ?                                         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;AKR1C1, 20-alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, Indanol dehydrogenase, Dihydrodiol dehydrogenase 1/2, DD1/DD2, Chlordecone reductase homolog HAKRC, High-affinity hepatic bile acid-binding protein, HBAB
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF
YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLA
KSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS
DEY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF
YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLA
KSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS
DEY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   SER n 
1 4   LYS n 
1 5   TYR n 
1 6   GLN n 
1 7   CYS n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  ASN n 
1 12  ASP n 
1 13  GLY n 
1 14  HIS n 
1 15  PHE n 
1 16  MET n 
1 17  PRO n 
1 18  VAL n 
1 19  LEU n 
1 20  GLY n 
1 21  PHE n 
1 22  GLY n 
1 23  THR n 
1 24  TYR n 
1 25  ALA n 
1 26  PRO n 
1 27  ALA n 
1 28  GLU n 
1 29  VAL n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  LYS n 
1 34  ALA n 
1 35  LEU n 
1 36  GLU n 
1 37  ALA n 
1 38  THR n 
1 39  LYS n 
1 40  LEU n 
1 41  ALA n 
1 42  ILE n 
1 43  GLU n 
1 44  ALA n 
1 45  GLY n 
1 46  PHE n 
1 47  ARG n 
1 48  HIS n 
1 49  ILE n 
1 50  ASP n 
1 51  SER n 
1 52  ALA n 
1 53  HIS n 
1 54  LEU n 
1 55  TYR n 
1 56  ASN n 
1 57  ASN n 
1 58  GLU n 
1 59  GLU n 
1 60  GLN n 
1 61  VAL n 
1 62  GLY n 
1 63  LEU n 
1 64  ALA n 
1 65  ILE n 
1 66  ARG n 
1 67  SER n 
1 68  LYS n 
1 69  ILE n 
1 70  ALA n 
1 71  ASP n 
1 72  GLY n 
1 73  SER n 
1 74  VAL n 
1 75  LYS n 
1 76  ARG n 
1 77  GLU n 
1 78  ASP n 
1 79  ILE n 
1 80  PHE n 
1 81  TYR n 
1 82  THR n 
1 83  SER n 
1 84  LYS n 
1 85  LEU n 
1 86  TRP n 
1 87  CYS n 
1 88  ASN n 
1 89  SER n 
1 90  HIS n 
1 91  ARG n 
1 92  PRO n 
1 93  GLU n 
1 94  LEU n 
1 95  VAL n 
1 96  ARG n 
1 97  PRO n 
1 98  ALA n 
1 99  LEU n 
1 100 GLU n 
1 101 ARG n 
1 102 SER n 
1 103 LEU n 
1 104 LYS n 
1 105 ASN n 
1 106 LEU n 
1 107 GLN n 
1 108 LEU n 
1 109 ASP n 
1 110 TYR n 
1 111 VAL n 
1 112 ASP n 
1 113 LEU n 
1 114 TYR n 
1 115 LEU n 
1 116 ILE n 
1 117 HIS n 
1 118 PHE n 
1 119 PRO n 
1 120 VAL n 
1 121 SER n 
1 122 VAL n 
1 123 LYS n 
1 124 PRO n 
1 125 GLY n 
1 126 GLU n 
1 127 GLU n 
1 128 VAL n 
1 129 ILE n 
1 130 PRO n 
1 131 LYS n 
1 132 ASP n 
1 133 GLU n 
1 134 ASN n 
1 135 GLY n 
1 136 LYS n 
1 137 ILE n 
1 138 LEU n 
1 139 PHE n 
1 140 ASP n 
1 141 THR n 
1 142 VAL n 
1 143 ASP n 
1 144 LEU n 
1 145 CYS n 
1 146 ALA n 
1 147 THR n 
1 148 TRP n 
1 149 GLU n 
1 150 ALA n 
1 151 VAL n 
1 152 GLU n 
1 153 LYS n 
1 154 CYS n 
1 155 LYS n 
1 156 ASP n 
1 157 ALA n 
1 158 GLY n 
1 159 LEU n 
1 160 ALA n 
1 161 LYS n 
1 162 SER n 
1 163 ILE n 
1 164 GLY n 
1 165 VAL n 
1 166 SER n 
1 167 ASN n 
1 168 PHE n 
1 169 ASN n 
1 170 ARG n 
1 171 ARG n 
1 172 GLN n 
1 173 LEU n 
1 174 GLU n 
1 175 MET n 
1 176 ILE n 
1 177 LEU n 
1 178 ASN n 
1 179 LYS n 
1 180 PRO n 
1 181 GLY n 
1 182 LEU n 
1 183 LYS n 
1 184 TYR n 
1 185 LYS n 
1 186 PRO n 
1 187 VAL n 
1 188 CYS n 
1 189 ASN n 
1 190 GLN n 
1 191 VAL n 
1 192 GLU n 
1 193 CYS n 
1 194 HIS n 
1 195 PRO n 
1 196 TYR n 
1 197 PHE n 
1 198 ASN n 
1 199 GLN n 
1 200 ARG n 
1 201 LYS n 
1 202 LEU n 
1 203 LEU n 
1 204 ASP n 
1 205 PHE n 
1 206 CYS n 
1 207 LYS n 
1 208 SER n 
1 209 LYS n 
1 210 ASP n 
1 211 ILE n 
1 212 VAL n 
1 213 LEU n 
1 214 VAL n 
1 215 ALA n 
1 216 TYR n 
1 217 SER n 
1 218 ALA n 
1 219 LEU n 
1 220 GLY n 
1 221 SER n 
1 222 HIS n 
1 223 ARG n 
1 224 GLU n 
1 225 GLU n 
1 226 PRO n 
1 227 TRP n 
1 228 VAL n 
1 229 ASP n 
1 230 PRO n 
1 231 ASN n 
1 232 SER n 
1 233 PRO n 
1 234 VAL n 
1 235 LEU n 
1 236 LEU n 
1 237 GLU n 
1 238 ASP n 
1 239 PRO n 
1 240 VAL n 
1 241 LEU n 
1 242 CYS n 
1 243 ALA n 
1 244 LEU n 
1 245 ALA n 
1 246 LYS n 
1 247 LYS n 
1 248 HIS n 
1 249 LYS n 
1 250 ARG n 
1 251 THR n 
1 252 PRO n 
1 253 ALA n 
1 254 LEU n 
1 255 ILE n 
1 256 ALA n 
1 257 LEU n 
1 258 ARG n 
1 259 TYR n 
1 260 GLN n 
1 261 LEU n 
1 262 GLN n 
1 263 ARG n 
1 264 GLY n 
1 265 VAL n 
1 266 VAL n 
1 267 VAL n 
1 268 LEU n 
1 269 ALA n 
1 270 LYS n 
1 271 SER n 
1 272 TYR n 
1 273 ASN n 
1 274 GLU n 
1 275 GLN n 
1 276 ARG n 
1 277 ILE n 
1 278 ARG n 
1 279 GLN n 
1 280 ASN n 
1 281 VAL n 
1 282 GLN n 
1 283 VAL n 
1 284 PHE n 
1 285 GLU n 
1 286 PHE n 
1 287 GLN n 
1 288 LEU n 
1 289 THR n 
1 290 SER n 
1 291 GLU n 
1 292 GLU n 
1 293 MET n 
1 294 LYS n 
1 295 ALA n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 LEU n 
1 300 ASN n 
1 301 ARG n 
1 302 ASN n 
1 303 VAL n 
1 304 ARG n 
1 305 TYR n 
1 306 LEU n 
1 307 THR n 
1 308 LEU n 
1 309 ASP n 
1 310 ILE n 
1 311 PHE n 
1 312 ALA n 
1 313 GLY n 
1 314 PRO n 
1 315 PRO n 
1 316 ASN n 
1 317 TYR n 
1 318 PRO n 
1 319 PHE n 
1 320 SER n 
1 321 ASP n 
1 322 GLU n 
1 323 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pKK223-3, pKKDD1' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AK1C1_HUMAN 
_struct_ref.pdbx_db_accession          Q04828 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF
YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLA
KSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS
DEY
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3NTY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 323 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q04828 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  323 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       323 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5P3 non-polymer         . '5-chloro-4-hydroxybiphenyl-3-carboxylic acid'     '5-Phenyl,3-chlorosalicylic acid'            
'C13 H9 Cl O3'      248.662 
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                         ?                                            'Zn 2' 
65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3NTY 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   44.48 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.1M MES, 20%v/v Polyethylene glycol monomethyl ether 550, 0.01M Zinc sulphate heptahydrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-05-20 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Mirrors 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54179 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54179 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3NTY 
_reflns.observed_criterion_sigma_F   1 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            1.87 
_reflns.d_resolution_low             30 
_reflns.number_all                   24636 
_reflns.number_obs                   22148 
_reflns.percent_possible_obs         89.9 
_reflns.pdbx_Rmerge_I_obs            0.0918 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.37 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high                  1.87 
_reflns_shell.d_res_low                   1.93 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        81.1 
_reflns_shell.Rmerge_I_obs                0.3522 
_reflns_shell.meanI_over_sigI_obs         1.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             3.23 
_reflns_shell.number_unique_all           1852 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_diffrn_id              ? 
_reflns_shell.pdbx_ordinal                1 
# 
_refine.entry_id                                 3NTY 
_refine.ls_d_res_high                            1.8700 
_refine.ls_d_res_low                             28.62 
_refine.pdbx_ls_sigma_F                          1 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_number_reflns_obs                     22148 
_refine.ls_number_reflns_all                     24636 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          0.22 
_refine.ls_R_factor_obs                          0.1884 
_refine.ls_R_factor_R_work                       0.1850 
_refine.ls_wR_factor_R_work                      0.1879 
_refine.ls_R_factor_R_free                       0.2531 
_refine.ls_wR_factor_R_free                      0.2564 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_number_reflns_R_free                  1107 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               25.3882 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.9900 
_refine.aniso_B[2][2]                            1.4400 
_refine.aniso_B[3][3]                            -0.4900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.8300 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9570 
_refine.correlation_coeff_Fo_to_Fc_free          0.9260 
_refine.overall_SU_R_Cruickshank_DPI             0.1938 
_refine.overall_SU_R_free                        0.1800 
_refine.pdbx_overall_ESU_R_Free                  0.1800 
_refine.overall_SU_ML                            0.1230 
_refine.overall_SU_B                             4.1690 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3C3U' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8109 
_refine.B_iso_max                                58.320 
_refine.B_iso_min                                9.950 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.pdbx_ls_sigma_I                          1 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3NTY 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2549 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             379 
_refine_hist.number_atoms_total               2994 
_refine_hist.d_res_high                       1.8700 
_refine_hist.d_res_low                        28.62 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       2701 0.022  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    3678 1.859  2.005  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 327  6.024  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 123  35.157 24.228 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 469  13.726 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 17   16.217 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         403  0.122  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   2046 0.011  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            1609 0.968  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           2611 1.571  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            1092 2.738  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           1062 3.997  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.8700 
_refine_ls_shell.d_res_low                        1.93 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               81.1 
_refine_ls_shell.number_reflns_R_work             1551 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3890 
_refine_ls_shell.R_factor_R_free                  0.4260 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             92 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1627 
_refine_ls_shell.number_reflns_obs                1852 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3NTY 
_struct.title                     'Crystal structure of AKR1C1 in complex with NADP and 5-Phenyl,3-chlorosalicylic acid' 
_struct.pdbx_descriptor           'Aldo-keto reductase family 1 member C1 (E.C.1.1.1.-, 1.1.1.149, 1.3.1.20, 1.1.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NTY 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR' 
_struct_keywords.text            
'Aldo-keto reductase, 20 alpha hydroxysteroid dehydrogenase, AKR1C1, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 32  ? GLY A 45  ? SER A 32  GLY A 45  1 ? 14 
HELX_P HELX_P2  2  ALA A 52  ? ASN A 56  ? ALA A 52  ASN A 56  5 ? 5  
HELX_P HELX_P3  3  ASN A 57  ? ASP A 71  ? ASN A 57  ASP A 71  1 ? 15 
HELX_P HELX_P4  4  LYS A 75  ? ILE A 79  ? LYS A 75  ILE A 79  5 ? 5  
HELX_P HELX_P5  5  TRP A 86  ? HIS A 90  ? TRP A 86  HIS A 90  5 ? 5  
HELX_P HELX_P6  6  ARG A 91  ? GLU A 93  ? ARG A 91  GLU A 93  5 ? 3  
HELX_P HELX_P7  7  LEU A 94  ? GLN A 107 ? LEU A 94  GLN A 107 1 ? 14 
HELX_P HELX_P8  8  ASP A 143 ? ALA A 157 ? ASP A 143 ALA A 157 1 ? 15 
HELX_P HELX_P9  9  ASN A 169 ? ASN A 178 ? ASN A 169 ASN A 178 1 ? 10 
HELX_P HELX_P10 10 GLN A 199 ? LYS A 209 ? GLN A 199 LYS A 209 1 ? 11 
HELX_P HELX_P11 11 VAL A 234 ? GLU A 237 ? VAL A 234 GLU A 237 5 ? 4  
HELX_P HELX_P12 12 ASP A 238 ? HIS A 248 ? ASP A 238 HIS A 248 1 ? 11 
HELX_P HELX_P13 13 THR A 251 ? ARG A 263 ? THR A 251 ARG A 263 1 ? 13 
HELX_P HELX_P14 14 ASN A 273 ? VAL A 281 ? ASN A 273 VAL A 281 1 ? 9  
HELX_P HELX_P15 15 GLN A 282 ? PHE A 286 ? GLN A 282 PHE A 286 5 ? 5  
HELX_P HELX_P16 16 THR A 289 ? GLY A 298 ? THR A 289 GLY A 298 1 ? 10 
HELX_P HELX_P17 17 LEU A 308 ? ALA A 312 ? LEU A 308 ALA A 312 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A GLU 292 OE1 ? ? ? 1_555 D ZN  . ZN ? ? A GLU 292 A ZN  324 1_555 ? ? ? ? ? ? ? 1.951 ? 
metalc2 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 E HOH . O  ? ? A ZN  324 A HOH 333 1_555 ? ? ? ? ? ? ? 1.972 ? 
metalc3 metalc ? ? A HIS 248 NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 248 A ZN  324 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc4 metalc ? ? A GLU 292 OE2 ? ? ? 1_555 D ZN  . ZN ? ? A GLU 292 A ZN  324 1_555 ? ? ? ? ? ? ? 2.553 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           225 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            225 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    226 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     226 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
B 8 9 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 7   ? LYS A 9   ? CYS A 7   LYS A 9   
A 2 PHE A 15  ? PRO A 17  ? PHE A 15  PRO A 17  
B 1 LEU A 19  ? GLY A 22  ? LEU A 19  GLY A 22  
B 2 HIS A 48  ? ASP A 50  ? HIS A 48  ASP A 50  
B 3 PHE A 80  ? LEU A 85  ? PHE A 80  LEU A 85  
B 4 VAL A 111 ? ILE A 116 ? VAL A 111 ILE A 116 
B 5 ALA A 160 ? SER A 166 ? ALA A 160 SER A 166 
B 6 CYS A 188 ? GLU A 192 ? CYS A 188 GLU A 192 
B 7 VAL A 212 ? TYR A 216 ? VAL A 212 TYR A 216 
B 8 VAL A 266 ? LYS A 270 ? VAL A 266 LYS A 270 
B 9 LEU A 19  ? GLY A 22  ? LEU A 19  GLY A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 8   ? N VAL A 8   O MET A 16  ? O MET A 16  
B 1 2 N PHE A 21  ? N PHE A 21  O HIS A 48  ? O HIS A 48  
B 2 3 N ILE A 49  ? N ILE A 49  O THR A 82  ? O THR A 82  
B 3 4 N LEU A 85  ? N LEU A 85  O LEU A 115 ? O LEU A 115 
B 4 5 N VAL A 111 ? N VAL A 111 O LYS A 161 ? O LYS A 161 
B 5 6 N VAL A 165 ? N VAL A 165 O CYS A 188 ? O CYS A 188 
B 6 7 N VAL A 191 ? N VAL A 191 O TYR A 216 ? O TYR A 216 
B 7 8 N ALA A 215 ? N ALA A 215 O VAL A 266 ? O VAL A 266 
B 8 9 O VAL A 267 ? O VAL A 267 N GLY A 20  ? N GLY A 20  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE NAP A 351' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 5P3 A 350' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 324'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 36 GLY A 22  ? GLY A 22  . ? 1_555 ? 
2  AC1 36 THR A 23  ? THR A 23  . ? 1_555 ? 
3  AC1 36 TYR A 24  ? TYR A 24  . ? 1_555 ? 
4  AC1 36 ASP A 50  ? ASP A 50  . ? 1_555 ? 
5  AC1 36 TYR A 55  ? TYR A 55  . ? 1_555 ? 
6  AC1 36 HIS A 117 ? HIS A 117 . ? 1_555 ? 
7  AC1 36 SER A 166 ? SER A 166 . ? 1_555 ? 
8  AC1 36 ASN A 167 ? ASN A 167 . ? 1_555 ? 
9  AC1 36 GLN A 190 ? GLN A 190 . ? 1_555 ? 
10 AC1 36 TYR A 216 ? TYR A 216 . ? 1_555 ? 
11 AC1 36 SER A 217 ? SER A 217 . ? 1_555 ? 
12 AC1 36 ALA A 218 ? ALA A 218 . ? 1_555 ? 
13 AC1 36 LEU A 219 ? LEU A 219 . ? 1_555 ? 
14 AC1 36 GLY A 220 ? GLY A 220 . ? 1_555 ? 
15 AC1 36 SER A 221 ? SER A 221 . ? 1_555 ? 
16 AC1 36 HIS A 222 ? HIS A 222 . ? 1_555 ? 
17 AC1 36 LEU A 236 ? LEU A 236 . ? 1_555 ? 
18 AC1 36 ALA A 253 ? ALA A 253 . ? 1_555 ? 
19 AC1 36 LEU A 268 ? LEU A 268 . ? 1_555 ? 
20 AC1 36 ALA A 269 ? ALA A 269 . ? 1_555 ? 
21 AC1 36 LYS A 270 ? LYS A 270 . ? 1_555 ? 
22 AC1 36 SER A 271 ? SER A 271 . ? 1_555 ? 
23 AC1 36 TYR A 272 ? TYR A 272 . ? 1_555 ? 
24 AC1 36 ARG A 276 ? ARG A 276 . ? 1_555 ? 
25 AC1 36 GLN A 279 ? GLN A 279 . ? 1_555 ? 
26 AC1 36 ASN A 280 ? ASN A 280 . ? 1_555 ? 
27 AC1 36 LEU A 306 ? LEU A 306 . ? 1_555 ? 
28 AC1 36 5P3 C .   ? 5P3 A 350 . ? 1_555 ? 
29 AC1 36 HOH E .   ? HOH A 383 . ? 1_555 ? 
30 AC1 36 HOH E .   ? HOH A 443 . ? 1_555 ? 
31 AC1 36 HOH E .   ? HOH A 450 . ? 1_555 ? 
32 AC1 36 HOH E .   ? HOH A 484 . ? 1_555 ? 
33 AC1 36 HOH E .   ? HOH A 590 . ? 1_555 ? 
34 AC1 36 HOH E .   ? HOH A 617 . ? 1_555 ? 
35 AC1 36 HOH E .   ? HOH A 658 . ? 1_555 ? 
36 AC1 36 HOH E .   ? HOH A 667 . ? 1_555 ? 
37 AC2 9  TYR A 24  ? TYR A 24  . ? 1_555 ? 
38 AC2 9  LEU A 54  ? LEU A 54  . ? 1_555 ? 
39 AC2 9  TYR A 55  ? TYR A 55  . ? 1_555 ? 
40 AC2 9  TRP A 86  ? TRP A 86  . ? 1_555 ? 
41 AC2 9  HIS A 117 ? HIS A 117 . ? 1_555 ? 
42 AC2 9  HIS A 222 ? HIS A 222 . ? 1_555 ? 
43 AC2 9  TRP A 227 ? TRP A 227 . ? 1_555 ? 
44 AC2 9  LEU A 308 ? LEU A 308 . ? 1_555 ? 
45 AC2 9  NAP B .   ? NAP A 351 . ? 1_555 ? 
46 AC3 4  GLU A 133 ? GLU A 133 . ? 1_656 ? 
47 AC3 4  HIS A 248 ? HIS A 248 . ? 1_555 ? 
48 AC3 4  GLU A 292 ? GLU A 292 . ? 1_555 ? 
49 AC3 4  HOH E .   ? HOH A 333 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3NTY 
_atom_sites.fract_transf_matrix[1][1]   0.025248 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000621 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011897 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020393 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . GLN A 1 6   ? 20.715  7.506   34.476 1.00 35.87 ? 6   GLN A N    1 
ATOM   2    C  CA   . GLN A 1 6   ? 21.973  7.222   33.708 1.00 33.24 ? 6   GLN A CA   1 
ATOM   3    C  C    . GLN A 1 6   ? 21.712  7.318   32.211 1.00 31.62 ? 6   GLN A C    1 
ATOM   4    O  O    . GLN A 1 6   ? 20.705  6.823   31.715 1.00 29.63 ? 6   GLN A O    1 
ATOM   5    C  CB   . GLN A 1 6   ? 22.476  5.821   34.060 1.00 35.37 ? 6   GLN A CB   1 
ATOM   6    C  CG   . GLN A 1 6   ? 23.783  5.339   33.346 0.50 34.84 ? 6   GLN A CG   1 
ATOM   7    C  CD   . GLN A 1 6   ? 24.879  6.375   33.348 0.50 33.10 ? 6   GLN A CD   1 
ATOM   8    O  OE1  . GLN A 1 6   ? 24.629  7.560   33.573 0.50 34.13 ? 6   GLN A OE1  1 
ATOM   9    N  NE2  . GLN A 1 6   ? 26.096  5.940   33.085 0.50 34.07 ? 6   GLN A NE2  1 
ATOM   10   N  N    . CYS A 1 7   ? 22.619  7.990   31.500 1.00 29.94 ? 7   CYS A N    1 
ATOM   11   C  CA   . CYS A 1 7   ? 22.411  8.309   30.086 1.00 28.73 ? 7   CYS A CA   1 
ATOM   12   C  C    . CYS A 1 7   ? 23.617  7.931   29.216 1.00 26.99 ? 7   CYS A C    1 
ATOM   13   O  O    . CYS A 1 7   ? 24.742  7.723   29.706 1.00 26.47 ? 7   CYS A O    1 
ATOM   14   C  CB   . CYS A 1 7   ? 22.077  9.802   29.921 1.00 28.49 ? 7   CYS A CB   1 
ATOM   15   S  SG   . CYS A 1 7   ? 20.486  10.399  30.582 1.00 35.67 ? 7   CYS A SG   1 
ATOM   16   N  N    . VAL A 1 8   ? 23.359  7.753   27.934 1.00 24.24 ? 8   VAL A N    1 
ATOM   17   C  CA   . VAL A 1 8   ? 24.396  7.442   27.010 1.00 23.64 ? 8   VAL A CA   1 
ATOM   18   C  C    . VAL A 1 8   ? 24.445  8.510   25.939 1.00 23.03 ? 8   VAL A C    1 
ATOM   19   O  O    . VAL A 1 8   ? 23.404  8.955   25.484 1.00 24.20 ? 8   VAL A O    1 
ATOM   20   C  CB   . VAL A 1 8   ? 24.263  6.011   26.332 1.00 22.45 ? 8   VAL A CB   1 
ATOM   21   C  CG1  . VAL A 1 8   ? 22.969  5.857   25.467 1.00 18.08 ? 8   VAL A CG1  1 
ATOM   22   C  CG2  . VAL A 1 8   ? 25.446  5.758   25.479 1.00 22.97 ? 8   VAL A CG2  1 
ATOM   23   N  N    . LYS A 1 9   ? 25.643  8.942   25.592 1.00 21.27 ? 9   LYS A N    1 
ATOM   24   C  CA   . LYS A 1 9   ? 25.801  9.939   24.550 1.00 22.99 ? 9   LYS A CA   1 
ATOM   25   C  C    . LYS A 1 9   ? 25.751  9.275   23.201 1.00 22.08 ? 9   LYS A C    1 
ATOM   26   O  O    . LYS A 1 9   ? 26.567  8.377   22.902 1.00 23.77 ? 9   LYS A O    1 
ATOM   27   C  CB   . LYS A 1 9   ? 27.121  10.744  24.714 1.00 22.22 ? 9   LYS A CB   1 
ATOM   28   C  CG   . LYS A 1 9   ? 27.272  11.752  23.600 1.00 24.28 ? 9   LYS A CG   1 
ATOM   29   C  CD   . LYS A 1 9   ? 28.717  12.215  23.515 1.00 32.01 ? 9   LYS A CD   1 
ATOM   30   C  CE   . LYS A 1 9   ? 28.893  13.336  24.459 1.00 31.08 ? 9   LYS A CE   1 
ATOM   31   N  NZ   . LYS A 1 9   ? 28.922  14.564  23.590 1.00 36.06 ? 9   LYS A NZ   1 
ATOM   32   N  N    . LEU A 1 10  ? 24.735  9.696   22.418 1.00 22.44 ? 10  LEU A N    1 
ATOM   33   C  CA   . LEU A 1 10  ? 24.480  9.226   21.063 1.00 21.19 ? 10  LEU A CA   1 
ATOM   34   C  C    . LEU A 1 10  ? 25.455  9.870   20.115 1.00 22.38 ? 10  LEU A C    1 
ATOM   35   O  O    . LEU A 1 10  ? 26.062  10.914  20.488 1.00 21.63 ? 10  LEU A O    1 
ATOM   36   C  CB   . LEU A 1 10  ? 23.024  9.575   20.657 1.00 19.37 ? 10  LEU A CB   1 
ATOM   37   C  CG   . LEU A 1 10  ? 21.907  9.149   21.643 1.00 16.78 ? 10  LEU A CG   1 
ATOM   38   C  CD1  . LEU A 1 10  ? 20.526  9.731   21.175 1.00 21.15 ? 10  LEU A CD1  1 
ATOM   39   C  CD2  . LEU A 1 10  ? 21.830  7.597   21.708 1.00 18.31 ? 10  LEU A CD2  1 
ATOM   40   N  N    . ASN A 1 11  ? 25.625  9.299   18.927 1.00 22.22 ? 11  ASN A N    1 
ATOM   41   C  CA   . ASN A 1 11  ? 26.550  9.844   17.940 1.00 23.26 ? 11  ASN A CA   1 
ATOM   42   C  C    . ASN A 1 11  ? 26.058  11.164  17.355 1.00 23.02 ? 11  ASN A C    1 
ATOM   43   O  O    . ASN A 1 11  ? 26.667  11.712  16.436 1.00 24.92 ? 11  ASN A O    1 
ATOM   44   C  CB   . ASN A 1 11  ? 26.796  8.831   16.820 1.00 21.68 ? 11  ASN A CB   1 
ATOM   45   C  CG   . ASN A 1 11  ? 25.626  8.726   15.862 1.00 22.08 ? 11  ASN A CG   1 
ATOM   46   O  OD1  . ASN A 1 11  ? 25.029  9.733   15.479 1.00 22.43 ? 11  ASN A OD1  1 
ATOM   47   N  ND2  . ASN A 1 11  ? 25.291  7.503   15.469 1.00 18.05 ? 11  ASN A ND2  1 
ATOM   48   N  N    . ASP A 1 12  ? 24.953  11.669  17.893 1.00 23.13 ? 12  ASP A N    1 
ATOM   49   C  CA   . ASP A 1 12  ? 24.378  12.924  17.425 1.00 21.88 ? 12  ASP A CA   1 
ATOM   50   C  C    . ASP A 1 12  ? 24.548  14.029  18.463 1.00 22.47 ? 12  ASP A C    1 
ATOM   51   O  O    . ASP A 1 12  ? 24.103  15.159  18.259 1.00 22.24 ? 12  ASP A O    1 
ATOM   52   C  CB   . ASP A 1 12  ? 22.896  12.743  17.088 1.00 21.80 ? 12  ASP A CB   1 
ATOM   53   C  CG   . ASP A 1 12  ? 22.006  12.828  18.312 1.00 21.54 ? 12  ASP A CG   1 
ATOM   54   O  OD1  . ASP A 1 12  ? 22.532  13.083  19.416 1.00 19.07 ? 12  ASP A OD1  1 
ATOM   55   O  OD2  . ASP A 1 12  ? 20.779  12.639  18.170 1.00 24.10 ? 12  ASP A OD2  1 
ATOM   56   N  N    . GLY A 1 13  ? 25.193  13.695  19.575 1.00 23.04 ? 13  GLY A N    1 
ATOM   57   C  CA   . GLY A 1 13  ? 25.422  14.652  20.641 1.00 22.70 ? 13  GLY A CA   1 
ATOM   58   C  C    . GLY A 1 13  ? 24.346  14.598  21.709 1.00 22.35 ? 13  GLY A C    1 
ATOM   59   O  O    . GLY A 1 13  ? 24.587  14.948  22.864 1.00 22.63 ? 13  GLY A O    1 
ATOM   60   N  N    . HIS A 1 14  ? 23.155  14.156  21.320 1.00 22.81 ? 14  HIS A N    1 
ATOM   61   C  CA   . HIS A 1 14  ? 22.035  14.055  22.247 1.00 22.27 ? 14  HIS A CA   1 
ATOM   62   C  C    . HIS A 1 14  ? 22.253  12.930  23.254 1.00 22.06 ? 14  HIS A C    1 
ATOM   63   O  O    . HIS A 1 14  ? 23.071  12.037  23.034 1.00 22.15 ? 14  HIS A O    1 
ATOM   64   C  CB   . HIS A 1 14  ? 20.727  13.832  21.486 1.00 23.21 ? 14  HIS A CB   1 
ATOM   65   C  CG   . HIS A 1 14  ? 20.289  15.013  20.677 1.00 21.68 ? 14  HIS A CG   1 
ATOM   66   N  ND1  . HIS A 1 14  ? 19.938  16.217  21.249 1.00 26.73 ? 14  HIS A ND1  1 
ATOM   67   C  CD2  . HIS A 1 14  ? 20.146  15.175  19.341 1.00 23.13 ? 14  HIS A CD2  1 
ATOM   68   C  CE1  . HIS A 1 14  ? 19.598  17.070  20.299 1.00 27.98 ? 14  HIS A CE1  1 
ATOM   69   N  NE2  . HIS A 1 14  ? 19.715  16.463  19.132 1.00 25.68 ? 14  HIS A NE2  1 
ATOM   70   N  N    . PHE A 1 15  ? 21.518  12.982  24.360 1.00 21.33 ? 15  PHE A N    1 
ATOM   71   C  CA   . PHE A 1 15  ? 21.629  11.968  25.402 1.00 22.73 ? 15  PHE A CA   1 
ATOM   72   C  C    . PHE A 1 15  ? 20.385  11.088  25.451 1.00 21.11 ? 15  PHE A C    1 
ATOM   73   O  O    . PHE A 1 15  ? 19.281  11.540  25.148 1.00 21.79 ? 15  PHE A O    1 
ATOM   74   C  CB   . PHE A 1 15  ? 21.863  12.624  26.765 1.00 22.48 ? 15  PHE A CB   1 
ATOM   75   C  CG   . PHE A 1 15  ? 23.288  13.032  27.005 1.00 24.72 ? 15  PHE A CG   1 
ATOM   76   C  CD1  . PHE A 1 15  ? 23.725  14.304  26.672 1.00 29.63 ? 15  PHE A CD1  1 
ATOM   77   C  CD2  . PHE A 1 15  ? 24.192  12.144  27.563 1.00 29.04 ? 15  PHE A CD2  1 
ATOM   78   C  CE1  . PHE A 1 15  ? 25.036  14.682  26.892 1.00 30.77 ? 15  PHE A CE1  1 
ATOM   79   C  CE2  . PHE A 1 15  ? 25.505  12.516  27.785 1.00 30.22 ? 15  PHE A CE2  1 
ATOM   80   C  CZ   . PHE A 1 15  ? 25.927  13.786  27.449 1.00 30.36 ? 15  PHE A CZ   1 
ATOM   81   N  N    . MET A 1 16  ? 20.572  9.829   25.834 1.00 20.98 ? 16  MET A N    1 
ATOM   82   C  CA   . MET A 1 16  ? 19.459  8.877   25.923 1.00 20.62 ? 16  MET A CA   1 
ATOM   83   C  C    . MET A 1 16  ? 19.545  8.135   27.247 1.00 20.05 ? 16  MET A C    1 
ATOM   84   O  O    . MET A 1 16  ? 20.585  7.538   27.545 1.00 20.98 ? 16  MET A O    1 
ATOM   85   C  CB   . MET A 1 16  ? 19.595  7.796   24.798 1.00 22.04 ? 16  MET A CB   1 
ATOM   86   C  CG   . MET A 1 16  ? 18.410  6.845   24.657 1.00 21.52 ? 16  MET A CG   1 
ATOM   87   S  SD   . MET A 1 16  ? 18.926  5.430   23.657 1.00 25.95 ? 16  MET A SD   1 
ATOM   88   C  CE   . MET A 1 16  ? 18.381  6.098   22.102 1.00 20.26 ? 16  MET A CE   1 
ATOM   89   N  N    . PRO A 1 17  ? 18.474  8.151   28.047 1.00 20.27 ? 17  PRO A N    1 
ATOM   90   C  CA   . PRO A 1 17  ? 18.439  7.352   29.292 1.00 20.25 ? 17  PRO A CA   1 
ATOM   91   C  C    . PRO A 1 17  ? 18.577  5.865   28.956 1.00 19.38 ? 17  PRO A C    1 
ATOM   92   O  O    . PRO A 1 17  ? 18.016  5.396   27.963 1.00 18.45 ? 17  PRO A O    1 
ATOM   93   C  CB   . PRO A 1 17  ? 17.069  7.701   29.902 1.00 20.71 ? 17  PRO A CB   1 
ATOM   94   C  CG   . PRO A 1 17  ? 16.783  9.123   29.376 1.00 21.36 ? 17  PRO A CG   1 
ATOM   95   C  CD   . PRO A 1 17  ? 17.268  8.983   27.911 1.00 20.52 ? 17  PRO A CD   1 
ATOM   96   N  N    . VAL A 1 18  ? 19.397  5.163   29.734 1.00 18.60 ? 18  VAL A N    1 
ATOM   97   C  CA   . VAL A 1 18  ? 19.770  3.768   29.374 1.00 19.12 ? 18  VAL A CA   1 
ATOM   98   C  C    . VAL A 1 18  ? 18.657  2.760   29.721 1.00 18.80 ? 18  VAL A C    1 
ATOM   99   O  O    . VAL A 1 18  ? 18.625  1.624   29.199 1.00 18.71 ? 18  VAL A O    1 
ATOM   100  C  CB   . VAL A 1 18  ? 21.131  3.301   30.049 1.00 18.37 ? 18  VAL A CB   1 
ATOM   101  C  CG1  . VAL A 1 18  ? 22.363  4.080   29.516 1.00 20.12 ? 18  VAL A CG1  1 
ATOM   102  C  CG2  . VAL A 1 18  ? 21.032  3.417   31.568 1.00 15.68 ? 18  VAL A CG2  1 
ATOM   103  N  N    . LEU A 1 19  ? 17.787  3.161   30.647 1.00 19.40 ? 19  LEU A N    1 
ATOM   104  C  CA   . LEU A 1 19  ? 16.569  2.436   30.959 1.00 19.26 ? 19  LEU A CA   1 
ATOM   105  C  C    . LEU A 1 19  ? 15.354  3.100   30.254 1.00 19.90 ? 19  LEU A C    1 
ATOM   106  O  O    . LEU A 1 19  ? 15.073  4.300   30.406 1.00 19.34 ? 19  LEU A O    1 
ATOM   107  C  CB   . LEU A 1 19  ? 16.311  2.377   32.470 1.00 20.43 ? 19  LEU A CB   1 
ATOM   108  C  CG   . LEU A 1 19  ? 15.031  1.638   32.840 1.00 18.93 ? 19  LEU A CG   1 
ATOM   109  C  CD1  . LEU A 1 19  ? 15.221  0.168   32.355 1.00 18.37 ? 19  LEU A CD1  1 
ATOM   110  C  CD2  . LEU A 1 19  ? 14.850  1.663   34.344 1.00 20.83 ? 19  LEU A CD2  1 
ATOM   111  N  N    . GLY A 1 20  ? 14.612  2.306   29.518 1.00 18.42 ? 20  GLY A N    1 
ATOM   112  C  CA   . GLY A 1 20  ? 13.464  2.827   28.753 1.00 16.74 ? 20  GLY A CA   1 
ATOM   113  C  C    . GLY A 1 20  ? 12.200  2.105   29.155 1.00 17.65 ? 20  GLY A C    1 
ATOM   114  O  O    . GLY A 1 20  ? 12.249  0.918   29.513 1.00 16.93 ? 20  GLY A O    1 
ATOM   115  N  N    . PHE A 1 21  ? 11.084  2.818   29.079 1.00 17.46 ? 21  PHE A N    1 
ATOM   116  C  CA   . PHE A 1 21  ? 9.744   2.246   29.391 1.00 18.07 ? 21  PHE A CA   1 
ATOM   117  C  C    . PHE A 1 21  ? 9.076   1.758   28.097 1.00 18.00 ? 21  PHE A C    1 
ATOM   118  O  O    . PHE A 1 21  ? 8.779   2.551   27.204 1.00 20.23 ? 21  PHE A O    1 
ATOM   119  C  CB   . PHE A 1 21  ? 8.873   3.249   30.174 1.00 19.37 ? 21  PHE A CB   1 
ATOM   120  C  CG   . PHE A 1 21  ? 7.480   2.704   30.517 1.00 16.95 ? 21  PHE A CG   1 
ATOM   121  C  CD1  . PHE A 1 21  ? 7.343   1.623   31.426 1.00 15.27 ? 21  PHE A CD1  1 
ATOM   122  C  CD2  . PHE A 1 21  ? 6.371   3.237   29.948 1.00 16.92 ? 21  PHE A CD2  1 
ATOM   123  C  CE1  . PHE A 1 21  ? 6.098   1.116   31.725 1.00 18.29 ? 21  PHE A CE1  1 
ATOM   124  C  CE2  . PHE A 1 21  ? 5.122   2.754   30.223 1.00 19.71 ? 21  PHE A CE2  1 
ATOM   125  C  CZ   . PHE A 1 21  ? 4.957   1.690   31.116 1.00 22.72 ? 21  PHE A CZ   1 
ATOM   126  N  N    . GLY A 1 22  ? 8.842   0.446   27.957 1.00 18.45 ? 22  GLY A N    1 
ATOM   127  C  CA   . GLY A 1 22  ? 8.132   -0.028  26.782 1.00 19.13 ? 22  GLY A CA   1 
ATOM   128  C  C    . GLY A 1 22  ? 6.607   0.188   26.923 1.00 20.92 ? 22  GLY A C    1 
ATOM   129  O  O    . GLY A 1 22  ? 6.016   -0.012  28.031 1.00 19.64 ? 22  GLY A O    1 
ATOM   130  N  N    . THR A 1 23  ? 5.928   0.504   25.800 1.00 20.24 ? 23  THR A N    1 
ATOM   131  C  CA   . THR A 1 23  ? 4.488   0.873   25.899 1.00 19.95 ? 23  THR A CA   1 
ATOM   132  C  C    . THR A 1 23  ? 3.565   0.014   25.029 1.00 20.57 ? 23  THR A C    1 
ATOM   133  O  O    . THR A 1 23  ? 2.339   0.145   25.126 1.00 19.57 ? 23  THR A O    1 
ATOM   134  C  CB   . THR A 1 23  ? 4.152   2.360   25.524 1.00 20.22 ? 23  THR A CB   1 
ATOM   135  O  OG1  . THR A 1 23  ? 4.438   2.557   24.144 1.00 18.51 ? 23  THR A OG1  1 
ATOM   136  C  CG2  . THR A 1 23  ? 4.940   3.331   26.340 1.00 16.18 ? 23  THR A CG2  1 
ATOM   137  N  N    . TYR A 1 24  ? 4.141   -0.851  24.191 1.00 20.91 ? 24  TYR A N    1 
ATOM   138  C  CA   . TYR A 1 24  ? 3.304   -1.779  23.428 1.00 21.71 ? 24  TYR A CA   1 
ATOM   139  C  C    . TYR A 1 24  ? 2.564   -2.659  24.405 1.00 22.04 ? 24  TYR A C    1 
ATOM   140  O  O    . TYR A 1 24  ? 3.157   -3.193  25.367 1.00 20.19 ? 24  TYR A O    1 
ATOM   141  C  CB   . TYR A 1 24  ? 4.111   -2.681  22.476 1.00 21.35 ? 24  TYR A CB   1 
ATOM   142  C  CG   . TYR A 1 24  ? 3.229   -3.675  21.718 1.00 20.79 ? 24  TYR A CG   1 
ATOM   143  C  CD1  . TYR A 1 24  ? 2.543   -3.290  20.564 1.00 24.57 ? 24  TYR A CD1  1 
ATOM   144  C  CD2  . TYR A 1 24  ? 3.064   -4.981  22.160 1.00 19.75 ? 24  TYR A CD2  1 
ATOM   145  C  CE1  . TYR A 1 24  ? 1.729   -4.169  19.859 1.00 22.74 ? 24  TYR A CE1  1 
ATOM   146  C  CE2  . TYR A 1 24  ? 2.264   -5.855  21.484 1.00 19.09 ? 24  TYR A CE2  1 
ATOM   147  C  CZ   . TYR A 1 24  ? 1.611   -5.463  20.321 1.00 22.47 ? 24  TYR A CZ   1 
ATOM   148  O  OH   . TYR A 1 24  ? 0.782   -6.366  19.677 1.00 21.69 ? 24  TYR A OH   1 
ATOM   149  N  N    . ALA A 1 25  ? 1.278   -2.863  24.089 1.00 22.68 ? 25  ALA A N    1 
ATOM   150  C  CA   . ALA A 1 25  ? 0.566   -3.999  24.660 1.00 22.46 ? 25  ALA A CA   1 
ATOM   151  C  C    . ALA A 1 25  ? -0.278  -4.721  23.600 1.00 22.28 ? 25  ALA A C    1 
ATOM   152  O  O    . ALA A 1 25  ? -0.630  -4.150  22.590 1.00 22.28 ? 25  ALA A O    1 
ATOM   153  C  CB   . ALA A 1 25  ? -0.281  -3.592  25.905 1.00 20.67 ? 25  ALA A CB   1 
ATOM   154  N  N    . PRO A 1 26  ? -0.537  -6.026  23.819 1.00 22.68 ? 26  PRO A N    1 
ATOM   155  C  CA   . PRO A 1 26  ? -1.306  -6.926  22.982 1.00 22.42 ? 26  PRO A CA   1 
ATOM   156  C  C    . PRO A 1 26  ? -2.680  -6.271  22.652 1.00 21.91 ? 26  PRO A C    1 
ATOM   157  O  O    . PRO A 1 26  ? -3.193  -5.494  23.461 1.00 20.45 ? 26  PRO A O    1 
ATOM   158  C  CB   . PRO A 1 26  ? -1.511  -8.160  23.891 1.00 23.52 ? 26  PRO A CB   1 
ATOM   159  C  CG   . PRO A 1 26  ? -0.380  -8.114  24.899 1.00 22.85 ? 26  PRO A CG   1 
ATOM   160  C  CD   . PRO A 1 26  ? -0.034  -6.666  25.058 1.00 22.89 ? 26  PRO A CD   1 
ATOM   161  N  N    . ALA A 1 27  ? -3.207  -6.543  21.454 1.00 23.15 ? 27  ALA A N    1 
ATOM   162  C  CA   . ALA A 1 27  ? -4.437  -5.943  20.936 1.00 23.76 ? 27  ALA A CA   1 
ATOM   163  C  C    . ALA A 1 27  ? -5.545  -6.020  21.971 1.00 24.02 ? 27  ALA A C    1 
ATOM   164  O  O    . ALA A 1 27  ? -6.299  -5.090  22.115 1.00 25.48 ? 27  ALA A O    1 
ATOM   165  C  CB   . ALA A 1 27  ? -4.826  -6.615  19.603 1.00 23.20 ? 27  ALA A CB   1 
ATOM   166  N  N    . GLU A 1 28  ? -5.579  -7.084  22.763 1.00 24.62 ? 28  GLU A N    1 
ATOM   167  C  CA   . GLU A 1 28  ? -6.696  -7.287  23.698 1.00 25.93 ? 28  GLU A CA   1 
ATOM   168  C  C    . GLU A 1 28  ? -6.725  -6.345  24.931 1.00 25.55 ? 28  GLU A C    1 
ATOM   169  O  O    . GLU A 1 28  ? -7.707  -6.343  25.706 1.00 25.17 ? 28  GLU A O    1 
ATOM   170  C  CB   . GLU A 1 28  ? -6.753  -8.760  24.148 1.00 26.33 ? 28  GLU A CB   1 
ATOM   171  C  CG   . GLU A 1 28  ? -5.763  -9.169  25.247 1.00 29.52 ? 28  GLU A CG   1 
ATOM   172  C  CD   . GLU A 1 28  ? -6.093  -10.534 25.844 1.00 35.80 ? 28  GLU A CD   1 
ATOM   173  O  OE1  . GLU A 1 28  ? -5.307  -11.472 25.652 1.00 41.82 ? 28  GLU A OE1  1 
ATOM   174  O  OE2  . GLU A 1 28  ? -7.152  -10.682 26.503 1.00 41.17 ? 28  GLU A OE2  1 
ATOM   175  N  N    . VAL A 1 29  ? -5.659  -5.578  25.130 1.00 24.48 ? 29  VAL A N    1 
ATOM   176  C  CA   . VAL A 1 29  ? -5.587  -4.674  26.274 1.00 23.96 ? 29  VAL A CA   1 
ATOM   177  C  C    . VAL A 1 29  ? -6.214  -3.331  25.926 1.00 24.05 ? 29  VAL A C    1 
ATOM   178  O  O    . VAL A 1 29  ? -5.814  -2.691  24.954 1.00 24.24 ? 29  VAL A O    1 
ATOM   179  C  CB   . VAL A 1 29  ? -4.133  -4.451  26.728 1.00 22.32 ? 29  VAL A CB   1 
ATOM   180  C  CG1  . VAL A 1 29  ? -4.078  -3.411  27.836 1.00 22.13 ? 29  VAL A CG1  1 
ATOM   181  C  CG2  . VAL A 1 29  ? -3.514  -5.762  27.186 1.00 21.12 ? 29  VAL A CG2  1 
ATOM   182  N  N    . PRO A 1 30  ? -7.199  -2.901  26.711 1.00 26.21 ? 30  PRO A N    1 
ATOM   183  C  CA   . PRO A 1 30  ? -7.883  -1.629  26.401 1.00 25.95 ? 30  PRO A CA   1 
ATOM   184  C  C    . PRO A 1 30  ? -6.886  -0.492  26.179 1.00 27.95 ? 30  PRO A C    1 
ATOM   185  O  O    . PRO A 1 30  ? -5.857  -0.446  26.886 1.00 26.72 ? 30  PRO A O    1 
ATOM   186  C  CB   . PRO A 1 30  ? -8.692  -1.361  27.691 1.00 26.38 ? 30  PRO A CB   1 
ATOM   187  C  CG   . PRO A 1 30  ? -8.887  -2.657  28.288 1.00 26.33 ? 30  PRO A CG   1 
ATOM   188  C  CD   . PRO A 1 30  ? -7.629  -3.410  28.036 1.00 25.30 ? 30  PRO A CD   1 
ATOM   189  N  N    . LYS A 1 31  ? -7.153  0.439   25.255 1.00 28.94 ? 31  LYS A N    1 
ATOM   190  C  CA   . LYS A 1 31  ? -6.168  1.537   25.053 1.00 30.53 ? 31  LYS A CA   1 
ATOM   191  C  C    . LYS A 1 31  ? -6.058  2.474   26.264 1.00 29.98 ? 31  LYS A C    1 
ATOM   192  O  O    . LYS A 1 31  ? -5.043  3.204   26.434 1.00 32.41 ? 31  LYS A O    1 
ATOM   193  C  CB   . LYS A 1 31  ? -6.391  2.311   23.744 1.00 31.07 ? 31  LYS A CB   1 
ATOM   194  C  CG   . LYS A 1 31  ? -7.543  3.273   23.768 1.00 34.71 ? 31  LYS A CG   1 
ATOM   195  C  CD   . LYS A 1 31  ? -7.926  3.746   22.355 1.00 35.94 ? 31  LYS A CD   1 
ATOM   196  C  CE   . LYS A 1 31  ? -8.908  4.893   22.480 1.00 38.85 ? 31  LYS A CE   1 
ATOM   197  N  NZ   . LYS A 1 31  ? -9.357  5.432   21.168 1.00 38.93 ? 31  LYS A NZ   1 
ATOM   198  N  N    . SER A 1 32  ? -7.047  2.416   27.153 1.00 29.40 ? 32  SER A N    1 
ATOM   199  C  CA   . SER A 1 32  ? -7.019  3.272   28.352 1.00 29.13 ? 32  SER A CA   1 
ATOM   200  C  C    . SER A 1 32  ? -5.859  2.943   29.310 1.00 27.89 ? 32  SER A C    1 
ATOM   201  O  O    . SER A 1 32  ? -5.311  3.817   29.970 1.00 27.56 ? 32  SER A O    1 
ATOM   202  C  CB   . SER A 1 32  ? -8.372  3.286   29.078 1.00 30.21 ? 32  SER A CB   1 
ATOM   203  O  OG   . SER A 1 32  ? -8.782  1.997   29.529 1.00 26.77 ? 32  SER A OG   1 
ATOM   204  N  N    . LYS A 1 33  ? -5.489  1.666   29.332 1.00 27.47 ? 33  LYS A N    1 
ATOM   205  C  CA   . LYS A 1 33  ? -4.409  1.138   30.160 1.00 27.34 ? 33  LYS A CA   1 
ATOM   206  C  C    . LYS A 1 33  ? -3.060  1.829   29.919 1.00 26.20 ? 33  LYS A C    1 
ATOM   207  O  O    . LYS A 1 33  ? -2.321  2.038   30.865 1.00 26.03 ? 33  LYS A O    1 
ATOM   208  C  CB   . LYS A 1 33  ? -4.310  -0.389  30.010 1.00 28.29 ? 33  LYS A CB   1 
ATOM   209  C  CG   . LYS A 1 33  ? -5.529  -1.121  30.597 1.00 28.06 ? 33  LYS A CG   1 
ATOM   210  C  CD   . LYS A 1 33  ? -5.592  -0.857  32.099 0.50 28.34 ? 33  LYS A CD   1 
ATOM   211  C  CE   . LYS A 1 33  ? -6.542  -1.806  32.825 0.50 31.68 ? 33  LYS A CE   1 
ATOM   212  N  NZ   . LYS A 1 33  ? -5.934  -2.219  34.142 0.50 33.70 ? 33  LYS A NZ   1 
ATOM   213  N  N    . ALA A 1 34  ? -2.759  2.206   28.678 1.00 25.75 ? 34  ALA A N    1 
ATOM   214  C  CA   . ALA A 1 34  ? -1.491  2.898   28.334 1.00 25.98 ? 34  ALA A CA   1 
ATOM   215  C  C    . ALA A 1 34  ? -1.312  4.206   29.081 1.00 25.00 ? 34  ALA A C    1 
ATOM   216  O  O    . ALA A 1 34  ? -0.208  4.643   29.347 1.00 23.90 ? 34  ALA A O    1 
ATOM   217  C  CB   . ALA A 1 34  ? -1.447  3.165   26.830 1.00 26.12 ? 34  ALA A CB   1 
ATOM   218  N  N    . LEU A 1 35  ? -2.447  4.833   29.369 1.00 25.37 ? 35  LEU A N    1 
ATOM   219  C  CA   A LEU A 1 35  ? -2.484  6.129   30.015 0.50 24.01 ? 35  LEU A CA   1 
ATOM   220  C  CA   B LEU A 1 35  ? -2.476  6.134   30.000 0.50 24.16 ? 35  LEU A CA   1 
ATOM   221  C  C    . LEU A 1 35  ? -1.972  6.011   31.457 1.00 23.83 ? 35  LEU A C    1 
ATOM   222  O  O    . LEU A 1 35  ? -0.993  6.652   31.818 1.00 23.37 ? 35  LEU A O    1 
ATOM   223  C  CB   A LEU A 1 35  ? -3.896  6.686   30.015 0.50 24.07 ? 35  LEU A CB   1 
ATOM   224  C  CB   B LEU A 1 35  ? -3.882  6.721   29.927 0.50 24.41 ? 35  LEU A CB   1 
ATOM   225  C  CG   A LEU A 1 35  ? -4.049  8.017   30.756 0.50 23.00 ? 35  LEU A CG   1 
ATOM   226  C  CG   B LEU A 1 35  ? -4.024  8.245   29.799 0.50 23.93 ? 35  LEU A CG   1 
ATOM   227  C  CD1  A LEU A 1 35  ? -3.273  9.109   30.010 0.50 21.69 ? 35  LEU A CD1  1 
ATOM   228  C  CD1  B LEU A 1 35  ? -5.452  8.647   29.419 0.50 21.97 ? 35  LEU A CD1  1 
ATOM   229  C  CD2  A LEU A 1 35  ? -5.509  8.351   30.875 0.50 20.89 ? 35  LEU A CD2  1 
ATOM   230  C  CD2  B LEU A 1 35  ? -3.626  8.922   31.086 0.50 23.93 ? 35  LEU A CD2  1 
ATOM   231  N  N    . GLU A 1 36  ? -2.630  5.188   32.282 1.00 23.41 ? 36  GLU A N    1 
ATOM   232  C  CA   . GLU A 1 36  ? -2.241  5.155   33.679 1.00 25.73 ? 36  GLU A CA   1 
ATOM   233  C  C    . GLU A 1 36  ? -0.858  4.571   33.814 1.00 24.49 ? 36  GLU A C    1 
ATOM   234  O  O    . GLU A 1 36  ? -0.078  5.095   34.576 1.00 26.19 ? 36  GLU A O    1 
ATOM   235  C  CB   . GLU A 1 36  ? -3.234  4.397   34.585 1.00 27.67 ? 36  GLU A CB   1 
ATOM   236  C  CG   . GLU A 1 36  ? -2.780  4.241   36.074 1.00 29.71 ? 36  GLU A CG   1 
ATOM   237  C  CD   . GLU A 1 36  ? -2.593  5.574   36.917 1.00 38.47 ? 36  GLU A CD   1 
ATOM   238  O  OE1  . GLU A 1 36  ? -2.699  6.722   36.409 1.00 39.96 ? 36  GLU A OE1  1 
ATOM   239  O  OE2  . GLU A 1 36  ? -2.365  5.448   38.160 1.00 40.14 ? 36  GLU A OE2  1 
ATOM   240  N  N    . ALA A 1 37  ? -0.554  3.504   33.065 1.00 25.78 ? 37  ALA A N    1 
ATOM   241  C  CA   . ALA A 1 37  ? 0.791   2.862   33.123 1.00 24.97 ? 37  ALA A CA   1 
ATOM   242  C  C    . ALA A 1 37  ? 1.927   3.835   32.796 1.00 24.27 ? 37  ALA A C    1 
ATOM   243  O  O    . ALA A 1 37  ? 2.971   3.806   33.454 1.00 23.33 ? 37  ALA A O    1 
ATOM   244  C  CB   . ALA A 1 37  ? 0.867   1.660   32.207 1.00 25.30 ? 37  ALA A CB   1 
ATOM   245  N  N    . THR A 1 38  ? 1.726   4.693   31.789 1.00 23.07 ? 38  THR A N    1 
ATOM   246  C  CA   . THR A 1 38  ? 2.751   5.673   31.432 1.00 22.82 ? 38  THR A CA   1 
ATOM   247  C  C    . THR A 1 38  ? 2.920   6.717   32.549 1.00 21.71 ? 38  THR A C    1 
ATOM   248  O  O    . THR A 1 38  ? 4.041   7.030   32.922 1.00 21.18 ? 38  THR A O    1 
ATOM   249  C  CB   . THR A 1 38  ? 2.489   6.293   30.058 1.00 21.43 ? 38  THR A CB   1 
ATOM   250  O  OG1  . THR A 1 38  ? 2.415   5.229   29.089 1.00 22.51 ? 38  THR A OG1  1 
ATOM   251  C  CG2  . THR A 1 38  ? 3.603   7.235   29.679 1.00 23.58 ? 38  THR A CG2  1 
ATOM   252  N  N    . LYS A 1 39  ? 1.821   7.160   33.150 1.00 22.42 ? 39  LYS A N    1 
ATOM   253  C  CA   . LYS A 1 39  ? 1.888   8.033   34.340 1.00 23.14 ? 39  LYS A CA   1 
ATOM   254  C  C    . LYS A 1 39  ? 2.626   7.329   35.465 1.00 23.15 ? 39  LYS A C    1 
ATOM   255  O  O    . LYS A 1 39  ? 3.549   7.875   35.984 1.00 23.31 ? 39  LYS A O    1 
ATOM   256  C  CB   . LYS A 1 39  ? 0.504   8.530   34.835 1.00 23.91 ? 39  LYS A CB   1 
ATOM   257  C  CG   . LYS A 1 39  ? -0.344  9.273   33.756 1.00 24.45 ? 39  LYS A CG   1 
ATOM   258  C  CD   . LYS A 1 39  ? -1.571  9.846   34.452 1.00 31.57 ? 39  LYS A CD   1 
ATOM   259  C  CE   . LYS A 1 39  ? -2.666  10.295  33.558 1.00 34.45 ? 39  LYS A CE   1 
ATOM   260  N  NZ   . LYS A 1 39  ? -3.987  10.136  34.342 1.00 40.92 ? 39  LYS A NZ   1 
ATOM   261  N  N    . LEU A 1 40  ? 2.253   6.098   35.786 1.00 24.45 ? 40  LEU A N    1 
ATOM   262  C  CA   . LEU A 1 40  ? 2.986   5.314   36.808 1.00 24.98 ? 40  LEU A CA   1 
ATOM   263  C  C    . LEU A 1 40  ? 4.498   5.254   36.566 1.00 24.71 ? 40  LEU A C    1 
ATOM   264  O  O    . LEU A 1 40  ? 5.317   5.390   37.517 1.00 26.41 ? 40  LEU A O    1 
ATOM   265  C  CB   . LEU A 1 40  ? 2.393   3.910   36.877 1.00 25.04 ? 40  LEU A CB   1 
ATOM   266  C  CG   . LEU A 1 40  ? 0.976   3.903   37.502 1.00 28.58 ? 40  LEU A CG   1 
ATOM   267  C  CD1  . LEU A 1 40  ? 0.415   2.496   37.683 1.00 29.82 ? 40  LEU A CD1  1 
ATOM   268  C  CD2  . LEU A 1 40  ? 0.991   4.701   38.847 1.00 33.30 ? 40  LEU A CD2  1 
ATOM   269  N  N    . ALA A 1 41  ? 4.897   5.045   35.298 1.00 24.45 ? 41  ALA A N    1 
ATOM   270  C  CA   . ALA A 1 41  ? 6.325   4.904   34.961 1.00 23.18 ? 41  ALA A CA   1 
ATOM   271  C  C    . ALA A 1 41  ? 7.093   6.163   35.248 1.00 23.28 ? 41  ALA A C    1 
ATOM   272  O  O    . ALA A 1 41  ? 8.145   6.121   35.861 1.00 21.01 ? 41  ALA A O    1 
ATOM   273  C  CB   . ALA A 1 41  ? 6.529   4.457   33.476 1.00 23.93 ? 41  ALA A CB   1 
ATOM   274  N  N    . ILE A 1 42  ? 6.583   7.299   34.786 1.00 22.58 ? 42  ILE A N    1 
ATOM   275  C  CA   . ILE A 1 42  ? 7.254   8.596   35.050 1.00 24.06 ? 42  ILE A CA   1 
ATOM   276  C  C    . ILE A 1 42  ? 7.484   8.853   36.551 1.00 25.49 ? 42  ILE A C    1 
ATOM   277  O  O    . ILE A 1 42  ? 8.601   9.245   36.988 1.00 26.70 ? 42  ILE A O    1 
ATOM   278  C  CB   . ILE A 1 42  ? 6.409   9.725   34.435 1.00 23.45 ? 42  ILE A CB   1 
ATOM   279  C  CG1  . ILE A 1 42  ? 6.417   9.592   32.914 1.00 24.02 ? 42  ILE A CG1  1 
ATOM   280  C  CG2  . ILE A 1 42  ? 6.945   11.092  34.806 1.00 25.24 ? 42  ILE A CG2  1 
ATOM   281  C  CD1  . ILE A 1 42  ? 5.336   10.419  32.127 1.00 25.74 ? 42  ILE A CD1  1 
ATOM   282  N  N    . GLU A 1 43  ? 6.403   8.646   37.315 1.00 27.71 ? 43  GLU A N    1 
ATOM   283  C  CA   . GLU A 1 43  ? 6.356   8.728   38.803 1.00 28.37 ? 43  GLU A CA   1 
ATOM   284  C  C    . GLU A 1 43  ? 7.387   7.837   39.468 1.00 28.09 ? 43  GLU A C    1 
ATOM   285  O  O    . GLU A 1 43  ? 8.156   8.305   40.364 1.00 28.21 ? 43  GLU A O    1 
ATOM   286  C  CB   . GLU A 1 43  ? 4.966   8.348   39.272 1.00 28.44 ? 43  GLU A CB   1 
ATOM   287  C  CG   . GLU A 1 43  ? 3.885   9.323   38.713 0.70 32.98 ? 43  GLU A CG   1 
ATOM   288  C  CD   . GLU A 1 43  ? 2.443   9.064   39.208 0.70 37.81 ? 43  GLU A CD   1 
ATOM   289  O  OE1  . GLU A 1 43  ? 2.231   8.107   39.997 0.70 37.25 ? 43  GLU A OE1  1 
ATOM   290  O  OE2  . GLU A 1 43  ? 1.516   9.837   38.782 1.00 40.76 ? 43  GLU A OE2  1 
ATOM   291  N  N    . ALA A 1 44  ? 7.440   6.568   39.025 1.00 27.26 ? 44  ALA A N    1 
ATOM   292  C  CA   . ALA A 1 44  ? 8.506   5.649   39.499 1.00 27.30 ? 44  ALA A CA   1 
ATOM   293  C  C    . ALA A 1 44  ? 9.922   6.104   39.101 1.00 27.24 ? 44  ALA A C    1 
ATOM   294  O  O    . ALA A 1 44  ? 10.919  5.681   39.713 1.00 28.17 ? 44  ALA A O    1 
ATOM   295  C  CB   . ALA A 1 44  ? 8.274   4.236   38.966 1.00 27.96 ? 44  ALA A CB   1 
ATOM   296  N  N    . GLY A 1 45  ? 10.028  6.881   38.030 1.00 25.40 ? 45  GLY A N    1 
ATOM   297  C  CA   . GLY A 1 45  ? 11.321  7.410   37.634 1.00 24.52 ? 45  GLY A CA   1 
ATOM   298  C  C    . GLY A 1 45  ? 11.748  7.174   36.213 1.00 22.43 ? 45  GLY A C    1 
ATOM   299  O  O    . GLY A 1 45  ? 12.853  7.523   35.860 1.00 23.18 ? 45  GLY A O    1 
ATOM   300  N  N    . PHE A 1 46  ? 10.909  6.543   35.399 1.00 23.13 ? 46  PHE A N    1 
ATOM   301  C  CA   . PHE A 1 46  ? 11.296  6.337   33.995 1.00 23.03 ? 46  PHE A CA   1 
ATOM   302  C  C    . PHE A 1 46  ? 11.302  7.688   33.305 1.00 23.79 ? 46  PHE A C    1 
ATOM   303  O  O    . PHE A 1 46  ? 10.412  8.500   33.551 1.00 25.48 ? 46  PHE A O    1 
ATOM   304  C  CB   . PHE A 1 46  ? 10.316  5.444   33.274 1.00 22.57 ? 46  PHE A CB   1 
ATOM   305  C  CG   . PHE A 1 46  ? 10.547  3.973   33.492 1.00 18.83 ? 46  PHE A CG   1 
ATOM   306  C  CD1  . PHE A 1 46  ? 9.984   3.327   34.533 1.00 19.33 ? 46  PHE A CD1  1 
ATOM   307  C  CD2  . PHE A 1 46  ? 11.360  3.249   32.621 1.00 20.77 ? 46  PHE A CD2  1 
ATOM   308  C  CE1  . PHE A 1 46  ? 10.165  1.907   34.670 1.00 17.30 ? 46  PHE A CE1  1 
ATOM   309  C  CE2  . PHE A 1 46  ? 11.539  1.877   32.764 1.00 18.34 ? 46  PHE A CE2  1 
ATOM   310  C  CZ   . PHE A 1 46  ? 10.983  1.228   33.791 1.00 15.30 ? 46  PHE A CZ   1 
ATOM   311  N  N    . ARG A 1 47  ? 12.294  7.923   32.452 1.00 24.30 ? 47  ARG A N    1 
ATOM   312  C  CA   . ARG A 1 47  ? 12.400  9.185   31.730 1.00 24.65 ? 47  ARG A CA   1 
ATOM   313  C  C    . ARG A 1 47  ? 12.410  8.958   30.222 1.00 25.08 ? 47  ARG A C    1 
ATOM   314  O  O    . ARG A 1 47  ? 12.074  9.853   29.447 1.00 27.78 ? 47  ARG A O    1 
ATOM   315  C  CB   . ARG A 1 47  ? 13.660  9.942   32.156 1.00 23.80 ? 47  ARG A CB   1 
ATOM   316  C  CG   . ARG A 1 47  ? 13.593  10.517  33.561 1.00 23.88 ? 47  ARG A CG   1 
ATOM   317  C  CD   . ARG A 1 47  ? 12.411  11.459  33.717 1.00 23.83 ? 47  ARG A CD   1 
ATOM   318  N  NE   . ARG A 1 47  ? 12.250  11.912  35.095 1.00 26.89 ? 47  ARG A NE   1 
ATOM   319  C  CZ   . ARG A 1 47  ? 11.385  11.389  35.958 1.00 26.72 ? 47  ARG A CZ   1 
ATOM   320  N  NH1  . ARG A 1 47  ? 11.307  11.865  37.193 1.00 28.83 ? 47  ARG A NH1  1 
ATOM   321  N  NH2  . ARG A 1 47  ? 10.597  10.390  35.586 1.00 26.69 ? 47  ARG A NH2  1 
ATOM   322  N  N    . HIS A 1 48  ? 12.797  7.754   29.813 1.00 23.57 ? 48  HIS A N    1 
ATOM   323  C  CA   . HIS A 1 48  ? 12.850  7.405   28.399 1.00 21.80 ? 48  HIS A CA   1 
ATOM   324  C  C    . HIS A 1 48  ? 11.723  6.447   28.026 1.00 21.48 ? 48  HIS A C    1 
ATOM   325  O  O    . HIS A 1 48  ? 11.792  5.252   28.313 1.00 20.71 ? 48  HIS A O    1 
ATOM   326  C  CB   . HIS A 1 48  ? 14.204  6.785   28.050 1.00 21.24 ? 48  HIS A CB   1 
ATOM   327  C  CG   . HIS A 1 48  ? 14.189  5.967   26.796 1.00 20.74 ? 48  HIS A CG   1 
ATOM   328  N  ND1  . HIS A 1 48  ? 15.280  5.242   26.367 1.00 20.01 ? 48  HIS A ND1  1 
ATOM   329  C  CD2  . HIS A 1 48  ? 13.215  5.759   25.879 1.00 20.75 ? 48  HIS A CD2  1 
ATOM   330  C  CE1  . HIS A 1 48  ? 14.979  4.623   25.240 1.00 23.49 ? 48  HIS A CE1  1 
ATOM   331  N  NE2  . HIS A 1 48  ? 13.732  4.920   24.921 1.00 22.51 ? 48  HIS A NE2  1 
ATOM   332  N  N    . ILE A 1 49  ? 10.687  6.980   27.387 1.00 21.20 ? 49  ILE A N    1 
ATOM   333  C  CA   . ILE A 1 49  ? 9.543   6.175   26.977 1.00 21.49 ? 49  ILE A CA   1 
ATOM   334  C  C    . ILE A 1 49  ? 9.592   5.861   25.486 1.00 20.92 ? 49  ILE A C    1 
ATOM   335  O  O    . ILE A 1 49  ? 10.035  6.682   24.683 1.00 21.18 ? 49  ILE A O    1 
ATOM   336  C  CB   . ILE A 1 49  ? 8.212   6.880   27.300 1.00 23.85 ? 49  ILE A CB   1 
ATOM   337  C  CG1  . ILE A 1 49  ? 8.083   7.112   28.806 1.00 24.17 ? 49  ILE A CG1  1 
ATOM   338  C  CG2  . ILE A 1 49  ? 7.038   6.066   26.778 1.00 23.03 ? 49  ILE A CG2  1 
ATOM   339  C  CD1  . ILE A 1 49  ? 7.453   8.439   29.168 1.00 26.91 ? 49  ILE A CD1  1 
ATOM   340  N  N    . ASP A 1 50  ? 9.135   4.668   25.122 1.00 18.49 ? 50  ASP A N    1 
ATOM   341  C  CA   . ASP A 1 50  ? 9.121   4.244   23.727 1.00 19.02 ? 50  ASP A CA   1 
ATOM   342  C  C    . ASP A 1 50  ? 7.696   4.014   23.237 1.00 18.09 ? 50  ASP A C    1 
ATOM   343  O  O    . ASP A 1 50  ? 6.862   3.468   23.959 1.00 19.34 ? 50  ASP A O    1 
ATOM   344  C  CB   . ASP A 1 50  ? 9.952   2.972   23.545 1.00 20.16 ? 50  ASP A CB   1 
ATOM   345  C  CG   . ASP A 1 50  ? 9.941   2.468   22.116 1.00 18.81 ? 50  ASP A CG   1 
ATOM   346  O  OD1  . ASP A 1 50  ? 10.643  3.060   21.270 1.00 22.84 ? 50  ASP A OD1  1 
ATOM   347  O  OD2  . ASP A 1 50  ? 9.230   1.479   21.838 1.00 19.62 ? 50  ASP A OD2  1 
ATOM   348  N  N    . SER A 1 51  ? 7.434   4.459   22.016 1.00 18.87 ? 51  SER A N    1 
ATOM   349  C  CA   . SER A 1 51  ? 6.128   4.317   21.400 1.00 15.86 ? 51  SER A CA   1 
ATOM   350  C  C    . SER A 1 51  ? 6.299   4.451   19.898 1.00 16.41 ? 51  SER A C    1 
ATOM   351  O  O    . SER A 1 51  ? 7.379   4.792   19.417 1.00 16.62 ? 51  SER A O    1 
ATOM   352  C  CB   . SER A 1 51  ? 5.166   5.385   21.922 1.00 18.80 ? 51  SER A CB   1 
ATOM   353  O  OG   . SER A 1 51  ? 3.827   5.077   21.577 1.00 20.96 ? 51  SER A OG   1 
ATOM   354  N  N    . ALA A 1 52  ? 5.235   4.161   19.160 1.00 16.47 ? 52  ALA A N    1 
ATOM   355  C  CA   . ALA A 1 52  ? 5.274   4.225   17.708 1.00 16.88 ? 52  ALA A CA   1 
ATOM   356  C  C    . ALA A 1 52  ? 3.860   4.220   17.150 1.00 16.53 ? 52  ALA A C    1 
ATOM   357  O  O    . ALA A 1 52  ? 2.910   3.865   17.847 1.00 17.04 ? 52  ALA A O    1 
ATOM   358  C  CB   . ALA A 1 52  ? 6.073   3.061   17.146 1.00 16.31 ? 52  ALA A CB   1 
ATOM   359  N  N    . HIS A 1 53  ? 3.725   4.617   15.891 1.00 16.53 ? 53  HIS A N    1 
ATOM   360  C  CA   . HIS A 1 53  ? 2.414   4.674   15.256 1.00 17.76 ? 53  HIS A CA   1 
ATOM   361  C  C    . HIS A 1 53  ? 1.700   3.329   15.342 1.00 18.02 ? 53  HIS A C    1 
ATOM   362  O  O    . HIS A 1 53  ? 0.484   3.271   15.525 1.00 17.41 ? 53  HIS A O    1 
ATOM   363  C  CB   . HIS A 1 53  ? 2.545   5.106   13.794 1.00 18.00 ? 53  HIS A CB   1 
ATOM   364  C  CG   . HIS A 1 53  ? 1.238   5.193   13.069 1.00 20.60 ? 53  HIS A CG   1 
ATOM   365  N  ND1  . HIS A 1 53  ? 0.291   6.152   13.356 1.00 24.73 ? 53  HIS A ND1  1 
ATOM   366  C  CD2  . HIS A 1 53  ? 0.721   4.441   12.070 1.00 24.93 ? 53  HIS A CD2  1 
ATOM   367  C  CE1  . HIS A 1 53  ? -0.754  5.987   12.564 1.00 26.21 ? 53  HIS A CE1  1 
ATOM   368  N  NE2  . HIS A 1 53  ? -0.518  4.955   11.774 1.00 28.30 ? 53  HIS A NE2  1 
ATOM   369  N  N    . LEU A 1 54  ? 2.465   2.250   15.211 1.00 19.13 ? 54  LEU A N    1 
ATOM   370  C  CA   . LEU A 1 54  ? 1.907   0.901   15.275 1.00 19.15 ? 54  LEU A CA   1 
ATOM   371  C  C    . LEU A 1 54  ? 1.054   0.611   16.527 1.00 20.27 ? 54  LEU A C    1 
ATOM   372  O  O    . LEU A 1 54  ? 0.038   -0.081  16.447 1.00 20.58 ? 54  LEU A O    1 
ATOM   373  C  CB   . LEU A 1 54  ? 2.985   -0.165  15.120 1.00 18.74 ? 54  LEU A CB   1 
ATOM   374  C  CG   . LEU A 1 54  ? 2.439   -1.643  15.215 1.00 18.59 ? 54  LEU A CG   1 
ATOM   375  C  CD1  . LEU A 1 54  ? 1.527   -2.035  14.036 1.00 21.37 ? 54  LEU A CD1  1 
ATOM   376  C  CD2  . LEU A 1 54  ? 3.573   -2.661  15.251 1.00 21.15 ? 54  LEU A CD2  1 
ATOM   377  N  N    . TYR A 1 55  ? 1.494   1.092   17.681 1.00 18.96 ? 55  TYR A N    1 
ATOM   378  C  CA   . TYR A 1 55  ? 0.924   0.673   18.938 1.00 19.43 ? 55  TYR A CA   1 
ATOM   379  C  C    . TYR A 1 55  ? -0.459  1.217   19.232 1.00 21.07 ? 55  TYR A C    1 
ATOM   380  O  O    . TYR A 1 55  ? -1.039  0.868   20.283 1.00 22.41 ? 55  TYR A O    1 
ATOM   381  C  CB   . TYR A 1 55  ? 1.855   1.032   20.105 1.00 19.14 ? 55  TYR A CB   1 
ATOM   382  C  CG   . TYR A 1 55  ? 3.303   0.559   19.954 1.00 16.07 ? 55  TYR A CG   1 
ATOM   383  C  CD1  . TYR A 1 55  ? 3.666   -0.357  18.922 1.00 16.91 ? 55  TYR A CD1  1 
ATOM   384  C  CD2  . TYR A 1 55  ? 4.271   0.956   20.866 1.00 17.19 ? 55  TYR A CD2  1 
ATOM   385  C  CE1  . TYR A 1 55  ? 4.946   -0.793  18.782 1.00 15.31 ? 55  TYR A CE1  1 
ATOM   386  C  CE2  . TYR A 1 55  ? 5.629   0.495   20.755 1.00 16.31 ? 55  TYR A CE2  1 
ATOM   387  C  CZ   . TYR A 1 55  ? 5.935   -0.358  19.699 1.00 17.11 ? 55  TYR A CZ   1 
ATOM   388  O  OH   . TYR A 1 55  ? 7.207   -0.808  19.542 1.00 17.11 ? 55  TYR A OH   1 
ATOM   389  N  N    . ASN A 1 56  ? -0.934  2.151   18.412 1.00 20.98 ? 56  ASN A N    1 
ATOM   390  C  CA   . ASN A 1 56  ? -2.284  2.688   18.590 1.00 21.81 ? 56  ASN A CA   1 
ATOM   391  C  C    . ASN A 1 56  ? -2.473  3.340   19.950 1.00 21.77 ? 56  ASN A C    1 
ATOM   392  O  O    . ASN A 1 56  ? -3.586  3.462   20.464 1.00 21.27 ? 56  ASN A O    1 
ATOM   393  C  CB   . ASN A 1 56  ? -3.320  1.599   18.238 1.00 21.02 ? 56  ASN A CB   1 
ATOM   394  C  CG   . ASN A 1 56  ? -4.769  2.112   18.246 1.00 26.25 ? 56  ASN A CG   1 
ATOM   395  O  OD1  . ASN A 1 56  ? -5.080  3.340   18.189 1.00 25.60 ? 56  ASN A OD1  1 
ATOM   396  N  ND2  . ASN A 1 56  ? -5.643  1.185   18.291 1.00 19.65 ? 56  ASN A ND2  1 
ATOM   397  N  N    . ASN A 1 57  ? -1.361  3.765   20.541 1.00 21.63 ? 57  ASN A N    1 
ATOM   398  C  CA   . ASN A 1 57  ? -1.362  4.297   21.899 1.00 21.48 ? 57  ASN A CA   1 
ATOM   399  C  C    . ASN A 1 57  ? -0.805  5.714   21.990 1.00 21.63 ? 57  ASN A C    1 
ATOM   400  O  O    . ASN A 1 57  ? -0.736  6.295   23.074 1.00 22.86 ? 57  ASN A O    1 
ATOM   401  C  CB   . ASN A 1 57  ? -0.837  3.251   22.885 1.00 21.36 ? 57  ASN A CB   1 
ATOM   402  C  CG   . ASN A 1 57  ? 0.677   3.190   22.918 1.00 20.71 ? 57  ASN A CG   1 
ATOM   403  O  OD1  . ASN A 1 57  ? 1.358   4.070   22.391 1.00 21.88 ? 57  ASN A OD1  1 
ATOM   404  N  ND2  . ASN A 1 57  ? 1.213   2.146   23.540 1.00 21.53 ? 57  ASN A ND2  1 
ATOM   405  N  N    . GLU A 1 58  ? -0.276  6.220   20.895 1.00 22.12 ? 58  GLU A N    1 
ATOM   406  C  CA   . GLU A 1 58  ? 0.346   7.538   20.874 1.00 22.79 ? 58  GLU A CA   1 
ATOM   407  C  C    . GLU A 1 58  ? -0.428  8.625   21.614 1.00 22.01 ? 58  GLU A C    1 
ATOM   408  O  O    . GLU A 1 58  ? 0.163   9.493   22.255 1.00 21.48 ? 58  GLU A O    1 
ATOM   409  C  CB   . GLU A 1 58  ? 0.685   7.931   19.435 1.00 22.43 ? 58  GLU A CB   1 
ATOM   410  C  CG   . GLU A 1 58  ? 1.958   7.294   18.901 1.00 21.43 ? 58  GLU A CG   1 
ATOM   411  C  CD   . GLU A 1 58  ? 2.653   8.158   17.868 1.00 21.60 ? 58  GLU A CD   1 
ATOM   412  O  OE1  . GLU A 1 58  ? 2.064   8.391   16.792 1.00 17.96 ? 58  GLU A OE1  1 
ATOM   413  O  OE2  . GLU A 1 58  ? 3.790   8.604   18.132 1.00 21.88 ? 58  GLU A OE2  1 
ATOM   414  N  N    . GLU A 1 59  ? -1.752  8.569   21.518 1.00 22.52 ? 59  GLU A N    1 
ATOM   415  C  CA   . GLU A 1 59  ? -2.608  9.576   22.134 1.00 22.31 ? 59  GLU A CA   1 
ATOM   416  C  C    . GLU A 1 59  ? -2.593  9.457   23.654 1.00 23.02 ? 59  GLU A C    1 
ATOM   417  O  O    . GLU A 1 59  ? -2.490  10.457  24.364 1.00 22.91 ? 59  GLU A O    1 
ATOM   418  C  CB   . GLU A 1 59  ? -4.041  9.453   21.611 1.00 23.68 ? 59  GLU A CB   1 
ATOM   419  C  CG   . GLU A 1 59  ? -5.043  10.341  22.331 1.00 23.61 ? 59  GLU A CG   1 
ATOM   420  C  CD   . GLU A 1 59  ? -6.460  10.144  21.831 1.00 33.49 ? 59  GLU A CD   1 
ATOM   421  O  OE1  . GLU A 1 59  ? -6.681  9.226   21.012 1.00 34.17 ? 59  GLU A OE1  1 
ATOM   422  O  OE2  . GLU A 1 59  ? -7.354  10.905  22.257 1.00 34.26 ? 59  GLU A OE2  1 
ATOM   423  N  N    . GLN A 1 60  ? -2.696  8.227   24.147 1.00 21.43 ? 60  GLN A N    1 
ATOM   424  C  CA   . GLN A 1 60  ? -2.692  7.971   25.601 1.00 20.99 ? 60  GLN A CA   1 
ATOM   425  C  C    . GLN A 1 60  ? -1.352  8.300   26.223 1.00 21.51 ? 60  GLN A C    1 
ATOM   426  O  O    . GLN A 1 60  ? -1.291  8.994   27.260 1.00 20.92 ? 60  GLN A O    1 
ATOM   427  C  CB   . GLN A 1 60  ? -3.069  6.496   25.851 1.00 21.87 ? 60  GLN A CB   1 
ATOM   428  C  CG   . GLN A 1 60  ? -4.555  6.241   25.675 1.00 23.70 ? 60  GLN A CG   1 
ATOM   429  C  CD   . GLN A 1 60  ? -5.030  6.363   24.246 1.00 22.46 ? 60  GLN A CD   1 
ATOM   430  O  OE1  . GLN A 1 60  ? -4.358  5.950   23.261 1.00 22.56 ? 60  GLN A OE1  1 
ATOM   431  N  NE2  . GLN A 1 60  ? -6.226  6.933   24.107 1.00 27.69 ? 60  GLN A NE2  1 
ATOM   432  N  N    . VAL A 1 61  ? -0.275  7.818   25.611 1.00 20.05 ? 61  VAL A N    1 
ATOM   433  C  CA   . VAL A 1 61  ? 1.069   8.095   26.105 1.00 21.00 ? 61  VAL A CA   1 
ATOM   434  C  C    . VAL A 1 61  ? 1.328   9.598   26.131 1.00 22.15 ? 61  VAL A C    1 
ATOM   435  O  O    . VAL A 1 61  ? 1.942   10.119  27.062 1.00 23.09 ? 61  VAL A O    1 
ATOM   436  C  CB   . VAL A 1 61  ? 2.142   7.412   25.238 1.00 20.62 ? 61  VAL A CB   1 
ATOM   437  C  CG1  . VAL A 1 61  ? 3.531   7.861   25.663 1.00 18.27 ? 61  VAL A CG1  1 
ATOM   438  C  CG2  . VAL A 1 61  ? 2.012   5.899   25.328 1.00 20.75 ? 61  VAL A CG2  1 
ATOM   439  N  N    . GLY A 1 62  ? 0.851   10.286  25.099 1.00 23.61 ? 62  GLY A N    1 
ATOM   440  C  CA   . GLY A 1 62  ? 0.993   11.721  24.996 1.00 23.94 ? 62  GLY A CA   1 
ATOM   441  C  C    . GLY A 1 62  ? 0.234   12.412  26.114 1.00 25.37 ? 62  GLY A C    1 
ATOM   442  O  O    . GLY A 1 62  ? 0.789   13.286  26.760 1.00 27.13 ? 62  GLY A O    1 
ATOM   443  N  N    . LEU A 1 63  ? -1.005  11.992  26.366 1.00 26.33 ? 63  LEU A N    1 
ATOM   444  C  CA   . LEU A 1 63  ? -1.791  12.500  27.507 1.00 28.41 ? 63  LEU A CA   1 
ATOM   445  C  C    . LEU A 1 63  ? -1.002  12.326  28.780 1.00 27.87 ? 63  LEU A C    1 
ATOM   446  O  O    . LEU A 1 63  ? -0.781  13.303  29.495 1.00 28.42 ? 63  LEU A O    1 
ATOM   447  C  CB   . LEU A 1 63  ? -3.169  11.814  27.640 1.00 28.77 ? 63  LEU A CB   1 
ATOM   448  C  CG   . LEU A 1 63  ? -4.249  12.202  26.615 1.00 31.95 ? 63  LEU A CG   1 
ATOM   449  C  CD1  . LEU A 1 63  ? -5.347  11.201  26.530 1.00 35.06 ? 63  LEU A CD1  1 
ATOM   450  C  CD2  . LEU A 1 63  ? -4.838  13.610  26.895 1.00 32.15 ? 63  LEU A CD2  1 
ATOM   451  N  N    . ALA A 1 64  ? -0.541  11.108  29.041 1.00 26.15 ? 64  ALA A N    1 
ATOM   452  C  CA   . ALA A 1 64  ? 0.243   10.819  30.237 1.00 25.79 ? 64  ALA A CA   1 
ATOM   453  C  C    . ALA A 1 64  ? 1.443   11.753  30.423 1.00 26.00 ? 64  ALA A C    1 
ATOM   454  O  O    . ALA A 1 64  ? 1.621   12.332  31.494 1.00 27.21 ? 64  ALA A O    1 
ATOM   455  C  CB   . ALA A 1 64  ? 0.699   9.365   30.231 1.00 25.19 ? 64  ALA A CB   1 
ATOM   456  N  N    . ILE A 1 65  ? 2.267   11.890  29.387 1.00 23.17 ? 65  ILE A N    1 
ATOM   457  C  CA   . ILE A 1 65  ? 3.488   12.655  29.498 1.00 22.09 ? 65  ILE A CA   1 
ATOM   458  C  C    . ILE A 1 65  ? 3.153   14.137  29.783 1.00 23.81 ? 65  ILE A C    1 
ATOM   459  O  O    . ILE A 1 65  ? 3.852   14.799  30.518 1.00 21.79 ? 65  ILE A O    1 
ATOM   460  C  CB   . ILE A 1 65  ? 4.252   12.645  28.205 1.00 20.51 ? 65  ILE A CB   1 
ATOM   461  C  CG1  . ILE A 1 65  ? 4.960   11.292  27.975 1.00 19.62 ? 65  ILE A CG1  1 
ATOM   462  C  CG2  . ILE A 1 65  ? 5.232   13.675  28.222 1.00 17.32 ? 65  ILE A CG2  1 
ATOM   463  C  CD1  . ILE A 1 65  ? 5.700   11.207  26.642 1.00 22.14 ? 65  ILE A CD1  1 
ATOM   464  N  N    . ARG A 1 66  ? 2.093   14.632  29.169 1.00 23.91 ? 66  ARG A N    1 
ATOM   465  C  CA   . ARG A 1 66  ? 1.831   16.059  29.228 1.00 27.43 ? 66  ARG A CA   1 
ATOM   466  C  C    . ARG A 1 66  ? 1.211   16.384  30.585 1.00 29.17 ? 66  ARG A C    1 
ATOM   467  O  O    . ARG A 1 66  ? 1.504   17.402  31.150 1.00 29.60 ? 66  ARG A O    1 
ATOM   468  C  CB   . ARG A 1 66  ? 1.004   16.497  28.024 1.00 26.16 ? 66  ARG A CB   1 
ATOM   469  C  CG   . ARG A 1 66  ? 1.827   16.560  26.749 1.00 28.12 ? 66  ARG A CG   1 
ATOM   470  C  CD   . ARG A 1 66  ? 1.012   17.144  25.551 1.00 30.62 ? 66  ARG A CD   1 
ATOM   471  N  NE   . ARG A 1 66  ? -0.096  16.283  25.145 1.00 30.80 ? 66  ARG A NE   1 
ATOM   472  C  CZ   . ARG A 1 66  ? -1.371  16.463  25.504 1.00 30.33 ? 66  ARG A CZ   1 
ATOM   473  N  NH1  . ARG A 1 66  ? -1.714  17.500  26.279 1.00 26.32 ? 66  ARG A NH1  1 
ATOM   474  N  NH2  . ARG A 1 66  ? -2.308  15.615  25.061 1.00 25.49 ? 66  ARG A NH2  1 
ATOM   475  N  N    . SER A 1 67  ? 0.410   15.460  31.115 1.00 31.50 ? 67  SER A N    1 
ATOM   476  C  CA   . SER A 1 67  ? -0.051  15.502  32.512 1.00 33.26 ? 67  SER A CA   1 
ATOM   477  C  C    . SER A 1 67  ? 1.116   15.650  33.489 1.00 34.03 ? 67  SER A C    1 
ATOM   478  O  O    . SER A 1 67  ? 1.059   16.474  34.437 1.00 34.94 ? 67  SER A O    1 
ATOM   479  C  CB   . SER A 1 67  ? -0.804  14.209  32.825 1.00 33.90 ? 67  SER A CB   1 
ATOM   480  O  OG   . SER A 1 67  ? -1.542  14.278  34.025 1.00 36.79 ? 67  SER A OG   1 
ATOM   481  N  N    . LYS A 1 68  ? 2.162   14.841  33.273 1.00 32.74 ? 68  LYS A N    1 
ATOM   482  C  CA   . LYS A 1 68  ? 3.317   14.840  34.167 1.00 32.61 ? 68  LYS A CA   1 
ATOM   483  C  C    . LYS A 1 68  ? 4.141   16.088  34.072 1.00 32.39 ? 68  LYS A C    1 
ATOM   484  O  O    . LYS A 1 68  ? 4.770   16.465  35.077 1.00 31.72 ? 68  LYS A O    1 
ATOM   485  C  CB   . LYS A 1 68  ? 4.197   13.584  34.007 1.00 31.70 ? 68  LYS A CB   1 
ATOM   486  C  CG   . LYS A 1 68  ? 3.469   12.222  34.235 1.00 32.54 ? 68  LYS A CG   1 
ATOM   487  C  CD   . LYS A 1 68  ? 2.579   12.111  35.490 1.00 35.34 ? 68  LYS A CD   1 
ATOM   488  C  CE   . LYS A 1 68  ? 3.343   12.508  36.758 1.00 37.75 ? 68  LYS A CE   1 
ATOM   489  N  NZ   . LYS A 1 68  ? 2.565   12.211  37.972 1.00 37.76 ? 68  LYS A NZ   1 
ATOM   490  N  N    . ILE A 1 69  ? 4.152   16.704  32.877 1.00 32.45 ? 69  ILE A N    1 
ATOM   491  C  CA   . ILE A 1 69  ? 4.771   18.027  32.626 1.00 33.86 ? 69  ILE A CA   1 
ATOM   492  C  C    . ILE A 1 69  ? 3.927   19.195  33.210 1.00 35.01 ? 69  ILE A C    1 
ATOM   493  O  O    . ILE A 1 69  ? 4.495   20.158  33.790 1.00 35.40 ? 69  ILE A O    1 
ATOM   494  C  CB   . ILE A 1 69  ? 5.085   18.293  31.093 1.00 33.66 ? 69  ILE A CB   1 
ATOM   495  C  CG1  . ILE A 1 69  ? 6.108   17.308  30.482 1.00 31.35 ? 69  ILE A CG1  1 
ATOM   496  C  CG2  . ILE A 1 69  ? 5.625   19.681  30.896 1.00 34.73 ? 69  ILE A CG2  1 
ATOM   497  C  CD1  . ILE A 1 69  ? 6.321   17.549  28.978 1.00 24.91 ? 69  ILE A CD1  1 
ATOM   498  N  N    . ALA A 1 70  ? 2.601   19.094  33.112 1.00 35.29 ? 70  ALA A N    1 
ATOM   499  C  CA   . ALA A 1 70  ? 1.703   20.142  33.643 1.00 36.66 ? 70  ALA A CA   1 
ATOM   500  C  C    . ALA A 1 70  ? 1.640   20.155  35.209 1.00 37.43 ? 70  ALA A C    1 
ATOM   501  O  O    . ALA A 1 70  ? 1.690   21.242  35.852 1.00 36.31 ? 70  ALA A O    1 
ATOM   502  C  CB   . ALA A 1 70  ? 0.294   20.010  33.050 1.00 36.46 ? 70  ALA A CB   1 
ATOM   503  N  N    . ASP A 1 71  ? 1.585   18.966  35.799 1.00 36.80 ? 71  ASP A N    1 
ATOM   504  C  CA   . ASP A 1 71  ? 1.622   18.832  37.247 1.00 36.38 ? 71  ASP A CA   1 
ATOM   505  C  C    . ASP A 1 71  ? 2.966   19.293  37.808 1.00 36.54 ? 71  ASP A C    1 
ATOM   506  O  O    . ASP A 1 71  ? 3.104   19.492  39.015 1.00 36.97 ? 71  ASP A O    1 
ATOM   507  C  CB   . ASP A 1 71  ? 1.347   17.385  37.659 1.00 37.30 ? 71  ASP A CB   1 
ATOM   508  C  CG   . ASP A 1 71  ? 2.496   16.455  37.319 1.00 37.08 ? 71  ASP A CG   1 
ATOM   509  O  OD1  . ASP A 1 71  ? 3.596   16.957  37.005 1.00 37.85 ? 71  ASP A OD1  1 
ATOM   510  O  OD2  . ASP A 1 71  ? 2.299   15.223  37.367 1.00 40.77 ? 71  ASP A OD2  1 
ATOM   511  N  N    . GLY A 1 72  ? 3.956   19.461  36.934 1.00 36.24 ? 72  GLY A N    1 
ATOM   512  C  CA   . GLY A 1 72  ? 5.277   19.900  37.371 1.00 36.42 ? 72  GLY A CA   1 
ATOM   513  C  C    . GLY A 1 72  ? 6.278   18.823  37.771 1.00 36.16 ? 72  GLY A C    1 
ATOM   514  O  O    . GLY A 1 72  ? 7.435   19.153  38.050 1.00 37.14 ? 72  GLY A O    1 
ATOM   515  N  N    . SER A 1 73  ? 5.850   17.550  37.782 1.00 35.60 ? 73  SER A N    1 
ATOM   516  C  CA   . SER A 1 73  ? 6.738   16.387  38.085 1.00 35.33 ? 73  SER A CA   1 
ATOM   517  C  C    . SER A 1 73  ? 8.007   16.392  37.231 1.00 34.04 ? 73  SER A C    1 
ATOM   518  O  O    . SER A 1 73  ? 9.114   16.257  37.731 1.00 33.99 ? 73  SER A O    1 
ATOM   519  C  CB   . SER A 1 73  ? 6.000   15.044  37.930 1.00 34.59 ? 73  SER A CB   1 
ATOM   520  O  OG   . SER A 1 73  ? 4.851   14.928  38.779 1.00 36.46 ? 73  SER A OG   1 
ATOM   521  N  N    . VAL A 1 74  ? 7.833   16.554  35.925 1.00 34.22 ? 74  VAL A N    1 
ATOM   522  C  CA   . VAL A 1 74  ? 8.944   16.635  34.963 1.00 32.39 ? 74  VAL A CA   1 
ATOM   523  C  C    . VAL A 1 74  ? 8.748   17.807  34.040 1.00 32.32 ? 74  VAL A C    1 
ATOM   524  O  O    . VAL A 1 74  ? 7.595   18.274  33.867 1.00 32.16 ? 74  VAL A O    1 
ATOM   525  C  CB   . VAL A 1 74  ? 9.022   15.366  34.046 1.00 32.09 ? 74  VAL A CB   1 
ATOM   526  C  CG1  . VAL A 1 74  ? 9.673   14.232  34.760 1.00 32.23 ? 74  VAL A CG1  1 
ATOM   527  C  CG2  . VAL A 1 74  ? 7.618   14.967  33.498 1.00 30.55 ? 74  VAL A CG2  1 
ATOM   528  N  N    . LYS A 1 75  ? 9.859   18.226  33.431 1.00 32.44 ? 75  LYS A N    1 
ATOM   529  C  CA   . LYS A 1 75  ? 9.924   19.220  32.332 1.00 33.12 ? 75  LYS A CA   1 
ATOM   530  C  C    . LYS A 1 75  ? 10.071  18.390  31.055 1.00 33.71 ? 75  LYS A C    1 
ATOM   531  O  O    . LYS A 1 75  ? 10.542  17.251  31.137 1.00 33.77 ? 75  LYS A O    1 
ATOM   532  C  CB   . LYS A 1 75  ? 11.145  20.119  32.505 0.50 33.12 ? 75  LYS A CB   1 
ATOM   533  C  CG   . LYS A 1 75  ? 11.173  20.936  33.809 0.50 33.46 ? 75  LYS A CG   1 
ATOM   534  C  CD   . LYS A 1 75  ? 12.594  21.469  34.127 0.50 33.27 ? 75  LYS A CD   1 
ATOM   535  C  CE   . LYS A 1 75  ? 12.587  22.429  35.331 0.50 33.50 ? 75  LYS A CE   1 
ATOM   536  N  NZ   . LYS A 1 75  ? 13.656  22.173  36.377 0.50 31.48 ? 75  LYS A NZ   1 
ATOM   537  N  N    . ARG A 1 76  ? 9.691   18.938  29.886 1.00 33.05 ? 76  ARG A N    1 
ATOM   538  C  CA   . ARG A 1 76  ? 9.796   18.203  28.595 1.00 31.45 ? 76  ARG A CA   1 
ATOM   539  C  C    . ARG A 1 76  ? 11.194  17.717  28.256 1.00 31.12 ? 76  ARG A C    1 
ATOM   540  O  O    . ARG A 1 76  ? 11.371  16.610  27.723 1.00 30.39 ? 76  ARG A O    1 
ATOM   541  C  CB   . ARG A 1 76  ? 9.246   19.045  27.435 1.00 31.59 ? 76  ARG A CB   1 
ATOM   542  C  CG   . ARG A 1 76  ? 9.387   18.455  26.032 1.00 29.99 ? 76  ARG A CG   1 
ATOM   543  C  CD   . ARG A 1 76  ? 8.402   17.321  25.734 1.00 28.95 ? 76  ARG A CD   1 
ATOM   544  N  NE   . ARG A 1 76  ? 8.671   16.613  24.472 1.00 24.37 ? 76  ARG A NE   1 
ATOM   545  C  CZ   . ARG A 1 76  ? 9.613   15.682  24.321 1.00 27.83 ? 76  ARG A CZ   1 
ATOM   546  N  NH1  . ARG A 1 76  ? 10.395  15.383  25.367 1.00 26.01 ? 76  ARG A NH1  1 
ATOM   547  N  NH2  . ARG A 1 76  ? 9.807   15.079  23.126 1.00 20.89 ? 76  ARG A NH2  1 
ATOM   548  N  N    . GLU A 1 77  ? 12.189  18.543  28.569 1.00 30.96 ? 77  GLU A N    1 
ATOM   549  C  CA   . GLU A 1 77  ? 13.599  18.199  28.406 1.00 31.18 ? 77  GLU A CA   1 
ATOM   550  C  C    . GLU A 1 77  ? 14.048  17.020  29.270 1.00 29.71 ? 77  GLU A C    1 
ATOM   551  O  O    . GLU A 1 77  ? 15.084  16.403  28.966 1.00 30.60 ? 77  GLU A O    1 
ATOM   552  C  CB   . GLU A 1 77  ? 14.533  19.420  28.637 1.00 31.40 ? 77  GLU A CB   1 
ATOM   553  C  CG   . GLU A 1 77  ? 14.208  20.642  27.751 1.00 34.39 ? 77  GLU A CG   1 
ATOM   554  C  CD   . GLU A 1 77  ? 13.015  21.503  28.268 1.00 36.34 ? 77  GLU A CD   1 
ATOM   555  O  OE1  . GLU A 1 77  ? 12.402  21.194  29.331 0.70 33.10 ? 77  GLU A OE1  1 
ATOM   556  O  OE2  . GLU A 1 77  ? 12.711  22.499  27.580 0.70 35.46 ? 77  GLU A OE2  1 
ATOM   557  N  N    . ASP A 1 78  ? 13.304  16.730  30.340 1.00 29.93 ? 78  ASP A N    1 
ATOM   558  C  CA   . ASP A 1 78  ? 13.605  15.570  31.214 1.00 29.15 ? 78  ASP A CA   1 
ATOM   559  C  C    . ASP A 1 78  ? 13.067  14.254  30.629 1.00 27.85 ? 78  ASP A C    1 
ATOM   560  O  O    . ASP A 1 78  ? 13.393  13.202  31.123 1.00 28.23 ? 78  ASP A O    1 
ATOM   561  C  CB   . ASP A 1 78  ? 12.953  15.683  32.601 1.00 29.27 ? 78  ASP A CB   1 
ATOM   562  C  CG   . ASP A 1 78  ? 13.371  16.930  33.405 1.00 32.35 ? 78  ASP A CG   1 
ATOM   563  O  OD1  . ASP A 1 78  ? 14.540  17.416  33.277 1.00 33.96 ? 78  ASP A OD1  1 
ATOM   564  O  OD2  . ASP A 1 78  ? 12.486  17.334  34.207 1.00 29.92 ? 78  ASP A OD2  1 
ATOM   565  N  N    . ILE A 1 79  ? 12.194  14.327  29.632 1.00 26.93 ? 79  ILE A N    1 
ATOM   566  C  CA   . ILE A 1 79  ? 11.556  13.140  29.061 1.00 25.09 ? 79  ILE A CA   1 
ATOM   567  C  C    . ILE A 1 79  ? 12.233  12.846  27.748 1.00 23.41 ? 79  ILE A C    1 
ATOM   568  O  O    . ILE A 1 79  ? 12.476  13.757  26.970 1.00 23.58 ? 79  ILE A O    1 
ATOM   569  C  CB   . ILE A 1 79  ? 10.044  13.405  28.852 1.00 25.76 ? 79  ILE A CB   1 
ATOM   570  C  CG1  . ILE A 1 79  ? 9.358   13.630  30.212 1.00 29.06 ? 79  ILE A CG1  1 
ATOM   571  C  CG2  . ILE A 1 79  ? 9.392   12.281  28.018 1.00 24.01 ? 79  ILE A CG2  1 
ATOM   572  C  CD1  . ILE A 1 79  ? 9.140   12.335  31.122 1.00 25.59 ? 79  ILE A CD1  1 
ATOM   573  N  N    . PHE A 1 80  ? 12.579  11.577  27.512 1.00 22.25 ? 80  PHE A N    1 
ATOM   574  C  CA   . PHE A 1 80  ? 13.093  11.136  26.210 1.00 21.91 ? 80  PHE A CA   1 
ATOM   575  C  C    . PHE A 1 80  ? 12.058  10.223  25.573 1.00 20.86 ? 80  PHE A C    1 
ATOM   576  O  O    . PHE A 1 80  ? 11.847  9.048   25.995 1.00 20.71 ? 80  PHE A O    1 
ATOM   577  C  CB   . PHE A 1 80  ? 14.450  10.417  26.384 1.00 21.98 ? 80  PHE A CB   1 
ATOM   578  C  CG   . PHE A 1 80  ? 15.177  10.071  25.067 1.00 22.58 ? 80  PHE A CG   1 
ATOM   579  C  CD1  . PHE A 1 80  ? 14.806  8.939   24.336 1.00 19.79 ? 80  PHE A CD1  1 
ATOM   580  C  CD2  . PHE A 1 80  ? 16.291  10.820  24.627 1.00 19.66 ? 80  PHE A CD2  1 
ATOM   581  C  CE1  . PHE A 1 80  ? 15.468  8.591   23.147 1.00 17.79 ? 80  PHE A CE1  1 
ATOM   582  C  CE2  . PHE A 1 80  ? 16.968  10.474  23.481 1.00 16.40 ? 80  PHE A CE2  1 
ATOM   583  C  CZ   . PHE A 1 80  ? 16.521  9.344   22.711 1.00 18.47 ? 80  PHE A CZ   1 
ATOM   584  N  N    . TYR A 1 81  ? 11.394  10.775  24.563 1.00 20.59 ? 81  TYR A N    1 
ATOM   585  C  CA   . TYR A 1 81  ? 10.293  10.085  23.927 1.00 19.81 ? 81  TYR A CA   1 
ATOM   586  C  C    . TYR A 1 81  ? 10.626  9.630   22.497 1.00 18.61 ? 81  TYR A C    1 
ATOM   587  O  O    . TYR A 1 81  ? 11.029  10.440  21.665 1.00 18.96 ? 81  TYR A O    1 
ATOM   588  C  CB   . TYR A 1 81  ? 8.997   10.920  23.967 1.00 21.49 ? 81  TYR A CB   1 
ATOM   589  C  CG   . TYR A 1 81  ? 7.909   10.246  23.167 1.00 19.06 ? 81  TYR A CG   1 
ATOM   590  C  CD1  . TYR A 1 81  ? 7.193   9.172   23.724 1.00 21.43 ? 81  TYR A CD1  1 
ATOM   591  C  CD2  . TYR A 1 81  ? 7.719   10.559  21.825 1.00 17.98 ? 81  TYR A CD2  1 
ATOM   592  C  CE1  . TYR A 1 81  ? 6.250   8.516   22.997 1.00 20.58 ? 81  TYR A CE1  1 
ATOM   593  C  CE2  . TYR A 1 81  ? 6.757   9.911   21.077 1.00 18.37 ? 81  TYR A CE2  1 
ATOM   594  C  CZ   . TYR A 1 81  ? 6.045   8.865   21.681 1.00 18.76 ? 81  TYR A CZ   1 
ATOM   595  O  OH   . TYR A 1 81  ? 5.130   8.164   20.963 1.00 19.12 ? 81  TYR A OH   1 
ATOM   596  N  N    . THR A 1 82  ? 10.447  8.326   22.245 1.00 18.64 ? 82  THR A N    1 
ATOM   597  C  CA   . THR A 1 82  ? 10.692  7.729   20.947 1.00 16.20 ? 82  THR A CA   1 
ATOM   598  C  C    . THR A 1 82  ? 9.398   7.427   20.176 1.00 17.07 ? 82  THR A C    1 
ATOM   599  O  O    . THR A 1 82  ? 8.434   6.925   20.753 1.00 17.38 ? 82  THR A O    1 
ATOM   600  C  CB   . THR A 1 82  ? 11.446  6.405   21.142 1.00 16.65 ? 82  THR A CB   1 
ATOM   601  O  OG1  . THR A 1 82  ? 12.712  6.707   21.754 1.00 16.32 ? 82  THR A OG1  1 
ATOM   602  C  CG2  . THR A 1 82  ? 11.660  5.684   19.770 1.00 17.56 ? 82  THR A CG2  1 
ATOM   603  N  N    . SER A 1 83  ? 9.429   7.670   18.867 1.00 17.08 ? 83  SER A N    1 
ATOM   604  C  CA   . SER A 1 83  ? 8.360   7.265   17.957 1.00 17.42 ? 83  SER A CA   1 
ATOM   605  C  C    . SER A 1 83  ? 8.950   6.457   16.796 1.00 16.90 ? 83  SER A C    1 
ATOM   606  O  O    . SER A 1 83  ? 10.161  6.477   16.577 1.00 16.26 ? 83  SER A O    1 
ATOM   607  C  CB   . SER A 1 83  ? 7.612   8.488   17.426 1.00 18.79 ? 83  SER A CB   1 
ATOM   608  O  OG   . SER A 1 83  ? 6.412   8.109   16.775 1.00 19.84 ? 83  SER A OG   1 
ATOM   609  N  N    . LYS A 1 84  ? 8.099   5.748   16.056 1.00 15.36 ? 84  LYS A N    1 
ATOM   610  C  CA   . LYS A 1 84  ? 8.560   4.928   14.947 1.00 17.47 ? 84  LYS A CA   1 
ATOM   611  C  C    . LYS A 1 84  ? 7.690   5.026   13.752 1.00 16.61 ? 84  LYS A C    1 
ATOM   612  O  O    . LYS A 1 84  ? 6.461   4.993   13.881 1.00 18.74 ? 84  LYS A O    1 
ATOM   613  C  CB   . LYS A 1 84  ? 8.735   3.419   15.328 1.00 16.19 ? 84  LYS A CB   1 
ATOM   614  C  CG   . LYS A 1 84  ? 9.606   3.208   16.625 1.00 18.29 ? 84  LYS A CG   1 
ATOM   615  C  CD   . LYS A 1 84  ? 9.843   1.722   16.883 1.00 20.18 ? 84  LYS A CD   1 
ATOM   616  C  CE   . LYS A 1 84  ? 10.223  1.425   18.364 1.00 15.78 ? 84  LYS A CE   1 
ATOM   617  N  NZ   . LYS A 1 84  ? 9.072   1.472   19.355 1.00 17.57 ? 84  LYS A NZ   1 
ATOM   618  N  N    . LEU A 1 85  ? 8.361   5.104   12.589 1.00 17.35 ? 85  LEU A N    1 
ATOM   619  C  CA   . LEU A 1 85  ? 7.729   5.257   11.308 1.00 17.96 ? 85  LEU A CA   1 
ATOM   620  C  C    . LEU A 1 85  ? 7.261   3.891   10.859 1.00 18.77 ? 85  LEU A C    1 
ATOM   621  O  O    . LEU A 1 85  ? 8.070   2.991   10.737 1.00 19.31 ? 85  LEU A O    1 
ATOM   622  C  CB   . LEU A 1 85  ? 8.713   5.786   10.290 1.00 17.90 ? 85  LEU A CB   1 
ATOM   623  C  CG   . LEU A 1 85  ? 8.335   5.750   8.826  1.00 17.51 ? 85  LEU A CG   1 
ATOM   624  C  CD1  . LEU A 1 85  ? 7.402   6.973   8.646  1.00 19.42 ? 85  LEU A CD1  1 
ATOM   625  C  CD2  . LEU A 1 85  ? 9.613   5.872   7.986  1.00 20.68 ? 85  LEU A CD2  1 
ATOM   626  N  N    . TRP A 1 86  ? 5.958   3.757   10.584 1.00 18.52 ? 86  TRP A N    1 
ATOM   627  C  CA   . TRP A 1 86  ? 5.433   2.401   10.320 1.00 18.94 ? 86  TRP A CA   1 
ATOM   628  C  C    . TRP A 1 86  ? 5.653   2.008   8.840  1.00 18.76 ? 86  TRP A C    1 
ATOM   629  O  O    . TRP A 1 86  ? 5.850   2.870   8.013  1.00 19.44 ? 86  TRP A O    1 
ATOM   630  C  CB   . TRP A 1 86  ? 3.958   2.229   10.773 1.00 17.81 ? 86  TRP A CB   1 
ATOM   631  C  CG   . TRP A 1 86  ? 3.537   0.847   10.454 1.00 21.39 ? 86  TRP A CG   1 
ATOM   632  C  CD1  . TRP A 1 86  ? 2.584   0.454   9.523  1.00 22.38 ? 86  TRP A CD1  1 
ATOM   633  C  CD2  . TRP A 1 86  ? 4.117   -0.353  10.969 1.00 22.72 ? 86  TRP A CD2  1 
ATOM   634  N  NE1  . TRP A 1 86  ? 2.512   -0.930  9.488  1.00 24.52 ? 86  TRP A NE1  1 
ATOM   635  C  CE2  . TRP A 1 86  ? 3.450   -1.454  10.341 1.00 24.72 ? 86  TRP A CE2  1 
ATOM   636  C  CE3  . TRP A 1 86  ? 5.142   -0.620  11.903 1.00 19.20 ? 86  TRP A CE3  1 
ATOM   637  C  CZ2  . TRP A 1 86  ? 3.771   -2.800  10.630 1.00 23.92 ? 86  TRP A CZ2  1 
ATOM   638  C  CZ3  . TRP A 1 86  ? 5.447   -1.952  12.179 1.00 21.81 ? 86  TRP A CZ3  1 
ATOM   639  C  CH2  . TRP A 1 86  ? 4.765   -3.019  11.560 1.00 20.33 ? 86  TRP A CH2  1 
ATOM   640  N  N    . CYS A 1 87  ? 5.713   0.700   8.546  1.00 18.70 ? 87  CYS A N    1 
ATOM   641  C  CA   . CYS A 1 87  ? 5.880   0.167   7.170  1.00 19.81 ? 87  CYS A CA   1 
ATOM   642  C  C    . CYS A 1 87  ? 5.026   0.753   6.005  1.00 21.00 ? 87  CYS A C    1 
ATOM   643  O  O    . CYS A 1 87  ? 5.438   0.681   4.813  1.00 20.32 ? 87  CYS A O    1 
ATOM   644  C  CB   . CYS A 1 87  ? 5.734   -1.352  7.239  1.00 18.97 ? 87  CYS A CB   1 
ATOM   645  S  SG   . CYS A 1 87  ? 6.874   -1.893  8.511  1.00 21.31 ? 87  CYS A SG   1 
ATOM   646  N  N    . ASN A 1 88  ? 3.871   1.337   6.346  1.00 21.84 ? 88  ASN A N    1 
ATOM   647  C  CA   . ASN A 1 88  ? 2.960   1.904   5.355  1.00 22.60 ? 88  ASN A CA   1 
ATOM   648  C  C    . ASN A 1 88  ? 3.392   3.342   4.948  1.00 23.45 ? 88  ASN A C    1 
ATOM   649  O  O    . ASN A 1 88  ? 2.880   3.857   3.953  1.00 23.33 ? 88  ASN A O    1 
ATOM   650  C  CB   . ASN A 1 88  ? 1.491   1.824   5.849  1.00 22.67 ? 88  ASN A CB   1 
ATOM   651  C  CG   . ASN A 1 88  ? 1.221   2.789   7.013  1.00 23.76 ? 88  ASN A CG   1 
ATOM   652  O  OD1  . ASN A 1 88  ? 2.126   3.148   7.771  1.00 26.52 ? 88  ASN A OD1  1 
ATOM   653  N  ND2  . ASN A 1 88  ? 0.015   3.260   7.103  1.00 27.58 ? 88  ASN A ND2  1 
ATOM   654  N  N    . SER A 1 89  ? 4.410   3.918   5.624  1.00 22.77 ? 89  SER A N    1 
ATOM   655  C  CA   . SER A 1 89  ? 4.927   5.252   5.239  1.00 21.93 ? 89  SER A CA   1 
ATOM   656  C  C    . SER A 1 89  ? 6.429   5.378   4.894  1.00 22.51 ? 89  SER A C    1 
ATOM   657  O  O    . SER A 1 89  ? 7.009   6.470   4.940  1.00 21.55 ? 89  SER A O    1 
ATOM   658  C  CB   . SER A 1 89  ? 4.537   6.295   6.297  1.00 20.94 ? 89  SER A CB   1 
ATOM   659  O  OG   . SER A 1 89  ? 3.129   6.374   6.400  1.00 21.83 ? 89  SER A OG   1 
ATOM   660  N  N    . HIS A 1 90  ? 7.035   4.264   4.508  1.00 22.27 ? 90  HIS A N    1 
ATOM   661  C  CA   . HIS A 1 90  ? 8.384   4.229   3.957  1.00 22.81 ? 90  HIS A CA   1 
ATOM   662  C  C    . HIS A 1 90  ? 8.578   5.186   2.784  1.00 23.18 ? 90  HIS A C    1 
ATOM   663  O  O    . HIS A 1 90  ? 9.647   5.749   2.643  1.00 21.50 ? 90  HIS A O    1 
ATOM   664  C  CB   . HIS A 1 90  ? 8.781   2.793   3.546  1.00 23.34 ? 90  HIS A CB   1 
ATOM   665  C  CG   . HIS A 1 90  ? 9.147   1.918   4.713  1.00 25.42 ? 90  HIS A CG   1 
ATOM   666  N  ND1  . HIS A 1 90  ? 9.923   0.788   4.580  1.00 28.97 ? 90  HIS A ND1  1 
ATOM   667  C  CD2  . HIS A 1 90  ? 8.895   2.049   6.038  1.00 21.74 ? 90  HIS A CD2  1 
ATOM   668  C  CE1  . HIS A 1 90  ? 10.115  0.247   5.769  1.00 30.01 ? 90  HIS A CE1  1 
ATOM   669  N  NE2  . HIS A 1 90  ? 9.484   0.989   6.669  1.00 30.34 ? 90  HIS A NE2  1 
ATOM   670  N  N    . ARG A 1 91  ? 7.552   5.358   1.929  1.00 22.51 ? 91  ARG A N    1 
ATOM   671  C  CA   . ARG A 1 91  ? 7.738   6.213   0.741  1.00 23.71 ? 91  ARG A CA   1 
ATOM   672  C  C    . ARG A 1 91  ? 8.187   7.610   1.187  1.00 24.10 ? 91  ARG A C    1 
ATOM   673  O  O    . ARG A 1 91  ? 7.553   8.226   2.076  1.00 23.72 ? 91  ARG A O    1 
ATOM   674  C  CB   . ARG A 1 91  ? 6.468   6.289   -0.136 1.00 23.98 ? 91  ARG A CB   1 
ATOM   675  C  CG   . ARG A 1 91  ? 6.129   4.989   -0.861 1.00 23.40 ? 91  ARG A CG   1 
ATOM   676  C  CD   . ARG A 1 91  ? 4.786   5.079   -1.660 1.00 27.63 ? 91  ARG A CD   1 
ATOM   677  N  NE   . ARG A 1 91  ? 4.538   3.817   -2.349 1.00 25.68 ? 91  ARG A NE   1 
ATOM   678  C  CZ   . ARG A 1 91  ? 3.850   3.684   -3.479 1.00 27.26 ? 91  ARG A CZ   1 
ATOM   679  N  NH1  . ARG A 1 91  ? 3.317   4.741   -4.079 1.00 25.61 ? 91  ARG A NH1  1 
ATOM   680  N  NH2  . ARG A 1 91  ? 3.675   2.475   -4.017 1.00 25.51 ? 91  ARG A NH2  1 
ATOM   681  N  N    . PRO A 1 92  ? 9.259   8.106   0.566  1.00 24.40 ? 92  PRO A N    1 
ATOM   682  C  CA   . PRO A 1 92  ? 9.884   9.363   0.967  1.00 24.80 ? 92  PRO A CA   1 
ATOM   683  C  C    . PRO A 1 92  ? 8.915   10.503  1.270  1.00 25.19 ? 92  PRO A C    1 
ATOM   684  O  O    . PRO A 1 92  ? 9.055   11.152  2.307  1.00 24.77 ? 92  PRO A O    1 
ATOM   685  C  CB   . PRO A 1 92  ? 10.875  9.676   -0.196 1.00 24.96 ? 92  PRO A CB   1 
ATOM   686  C  CG   . PRO A 1 92  ? 10.637  8.625   -1.259 1.00 27.27 ? 92  PRO A CG   1 
ATOM   687  C  CD   . PRO A 1 92  ? 9.989   7.442   -0.550 1.00 24.30 ? 92  PRO A CD   1 
ATOM   688  N  N    . GLU A 1 93  ? 7.921   10.717  0.417  1.00 25.25 ? 93  GLU A N    1 
ATOM   689  C  CA   . GLU A 1 93  ? 6.982   11.825  0.594  1.00 26.33 ? 93  GLU A CA   1 
ATOM   690  C  C    . GLU A 1 93  ? 5.922   11.606  1.704  1.00 25.09 ? 93  GLU A C    1 
ATOM   691  O  O    . GLU A 1 93  ? 5.264   12.558  2.139  1.00 23.54 ? 93  GLU A O    1 
ATOM   692  C  CB   . GLU A 1 93  ? 6.348   12.224  -0.771 1.00 27.22 ? 93  GLU A CB   1 
ATOM   693  C  CG   . GLU A 1 93  ? 5.244   11.255  -1.313 1.00 30.53 ? 93  GLU A CG   1 
ATOM   694  C  CD   . GLU A 1 93  ? 5.721   9.856   -1.799 1.00 33.42 ? 93  GLU A CD   1 
ATOM   695  O  OE1  . GLU A 1 93  ? 6.946   9.594   -1.942 1.00 31.04 ? 93  GLU A OE1  1 
ATOM   696  O  OE2  . GLU A 1 93  ? 4.821   8.998   -2.071 1.00 39.61 ? 93  GLU A OE2  1 
ATOM   697  N  N    . LEU A 1 94  ? 5.837   10.364  2.210  1.00 22.88 ? 94  LEU A N    1 
ATOM   698  C  CA   . LEU A 1 94  ? 4.937   9.971   3.277  1.00 21.88 ? 94  LEU A CA   1 
ATOM   699  C  C    . LEU A 1 94  ? 5.566   10.052  4.659  1.00 21.31 ? 94  LEU A C    1 
ATOM   700  O  O    . LEU A 1 94  ? 4.840   9.999   5.644  1.00 22.38 ? 94  LEU A O    1 
ATOM   701  C  CB   . LEU A 1 94  ? 4.420   8.515   3.032  1.00 20.93 ? 94  LEU A CB   1 
ATOM   702  C  CG   . LEU A 1 94  ? 3.683   8.375   1.687  1.00 22.84 ? 94  LEU A CG   1 
ATOM   703  C  CD1  . LEU A 1 94  ? 2.988   7.023   1.592  1.00 19.76 ? 94  LEU A CD1  1 
ATOM   704  C  CD2  . LEU A 1 94  ? 2.664   9.495   1.469  1.00 17.85 ? 94  LEU A CD2  1 
ATOM   705  N  N    . VAL A 1 95  ? 6.898   10.096  4.737  1.00 21.43 ? 95  VAL A N    1 
ATOM   706  C  CA   . VAL A 1 95  ? 7.636   10.125  6.034  1.00 20.73 ? 95  VAL A CA   1 
ATOM   707  C  C    . VAL A 1 95  ? 7.294   11.308  6.948  1.00 21.46 ? 95  VAL A C    1 
ATOM   708  O  O    . VAL A 1 95  ? 6.958   11.115  8.128  1.00 20.62 ? 95  VAL A O    1 
ATOM   709  C  CB   . VAL A 1 95  ? 9.143   10.062  5.808  1.00 21.28 ? 95  VAL A CB   1 
ATOM   710  C  CG1  . VAL A 1 95  ? 9.955   10.104  7.187  1.00 21.54 ? 95  VAL A CG1  1 
ATOM   711  C  CG2  . VAL A 1 95  ? 9.495   8.835   5.028  1.00 22.84 ? 95  VAL A CG2  1 
ATOM   712  N  N    . ARG A 1 96  ? 7.379   12.543  6.430  1.00 20.44 ? 96  ARG A N    1 
ATOM   713  C  CA   . ARG A 1 96  ? 7.083   13.690  7.268  1.00 20.69 ? 96  ARG A CA   1 
ATOM   714  C  C    . ARG A 1 96  ? 5.589   13.680  7.708  1.00 21.61 ? 96  ARG A C    1 
ATOM   715  O  O    . ARG A 1 96  ? 5.302   13.882  8.887  1.00 20.40 ? 96  ARG A O    1 
ATOM   716  C  CB   . ARG A 1 96  ? 7.488   14.998  6.602  1.00 21.03 ? 96  ARG A CB   1 
ATOM   717  C  CG   . ARG A 1 96  ? 7.385   16.125  7.542  1.00 22.74 ? 96  ARG A CG   1 
ATOM   718  C  CD   . ARG A 1 96  ? 8.137   17.308  7.081  1.00 28.20 ? 96  ARG A CD   1 
ATOM   719  N  NE   . ARG A 1 96  ? 7.570   18.455  7.750  1.00 34.58 ? 96  ARG A NE   1 
ATOM   720  C  CZ   . ARG A 1 96  ? 8.192   19.611  7.854  1.00 37.53 ? 96  ARG A CZ   1 
ATOM   721  N  NH1  . ARG A 1 96  ? 9.412   19.723  7.322  1.00 38.02 ? 96  ARG A NH1  1 
ATOM   722  N  NH2  . ARG A 1 96  ? 7.612   20.613  8.510  1.00 35.34 ? 96  ARG A NH2  1 
ATOM   723  N  N    . PRO A 1 97  ? 4.647   13.388  6.780  1.00 21.22 ? 97  PRO A N    1 
ATOM   724  C  CA   . PRO A 1 97  ? 3.289   13.359  7.280  1.00 21.03 ? 97  PRO A CA   1 
ATOM   725  C  C    . PRO A 1 97  ? 3.115   12.350  8.420  1.00 20.54 ? 97  PRO A C    1 
ATOM   726  O  O    . PRO A 1 97  ? 2.371   12.597  9.387  1.00 20.71 ? 97  PRO A O    1 
ATOM   727  C  CB   . PRO A 1 97  ? 2.465   12.927  6.046  1.00 20.05 ? 97  PRO A CB   1 
ATOM   728  C  CG   . PRO A 1 97  ? 3.252   13.581  4.857  1.00 22.13 ? 97  PRO A CG   1 
ATOM   729  C  CD   . PRO A 1 97  ? 4.708   13.451  5.294  1.00 21.95 ? 97  PRO A CD   1 
ATOM   730  N  N    . ALA A 1 98  ? 3.771   11.201  8.311  1.00 21.30 ? 98  ALA A N    1 
ATOM   731  C  CA   . ALA A 1 98  ? 3.602   10.182  9.359  1.00 20.87 ? 98  ALA A CA   1 
ATOM   732  C  C    . ALA A 1 98  ? 4.071   10.721  10.707 1.00 20.26 ? 98  ALA A C    1 
ATOM   733  O  O    . ALA A 1 98  ? 3.425   10.554  11.742 1.00 20.47 ? 98  ALA A O    1 
ATOM   734  C  CB   . ALA A 1 98  ? 4.383   8.892   9.004  1.00 20.88 ? 98  ALA A CB   1 
ATOM   735  N  N    . LEU A 1 99  ? 5.232   11.344  10.675 1.00 22.08 ? 99  LEU A N    1 
ATOM   736  C  CA   . LEU A 1 99  ? 5.820   11.891  11.906 1.00 22.61 ? 99  LEU A CA   1 
ATOM   737  C  C    . LEU A 1 99  ? 4.900   12.969  12.429 1.00 23.40 ? 99  LEU A C    1 
ATOM   738  O  O    . LEU A 1 99  ? 4.636   13.036  13.612 1.00 23.69 ? 99  LEU A O    1 
ATOM   739  C  CB   . LEU A 1 99  ? 7.214   12.429  11.637 1.00 21.96 ? 99  LEU A CB   1 
ATOM   740  C  CG   . LEU A 1 99  ? 7.877   13.190  12.817 1.00 22.88 ? 99  LEU A CG   1 
ATOM   741  C  CD1  . LEU A 1 99  ? 7.832   12.331  14.127 1.00 20.40 ? 99  LEU A CD1  1 
ATOM   742  C  CD2  . LEU A 1 99  ? 9.327   13.572  12.470 1.00 20.89 ? 99  LEU A CD2  1 
ATOM   743  N  N    . GLU A 1 100 ? 4.397   13.820  11.537 1.00 24.64 ? 100 GLU A N    1 
ATOM   744  C  CA   . GLU A 1 100 ? 3.555   14.937  11.950 1.00 24.41 ? 100 GLU A CA   1 
ATOM   745  C  C    . GLU A 1 100 ? 2.232   14.456  12.550 1.00 23.93 ? 100 GLU A C    1 
ATOM   746  O  O    . GLU A 1 100 ? 1.694   15.070  13.469 1.00 21.56 ? 100 GLU A O    1 
ATOM   747  C  CB   . GLU A 1 100 ? 3.284   15.844  10.745 1.00 25.60 ? 100 GLU A CB   1 
ATOM   748  C  CG   . GLU A 1 100 ? 4.424   16.795  10.463 1.00 29.04 ? 100 GLU A CG   1 
ATOM   749  C  CD   . GLU A 1 100 ? 4.101   17.811  9.345  1.00 35.53 ? 100 GLU A CD   1 
ATOM   750  O  OE1  . GLU A 1 100 ? 2.941   17.858  8.887  1.00 41.80 ? 100 GLU A OE1  1 
ATOM   751  O  OE2  . GLU A 1 100 ? 4.963   18.612  8.972  1.00 31.42 ? 100 GLU A OE2  1 
ATOM   752  N  N    . ARG A 1 101 ? 1.715   13.358  12.003 1.00 23.70 ? 101 ARG A N    1 
ATOM   753  C  CA   . ARG A 1 101 ? 0.531   12.704  12.554 1.00 23.52 ? 101 ARG A CA   1 
ATOM   754  C  C    . ARG A 1 101 ? 0.750   12.141  13.926 1.00 21.62 ? 101 ARG A C    1 
ATOM   755  O  O    . ARG A 1 101 ? -0.120  12.323  14.788 1.00 20.71 ? 101 ARG A O    1 
ATOM   756  C  CB   . ARG A 1 101 ? 0.000   11.601  11.622 1.00 23.98 ? 101 ARG A CB   1 
ATOM   757  C  CG   . ARG A 1 101 ? -1.297  10.977  12.052 1.00 29.64 ? 101 ARG A CG   1 
ATOM   758  C  CD   . ARG A 1 101 ? -1.921  10.240  10.879 1.00 36.24 ? 101 ARG A CD   1 
ATOM   759  N  NE   . ARG A 1 101 ? -2.981  9.356   11.340 1.00 39.60 ? 101 ARG A NE   1 
ATOM   760  C  CZ   . ARG A 1 101 ? -3.560  8.442   10.566 1.00 42.08 ? 101 ARG A CZ   1 
ATOM   761  N  NH1  . ARG A 1 101 ? -3.181  8.332   9.284  1.00 37.69 ? 101 ARG A NH1  1 
ATOM   762  N  NH2  . ARG A 1 101 ? -4.525  7.653   11.072 1.00 39.02 ? 101 ARG A NH2  1 
ATOM   763  N  N    . SER A 1 102 ? 1.862   11.421  14.152 1.00 20.84 ? 102 SER A N    1 
ATOM   764  C  CA   . SER A 1 102 ? 2.231   11.072  15.539 1.00 18.71 ? 102 SER A CA   1 
ATOM   765  C  C    . SER A 1 102 ? 2.271   12.275  16.470 1.00 19.05 ? 102 SER A C    1 
ATOM   766  O  O    . SER A 1 102 ? 1.786   12.243  17.609 1.00 18.27 ? 102 SER A O    1 
ATOM   767  C  CB   . SER A 1 102 ? 3.566   10.357  15.629 1.00 18.40 ? 102 SER A CB   1 
ATOM   768  O  OG   . SER A 1 102 ? 3.469   9.171   14.872 1.00 18.44 ? 102 SER A OG   1 
ATOM   769  N  N    . LEU A 1 103 ? 2.853   13.339  15.973 1.00 19.16 ? 103 LEU A N    1 
ATOM   770  C  CA   . LEU A 1 103 ? 2.964   14.521  16.831 1.00 20.42 ? 103 LEU A CA   1 
ATOM   771  C  C    . LEU A 1 103 ? 1.644   15.153  17.210 1.00 20.66 ? 103 LEU A C    1 
ATOM   772  O  O    . LEU A 1 103 ? 1.483   15.644  18.343 1.00 22.20 ? 103 LEU A O    1 
ATOM   773  C  CB   . LEU A 1 103 ? 3.901   15.535  16.173 1.00 18.70 ? 103 LEU A CB   1 
ATOM   774  C  CG   . LEU A 1 103 ? 5.356   15.058  16.132 1.00 20.29 ? 103 LEU A CG   1 
ATOM   775  C  CD1  . LEU A 1 103 ? 6.158   15.969  15.230 1.00 23.43 ? 103 LEU A CD1  1 
ATOM   776  C  CD2  . LEU A 1 103 ? 5.911   15.132  17.538 1.00 22.27 ? 103 LEU A CD2  1 
ATOM   777  N  N    . LYS A 1 104 ? 0.713   15.153  16.263 1.00 22.43 ? 104 LYS A N    1 
ATOM   778  C  CA   . LYS A 1 104 ? -0.617  15.696  16.495 1.00 21.92 ? 104 LYS A CA   1 
ATOM   779  C  C    . LYS A 1 104 ? -1.380  14.817  17.475 1.00 22.29 ? 104 LYS A C    1 
ATOM   780  O  O    . LYS A 1 104 ? -2.175  15.310  18.275 1.00 21.69 ? 104 LYS A O    1 
ATOM   781  C  CB   . LYS A 1 104 ? -1.388  15.810  15.178 1.00 23.42 ? 104 LYS A CB   1 
ATOM   782  C  CG   . LYS A 1 104 ? -2.620  16.697  15.255 1.00 26.68 ? 104 LYS A CG   1 
ATOM   783  C  CD   . LYS A 1 104 ? -3.395  16.679  13.948 1.00 30.81 ? 104 LYS A CD   1 
ATOM   784  C  CE   . LYS A 1 104 ? -3.077  15.436  13.134 0.50 32.72 ? 104 LYS A CE   1 
ATOM   785  N  NZ   . LYS A 1 104 ? -2.143  14.525  13.853 0.50 33.90 ? 104 LYS A NZ   1 
ATOM   786  N  N    . ASN A 1 105 ? -1.142  13.503  17.420 1.00 20.88 ? 105 ASN A N    1 
ATOM   787  C  CA   . ASN A 1 105 ? -1.791  12.583  18.335 1.00 20.73 ? 105 ASN A CA   1 
ATOM   788  C  C    . ASN A 1 105 ? -1.202  12.739  19.742 1.00 19.48 ? 105 ASN A C    1 
ATOM   789  O  O    . ASN A 1 105 ? -1.952  12.644  20.737 1.00 18.61 ? 105 ASN A O    1 
ATOM   790  C  CB   . ASN A 1 105 ? -1.615  11.116  17.864 1.00 20.04 ? 105 ASN A CB   1 
ATOM   791  C  CG   . ASN A 1 105 ? -2.550  10.731  16.721 1.00 23.73 ? 105 ASN A CG   1 
ATOM   792  O  OD1  . ASN A 1 105 ? -3.509  11.420  16.374 1.00 24.47 ? 105 ASN A OD1  1 
ATOM   793  N  ND2  . ASN A 1 105 ? -2.282  9.629   16.165 1.00 16.46 ? 105 ASN A ND2  1 
ATOM   794  N  N    . LEU A 1 106 ? 0.130   12.895  19.832 1.00 19.54 ? 106 LEU A N    1 
ATOM   795  C  CA   . LEU A 1 106 ? 0.811   13.077  21.124 1.00 19.73 ? 106 LEU A CA   1 
ATOM   796  C  C    . LEU A 1 106 ? 0.517   14.467  21.710 1.00 20.51 ? 106 LEU A C    1 
ATOM   797  O  O    . LEU A 1 106 ? 0.688   14.672  22.942 1.00 21.93 ? 106 LEU A O    1 
ATOM   798  C  CB   . LEU A 1 106 ? 2.341   13.028  20.962 1.00 19.35 ? 106 LEU A CB   1 
ATOM   799  C  CG   . LEU A 1 106 ? 2.928   11.640  20.622 1.00 18.87 ? 106 LEU A CG   1 
ATOM   800  C  CD1  . LEU A 1 106 ? 4.249   11.813  19.862 1.00 18.65 ? 106 LEU A CD1  1 
ATOM   801  C  CD2  . LEU A 1 106 ? 3.034   10.815  21.961 1.00 15.09 ? 106 LEU A CD2  1 
ATOM   802  N  N    . GLN A 1 107 ? 0.204   15.435  20.857 1.00 20.30 ? 107 GLN A N    1 
ATOM   803  C  CA   . GLN A 1 107 ? 0.130   16.826  21.293 1.00 21.97 ? 107 GLN A CA   1 
ATOM   804  C  C    . GLN A 1 107 ? 1.492   17.304  21.817 1.00 22.63 ? 107 GLN A C    1 
ATOM   805  O  O    . GLN A 1 107 ? 1.586   17.858  22.912 1.00 24.67 ? 107 GLN A O    1 
ATOM   806  C  CB   . GLN A 1 107 ? -0.941  16.996  22.371 1.00 22.49 ? 107 GLN A CB   1 
ATOM   807  C  CG   . GLN A 1 107 ? -2.362  16.805  21.869 1.00 28.35 ? 107 GLN A CG   1 
ATOM   808  C  CD   . GLN A 1 107 ? -3.402  17.190  22.903 1.00 36.40 ? 107 GLN A CD   1 
ATOM   809  O  OE1  . GLN A 1 107 ? -4.362  16.456  23.139 1.00 38.55 ? 107 GLN A OE1  1 
ATOM   810  N  NE2  . GLN A 1 107 ? -3.216  18.348  23.527 1.00 35.44 ? 107 GLN A NE2  1 
ATOM   811  N  N    . LEU A 1 108 ? 2.539   17.081  21.025 1.00 23.14 ? 108 LEU A N    1 
ATOM   812  C  CA   . LEU A 1 108 ? 3.913   17.455  21.387 1.00 23.86 ? 108 LEU A CA   1 
ATOM   813  C  C    . LEU A 1 108 ? 4.465   18.088  20.137 1.00 22.92 ? 108 LEU A C    1 
ATOM   814  O  O    . LEU A 1 108 ? 3.995   17.773  19.080 1.00 22.05 ? 108 LEU A O    1 
ATOM   815  C  CB   . LEU A 1 108 ? 4.767   16.187  21.697 1.00 22.78 ? 108 LEU A CB   1 
ATOM   816  C  CG   . LEU A 1 108 ? 4.516   15.472  23.012 1.00 23.91 ? 108 LEU A CG   1 
ATOM   817  C  CD1  . LEU A 1 108 ? 5.392   14.226  23.167 1.00 22.49 ? 108 LEU A CD1  1 
ATOM   818  C  CD2  . LEU A 1 108 ? 4.784   16.463  24.153 1.00 23.45 ? 108 LEU A CD2  1 
ATOM   819  N  N    . ASP A 1 109 ? 5.448   18.981  20.251 1.00 24.43 ? 109 ASP A N    1 
ATOM   820  C  CA   . ASP A 1 109 ? 6.009   19.610  19.042 1.00 23.61 ? 109 ASP A CA   1 
ATOM   821  C  C    . ASP A 1 109 ? 7.173   18.828  18.436 1.00 23.56 ? 109 ASP A C    1 
ATOM   822  O  O    . ASP A 1 109 ? 7.505   19.047  17.273 1.00 24.30 ? 109 ASP A O    1 
ATOM   823  C  CB   . ASP A 1 109 ? 6.440   21.060  19.276 1.00 24.52 ? 109 ASP A CB   1 
ATOM   824  C  CG   . ASP A 1 109 ? 5.365   21.907  19.948 1.00 28.45 ? 109 ASP A CG   1 
ATOM   825  O  OD1  . ASP A 1 109 ? 4.177   21.788  19.572 1.00 29.58 ? 109 ASP A OD1  1 
ATOM   826  O  OD2  . ASP A 1 109 ? 5.725   22.708  20.851 1.00 37.16 ? 109 ASP A OD2  1 
ATOM   827  N  N    . TYR A 1 110 ? 7.763   17.904  19.189 1.00 22.50 ? 110 TYR A N    1 
ATOM   828  C  CA   . TYR A 1 110 ? 8.859   17.094  18.654 1.00 21.91 ? 110 TYR A CA   1 
ATOM   829  C  C    . TYR A 1 110 ? 9.137   15.829  19.466 1.00 19.88 ? 110 TYR A C    1 
ATOM   830  O  O    . TYR A 1 110 ? 8.913   15.796  20.676 1.00 21.15 ? 110 TYR A O    1 
ATOM   831  C  CB   . TYR A 1 110 ? 10.136  17.933  18.545 1.00 22.53 ? 110 TYR A CB   1 
ATOM   832  C  CG   . TYR A 1 110 ? 10.773  18.254  19.878 1.00 26.31 ? 110 TYR A CG   1 
ATOM   833  C  CD1  . TYR A 1 110 ? 11.566  17.320  20.533 1.00 26.48 ? 110 TYR A CD1  1 
ATOM   834  C  CD2  . TYR A 1 110 ? 10.582  19.489  20.482 1.00 26.68 ? 110 TYR A CD2  1 
ATOM   835  C  CE1  . TYR A 1 110 ? 12.150  17.609  21.751 1.00 28.88 ? 110 TYR A CE1  1 
ATOM   836  C  CE2  . TYR A 1 110 ? 11.162  19.787  21.700 1.00 27.61 ? 110 TYR A CE2  1 
ATOM   837  C  CZ   . TYR A 1 110 ? 11.945  18.843  22.330 1.00 30.44 ? 110 TYR A CZ   1 
ATOM   838  O  OH   . TYR A 1 110 ? 12.525  19.135  23.543 1.00 34.68 ? 110 TYR A OH   1 
ATOM   839  N  N    . VAL A 1 111 ? 9.631   14.791  18.793 1.00 17.43 ? 111 VAL A N    1 
ATOM   840  C  CA   . VAL A 1 111 ? 10.005  13.557  19.463 1.00 18.53 ? 111 VAL A CA   1 
ATOM   841  C  C    . VAL A 1 111 ? 11.490  13.574  19.691 1.00 18.88 ? 111 VAL A C    1 
ATOM   842  O  O    . VAL A 1 111 ? 12.208  14.156  18.943 1.00 20.73 ? 111 VAL A O    1 
ATOM   843  C  CB   . VAL A 1 111 ? 9.675   12.247  18.634 1.00 16.91 ? 111 VAL A CB   1 
ATOM   844  C  CG1  . VAL A 1 111 ? 8.232   12.041  18.389 1.00 15.87 ? 111 VAL A CG1  1 
ATOM   845  C  CG2  . VAL A 1 111 ? 10.421  12.164  17.392 1.00 18.47 ? 111 VAL A CG2  1 
ATOM   846  N  N    . ASP A 1 112 ? 11.945  12.910  20.712 1.00 19.27 ? 112 ASP A N    1 
ATOM   847  C  CA   . ASP A 1 112 ? 13.355  12.852  20.912 1.00 18.97 ? 112 ASP A CA   1 
ATOM   848  C  C    . ASP A 1 112 ? 14.053  11.929  19.922 1.00 19.50 ? 112 ASP A C    1 
ATOM   849  O  O    . ASP A 1 112 ? 15.167  12.167  19.567 1.00 18.86 ? 112 ASP A O    1 
ATOM   850  C  CB   . ASP A 1 112 ? 13.673  12.528  22.363 1.00 19.46 ? 112 ASP A CB   1 
ATOM   851  C  CG   . ASP A 1 112 ? 13.183  13.569  23.291 1.00 19.83 ? 112 ASP A CG   1 
ATOM   852  O  OD1  . ASP A 1 112 ? 12.071  13.478  23.759 1.00 18.23 ? 112 ASP A OD1  1 
ATOM   853  O  OD2  . ASP A 1 112 ? 13.937  14.479  23.532 1.00 25.30 ? 112 ASP A OD2  1 
ATOM   854  N  N    . LEU A 1 113 ? 13.337  10.933  19.425 1.00 17.59 ? 113 LEU A N    1 
ATOM   855  C  CA   . LEU A 1 113 ? 13.947  9.880   18.595 1.00 18.70 ? 113 LEU A CA   1 
ATOM   856  C  C    . LEU A 1 113 ? 12.894  9.340   17.629 1.00 17.82 ? 113 LEU A C    1 
ATOM   857  O  O    . LEU A 1 113 ? 11.782  9.061   18.044 1.00 18.07 ? 113 LEU A O    1 
ATOM   858  C  CB   . LEU A 1 113 ? 14.446  8.713   19.469 1.00 17.33 ? 113 LEU A CB   1 
ATOM   859  C  CG   . LEU A 1 113 ? 15.152  7.501   18.797 1.00 18.98 ? 113 LEU A CG   1 
ATOM   860  C  CD1  . LEU A 1 113 ? 16.314  7.888   17.853 1.00 15.79 ? 113 LEU A CD1  1 
ATOM   861  C  CD2  . LEU A 1 113 ? 15.759  6.524   19.909 1.00 20.17 ? 113 LEU A CD2  1 
ATOM   862  N  N    . TYR A 1 114 ? 13.273  9.158   16.367 1.00 18.01 ? 114 TYR A N    1 
ATOM   863  C  CA   . TYR A 1 114 ? 12.363  8.627   15.383 1.00 18.57 ? 114 TYR A CA   1 
ATOM   864  C  C    . TYR A 1 114 ? 13.064  7.557   14.625 1.00 17.33 ? 114 TYR A C    1 
ATOM   865  O  O    . TYR A 1 114 ? 14.155  7.817   14.106 1.00 18.45 ? 114 TYR A O    1 
ATOM   866  C  CB   . TYR A 1 114 ? 11.936  9.693   14.391 1.00 19.49 ? 114 TYR A CB   1 
ATOM   867  C  CG   . TYR A 1 114 ? 10.649  9.375   13.655 1.00 19.20 ? 114 TYR A CG   1 
ATOM   868  C  CD1  . TYR A 1 114 ? 9.496   8.988   14.351 1.00 20.45 ? 114 TYR A CD1  1 
ATOM   869  C  CD2  . TYR A 1 114 ? 10.556  9.549   12.273 1.00 17.56 ? 114 TYR A CD2  1 
ATOM   870  C  CE1  . TYR A 1 114 ? 8.287   8.737   13.683 1.00 18.78 ? 114 TYR A CE1  1 
ATOM   871  C  CE2  . TYR A 1 114 ? 9.311   9.305   11.587 1.00 20.73 ? 114 TYR A CE2  1 
ATOM   872  C  CZ   . TYR A 1 114 ? 8.205   8.899   12.300 1.00 16.63 ? 114 TYR A CZ   1 
ATOM   873  O  OH   . TYR A 1 114 ? 6.935   8.662   11.697 1.00 21.99 ? 114 TYR A OH   1 
ATOM   874  N  N    . LEU A 1 115 ? 12.446  6.367   14.599 1.00 16.57 ? 115 LEU A N    1 
ATOM   875  C  CA   . LEU A 1 115 ? 12.999  5.168   13.989 1.00 17.98 ? 115 LEU A CA   1 
ATOM   876  C  C    . LEU A 1 115 ? 12.190  4.652   12.848 1.00 17.38 ? 115 LEU A C    1 
ATOM   877  O  O    . LEU A 1 115 ? 10.918  4.696   12.827 1.00 18.92 ? 115 LEU A O    1 
ATOM   878  C  CB   . LEU A 1 115 ? 13.104  4.014   14.990 1.00 16.66 ? 115 LEU A CB   1 
ATOM   879  C  CG   . LEU A 1 115 ? 13.608  4.293   16.401 1.00 17.98 ? 115 LEU A CG   1 
ATOM   880  C  CD1  . LEU A 1 115 ? 13.521  3.000   17.269 1.00 17.20 ? 115 LEU A CD1  1 
ATOM   881  C  CD2  . LEU A 1 115 ? 15.077  4.827   16.352 1.00 15.14 ? 115 LEU A CD2  1 
ATOM   882  N  N    . ILE A 1 116 ? 12.930  4.148   11.874 1.00 18.32 ? 116 ILE A N    1 
ATOM   883  C  CA   . ILE A 1 116 ? 12.336  3.302   10.838 1.00 19.60 ? 116 ILE A CA   1 
ATOM   884  C  C    . ILE A 1 116 ? 12.035  2.003   11.556 1.00 18.75 ? 116 ILE A C    1 
ATOM   885  O  O    . ILE A 1 116 ? 12.954  1.389   12.081 1.00 17.27 ? 116 ILE A O    1 
ATOM   886  C  CB   . ILE A 1 116 ? 13.299  3.027   9.690  1.00 19.81 ? 116 ILE A CB   1 
ATOM   887  C  CG1  . ILE A 1 116 ? 13.515  4.305   8.874  1.00 22.53 ? 116 ILE A CG1  1 
ATOM   888  C  CG2  . ILE A 1 116 ? 12.691  1.897   8.820  1.00 21.72 ? 116 ILE A CG2  1 
ATOM   889  C  CD1  . ILE A 1 116 ? 14.512  4.161   7.674  1.00 20.14 ? 116 ILE A CD1  1 
ATOM   890  N  N    . HIS A 1 117 ? 10.750  1.631   11.612 1.00 18.18 ? 117 HIS A N    1 
ATOM   891  C  CA   . HIS A 1 117 ? 10.302  0.606   12.536 1.00 18.75 ? 117 HIS A CA   1 
ATOM   892  C  C    . HIS A 1 117 ? 10.685  -0.822  12.095 1.00 19.73 ? 117 HIS A C    1 
ATOM   893  O  O    . HIS A 1 117 ? 11.067  -1.655  12.936 1.00 20.16 ? 117 HIS A O    1 
ATOM   894  C  CB   . HIS A 1 117 ? 8.795   0.753   12.725 1.00 17.56 ? 117 HIS A CB   1 
ATOM   895  C  CG   . HIS A 1 117 ? 8.245   -0.008  13.896 1.00 20.80 ? 117 HIS A CG   1 
ATOM   896  N  ND1  . HIS A 1 117 ? 7.126   0.408   14.584 1.00 18.91 ? 117 HIS A ND1  1 
ATOM   897  C  CD2  . HIS A 1 117 ? 8.662   -1.157  14.494 1.00 17.52 ? 117 HIS A CD2  1 
ATOM   898  C  CE1  . HIS A 1 117 ? 6.860   -0.471  15.538 1.00 22.28 ? 117 HIS A CE1  1 
ATOM   899  N  NE2  . HIS A 1 117 ? 7.803   -1.408  15.531 1.00 18.62 ? 117 HIS A NE2  1 
ATOM   900  N  N    . PHE A 1 118 ? 10.688  -1.055  10.784 1.00 19.51 ? 118 PHE A N    1 
ATOM   901  C  CA   . PHE A 1 118 ? 10.942  -2.395  10.214 1.00 20.12 ? 118 PHE A CA   1 
ATOM   902  C  C    . PHE A 1 118 ? 11.298  -2.231  8.737  1.00 20.33 ? 118 PHE A C    1 
ATOM   903  O  O    . PHE A 1 118 ? 10.697  -1.415  8.031  1.00 19.19 ? 118 PHE A O    1 
ATOM   904  C  CB   . PHE A 1 118 ? 9.748   -3.319  10.420 1.00 19.21 ? 118 PHE A CB   1 
ATOM   905  C  CG   . PHE A 1 118 ? 10.041  -4.786  10.163 1.00 22.11 ? 118 PHE A CG   1 
ATOM   906  C  CD1  . PHE A 1 118 ? 10.679  -5.559  11.115 1.00 18.80 ? 118 PHE A CD1  1 
ATOM   907  C  CD2  . PHE A 1 118 ? 9.622   -5.400  8.950  1.00 22.33 ? 118 PHE A CD2  1 
ATOM   908  C  CE1  . PHE A 1 118 ? 10.932  -6.901  10.900 1.00 19.37 ? 118 PHE A CE1  1 
ATOM   909  C  CE2  . PHE A 1 118 ? 9.898   -6.749  8.706  1.00 24.47 ? 118 PHE A CE2  1 
ATOM   910  C  CZ   . PHE A 1 118 ? 10.540  -7.522  9.681  1.00 21.67 ? 118 PHE A CZ   1 
ATOM   911  N  N    . PRO A 1 119 ? 12.302  -2.976  8.273  1.00 20.58 ? 119 PRO A N    1 
ATOM   912  C  CA   . PRO A 1 119 ? 12.794  -2.599  6.952  1.00 21.72 ? 119 PRO A CA   1 
ATOM   913  C  C    . PRO A 1 119 ? 11.940  -3.055  5.761  1.00 22.99 ? 119 PRO A C    1 
ATOM   914  O  O    . PRO A 1 119 ? 12.256  -2.693  4.620  1.00 24.45 ? 119 PRO A O    1 
ATOM   915  C  CB   . PRO A 1 119 ? 14.155  -3.253  6.902  1.00 20.15 ? 119 PRO A CB   1 
ATOM   916  C  CG   . PRO A 1 119 ? 14.000  -4.506  7.815  1.00 21.37 ? 119 PRO A CG   1 
ATOM   917  C  CD   . PRO A 1 119 ? 13.241  -3.893  8.973  1.00 20.85 ? 119 PRO A CD   1 
ATOM   918  N  N    . VAL A 1 120 ? 10.890  -3.831  6.004  1.00 24.34 ? 120 VAL A N    1 
ATOM   919  C  CA   . VAL A 1 120 ? 9.990   -4.268  4.931  1.00 24.00 ? 120 VAL A CA   1 
ATOM   920  C  C    . VAL A 1 120 ? 8.794   -3.283  4.786  1.00 24.84 ? 120 VAL A C    1 
ATOM   921  O  O    . VAL A 1 120 ? 8.102   -3.043  5.767  1.00 25.81 ? 120 VAL A O    1 
ATOM   922  C  CB   . VAL A 1 120 ? 9.486   -5.749  5.189  1.00 22.56 ? 120 VAL A CB   1 
ATOM   923  C  CG1  . VAL A 1 120 ? 8.498   -6.177  4.113  1.00 21.13 ? 120 VAL A CG1  1 
ATOM   924  C  CG2  . VAL A 1 120 ? 10.624  -6.721  5.243  1.00 26.07 ? 120 VAL A CG2  1 
ATOM   925  N  N    . SER A 1 121 ? 8.541   -2.734  3.581  1.00 25.02 ? 121 SER A N    1 
ATOM   926  C  CA   A SER A 1 121 ? 7.462   -1.745  3.391  0.50 24.45 ? 121 SER A CA   1 
ATOM   927  C  CA   B SER A 1 121 ? 7.480   -1.742  3.362  0.50 24.81 ? 121 SER A CA   1 
ATOM   928  C  C    . SER A 1 121 ? 6.163   -2.411  3.029  1.00 25.23 ? 121 SER A C    1 
ATOM   929  O  O    . SER A 1 121 ? 6.162   -3.542  2.498  1.00 25.51 ? 121 SER A O    1 
ATOM   930  C  CB   A SER A 1 121 ? 7.788   -0.750  2.278  0.50 24.41 ? 121 SER A CB   1 
ATOM   931  C  CB   B SER A 1 121 ? 7.867   -0.777  2.230  0.50 24.84 ? 121 SER A CB   1 
ATOM   932  O  OG   A SER A 1 121 ? 9.158   -0.443  2.233  0.50 21.70 ? 121 SER A OG   1 
ATOM   933  O  OG   B SER A 1 121 ? 7.902   -1.420  0.955  0.50 24.16 ? 121 SER A OG   1 
ATOM   934  N  N    . VAL A 1 122 ? 5.056   -1.746  3.319  1.00 24.62 ? 122 VAL A N    1 
ATOM   935  C  CA   . VAL A 1 122 ? 3.752   -2.255  2.924  1.00 24.57 ? 122 VAL A CA   1 
ATOM   936  C  C    . VAL A 1 122 ? 2.948   -1.177  2.212  1.00 25.21 ? 122 VAL A C    1 
ATOM   937  O  O    . VAL A 1 122 ? 3.327   -0.004  2.198  1.00 26.13 ? 122 VAL A O    1 
ATOM   938  C  CB   . VAL A 1 122 ? 2.950   -2.805  4.116  1.00 22.47 ? 122 VAL A CB   1 
ATOM   939  C  CG1  . VAL A 1 122 ? 3.624   -4.047  4.690  1.00 19.54 ? 122 VAL A CG1  1 
ATOM   940  C  CG2  . VAL A 1 122 ? 2.758   -1.728  5.175  1.00 22.64 ? 122 VAL A CG2  1 
ATOM   941  N  N    . LYS A 1 123 ? 1.836   -1.585  1.622  1.00 25.09 ? 123 LYS A N    1 
ATOM   942  C  CA   . LYS A 1 123 ? 1.020   -0.671  0.785  1.00 24.56 ? 123 LYS A CA   1 
ATOM   943  C  C    . LYS A 1 123 ? 0.602   0.532   1.596  1.00 24.38 ? 123 LYS A C    1 
ATOM   944  O  O    . LYS A 1 123 ? 0.088   0.380   2.711  1.00 24.35 ? 123 LYS A O    1 
ATOM   945  C  CB   . LYS A 1 123 ? -0.250  -1.394  0.304  1.00 25.24 ? 123 LYS A CB   1 
ATOM   946  C  CG   . LYS A 1 123 ? -1.116  -0.597  -0.658 1.00 25.79 ? 123 LYS A CG   1 
ATOM   947  C  CD   . LYS A 1 123 ? -2.138  -1.486  -1.375 1.00 27.20 ? 123 LYS A CD   1 
ATOM   948  C  CE   . LYS A 1 123 ? -3.302  -0.669  -1.937 1.00 30.91 ? 123 LYS A CE   1 
ATOM   949  N  NZ   . LYS A 1 123 ? -4.552  -1.556  -2.306 1.00 32.46 ? 123 LYS A NZ   1 
ATOM   950  N  N    . PRO A 1 124 ? 0.763   1.734   1.028  1.00 24.23 ? 124 PRO A N    1 
ATOM   951  C  CA   . PRO A 1 124 ? 0.327   2.935   1.742  1.00 24.32 ? 124 PRO A CA   1 
ATOM   952  C  C    . PRO A 1 124 ? -1.178  2.937   1.961  1.00 24.40 ? 124 PRO A C    1 
ATOM   953  O  O    . PRO A 1 124 ? -1.927  2.325   1.167  1.00 24.59 ? 124 PRO A O    1 
ATOM   954  C  CB   . PRO A 1 124 ? 0.743   4.070   0.805  1.00 23.07 ? 124 PRO A CB   1 
ATOM   955  C  CG   . PRO A 1 124 ? 1.767   3.495   -0.066 1.00 24.11 ? 124 PRO A CG   1 
ATOM   956  C  CD   . PRO A 1 124 ? 1.530   2.050   -0.191 1.00 23.85 ? 124 PRO A CD   1 
ATOM   957  N  N    . GLY A 1 125 ? -1.620  3.565   3.061  1.00 25.11 ? 125 GLY A N    1 
ATOM   958  C  CA   . GLY A 1 125 ? -3.031  3.608   3.477  1.00 24.98 ? 125 GLY A CA   1 
ATOM   959  C  C    . GLY A 1 125 ? -3.141  3.534   4.990  1.00 26.78 ? 125 GLY A C    1 
ATOM   960  O  O    . GLY A 1 125 ? -2.119  3.489   5.695  1.00 24.58 ? 125 GLY A O    1 
ATOM   961  N  N    . GLU A 1 126 ? -4.374  3.558   5.492  1.00 27.07 ? 126 GLU A N    1 
ATOM   962  C  CA   . GLU A 1 126 ? -4.662  3.511   6.946  1.00 29.21 ? 126 GLU A CA   1 
ATOM   963  C  C    . GLU A 1 126 ? -4.386  2.163   7.598  1.00 29.29 ? 126 GLU A C    1 
ATOM   964  O  O    . GLU A 1 126 ? -3.954  2.062   8.772  1.00 30.50 ? 126 GLU A O    1 
ATOM   965  C  CB   . GLU A 1 126 ? -6.108  3.906   7.187  1.00 30.46 ? 126 GLU A CB   1 
ATOM   966  C  CG   . GLU A 1 126 ? -6.377  5.373   6.903  1.00 34.25 ? 126 GLU A CG   1 
ATOM   967  C  CD   . GLU A 1 126 ? -5.665  6.266   7.892  1.00 38.74 ? 126 GLU A CD   1 
ATOM   968  O  OE1  . GLU A 1 126 ? -6.118  6.325   9.056  1.00 39.71 ? 126 GLU A OE1  1 
ATOM   969  O  OE2  . GLU A 1 126 ? -4.670  6.909   7.493  1.00 39.19 ? 126 GLU A OE2  1 
ATOM   970  N  N    . GLU A 1 127 ? -4.570  1.108   6.839  1.00 27.96 ? 127 GLU A N    1 
ATOM   971  C  CA   . GLU A 1 127 ? -4.333  -0.184  7.432  1.00 27.43 ? 127 GLU A CA   1 
ATOM   972  C  C    . GLU A 1 127 ? -2.824  -0.472  7.663  1.00 27.11 ? 127 GLU A C    1 
ATOM   973  O  O    . GLU A 1 127 ? -1.970  -0.365  6.765  1.00 27.62 ? 127 GLU A O    1 
ATOM   974  C  CB   . GLU A 1 127 ? -5.032  -1.277  6.659  1.00 26.59 ? 127 GLU A CB   1 
ATOM   975  C  CG   . GLU A 1 127 ? -4.634  -2.626  7.193  1.00 27.38 ? 127 GLU A CG   1 
ATOM   976  C  CD   . GLU A 1 127 ? -5.123  -2.926  8.572  0.60 26.75 ? 127 GLU A CD   1 
ATOM   977  O  OE1  . GLU A 1 127 ? -6.308  -2.561  8.884  0.60 25.21 ? 127 GLU A OE1  1 
ATOM   978  O  OE2  . GLU A 1 127 ? -4.312  -3.579  9.313  0.60 25.50 ? 127 GLU A OE2  1 
ATOM   979  N  N    . VAL A 1 128 ? -2.508  -0.776  8.908  1.00 27.51 ? 128 VAL A N    1 
ATOM   980  C  CA   . VAL A 1 128 ? -1.122  -1.087  9.307  1.00 27.41 ? 128 VAL A CA   1 
ATOM   981  C  C    . VAL A 1 128 ? -0.591  -2.383  8.665  1.00 27.49 ? 128 VAL A C    1 
ATOM   982  O  O    . VAL A 1 128 ? 0.622   -2.473  8.375  1.00 28.51 ? 128 VAL A O    1 
ATOM   983  C  CB   . VAL A 1 128 ? -0.920  -1.112  10.878 1.00 26.49 ? 128 VAL A CB   1 
ATOM   984  C  CG1  . VAL A 1 128 ? -1.025  0.305   11.451 1.00 25.88 ? 128 VAL A CG1  1 
ATOM   985  C  CG2  . VAL A 1 128 ? -1.899  -2.086  11.609 1.00 28.20 ? 128 VAL A CG2  1 
ATOM   986  N  N    . ILE A 1 129 ? -1.457  -3.357  8.425  1.00 26.98 ? 129 ILE A N    1 
ATOM   987  C  CA   . ILE A 1 129 ? -1.047  -4.566  7.722  1.00 26.23 ? 129 ILE A CA   1 
ATOM   988  C  C    . ILE A 1 129 ? -2.058  -4.840  6.626  1.00 27.12 ? 129 ILE A C    1 
ATOM   989  O  O    . ILE A 1 129 ? -3.025  -5.572  6.841  1.00 26.64 ? 129 ILE A O    1 
ATOM   990  C  CB   . ILE A 1 129 ? -0.976  -5.777  8.667  1.00 26.03 ? 129 ILE A CB   1 
ATOM   991  C  CG1  . ILE A 1 129 ? 0.027   -5.516  9.793  1.00 26.87 ? 129 ILE A CG1  1 
ATOM   992  C  CG2  . ILE A 1 129 ? -0.603  -7.033  7.896  1.00 25.75 ? 129 ILE A CG2  1 
ATOM   993  C  CD1  . ILE A 1 129 ? 0.046   -6.594  10.855 1.00 26.72 ? 129 ILE A CD1  1 
ATOM   994  N  N    . PRO A 1 130 ? -1.859  -4.244  5.453  1.00 26.77 ? 130 PRO A N    1 
ATOM   995  C  CA   . PRO A 1 130 ? -2.918  -4.301  4.440  1.00 26.82 ? 130 PRO A CA   1 
ATOM   996  C  C    . PRO A 1 130 ? -2.885  -5.659  3.760  1.00 26.64 ? 130 PRO A C    1 
ATOM   997  O  O    . PRO A 1 130 ? -1.797  -6.148  3.441  1.00 26.48 ? 130 PRO A O    1 
ATOM   998  C  CB   . PRO A 1 130 ? -2.538  -3.211  3.458  1.00 25.74 ? 130 PRO A CB   1 
ATOM   999  C  CG   . PRO A 1 130 ? -1.153  -2.983  3.636  1.00 28.08 ? 130 PRO A CG   1 
ATOM   1000 C  CD   . PRO A 1 130 ? -0.735  -3.427  5.002  1.00 28.40 ? 130 PRO A CD   1 
ATOM   1001 N  N    . LYS A 1 131 ? -4.067  -6.253  3.586  1.00 27.22 ? 131 LYS A N    1 
ATOM   1002 C  CA   . LYS A 1 131 ? -4.202  -7.544  2.928  1.00 25.95 ? 131 LYS A CA   1 
ATOM   1003 C  C    . LYS A 1 131 ? -5.134  -7.508  1.702  1.00 25.93 ? 131 LYS A C    1 
ATOM   1004 O  O    . LYS A 1 131 ? -6.067  -6.694  1.642  1.00 25.97 ? 131 LYS A O    1 
ATOM   1005 C  CB   . LYS A 1 131 ? -4.651  -8.585  3.946  1.00 26.75 ? 131 LYS A CB   1 
ATOM   1006 C  CG   . LYS A 1 131 ? -3.528  -8.934  4.947  1.00 27.17 ? 131 LYS A CG   1 
ATOM   1007 C  CD   . LYS A 1 131 ? -4.108  -9.788  6.097  1.00 27.99 ? 131 LYS A CD   1 
ATOM   1008 C  CE   . LYS A 1 131 ? -3.112  -9.911  7.269  1.00 31.54 ? 131 LYS A CE   1 
ATOM   1009 N  NZ   . LYS A 1 131 ? -3.603  -10.953 8.288  1.00 33.05 ? 131 LYS A NZ   1 
ATOM   1010 N  N    . ASP A 1 132 ? -4.833  -8.341  0.702  1.00 25.85 ? 132 ASP A N    1 
ATOM   1011 C  CA   . ASP A 1 132 ? -5.767  -8.521  -0.436 1.00 25.57 ? 132 ASP A CA   1 
ATOM   1012 C  C    . ASP A 1 132 ? -7.050  -9.271  0.055  1.00 25.47 ? 132 ASP A C    1 
ATOM   1013 O  O    . ASP A 1 132 ? -7.166  -9.607  1.262  1.00 25.44 ? 132 ASP A O    1 
ATOM   1014 C  CB   . ASP A 1 132 ? -5.046  -9.140  -1.672 1.00 23.80 ? 132 ASP A CB   1 
ATOM   1015 C  CG   . ASP A 1 132 ? -4.744  -10.629 -1.533 1.00 24.35 ? 132 ASP A CG   1 
ATOM   1016 O  OD1  . ASP A 1 132 ? -5.222  -11.308 -0.595 1.00 20.85 ? 132 ASP A OD1  1 
ATOM   1017 O  OD2  . ASP A 1 132 ? -4.043  -11.135 -2.431 1.00 27.02 ? 132 ASP A OD2  1 
ATOM   1018 N  N    . GLU A 1 133 ? -8.011  -9.480  -0.847 1.00 25.03 ? 133 GLU A N    1 
ATOM   1019 C  CA   . GLU A 1 133 ? -9.282  -10.102 -0.496 1.00 24.64 ? 133 GLU A CA   1 
ATOM   1020 C  C    . GLU A 1 133 ? -9.124  -11.570 -0.112 1.00 25.20 ? 133 GLU A C    1 
ATOM   1021 O  O    . GLU A 1 133 ? -10.095 -12.180 0.298  1.00 25.84 ? 133 GLU A O    1 
ATOM   1022 C  CB   . GLU A 1 133 ? -10.274 -10.034 -1.689 1.00 24.43 ? 133 GLU A CB   1 
ATOM   1023 C  CG   . GLU A 1 133 ? -9.787  -10.800 -2.913 1.00 21.22 ? 133 GLU A CG   1 
ATOM   1024 C  CD   . GLU A 1 133 ? -10.809 -10.766 -4.081 1.00 23.28 ? 133 GLU A CD   1 
ATOM   1025 O  OE1  . GLU A 1 133 ? -11.867 -10.126 -3.946 1.00 25.46 ? 133 GLU A OE1  1 
ATOM   1026 O  OE2  . GLU A 1 133 ? -10.552 -11.400 -5.119 1.00 25.21 ? 133 GLU A OE2  1 
ATOM   1027 N  N    . ASN A 1 134 ? -7.945  -12.148 -0.266 1.00 26.25 ? 134 ASN A N    1 
ATOM   1028 C  CA   . ASN A 1 134 ? -7.721  -13.516 0.171  1.00 27.56 ? 134 ASN A CA   1 
ATOM   1029 C  C    . ASN A 1 134 ? -6.877  -13.545 1.489  1.00 28.84 ? 134 ASN A C    1 
ATOM   1030 O  O    . ASN A 1 134 ? -6.461  -14.616 1.957  1.00 28.96 ? 134 ASN A O    1 
ATOM   1031 C  CB   . ASN A 1 134 ? -7.020  -14.332 -0.962 1.00 27.62 ? 134 ASN A CB   1 
ATOM   1032 C  CG   . ASN A 1 134 ? -7.754  -14.222 -2.342 1.00 28.13 ? 134 ASN A CG   1 
ATOM   1033 O  OD1  . ASN A 1 134 ? -8.930  -14.448 -2.414 1.00 24.47 ? 134 ASN A OD1  1 
ATOM   1034 N  ND2  . ASN A 1 134 ? -7.032  -13.848 -3.412 1.00 27.62 ? 134 ASN A ND2  1 
ATOM   1035 N  N    . GLY A 1 135 ? -6.582  -12.374 2.044  1.00 28.44 ? 135 GLY A N    1 
ATOM   1036 C  CA   . GLY A 1 135 ? -5.791  -12.285 3.286  1.00 28.10 ? 135 GLY A CA   1 
ATOM   1037 C  C    . GLY A 1 135 ? -4.290  -12.246 3.097  1.00 27.94 ? 135 GLY A C    1 
ATOM   1038 O  O    . GLY A 1 135 ? -3.510  -12.355 4.065  1.00 27.87 ? 135 GLY A O    1 
ATOM   1039 N  N    . LYS A 1 136 ? -3.866  -12.067 1.856  1.00 26.31 ? 136 LYS A N    1 
ATOM   1040 C  CA   . LYS A 1 136 ? -2.450  -12.050 1.539  1.00 25.75 ? 136 LYS A CA   1 
ATOM   1041 C  C    . LYS A 1 136 ? -1.938  -10.630 1.727  1.00 25.60 ? 136 LYS A C    1 
ATOM   1042 O  O    . LYS A 1 136 ? -2.623  -9.659  1.314  1.00 24.43 ? 136 LYS A O    1 
ATOM   1043 C  CB   . LYS A 1 136 ? -2.226  -12.538 0.106  1.00 26.33 ? 136 LYS A CB   1 
ATOM   1044 C  CG   . LYS A 1 136 ? -0.766  -12.663 -0.296 1.00 29.16 ? 136 LYS A CG   1 
ATOM   1045 C  CD   . LYS A 1 136 ? -0.586  -13.188 -1.697 1.00 33.58 ? 136 LYS A CD   1 
ATOM   1046 C  CE   . LYS A 1 136 ? 0.885   -13.223 -2.051 0.50 34.28 ? 136 LYS A CE   1 
ATOM   1047 N  NZ   . LYS A 1 136 ? 1.728   -13.718 -0.919 0.50 36.10 ? 136 LYS A NZ   1 
ATOM   1048 N  N    . ILE A 1 137 ? -0.769  -10.500 2.376  1.00 24.45 ? 137 ILE A N    1 
ATOM   1049 C  CA   . ILE A 1 137 ? -0.201  -9.186  2.637  1.00 23.61 ? 137 ILE A CA   1 
ATOM   1050 C  C    . ILE A 1 137 ? 0.270   -8.393  1.419  1.00 23.87 ? 137 ILE A C    1 
ATOM   1051 O  O    . ILE A 1 137 ? 1.042   -8.879  0.561  1.00 24.19 ? 137 ILE A O    1 
ATOM   1052 C  CB   . ILE A 1 137 ? 0.947   -9.205  3.707  1.00 22.49 ? 137 ILE A CB   1 
ATOM   1053 C  CG1  . ILE A 1 137 ? 0.405   -9.685  5.056  1.00 22.82 ? 137 ILE A CG1  1 
ATOM   1054 C  CG2  . ILE A 1 137 ? 1.459   -7.823  3.891  1.00 21.07 ? 137 ILE A CG2  1 
ATOM   1055 C  CD1  . ILE A 1 137 ? 1.547   -10.032 6.088  1.00 18.77 ? 137 ILE A CD1  1 
ATOM   1056 N  N    . LEU A 1 138 ? -0.154  -7.125  1.380  1.00 24.09 ? 138 LEU A N    1 
ATOM   1057 C  CA   . LEU A 1 138 ? 0.241   -6.282  0.260  1.00 24.71 ? 138 LEU A CA   1 
ATOM   1058 C  C    . LEU A 1 138 ? 1.523   -5.509  0.571  1.00 24.55 ? 138 LEU A C    1 
ATOM   1059 O  O    . LEU A 1 138 ? 1.472   -4.399  1.133  1.00 25.48 ? 138 LEU A O    1 
ATOM   1060 C  CB   . LEU A 1 138 ? -0.899  -5.347  -0.182 1.00 23.71 ? 138 LEU A CB   1 
ATOM   1061 C  CG   . LEU A 1 138 ? -2.115  -6.002  -0.817 1.00 26.02 ? 138 LEU A CG   1 
ATOM   1062 C  CD1  . LEU A 1 138 ? -3.307  -5.028  -0.839 1.00 27.27 ? 138 LEU A CD1  1 
ATOM   1063 C  CD2  . LEU A 1 138 ? -1.844  -6.501  -2.241 1.00 29.42 ? 138 LEU A CD2  1 
ATOM   1064 N  N    . PHE A 1 139 ? 2.645   -6.078  0.154  1.00 24.73 ? 139 PHE A N    1 
ATOM   1065 C  CA   . PHE A 1 139 ? 3.955   -5.431  0.332  1.00 27.19 ? 139 PHE A CA   1 
ATOM   1066 C  C    . PHE A 1 139 ? 4.211   -4.354  -0.711 1.00 26.65 ? 139 PHE A C    1 
ATOM   1067 O  O    . PHE A 1 139 ? 3.527   -4.305  -1.746 1.00 26.13 ? 139 PHE A O    1 
ATOM   1068 C  CB   . PHE A 1 139 ? 5.090   -6.439  0.289  1.00 26.90 ? 139 PHE A CB   1 
ATOM   1069 C  CG   . PHE A 1 139 ? 5.020   -7.452  1.399  1.00 30.22 ? 139 PHE A CG   1 
ATOM   1070 C  CD1  . PHE A 1 139 ? 5.255   -7.070  2.713  1.00 30.86 ? 139 PHE A CD1  1 
ATOM   1071 C  CD2  . PHE A 1 139 ? 4.658   -8.782  1.121  1.00 30.83 ? 139 PHE A CD2  1 
ATOM   1072 C  CE1  . PHE A 1 139 ? 5.174   -8.000  3.758  1.00 28.03 ? 139 PHE A CE1  1 
ATOM   1073 C  CE2  . PHE A 1 139 ? 4.580   -9.730  2.159  1.00 30.43 ? 139 PHE A CE2  1 
ATOM   1074 C  CZ   . PHE A 1 139 ? 4.838   -9.323  3.472  1.00 31.30 ? 139 PHE A CZ   1 
ATOM   1075 N  N    . ASP A 1 140 ? 5.188   -3.500  -0.414 1.00 26.09 ? 140 ASP A N    1 
ATOM   1076 C  CA   . ASP A 1 140 ? 5.492   -2.337  -1.235 1.00 26.25 ? 140 ASP A CA   1 
ATOM   1077 C  C    . ASP A 1 140 ? 6.964   -2.481  -1.528 1.00 26.92 ? 140 ASP A C    1 
ATOM   1078 O  O    . ASP A 1 140 ? 7.672   -3.222  -0.816 1.00 26.13 ? 140 ASP A O    1 
ATOM   1079 C  CB   . ASP A 1 140 ? 5.231   -1.026  -0.476 1.00 26.53 ? 140 ASP A CB   1 
ATOM   1080 C  CG   . ASP A 1 140 ? 5.103   0.154   -1.389 1.00 27.34 ? 140 ASP A CG   1 
ATOM   1081 O  OD1  . ASP A 1 140 ? 4.878   -0.080  -2.615 1.00 29.74 ? 140 ASP A OD1  1 
ATOM   1082 O  OD2  . ASP A 1 140 ? 5.178   1.329   -0.902 1.00 24.21 ? 140 ASP A OD2  1 
ATOM   1083 N  N    . THR A 1 141 ? 7.432   -1.773  -2.559 1.00 26.02 ? 141 THR A N    1 
ATOM   1084 C  CA   . THR A 1 141 ? 8.819   -1.779  -2.947 1.00 25.78 ? 141 THR A CA   1 
ATOM   1085 C  C    . THR A 1 141 ? 9.333   -0.328  -2.811 1.00 26.30 ? 141 THR A C    1 
ATOM   1086 O  O    . THR A 1 141 ? 8.958   0.558   -3.599 1.00 25.60 ? 141 THR A O    1 
ATOM   1087 C  CB   . THR A 1 141 ? 8.957   -2.256  -4.411 1.00 26.52 ? 141 THR A CB   1 
ATOM   1088 O  OG1  . THR A 1 141 ? 8.436   -3.602  -4.564 1.00 30.07 ? 141 THR A OG1  1 
ATOM   1089 C  CG2  . THR A 1 141 ? 10.394  -2.228  -4.825 1.00 25.96 ? 141 THR A CG2  1 
ATOM   1090 N  N    . VAL A 1 142 ? 10.147  -0.086  -1.790 1.00 26.18 ? 142 VAL A N    1 
ATOM   1091 C  CA   . VAL A 1 142 ? 10.681  1.263   -1.480 1.00 26.50 ? 142 VAL A CA   1 
ATOM   1092 C  C    . VAL A 1 142 ? 12.165  1.095   -1.198 1.00 27.41 ? 142 VAL A C    1 
ATOM   1093 O  O    . VAL A 1 142 ? 12.549  0.121   -0.523 1.00 26.93 ? 142 VAL A O    1 
ATOM   1094 C  CB   . VAL A 1 142 ? 9.987   1.905   -0.231 1.00 25.60 ? 142 VAL A CB   1 
ATOM   1095 C  CG1  . VAL A 1 142 ? 10.490  3.354   0.000  1.00 24.32 ? 142 VAL A CG1  1 
ATOM   1096 C  CG2  . VAL A 1 142 ? 8.528   1.901   -0.368 1.00 25.98 ? 142 VAL A CG2  1 
ATOM   1097 N  N    . ASP A 1 143 ? 12.984  2.015   -1.728 1.00 29.65 ? 143 ASP A N    1 
ATOM   1098 C  CA   . ASP A 1 143 ? 14.420  2.135   -1.425 1.00 31.89 ? 143 ASP A CA   1 
ATOM   1099 C  C    . ASP A 1 143 ? 14.561  2.669   0.001  1.00 31.58 ? 143 ASP A C    1 
ATOM   1100 O  O    . ASP A 1 143 ? 14.108  3.763   0.284  1.00 32.48 ? 143 ASP A O    1 
ATOM   1101 C  CB   . ASP A 1 143 ? 15.078  3.130   -2.418 1.00 32.69 ? 143 ASP A CB   1 
ATOM   1102 C  CG   . ASP A 1 143 ? 16.639  3.205   -2.317 1.00 35.93 ? 143 ASP A CG   1 
ATOM   1103 O  OD1  . ASP A 1 143 ? 17.314  2.440   -1.571 1.00 39.35 ? 143 ASP A OD1  1 
ATOM   1104 O  OD2  . ASP A 1 143 ? 17.230  4.057   -3.046 1.00 40.47 ? 143 ASP A OD2  1 
ATOM   1105 N  N    . LEU A 1 144 ? 15.142  1.886   0.895  1.00 31.47 ? 144 LEU A N    1 
ATOM   1106 C  CA   . LEU A 1 144 ? 15.318  2.314   2.299  1.00 31.59 ? 144 LEU A CA   1 
ATOM   1107 C  C    . LEU A 1 144 ? 16.257  3.535   2.444  1.00 31.68 ? 144 LEU A C    1 
ATOM   1108 O  O    . LEU A 1 144 ? 16.103  4.327   3.397  1.00 30.21 ? 144 LEU A O    1 
ATOM   1109 C  CB   . LEU A 1 144 ? 15.846  1.156   3.151  1.00 32.28 ? 144 LEU A CB   1 
ATOM   1110 C  CG   . LEU A 1 144 ? 14.764  0.193   3.665  1.00 33.79 ? 144 LEU A CG   1 
ATOM   1111 C  CD1  . LEU A 1 144 ? 15.414  -0.991  4.357  1.00 35.14 ? 144 LEU A CD1  1 
ATOM   1112 C  CD2  . LEU A 1 144 ? 13.669  0.862   4.528  1.00 34.78 ? 144 LEU A CD2  1 
ATOM   1113 N  N    . CYS A 1 145 ? 17.220  3.662   1.508  1.00 31.77 ? 145 CYS A N    1 
ATOM   1114 C  CA   . CYS A 1 145 ? 18.076  4.857   1.390  1.00 32.82 ? 145 CYS A CA   1 
ATOM   1115 C  C    . CYS A 1 145 ? 17.278  6.122   1.170  1.00 30.70 ? 145 CYS A C    1 
ATOM   1116 O  O    . CYS A 1 145 ? 17.624  7.133   1.732  1.00 30.52 ? 145 CYS A O    1 
ATOM   1117 C  CB   . CYS A 1 145 ? 19.142  4.716   0.300  1.00 31.50 ? 145 CYS A CB   1 
ATOM   1118 S  SG   . CYS A 1 145 ? 20.436  3.628   0.882  1.00 42.30 ? 145 CYS A SG   1 
ATOM   1119 N  N    . ALA A 1 146 ? 16.225  6.036   0.346  1.00 31.01 ? 146 ALA A N    1 
ATOM   1120 C  CA   . ALA A 1 146 ? 15.271  7.142   0.130  1.00 28.97 ? 146 ALA A CA   1 
ATOM   1121 C  C    . ALA A 1 146 ? 14.440  7.381   1.402  1.00 28.53 ? 146 ALA A C    1 
ATOM   1122 O  O    . ALA A 1 146 ? 14.231  8.550   1.828  1.00 27.22 ? 146 ALA A O    1 
ATOM   1123 C  CB   . ALA A 1 146 ? 14.367  6.860   -1.109 1.00 29.88 ? 146 ALA A CB   1 
ATOM   1124 N  N    . THR A 1 147 ? 13.996  6.290   2.047  1.00 26.71 ? 147 THR A N    1 
ATOM   1125 C  CA   . THR A 1 147 ? 13.293  6.467   3.311  1.00 24.81 ? 147 THR A CA   1 
ATOM   1126 C  C    . THR A 1 147 ? 14.175  7.219   4.306  1.00 25.39 ? 147 THR A C    1 
ATOM   1127 O  O    . THR A 1 147 ? 13.742  8.212   4.938  1.00 24.86 ? 147 THR A O    1 
ATOM   1128 C  CB   . THR A 1 147 ? 12.870  5.130   3.910  1.00 24.37 ? 147 THR A CB   1 
ATOM   1129 O  OG1  . THR A 1 147 ? 12.095  4.444   2.924  1.00 21.84 ? 147 THR A OG1  1 
ATOM   1130 C  CG2  . THR A 1 147 ? 12.017  5.352   5.190  1.00 22.90 ? 147 THR A CG2  1 
ATOM   1131 N  N    . TRP A 1 148 ? 15.425  6.786   4.411  1.00 25.13 ? 148 TRP A N    1 
ATOM   1132 C  CA   . TRP A 1 148 ? 16.356  7.398   5.347  1.00 25.32 ? 148 TRP A CA   1 
ATOM   1133 C  C    . TRP A 1 148 ? 16.593  8.893   5.061  1.00 26.26 ? 148 TRP A C    1 
ATOM   1134 O  O    . TRP A 1 148 ? 16.665  9.713   5.989  1.00 25.02 ? 148 TRP A O    1 
ATOM   1135 C  CB   . TRP A 1 148 ? 17.675  6.649   5.340  1.00 25.44 ? 148 TRP A CB   1 
ATOM   1136 C  CG   . TRP A 1 148 ? 18.576  7.169   6.401  1.00 24.20 ? 148 TRP A CG   1 
ATOM   1137 C  CD1  . TRP A 1 148 ? 19.696  7.867   6.220  1.00 22.13 ? 148 TRP A CD1  1 
ATOM   1138 C  CD2  . TRP A 1 148 ? 18.358  7.104   7.822  1.00 23.66 ? 148 TRP A CD2  1 
ATOM   1139 N  NE1  . TRP A 1 148 ? 20.261  8.198   7.423  1.00 21.52 ? 148 TRP A NE1  1 
ATOM   1140 C  CE2  . TRP A 1 148 ? 19.444  7.745   8.433  1.00 25.61 ? 148 TRP A CE2  1 
ATOM   1141 C  CE3  . TRP A 1 148 ? 17.359  6.543   8.628  1.00 23.43 ? 148 TRP A CE3  1 
ATOM   1142 C  CZ2  . TRP A 1 148 ? 19.577  7.849   9.832  1.00 19.33 ? 148 TRP A CZ2  1 
ATOM   1143 C  CZ3  . TRP A 1 148 ? 17.499  6.643   10.016 1.00 24.65 ? 148 TRP A CZ3  1 
ATOM   1144 C  CH2  . TRP A 1 148 ? 18.592  7.297   10.597 1.00 21.74 ? 148 TRP A CH2  1 
ATOM   1145 N  N    . GLU A 1 149 ? 16.696  9.257   3.779  1.00 26.85 ? 149 GLU A N    1 
ATOM   1146 C  CA   . GLU A 1 149 ? 16.955  10.665  3.471  1.00 27.29 ? 149 GLU A CA   1 
ATOM   1147 C  C    . GLU A 1 149 ? 15.760  11.522  3.892  1.00 28.17 ? 149 GLU A C    1 
ATOM   1148 O  O    . GLU A 1 149 ? 15.959  12.671  4.297  1.00 28.01 ? 149 GLU A O    1 
ATOM   1149 C  CB   . GLU A 1 149 ? 17.326  10.915  2.009  1.00 27.40 ? 149 GLU A CB   1 
ATOM   1150 C  CG   . GLU A 1 149 ? 18.315  9.862   1.369  1.00 32.68 ? 149 GLU A CG   1 
ATOM   1151 C  CD   . GLU A 1 149 ? 18.749  10.196  -0.080 1.00 37.24 ? 149 GLU A CD   1 
ATOM   1152 O  OE1  . GLU A 1 149 ? 18.212  11.159  -0.652 1.00 42.56 ? 149 GLU A OE1  1 
ATOM   1153 O  OE2  . GLU A 1 149 ? 19.630  9.507   -0.641 1.00 36.15 ? 149 GLU A OE2  1 
ATOM   1154 N  N    . ALA A 1 150 ? 14.527  10.981  3.815  1.00 27.20 ? 150 ALA A N    1 
ATOM   1155 C  CA   . ALA A 1 150 ? 13.355  11.728  4.327  1.00 25.88 ? 150 ALA A CA   1 
ATOM   1156 C  C    . ALA A 1 150 ? 13.344  11.783  5.852  1.00 25.49 ? 150 ALA A C    1 
ATOM   1157 O  O    . ALA A 1 150 ? 12.965  12.788  6.441  1.00 25.41 ? 150 ALA A O    1 
ATOM   1158 C  CB   . ALA A 1 150 ? 11.991  11.212  3.744  1.00 25.93 ? 150 ALA A CB   1 
ATOM   1159 N  N    . VAL A 1 151 ? 13.798  10.707  6.491  1.00 24.06 ? 151 VAL A N    1 
ATOM   1160 C  CA   . VAL A 1 151 ? 13.958  10.739  7.912  1.00 23.18 ? 151 VAL A CA   1 
ATOM   1161 C  C    . VAL A 1 151 ? 14.965  11.809  8.343  1.00 23.19 ? 151 VAL A C    1 
ATOM   1162 O  O    . VAL A 1 151 ? 14.731  12.508  9.307  1.00 23.14 ? 151 VAL A O    1 
ATOM   1163 C  CB   . VAL A 1 151 ? 14.310  9.330   8.454  1.00 23.69 ? 151 VAL A CB   1 
ATOM   1164 C  CG1  . VAL A 1 151 ? 14.506  9.368   9.957  1.00 21.83 ? 151 VAL A CG1  1 
ATOM   1165 C  CG2  . VAL A 1 151 ? 13.144  8.388   8.111  1.00 21.69 ? 151 VAL A CG2  1 
ATOM   1166 N  N    . GLU A 1 152 ? 16.062  11.935  7.610  1.00 22.02 ? 152 GLU A N    1 
ATOM   1167 C  CA   . GLU A 1 152 ? 17.054  13.007  7.822  1.00 23.01 ? 152 GLU A CA   1 
ATOM   1168 C  C    . GLU A 1 152 ? 16.466  14.396  7.775  1.00 22.68 ? 152 GLU A C    1 
ATOM   1169 O  O    . GLU A 1 152 ? 16.760  15.196  8.650  1.00 23.16 ? 152 GLU A O    1 
ATOM   1170 C  CB   . GLU A 1 152 ? 18.186  12.888  6.808  1.00 24.01 ? 152 GLU A CB   1 
ATOM   1171 C  CG   . GLU A 1 152 ? 19.185  11.767  7.203  1.00 25.12 ? 152 GLU A CG   1 
ATOM   1172 C  CD   . GLU A 1 152 ? 20.259  11.564  6.175  1.00 24.66 ? 152 GLU A CD   1 
ATOM   1173 O  OE1  . GLU A 1 152 ? 20.018  11.810  4.974  1.00 21.98 ? 152 GLU A OE1  1 
ATOM   1174 O  OE2  . GLU A 1 152 ? 21.354  11.166  6.582  1.00 23.50 ? 152 GLU A OE2  1 
ATOM   1175 N  N    . LYS A 1 153 ? 15.612  14.671  6.795  1.00 22.82 ? 153 LYS A N    1 
ATOM   1176 C  CA   . LYS A 1 153 ? 14.950  16.004  6.703  1.00 22.99 ? 153 LYS A CA   1 
ATOM   1177 C  C    . LYS A 1 153 ? 14.033  16.294  7.900  1.00 22.76 ? 153 LYS A C    1 
ATOM   1178 O  O    . LYS A 1 153 ? 13.780  17.470  8.237  1.00 23.46 ? 153 LYS A O    1 
ATOM   1179 C  CB   . LYS A 1 153 ? 14.166  16.122  5.393  1.00 24.08 ? 153 LYS A CB   1 
ATOM   1180 C  CG   . LYS A 1 153 ? 15.125  15.961  4.176  1.00 26.93 ? 153 LYS A CG   1 
ATOM   1181 C  CD   . LYS A 1 153 ? 14.513  16.489  2.884  0.70 29.26 ? 153 LYS A CD   1 
ATOM   1182 C  CE   . LYS A 1 153 ? 15.576  16.613  1.771  0.70 31.57 ? 153 LYS A CE   1 
ATOM   1183 N  NZ   . LYS A 1 153 ? 16.112  15.245  1.533  0.70 32.83 ? 153 LYS A NZ   1 
ATOM   1184 N  N    . CYS A 1 154 ? 13.565  15.244  8.582  1.00 21.81 ? 154 CYS A N    1 
ATOM   1185 C  CA   . CYS A 1 154 ? 12.755  15.448  9.822  1.00 22.57 ? 154 CYS A CA   1 
ATOM   1186 C  C    . CYS A 1 154 ? 13.656  15.952  10.928 1.00 21.25 ? 154 CYS A C    1 
ATOM   1187 O  O    . CYS A 1 154 ? 13.219  16.712  11.781 1.00 20.91 ? 154 CYS A O    1 
ATOM   1188 C  CB   . CYS A 1 154 ? 12.077  14.141  10.277 1.00 22.18 ? 154 CYS A CB   1 
ATOM   1189 S  SG   . CYS A 1 154 ? 10.778  13.590  9.141  1.00 27.76 ? 154 CYS A SG   1 
ATOM   1190 N  N    . LYS A 1 155 ? 14.922  15.522  10.894 1.00 20.77 ? 155 LYS A N    1 
ATOM   1191 C  CA   . LYS A 1 155 ? 15.896  15.972  11.893 1.00 21.62 ? 155 LYS A CA   1 
ATOM   1192 C  C    . LYS A 1 155 ? 16.279  17.414  11.564 1.00 22.72 ? 155 LYS A C    1 
ATOM   1193 O  O    . LYS A 1 155 ? 16.291  18.281  12.455 1.00 22.69 ? 155 LYS A O    1 
ATOM   1194 C  CB   . LYS A 1 155 ? 17.111  15.036  11.998 1.00 21.31 ? 155 LYS A CB   1 
ATOM   1195 C  CG   . LYS A 1 155 ? 18.246  15.524  12.949 1.00 21.66 ? 155 LYS A CG   1 
ATOM   1196 C  CD   . LYS A 1 155 ? 19.312  14.453  13.138 1.00 21.63 ? 155 LYS A CD   1 
ATOM   1197 C  CE   . LYS A 1 155 ? 20.615  15.042  13.787 1.00 22.61 ? 155 LYS A CE   1 
ATOM   1198 N  NZ   . LYS A 1 155 ? 20.334  15.267  15.251 1.00 21.62 ? 155 LYS A NZ   1 
ATOM   1199 N  N    . ASP A 1 156 ? 16.548  17.678  10.291 1.00 24.76 ? 156 ASP A N    1 
ATOM   1200 C  CA   . ASP A 1 156 ? 16.807  19.072  9.828  1.00 25.72 ? 156 ASP A CA   1 
ATOM   1201 C  C    . ASP A 1 156 ? 15.683  20.040  10.165 1.00 26.40 ? 156 ASP A C    1 
ATOM   1202 O  O    . ASP A 1 156 ? 15.941  21.196  10.514 1.00 26.33 ? 156 ASP A O    1 
ATOM   1203 C  CB   . ASP A 1 156 ? 17.074  19.127  8.314  1.00 27.17 ? 156 ASP A CB   1 
ATOM   1204 C  CG   . ASP A 1 156 ? 18.386  18.422  7.895  1.00 28.02 ? 156 ASP A CG   1 
ATOM   1205 O  OD1  . ASP A 1 156 ? 19.364  18.412  8.660  1.00 30.02 ? 156 ASP A OD1  1 
ATOM   1206 O  OD2  . ASP A 1 156 ? 18.416  17.911  6.758  1.00 33.55 ? 156 ASP A OD2  1 
ATOM   1207 N  N    . ALA A 1 157 ? 14.431  19.583  10.043 1.00 25.67 ? 157 ALA A N    1 
ATOM   1208 C  CA   . ALA A 1 157 ? 13.254  20.380  10.408 1.00 24.94 ? 157 ALA A CA   1 
ATOM   1209 C  C    . ALA A 1 157 ? 13.046  20.537  11.905 1.00 24.00 ? 157 ALA A C    1 
ATOM   1210 O  O    . ALA A 1 157 ? 12.225  21.341  12.311 1.00 23.61 ? 157 ALA A O    1 
ATOM   1211 C  CB   . ALA A 1 157 ? 11.956  19.834  9.727  1.00 23.80 ? 157 ALA A CB   1 
ATOM   1212 N  N    . GLY A 1 158 ? 13.774  19.770  12.726 1.00 24.76 ? 158 GLY A N    1 
ATOM   1213 C  CA   . GLY A 1 158 ? 13.670  19.894  14.191 1.00 23.06 ? 158 GLY A CA   1 
ATOM   1214 C  C    . GLY A 1 158 ? 12.531  19.069  14.792 1.00 24.56 ? 158 GLY A C    1 
ATOM   1215 O  O    . GLY A 1 158 ? 12.264  19.182  16.007 1.00 25.97 ? 158 GLY A O    1 
ATOM   1216 N  N    . LEU A 1 159 ? 11.850  18.265  13.955 1.00 21.86 ? 159 LEU A N    1 
ATOM   1217 C  CA   . LEU A 1 159 ? 10.682  17.465  14.358 1.00 21.79 ? 159 LEU A CA   1 
ATOM   1218 C  C    . LEU A 1 159 ? 11.090  16.197  15.076 1.00 21.18 ? 159 LEU A C    1 
ATOM   1219 O  O    . LEU A 1 159 ? 10.309  15.591  15.854 1.00 20.94 ? 159 LEU A O    1 
ATOM   1220 C  CB   . LEU A 1 159 ? 9.833   17.069  13.147 1.00 21.87 ? 159 LEU A CB   1 
ATOM   1221 C  CG   . LEU A 1 159 ? 9.241   18.208  12.328 1.00 21.30 ? 159 LEU A CG   1 
ATOM   1222 C  CD1  . LEU A 1 159 ? 8.351   17.584  11.223 1.00 20.65 ? 159 LEU A CD1  1 
ATOM   1223 C  CD2  . LEU A 1 159 ? 8.415   19.141  13.202 1.00 24.28 ? 159 LEU A CD2  1 
ATOM   1224 N  N    . ALA A 1 160 ? 12.331  15.806  14.846 1.00 19.86 ? 160 ALA A N    1 
ATOM   1225 C  CA   . ALA A 1 160 ? 12.876  14.665  15.594 1.00 20.68 ? 160 ALA A CA   1 
ATOM   1226 C  C    . ALA A 1 160 ? 14.255  15.122  16.006 1.00 20.70 ? 160 ALA A C    1 
ATOM   1227 O  O    . ALA A 1 160 ? 15.032  15.551  15.146 1.00 21.00 ? 160 ALA A O    1 
ATOM   1228 C  CB   . ALA A 1 160 ? 12.994  13.458  14.697 1.00 19.21 ? 160 ALA A CB   1 
ATOM   1229 N  N    . LYS A 1 161 ? 14.570  14.995  17.297 1.00 20.34 ? 161 LYS A N    1 
ATOM   1230 C  CA   . LYS A 1 161 ? 15.919  15.356  17.767 1.00 22.21 ? 161 LYS A CA   1 
ATOM   1231 C  C    . LYS A 1 161 ? 17.006  14.414  17.256 1.00 22.23 ? 161 LYS A C    1 
ATOM   1232 O  O    . LYS A 1 161 ? 17.997  14.881  16.685 1.00 21.74 ? 161 LYS A O    1 
ATOM   1233 C  CB   . LYS A 1 161 ? 15.910  15.500  19.302 1.00 23.20 ? 161 LYS A CB   1 
ATOM   1234 C  CG   . LYS A 1 161 ? 15.064  16.736  19.749 1.00 26.47 ? 161 LYS A CG   1 
ATOM   1235 C  CD   . LYS A 1 161 ? 15.435  17.322  21.122 1.00 30.12 ? 161 LYS A CD   1 
ATOM   1236 C  CE   . LYS A 1 161 ? 14.985  18.807  21.126 1.00 34.49 ? 161 LYS A CE   1 
ATOM   1237 N  NZ   . LYS A 1 161 ? 15.794  19.721  22.023 1.00 34.75 ? 161 LYS A NZ   1 
ATOM   1238 N  N    . SER A 1 162 ? 16.813  13.097  17.446 1.00 20.85 ? 162 SER A N    1 
ATOM   1239 C  CA   . SER A 1 162 ? 17.691  12.098  16.850 1.00 20.52 ? 162 SER A CA   1 
ATOM   1240 C  C    . SER A 1 162 ? 16.889  11.113  15.945 1.00 21.87 ? 162 SER A C    1 
ATOM   1241 O  O    . SER A 1 162 ? 15.647  11.014  16.036 1.00 21.58 ? 162 SER A O    1 
ATOM   1242 C  CB   . SER A 1 162 ? 18.421  11.312  17.935 1.00 21.47 ? 162 SER A CB   1 
ATOM   1243 O  OG   . SER A 1 162 ? 18.776  12.113  19.066 1.00 23.25 ? 162 SER A OG   1 
ATOM   1244 N  N    . ILE A 1 163 ? 17.603  10.356  15.103 1.00 21.04 ? 163 ILE A N    1 
ATOM   1245 C  CA   . ILE A 1 163 ? 16.937  9.431   14.215 1.00 19.12 ? 163 ILE A CA   1 
ATOM   1246 C  C    . ILE A 1 163 ? 17.716  8.140   14.247 1.00 17.86 ? 163 ILE A C    1 
ATOM   1247 O  O    . ILE A 1 163 ? 18.970  8.144   14.451 1.00 18.66 ? 163 ILE A O    1 
ATOM   1248 C  CB   . ILE A 1 163 ? 16.819  10.001  12.751 1.00 19.77 ? 163 ILE A CB   1 
ATOM   1249 C  CG1  . ILE A 1 163 ? 18.209  10.401  12.201 1.00 20.00 ? 163 ILE A CG1  1 
ATOM   1250 C  CG2  . ILE A 1 163 ? 15.808  11.150  12.714 1.00 16.24 ? 163 ILE A CG2  1 
ATOM   1251 C  CD1  . ILE A 1 163 ? 18.205  11.055  10.754 1.00 23.32 ? 163 ILE A CD1  1 
ATOM   1252 N  N    . GLY A 1 164 ? 17.014  7.032   14.060 1.00 17.06 ? 164 GLY A N    1 
ATOM   1253 C  CA   . GLY A 1 164 ? 17.658  5.720   14.178 1.00 16.59 ? 164 GLY A CA   1 
ATOM   1254 C  C    . GLY A 1 164 ? 16.847  4.638   13.500 1.00 17.10 ? 164 GLY A C    1 
ATOM   1255 O  O    . GLY A 1 164 ? 15.910  4.923   12.772 1.00 17.34 ? 164 GLY A O    1 
ATOM   1256 N  N    . VAL A 1 165 ? 17.226  3.380   13.704 1.00 17.45 ? 165 VAL A N    1 
ATOM   1257 C  CA   . VAL A 1 165 ? 16.560  2.275   13.014 1.00 17.58 ? 165 VAL A CA   1 
ATOM   1258 C  C    . VAL A 1 165 ? 16.098  1.185   13.975 1.00 17.45 ? 165 VAL A C    1 
ATOM   1259 O  O    . VAL A 1 165 ? 16.382  1.245   15.171 1.00 16.06 ? 165 VAL A O    1 
ATOM   1260 C  CB   . VAL A 1 165 ? 17.475  1.646   11.945 1.00 18.24 ? 165 VAL A CB   1 
ATOM   1261 C  CG1  . VAL A 1 165 ? 17.828  2.672   10.880 1.00 20.99 ? 165 VAL A CG1  1 
ATOM   1262 C  CG2  . VAL A 1 165 ? 18.732  1.081   12.588 1.00 20.46 ? 165 VAL A CG2  1 
ATOM   1263 N  N    . SER A 1 166 ? 15.387  0.188   13.452 1.00 16.65 ? 166 SER A N    1 
ATOM   1264 C  CA   . SER A 1 166 ? 14.916  -0.888  14.289 1.00 17.17 ? 166 SER A CA   1 
ATOM   1265 C  C    . SER A 1 166 ? 14.837  -2.101  13.423 1.00 17.44 ? 166 SER A C    1 
ATOM   1266 O  O    . SER A 1 166 ? 14.348  -2.026  12.292 1.00 18.11 ? 166 SER A O    1 
ATOM   1267 C  CB   . SER A 1 166 ? 13.534  -0.576  14.870 1.00 16.62 ? 166 SER A CB   1 
ATOM   1268 O  OG   . SER A 1 166 ? 13.147  -1.569  15.812 1.00 19.50 ? 166 SER A OG   1 
ATOM   1269 N  N    . ASN A 1 167 ? 15.270  -3.249  13.948 1.00 18.41 ? 167 ASN A N    1 
ATOM   1270 C  CA   . ASN A 1 167 ? 15.136  -4.519  13.213 1.00 18.91 ? 167 ASN A CA   1 
ATOM   1271 C  C    . ASN A 1 167 ? 15.941  -4.532  11.913 1.00 20.02 ? 167 ASN A C    1 
ATOM   1272 O  O    . ASN A 1 167 ? 15.589  -5.250  10.967 1.00 20.44 ? 167 ASN A O    1 
ATOM   1273 C  CB   . ASN A 1 167 ? 13.654  -4.829  12.861 1.00 18.50 ? 167 ASN A CB   1 
ATOM   1274 C  CG   . ASN A 1 167 ? 12.793  -5.033  14.094 1.00 18.93 ? 167 ASN A CG   1 
ATOM   1275 O  OD1  . ASN A 1 167 ? 13.087  -5.853  14.937 1.00 19.27 ? 167 ASN A OD1  1 
ATOM   1276 N  ND2  . ASN A 1 167 ? 11.719  -4.257  14.196 1.00 18.12 ? 167 ASN A ND2  1 
ATOM   1277 N  N    . PHE A 1 168 ? 17.015  -3.756  11.861 1.00 19.98 ? 168 PHE A N    1 
ATOM   1278 C  CA   . PHE A 1 168 ? 17.953  -3.826  10.728 1.00 20.53 ? 168 PHE A CA   1 
ATOM   1279 C  C    . PHE A 1 168 ? 19.038  -4.828  11.005 1.00 19.64 ? 168 PHE A C    1 
ATOM   1280 O  O    . PHE A 1 168 ? 19.551  -4.957  12.138 1.00 20.00 ? 168 PHE A O    1 
ATOM   1281 C  CB   . PHE A 1 168 ? 18.594  -2.450  10.499 1.00 19.39 ? 168 PHE A CB   1 
ATOM   1282 C  CG   . PHE A 1 168 ? 17.766  -1.511  9.708  1.00 21.16 ? 168 PHE A CG   1 
ATOM   1283 C  CD1  . PHE A 1 168 ? 16.387  -1.411  9.887  1.00 22.17 ? 168 PHE A CD1  1 
ATOM   1284 C  CD2  . PHE A 1 168 ? 18.394  -0.621  8.820  1.00 23.58 ? 168 PHE A CD2  1 
ATOM   1285 C  CE1  . PHE A 1 168 ? 15.624  -0.489  9.184  1.00 23.63 ? 168 PHE A CE1  1 
ATOM   1286 C  CE2  . PHE A 1 168 ? 17.646  0.311   8.123  1.00 22.46 ? 168 PHE A CE2  1 
ATOM   1287 C  CZ   . PHE A 1 168 ? 16.250  0.387   8.287  1.00 25.06 ? 168 PHE A CZ   1 
ATOM   1288 N  N    . ASN A 1 169 ? 19.435  -5.556  9.965  1.00 21.88 ? 169 ASN A N    1 
ATOM   1289 C  CA   . ASN A 1 169 ? 20.646  -6.399  10.079 1.00 22.10 ? 169 ASN A CA   1 
ATOM   1290 C  C    . ASN A 1 169 ? 21.903  -5.699  9.618  1.00 23.05 ? 169 ASN A C    1 
ATOM   1291 O  O    . ASN A 1 169 ? 21.884  -4.506  9.235  1.00 23.61 ? 169 ASN A O    1 
ATOM   1292 C  CB   . ASN A 1 169 ? 20.509  -7.759  9.404  1.00 22.31 ? 169 ASN A CB   1 
ATOM   1293 C  CG   . ASN A 1 169 ? 20.144  -7.640  7.929  1.00 22.68 ? 169 ASN A CG   1 
ATOM   1294 O  OD1  . ASN A 1 169 ? 20.507  -6.673  7.267  1.00 26.95 ? 169 ASN A OD1  1 
ATOM   1295 N  ND2  . ASN A 1 169 ? 19.429  -8.621  7.417  1.00 18.59 ? 169 ASN A ND2  1 
ATOM   1296 N  N    . ARG A 1 170 ? 23.026  -6.406  9.728  1.00 24.34 ? 170 ARG A N    1 
ATOM   1297 C  CA   . ARG A 1 170 ? 24.316  -5.824  9.407  1.00 26.40 ? 170 ARG A CA   1 
ATOM   1298 C  C    . ARG A 1 170 ? 24.348  -5.305  7.968  1.00 27.67 ? 170 ARG A C    1 
ATOM   1299 O  O    . ARG A 1 170 ? 24.786  -4.176  7.727  1.00 27.44 ? 170 ARG A O    1 
ATOM   1300 C  CB   . ARG A 1 170 ? 25.466  -6.780  9.685  1.00 26.95 ? 170 ARG A CB   1 
ATOM   1301 C  CG   . ARG A 1 170 ? 26.802  -6.167  9.281  1.00 30.29 ? 170 ARG A CG   1 
ATOM   1302 C  CD   . ARG A 1 170 ? 27.856  -7.157  8.746  1.00 36.77 ? 170 ARG A CD   1 
ATOM   1303 N  NE   . ARG A 1 170 ? 29.105  -6.394  8.538  1.00 38.42 ? 170 ARG A NE   1 
ATOM   1304 C  CZ   . ARG A 1 170 ? 30.266  -6.633  9.138  1.00 38.85 ? 170 ARG A CZ   1 
ATOM   1305 N  NH1  . ARG A 1 170 ? 31.293  -5.836  8.892  1.00 39.09 ? 170 ARG A NH1  1 
ATOM   1306 N  NH2  . ARG A 1 170 ? 30.412  -7.665  9.963  1.00 41.02 ? 170 ARG A NH2  1 
ATOM   1307 N  N    . ARG A 1 171 ? 23.817  -6.101  7.031  1.00 28.40 ? 171 ARG A N    1 
ATOM   1308 C  CA   . ARG A 1 171 ? 23.741  -5.672  5.617  1.00 28.66 ? 171 ARG A CA   1 
ATOM   1309 C  C    . ARG A 1 171 ? 23.013  -4.327  5.453  1.00 27.21 ? 171 ARG A C    1 
ATOM   1310 O  O    . ARG A 1 171 ? 23.521  -3.373  4.811  1.00 25.95 ? 171 ARG A O    1 
ATOM   1311 C  CB   . ARG A 1 171 ? 23.027  -6.754  4.835  1.00 29.52 ? 171 ARG A CB   1 
ATOM   1312 C  CG   . ARG A 1 171 ? 23.350  -6.887  3.358  1.00 34.90 ? 171 ARG A CG   1 
ATOM   1313 C  CD   . ARG A 1 171 ? 22.572  -8.165  2.867  1.00 39.93 ? 171 ARG A CD   1 
ATOM   1314 N  NE   . ARG A 1 171 ? 21.222  -7.786  2.423  1.00 42.66 ? 171 ARG A NE   1 
ATOM   1315 C  CZ   . ARG A 1 171 ? 20.057  -8.104  3.004  1.00 43.74 ? 171 ARG A CZ   1 
ATOM   1316 N  NH1  . ARG A 1 171 ? 20.009  -8.871  4.099  1.00 41.01 ? 171 ARG A NH1  1 
ATOM   1317 N  NH2  . ARG A 1 171 ? 18.916  -7.657  2.444  1.00 41.40 ? 171 ARG A NH2  1 
ATOM   1318 N  N    . GLN A 1 172 ? 21.845  -4.235  6.087  1.00 27.08 ? 172 GLN A N    1 
ATOM   1319 C  CA   . GLN A 1 172 ? 21.010  -3.015  6.023  1.00 26.63 ? 172 GLN A CA   1 
ATOM   1320 C  C    . GLN A 1 172 ? 21.605  -1.781  6.736  1.00 26.31 ? 172 GLN A C    1 
ATOM   1321 O  O    . GLN A 1 172 ? 21.490  -0.643  6.241  1.00 27.36 ? 172 GLN A O    1 
ATOM   1322 C  CB   . GLN A 1 172 ? 19.583  -3.346  6.477  1.00 26.10 ? 172 GLN A CB   1 
ATOM   1323 C  CG   . GLN A 1 172 ? 18.889  -4.514  5.678  1.00 26.33 ? 172 GLN A CG   1 
ATOM   1324 C  CD   . GLN A 1 172 ? 17.712  -5.158  6.392  1.00 26.83 ? 172 GLN A CD   1 
ATOM   1325 O  OE1  . GLN A 1 172 ? 17.679  -5.206  7.624  1.00 28.68 ? 172 GLN A OE1  1 
ATOM   1326 N  NE2  . GLN A 1 172 ? 16.746  -5.696  5.621  1.00 25.85 ? 172 GLN A NE2  1 
ATOM   1327 N  N    . LEU A 1 173 ? 22.256  -1.994  7.880  1.00 25.51 ? 173 LEU A N    1 
ATOM   1328 C  CA   . LEU A 1 173 ? 23.047  -0.931  8.521  1.00 25.11 ? 173 LEU A CA   1 
ATOM   1329 C  C    . LEU A 1 173 ? 24.142  -0.436  7.560  1.00 26.88 ? 173 LEU A C    1 
ATOM   1330 O  O    . LEU A 1 173 ? 24.317  0.746   7.391  1.00 24.40 ? 173 LEU A O    1 
ATOM   1331 C  CB   . LEU A 1 173 ? 23.694  -1.442  9.834  1.00 24.40 ? 173 LEU A CB   1 
ATOM   1332 C  CG   . LEU A 1 173 ? 22.718  -1.771  10.982 1.00 22.05 ? 173 LEU A CG   1 
ATOM   1333 C  CD1  . LEU A 1 173 ? 23.516  -2.095  12.198 1.00 24.64 ? 173 LEU A CD1  1 
ATOM   1334 C  CD2  . LEU A 1 173 ? 21.717  -0.634  11.266 1.00 23.77 ? 173 LEU A CD2  1 
ATOM   1335 N  N    . GLU A 1 174 ? 24.853  -1.364  6.910  1.00 27.92 ? 174 GLU A N    1 
ATOM   1336 C  CA   . GLU A 1 174 ? 25.894  -1.004  5.952  1.00 30.24 ? 174 GLU A CA   1 
ATOM   1337 C  C    . GLU A 1 174 ? 25.337  -0.269  4.735  1.00 31.01 ? 174 GLU A C    1 
ATOM   1338 O  O    . GLU A 1 174 ? 25.937  0.701   4.286  1.00 31.86 ? 174 GLU A O    1 
ATOM   1339 C  CB   . GLU A 1 174 ? 26.757  -2.223  5.542  1.00 30.05 ? 174 GLU A CB   1 
ATOM   1340 C  CG   . GLU A 1 174 ? 27.861  -2.539  6.582  1.00 35.15 ? 174 GLU A CG   1 
ATOM   1341 C  CD   . GLU A 1 174 ? 28.406  -3.961  6.514  1.00 42.00 ? 174 GLU A CD   1 
ATOM   1342 O  OE1  . GLU A 1 174 ? 28.043  -4.719  5.587  1.00 45.86 ? 174 GLU A OE1  1 
ATOM   1343 O  OE2  . GLU A 1 174 ? 29.217  -4.322  7.407  1.00 47.48 ? 174 GLU A OE2  1 
ATOM   1344 N  N    . MET A 1 175 ? 24.191  -0.695  4.211  1.00 32.19 ? 175 MET A N    1 
ATOM   1345 C  CA   . MET A 1 175 ? 23.580  0.082   3.132  1.00 31.86 ? 175 MET A CA   1 
ATOM   1346 C  C    . MET A 1 175 ? 23.287  1.537   3.515  1.00 31.09 ? 175 MET A C    1 
ATOM   1347 O  O    . MET A 1 175 ? 23.554  2.405   2.714  1.00 31.30 ? 175 MET A O    1 
ATOM   1348 C  CB   . MET A 1 175 ? 22.376  -0.624  2.568  1.00 32.64 ? 175 MET A CB   1 
ATOM   1349 C  CG   . MET A 1 175 ? 21.273  0.235   1.912  1.00 33.55 ? 175 MET A CG   1 
ATOM   1350 S  SD   . MET A 1 175 ? 19.690  -0.645  1.983  0.50 36.73 ? 175 MET A SD   1 
ATOM   1351 C  CE   . MET A 1 175 ? 20.177  -2.371  2.177  0.50 34.13 ? 175 MET A CE   1 
ATOM   1352 N  N    . ILE A 1 176 ? 22.770  1.821   4.715  1.00 30.54 ? 176 ILE A N    1 
ATOM   1353 C  CA   . ILE A 1 176 ? 22.565  3.242   5.139  1.00 29.30 ? 176 ILE A CA   1 
ATOM   1354 C  C    . ILE A 1 176 ? 23.917  3.954   5.322  1.00 30.20 ? 176 ILE A C    1 
ATOM   1355 O  O    . ILE A 1 176 ? 24.144  5.016   4.740  1.00 29.26 ? 176 ILE A O    1 
ATOM   1356 C  CB   . ILE A 1 176 ? 21.699  3.444   6.450  1.00 28.71 ? 176 ILE A CB   1 
ATOM   1357 C  CG1  . ILE A 1 176 ? 20.331  2.716   6.419  1.00 29.14 ? 176 ILE A CG1  1 
ATOM   1358 C  CG2  . ILE A 1 176 ? 21.619  4.981   6.835  1.00 25.15 ? 176 ILE A CG2  1 
ATOM   1359 C  CD1  . ILE A 1 176 ? 19.287  3.234   5.420  1.00 27.66 ? 176 ILE A CD1  1 
ATOM   1360 N  N    . LEU A 1 177 ? 24.821  3.351   6.110  1.00 30.45 ? 177 LEU A N    1 
ATOM   1361 C  CA   . LEU A 1 177 ? 26.171  3.932   6.374  1.00 31.03 ? 177 LEU A CA   1 
ATOM   1362 C  C    . LEU A 1 177 ? 26.993  4.314   5.121  1.00 32.63 ? 177 LEU A C    1 
ATOM   1363 O  O    . LEU A 1 177 ? 27.742  5.291   5.141  1.00 32.86 ? 177 LEU A O    1 
ATOM   1364 C  CB   . LEU A 1 177 ? 27.010  2.990   7.251  1.00 29.01 ? 177 LEU A CB   1 
ATOM   1365 C  CG   . LEU A 1 177 ? 26.500  2.741   8.689  1.00 28.21 ? 177 LEU A CG   1 
ATOM   1366 C  CD1  . LEU A 1 177 ? 27.147  1.593   9.334  1.00 24.13 ? 177 LEU A CD1  1 
ATOM   1367 C  CD2  . LEU A 1 177 ? 26.559  4.000   9.648  1.00 24.02 ? 177 LEU A CD2  1 
ATOM   1368 N  N    . ASN A 1 178 ? 26.827  3.548   4.050  1.00 34.04 ? 178 ASN A N    1 
ATOM   1369 C  CA   . ASN A 1 178 ? 27.612  3.693   2.851  1.00 35.52 ? 178 ASN A CA   1 
ATOM   1370 C  C    . ASN A 1 178 ? 26.849  4.403   1.703  1.00 36.19 ? 178 ASN A C    1 
ATOM   1371 O  O    . ASN A 1 178 ? 27.334  4.468   0.562  1.00 36.56 ? 178 ASN A O    1 
ATOM   1372 C  CB   . ASN A 1 178 ? 28.131  2.304   2.420  1.00 36.58 ? 178 ASN A CB   1 
ATOM   1373 C  CG   . ASN A 1 178 ? 29.051  1.648   3.485  1.00 38.20 ? 178 ASN A CG   1 
ATOM   1374 O  OD1  . ASN A 1 178 ? 28.780  0.534   3.967  1.00 41.51 ? 178 ASN A OD1  1 
ATOM   1375 N  ND2  . ASN A 1 178 ? 30.130  2.338   3.850  1.00 40.04 ? 178 ASN A ND2  1 
ATOM   1376 N  N    . LYS A 1 179 ? 25.681  4.948   2.029  1.00 35.33 ? 179 LYS A N    1 
ATOM   1377 C  CA   . LYS A 1 179 ? 24.834  5.671   1.093  1.00 35.92 ? 179 LYS A CA   1 
ATOM   1378 C  C    . LYS A 1 179 ? 25.507  6.981   0.654  1.00 35.65 ? 179 LYS A C    1 
ATOM   1379 O  O    . LYS A 1 179 ? 25.962  7.755   1.495  1.00 34.52 ? 179 LYS A O    1 
ATOM   1380 C  CB   . LYS A 1 179 ? 23.482  5.981   1.748  1.00 35.02 ? 179 LYS A CB   1 
ATOM   1381 C  CG   . LYS A 1 179 ? 22.395  6.588   0.832  1.00 37.86 ? 179 LYS A CG   1 
ATOM   1382 C  CD   . LYS A 1 179 ? 21.163  7.130   1.667  1.00 36.20 ? 179 LYS A CD   1 
ATOM   1383 C  CE   . LYS A 1 179 ? 21.474  8.479   2.285  1.00 39.70 ? 179 LYS A CE   1 
ATOM   1384 N  NZ   . LYS A 1 179 ? 21.639  9.597   1.256  1.00 39.90 ? 179 LYS A NZ   1 
ATOM   1385 N  N    . PRO A 1 180 ? 25.550  7.234   -0.678 1.00 36.14 ? 180 PRO A N    1 
ATOM   1386 C  CA   . PRO A 1 180 ? 26.103  8.518   -1.148 1.00 35.68 ? 180 PRO A CA   1 
ATOM   1387 C  C    . PRO A 1 180 ? 25.436  9.689   -0.444 1.00 34.74 ? 180 PRO A C    1 
ATOM   1388 O  O    . PRO A 1 180 ? 24.198  9.793   -0.457 1.00 35.18 ? 180 PRO A O    1 
ATOM   1389 C  CB   . PRO A 1 180 ? 25.722  8.559   -2.641 1.00 35.92 ? 180 PRO A CB   1 
ATOM   1390 C  CG   . PRO A 1 180 ? 25.573  7.094   -3.036 0.70 36.73 ? 180 PRO A CG   1 
ATOM   1391 C  CD   . PRO A 1 180 ? 25.036  6.402   -1.790 0.50 36.19 ? 180 PRO A CD   1 
ATOM   1392 N  N    . GLY A 1 181 ? 26.234  10.552  0.166  1.00 33.59 ? 181 GLY A N    1 
ATOM   1393 C  CA   . GLY A 1 181 ? 25.703  11.807  0.704  1.00 33.42 ? 181 GLY A CA   1 
ATOM   1394 C  C    . GLY A 1 181 ? 24.927  11.730  2.015  1.00 32.28 ? 181 GLY A C    1 
ATOM   1395 O  O    . GLY A 1 181 ? 24.218  12.675  2.361  1.00 32.20 ? 181 GLY A O    1 
ATOM   1396 N  N    . LEU A 1 182 ? 25.074  10.642  2.753  1.00 30.62 ? 182 LEU A N    1 
ATOM   1397 C  CA   A LEU A 1 182 ? 24.412  10.472  4.031  0.50 30.07 ? 182 LEU A CA   1 
ATOM   1398 C  CA   B LEU A 1 182 ? 24.558  10.496  4.081  0.50 30.20 ? 182 LEU A CA   1 
ATOM   1399 C  C    . LEU A 1 182 ? 24.739  11.753  4.896  1.00 30.18 ? 182 LEU A C    1 
ATOM   1400 O  O    . LEU A 1 182 ? 25.804  12.277  4.901  1.00 29.64 ? 182 LEU A O    1 
ATOM   1401 C  CB   A LEU A 1 182 ? 24.841  9.167   4.703  0.50 29.31 ? 182 LEU A CB   1 
ATOM   1402 C  CB   B LEU A 1 182 ? 25.352  9.418   4.790  0.50 29.63 ? 182 LEU A CB   1 
ATOM   1403 C  CG   A LEU A 1 182 ? 24.642  9.088   6.218  0.50 27.57 ? 182 LEU A CG   1 
ATOM   1404 C  CG   B LEU A 1 182 ? 24.811  8.369   5.742  0.50 28.44 ? 182 LEU A CG   1 
ATOM   1405 C  CD1  A LEU A 1 182 ? 23.440  8.220   6.558  0.50 25.05 ? 182 LEU A CD1  1 
ATOM   1406 C  CD1  B LEU A 1 182 ? 25.744  8.263   6.891  0.50 25.59 ? 182 LEU A CD1  1 
ATOM   1407 C  CD2  A LEU A 1 182 ? 25.897  8.563   6.898  0.50 22.74 ? 182 LEU A CD2  1 
ATOM   1408 C  CD2  B LEU A 1 182 ? 23.426  8.600   6.150  0.50 25.23 ? 182 LEU A CD2  1 
ATOM   1409 N  N    . LYS A 1 183 ? 23.717  12.193  5.596  1.00 29.61 ? 183 LYS A N    1 
ATOM   1410 C  CA   . LYS A 1 183 ? 23.886  13.331  6.479  1.00 30.73 ? 183 LYS A CA   1 
ATOM   1411 C  C    . LYS A 1 183 ? 24.126  12.904  7.949  1.00 30.26 ? 183 LYS A C    1 
ATOM   1412 O  O    . LYS A 1 183 ? 24.959  13.476  8.649  1.00 32.05 ? 183 LYS A O    1 
ATOM   1413 C  CB   . LYS A 1 183 ? 22.716  14.323  6.355  1.00 31.42 ? 183 LYS A CB   1 
ATOM   1414 C  CG   . LYS A 1 183 ? 22.493  14.805  4.907  1.00 33.35 ? 183 LYS A CG   1 
ATOM   1415 C  CD   . LYS A 1 183 ? 21.541  16.018  4.818  1.00 36.36 ? 183 LYS A CD   1 
ATOM   1416 C  CE   . LYS A 1 183 ? 20.076  15.622  4.850  0.60 34.84 ? 183 LYS A CE   1 
ATOM   1417 N  NZ   . LYS A 1 183 ? 19.236  16.777  4.401  0.60 36.46 ? 183 LYS A NZ   1 
ATOM   1418 N  N    . TYR A 1 184 ? 23.391  11.901  8.403  1.00 29.71 ? 184 TYR A N    1 
ATOM   1419 C  CA   . TYR A 1 184 ? 23.349  11.526  9.803  1.00 29.27 ? 184 TYR A CA   1 
ATOM   1420 C  C    . TYR A 1 184 ? 23.347  10.010  9.849  1.00 28.39 ? 184 TYR A C    1 
ATOM   1421 O  O    . TYR A 1 184 ? 22.470  9.398   9.277  1.00 28.49 ? 184 TYR A O    1 
ATOM   1422 C  CB   . TYR A 1 184 ? 22.040  12.017  10.435 1.00 30.45 ? 184 TYR A CB   1 
ATOM   1423 C  CG   . TYR A 1 184 ? 21.779  13.504  10.261 1.00 30.10 ? 184 TYR A CG   1 
ATOM   1424 C  CD1  . TYR A 1 184 ? 22.637  14.438  10.842 1.00 29.41 ? 184 TYR A CD1  1 
ATOM   1425 C  CD2  . TYR A 1 184 ? 20.696  13.970  9.517  1.00 29.17 ? 184 TYR A CD2  1 
ATOM   1426 C  CE1  . TYR A 1 184 ? 22.423  15.810  10.697 1.00 32.53 ? 184 TYR A CE1  1 
ATOM   1427 C  CE2  . TYR A 1 184 ? 20.470  15.364  9.374  1.00 32.49 ? 184 TYR A CE2  1 
ATOM   1428 C  CZ   . TYR A 1 184 ? 21.346  16.268  9.974  1.00 32.61 ? 184 TYR A CZ   1 
ATOM   1429 O  OH   . TYR A 1 184 ? 21.171  17.652  9.851  1.00 37.12 ? 184 TYR A OH   1 
ATOM   1430 N  N    . LYS A 1 185 ? 24.326  9.389   10.487 1.00 27.29 ? 185 LYS A N    1 
ATOM   1431 C  CA   . LYS A 1 185 ? 24.110  7.978   10.779 1.00 26.88 ? 185 LYS A CA   1 
ATOM   1432 C  C    . LYS A 1 185 ? 22.959  7.675   11.776 1.00 24.82 ? 185 LYS A C    1 
ATOM   1433 O  O    . LYS A 1 185 ? 22.596  8.501   12.597 1.00 25.05 ? 185 LYS A O    1 
ATOM   1434 C  CB   . LYS A 1 185 ? 25.376  7.199   11.106 1.00 27.59 ? 185 LYS A CB   1 
ATOM   1435 C  CG   . LYS A 1 185 ? 26.384  7.723   12.028 1.00 31.05 ? 185 LYS A CG   1 
ATOM   1436 C  CD   . LYS A 1 185 ? 27.660  6.965   11.665 1.00 33.27 ? 185 LYS A CD   1 
ATOM   1437 C  CE   . LYS A 1 185 ? 28.671  7.045   12.751 1.00 35.03 ? 185 LYS A CE   1 
ATOM   1438 N  NZ   . LYS A 1 185 ? 29.896  6.259   12.376 1.00 34.26 ? 185 LYS A NZ   1 
ATOM   1439 N  N    . PRO A 1 186 ? 22.385  6.485   11.693 1.00 23.81 ? 186 PRO A N    1 
ATOM   1440 C  CA   . PRO A 1 186 ? 21.379  6.130   12.719 1.00 23.36 ? 186 PRO A CA   1 
ATOM   1441 C  C    . PRO A 1 186 ? 22.071  6.199   14.081 1.00 22.14 ? 186 PRO A C    1 
ATOM   1442 O  O    . PRO A 1 186 ? 23.234  5.799   14.195 1.00 21.00 ? 186 PRO A O    1 
ATOM   1443 C  CB   . PRO A 1 186 ? 20.963  4.697   12.353 1.00 22.93 ? 186 PRO A CB   1 
ATOM   1444 C  CG   . PRO A 1 186 ? 22.077  4.176   11.499 1.00 24.56 ? 186 PRO A CG   1 
ATOM   1445 C  CD   . PRO A 1 186 ? 22.649  5.388   10.754 1.00 24.59 ? 186 PRO A CD   1 
ATOM   1446 N  N    . VAL A 1 187 ? 21.404  6.786   15.084 1.00 20.17 ? 187 VAL A N    1 
ATOM   1447 C  CA   . VAL A 1 187 ? 21.974  6.814   16.445 1.00 19.08 ? 187 VAL A CA   1 
ATOM   1448 C  C    . VAL A 1 187 ? 21.864  5.421   17.152 1.00 19.43 ? 187 VAL A C    1 
ATOM   1449 O  O    . VAL A 1 187 ? 22.522  5.178   18.175 1.00 20.47 ? 187 VAL A O    1 
ATOM   1450 C  CB   . VAL A 1 187 ? 21.296  7.848   17.318 1.00 17.91 ? 187 VAL A CB   1 
ATOM   1451 C  CG1  . VAL A 1 187 ? 21.596  9.362   16.833 1.00 17.12 ? 187 VAL A CG1  1 
ATOM   1452 C  CG2  . VAL A 1 187 ? 19.828  7.572   17.400 1.00 18.09 ? 187 VAL A CG2  1 
ATOM   1453 N  N    . CYS A 1 188 ? 20.986  4.546   16.643 1.00 20.34 ? 188 CYS A N    1 
ATOM   1454 C  CA   . CYS A 1 188 ? 20.650  3.288   17.310 1.00 19.22 ? 188 CYS A CA   1 
ATOM   1455 C  C    . CYS A 1 188 ? 20.017  2.298   16.359 1.00 19.67 ? 188 CYS A C    1 
ATOM   1456 O  O    . CYS A 1 188 ? 19.532  2.664   15.254 1.00 19.08 ? 188 CYS A O    1 
ATOM   1457 C  CB   . CYS A 1 188 ? 19.710  3.491   18.532 1.00 20.37 ? 188 CYS A CB   1 
ATOM   1458 S  SG   . CYS A 1 188 ? 17.997  3.995   18.094 1.00 20.82 ? 188 CYS A SG   1 
ATOM   1459 N  N    . ASN A 1 189 ? 20.093  1.033   16.784 1.00 18.59 ? 189 ASN A N    1 
ATOM   1460 C  CA   . ASN A 1 189 ? 19.400  -0.078  16.166 1.00 20.28 ? 189 ASN A CA   1 
ATOM   1461 C  C    . ASN A 1 189 ? 18.627  -0.764  17.291 1.00 19.74 ? 189 ASN A C    1 
ATOM   1462 O  O    . ASN A 1 189 ? 19.221  -1.383  18.189 1.00 19.73 ? 189 ASN A O    1 
ATOM   1463 C  CB   . ASN A 1 189 ? 20.343  -1.089  15.487 1.00 19.60 ? 189 ASN A CB   1 
ATOM   1464 C  CG   . ASN A 1 189 ? 19.592  -2.029  14.573 1.00 19.01 ? 189 ASN A CG   1 
ATOM   1465 O  OD1  . ASN A 1 189 ? 18.379  -1.824  14.272 1.00 22.33 ? 189 ASN A OD1  1 
ATOM   1466 N  ND2  . ASN A 1 189 ? 20.255  -3.083  14.160 1.00 18.91 ? 189 ASN A ND2  1 
ATOM   1467 N  N    . GLN A 1 190 ? 17.312  -0.626  17.263 1.00 19.15 ? 190 GLN A N    1 
ATOM   1468 C  CA   . GLN A 1 190 ? 16.518  -1.214  18.320 1.00 18.21 ? 190 GLN A CA   1 
ATOM   1469 C  C    . GLN A 1 190 ? 16.075  -2.589  17.866 1.00 18.26 ? 190 GLN A C    1 
ATOM   1470 O  O    . GLN A 1 190 ? 15.342  -2.724  16.878 1.00 17.22 ? 190 GLN A O    1 
ATOM   1471 C  CB   . GLN A 1 190 ? 15.305  -0.362  18.681 1.00 18.12 ? 190 GLN A CB   1 
ATOM   1472 C  CG   . GLN A 1 190 ? 14.473  -0.993  19.928 1.00 17.38 ? 190 GLN A CG   1 
ATOM   1473 C  CD   . GLN A 1 190 ? 13.140  -0.293  20.159 1.00 20.14 ? 190 GLN A CD   1 
ATOM   1474 O  OE1  . GLN A 1 190 ? 12.067  -0.900  20.140 1.00 17.34 ? 190 GLN A OE1  1 
ATOM   1475 N  NE2  . GLN A 1 190 ? 13.219  1.006   20.461 1.00 18.86 ? 190 GLN A NE2  1 
ATOM   1476 N  N    . VAL A 1 191 ? 16.497  -3.604  18.593 1.00 17.51 ? 191 VAL A N    1 
ATOM   1477 C  CA   . VAL A 1 191 ? 16.279  -5.007  18.163 1.00 17.37 ? 191 VAL A CA   1 
ATOM   1478 C  C    . VAL A 1 191 ? 15.980  -5.859  19.401 1.00 18.16 ? 191 VAL A C    1 
ATOM   1479 O  O    . VAL A 1 191 ? 16.278  -5.428  20.536 1.00 19.87 ? 191 VAL A O    1 
ATOM   1480 C  CB   . VAL A 1 191 ? 17.537  -5.588  17.397 1.00 18.23 ? 191 VAL A CB   1 
ATOM   1481 C  CG1  . VAL A 1 191 ? 17.799  -4.881  15.974 1.00 18.25 ? 191 VAL A CG1  1 
ATOM   1482 C  CG2  . VAL A 1 191 ? 18.811  -5.534  18.293 1.00 19.93 ? 191 VAL A CG2  1 
ATOM   1483 N  N    . GLU A 1 192 ? 15.414  -7.056  19.193 1.00 16.18 ? 192 GLU A N    1 
ATOM   1484 C  CA   . GLU A 1 192 ? 15.224  -8.049  20.222 1.00 17.72 ? 192 GLU A CA   1 
ATOM   1485 C  C    . GLU A 1 192 ? 16.525  -8.499  20.890 1.00 16.30 ? 192 GLU A C    1 
ATOM   1486 O  O    . GLU A 1 192 ? 17.450  -8.971  20.253 1.00 17.27 ? 192 GLU A O    1 
ATOM   1487 C  CB   . GLU A 1 192 ? 14.592  -9.334  19.636 1.00 16.97 ? 192 GLU A CB   1 
ATOM   1488 C  CG   . GLU A 1 192 ? 14.223  -10.380 20.714 1.00 19.35 ? 192 GLU A CG   1 
ATOM   1489 C  CD   . GLU A 1 192 ? 13.410  -11.546 20.221 1.00 20.18 ? 192 GLU A CD   1 
ATOM   1490 O  OE1  . GLU A 1 192 ? 12.720  -11.465 19.172 1.00 22.25 ? 192 GLU A OE1  1 
ATOM   1491 O  OE2  . GLU A 1 192 ? 13.434  -12.554 20.919 1.00 17.65 ? 192 GLU A OE2  1 
ATOM   1492 N  N    . CYS A 1 193 ? 16.592  -8.354  22.172 1.00 16.88 ? 193 CYS A N    1 
ATOM   1493 C  CA   . CYS A 1 193 ? 17.757  -8.785  22.934 1.00 18.24 ? 193 CYS A CA   1 
ATOM   1494 C  C    . CYS A 1 193 ? 17.460  -9.091  24.401 1.00 18.69 ? 193 CYS A C    1 
ATOM   1495 O  O    . CYS A 1 193 ? 16.909  -8.311  25.108 1.00 20.55 ? 193 CYS A O    1 
ATOM   1496 C  CB   . CYS A 1 193 ? 18.874  -7.755  22.757 1.00 16.94 ? 193 CYS A CB   1 
ATOM   1497 S  SG   . CYS A 1 193 ? 20.561  -8.230  23.183 1.00 20.40 ? 193 CYS A SG   1 
ATOM   1498 N  N    . HIS A 1 194 ? 17.895  -10.285 24.812 1.00 19.84 ? 194 HIS A N    1 
ATOM   1499 C  CA   . HIS A 1 194 ? 17.822  -10.772 26.193 1.00 18.51 ? 194 HIS A CA   1 
ATOM   1500 C  C    . HIS A 1 194 ? 18.778  -11.971 26.296 1.00 18.80 ? 194 HIS A C    1 
ATOM   1501 O  O    . HIS A 1 194 ? 19.491  -12.267 25.337 1.00 17.46 ? 194 HIS A O    1 
ATOM   1502 C  CB   . HIS A 1 194 ? 16.438  -11.347 26.492 1.00 18.71 ? 194 HIS A CB   1 
ATOM   1503 C  CG   . HIS A 1 194 ? 15.837  -12.101 25.347 1.00 18.76 ? 194 HIS A CG   1 
ATOM   1504 N  ND1  . HIS A 1 194 ? 16.116  -13.428 25.102 1.00 16.92 ? 194 HIS A ND1  1 
ATOM   1505 C  CD2  . HIS A 1 194 ? 14.972  -11.714 24.380 1.00 15.16 ? 194 HIS A CD2  1 
ATOM   1506 C  CE1  . HIS A 1 194 ? 15.449  -13.826 24.033 1.00 18.49 ? 194 HIS A CE1  1 
ATOM   1507 N  NE2  . HIS A 1 194 ? 14.747  -12.805 23.576 1.00 16.98 ? 194 HIS A NE2  1 
ATOM   1508 N  N    . PRO A 1 195 ? 18.754  -12.677 27.421 1.00 18.76 ? 195 PRO A N    1 
ATOM   1509 C  CA   . PRO A 1 195 ? 19.724  -13.747 27.688 1.00 18.73 ? 195 PRO A CA   1 
ATOM   1510 C  C    . PRO A 1 195 ? 19.662  -14.952 26.743 1.00 19.87 ? 195 PRO A C    1 
ATOM   1511 O  O    . PRO A 1 195 ? 20.649  -15.678 26.615 1.00 19.79 ? 195 PRO A O    1 
ATOM   1512 C  CB   . PRO A 1 195 ? 19.293  -14.268 29.061 1.00 18.73 ? 195 PRO A CB   1 
ATOM   1513 C  CG   . PRO A 1 195 ? 18.645  -13.099 29.713 1.00 16.44 ? 195 PRO A CG   1 
ATOM   1514 C  CD   . PRO A 1 195 ? 17.955  -12.343 28.613 1.00 17.99 ? 195 PRO A CD   1 
ATOM   1515 N  N    . TYR A 1 196 ? 18.510  -15.164 26.115 1.00 19.67 ? 196 TYR A N    1 
ATOM   1516 C  CA   . TYR A 1 196 ? 18.318  -16.308 25.233 1.00 19.76 ? 196 TYR A CA   1 
ATOM   1517 C  C    . TYR A 1 196 ? 18.783  -15.966 23.823 1.00 20.92 ? 196 TYR A C    1 
ATOM   1518 O  O    . TYR A 1 196 ? 19.155  -16.850 23.051 1.00 22.55 ? 196 TYR A O    1 
ATOM   1519 C  CB   . TYR A 1 196 ? 16.873  -16.807 25.311 1.00 20.49 ? 196 TYR A CB   1 
ATOM   1520 C  CG   . TYR A 1 196 ? 16.588  -17.673 26.517 1.00 18.87 ? 196 TYR A CG   1 
ATOM   1521 C  CD1  . TYR A 1 196 ? 17.608  -18.059 27.376 1.00 19.88 ? 196 TYR A CD1  1 
ATOM   1522 C  CD2  . TYR A 1 196 ? 15.299  -18.106 26.796 1.00 19.23 ? 196 TYR A CD2  1 
ATOM   1523 C  CE1  . TYR A 1 196 ? 17.353  -18.851 28.479 1.00 22.29 ? 196 TYR A CE1  1 
ATOM   1524 C  CE2  . TYR A 1 196 ? 15.033  -18.899 27.897 1.00 24.58 ? 196 TYR A CE2  1 
ATOM   1525 C  CZ   . TYR A 1 196 ? 16.064  -19.268 28.735 1.00 23.29 ? 196 TYR A CZ   1 
ATOM   1526 O  OH   . TYR A 1 196 ? 15.804  -20.057 29.832 1.00 24.21 ? 196 TYR A OH   1 
ATOM   1527 N  N    . PHE A 1 197 ? 18.760  -14.680 23.492 1.00 20.34 ? 197 PHE A N    1 
ATOM   1528 C  CA   . PHE A 1 197 ? 19.168  -14.237 22.188 1.00 19.48 ? 197 PHE A CA   1 
ATOM   1529 C  C    . PHE A 1 197 ? 19.989  -12.949 22.321 1.00 19.96 ? 197 PHE A C    1 
ATOM   1530 O  O    . PHE A 1 197 ? 19.523  -11.824 22.102 1.00 19.83 ? 197 PHE A O    1 
ATOM   1531 C  CB   . PHE A 1 197 ? 17.854  -14.104 21.368 1.00 18.64 ? 197 PHE A CB   1 
ATOM   1532 C  CG   . PHE A 1 197 ? 18.085  -13.924 19.875 1.00 20.78 ? 197 PHE A CG   1 
ATOM   1533 C  CD1  . PHE A 1 197 ? 18.332  -15.042 19.033 1.00 22.03 ? 197 PHE A CD1  1 
ATOM   1534 C  CD2  . PHE A 1 197 ? 18.086  -12.639 19.309 1.00 19.02 ? 197 PHE A CD2  1 
ATOM   1535 C  CE1  . PHE A 1 197 ? 18.643  -14.837 17.618 1.00 22.08 ? 197 PHE A CE1  1 
ATOM   1536 C  CE2  . PHE A 1 197 ? 18.323  -12.415 17.956 1.00 22.73 ? 197 PHE A CE2  1 
ATOM   1537 C  CZ   . PHE A 1 197 ? 18.607  -13.509 17.090 1.00 21.12 ? 197 PHE A CZ   1 
ATOM   1538 N  N    . ASN A 1 198 ? 21.259  -13.132 22.649 1.00 18.28 ? 198 ASN A N    1 
ATOM   1539 C  CA   . ASN A 1 198 ? 22.023  -11.999 23.191 1.00 18.55 ? 198 ASN A CA   1 
ATOM   1540 C  C    . ASN A 1 198 ? 22.669  -11.061 22.155 1.00 18.27 ? 198 ASN A C    1 
ATOM   1541 O  O    . ASN A 1 198 ? 23.255  -10.044 22.523 1.00 17.99 ? 198 ASN A O    1 
ATOM   1542 C  CB   . ASN A 1 198 ? 22.986  -12.484 24.268 1.00 18.10 ? 198 ASN A CB   1 
ATOM   1543 C  CG   . ASN A 1 198 ? 24.222  -13.134 23.687 1.00 20.70 ? 198 ASN A CG   1 
ATOM   1544 O  OD1  . ASN A 1 198 ? 24.592  -12.868 22.509 1.00 22.77 ? 198 ASN A OD1  1 
ATOM   1545 N  ND2  . ASN A 1 198 ? 24.911  -13.967 24.520 1.00 24.05 ? 198 ASN A ND2  1 
ATOM   1546 N  N    . GLN A 1 199 ? 22.551  -11.422 20.883 1.00 19.27 ? 199 GLN A N    1 
ATOM   1547 C  CA   . GLN A 1 199 ? 23.030  -10.593 19.782 1.00 19.13 ? 199 GLN A CA   1 
ATOM   1548 C  C    . GLN A 1 199 ? 24.444  -10.053 20.005 1.00 20.48 ? 199 GLN A C    1 
ATOM   1549 O  O    . GLN A 1 199 ? 24.693  -8.863  19.811 1.00 21.07 ? 199 GLN A O    1 
ATOM   1550 C  CB   . GLN A 1 199 ? 22.078  -9.435  19.469 1.00 19.95 ? 199 GLN A CB   1 
ATOM   1551 C  CG   . GLN A 1 199 ? 20.627  -9.854  19.296 1.00 16.70 ? 199 GLN A CG   1 
ATOM   1552 C  CD   . GLN A 1 199 ? 20.147  -9.714  17.865 1.00 21.66 ? 199 GLN A CD   1 
ATOM   1553 O  OE1  . GLN A 1 199 ? 20.875  -10.020 16.921 1.00 22.52 ? 199 GLN A OE1  1 
ATOM   1554 N  NE2  . GLN A 1 199 ? 18.914  -9.250  17.697 1.00 22.44 ? 199 GLN A NE2  1 
ATOM   1555 N  N    . ARG A 1 200 ? 25.369  -10.924 20.396 1.00 20.76 ? 200 ARG A N    1 
ATOM   1556 C  CA   . ARG A 1 200 ? 26.765  -10.549 20.456 1.00 20.97 ? 200 ARG A CA   1 
ATOM   1557 C  C    . ARG A 1 200 ? 27.325  -9.988  19.157 1.00 21.04 ? 200 ARG A C    1 
ATOM   1558 O  O    . ARG A 1 200 ? 27.866  -8.909  19.144 1.00 19.98 ? 200 ARG A O    1 
ATOM   1559 C  CB   . ARG A 1 200 ? 27.646  -11.668 20.981 1.00 20.45 ? 200 ARG A CB   1 
ATOM   1560 C  CG   . ARG A 1 200 ? 29.136  -11.424 20.855 1.00 21.32 ? 200 ARG A CG   1 
ATOM   1561 C  CD   . ARG A 1 200 ? 29.661  -10.166 21.598 1.00 24.23 ? 200 ARG A CD   1 
ATOM   1562 N  NE   . ARG A 1 200 ? 29.192  -10.063 22.954 1.00 24.99 ? 200 ARG A NE   1 
ATOM   1563 C  CZ   . ARG A 1 200 ? 29.079  -8.943  23.631 1.00 25.93 ? 200 ARG A CZ   1 
ATOM   1564 N  NH1  . ARG A 1 200 ? 29.380  -7.795  23.090 1.00 21.41 ? 200 ARG A NH1  1 
ATOM   1565 N  NH2  . ARG A 1 200 ? 28.616  -8.985  24.829 1.00 24.37 ? 200 ARG A NH2  1 
ATOM   1566 N  N    . LYS A 1 201 ? 27.172  -10.739 18.077 1.00 20.02 ? 201 LYS A N    1 
ATOM   1567 C  CA   . LYS A 1 201 ? 27.654  -10.247 16.755 1.00 20.21 ? 201 LYS A CA   1 
ATOM   1568 C  C    . LYS A 1 201 ? 27.065  -8.894  16.381 1.00 20.71 ? 201 LYS A C    1 
ATOM   1569 O  O    . LYS A 1 201 ? 27.805  -7.965  16.015 1.00 18.13 ? 201 LYS A O    1 
ATOM   1570 C  CB   . LYS A 1 201 ? 27.370  -11.248 15.651 1.00 20.45 ? 201 LYS A CB   1 
ATOM   1571 C  CG   . LYS A 1 201 ? 28.242  -12.531 15.854 1.00 24.75 ? 201 LYS A CG   1 
ATOM   1572 C  CD   . LYS A 1 201 ? 28.413  -13.352 14.592 1.00 28.02 ? 201 LYS A CD   1 
ATOM   1573 C  CE   . LYS A 1 201 ? 29.570  -14.338 14.714 1.00 34.35 ? 201 LYS A CE   1 
ATOM   1574 N  NZ   . LYS A 1 201 ? 29.560  -15.207 13.505 1.00 38.48 ? 201 LYS A NZ   1 
ATOM   1575 N  N    . LEU A 1 202 ? 25.732  -8.774  16.442 1.00 19.34 ? 202 LEU A N    1 
ATOM   1576 C  CA   . LEU A 1 202 ? 25.171  -7.468  16.124 1.00 20.35 ? 202 LEU A CA   1 
ATOM   1577 C  C    . LEU A 1 202 ? 25.593  -6.355  17.057 1.00 20.19 ? 202 LEU A C    1 
ATOM   1578 O  O    . LEU A 1 202 ? 25.729  -5.223  16.616 1.00 21.25 ? 202 LEU A O    1 
ATOM   1579 C  CB   . LEU A 1 202 ? 23.652  -7.539  15.962 1.00 18.63 ? 202 LEU A CB   1 
ATOM   1580 C  CG   . LEU A 1 202 ? 22.845  -6.396  15.348 1.00 19.31 ? 202 LEU A CG   1 
ATOM   1581 C  CD1  . LEU A 1 202 ? 23.257  -6.021  13.896 1.00 20.57 ? 202 LEU A CD1  1 
ATOM   1582 C  CD2  . LEU A 1 202 ? 21.326  -6.743  15.345 1.00 18.66 ? 202 LEU A CD2  1 
ATOM   1583 N  N    . LEU A 1 203 ? 25.716  -6.634  18.350 1.00 21.70 ? 203 LEU A N    1 
ATOM   1584 C  CA   . LEU A 1 203 ? 26.080  -5.606  19.341 1.00 22.00 ? 203 LEU A CA   1 
ATOM   1585 C  C    . LEU A 1 203 ? 27.483  -5.077  19.069 1.00 22.12 ? 203 LEU A C    1 
ATOM   1586 O  O    . LEU A 1 203 ? 27.711  -3.847  19.101 1.00 21.44 ? 203 LEU A O    1 
ATOM   1587 C  CB   . LEU A 1 203 ? 26.047  -6.191  20.776 1.00 21.48 ? 203 LEU A CB   1 
ATOM   1588 C  CG   . LEU A 1 203 ? 26.540  -5.426  22.002 1.00 22.77 ? 203 LEU A CG   1 
ATOM   1589 C  CD1  . LEU A 1 203 ? 25.917  -3.987  22.044 1.00 23.51 ? 203 LEU A CD1  1 
ATOM   1590 C  CD2  . LEU A 1 203 ? 26.119  -6.199  23.228 1.00 20.34 ? 203 LEU A CD2  1 
ATOM   1591 N  N    . ASP A 1 204 ? 28.414  -6.012  18.830 1.00 22.69 ? 204 ASP A N    1 
ATOM   1592 C  CA   . ASP A 1 204 ? 29.798  -5.671  18.342 1.00 23.54 ? 204 ASP A CA   1 
ATOM   1593 C  C    . ASP A 1 204 ? 29.844  -4.824  17.067 1.00 23.22 ? 204 ASP A C    1 
ATOM   1594 O  O    . ASP A 1 204 ? 30.485  -3.746  17.027 1.00 23.82 ? 204 ASP A O    1 
ATOM   1595 C  CB   . ASP A 1 204 ? 30.703  -6.915  18.186 1.00 23.50 ? 204 ASP A CB   1 
ATOM   1596 C  CG   . ASP A 1 204 ? 31.001  -7.642  19.515 1.00 24.11 ? 204 ASP A CG   1 
ATOM   1597 O  OD1  . ASP A 1 204 ? 30.595  -7.182  20.626 1.00 24.58 ? 204 ASP A OD1  1 
ATOM   1598 O  OD2  . ASP A 1 204 ? 31.623  -8.749  19.450 1.00 28.55 ? 204 ASP A OD2  1 
ATOM   1599 N  N    . PHE A 1 205 ? 29.107  -5.264  16.041 1.00 24.14 ? 205 PHE A N    1 
ATOM   1600 C  CA   . PHE A 1 205 ? 28.982  -4.482  14.835 1.00 23.89 ? 205 PHE A CA   1 
ATOM   1601 C  C    . PHE A 1 205 ? 28.423  -3.042  15.108 1.00 23.05 ? 205 PHE A C    1 
ATOM   1602 O  O    . PHE A 1 205 ? 29.002  -2.039  14.651 1.00 22.94 ? 205 PHE A O    1 
ATOM   1603 C  CB   . PHE A 1 205 ? 28.163  -5.224  13.735 1.00 23.68 ? 205 PHE A CB   1 
ATOM   1604 C  CG   . PHE A 1 205 ? 28.115  -4.448  12.472 1.00 27.49 ? 205 PHE A CG   1 
ATOM   1605 C  CD1  . PHE A 1 205 ? 29.235  -4.401  11.624 1.00 28.13 ? 205 PHE A CD1  1 
ATOM   1606 C  CD2  . PHE A 1 205 ? 27.045  -3.582  12.224 1.00 24.41 ? 205 PHE A CD2  1 
ATOM   1607 C  CE1  . PHE A 1 205 ? 29.231  -3.576  10.478 1.00 28.60 ? 205 PHE A CE1  1 
ATOM   1608 C  CE2  . PHE A 1 205 ? 27.040  -2.758  11.090 1.00 25.16 ? 205 PHE A CE2  1 
ATOM   1609 C  CZ   . PHE A 1 205 ? 28.107  -2.762  10.212 1.00 29.12 ? 205 PHE A CZ   1 
ATOM   1610 N  N    . CYS A 1 206 ? 27.332  -2.920  15.863 1.00 22.00 ? 206 CYS A N    1 
ATOM   1611 C  CA   . CYS A 1 206 ? 26.783  -1.581  16.126 1.00 22.86 ? 206 CYS A CA   1 
ATOM   1612 C  C    . CYS A 1 206 ? 27.844  -0.734  16.845 1.00 23.27 ? 206 CYS A C    1 
ATOM   1613 O  O    . CYS A 1 206 ? 28.116  0.427   16.462 1.00 22.93 ? 206 CYS A O    1 
ATOM   1614 C  CB   . CYS A 1 206 ? 25.438  -1.604  16.901 1.00 21.33 ? 206 CYS A CB   1 
ATOM   1615 S  SG   . CYS A 1 206 ? 24.084  -2.316  15.974 1.00 24.17 ? 206 CYS A SG   1 
ATOM   1616 N  N    . LYS A 1 207 ? 28.426  -1.306  17.884 1.00 22.07 ? 207 LYS A N    1 
ATOM   1617 C  CA   . LYS A 1 207 ? 29.480  -0.610  18.606 1.00 22.87 ? 207 LYS A CA   1 
ATOM   1618 C  C    . LYS A 1 207 ? 30.602  -0.073  17.670 1.00 23.44 ? 207 LYS A C    1 
ATOM   1619 O  O    . LYS A 1 207 ? 31.020  1.087   17.784 1.00 23.66 ? 207 LYS A O    1 
ATOM   1620 C  CB   . LYS A 1 207 ? 30.072  -1.545  19.622 1.00 23.03 ? 207 LYS A CB   1 
ATOM   1621 C  CG   . LYS A 1 207 ? 31.076  -0.835  20.552 1.00 24.00 ? 207 LYS A CG   1 
ATOM   1622 C  CD   . LYS A 1 207 ? 31.934  -1.885  21.284 1.00 25.50 ? 207 LYS A CD   1 
ATOM   1623 C  CE   . LYS A 1 207 ? 33.163  -1.296  21.797 1.00 28.98 ? 207 LYS A CE   1 
ATOM   1624 N  NZ   . LYS A 1 207 ? 34.139  -2.324  22.247 1.00 29.11 ? 207 LYS A NZ   1 
ATOM   1625 N  N    . SER A 1 208 ? 31.093  -0.918  16.764 1.00 22.95 ? 208 SER A N    1 
ATOM   1626 C  CA   . SER A 1 208 ? 32.156  -0.544  15.826 1.00 23.21 ? 208 SER A CA   1 
ATOM   1627 C  C    . SER A 1 208 ? 31.813  0.672   14.941 1.00 24.08 ? 208 SER A C    1 
ATOM   1628 O  O    . SER A 1 208 ? 32.746  1.351   14.445 1.00 25.12 ? 208 SER A O    1 
ATOM   1629 C  CB   . SER A 1 208 ? 32.522  -1.721  14.936 1.00 22.85 ? 208 SER A CB   1 
ATOM   1630 O  OG   . SER A 1 208 ? 31.584  -1.846  13.844 1.00 21.82 ? 208 SER A OG   1 
ATOM   1631 N  N    . LYS A 1 209 ? 30.507  0.951   14.753 1.00 22.46 ? 209 LYS A N    1 
ATOM   1632 C  CA   . LYS A 1 209 ? 30.059  2.043   13.901 1.00 22.96 ? 209 LYS A CA   1 
ATOM   1633 C  C    . LYS A 1 209 ? 29.435  3.245   14.652 1.00 22.86 ? 209 LYS A C    1 
ATOM   1634 O  O    . LYS A 1 209 ? 28.770  4.076   14.039 1.00 21.75 ? 209 LYS A O    1 
ATOM   1635 C  CB   . LYS A 1 209 ? 29.082  1.520   12.847 1.00 23.63 ? 209 LYS A CB   1 
ATOM   1636 C  CG   . LYS A 1 209 ? 29.602  0.331   11.984 1.00 26.85 ? 209 LYS A CG   1 
ATOM   1637 C  CD   . LYS A 1 209 ? 30.687  0.764   10.968 1.00 31.79 ? 209 LYS A CD   1 
ATOM   1638 C  CE   . LYS A 1 209 ? 31.142  -0.402  10.080 1.00 34.30 ? 209 LYS A CE   1 
ATOM   1639 N  NZ   . LYS A 1 209 ? 31.384  -0.045  8.601  1.00 36.64 ? 209 LYS A NZ   1 
ATOM   1640 N  N    . ASP A 1 210 ? 29.677  3.325   15.952 1.00 22.62 ? 210 ASP A N    1 
ATOM   1641 C  CA   . ASP A 1 210 ? 29.083  4.342   16.822 1.00 23.89 ? 210 ASP A CA   1 
ATOM   1642 C  C    . ASP A 1 210 ? 27.530  4.269   16.859 1.00 21.93 ? 210 ASP A C    1 
ATOM   1643 O  O    . ASP A 1 210 ? 26.882  5.288   16.868 1.00 19.99 ? 210 ASP A O    1 
ATOM   1644 C  CB   . ASP A 1 210 ? 29.549  5.750   16.364 1.00 24.69 ? 210 ASP A CB   1 
ATOM   1645 C  CG   . ASP A 1 210 ? 29.654  6.769   17.519 1.00 28.59 ? 210 ASP A CG   1 
ATOM   1646 O  OD1  . ASP A 1 210 ? 29.252  6.475   18.711 1.00 27.32 ? 210 ASP A OD1  1 
ATOM   1647 O  OD2  . ASP A 1 210 ? 30.167  7.872   17.210 1.00 28.99 ? 210 ASP A OD2  1 
ATOM   1648 N  N    . ILE A 1 211 ? 26.960  3.065   16.828 1.00 19.78 ? 211 ILE A N    1 
ATOM   1649 C  CA   . ILE A 1 211 ? 25.503  2.911   16.917 1.00 20.54 ? 211 ILE A CA   1 
ATOM   1650 C  C    . ILE A 1 211 ? 25.138  2.197   18.251 1.00 20.17 ? 211 ILE A C    1 
ATOM   1651 O  O    . ILE A 1 211 ? 25.654  1.111   18.558 1.00 21.40 ? 211 ILE A O    1 
ATOM   1652 C  CB   . ILE A 1 211 ? 24.978  2.125   15.709 1.00 20.86 ? 211 ILE A CB   1 
ATOM   1653 C  CG1  . ILE A 1 211 ? 25.257  2.882   14.405 1.00 21.57 ? 211 ILE A CG1  1 
ATOM   1654 C  CG2  . ILE A 1 211 ? 23.440  1.692   15.877 1.00 20.62 ? 211 ILE A CG2  1 
ATOM   1655 C  CD1  . ILE A 1 211 ? 25.043  1.961   13.136 1.00 20.45 ? 211 ILE A CD1  1 
ATOM   1656 N  N    . VAL A 1 212 ? 24.266  2.778   19.044 1.00 19.56 ? 212 VAL A N    1 
ATOM   1657 C  CA   . VAL A 1 212 ? 23.746  2.073   20.253 1.00 19.49 ? 212 VAL A CA   1 
ATOM   1658 C  C    . VAL A 1 212 ? 22.785  0.920   19.946 1.00 18.43 ? 212 VAL A C    1 
ATOM   1659 O  O    . VAL A 1 212 ? 21.868  1.045   19.091 1.00 17.86 ? 212 VAL A O    1 
ATOM   1660 C  CB   . VAL A 1 212 ? 23.020  3.084   21.135 1.00 20.33 ? 212 VAL A CB   1 
ATOM   1661 C  CG1  . VAL A 1 212 ? 22.349  2.386   22.286 1.00 19.21 ? 212 VAL A CG1  1 
ATOM   1662 C  CG2  . VAL A 1 212 ? 24.108  4.109   21.662 1.00 21.90 ? 212 VAL A CG2  1 
ATOM   1663 N  N    . LEU A 1 213 ? 22.928  -0.184  20.671 1.00 18.63 ? 213 LEU A N    1 
ATOM   1664 C  CA   . LEU A 1 213 ? 21.978  -1.288  20.557 1.00 17.41 ? 213 LEU A CA   1 
ATOM   1665 C  C    . LEU A 1 213 ? 20.902  -1.184  21.640 1.00 18.26 ? 213 LEU A C    1 
ATOM   1666 O  O    . LEU A 1 213 ? 21.203  -1.297  22.829 1.00 18.57 ? 213 LEU A O    1 
ATOM   1667 C  CB   . LEU A 1 213 ? 22.701  -2.632  20.658 1.00 18.11 ? 213 LEU A CB   1 
ATOM   1668 C  CG   . LEU A 1 213 ? 21.906  -3.863  20.220 1.00 17.01 ? 213 LEU A CG   1 
ATOM   1669 C  CD1  . LEU A 1 213 ? 22.842  -4.976  19.772 1.00 25.22 ? 213 LEU A CD1  1 
ATOM   1670 C  CD2  . LEU A 1 213 ? 20.994  -4.342  21.339 1.00 20.53 ? 213 LEU A CD2  1 
ATOM   1671 N  N    . VAL A 1 214 ? 19.669  -0.926  21.217 1.00 18.04 ? 214 VAL A N    1 
ATOM   1672 C  CA   . VAL A 1 214 ? 18.547  -0.795  22.135 1.00 17.55 ? 214 VAL A CA   1 
ATOM   1673 C  C    . VAL A 1 214 ? 17.770  -2.101  22.169 1.00 17.08 ? 214 VAL A C    1 
ATOM   1674 O  O    . VAL A 1 214 ? 17.158  -2.496  21.176 1.00 17.22 ? 214 VAL A O    1 
ATOM   1675 C  CB   . VAL A 1 214 ? 17.604  0.347   21.719 1.00 17.51 ? 214 VAL A CB   1 
ATOM   1676 C  CG1  . VAL A 1 214 ? 16.411  0.420   22.660 1.00 18.08 ? 214 VAL A CG1  1 
ATOM   1677 C  CG2  . VAL A 1 214 ? 18.353  1.670   21.693 1.00 16.13 ? 214 VAL A CG2  1 
ATOM   1678 N  N    . ALA A 1 215 ? 17.817  -2.793  23.301 1.00 17.45 ? 215 ALA A N    1 
ATOM   1679 C  CA   . ALA A 1 215 ? 17.242  -4.131  23.392 1.00 18.45 ? 215 ALA A CA   1 
ATOM   1680 C  C    . ALA A 1 215 ? 15.750  -4.140  23.710 1.00 18.06 ? 215 ALA A C    1 
ATOM   1681 O  O    . ALA A 1 215 ? 15.332  -3.708  24.784 1.00 17.87 ? 215 ALA A O    1 
ATOM   1682 C  CB   . ALA A 1 215 ? 18.007  -4.964  24.414 1.00 18.41 ? 215 ALA A CB   1 
ATOM   1683 N  N    . TYR A 1 216 ? 14.951  -4.648  22.775 1.00 18.42 ? 216 TYR A N    1 
ATOM   1684 C  CA   . TYR A 1 216 ? 13.565  -4.857  23.023 1.00 17.15 ? 216 TYR A CA   1 
ATOM   1685 C  C    . TYR A 1 216 ? 13.250  -6.316  23.433 1.00 18.30 ? 216 TYR A C    1 
ATOM   1686 O  O    . TYR A 1 216 ? 14.063  -7.163  23.283 1.00 18.22 ? 216 TYR A O    1 
ATOM   1687 C  CB   . TYR A 1 216 ? 12.659  -4.334  21.924 1.00 17.83 ? 216 TYR A CB   1 
ATOM   1688 C  CG   . TYR A 1 216 ? 12.488  -5.114  20.664 1.00 14.75 ? 216 TYR A CG   1 
ATOM   1689 C  CD1  . TYR A 1 216 ? 11.987  -6.370  20.669 1.00 14.62 ? 216 TYR A CD1  1 
ATOM   1690 C  CD2  . TYR A 1 216 ? 12.773  -4.539  19.444 1.00 14.46 ? 216 TYR A CD2  1 
ATOM   1691 C  CE1  . TYR A 1 216 ? 11.829  -7.047  19.507 1.00 19.36 ? 216 TYR A CE1  1 
ATOM   1692 C  CE2  . TYR A 1 216 ? 12.598  -5.184  18.294 1.00 19.26 ? 216 TYR A CE2  1 
ATOM   1693 C  CZ   . TYR A 1 216 ? 12.109  -6.453  18.309 1.00 19.97 ? 216 TYR A CZ   1 
ATOM   1694 O  OH   . TYR A 1 216 ? 11.912  -7.107  17.138 1.00 16.66 ? 216 TYR A OH   1 
ATOM   1695 N  N    . SER A 1 217 ? 12.046  -6.529  23.960 1.00 18.58 ? 217 SER A N    1 
ATOM   1696 C  CA   . SER A 1 217 ? 11.626  -7.793  24.542 1.00 16.89 ? 217 SER A CA   1 
ATOM   1697 C  C    . SER A 1 217 ? 12.720  -8.352  25.426 1.00 16.75 ? 217 SER A C    1 
ATOM   1698 O  O    . SER A 1 217 ? 13.002  -9.501  25.404 1.00 15.27 ? 217 SER A O    1 
ATOM   1699 C  CB   . SER A 1 217 ? 11.211  -8.841  23.513 1.00 17.36 ? 217 SER A CB   1 
ATOM   1700 O  OG   . SER A 1 217 ? 10.178  -8.447  22.661 1.00 17.87 ? 217 SER A OG   1 
ATOM   1701 N  N    . ALA A 1 218 ? 13.314  -7.471  26.222 1.00 15.74 ? 218 ALA A N    1 
ATOM   1702 C  CA   . ALA A 1 218 ? 14.406  -7.843  27.109 1.00 15.99 ? 218 ALA A CA   1 
ATOM   1703 C  C    . ALA A 1 218 ? 13.958  -8.766  28.239 1.00 16.13 ? 218 ALA A C    1 
ATOM   1704 O  O    . ALA A 1 218 ? 14.785  -9.440  28.852 1.00 18.44 ? 218 ALA A O    1 
ATOM   1705 C  CB   . ALA A 1 218 ? 15.075  -6.598  27.675 1.00 15.49 ? 218 ALA A CB   1 
ATOM   1706 N  N    . LEU A 1 219 ? 12.658  -8.800  28.522 1.00 16.70 ? 219 LEU A N    1 
ATOM   1707 C  CA   . LEU A 1 219 ? 12.176  -9.646  29.623 1.00 17.39 ? 219 LEU A CA   1 
ATOM   1708 C  C    . LEU A 1 219 ? 11.578  -10.904 29.062 1.00 17.94 ? 219 LEU A C    1 
ATOM   1709 O  O    . LEU A 1 219 ? 10.867  -11.618 29.737 1.00 19.01 ? 219 LEU A O    1 
ATOM   1710 C  CB   . LEU A 1 219 ? 11.166  -8.925  30.559 1.00 17.13 ? 219 LEU A CB   1 
ATOM   1711 C  CG   . LEU A 1 219 ? 11.655  -7.548  31.061 1.00 17.42 ? 219 LEU A CG   1 
ATOM   1712 C  CD1  . LEU A 1 219 ? 10.544  -6.881  31.877 1.00 16.83 ? 219 LEU A CD1  1 
ATOM   1713 C  CD2  . LEU A 1 219 ? 12.988  -7.652  31.915 1.00 18.04 ? 219 LEU A CD2  1 
ATOM   1714 N  N    . GLY A 1 220 ? 11.870  -11.169 27.804 1.00 18.86 ? 220 GLY A N    1 
ATOM   1715 C  CA   . GLY A 1 220 ? 11.383  -12.394 27.153 1.00 19.53 ? 220 GLY A CA   1 
ATOM   1716 C  C    . GLY A 1 220 ? 10.122  -12.164 26.350 1.00 19.81 ? 220 GLY A C    1 
ATOM   1717 O  O    . GLY A 1 220 ? 9.493   -13.133 25.895 1.00 17.45 ? 220 GLY A O    1 
ATOM   1718 N  N    . SER A 1 221 ? 9.727   -10.902 26.184 1.00 19.83 ? 221 SER A N    1 
ATOM   1719 C  CA   . SER A 1 221 ? 8.597   -10.536 25.318 1.00 19.98 ? 221 SER A CA   1 
ATOM   1720 C  C    . SER A 1 221 ? 7.203   -10.632 25.958 1.00 20.38 ? 221 SER A C    1 
ATOM   1721 O  O    . SER A 1 221 ? 7.031   -11.255 27.006 1.00 21.12 ? 221 SER A O    1 
ATOM   1722 C  CB   . SER A 1 221 ? 8.631   -11.362 24.028 1.00 20.68 ? 221 SER A CB   1 
ATOM   1723 O  OG   . SER A 1 221 ? 7.809   -12.511 24.137 1.00 19.69 ? 221 SER A OG   1 
ATOM   1724 N  N    . HIS A 1 222 ? 6.216   -10.011 25.309 1.00 20.52 ? 222 HIS A N    1 
ATOM   1725 C  CA   . HIS A 1 222 ? 4.819   -10.067 25.749 1.00 18.68 ? 222 HIS A CA   1 
ATOM   1726 C  C    . HIS A 1 222 ? 4.254   -11.499 25.582 1.00 20.50 ? 222 HIS A C    1 
ATOM   1727 O  O    . HIS A 1 222 ? 3.224   -11.827 26.206 1.00 20.87 ? 222 HIS A O    1 
ATOM   1728 C  CB   . HIS A 1 222 ? 3.963   -9.012  25.000 1.00 18.60 ? 222 HIS A CB   1 
ATOM   1729 C  CG   . HIS A 1 222 ? 4.266   -8.893  23.524 1.00 18.62 ? 222 HIS A CG   1 
ATOM   1730 N  ND1  . HIS A 1 222 ? 4.053   -9.912  22.618 1.00 20.62 ? 222 HIS A ND1  1 
ATOM   1731 C  CD2  . HIS A 1 222 ? 4.848   -7.890  22.825 1.00 16.42 ? 222 HIS A CD2  1 
ATOM   1732 C  CE1  . HIS A 1 222 ? 4.453   -9.520  21.420 1.00 22.38 ? 222 HIS A CE1  1 
ATOM   1733 N  NE2  . HIS A 1 222 ? 4.953   -8.292  21.528 1.00 18.20 ? 222 HIS A NE2  1 
ATOM   1734 N  N    . ARG A 1 223 ? 4.870   -12.302 24.722 1.00 20.09 ? 223 ARG A N    1 
ATOM   1735 C  CA   . ARG A 1 223 ? 4.377   -13.648 24.448 1.00 21.38 ? 223 ARG A CA   1 
ATOM   1736 C  C    . ARG A 1 223 ? 2.985   -13.646 23.809 1.00 21.83 ? 223 ARG A C    1 
ATOM   1737 O  O    . ARG A 1 223 ? 2.247   -14.625 23.915 1.00 21.22 ? 223 ARG A O    1 
ATOM   1738 C  CB   . ARG A 1 223 ? 4.363   -14.483 25.730 1.00 20.08 ? 223 ARG A CB   1 
ATOM   1739 C  CG   . ARG A 1 223 ? 5.743   -14.778 26.294 1.00 22.05 ? 223 ARG A CG   1 
ATOM   1740 C  CD   . ARG A 1 223 ? 5.692   -15.899 27.320 1.00 23.39 ? 223 ARG A CD   1 
ATOM   1741 N  NE   . ARG A 1 223 ? 5.544   -17.209 26.692 1.00 23.43 ? 223 ARG A NE   1 
ATOM   1742 C  CZ   . ARG A 1 223 ? 6.551   -17.914 26.189 1.00 24.70 ? 223 ARG A CZ   1 
ATOM   1743 N  NH1  . ARG A 1 223 ? 7.788   -17.437 26.239 1.00 21.58 ? 223 ARG A NH1  1 
ATOM   1744 N  NH2  . ARG A 1 223 ? 6.324   -19.098 25.636 1.00 22.81 ? 223 ARG A NH2  1 
ATOM   1745 N  N    . GLU A 1 224 ? 2.631   -12.547 23.147 1.00 21.60 ? 224 GLU A N    1 
ATOM   1746 C  CA   . GLU A 1 224 ? 1.344   -12.437 22.471 1.00 22.30 ? 224 GLU A CA   1 
ATOM   1747 C  C    . GLU A 1 224 ? 1.295   -13.323 21.230 1.00 23.16 ? 224 GLU A C    1 
ATOM   1748 O  O    . GLU A 1 224 ? 2.271   -13.423 20.488 1.00 22.46 ? 224 GLU A O    1 
ATOM   1749 C  CB   . GLU A 1 224 ? 1.062   -10.982 22.089 1.00 20.54 ? 224 GLU A CB   1 
ATOM   1750 C  CG   . GLU A 1 224 ? -0.267  -10.773 21.381 1.00 22.52 ? 224 GLU A CG   1 
ATOM   1751 C  CD   . GLU A 1 224 ? -0.514  -9.321  21.023 1.00 22.36 ? 224 GLU A CD   1 
ATOM   1752 O  OE1  . GLU A 1 224 ? 0.354   -8.476  21.329 1.00 21.07 ? 224 GLU A OE1  1 
ATOM   1753 O  OE2  . GLU A 1 224 ? -1.576  -9.024  20.437 1.00 26.85 ? 224 GLU A OE2  1 
ATOM   1754 N  N    . GLU A 1 225 ? 0.151   -13.964 21.012 1.00 23.95 ? 225 GLU A N    1 
ATOM   1755 C  CA   . GLU A 1 225 ? -0.028  -14.842 19.862 1.00 24.50 ? 225 GLU A CA   1 
ATOM   1756 C  C    . GLU A 1 225 ? -0.757  -14.126 18.730 1.00 23.93 ? 225 GLU A C    1 
ATOM   1757 O  O    . GLU A 1 225 ? -1.573  -13.236 18.969 1.00 24.18 ? 225 GLU A O    1 
ATOM   1758 C  CB   . GLU A 1 225 ? -0.794  -16.104 20.266 1.00 25.12 ? 225 GLU A CB   1 
ATOM   1759 C  CG   . GLU A 1 225 ? -0.107  -16.930 21.340 1.00 29.39 ? 225 GLU A CG   1 
ATOM   1760 C  CD   . GLU A 1 225 ? -0.894  -18.170 21.714 1.00 32.25 ? 225 GLU A CD   1 
ATOM   1761 O  OE1  . GLU A 1 225 ? -1.977  -18.387 21.132 1.00 35.54 ? 225 GLU A OE1  1 
ATOM   1762 O  OE2  . GLU A 1 225 ? -0.430  -18.929 22.591 1.00 32.11 ? 225 GLU A OE2  1 
ATOM   1763 N  N    . PRO A 1 226 ? -0.458  -14.521 17.497 1.00 24.89 ? 226 PRO A N    1 
ATOM   1764 C  CA   . PRO A 1 226 ? 0.519   -15.585 17.245 1.00 25.66 ? 226 PRO A CA   1 
ATOM   1765 C  C    . PRO A 1 226 ? 1.865   -15.024 16.799 1.00 24.94 ? 226 PRO A C    1 
ATOM   1766 O  O    . PRO A 1 226 ? 2.509   -15.594 15.918 1.00 26.20 ? 226 PRO A O    1 
ATOM   1767 C  CB   . PRO A 1 226 ? -0.123  -16.380 16.106 1.00 26.43 ? 226 PRO A CB   1 
ATOM   1768 C  CG   . PRO A 1 226 ? -0.963  -15.385 15.389 1.00 27.44 ? 226 PRO A CG   1 
ATOM   1769 C  CD   . PRO A 1 226 ? -1.485  -14.450 16.443 1.00 25.09 ? 226 PRO A CD   1 
ATOM   1770 N  N    . TRP A 1 227 ? 2.279   -13.916 17.405 1.00 23.07 ? 227 TRP A N    1 
ATOM   1771 C  CA   . TRP A 1 227 ? 3.549   -13.286 17.065 1.00 22.44 ? 227 TRP A CA   1 
ATOM   1772 C  C    . TRP A 1 227 ? 4.724   -14.058 17.655 1.00 21.08 ? 227 TRP A C    1 
ATOM   1773 O  O    . TRP A 1 227 ? 5.819   -14.065 17.094 1.00 20.74 ? 227 TRP A O    1 
ATOM   1774 C  CB   . TRP A 1 227 ? 3.575   -11.836 17.552 1.00 21.72 ? 227 TRP A CB   1 
ATOM   1775 C  CG   . TRP A 1 227 ? 2.480   -10.990 16.976 1.00 25.55 ? 227 TRP A CG   1 
ATOM   1776 C  CD1  . TRP A 1 227 ? 1.240   -10.782 17.505 1.00 23.15 ? 227 TRP A CD1  1 
ATOM   1777 C  CD2  . TRP A 1 227 ? 2.527   -10.238 15.757 1.00 22.40 ? 227 TRP A CD2  1 
ATOM   1778 N  NE1  . TRP A 1 227 ? 0.512   -9.948  16.693 1.00 26.72 ? 227 TRP A NE1  1 
ATOM   1779 C  CE2  . TRP A 1 227 ? 1.280   -9.599  15.613 1.00 25.26 ? 227 TRP A CE2  1 
ATOM   1780 C  CE3  . TRP A 1 227 ? 3.503   -10.043 14.775 1.00 21.93 ? 227 TRP A CE3  1 
ATOM   1781 C  CZ2  . TRP A 1 227 ? 0.982   -8.779  14.526 1.00 23.26 ? 227 TRP A CZ2  1 
ATOM   1782 C  CZ3  . TRP A 1 227 ? 3.206   -9.228  13.697 1.00 19.42 ? 227 TRP A CZ3  1 
ATOM   1783 C  CH2  . TRP A 1 227 ? 1.956   -8.607  13.581 1.00 19.63 ? 227 TRP A CH2  1 
ATOM   1784 N  N    . VAL A 1 228 ? 4.488   -14.706 18.791 1.00 21.58 ? 228 VAL A N    1 
ATOM   1785 C  CA   . VAL A 1 228 ? 5.526   -15.483 19.460 1.00 21.64 ? 228 VAL A CA   1 
ATOM   1786 C  C    . VAL A 1 228 ? 5.031   -16.883 19.805 1.00 22.50 ? 228 VAL A C    1 
ATOM   1787 O  O    . VAL A 1 228 ? 4.030   -17.043 20.505 1.00 23.53 ? 228 VAL A O    1 
ATOM   1788 C  CB   . VAL A 1 228 ? 6.010   -14.788 20.746 1.00 22.73 ? 228 VAL A CB   1 
ATOM   1789 C  CG1  . VAL A 1 228 ? 7.040   -15.651 21.459 1.00 23.41 ? 228 VAL A CG1  1 
ATOM   1790 C  CG2  . VAL A 1 228 ? 6.585   -13.417 20.423 1.00 23.14 ? 228 VAL A CG2  1 
ATOM   1791 N  N    . ASP A 1 229 ? 5.737   -17.894 19.311 1.00 22.68 ? 229 ASP A N    1 
ATOM   1792 C  CA   . ASP A 1 229 ? 5.371   -19.282 19.566 1.00 23.43 ? 229 ASP A CA   1 
ATOM   1793 C  C    . ASP A 1 229 ? 5.168   -19.533 21.056 1.00 24.25 ? 229 ASP A C    1 
ATOM   1794 O  O    . ASP A 1 229 ? 6.061   -19.282 21.865 1.00 24.79 ? 229 ASP A O    1 
ATOM   1795 C  CB   . ASP A 1 229 ? 6.438   -20.228 19.013 1.00 24.24 ? 229 ASP A CB   1 
ATOM   1796 C  CG   . ASP A 1 229 ? 6.104   -21.687 19.253 1.00 26.75 ? 229 ASP A CG   1 
ATOM   1797 O  OD1  . ASP A 1 229 ? 5.042   -21.965 19.849 1.00 24.38 ? 229 ASP A OD1  1 
ATOM   1798 O  OD2  . ASP A 1 229 ? 6.903   -22.556 18.846 1.00 29.97 ? 229 ASP A OD2  1 
ATOM   1799 N  N    . PRO A 1 230 ? 3.988   -20.031 21.412 1.00 24.84 ? 230 PRO A N    1 
ATOM   1800 C  CA   . PRO A 1 230 ? 3.663   -20.320 22.817 1.00 23.39 ? 230 PRO A CA   1 
ATOM   1801 C  C    . PRO A 1 230 ? 4.495   -21.500 23.378 1.00 23.02 ? 230 PRO A C    1 
ATOM   1802 O  O    . PRO A 1 230 ? 4.570   -21.671 24.596 1.00 23.50 ? 230 PRO A O    1 
ATOM   1803 C  CB   . PRO A 1 230 ? 2.176   -20.665 22.764 1.00 24.98 ? 230 PRO A CB   1 
ATOM   1804 C  CG   . PRO A 1 230 ? 1.984   -21.177 21.452 1.00 23.77 ? 230 PRO A CG   1 
ATOM   1805 C  CD   . PRO A 1 230 ? 2.893   -20.423 20.523 1.00 24.57 ? 230 PRO A CD   1 
ATOM   1806 N  N    . ASN A 1 231 ? 5.171   -22.254 22.514 1.00 20.99 ? 231 ASN A N    1 
ATOM   1807 C  CA   . ASN A 1 231 ? 6.001   -23.340 22.977 1.00 20.08 ? 231 ASN A CA   1 
ATOM   1808 C  C    . ASN A 1 231 ? 7.450   -22.927 23.276 1.00 19.54 ? 231 ASN A C    1 
ATOM   1809 O  O    . ASN A 1 231 ? 8.269   -23.777 23.620 1.00 18.22 ? 231 ASN A O    1 
ATOM   1810 C  CB   . ASN A 1 231 ? 5.959   -24.503 21.982 1.00 19.49 ? 231 ASN A CB   1 
ATOM   1811 C  CG   . ASN A 1 231 ? 4.521   -24.973 21.689 1.00 24.95 ? 231 ASN A CG   1 
ATOM   1812 O  OD1  . ASN A 1 231 ? 3.666   -24.989 22.590 1.00 25.58 ? 231 ASN A OD1  1 
ATOM   1813 N  ND2  . ASN A 1 231 ? 4.247   -25.332 20.410 1.00 24.89 ? 231 ASN A ND2  1 
ATOM   1814 N  N    . SER A 1 232 ? 7.794   -21.641 23.091 1.00 18.31 ? 232 SER A N    1 
ATOM   1815 C  CA   . SER A 1 232 ? 9.130   -21.234 23.351 1.00 18.61 ? 232 SER A CA   1 
ATOM   1816 C  C    . SER A 1 232 ? 9.360   -21.247 24.857 1.00 18.83 ? 232 SER A C    1 
ATOM   1817 O  O    . SER A 1 232 ? 8.421   -20.983 25.620 1.00 19.27 ? 232 SER A O    1 
ATOM   1818 C  CB   . SER A 1 232 ? 9.335   -19.812 22.840 1.00 17.35 ? 232 SER A CB   1 
ATOM   1819 O  OG   . SER A 1 232 ? 8.348   -18.981 23.442 1.00 20.10 ? 232 SER A OG   1 
ATOM   1820 N  N    . PRO A 1 233 ? 10.619  -21.469 25.289 1.00 19.01 ? 233 PRO A N    1 
ATOM   1821 C  CA   . PRO A 1 233 ? 10.897  -21.388 26.703 1.00 19.43 ? 233 PRO A CA   1 
ATOM   1822 C  C    . PRO A 1 233 ? 10.545  -19.999 27.214 1.00 20.04 ? 233 PRO A C    1 
ATOM   1823 O  O    . PRO A 1 233 ? 10.685  -19.005 26.460 1.00 19.10 ? 233 PRO A O    1 
ATOM   1824 C  CB   . PRO A 1 233 ? 12.403  -21.626 26.780 1.00 20.58 ? 233 PRO A CB   1 
ATOM   1825 C  CG   . PRO A 1 233 ? 12.951  -21.292 25.377 1.00 20.35 ? 233 PRO A CG   1 
ATOM   1826 C  CD   . PRO A 1 233 ? 11.836  -21.523 24.446 1.00 19.31 ? 233 PRO A CD   1 
ATOM   1827 N  N    . VAL A 1 234 ? 10.157  -19.928 28.479 1.00 19.70 ? 234 VAL A N    1 
ATOM   1828 C  CA   . VAL A 1 234 ? 9.804   -18.642 29.116 1.00 20.24 ? 234 VAL A CA   1 
ATOM   1829 C  C    . VAL A 1 234 ? 11.069  -18.069 29.808 1.00 20.68 ? 234 VAL A C    1 
ATOM   1830 O  O    . VAL A 1 234 ? 11.588  -18.622 30.783 1.00 20.30 ? 234 VAL A O    1 
ATOM   1831 C  CB   . VAL A 1 234 ? 8.639   -18.829 30.131 1.00 18.79 ? 234 VAL A CB   1 
ATOM   1832 C  CG1  . VAL A 1 234 ? 8.241   -17.488 30.774 1.00 20.44 ? 234 VAL A CG1  1 
ATOM   1833 C  CG2  . VAL A 1 234 ? 7.399   -19.544 29.411 1.00 21.31 ? 234 VAL A CG2  1 
ATOM   1834 N  N    . LEU A 1 235 ? 11.538  -16.919 29.321 1.00 21.20 ? 235 LEU A N    1 
ATOM   1835 C  CA   . LEU A 1 235 ? 12.811  -16.361 29.780 1.00 19.62 ? 235 LEU A CA   1 
ATOM   1836 C  C    . LEU A 1 235 ? 12.843  -16.150 31.295 1.00 20.32 ? 235 LEU A C    1 
ATOM   1837 O  O    . LEU A 1 235 ? 13.847  -16.439 31.942 1.00 19.75 ? 235 LEU A O    1 
ATOM   1838 C  CB   . LEU A 1 235 ? 13.142  -15.020 29.087 1.00 18.43 ? 235 LEU A CB   1 
ATOM   1839 C  CG   . LEU A 1 235 ? 14.493  -14.419 29.554 1.00 18.45 ? 235 LEU A CG   1 
ATOM   1840 C  CD1  . LEU A 1 235 ? 15.782  -15.029 28.898 1.00 18.35 ? 235 LEU A CD1  1 
ATOM   1841 C  CD2  . LEU A 1 235 ? 14.504  -12.846 29.265 1.00 17.57 ? 235 LEU A CD2  1 
ATOM   1842 N  N    . LEU A 1 236 ? 11.736  -15.712 31.856 1.00 21.13 ? 236 LEU A N    1 
ATOM   1843 C  CA   . LEU A 1 236 ? 11.735  -15.341 33.255 1.00 23.07 ? 236 LEU A CA   1 
ATOM   1844 C  C    . LEU A 1 236 ? 11.606  -16.548 34.193 1.00 24.46 ? 236 LEU A C    1 
ATOM   1845 O  O    . LEU A 1 236 ? 11.733  -16.385 35.418 1.00 25.00 ? 236 LEU A O    1 
ATOM   1846 C  CB   . LEU A 1 236 ? 10.662  -14.276 33.547 1.00 23.11 ? 236 LEU A CB   1 
ATOM   1847 C  CG   . LEU A 1 236 ? 10.926  -12.909 32.896 1.00 22.75 ? 236 LEU A CG   1 
ATOM   1848 C  CD1  . LEU A 1 236 ? 10.110  -11.839 33.578 1.00 26.84 ? 236 LEU A CD1  1 
ATOM   1849 C  CD2  . LEU A 1 236 ? 12.406  -12.545 32.882 1.00 28.45 ? 236 LEU A CD2  1 
ATOM   1850 N  N    . GLU A 1 237 ? 11.427  -17.753 33.630 1.00 24.23 ? 237 GLU A N    1 
ATOM   1851 C  CA   . GLU A 1 237 ? 11.453  -18.954 34.465 1.00 24.55 ? 237 GLU A CA   1 
ATOM   1852 C  C    . GLU A 1 237 ? 12.820  -19.581 34.491 1.00 23.78 ? 237 GLU A C    1 
ATOM   1853 O  O    . GLU A 1 237 ? 12.981  -20.681 35.053 1.00 22.12 ? 237 GLU A O    1 
ATOM   1854 C  CB   . GLU A 1 237 ? 10.371  -19.983 34.061 1.00 25.28 ? 237 GLU A CB   1 
ATOM   1855 C  CG   . GLU A 1 237 ? 8.954   -19.400 34.136 1.00 25.48 ? 237 GLU A CG   1 
ATOM   1856 C  CD   . GLU A 1 237 ? 7.898   -20.354 33.588 1.00 30.20 ? 237 GLU A CD   1 
ATOM   1857 O  OE1  . GLU A 1 237 ? 8.199   -21.550 33.283 1.00 33.56 ? 237 GLU A OE1  1 
ATOM   1858 O  OE2  . GLU A 1 237 ? 6.745   -19.910 33.446 1.00 31.89 ? 237 GLU A OE2  1 
ATOM   1859 N  N    . ASP A 1 238 ? 13.800  -18.897 33.880 1.00 21.86 ? 238 ASP A N    1 
ATOM   1860 C  CA   . ASP A 1 238 ? 15.129  -19.456 33.722 1.00 21.78 ? 238 ASP A CA   1 
ATOM   1861 C  C    . ASP A 1 238 ? 15.775  -19.704 35.061 1.00 21.69 ? 238 ASP A C    1 
ATOM   1862 O  O    . ASP A 1 238 ? 15.832  -18.789 35.873 1.00 20.73 ? 238 ASP A O    1 
ATOM   1863 C  CB   . ASP A 1 238 ? 16.078  -18.551 32.871 1.00 21.38 ? 238 ASP A CB   1 
ATOM   1864 C  CG   . ASP A 1 238 ? 17.425  -19.207 32.672 1.00 23.43 ? 238 ASP A CG   1 
ATOM   1865 O  OD1  . ASP A 1 238 ? 17.536  -20.046 31.762 1.00 25.18 ? 238 ASP A OD1  1 
ATOM   1866 O  OD2  . ASP A 1 238 ? 18.353  -18.989 33.489 1.00 25.59 ? 238 ASP A OD2  1 
ATOM   1867 N  N    . PRO A 1 239 ? 16.221  -20.949 35.342 1.00 21.91 ? 239 PRO A N    1 
ATOM   1868 C  CA   . PRO A 1 239 ? 16.802  -21.246 36.668 1.00 23.10 ? 239 PRO A CA   1 
ATOM   1869 C  C    . PRO A 1 239 ? 17.995  -20.380 37.118 1.00 22.81 ? 239 PRO A C    1 
ATOM   1870 O  O    . PRO A 1 239 ? 18.125  -20.086 38.285 1.00 23.80 ? 239 PRO A O    1 
ATOM   1871 C  CB   . PRO A 1 239 ? 17.290  -22.729 36.530 1.00 23.77 ? 239 PRO A CB   1 
ATOM   1872 C  CG   . PRO A 1 239 ? 16.531  -23.297 35.442 1.00 23.14 ? 239 PRO A CG   1 
ATOM   1873 C  CD   . PRO A 1 239 ? 16.223  -22.147 34.469 1.00 23.48 ? 239 PRO A CD   1 
ATOM   1874 N  N    . VAL A 1 240 ? 18.848  -19.986 36.189 1.00 21.68 ? 240 VAL A N    1 
ATOM   1875 C  CA   . VAL A 1 240 ? 20.013  -19.205 36.496 1.00 21.48 ? 240 VAL A CA   1 
ATOM   1876 C  C    . VAL A 1 240 ? 19.614  -17.739 36.787 1.00 20.54 ? 240 VAL A C    1 
ATOM   1877 O  O    . VAL A 1 240 ? 20.127  -17.117 37.716 1.00 21.28 ? 240 VAL A O    1 
ATOM   1878 C  CB   . VAL A 1 240 ? 21.004  -19.210 35.303 1.00 19.95 ? 240 VAL A CB   1 
ATOM   1879 C  CG1  . VAL A 1 240 ? 22.169  -18.195 35.581 1.00 21.04 ? 240 VAL A CG1  1 
ATOM   1880 C  CG2  . VAL A 1 240 ? 21.479  -20.662 34.997 1.00 21.02 ? 240 VAL A CG2  1 
ATOM   1881 N  N    . LEU A 1 241 ? 18.677  -17.206 36.036 1.00 20.89 ? 241 LEU A N    1 
ATOM   1882 C  CA   . LEU A 1 241 ? 18.164  -15.876 36.388 1.00 22.11 ? 241 LEU A CA   1 
ATOM   1883 C  C    . LEU A 1 241 ? 17.470  -15.886 37.733 1.00 23.08 ? 241 LEU A C    1 
ATOM   1884 O  O    . LEU A 1 241 ? 17.532  -14.895 38.460 1.00 22.72 ? 241 LEU A O    1 
ATOM   1885 C  CB   . LEU A 1 241 ? 17.234  -15.316 35.312 1.00 21.54 ? 241 LEU A CB   1 
ATOM   1886 C  CG   . LEU A 1 241 ? 17.824  -15.102 33.916 1.00 21.81 ? 241 LEU A CG   1 
ATOM   1887 C  CD1  . LEU A 1 241 ? 16.738  -14.495 33.032 1.00 20.86 ? 241 LEU A CD1  1 
ATOM   1888 C  CD2  . LEU A 1 241 ? 19.085  -14.244 33.908 1.00 19.89 ? 241 LEU A CD2  1 
ATOM   1889 N  N    . CYS A 1 242 ? 16.809  -16.997 38.068 1.00 24.14 ? 242 CYS A N    1 
ATOM   1890 C  CA   A CYS A 1 242 ? 16.129  -17.149 39.388 0.50 25.84 ? 242 CYS A CA   1 
ATOM   1891 C  CA   B CYS A 1 242 ? 16.139  -17.128 39.376 0.50 25.14 ? 242 CYS A CA   1 
ATOM   1892 C  C    . CYS A 1 242 ? 17.136  -17.262 40.555 1.00 24.98 ? 242 CYS A C    1 
ATOM   1893 O  O    . CYS A 1 242 ? 16.947  -16.659 41.622 1.00 24.75 ? 242 CYS A O    1 
ATOM   1894 C  CB   A CYS A 1 242 ? 15.165  -18.353 39.411 0.50 25.58 ? 242 CYS A CB   1 
ATOM   1895 C  CB   B CYS A 1 242 ? 15.145  -18.289 39.335 0.50 24.75 ? 242 CYS A CB   1 
ATOM   1896 S  SG   A CYS A 1 242 ? 14.451  -18.693 41.079 0.50 30.15 ? 242 CYS A SG   1 
ATOM   1897 S  SG   B CYS A 1 242 ? 13.828  -17.954 38.179 0.50 24.92 ? 242 CYS A SG   1 
ATOM   1898 N  N    . ALA A 1 243 ? 18.197  -18.046 40.356 1.00 25.65 ? 243 ALA A N    1 
ATOM   1899 C  CA   . ALA A 1 243 ? 19.275  -18.177 41.390 1.00 24.65 ? 243 ALA A CA   1 
ATOM   1900 C  C    . ALA A 1 243 ? 19.971  -16.830 41.597 1.00 23.76 ? 243 ALA A C    1 
ATOM   1901 O  O    . ALA A 1 243 ? 20.117  -16.373 42.731 1.00 22.51 ? 243 ALA A O    1 
ATOM   1902 C  CB   . ALA A 1 243 ? 20.293  -19.313 41.045 1.00 23.84 ? 243 ALA A CB   1 
ATOM   1903 N  N    . LEU A 1 244 ? 20.341  -16.164 40.491 1.00 22.93 ? 244 LEU A N    1 
ATOM   1904 C  CA   . LEU A 1 244 ? 20.911  -14.805 40.548 1.00 21.32 ? 244 LEU A CA   1 
ATOM   1905 C  C    . LEU A 1 244 ? 19.963  -13.795 41.252 1.00 22.21 ? 244 LEU A C    1 
ATOM   1906 O  O    . LEU A 1 244 ? 20.420  -12.945 42.030 1.00 21.77 ? 244 LEU A O    1 
ATOM   1907 C  CB   . LEU A 1 244 ? 21.304  -14.332 39.123 1.00 20.69 ? 244 LEU A CB   1 
ATOM   1908 C  CG   . LEU A 1 244 ? 22.529  -14.999 38.452 1.00 18.38 ? 244 LEU A CG   1 
ATOM   1909 C  CD1  . LEU A 1 244 ? 22.622  -14.645 36.932 1.00 17.64 ? 244 LEU A CD1  1 
ATOM   1910 C  CD2  . LEU A 1 244 ? 23.914  -14.636 39.179 1.00 18.76 ? 244 LEU A CD2  1 
ATOM   1911 N  N    . ALA A 1 245 ? 18.664  -13.876 40.972 1.00 21.54 ? 245 ALA A N    1 
ATOM   1912 C  CA   . ALA A 1 245 ? 17.677  -13.037 41.640 1.00 22.54 ? 245 ALA A CA   1 
ATOM   1913 C  C    . ALA A 1 245 ? 17.688  -13.236 43.158 1.00 23.45 ? 245 ALA A C    1 
ATOM   1914 O  O    . ALA A 1 245 ? 17.757  -12.260 43.891 1.00 22.83 ? 245 ALA A O    1 
ATOM   1915 C  CB   . ALA A 1 245 ? 16.294  -13.341 41.113 1.00 23.78 ? 245 ALA A CB   1 
ATOM   1916 N  N    . LYS A 1 246 ? 17.559  -14.495 43.621 1.00 22.60 ? 246 LYS A N    1 
ATOM   1917 C  CA   . LYS A 1 246 ? 17.626  -14.807 45.061 1.00 24.27 ? 246 LYS A CA   1 
ATOM   1918 C  C    . LYS A 1 246 ? 18.912  -14.321 45.718 1.00 23.29 ? 246 LYS A C    1 
ATOM   1919 O  O    . LYS A 1 246 ? 18.850  -13.747 46.813 1.00 23.23 ? 246 LYS A O    1 
ATOM   1920 C  CB   . LYS A 1 246 ? 17.566  -16.326 45.293 1.00 24.69 ? 246 LYS A CB   1 
ATOM   1921 C  CG   . LYS A 1 246 ? 16.237  -16.873 45.442 1.00 26.98 ? 246 LYS A CG   1 
ATOM   1922 C  CD   . LYS A 1 246 ? 16.087  -18.215 44.737 0.70 27.94 ? 246 LYS A CD   1 
ATOM   1923 C  CE   . LYS A 1 246 ? 14.615  -18.602 44.625 0.70 27.98 ? 246 LYS A CE   1 
ATOM   1924 N  NZ   . LYS A 1 246 ? 14.524  -20.118 44.565 0.70 29.28 ? 246 LYS A NZ   1 
ATOM   1925 N  N    . LYS A 1 247 ? 20.064  -14.581 45.093 1.00 23.58 ? 247 LYS A N    1 
ATOM   1926 C  CA   . LYS A 1 247 ? 21.372  -14.178 45.655 1.00 24.87 ? 247 LYS A CA   1 
ATOM   1927 C  C    . LYS A 1 247 ? 21.490  -12.645 45.868 1.00 25.58 ? 247 LYS A C    1 
ATOM   1928 O  O    . LYS A 1 247 ? 22.247  -12.189 46.726 1.00 24.30 ? 247 LYS A O    1 
ATOM   1929 C  CB   . LYS A 1 247 ? 22.498  -14.601 44.724 1.00 26.13 ? 247 LYS A CB   1 
ATOM   1930 C  CG   . LYS A 1 247 ? 23.872  -13.998 45.068 1.00 27.84 ? 247 LYS A CG   1 
ATOM   1931 C  CD   . LYS A 1 247 ? 24.966  -14.912 44.595 1.00 32.58 ? 247 LYS A CD   1 
ATOM   1932 C  CE   . LYS A 1 247 ? 26.347  -14.407 45.021 1.00 36.78 ? 247 LYS A CE   1 
ATOM   1933 N  NZ   . LYS A 1 247 ? 27.468  -15.279 44.531 0.50 36.09 ? 247 LYS A NZ   1 
ATOM   1934 N  N    . HIS A 1 248 ? 20.749  -11.871 45.090 1.00 24.56 ? 248 HIS A N    1 
ATOM   1935 C  CA   . HIS A 1 248 ? 20.884  -10.389 45.124 1.00 24.99 ? 248 HIS A CA   1 
ATOM   1936 C  C    . HIS A 1 248 ? 19.635  -9.735  45.667 1.00 26.12 ? 248 HIS A C    1 
ATOM   1937 O  O    . HIS A 1 248 ? 19.502  -8.508  45.538 1.00 26.67 ? 248 HIS A O    1 
ATOM   1938 C  CB   . HIS A 1 248 ? 21.185  -9.830  43.713 1.00 24.56 ? 248 HIS A CB   1 
ATOM   1939 C  CG   . HIS A 1 248 ? 22.407  -10.416 43.067 1.00 25.64 ? 248 HIS A CG   1 
ATOM   1940 N  ND1  . HIS A 1 248 ? 22.425  -11.656 42.443 1.00 24.04 ? 248 HIS A ND1  1 
ATOM   1941 C  CD2  . HIS A 1 248 ? 23.682  -9.948  43.015 1.00 23.05 ? 248 HIS A CD2  1 
ATOM   1942 C  CE1  . HIS A 1 248 ? 23.646  -11.900 42.003 1.00 18.53 ? 248 HIS A CE1  1 
ATOM   1943 N  NE2  . HIS A 1 248 ? 24.422  -10.873 42.325 1.00 22.75 ? 248 HIS A NE2  1 
ATOM   1944 N  N    . LYS A 1 249 ? 18.739  -10.519 46.257 1.00 24.92 ? 249 LYS A N    1 
ATOM   1945 C  CA   . LYS A 1 249 ? 17.500  -9.984  46.811 1.00 26.15 ? 249 LYS A CA   1 
ATOM   1946 C  C    . LYS A 1 249 ? 16.719  -9.203  45.759 1.00 25.54 ? 249 LYS A C    1 
ATOM   1947 O  O    . LYS A 1 249 ? 16.380  -8.038  45.962 1.00 22.83 ? 249 LYS A O    1 
ATOM   1948 C  CB   . LYS A 1 249 ? 17.794  -9.091  48.018 1.00 26.05 ? 249 LYS A CB   1 
ATOM   1949 C  CG   . LYS A 1 249 ? 18.166  -9.854  49.279 1.00 28.98 ? 249 LYS A CG   1 
ATOM   1950 C  CD   . LYS A 1 249 ? 17.515  -11.228 49.305 1.00 28.04 ? 249 LYS A CD   1 
ATOM   1951 C  CE   . LYS A 1 249 ? 18.119  -12.104 50.390 1.00 31.22 ? 249 LYS A CE   1 
ATOM   1952 N  NZ   . LYS A 1 249 ? 17.311  -13.333 50.625 1.00 36.84 ? 249 LYS A NZ   1 
ATOM   1953 N  N    . ARG A 1 250 ? 16.436  -9.854  44.635 1.00 26.49 ? 250 ARG A N    1 
ATOM   1954 C  CA   . ARG A 1 250 ? 15.695  -9.223  43.550 1.00 26.07 ? 250 ARG A CA   1 
ATOM   1955 C  C    . ARG A 1 250 ? 15.059  -10.304 42.683 1.00 26.07 ? 250 ARG A C    1 
ATOM   1956 O  O    . ARG A 1 250 ? 15.118  -11.490 43.010 1.00 26.47 ? 250 ARG A O    1 
ATOM   1957 C  CB   . ARG A 1 250 ? 16.649  -8.485  42.608 1.00 25.20 ? 250 ARG A CB   1 
ATOM   1958 C  CG   . ARG A 1 250 ? 17.743  -7.705  43.319 1.00 24.92 ? 250 ARG A CG   1 
ATOM   1959 C  CD   . ARG A 1 250 ? 17.423  -6.219  43.361 1.00 27.05 ? 250 ARG A CD   1 
ATOM   1960 N  NE   . ARG A 1 250 ? 18.380  -5.477  44.177 1.00 32.94 ? 250 ARG A NE   1 
ATOM   1961 C  CZ   . ARG A 1 250 ? 18.159  -4.261  44.665 1.00 33.93 ? 250 ARG A CZ   1 
ATOM   1962 N  NH1  . ARG A 1 250 ? 17.011  -3.644  44.422 1.00 33.73 ? 250 ARG A NH1  1 
ATOM   1963 N  NH2  . ARG A 1 250 ? 19.087  -3.660  45.398 1.00 37.25 ? 250 ARG A NH2  1 
ATOM   1964 N  N    . THR A 1 251 ? 14.451  -9.888  41.577 1.00 25.23 ? 251 THR A N    1 
ATOM   1965 C  CA   . THR A 1 251 ? 13.804  -10.819 40.661 1.00 23.88 ? 251 THR A CA   1 
ATOM   1966 C  C    . THR A 1 251 ? 14.531  -11.100 39.350 1.00 23.33 ? 251 THR A C    1 
ATOM   1967 O  O    . THR A 1 251 ? 15.491  -10.413 39.002 1.00 22.26 ? 251 THR A O    1 
ATOM   1968 C  CB   . THR A 1 251 ? 12.414  -10.234 40.351 1.00 25.75 ? 251 THR A CB   1 
ATOM   1969 O  OG1  . THR A 1 251 ? 12.541  -9.172  39.397 1.00 25.44 ? 251 THR A OG1  1 
ATOM   1970 C  CG2  . THR A 1 251 ? 11.767  -9.696  41.618 1.00 24.93 ? 251 THR A CG2  1 
ATOM   1971 N  N    . PRO A 1 252 ? 14.067  -12.114 38.627 1.00 21.76 ? 252 PRO A N    1 
ATOM   1972 C  CA   . PRO A 1 252 ? 14.668  -12.485 37.363 1.00 20.56 ? 252 PRO A CA   1 
ATOM   1973 C  C    . PRO A 1 252 ? 14.607  -11.354 36.320 1.00 19.53 ? 252 PRO A C    1 
ATOM   1974 O  O    . PRO A 1 252 ? 15.494  -11.216 35.542 1.00 17.89 ? 252 PRO A O    1 
ATOM   1975 C  CB   . PRO A 1 252 ? 13.851  -13.701 36.944 1.00 22.45 ? 252 PRO A CB   1 
ATOM   1976 C  CG   . PRO A 1 252 ? 13.518  -14.341 38.287 1.00 22.67 ? 252 PRO A CG   1 
ATOM   1977 C  CD   . PRO A 1 252 ? 13.074  -13.111 39.060 1.00 21.96 ? 252 PRO A CD   1 
ATOM   1978 N  N    . ALA A 1 253 ? 13.527  -10.606 36.299 1.00 19.81 ? 253 ALA A N    1 
ATOM   1979 C  CA   . ALA A 1 253 ? 13.405  -9.459  35.393 1.00 19.92 ? 253 ALA A CA   1 
ATOM   1980 C  C    . ALA A 1 253 ? 14.536  -8.437  35.639 1.00 19.37 ? 253 ALA A C    1 
ATOM   1981 O  O    . ALA A 1 253 ? 15.216  -7.988  34.705 1.00 20.35 ? 253 ALA A O    1 
ATOM   1982 C  CB   . ALA A 1 253 ? 11.997  -8.814  35.546 1.00 17.92 ? 253 ALA A CB   1 
ATOM   1983 N  N    . LEU A 1 254 ? 14.779  -8.086  36.896 1.00 19.08 ? 254 LEU A N    1 
ATOM   1984 C  CA   . LEU A 1 254 ? 15.877  -7.171  37.203 1.00 18.80 ? 254 LEU A CA   1 
ATOM   1985 C  C    . LEU A 1 254 ? 17.232  -7.716  36.853 1.00 18.07 ? 254 LEU A C    1 
ATOM   1986 O  O    . LEU A 1 254 ? 18.114  -6.955  36.513 1.00 19.00 ? 254 LEU A O    1 
ATOM   1987 C  CB   . LEU A 1 254 ? 15.884  -6.780  38.668 1.00 18.98 ? 254 LEU A CB   1 
ATOM   1988 C  CG   . LEU A 1 254 ? 14.911  -5.662  39.065 1.00 18.72 ? 254 LEU A CG   1 
ATOM   1989 C  CD1  . LEU A 1 254 ? 14.576  -5.862  40.526 1.00 21.51 ? 254 LEU A CD1  1 
ATOM   1990 C  CD2  . LEU A 1 254 ? 15.412  -4.252  38.804 1.00 18.59 ? 254 LEU A CD2  1 
ATOM   1991 N  N    . ILE A 1 255 ? 17.430  -9.028  36.968 1.00 17.53 ? 255 ILE A N    1 
ATOM   1992 C  CA   . ILE A 1 255 ? 18.674  -9.608  36.490 1.00 16.44 ? 255 ILE A CA   1 
ATOM   1993 C  C    . ILE A 1 255 ? 18.838  -9.441  34.950 1.00 15.74 ? 255 ILE A C    1 
ATOM   1994 O  O    . ILE A 1 255 ? 19.916  -9.145  34.442 1.00 16.04 ? 255 ILE A O    1 
ATOM   1995 C  CB   . ILE A 1 255 ? 18.826  -11.106 36.941 1.00 15.57 ? 255 ILE A CB   1 
ATOM   1996 C  CG1  . ILE A 1 255 ? 18.749  -11.232 38.479 1.00 18.09 ? 255 ILE A CG1  1 
ATOM   1997 C  CG2  . ILE A 1 255 ? 20.213  -11.749 36.401 1.00 17.18 ? 255 ILE A CG2  1 
ATOM   1998 C  CD1  . ILE A 1 255 ? 19.853  -10.498 39.262 1.00 21.32 ? 255 ILE A CD1  1 
ATOM   1999 N  N    . ALA A 1 256 ? 17.779  -9.689  34.190 1.00 16.08 ? 256 ALA A N    1 
ATOM   2000 C  CA   . ALA A 1 256 ? 17.915  -9.599  32.694 1.00 16.23 ? 256 ALA A CA   1 
ATOM   2001 C  C    . ALA A 1 256 ? 18.164  -8.168  32.314 1.00 15.75 ? 256 ALA A C    1 
ATOM   2002 O  O    . ALA A 1 256 ? 18.901  -7.904  31.339 1.00 18.33 ? 256 ALA A O    1 
ATOM   2003 C  CB   . ALA A 1 256 ? 16.650  -10.128 31.950 1.00 17.04 ? 256 ALA A CB   1 
ATOM   2004 N  N    . LEU A 1 257 ? 17.540  -7.243  33.043 1.00 14.45 ? 257 LEU A N    1 
ATOM   2005 C  CA   . LEU A 1 257 ? 17.724  -5.781  32.726 1.00 15.28 ? 257 LEU A CA   1 
ATOM   2006 C  C    . LEU A 1 257 ? 19.166  -5.328  33.027 1.00 16.23 ? 257 LEU A C    1 
ATOM   2007 O  O    . LEU A 1 257 ? 19.822  -4.686  32.191 1.00 17.28 ? 257 LEU A O    1 
ATOM   2008 C  CB   . LEU A 1 257 ? 16.773  -4.926  33.546 1.00 14.56 ? 257 LEU A CB   1 
ATOM   2009 C  CG   . LEU A 1 257 ? 15.305  -5.026  33.097 1.00 15.09 ? 257 LEU A CG   1 
ATOM   2010 C  CD1  . LEU A 1 257 ? 14.340  -4.184  33.960 1.00 19.92 ? 257 LEU A CD1  1 
ATOM   2011 C  CD2  . LEU A 1 257 ? 15.146  -4.725  31.635 1.00 16.64 ? 257 LEU A CD2  1 
ATOM   2012 N  N    . ARG A 1 258 ? 19.662  -5.679  34.217 1.00 17.25 ? 258 ARG A N    1 
ATOM   2013 C  CA   . ARG A 1 258 ? 21.016  -5.318  34.612 1.00 18.40 ? 258 ARG A CA   1 
ATOM   2014 C  C    . ARG A 1 258 ? 22.069  -5.872  33.674 1.00 18.00 ? 258 ARG A C    1 
ATOM   2015 O  O    . ARG A 1 258 ? 23.026  -5.181  33.367 1.00 17.53 ? 258 ARG A O    1 
ATOM   2016 C  CB   . ARG A 1 258 ? 21.316  -5.724  36.085 1.00 18.72 ? 258 ARG A CB   1 
ATOM   2017 C  CG   . ARG A 1 258 ? 22.706  -5.241  36.565 1.00 21.49 ? 258 ARG A CG   1 
ATOM   2018 C  CD   . ARG A 1 258 ? 22.691  -3.779  37.107 1.00 20.33 ? 258 ARG A CD   1 
ATOM   2019 N  NE   . ARG A 1 258 ? 24.023  -3.172  37.105 1.00 18.40 ? 258 ARG A NE   1 
ATOM   2020 C  CZ   . ARG A 1 258 ? 24.263  -1.860  37.277 1.00 19.83 ? 258 ARG A CZ   1 
ATOM   2021 N  NH1  . ARG A 1 258 ? 23.278  -1.025  37.513 1.00 24.30 ? 258 ARG A NH1  1 
ATOM   2022 N  NH2  . ARG A 1 258 ? 25.523  -1.379  37.203 1.00 22.60 ? 258 ARG A NH2  1 
ATOM   2023 N  N    . TYR A 1 259 ? 21.921  -7.138  33.258 1.00 18.19 ? 259 TYR A N    1 
ATOM   2024 C  CA   . TYR A 1 259 ? 22.777  -7.732  32.247 1.00 19.08 ? 259 TYR A CA   1 
ATOM   2025 C  C    . TYR A 1 259 ? 22.990  -6.837  31.030 1.00 18.87 ? 259 TYR A C    1 
ATOM   2026 O  O    . TYR A 1 259 ? 24.147  -6.635  30.629 1.00 18.86 ? 259 TYR A O    1 
ATOM   2027 C  CB   . TYR A 1 259 ? 22.181  -9.060  31.833 1.00 19.25 ? 259 TYR A CB   1 
ATOM   2028 C  CG   . TYR A 1 259 ? 22.872  -9.733  30.689 1.00 22.14 ? 259 TYR A CG   1 
ATOM   2029 C  CD1  . TYR A 1 259 ? 24.158  -10.223 30.833 1.00 20.78 ? 259 TYR A CD1  1 
ATOM   2030 C  CD2  . TYR A 1 259 ? 22.206  -9.940  29.463 1.00 22.13 ? 259 TYR A CD2  1 
ATOM   2031 C  CE1  . TYR A 1 259 ? 24.777  -10.934 29.795 1.00 21.02 ? 259 TYR A CE1  1 
ATOM   2032 C  CE2  . TYR A 1 259 ? 22.833  -10.600 28.422 1.00 22.00 ? 259 TYR A CE2  1 
ATOM   2033 C  CZ   . TYR A 1 259 ? 24.104  -11.123 28.605 1.00 20.17 ? 259 TYR A CZ   1 
ATOM   2034 O  OH   . TYR A 1 259 ? 24.753  -11.776 27.544 1.00 20.41 ? 259 TYR A OH   1 
ATOM   2035 N  N    . GLN A 1 260 ? 21.930  -6.202  30.495 1.00 18.58 ? 260 GLN A N    1 
ATOM   2036 C  CA   . GLN A 1 260 ? 22.049  -5.390  29.284 1.00 16.81 ? 260 GLN A CA   1 
ATOM   2037 C  C    . GLN A 1 260 ? 22.802  -4.065  29.622 1.00 18.10 ? 260 GLN A C    1 
ATOM   2038 O  O    . GLN A 1 260 ? 23.739  -3.630  28.908 1.00 19.14 ? 260 GLN A O    1 
ATOM   2039 C  CB   . GLN A 1 260 ? 20.674  -5.092  28.611 1.00 18.67 ? 260 GLN A CB   1 
ATOM   2040 C  CG   . GLN A 1 260 ? 19.821  -6.341  28.195 1.00 15.84 ? 260 GLN A CG   1 
ATOM   2041 C  CD   . GLN A 1 260 ? 20.374  -7.173  27.085 1.00 18.44 ? 260 GLN A CD   1 
ATOM   2042 O  OE1  . GLN A 1 260 ? 19.733  -8.186  26.692 1.00 19.24 ? 260 GLN A OE1  1 
ATOM   2043 N  NE2  . GLN A 1 260 ? 21.560  -6.793  26.538 1.00 17.91 ? 260 GLN A NE2  1 
ATOM   2044 N  N    . LEU A 1 261 ? 22.422  -3.439  30.730 1.00 17.75 ? 261 LEU A N    1 
ATOM   2045 C  CA   . LEU A 1 261 ? 23.120  -2.232  31.130 1.00 18.76 ? 261 LEU A CA   1 
ATOM   2046 C  C    . LEU A 1 261 ? 24.623  -2.471  31.285 1.00 18.87 ? 261 LEU A C    1 
ATOM   2047 O  O    . LEU A 1 261 ? 25.404  -1.575  31.018 1.00 18.82 ? 261 LEU A O    1 
ATOM   2048 C  CB   . LEU A 1 261 ? 22.585  -1.687  32.460 1.00 18.79 ? 261 LEU A CB   1 
ATOM   2049 C  CG   . LEU A 1 261 ? 21.145  -1.199  32.466 1.00 19.16 ? 261 LEU A CG   1 
ATOM   2050 C  CD1  . LEU A 1 261 ? 20.968  -0.504  33.768 1.00 16.18 ? 261 LEU A CD1  1 
ATOM   2051 C  CD2  . LEU A 1 261 ? 20.822  -0.273  31.266 1.00 17.41 ? 261 LEU A CD2  1 
ATOM   2052 N  N    . GLN A 1 262 ? 25.041  -3.639  31.757 1.00 18.98 ? 262 GLN A N    1 
ATOM   2053 C  CA   . GLN A 1 262 ? 26.503  -3.831  32.014 1.00 20.36 ? 262 GLN A CA   1 
ATOM   2054 C  C    . GLN A 1 262 ? 27.307  -4.180  30.749 1.00 21.17 ? 262 GLN A C    1 
ATOM   2055 O  O    . GLN A 1 262 ? 28.520  -3.944  30.705 1.00 20.96 ? 262 GLN A O    1 
ATOM   2056 C  CB   . GLN A 1 262 ? 26.763  -4.815  33.153 1.00 19.66 ? 262 GLN A CB   1 
ATOM   2057 C  CG   . GLN A 1 262 ? 26.466  -4.178  34.529 1.00 21.30 ? 262 GLN A CG   1 
ATOM   2058 C  CD   . GLN A 1 262 ? 26.809  -5.092  35.722 1.00 21.71 ? 262 GLN A CD   1 
ATOM   2059 O  OE1  . GLN A 1 262 ? 26.090  -5.103  36.718 1.00 24.55 ? 262 GLN A OE1  1 
ATOM   2060 N  NE2  . GLN A 1 262 ? 27.861  -5.905  35.590 1.00 21.03 ? 262 GLN A NE2  1 
ATOM   2061 N  N    . ARG A 1 263 ? 26.614  -4.607  29.695 1.00 20.17 ? 263 ARG A N    1 
ATOM   2062 C  CA   . ARG A 1 263 ? 27.275  -4.947  28.399 1.00 19.69 ? 263 ARG A CA   1 
ATOM   2063 C  C    . ARG A 1 263 ? 27.132  -3.842  27.368 1.00 19.90 ? 263 ARG A C    1 
ATOM   2064 O  O    . ARG A 1 263 ? 27.331  -4.046  26.183 1.00 21.86 ? 263 ARG A O    1 
ATOM   2065 C  CB   . ARG A 1 263 ? 26.714  -6.297  27.860 1.00 18.80 ? 263 ARG A CB   1 
ATOM   2066 C  CG   . ARG A 1 263 ? 25.179  -6.323  27.522 1.00 15.94 ? 263 ARG A CG   1 
ATOM   2067 C  CD   . ARG A 1 263 ? 24.643  -7.772  27.581 1.00 17.02 ? 263 ARG A CD   1 
ATOM   2068 N  NE   . ARG A 1 263 ? 25.226  -8.645  26.542 1.00 19.23 ? 263 ARG A NE   1 
ATOM   2069 C  CZ   . ARG A 1 263 ? 24.707  -8.911  25.346 1.00 15.37 ? 263 ARG A CZ   1 
ATOM   2070 N  NH1  . ARG A 1 263 ? 25.370  -9.727  24.528 1.00 23.39 ? 263 ARG A NH1  1 
ATOM   2071 N  NH2  . ARG A 1 263 ? 23.529  -8.417  24.935 1.00 17.23 ? 263 ARG A NH2  1 
ATOM   2072 N  N    . GLY A 1 264 ? 26.795  -2.636  27.796 1.00 21.09 ? 264 GLY A N    1 
ATOM   2073 C  CA   . GLY A 1 264 ? 26.805  -1.496  26.853 1.00 21.06 ? 264 GLY A CA   1 
ATOM   2074 C  C    . GLY A 1 264 ? 25.482  -1.286  26.076 1.00 20.47 ? 264 GLY A C    1 
ATOM   2075 O  O    . GLY A 1 264 ? 25.436  -0.494  25.136 1.00 20.08 ? 264 GLY A O    1 
ATOM   2076 N  N    . VAL A 1 265 ? 24.424  -1.973  26.492 1.00 18.40 ? 265 VAL A N    1 
ATOM   2077 C  CA   . VAL A 1 265 ? 23.139  -1.990  25.794 1.00 17.93 ? 265 VAL A CA   1 
ATOM   2078 C  C    . VAL A 1 265 ? 22.182  -1.009  26.451 1.00 19.46 ? 265 VAL A C    1 
ATOM   2079 O  O    . VAL A 1 265 ? 22.168  -0.891  27.661 1.00 20.79 ? 265 VAL A O    1 
ATOM   2080 C  CB   . VAL A 1 265 ? 22.571  -3.422  25.767 1.00 16.43 ? 265 VAL A CB   1 
ATOM   2081 C  CG1  . VAL A 1 265 ? 21.098  -3.465  25.287 1.00 14.54 ? 265 VAL A CG1  1 
ATOM   2082 C  CG2  . VAL A 1 265 ? 23.405  -4.245  24.814 1.00 17.59 ? 265 VAL A CG2  1 
ATOM   2083 N  N    . VAL A 1 266 ? 21.383  -0.292  25.658 1.00 20.34 ? 266 VAL A N    1 
ATOM   2084 C  CA   . VAL A 1 266 ? 20.255  0.450   26.229 1.00 19.91 ? 266 VAL A CA   1 
ATOM   2085 C  C    . VAL A 1 266 ? 19.036  -0.436  26.278 1.00 19.44 ? 266 VAL A C    1 
ATOM   2086 O  O    . VAL A 1 266 ? 18.723  -1.079  25.302 1.00 20.21 ? 266 VAL A O    1 
ATOM   2087 C  CB   . VAL A 1 266 ? 19.948  1.710   25.463 1.00 19.30 ? 266 VAL A CB   1 
ATOM   2088 C  CG1  . VAL A 1 266 ? 18.618  2.289   25.857 1.00 18.78 ? 266 VAL A CG1  1 
ATOM   2089 C  CG2  . VAL A 1 266 ? 21.045  2.718   25.718 1.00 16.48 ? 266 VAL A CG2  1 
ATOM   2090 N  N    . VAL A 1 267 ? 18.381  -0.512  27.432 1.00 18.54 ? 267 VAL A N    1 
ATOM   2091 C  CA   . VAL A 1 267 ? 17.383  -1.553  27.596 1.00 19.11 ? 267 VAL A CA   1 
ATOM   2092 C  C    . VAL A 1 267 ? 15.964  -1.033  27.832 1.00 18.67 ? 267 VAL A C    1 
ATOM   2093 O  O    . VAL A 1 267 ? 15.719  -0.196  28.689 1.00 17.52 ? 267 VAL A O    1 
ATOM   2094 C  CB   . VAL A 1 267 ? 17.839  -2.588  28.706 1.00 19.66 ? 267 VAL A CB   1 
ATOM   2095 C  CG1  . VAL A 1 267 ? 17.905  -1.884  30.058 1.00 18.99 ? 267 VAL A CG1  1 
ATOM   2096 C  CG2  . VAL A 1 267 ? 16.910  -3.803  28.738 1.00 18.52 ? 267 VAL A CG2  1 
ATOM   2097 N  N    . LEU A 1 268 ? 15.010  -1.584  27.098 1.00 18.62 ? 268 LEU A N    1 
ATOM   2098 C  CA   . LEU A 1 268 ? 13.587  -1.325  27.387 1.00 19.65 ? 268 LEU A CA   1 
ATOM   2099 C  C    . LEU A 1 268 ? 12.952  -2.326  28.357 1.00 19.82 ? 268 LEU A C    1 
ATOM   2100 O  O    . LEU A 1 268 ? 13.440  -3.431  28.494 1.00 19.45 ? 268 LEU A O    1 
ATOM   2101 C  CB   . LEU A 1 268 ? 12.772  -1.286  26.089 1.00 20.04 ? 268 LEU A CB   1 
ATOM   2102 C  CG   . LEU A 1 268 ? 13.284  -0.376  24.956 1.00 19.68 ? 268 LEU A CG   1 
ATOM   2103 C  CD1  . LEU A 1 268 ? 12.386  -0.527  23.748 1.00 12.66 ? 268 LEU A CD1  1 
ATOM   2104 C  CD2  . LEU A 1 268 ? 13.366  1.107   25.351 1.00 21.60 ? 268 LEU A CD2  1 
ATOM   2105 N  N    . ALA A 1 269 ? 11.919  -1.904  29.083 1.00 18.27 ? 269 ALA A N    1 
ATOM   2106 C  CA   . ALA A 1 269 ? 11.133  -2.809  29.915 1.00 18.13 ? 269 ALA A CA   1 
ATOM   2107 C  C    . ALA A 1 269 ? 9.647   -2.344  29.864 1.00 19.41 ? 269 ALA A C    1 
ATOM   2108 O  O    . ALA A 1 269 ? 9.327   -1.216  30.298 1.00 17.76 ? 269 ALA A O    1 
ATOM   2109 C  CB   . ALA A 1 269 ? 11.643  -2.820  31.354 1.00 17.65 ? 269 ALA A CB   1 
ATOM   2110 N  N    . LYS A 1 270 ? 8.777   -3.162  29.285 1.00 19.19 ? 270 LYS A N    1 
ATOM   2111 C  CA   . LYS A 1 270 ? 7.343   -2.859  29.382 1.00 19.36 ? 270 LYS A CA   1 
ATOM   2112 C  C    . LYS A 1 270 ? 6.715   -3.504  30.635 1.00 19.84 ? 270 LYS A C    1 
ATOM   2113 O  O    . LYS A 1 270 ? 6.888   -4.668  30.878 1.00 20.77 ? 270 LYS A O    1 
ATOM   2114 C  CB   . LYS A 1 270 ? 6.568   -3.318  28.133 1.00 19.65 ? 270 LYS A CB   1 
ATOM   2115 C  CG   . LYS A 1 270 ? 4.991   -3.127  28.214 1.00 13.95 ? 270 LYS A CG   1 
ATOM   2116 C  CD   . LYS A 1 270 ? 4.229   -4.404  28.712 1.00 17.27 ? 270 LYS A CD   1 
ATOM   2117 C  CE   . LYS A 1 270 ? 2.690   -4.123  28.788 1.00 14.55 ? 270 LYS A CE   1 
ATOM   2118 N  NZ   . LYS A 1 270 ? 1.969   -5.284  29.373 1.00 12.14 ? 270 LYS A NZ   1 
ATOM   2119 N  N    . SER A 1 271 ? 5.911   -2.742  31.372 1.00 20.02 ? 271 SER A N    1 
ATOM   2120 C  CA   . SER A 1 271 ? 4.933   -3.311  32.306 1.00 19.25 ? 271 SER A CA   1 
ATOM   2121 C  C    . SER A 1 271 ? 3.774   -2.330  32.445 1.00 19.82 ? 271 SER A C    1 
ATOM   2122 O  O    . SER A 1 271 ? 3.994   -1.105  32.509 1.00 17.71 ? 271 SER A O    1 
ATOM   2123 C  CB   . SER A 1 271 ? 5.556   -3.527  33.682 1.00 19.94 ? 271 SER A CB   1 
ATOM   2124 O  OG   . SER A 1 271 ? 4.606   -4.074  34.587 1.00 17.82 ? 271 SER A OG   1 
ATOM   2125 N  N    . TYR A 1 272 ? 2.568   -2.879  32.464 1.00 20.42 ? 272 TYR A N    1 
ATOM   2126 C  CA   . TYR A 1 272 ? 1.363   -2.143  32.877 1.00 22.29 ? 272 TYR A CA   1 
ATOM   2127 C  C    . TYR A 1 272 ? 0.916   -2.500  34.300 1.00 23.24 ? 272 TYR A C    1 
ATOM   2128 O  O    . TYR A 1 272 ? -0.219  -2.183  34.678 1.00 23.80 ? 272 TYR A O    1 
ATOM   2129 C  CB   . TYR A 1 272 ? 0.186   -2.357  31.905 1.00 21.98 ? 272 TYR A CB   1 
ATOM   2130 C  CG   . TYR A 1 272 ? 0.344   -1.634  30.536 1.00 20.32 ? 272 TYR A CG   1 
ATOM   2131 C  CD1  . TYR A 1 272 ? 1.514   -0.958  30.181 1.00 20.86 ? 272 TYR A CD1  1 
ATOM   2132 C  CD2  . TYR A 1 272 ? -0.706  -1.670  29.607 1.00 17.50 ? 272 TYR A CD2  1 
ATOM   2133 C  CE1  . TYR A 1 272 ? 1.629   -0.330  28.939 1.00 17.90 ? 272 TYR A CE1  1 
ATOM   2134 C  CE2  . TYR A 1 272 ? -0.611  -1.091  28.383 1.00 20.01 ? 272 TYR A CE2  1 
ATOM   2135 C  CZ   . TYR A 1 272 ? 0.519   -0.397  28.049 1.00 18.89 ? 272 TYR A CZ   1 
ATOM   2136 O  OH   . TYR A 1 272 ? 0.508   0.131   26.793 1.00 20.42 ? 272 TYR A OH   1 
ATOM   2137 N  N    . ASN A 1 273 ? 1.807   -3.103  35.098 1.00 22.97 ? 273 ASN A N    1 
ATOM   2138 C  CA   . ASN A 1 273 ? 1.454   -3.476  36.486 1.00 23.29 ? 273 ASN A CA   1 
ATOM   2139 C  C    . ASN A 1 273 ? 2.184   -2.543  37.420 1.00 23.41 ? 273 ASN A C    1 
ATOM   2140 O  O    . ASN A 1 273 ? 3.384   -2.478  37.368 1.00 24.81 ? 273 ASN A O    1 
ATOM   2141 C  CB   . ASN A 1 273 ? 1.860   -4.922  36.771 1.00 23.21 ? 273 ASN A CB   1 
ATOM   2142 C  CG   . ASN A 1 273 ? 1.618   -5.355  38.229 1.00 26.31 ? 273 ASN A CG   1 
ATOM   2143 O  OD1  . ASN A 1 273 ? 0.524   -5.867  38.590 1.00 31.63 ? 273 ASN A OD1  1 
ATOM   2144 N  ND2  . ASN A 1 273 ? 2.629   -5.215  39.056 1.00 24.99 ? 273 ASN A ND2  1 
ATOM   2145 N  N    . GLU A 1 274 ? 1.467   -1.844  38.287 1.00 23.17 ? 274 GLU A N    1 
ATOM   2146 C  CA   . GLU A 1 274 ? 2.099   -0.875  39.175 1.00 24.21 ? 274 GLU A CA   1 
ATOM   2147 C  C    . GLU A 1 274 ? 3.292   -1.426  39.990 1.00 23.68 ? 274 GLU A C    1 
ATOM   2148 O  O    . GLU A 1 274 ? 4.336   -0.752  40.110 1.00 25.51 ? 274 GLU A O    1 
ATOM   2149 C  CB   . GLU A 1 274 ? 1.051   -0.238  40.111 1.00 24.91 ? 274 GLU A CB   1 
ATOM   2150 C  CG   . GLU A 1 274 ? 1.678   0.629   41.206 1.00 27.20 ? 274 GLU A CG   1 
ATOM   2151 C  CD   . GLU A 1 274 ? 0.740   1.673   41.799 1.00 34.52 ? 274 GLU A CD   1 
ATOM   2152 O  OE1  . GLU A 1 274 ? 1.221   2.480   42.622 1.00 36.77 ? 274 GLU A OE1  1 
ATOM   2153 O  OE2  . GLU A 1 274 ? -0.464  1.701   41.437 1.00 39.50 ? 274 GLU A OE2  1 
ATOM   2154 N  N    . GLN A 1 275 ? 3.137   -2.629  40.551 1.00 21.58 ? 275 GLN A N    1 
ATOM   2155 C  CA   . GLN A 1 275 ? 4.208   -3.223  41.361 1.00 23.03 ? 275 GLN A CA   1 
ATOM   2156 C  C    . GLN A 1 275 ? 5.426   -3.470  40.472 1.00 21.65 ? 275 GLN A C    1 
ATOM   2157 O  O    . GLN A 1 275 ? 6.519   -3.130  40.836 1.00 22.34 ? 275 GLN A O    1 
ATOM   2158 C  CB   . GLN A 1 275 ? 3.730   -4.493  42.110 1.00 23.28 ? 275 GLN A CB   1 
ATOM   2159 C  CG   . GLN A 1 275 ? 2.770   -4.127  43.258 1.00 24.59 ? 275 GLN A CG   1 
ATOM   2160 C  CD   . GLN A 1 275 ? 3.355   -3.018  44.200 1.00 33.34 ? 275 GLN A CD   1 
ATOM   2161 O  OE1  . GLN A 1 275 ? 4.453   -3.193  44.766 1.00 32.66 ? 275 GLN A OE1  1 
ATOM   2162 N  NE2  . GLN A 1 275 ? 2.591   -1.914  44.404 1.00 30.28 ? 275 GLN A NE2  1 
ATOM   2163 N  N    . ARG A 1 276 ? 5.217   -3.970  39.259 1.00 23.26 ? 276 ARG A N    1 
ATOM   2164 C  CA   . ARG A 1 276 ? 6.365   -4.297  38.397 1.00 23.91 ? 276 ARG A CA   1 
ATOM   2165 C  C    . ARG A 1 276 ? 7.053   -3.063  37.862 1.00 25.17 ? 276 ARG A C    1 
ATOM   2166 O  O    . ARG A 1 276 ? 8.294   -2.988  37.844 1.00 24.55 ? 276 ARG A O    1 
ATOM   2167 C  CB   . ARG A 1 276 ? 5.995   -5.324  37.326 1.00 23.71 ? 276 ARG A CB   1 
ATOM   2168 C  CG   . ARG A 1 276 ? 5.698   -6.657  38.019 1.00 24.45 ? 276 ARG A CG   1 
ATOM   2169 C  CD   . ARG A 1 276 ? 5.434   -7.795  37.074 1.00 29.64 ? 276 ARG A CD   1 
ATOM   2170 N  NE   . ARG A 1 276 ? 4.148   -7.744  36.365 1.00 30.00 ? 276 ARG A NE   1 
ATOM   2171 C  CZ   . ARG A 1 276 ? 2.981   -8.085  36.923 1.00 33.59 ? 276 ARG A CZ   1 
ATOM   2172 N  NH1  . ARG A 1 276 ? 2.951   -8.437  38.213 1.00 33.17 ? 276 ARG A NH1  1 
ATOM   2173 N  NH2  . ARG A 1 276 ? 1.842   -8.053  36.216 1.00 26.29 ? 276 ARG A NH2  1 
ATOM   2174 N  N    . ILE A 1 277 ? 6.244   -2.070  37.494 1.00 25.01 ? 277 ILE A N    1 
ATOM   2175 C  CA   . ILE A 1 277 ? 6.775   -0.782  37.117 1.00 25.83 ? 277 ILE A CA   1 
ATOM   2176 C  C    . ILE A 1 277 ? 7.772   -0.259  38.184 1.00 25.72 ? 277 ILE A C    1 
ATOM   2177 O  O    . ILE A 1 277 ? 8.888   0.111   37.835 1.00 26.19 ? 277 ILE A O    1 
ATOM   2178 C  CB   . ILE A 1 277 ? 5.626   0.257   36.817 1.00 25.19 ? 277 ILE A CB   1 
ATOM   2179 C  CG1  . ILE A 1 277 ? 4.743   -0.200  35.612 1.00 27.36 ? 277 ILE A CG1  1 
ATOM   2180 C  CG2  . ILE A 1 277 ? 6.214   1.659   36.638 1.00 25.47 ? 277 ILE A CG2  1 
ATOM   2181 C  CD1  . ILE A 1 277 ? 3.427   0.614   35.346 1.00 22.26 ? 277 ILE A CD1  1 
ATOM   2182 N  N    . ARG A 1 278 ? 7.362   -0.188  39.460 1.00 25.58 ? 278 ARG A N    1 
ATOM   2183 C  CA   . ARG A 1 278 ? 8.185   0.418   40.537 1.00 25.65 ? 278 ARG A CA   1 
ATOM   2184 C  C    . ARG A 1 278 ? 9.449   -0.417  40.837 1.00 25.30 ? 278 ARG A C    1 
ATOM   2185 O  O    . ARG A 1 278 ? 10.462  0.086   41.250 1.00 26.43 ? 278 ARG A O    1 
ATOM   2186 C  CB   . ARG A 1 278 ? 7.372   0.581   41.841 1.00 25.29 ? 278 ARG A CB   1 
ATOM   2187 C  CG   . ARG A 1 278 ? 6.062   1.419   41.688 1.00 25.06 ? 278 ARG A CG   1 
ATOM   2188 C  CD   . ARG A 1 278 ? 5.336   1.646   43.054 1.00 24.88 ? 278 ARG A CD   1 
ATOM   2189 N  NE   . ARG A 1 278 ? 6.236   2.286   44.005 1.00 25.66 ? 278 ARG A NE   1 
ATOM   2190 C  CZ   . ARG A 1 278 ? 6.356   3.595   44.105 1.00 30.78 ? 278 ARG A CZ   1 
ATOM   2191 N  NH1  . ARG A 1 278 ? 5.626   4.398   43.308 1.00 29.84 ? 278 ARG A NH1  1 
ATOM   2192 N  NH2  . ARG A 1 278 ? 7.211   4.109   44.961 1.00 30.31 ? 278 ARG A NH2  1 
ATOM   2193 N  N    . GLN A 1 279 ? 9.318   -1.710  40.646 1.00 23.41 ? 279 GLN A N    1 
ATOM   2194 C  CA   . GLN A 1 279 ? 10.392  -2.637  40.770 1.00 23.90 ? 279 GLN A CA   1 
ATOM   2195 C  C    . GLN A 1 279 ? 11.478  -2.439  39.676 1.00 22.78 ? 279 GLN A C    1 
ATOM   2196 O  O    . GLN A 1 279 ? 12.695  -2.403  39.950 1.00 22.01 ? 279 GLN A O    1 
ATOM   2197 C  CB   . GLN A 1 279 ? 9.750   -4.023  40.706 1.00 23.23 ? 279 GLN A CB   1 
ATOM   2198 C  CG   . GLN A 1 279 ? 10.694  -5.137  40.816 1.00 27.41 ? 279 GLN A CG   1 
ATOM   2199 C  CD   . GLN A 1 279 ? 10.099  -6.464  40.324 1.00 33.68 ? 279 GLN A CD   1 
ATOM   2200 O  OE1  . GLN A 1 279 ? 9.058   -6.961  40.823 1.00 31.52 ? 279 GLN A OE1  1 
ATOM   2201 N  NE2  . GLN A 1 279 ? 10.759  -7.045  39.338 1.00 30.93 ? 279 GLN A NE2  1 
ATOM   2202 N  N    . ASN A 1 280 ? 11.028  -2.325  38.421 1.00 22.78 ? 280 ASN A N    1 
ATOM   2203 C  CA   . ASN A 1 280 ? 11.960  -2.237  37.259 1.00 22.46 ? 280 ASN A CA   1 
ATOM   2204 C  C    . ASN A 1 280 ? 12.996  -1.111  37.279 1.00 23.38 ? 280 ASN A C    1 
ATOM   2205 O  O    . ASN A 1 280 ? 14.111  -1.293  36.785 1.00 23.04 ? 280 ASN A O    1 
ATOM   2206 C  CB   . ASN A 1 280 ? 11.155  -2.247  35.947 1.00 21.90 ? 280 ASN A CB   1 
ATOM   2207 C  CG   . ASN A 1 280 ? 10.650  -3.606  35.638 1.00 22.00 ? 280 ASN A CG   1 
ATOM   2208 O  OD1  . ASN A 1 280 ? 11.111  -4.542  36.258 1.00 26.21 ? 280 ASN A OD1  1 
ATOM   2209 N  ND2  . ASN A 1 280 ? 9.714   -3.756  34.692 1.00 21.26 ? 280 ASN A ND2  1 
ATOM   2210 N  N    . VAL A 1 281 ? 12.654  0.050   37.855 1.00 23.69 ? 281 VAL A N    1 
ATOM   2211 C  CA   . VAL A 1 281 ? 13.615  1.130   38.010 1.00 24.83 ? 281 VAL A CA   1 
ATOM   2212 C  C    . VAL A 1 281 ? 14.742  0.871   39.025 1.00 26.18 ? 281 VAL A C    1 
ATOM   2213 O  O    . VAL A 1 281 ? 15.684  1.653   39.151 1.00 27.13 ? 281 VAL A O    1 
ATOM   2214 C  CB   . VAL A 1 281 ? 12.938  2.453   38.410 1.00 25.55 ? 281 VAL A CB   1 
ATOM   2215 C  CG1  . VAL A 1 281 ? 12.028  2.937   37.306 1.00 25.79 ? 281 VAL A CG1  1 
ATOM   2216 C  CG2  . VAL A 1 281 ? 12.193  2.303   39.740 1.00 27.56 ? 281 VAL A CG2  1 
ATOM   2217 N  N    . GLN A 1 282 ? 14.638  -0.227  39.771 1.00 27.26 ? 282 GLN A N    1 
ATOM   2218 C  CA   . GLN A 1 282 ? 15.626  -0.541  40.770 1.00 27.80 ? 282 GLN A CA   1 
ATOM   2219 C  C    . GLN A 1 282 ? 16.882  -1.179  40.182 1.00 27.46 ? 282 GLN A C    1 
ATOM   2220 O  O    . GLN A 1 282 ? 17.812  -1.480  40.929 1.00 26.83 ? 282 GLN A O    1 
ATOM   2221 C  CB   . GLN A 1 282 ? 15.010  -1.472  41.808 1.00 28.31 ? 282 GLN A CB   1 
ATOM   2222 C  CG   . GLN A 1 282 ? 13.957  -0.795  42.641 1.00 31.52 ? 282 GLN A CG   1 
ATOM   2223 C  CD   . GLN A 1 282 ? 13.298  -1.763  43.591 1.00 39.17 ? 282 GLN A CD   1 
ATOM   2224 O  OE1  . GLN A 1 282 ? 13.341  -2.984  43.387 1.00 42.45 ? 282 GLN A OE1  1 
ATOM   2225 N  NE2  . GLN A 1 282 ? 12.660  -1.229  44.622 1.00 42.22 ? 282 GLN A NE2  1 
ATOM   2226 N  N    . VAL A 1 283 ? 16.914  -1.354  38.865 1.00 26.77 ? 283 VAL A N    1 
ATOM   2227 C  CA   . VAL A 1 283 ? 18.068  -1.946  38.198 1.00 24.51 ? 283 VAL A CA   1 
ATOM   2228 C  C    . VAL A 1 283 ? 19.361  -1.181  38.479 1.00 23.39 ? 283 VAL A C    1 
ATOM   2229 O  O    . VAL A 1 283 ? 20.453  -1.740  38.377 1.00 22.40 ? 283 VAL A O    1 
ATOM   2230 C  CB   . VAL A 1 283 ? 17.856  -2.029  36.674 1.00 25.55 ? 283 VAL A CB   1 
ATOM   2231 C  CG1  . VAL A 1 283 ? 17.647  -0.639  36.092 1.00 24.25 ? 283 VAL A CG1  1 
ATOM   2232 C  CG2  . VAL A 1 283 ? 19.036  -2.721  36.011 1.00 26.84 ? 283 VAL A CG2  1 
ATOM   2233 N  N    . PHE A 1 284 ? 19.237  0.096   38.829 1.00 23.49 ? 284 PHE A N    1 
ATOM   2234 C  CA   . PHE A 1 284 ? 20.418  0.938   39.095 1.00 23.85 ? 284 PHE A CA   1 
ATOM   2235 C  C    . PHE A 1 284 ? 20.935  0.720   40.513 1.00 25.09 ? 284 PHE A C    1 
ATOM   2236 O  O    . PHE A 1 284 ? 22.004  1.213   40.859 1.00 26.78 ? 284 PHE A O    1 
ATOM   2237 C  CB   . PHE A 1 284 ? 20.057  2.425   38.868 1.00 24.45 ? 284 PHE A CB   1 
ATOM   2238 C  CG   . PHE A 1 284 ? 19.793  2.754   37.409 1.00 23.75 ? 284 PHE A CG   1 
ATOM   2239 C  CD1  . PHE A 1 284 ? 20.822  2.667   36.469 1.00 21.98 ? 284 PHE A CD1  1 
ATOM   2240 C  CD2  . PHE A 1 284 ? 18.530  3.131   36.988 1.00 25.03 ? 284 PHE A CD2  1 
ATOM   2241 C  CE1  . PHE A 1 284 ? 20.607  2.972   35.106 1.00 24.90 ? 284 PHE A CE1  1 
ATOM   2242 C  CE2  . PHE A 1 284 ? 18.288  3.450   35.621 1.00 23.18 ? 284 PHE A CE2  1 
ATOM   2243 C  CZ   . PHE A 1 284 ? 19.360  3.358   34.683 1.00 21.30 ? 284 PHE A CZ   1 
ATOM   2244 N  N    . GLU A 1 285 ? 20.193  -0.036  41.326 1.00 25.58 ? 285 GLU A N    1 
ATOM   2245 C  CA   . GLU A 1 285 ? 20.544  -0.214  42.746 1.00 27.88 ? 285 GLU A CA   1 
ATOM   2246 C  C    . GLU A 1 285 ? 21.491  -1.374  43.050 1.00 27.57 ? 285 GLU A C    1 
ATOM   2247 O  O    . GLU A 1 285 ? 21.885  -1.555  44.200 1.00 28.39 ? 285 GLU A O    1 
ATOM   2248 C  CB   . GLU A 1 285 ? 19.276  -0.399  43.600 1.00 28.22 ? 285 GLU A CB   1 
ATOM   2249 C  CG   . GLU A 1 285 ? 18.372  0.801   43.682 1.00 32.79 ? 285 GLU A CG   1 
ATOM   2250 C  CD   . GLU A 1 285 ? 17.010  0.424   44.234 1.00 39.95 ? 285 GLU A CD   1 
ATOM   2251 O  OE1  . GLU A 1 285 ? 16.868  -0.726  44.729 1.00 42.11 ? 285 GLU A OE1  1 
ATOM   2252 O  OE2  . GLU A 1 285 ? 16.074  1.264   44.182 1.00 42.99 ? 285 GLU A OE2  1 
ATOM   2253 N  N    . PHE A 1 286 ? 21.866  -2.164  42.046 1.00 26.82 ? 286 PHE A N    1 
ATOM   2254 C  CA   . PHE A 1 286 ? 22.766  -3.314  42.289 1.00 25.57 ? 286 PHE A CA   1 
ATOM   2255 C  C    . PHE A 1 286 ? 23.625  -3.567  41.062 1.00 25.94 ? 286 PHE A C    1 
ATOM   2256 O  O    . PHE A 1 286 ? 23.473  -2.866  40.031 1.00 24.95 ? 286 PHE A O    1 
ATOM   2257 C  CB   . PHE A 1 286 ? 21.977  -4.549  42.717 1.00 23.84 ? 286 PHE A CB   1 
ATOM   2258 C  CG   . PHE A 1 286 ? 21.201  -5.179  41.609 1.00 23.85 ? 286 PHE A CG   1 
ATOM   2259 C  CD1  . PHE A 1 286 ? 19.985  -4.632  41.188 1.00 19.76 ? 286 PHE A CD1  1 
ATOM   2260 C  CD2  . PHE A 1 286 ? 21.713  -6.322  40.942 1.00 23.26 ? 286 PHE A CD2  1 
ATOM   2261 C  CE1  . PHE A 1 286 ? 19.256  -5.254  40.106 1.00 19.35 ? 286 PHE A CE1  1 
ATOM   2262 C  CE2  . PHE A 1 286 ? 21.042  -6.918  39.896 1.00 22.94 ? 286 PHE A CE2  1 
ATOM   2263 C  CZ   . PHE A 1 286 ? 19.808  -6.391  39.456 1.00 21.85 ? 286 PHE A CZ   1 
ATOM   2264 N  N    . GLN A 1 287 ? 24.559  -4.524  41.164 1.00 25.76 ? 287 GLN A N    1 
ATOM   2265 C  CA   . GLN A 1 287 ? 25.346  -4.852  40.020 1.00 25.72 ? 287 GLN A CA   1 
ATOM   2266 C  C    . GLN A 1 287 ? 25.749  -6.328  40.025 1.00 24.74 ? 287 GLN A C    1 
ATOM   2267 O  O    . GLN A 1 287 ? 25.660  -6.997  41.044 1.00 24.01 ? 287 GLN A O    1 
ATOM   2268 C  CB   . GLN A 1 287 ? 26.558  -3.910  39.909 1.00 26.54 ? 287 GLN A CB   1 
ATOM   2269 C  CG   . GLN A 1 287 ? 27.618  -4.147  40.961 1.00 31.27 ? 287 GLN A CG   1 
ATOM   2270 C  CD   . GLN A 1 287 ? 28.772  -3.168  40.816 1.00 35.67 ? 287 GLN A CD   1 
ATOM   2271 O  OE1  . GLN A 1 287 ? 28.568  -1.978  40.601 1.00 40.98 ? 287 GLN A OE1  1 
ATOM   2272 N  NE2  . GLN A 1 287 ? 29.987  -3.670  40.926 1.00 37.89 ? 287 GLN A NE2  1 
ATOM   2273 N  N    . LEU A 1 288 ? 26.162  -6.802  38.861 1.00 23.52 ? 288 LEU A N    1 
ATOM   2274 C  CA   . LEU A 1 288 ? 26.584  -8.186  38.682 1.00 22.57 ? 288 LEU A CA   1 
ATOM   2275 C  C    . LEU A 1 288 ? 28.109  -8.225  38.561 1.00 22.82 ? 288 LEU A C    1 
ATOM   2276 O  O    . LEU A 1 288 ? 28.681  -7.337  37.947 1.00 23.43 ? 288 LEU A O    1 
ATOM   2277 C  CB   . LEU A 1 288 ? 25.964  -8.779  37.417 1.00 22.52 ? 288 LEU A CB   1 
ATOM   2278 C  CG   . LEU A 1 288 ? 24.434  -8.856  37.404 1.00 20.40 ? 288 LEU A CG   1 
ATOM   2279 C  CD1  . LEU A 1 288 ? 23.886  -8.915  35.934 1.00 16.78 ? 288 LEU A CD1  1 
ATOM   2280 C  CD2  . LEU A 1 288 ? 23.877  -9.912  38.414 1.00 20.97 ? 288 LEU A CD2  1 
ATOM   2281 N  N    . THR A 1 289 ? 28.759  -9.278  39.072 1.00 22.40 ? 289 THR A N    1 
ATOM   2282 C  CA   . THR A 1 289 ? 30.208  -9.399  38.905 1.00 22.69 ? 289 THR A CA   1 
ATOM   2283 C  C    . THR A 1 289 ? 30.513  -9.895  37.496 1.00 24.25 ? 289 THR A C    1 
ATOM   2284 O  O    . THR A 1 289 ? 29.585  -10.278 36.774 1.00 22.90 ? 289 THR A O    1 
ATOM   2285 C  CB   . THR A 1 289 ? 30.797  -10.368 39.875 1.00 23.95 ? 289 THR A CB   1 
ATOM   2286 O  OG1  . THR A 1 289 ? 30.369  -11.691 39.505 1.00 24.34 ? 289 THR A OG1  1 
ATOM   2287 C  CG2  . THR A 1 289 ? 30.333  -10.032 41.325 1.00 21.35 ? 289 THR A CG2  1 
ATOM   2288 N  N    . SER A 1 290 ? 31.788  -9.919  37.106 1.00 23.68 ? 290 SER A N    1 
ATOM   2289 C  CA   A SER A 1 290 ? 32.221  -10.480 35.884 0.00 23.06 ? 290 SER A CA   1 
ATOM   2290 C  CA   B SER A 1 290 ? 32.140  -10.394 35.757 0.50 23.76 ? 290 SER A CA   1 
ATOM   2291 C  C    . SER A 1 290 ? 31.793  -11.880 35.560 1.00 24.21 ? 290 SER A C    1 
ATOM   2292 O  O    . SER A 1 290 ? 31.438  -12.310 34.466 1.00 24.04 ? 290 SER A O    1 
ATOM   2293 C  CB   A SER A 1 290 ? 33.735  -10.528 35.912 0.00 23.24 ? 290 SER A CB   1 
ATOM   2294 C  CB   B SER A 1 290 ? 33.614  -10.164 35.474 0.50 23.78 ? 290 SER A CB   1 
ATOM   2295 O  OG   A SER A 1 290 ? 34.230  -9.742  34.900 0.00 24.14 ? 290 SER A OG   1 
ATOM   2296 O  OG   B SER A 1 290 ? 34.374  -10.890 36.413 0.50 26.03 ? 290 SER A OG   1 
ATOM   2297 N  N    . GLU A 1 291 ? 31.869  -12.657 36.632 1.00 24.01 ? 291 GLU A N    1 
ATOM   2298 C  CA   . GLU A 1 291 ? 31.626  -14.091 36.552 1.00 25.34 ? 291 GLU A CA   1 
ATOM   2299 C  C    . GLU A 1 291 ? 30.118  -14.342 36.474 1.00 24.82 ? 291 GLU A C    1 
ATOM   2300 O  O    . GLU A 1 291 ? 29.639  -15.354 35.982 1.00 24.88 ? 291 GLU A O    1 
ATOM   2301 C  CB   . GLU A 1 291 ? 32.201  -14.749 37.796 1.00 27.31 ? 291 GLU A CB   1 
ATOM   2302 C  CG   . GLU A 1 291 ? 33.707  -15.039 37.713 1.00 31.44 ? 291 GLU A CG   1 
ATOM   2303 C  CD   . GLU A 1 291 ? 33.994  -16.500 37.418 1.00 38.89 ? 291 GLU A CD   1 
ATOM   2304 O  OE1  . GLU A 1 291 ? 33.390  -17.087 36.484 1.00 41.76 ? 291 GLU A OE1  1 
ATOM   2305 O  OE2  . GLU A 1 291 ? 34.831  -17.088 38.129 1.00 45.48 ? 291 GLU A OE2  1 
ATOM   2306 N  N    . GLU A 1 292 ? 29.356  -13.378 36.951 1.00 24.25 ? 292 GLU A N    1 
ATOM   2307 C  CA   . GLU A 1 292 ? 27.911  -13.498 36.892 1.00 24.53 ? 292 GLU A CA   1 
ATOM   2308 C  C    . GLU A 1 292 ? 27.495  -13.108 35.481 1.00 23.42 ? 292 GLU A C    1 
ATOM   2309 O  O    . GLU A 1 292 ? 26.652  -13.791 34.874 1.00 24.32 ? 292 GLU A O    1 
ATOM   2310 C  CB   . GLU A 1 292 ? 27.242  -12.723 38.042 1.00 23.88 ? 292 GLU A CB   1 
ATOM   2311 C  CG   . GLU A 1 292 ? 27.560  -13.312 39.453 1.00 22.72 ? 292 GLU A CG   1 
ATOM   2312 C  CD   . GLU A 1 292 ? 26.960  -12.520 40.616 1.00 24.77 ? 292 GLU A CD   1 
ATOM   2313 O  OE1  . GLU A 1 292 ? 26.953  -11.274 40.579 1.00 25.30 ? 292 GLU A OE1  1 
ATOM   2314 O  OE2  . GLU A 1 292 ? 26.527  -13.100 41.630 1.00 20.44 ? 292 GLU A OE2  1 
ATOM   2315 N  N    . MET A 1 293 ? 28.127  -12.058 34.938 1.00 22.60 ? 293 MET A N    1 
ATOM   2316 C  CA   . MET A 1 293 ? 27.891  -11.679 33.524 1.00 22.15 ? 293 MET A CA   1 
ATOM   2317 C  C    . MET A 1 293 ? 28.173  -12.849 32.562 1.00 22.96 ? 293 MET A C    1 
ATOM   2318 O  O    . MET A 1 293 ? 27.373  -13.128 31.663 1.00 21.41 ? 293 MET A O    1 
ATOM   2319 C  CB   . MET A 1 293 ? 28.639  -10.392 33.120 1.00 21.36 ? 293 MET A CB   1 
ATOM   2320 C  CG   . MET A 1 293 ? 28.090  -9.163  33.860 1.00 16.82 ? 293 MET A CG   1 
ATOM   2321 S  SD   . MET A 1 293 ? 26.443  -8.683  33.298 1.00 19.42 ? 293 MET A SD   1 
ATOM   2322 C  CE   . MET A 1 293 ? 26.783  -8.327  31.556 1.00 19.34 ? 293 MET A CE   1 
ATOM   2323 N  N    . LYS A 1 294 ? 29.256  -13.573 32.807 1.00 23.04 ? 294 LYS A N    1 
ATOM   2324 C  CA   . LYS A 1 294 ? 29.630  -14.754 32.000 1.00 24.02 ? 294 LYS A CA   1 
ATOM   2325 C  C    . LYS A 1 294 ? 28.605  -15.911 32.135 1.00 23.21 ? 294 LYS A C    1 
ATOM   2326 O  O    . LYS A 1 294 ? 28.247  -16.536 31.137 1.00 25.30 ? 294 LYS A O    1 
ATOM   2327 C  CB   . LYS A 1 294 ? 31.051  -15.206 32.359 1.00 23.44 ? 294 LYS A CB   1 
ATOM   2328 C  CG   . LYS A 1 294 ? 31.522  -16.514 31.659 1.00 26.55 ? 294 LYS A CG   1 
ATOM   2329 C  CD   . LYS A 1 294 ? 33.049  -16.668 31.877 0.50 27.37 ? 294 LYS A CD   1 
ATOM   2330 C  CE   . LYS A 1 294 ? 33.483  -18.120 32.061 0.50 28.11 ? 294 LYS A CE   1 
ATOM   2331 N  NZ   . LYS A 1 294 ? 34.885  -18.179 32.579 0.50 28.01 ? 294 LYS A NZ   1 
ATOM   2332 N  N    . ALA A 1 295 ? 28.097  -16.127 33.343 1.00 23.42 ? 295 ALA A N    1 
ATOM   2333 C  CA   . ALA A 1 295 ? 27.030  -17.099 33.554 1.00 22.75 ? 295 ALA A CA   1 
ATOM   2334 C  C    . ALA A 1 295 ? 25.810  -16.775 32.688 1.00 22.29 ? 295 ALA A C    1 
ATOM   2335 O  O    . ALA A 1 295 ? 25.192  -17.671 32.114 1.00 24.14 ? 295 ALA A O    1 
ATOM   2336 C  CB   . ALA A 1 295 ? 26.643  -17.152 35.023 1.00 22.37 ? 295 ALA A CB   1 
ATOM   2337 N  N    . ILE A 1 296 ? 25.469  -15.491 32.600 1.00 21.29 ? 296 ILE A N    1 
ATOM   2338 C  CA   . ILE A 1 296 ? 24.322  -15.040 31.800 1.00 19.40 ? 296 ILE A CA   1 
ATOM   2339 C  C    . ILE A 1 296 ? 24.579  -15.164 30.291 1.00 19.98 ? 296 ILE A C    1 
ATOM   2340 O  O    . ILE A 1 296 ? 23.670  -15.498 29.519 1.00 20.65 ? 296 ILE A O    1 
ATOM   2341 C  CB   . ILE A 1 296 ? 23.890  -13.584 32.189 1.00 17.64 ? 296 ILE A CB   1 
ATOM   2342 C  CG1  . ILE A 1 296 ? 23.496  -13.578 33.673 1.00 18.40 ? 296 ILE A CG1  1 
ATOM   2343 C  CG2  . ILE A 1 296 ? 22.557  -13.231 31.474 1.00 18.84 ? 296 ILE A CG2  1 
ATOM   2344 C  CD1  . ILE A 1 296 ? 23.191  -12.174 34.255 1.00 17.99 ? 296 ILE A CD1  1 
ATOM   2345 N  N    . ASP A 1 297 ? 25.804  -14.916 29.898 1.00 21.30 ? 297 ASP A N    1 
ATOM   2346 C  CA   . ASP A 1 297 ? 26.243  -15.074 28.561 1.00 21.11 ? 297 ASP A CA   1 
ATOM   2347 C  C    . ASP A 1 297 ? 26.026  -16.530 28.163 1.00 22.37 ? 297 ASP A C    1 
ATOM   2348 O  O    . ASP A 1 297 ? 25.753  -16.801 27.045 1.00 23.18 ? 297 ASP A O    1 
ATOM   2349 C  CB   . ASP A 1 297 ? 27.737  -14.748 28.437 1.00 20.63 ? 297 ASP A CB   1 
ATOM   2350 C  CG   . ASP A 1 297 ? 28.068  -13.248 28.242 1.00 22.67 ? 297 ASP A CG   1 
ATOM   2351 O  OD1  . ASP A 1 297 ? 27.214  -12.398 28.040 1.00 20.99 ? 297 ASP A OD1  1 
ATOM   2352 O  OD2  . ASP A 1 297 ? 29.249  -12.961 28.326 1.00 23.88 ? 297 ASP A OD2  1 
ATOM   2353 N  N    . GLY A 1 298 ? 26.195  -17.454 29.090 1.00 23.23 ? 298 GLY A N    1 
ATOM   2354 C  CA   . GLY A 1 298 ? 26.002  -18.865 28.792 1.00 24.23 ? 298 GLY A CA   1 
ATOM   2355 C  C    . GLY A 1 298 ? 24.584  -19.321 28.475 1.00 25.34 ? 298 GLY A C    1 
ATOM   2356 O  O    . GLY A 1 298 ? 24.349  -20.392 28.028 1.00 26.33 ? 298 GLY A O    1 
ATOM   2357 N  N    . LEU A 1 299 ? 23.633  -18.477 28.786 1.00 23.84 ? 299 LEU A N    1 
ATOM   2358 C  CA   . LEU A 1 299 ? 22.235  -18.742 28.554 1.00 24.63 ? 299 LEU A CA   1 
ATOM   2359 C  C    . LEU A 1 299 ? 21.795  -18.641 27.099 1.00 24.75 ? 299 LEU A C    1 
ATOM   2360 O  O    . LEU A 1 299 ? 20.754  -19.087 26.761 1.00 25.60 ? 299 LEU A O    1 
ATOM   2361 C  CB   . LEU A 1 299 ? 21.390  -17.805 29.423 1.00 22.73 ? 299 LEU A CB   1 
ATOM   2362 C  CG   . LEU A 1 299 ? 21.592  -17.834 30.917 1.00 25.66 ? 299 LEU A CG   1 
ATOM   2363 C  CD1  . LEU A 1 299 ? 20.814  -16.827 31.642 1.00 24.65 ? 299 LEU A CD1  1 
ATOM   2364 C  CD2  . LEU A 1 299 ? 21.309  -19.196 31.476 1.00 22.26 ? 299 LEU A CD2  1 
ATOM   2365 N  N    . ASN A 1 300 ? 22.610  -18.006 26.264 1.00 25.15 ? 300 ASN A N    1 
ATOM   2366 C  CA   . ASN A 1 300 ? 22.247  -17.788 24.867 1.00 25.75 ? 300 ASN A CA   1 
ATOM   2367 C  C    . ASN A 1 300 ? 21.890  -19.017 24.034 1.00 25.56 ? 300 ASN A C    1 
ATOM   2368 O  O    . ASN A 1 300 ? 22.747  -19.857 23.763 1.00 25.01 ? 300 ASN A O    1 
ATOM   2369 C  CB   . ASN A 1 300 ? 23.393  -17.108 24.115 1.00 25.08 ? 300 ASN A CB   1 
ATOM   2370 C  CG   . ASN A 1 300 ? 22.968  -16.576 22.761 1.00 28.81 ? 300 ASN A CG   1 
ATOM   2371 O  OD1  . ASN A 1 300 ? 21.880  -16.019 22.614 1.00 26.01 ? 300 ASN A OD1  1 
ATOM   2372 N  ND2  . ASN A 1 300 ? 23.826  -16.746 21.762 1.00 31.70 ? 300 ASN A ND2  1 
ATOM   2373 N  N    . ARG A 1 301 ? 20.631  -19.111 23.600 1.00 26.02 ? 301 ARG A N    1 
ATOM   2374 C  CA   . ARG A 1 301 ? 20.168  -20.290 22.856 1.00 26.68 ? 301 ARG A CA   1 
ATOM   2375 C  C    . ARG A 1 301 ? 19.450  -20.102 21.505 1.00 26.58 ? 301 ARG A C    1 
ATOM   2376 O  O    . ARG A 1 301 ? 18.736  -20.997 21.054 1.00 25.16 ? 301 ARG A O    1 
ATOM   2377 C  CB   . ARG A 1 301 ? 19.259  -21.062 23.818 1.00 28.30 ? 301 ARG A CB   1 
ATOM   2378 C  CG   . ARG A 1 301 ? 18.190  -20.210 24.480 1.00 26.72 ? 301 ARG A CG   1 
ATOM   2379 C  CD   . ARG A 1 301 ? 17.571  -20.926 25.670 1.00 29.37 ? 301 ARG A CD   1 
ATOM   2380 N  NE   . ARG A 1 301 ? 16.878  -22.148 25.272 1.00 29.27 ? 301 ARG A NE   1 
ATOM   2381 C  CZ   . ARG A 1 301 ? 16.230  -22.948 26.113 1.00 28.87 ? 301 ARG A CZ   1 
ATOM   2382 N  NH1  . ARG A 1 301 ? 16.185  -22.656 27.406 1.00 29.88 ? 301 ARG A NH1  1 
ATOM   2383 N  NH2  . ARG A 1 301 ? 15.628  -24.040 25.663 1.00 34.88 ? 301 ARG A NH2  1 
ATOM   2384 N  N    . ASN A 1 302 ? 19.644  -18.953 20.864 1.00 25.53 ? 302 ASN A N    1 
ATOM   2385 C  CA   . ASN A 1 302 ? 19.101  -18.693 19.542 1.00 26.65 ? 302 ASN A CA   1 
ATOM   2386 C  C    . ASN A 1 302 ? 17.583  -18.657 19.544 1.00 26.53 ? 302 ASN A C    1 
ATOM   2387 O  O    . ASN A 1 302 ? 16.950  -18.981 18.539 1.00 27.34 ? 302 ASN A O    1 
ATOM   2388 C  CB   . ASN A 1 302 ? 19.600  -19.739 18.543 1.00 26.17 ? 302 ASN A CB   1 
ATOM   2389 C  CG   . ASN A 1 302 ? 19.517  -19.261 17.107 1.00 29.16 ? 302 ASN A CG   1 
ATOM   2390 O  OD1  . ASN A 1 302 ? 19.463  -18.060 16.843 0.60 29.94 ? 302 ASN A OD1  1 
ATOM   2391 N  ND2  . ASN A 1 302 ? 19.505  -20.201 16.170 0.60 30.87 ? 302 ASN A ND2  1 
ATOM   2392 N  N    . VAL A 1 303 ? 16.994  -18.265 20.669 1.00 25.46 ? 303 VAL A N    1 
ATOM   2393 C  CA   . VAL A 1 303 ? 15.575  -18.211 20.731 1.00 25.42 ? 303 VAL A CA   1 
ATOM   2394 C  C    . VAL A 1 303 ? 15.153  -16.792 20.377 1.00 23.82 ? 303 VAL A C    1 
ATOM   2395 O  O    . VAL A 1 303 ? 15.244  -15.918 21.179 1.00 23.70 ? 303 VAL A O    1 
ATOM   2396 C  CB   . VAL A 1 303 ? 15.063  -18.682 22.086 1.00 26.94 ? 303 VAL A CB   1 
ATOM   2397 C  CG1  . VAL A 1 303 ? 13.671  -18.251 22.363 1.00 25.77 ? 303 VAL A CG1  1 
ATOM   2398 C  CG2  . VAL A 1 303 ? 15.302  -20.149 22.241 1.00 27.08 ? 303 VAL A CG2  1 
ATOM   2399 N  N    . ARG A 1 304 ? 14.725  -16.604 19.143 1.00 21.59 ? 304 ARG A N    1 
ATOM   2400 C  CA   . ARG A 1 304 ? 14.164  -15.282 18.734 1.00 20.79 ? 304 ARG A CA   1 
ATOM   2401 C  C    . ARG A 1 304 ? 12.663  -15.360 18.930 1.00 19.65 ? 304 ARG A C    1 
ATOM   2402 O  O    . ARG A 1 304 ? 12.014  -16.173 18.264 1.00 18.91 ? 304 ARG A O    1 
ATOM   2403 C  CB   . ARG A 1 304 ? 14.527  -14.946 17.277 1.00 20.84 ? 304 ARG A CB   1 
ATOM   2404 C  CG   . ARG A 1 304 ? 13.945  -13.554 16.805 1.00 20.15 ? 304 ARG A CG   1 
ATOM   2405 C  CD   . ARG A 1 304 ? 14.052  -13.449 15.260 1.00 22.49 ? 304 ARG A CD   1 
ATOM   2406 N  NE   . ARG A 1 304 ? 15.420  -13.313 14.775 1.00 24.63 ? 304 ARG A NE   1 
ATOM   2407 C  CZ   . ARG A 1 304 ? 16.215  -12.227 14.865 1.00 22.79 ? 304 ARG A CZ   1 
ATOM   2408 N  NH1  . ARG A 1 304 ? 15.847  -11.119 15.506 1.00 20.04 ? 304 ARG A NH1  1 
ATOM   2409 N  NH2  . ARG A 1 304 ? 17.444  -12.278 14.321 1.00 20.00 ? 304 ARG A NH2  1 
ATOM   2410 N  N    . TYR A 1 305 ? 12.094  -14.584 19.868 1.00 19.43 ? 305 TYR A N    1 
ATOM   2411 C  CA   . TYR A 1 305 ? 10.664  -14.661 20.183 1.00 19.80 ? 305 TYR A CA   1 
ATOM   2412 C  C    . TYR A 1 305 ? 9.807   -13.989 19.134 1.00 20.46 ? 305 TYR A C    1 
ATOM   2413 O  O    . TYR A 1 305 ? 8.771   -14.503 18.705 1.00 20.49 ? 305 TYR A O    1 
ATOM   2414 C  CB   . TYR A 1 305 ? 10.332  -13.969 21.498 1.00 21.01 ? 305 TYR A CB   1 
ATOM   2415 C  CG   . TYR A 1 305 ? 10.855  -14.671 22.689 1.00 21.61 ? 305 TYR A CG   1 
ATOM   2416 C  CD1  . TYR A 1 305 ? 10.314  -15.923 23.078 1.00 21.36 ? 305 TYR A CD1  1 
ATOM   2417 C  CD2  . TYR A 1 305 ? 11.921  -14.146 23.415 1.00 18.18 ? 305 TYR A CD2  1 
ATOM   2418 C  CE1  . TYR A 1 305 ? 10.813  -16.614 24.182 1.00 20.25 ? 305 TYR A CE1  1 
ATOM   2419 C  CE2  . TYR A 1 305 ? 12.426  -14.835 24.562 1.00 19.12 ? 305 TYR A CE2  1 
ATOM   2420 C  CZ   . TYR A 1 305 ? 11.847  -16.065 24.918 1.00 20.41 ? 305 TYR A CZ   1 
ATOM   2421 O  OH   . TYR A 1 305 ? 12.317  -16.747 25.979 1.00 21.65 ? 305 TYR A OH   1 
ATOM   2422 N  N    . LEU A 1 306 ? 10.227  -12.808 18.703 1.00 19.55 ? 306 LEU A N    1 
ATOM   2423 C  CA   . LEU A 1 306 ? 9.470   -12.082 17.691 1.00 19.78 ? 306 LEU A CA   1 
ATOM   2424 C  C    . LEU A 1 306 ? 10.084  -12.283 16.312 1.00 20.52 ? 306 LEU A C    1 
ATOM   2425 O  O    . LEU A 1 306 ? 10.847  -11.438 15.844 1.00 20.99 ? 306 LEU A O    1 
ATOM   2426 C  CB   . LEU A 1 306 ? 9.413   -10.592 18.030 1.00 19.53 ? 306 LEU A CB   1 
ATOM   2427 C  CG   . LEU A 1 306 ? 8.135   -9.853  17.630 1.00 20.06 ? 306 LEU A CG   1 
ATOM   2428 C  CD1  . LEU A 1 306 ? 6.933   -10.421 18.370 1.00 21.08 ? 306 LEU A CD1  1 
ATOM   2429 C  CD2  . LEU A 1 306 ? 8.273   -8.361  17.889 1.00 22.67 ? 306 LEU A CD2  1 
ATOM   2430 N  N    . THR A 1 307 ? 9.760   -13.396 15.658 1.00 20.19 ? 307 THR A N    1 
ATOM   2431 C  CA   . THR A 1 307 ? 10.344  -13.650 14.349 1.00 20.90 ? 307 THR A CA   1 
ATOM   2432 C  C    . THR A 1 307 ? 9.779   -12.761 13.254 1.00 21.28 ? 307 THR A C    1 
ATOM   2433 O  O    . THR A 1 307 ? 10.403  -12.613 12.170 1.00 21.96 ? 307 THR A O    1 
ATOM   2434 C  CB   . THR A 1 307 ? 10.147  -15.116 13.881 1.00 21.45 ? 307 THR A CB   1 
ATOM   2435 O  OG1  . THR A 1 307 ? 8.733   -15.310 13.667 1.00 25.96 ? 307 THR A OG1  1 
ATOM   2436 C  CG2  . THR A 1 307 ? 10.675  -16.085 14.914 1.00 21.13 ? 307 THR A CG2  1 
ATOM   2437 N  N    . LEU A 1 308 ? 8.588   -12.225 13.475 1.00 22.78 ? 308 LEU A N    1 
ATOM   2438 C  CA   . LEU A 1 308 ? 7.916   -11.410 12.447 1.00 23.60 ? 308 LEU A CA   1 
ATOM   2439 C  C    . LEU A 1 308 ? 7.962   -12.131 11.068 1.00 25.38 ? 308 LEU A C    1 
ATOM   2440 O  O    . LEU A 1 308 ? 8.050   -11.489 10.007 1.00 25.71 ? 308 LEU A O    1 
ATOM   2441 C  CB   . LEU A 1 308 ? 8.587   -10.027 12.384 1.00 23.28 ? 308 LEU A CB   1 
ATOM   2442 C  CG   . LEU A 1 308 ? 8.611   -9.299  13.727 1.00 18.06 ? 308 LEU A CG   1 
ATOM   2443 C  CD1  . LEU A 1 308 ? 9.405   -8.017  13.597 1.00 22.17 ? 308 LEU A CD1  1 
ATOM   2444 C  CD2  . LEU A 1 308 ? 7.134   -8.962  14.116 1.00 17.84 ? 308 LEU A CD2  1 
ATOM   2445 N  N    . ASP A 1 309 ? 7.824   -13.459 11.084 1.00 27.14 ? 309 ASP A N    1 
ATOM   2446 C  CA   . ASP A 1 309 ? 7.937   -14.248 9.848  1.00 27.63 ? 309 ASP A CA   1 
ATOM   2447 C  C    . ASP A 1 309 ? 6.735   -14.091 8.947  1.00 28.44 ? 309 ASP A C    1 
ATOM   2448 O  O    . ASP A 1 309 ? 6.784   -14.485 7.786  1.00 28.63 ? 309 ASP A O    1 
ATOM   2449 C  CB   . ASP A 1 309 ? 8.295   -15.721 10.123 1.00 29.06 ? 309 ASP A CB   1 
ATOM   2450 C  CG   . ASP A 1 309 ? 7.218   -16.477 10.892 1.00 29.78 ? 309 ASP A CG   1 
ATOM   2451 O  OD1  . ASP A 1 309 ? 6.104   -15.955 11.147 1.00 30.67 ? 309 ASP A OD1  1 
ATOM   2452 O  OD2  . ASP A 1 309 ? 7.524   -17.644 11.245 1.00 37.95 ? 309 ASP A OD2  1 
ATOM   2453 N  N    . ILE A 1 310 ? 5.664   -13.491 9.460  1.00 28.01 ? 310 ILE A N    1 
ATOM   2454 C  CA   . ILE A 1 310 ? 4.626   -12.989 8.526  1.00 29.30 ? 310 ILE A CA   1 
ATOM   2455 C  C    . ILE A 1 310 ? 5.165   -12.021 7.434  1.00 28.33 ? 310 ILE A C    1 
ATOM   2456 O  O    . ILE A 1 310 ? 4.523   -11.872 6.348  1.00 25.09 ? 310 ILE A O    1 
ATOM   2457 C  CB   . ILE A 1 310 ? 3.373   -12.393 9.212  1.00 29.30 ? 310 ILE A CB   1 
ATOM   2458 C  CG1  . ILE A 1 310 ? 3.743   -11.245 10.149 1.00 29.89 ? 310 ILE A CG1  1 
ATOM   2459 C  CG2  . ILE A 1 310 ? 2.554   -13.526 9.879  1.00 32.14 ? 310 ILE A CG2  1 
ATOM   2460 C  CD1  . ILE A 1 310 ? 2.652   -10.209 10.211 1.00 33.66 ? 310 ILE A CD1  1 
ATOM   2461 N  N    . PHE A 1 311 ? 6.338   -11.416 7.711  1.00 26.97 ? 311 PHE A N    1 
ATOM   2462 C  CA   . PHE A 1 311 ? 6.963   -10.430 6.791  1.00 27.45 ? 311 PHE A CA   1 
ATOM   2463 C  C    . PHE A 1 311 ? 8.182   -11.019 6.025  1.00 27.35 ? 311 PHE A C    1 
ATOM   2464 O  O    . PHE A 1 311 ? 8.999   -10.302 5.460  1.00 25.25 ? 311 PHE A O    1 
ATOM   2465 C  CB   . PHE A 1 311 ? 7.311   -9.106  7.523  1.00 26.83 ? 311 PHE A CB   1 
ATOM   2466 C  CG   . PHE A 1 311 ? 6.173   -8.058  7.598  1.00 27.70 ? 311 PHE A CG   1 
ATOM   2467 C  CD1  . PHE A 1 311 ? 4.839   -8.411  7.743  1.00 29.42 ? 311 PHE A CD1  1 
ATOM   2468 C  CD2  . PHE A 1 311 ? 6.490   -6.687  7.602  1.00 26.02 ? 311 PHE A CD2  1 
ATOM   2469 C  CE1  . PHE A 1 311 ? 3.825   -7.450  7.832  1.00 24.12 ? 311 PHE A CE1  1 
ATOM   2470 C  CE2  . PHE A 1 311 ? 5.515   -5.707  7.683  1.00 25.37 ? 311 PHE A CE2  1 
ATOM   2471 C  CZ   . PHE A 1 311 ? 4.174   -6.063  7.823  1.00 25.76 ? 311 PHE A CZ   1 
ATOM   2472 N  N    . ALA A 1 312 ? 8.293   -12.344 6.009  1.00 27.54 ? 312 ALA A N    1 
ATOM   2473 C  CA   . ALA A 1 312 ? 9.338   -13.017 5.269  1.00 29.26 ? 312 ALA A CA   1 
ATOM   2474 C  C    . ALA A 1 312 ? 8.811   -13.176 3.853  1.00 29.85 ? 312 ALA A C    1 
ATOM   2475 O  O    . ALA A 1 312 ? 7.596   -13.104 3.604  1.00 31.15 ? 312 ALA A O    1 
ATOM   2476 C  CB   . ALA A 1 312 ? 9.669   -14.384 5.915  1.00 29.44 ? 312 ALA A CB   1 
ATOM   2477 N  N    . GLY A 1 313 ? 9.704   -13.324 2.905  1.00 29.50 ? 313 GLY A N    1 
ATOM   2478 C  CA   . GLY A 1 313 ? 9.286   -13.281 1.517  1.00 28.89 ? 313 GLY A CA   1 
ATOM   2479 C  C    . GLY A 1 313 ? 10.017  -12.118 0.899  1.00 28.58 ? 313 GLY A C    1 
ATOM   2480 O  O    . GLY A 1 313 ? 10.967  -12.315 0.148  1.00 28.55 ? 313 GLY A O    1 
ATOM   2481 N  N    . PRO A 1 314 ? 9.619   -10.876 1.248  1.00 29.04 ? 314 PRO A N    1 
ATOM   2482 C  CA   . PRO A 1 314 ? 10.257  -9.707  0.616  1.00 29.97 ? 314 PRO A CA   1 
ATOM   2483 C  C    . PRO A 1 314 ? 11.761  -9.669  0.790  1.00 31.13 ? 314 PRO A C    1 
ATOM   2484 O  O    . PRO A 1 314 ? 12.270  -10.276 1.713  1.00 32.30 ? 314 PRO A O    1 
ATOM   2485 C  CB   . PRO A 1 314 ? 9.589   -8.536  1.320  1.00 30.65 ? 314 PRO A CB   1 
ATOM   2486 C  CG   . PRO A 1 314 ? 8.224   -9.039  1.579  1.00 29.08 ? 314 PRO A CG   1 
ATOM   2487 C  CD   . PRO A 1 314 ? 8.426   -10.474 2.006  1.00 29.07 ? 314 PRO A CD   1 
ATOM   2488 N  N    . PRO A 1 315 ? 12.481  -8.979  -0.122 1.00 32.63 ? 315 PRO A N    1 
ATOM   2489 C  CA   . PRO A 1 315 ? 13.964  -8.940  -0.073 1.00 32.34 ? 315 PRO A CA   1 
ATOM   2490 C  C    . PRO A 1 315 ? 14.523  -8.370  1.216  1.00 32.01 ? 315 PRO A C    1 
ATOM   2491 O  O    . PRO A 1 315 ? 15.609  -8.753  1.610  1.00 32.27 ? 315 PRO A O    1 
ATOM   2492 C  CB   . PRO A 1 315 ? 14.356  -8.000  -1.233 0.70 33.34 ? 315 PRO A CB   1 
ATOM   2493 C  CG   . PRO A 1 315 ? 13.172  -7.862  -2.078 0.70 33.68 ? 315 PRO A CG   1 
ATOM   2494 C  CD   . PRO A 1 315 ? 11.942  -8.366  -1.352 1.00 32.46 ? 315 PRO A CD   1 
ATOM   2495 N  N    . ASN A 1 316 ? 13.792  -7.448  1.865  1.00 30.33 ? 316 ASN A N    1 
ATOM   2496 C  CA   . ASN A 1 316 ? 14.341  -6.794  3.064  1.00 28.95 ? 316 ASN A CA   1 
ATOM   2497 C  C    . ASN A 1 316 ? 14.012  -7.518  4.364  1.00 26.77 ? 316 ASN A C    1 
ATOM   2498 O  O    . ASN A 1 316 ? 14.375  -7.018  5.432  1.00 25.67 ? 316 ASN A O    1 
ATOM   2499 C  CB   . ASN A 1 316 ? 13.941  -5.280  3.199  1.00 28.37 ? 316 ASN A CB   1 
ATOM   2500 C  CG   . ASN A 1 316 ? 14.368  -4.407  1.988  1.00 32.71 ? 316 ASN A CG   1 
ATOM   2501 O  OD1  . ASN A 1 316 ? 13.854  -3.279  1.792  1.00 38.08 ? 316 ASN A OD1  1 
ATOM   2502 N  ND2  . ASN A 1 316 ? 15.298  -4.901  1.199  1.00 33.99 ? 316 ASN A ND2  1 
ATOM   2503 N  N    . TYR A 1 317 ? 13.358  -8.678  4.319  1.00 25.32 ? 317 TYR A N    1 
ATOM   2504 C  CA   . TYR A 1 317 ? 13.175  -9.427  5.612  1.00 24.29 ? 317 TYR A CA   1 
ATOM   2505 C  C    . TYR A 1 317 ? 14.530  -9.530  6.333  1.00 23.38 ? 317 TYR A C    1 
ATOM   2506 O  O    . TYR A 1 317 ? 15.471  -10.079 5.774  1.00 22.73 ? 317 TYR A O    1 
ATOM   2507 C  CB   . TYR A 1 317 ? 12.562  -10.825 5.428  1.00 23.53 ? 317 TYR A CB   1 
ATOM   2508 C  CG   . TYR A 1 317 ? 12.340  -11.543 6.732  1.00 23.90 ? 317 TYR A CG   1 
ATOM   2509 C  CD1  . TYR A 1 317 ? 11.390  -11.095 7.643  1.00 25.72 ? 317 TYR A CD1  1 
ATOM   2510 C  CD2  . TYR A 1 317 ? 13.071  -12.678 7.057  1.00 22.33 ? 317 TYR A CD2  1 
ATOM   2511 C  CE1  . TYR A 1 317 ? 11.174  -11.738 8.837  1.00 23.71 ? 317 TYR A CE1  1 
ATOM   2512 C  CE2  . TYR A 1 317 ? 12.838  -13.340 8.224  1.00 23.88 ? 317 TYR A CE2  1 
ATOM   2513 C  CZ   . TYR A 1 317 ? 11.893  -12.870 9.122  1.00 22.73 ? 317 TYR A CZ   1 
ATOM   2514 O  OH   . TYR A 1 317 ? 11.691  -13.541 10.310 1.00 21.77 ? 317 TYR A OH   1 
ATOM   2515 N  N    . PRO A 1 318 ? 14.637  -8.959  7.555  1.00 22.18 ? 318 PRO A N    1 
ATOM   2516 C  CA   . PRO A 1 318 ? 15.970  -8.829  8.164  1.00 22.36 ? 318 PRO A CA   1 
ATOM   2517 C  C    . PRO A 1 318 ? 16.530  -10.065 8.799  1.00 21.54 ? 318 PRO A C    1 
ATOM   2518 O  O    . PRO A 1 318 ? 17.718  -10.109 8.984  1.00 23.62 ? 318 PRO A O    1 
ATOM   2519 C  CB   . PRO A 1 318 ? 15.793  -7.695  9.203  1.00 22.16 ? 318 PRO A CB   1 
ATOM   2520 C  CG   . PRO A 1 318 ? 14.267  -7.755  9.570  1.00 22.65 ? 318 PRO A CG   1 
ATOM   2521 C  CD   . PRO A 1 318 ? 13.559  -8.400  8.402  1.00 21.72 ? 318 PRO A CD   1 
ATOM   2522 N  N    . PHE A 1 319 ? 15.745  -11.109 9.049  1.00 23.00 ? 319 PHE A N    1 
ATOM   2523 C  CA   . PHE A 1 319 ? 16.240  -12.161 9.969  1.00 24.02 ? 319 PHE A CA   1 
ATOM   2524 C  C    . PHE A 1 319 ? 16.706  -13.487 9.326  1.00 26.15 ? 319 PHE A C    1 
ATOM   2525 O  O    . PHE A 1 319 ? 17.047  -14.411 10.068 1.00 26.36 ? 319 PHE A O    1 
ATOM   2526 C  CB   . PHE A 1 319 ? 15.272  -12.468 11.121 1.00 22.93 ? 319 PHE A CB   1 
ATOM   2527 C  CG   . PHE A 1 319 ? 14.746  -11.229 11.836 1.00 20.67 ? 319 PHE A CG   1 
ATOM   2528 C  CD1  . PHE A 1 319 ? 15.543  -10.094 12.017 1.00 26.06 ? 319 PHE A CD1  1 
ATOM   2529 C  CD2  . PHE A 1 319 ? 13.469  -11.243 12.382 1.00 23.28 ? 319 PHE A CD2  1 
ATOM   2530 C  CE1  . PHE A 1 319 ? 15.061  -8.960  12.696 1.00 23.97 ? 319 PHE A CE1  1 
ATOM   2531 C  CE2  . PHE A 1 319 ? 12.958  -10.131 13.092 1.00 24.14 ? 319 PHE A CE2  1 
ATOM   2532 C  CZ   . PHE A 1 319 ? 13.768  -8.968  13.231 1.00 26.77 ? 319 PHE A CZ   1 
ATOM   2533 N  N    . SER A 1 320 ? 16.741  -13.564 7.994  1.00 26.45 ? 320 SER A N    1 
ATOM   2534 C  CA   A SER A 1 320 ? 17.320  -14.733 7.305  0.50 26.97 ? 320 SER A CA   1 
ATOM   2535 C  CA   B SER A 1 320 ? 17.308  -14.729 7.295  0.50 26.92 ? 320 SER A CA   1 
ATOM   2536 C  C    . SER A 1 320 ? 18.848  -14.673 7.355  1.00 27.73 ? 320 SER A C    1 
ATOM   2537 O  O    . SER A 1 320 ? 19.530  -15.718 7.383  1.00 27.93 ? 320 SER A O    1 
ATOM   2538 C  CB   A SER A 1 320 ? 16.842  -14.799 5.851  0.50 27.05 ? 320 SER A CB   1 
ATOM   2539 C  CB   B SER A 1 320 ? 16.809  -14.773 5.839  0.50 26.95 ? 320 SER A CB   1 
ATOM   2540 O  OG   A SER A 1 320 ? 17.231  -13.638 5.136  0.50 27.00 ? 320 SER A OG   1 
ATOM   2541 O  OG   B SER A 1 320 ? 15.403  -14.533 5.742  0.50 26.65 ? 320 SER A OG   1 
ATOM   2542 N  N    . ASP A 1 321 ? 19.420  -13.463 7.377  1.00 27.09 ? 321 ASP A N    1 
ATOM   2543 C  CA   . ASP A 1 321 ? 20.878  -13.381 7.510  1.00 28.19 ? 321 ASP A CA   1 
ATOM   2544 C  C    . ASP A 1 321 ? 21.400  -13.831 8.895  1.00 28.19 ? 321 ASP A C    1 
ATOM   2545 O  O    . ASP A 1 321 ? 20.641  -13.859 9.846  1.00 27.26 ? 321 ASP A O    1 
ATOM   2546 C  CB   . ASP A 1 321 ? 21.409  -11.964 7.231  1.00 29.15 ? 321 ASP A CB   1 
ATOM   2547 C  CG   . ASP A 1 321 ? 21.331  -11.581 5.772  1.00 29.34 ? 321 ASP A CG   1 
ATOM   2548 O  OD1  . ASP A 1 321 ? 20.845  -12.393 4.984  1.00 26.84 ? 321 ASP A OD1  1 
ATOM   2549 O  OD2  . ASP A 1 321 ? 21.778  -10.454 5.439  1.00 29.90 ? 321 ASP A OD2  1 
ATOM   2550 N  N    . GLU A 1 322 ? 22.702  -14.114 9.010  1.00 29.20 ? 322 GLU A N    1 
ATOM   2551 C  CA   . GLU A 1 322 ? 23.234  -14.655 10.280 1.00 30.57 ? 322 GLU A CA   1 
ATOM   2552 C  C    . GLU A 1 322 ? 23.103  -13.593 11.367 1.00 30.80 ? 322 GLU A C    1 
ATOM   2553 O  O    . GLU A 1 322 ? 22.655  -13.883 12.487 1.00 29.45 ? 322 GLU A O    1 
ATOM   2554 C  CB   . GLU A 1 322 ? 24.682  -15.128 10.161 1.00 31.79 ? 322 GLU A CB   1 
ATOM   2555 C  CG   . GLU A 1 322 ? 25.206  -15.591 11.511 1.00 34.22 ? 322 GLU A CG   1 
ATOM   2556 C  CD   . GLU A 1 322 ? 26.727  -15.587 11.600 1.00 36.63 ? 322 GLU A CD   1 
ATOM   2557 O  OE1  . GLU A 1 322 ? 27.380  -15.026 10.687 1.00 36.97 ? 322 GLU A OE1  1 
ATOM   2558 O  OE2  . GLU A 1 322 ? 27.260  -16.156 12.598 1.00 38.56 ? 322 GLU A OE2  1 
ATOM   2559 N  N    . TYR A 1 323 ? 23.470  -12.361 11.008 1.00 30.46 ? 323 TYR A N    1 
ATOM   2560 C  CA   . TYR A 1 323 ? 23.054  -11.183 11.759 1.00 30.98 ? 323 TYR A CA   1 
ATOM   2561 C  C    . TYR A 1 323 ? 23.178  -9.983  10.845 1.00 30.58 ? 323 TYR A C    1 
ATOM   2562 O  O    . TYR A 1 323 ? 22.784  -8.851  11.221 1.00 29.95 ? 323 TYR A O    1 
ATOM   2563 C  CB   . TYR A 1 323 ? 23.928  -10.988 13.000 1.00 31.11 ? 323 TYR A CB   1 
ATOM   2564 C  CG   . TYR A 1 323 ? 25.356  -10.618 12.659 1.00 32.84 ? 323 TYR A CG   1 
ATOM   2565 C  CD1  . TYR A 1 323 ? 26.298  -11.591 12.228 1.00 33.67 ? 323 TYR A CD1  1 
ATOM   2566 C  CD2  . TYR A 1 323 ? 25.776  -9.296  12.768 1.00 32.16 ? 323 TYR A CD2  1 
ATOM   2567 C  CE1  . TYR A 1 323 ? 27.619  -11.220 11.925 1.00 31.20 ? 323 TYR A CE1  1 
ATOM   2568 C  CE2  . TYR A 1 323 ? 27.052  -8.931  12.461 1.00 31.77 ? 323 TYR A CE2  1 
ATOM   2569 C  CZ   . TYR A 1 323 ? 27.969  -9.877  12.045 1.00 33.86 ? 323 TYR A CZ   1 
ATOM   2570 O  OH   . TYR A 1 323 ? 29.217  -9.391  11.786 1.00 32.51 ? 323 TYR A OH   1 
ATOM   2571 O  OXT  . TYR A 1 323 ? 23.689  -10.121 9.721  1.00 29.62 ? 323 TYR A OXT  1 
HETATM 2572 P  PA   . NAP B 2 .   ? 9.134   -6.982  27.732 1.00 20.00 ? 351 NAP A PA   1 
HETATM 2573 O  O1A  . NAP B 2 .   ? 10.076  -8.021  27.225 1.00 17.77 ? 351 NAP A O1A  1 
HETATM 2574 O  O2A  . NAP B 2 .   ? 9.708   -5.678  28.168 1.00 19.66 ? 351 NAP A O2A  1 
HETATM 2575 O  O5B  . NAP B 2 .   ? 8.290   -7.621  28.916 1.00 22.13 ? 351 NAP A O5B  1 
HETATM 2576 C  C5B  . NAP B 2 .   ? 7.465   -8.737  28.693 1.00 19.16 ? 351 NAP A C5B  1 
HETATM 2577 C  C4B  . NAP B 2 .   ? 6.513   -8.998  29.892 1.00 21.20 ? 351 NAP A C4B  1 
HETATM 2578 O  O4B  . NAP B 2 .   ? 7.241   -8.985  31.079 1.00 18.92 ? 351 NAP A O4B  1 
HETATM 2579 C  C3B  . NAP B 2 .   ? 5.486   -7.893  29.998 1.00 22.89 ? 351 NAP A C3B  1 
HETATM 2580 O  O3B  . NAP B 2 .   ? 4.289   -8.405  29.417 1.00 21.23 ? 351 NAP A O3B  1 
HETATM 2581 C  C2B  . NAP B 2 .   ? 5.324   -7.602  31.463 1.00 21.05 ? 351 NAP A C2B  1 
HETATM 2582 O  O2B  . NAP B 2 .   ? 3.984   -7.940  31.871 1.00 20.51 ? 351 NAP A O2B  1 
HETATM 2583 C  C1B  . NAP B 2 .   ? 6.384   -8.509  32.114 1.00 24.62 ? 351 NAP A C1B  1 
HETATM 2584 N  N9A  . NAP B 2 .   ? 7.208   -7.844  33.164 1.00 21.39 ? 351 NAP A N9A  1 
HETATM 2585 C  C8A  . NAP B 2 .   ? 7.631   -6.533  33.190 1.00 18.34 ? 351 NAP A C8A  1 
HETATM 2586 N  N7A  . NAP B 2 .   ? 8.284   -6.312  34.337 1.00 18.03 ? 351 NAP A N7A  1 
HETATM 2587 C  C5A  . NAP B 2 .   ? 8.283   -7.522  35.032 1.00 19.50 ? 351 NAP A C5A  1 
HETATM 2588 C  C6A  . NAP B 2 .   ? 8.768   -7.995  36.282 1.00 24.04 ? 351 NAP A C6A  1 
HETATM 2589 N  N6A  . NAP B 2 .   ? 9.494   -7.264  37.161 1.00 26.51 ? 351 NAP A N6A  1 
HETATM 2590 N  N1A  . NAP B 2 .   ? 8.583   -9.296  36.661 1.00 20.75 ? 351 NAP A N1A  1 
HETATM 2591 C  C2A  . NAP B 2 .   ? 7.886   -10.147 35.891 1.00 21.02 ? 351 NAP A C2A  1 
HETATM 2592 N  N3A  . NAP B 2 .   ? 7.420   -9.742  34.698 1.00 19.97 ? 351 NAP A N3A  1 
HETATM 2593 C  C4A  . NAP B 2 .   ? 7.612   -8.448  34.267 1.00 16.60 ? 351 NAP A C4A  1 
HETATM 2594 O  O3   . NAP B 2 .   ? 7.908   -6.606  26.723 1.00 17.58 ? 351 NAP A O3   1 
HETATM 2595 P  PN   . NAP B 2 .   ? 7.844   -6.330  25.110 1.00 18.96 ? 351 NAP A PN   1 
HETATM 2596 O  O1N  . NAP B 2 .   ? 6.626   -5.454  25.017 1.00 20.15 ? 351 NAP A O1N  1 
HETATM 2597 O  O2N  . NAP B 2 .   ? 7.895   -7.624  24.339 1.00 20.80 ? 351 NAP A O2N  1 
HETATM 2598 O  O5D  . NAP B 2 .   ? 9.117   -5.401  24.879 1.00 20.53 ? 351 NAP A O5D  1 
HETATM 2599 C  C5D  . NAP B 2 .   ? 9.183   -4.134  25.548 1.00 18.04 ? 351 NAP A C5D  1 
HETATM 2600 C  C4D  . NAP B 2 .   ? 9.054   -2.938  24.599 1.00 16.81 ? 351 NAP A C4D  1 
HETATM 2601 O  O4D  . NAP B 2 .   ? 9.949   -2.931  23.478 1.00 14.95 ? 351 NAP A O4D  1 
HETATM 2602 C  C3D  . NAP B 2 .   ? 7.702   -2.952  23.890 1.00 17.27 ? 351 NAP A C3D  1 
HETATM 2603 O  O3D  . NAP B 2 .   ? 6.577   -2.649  24.753 1.00 15.74 ? 351 NAP A O3D  1 
HETATM 2604 C  C2D  . NAP B 2 .   ? 7.909   -1.928  22.793 1.00 18.47 ? 351 NAP A C2D  1 
HETATM 2605 O  O2D  . NAP B 2 .   ? 7.862   -0.615  23.396 1.00 17.62 ? 351 NAP A O2D  1 
HETATM 2606 C  C1D  . NAP B 2 .   ? 9.335   -2.296  22.352 1.00 15.15 ? 351 NAP A C1D  1 
HETATM 2607 N  N1N  . NAP B 2 .   ? 9.335   -3.264  21.255 1.00 13.94 ? 351 NAP A N1N  1 
HETATM 2608 C  C2N  . NAP B 2 .   ? 9.726   -2.871  20.027 1.00 12.65 ? 351 NAP A C2N  1 
HETATM 2609 C  C3N  . NAP B 2 .   ? 9.725   -3.735  18.940 1.00 15.57 ? 351 NAP A C3N  1 
HETATM 2610 C  C7N  . NAP B 2 .   ? 10.180  -3.254  17.541 1.00 21.29 ? 351 NAP A C7N  1 
HETATM 2611 O  O7N  . NAP B 2 .   ? 9.831   -3.896  16.516 1.00 19.12 ? 351 NAP A O7N  1 
HETATM 2612 N  N7N  . NAP B 2 .   ? 10.996  -2.170  17.432 1.00 15.14 ? 351 NAP A N7N  1 
HETATM 2613 C  C4N  . NAP B 2 .   ? 9.322   -5.068  19.194 1.00 16.16 ? 351 NAP A C4N  1 
HETATM 2614 C  C5N  . NAP B 2 .   ? 8.904   -5.500  20.454 1.00 18.09 ? 351 NAP A C5N  1 
HETATM 2615 C  C6N  . NAP B 2 .   ? 8.972   -4.581  21.506 1.00 14.16 ? 351 NAP A C6N  1 
HETATM 2616 P  P2B  . NAP B 2 .   ? 3.173   -6.907  32.911 1.00 23.37 ? 351 NAP A P2B  1 
HETATM 2617 O  O1X  . NAP B 2 .   ? 4.157   -6.423  33.982 1.00 25.37 ? 351 NAP A O1X  1 
HETATM 2618 O  O2X  . NAP B 2 .   ? 1.978   -7.704  33.343 1.00 21.91 ? 351 NAP A O2X  1 
HETATM 2619 O  O3X  . NAP B 2 .   ? 2.738   -5.754  32.040 1.00 23.45 ? 351 NAP A O3X  1 
HETATM 2620 C  C1   . 5P3 C 3 .   ? 5.963   -4.900  17.723 1.00 18.62 ? 350 5P3 A C1   1 
HETATM 2621 C  C2   . 5P3 C 3 .   ? 6.007   -4.858  16.326 1.00 17.18 ? 350 5P3 A C2   1 
HETATM 2622 C  C3   . 5P3 C 3 .   ? 5.426   -5.847  15.546 1.00 20.75 ? 350 5P3 A C3   1 
HETATM 2623 C  C4   . 5P3 C 3 .   ? 4.767   -6.889  16.225 1.00 21.99 ? 350 5P3 A C4   1 
HETATM 2624 C  C5   . 5P3 C 3 .   ? 4.688   -6.915  17.612 1.00 21.99 ? 350 5P3 A C5   1 
HETATM 2625 C  C6   . 5P3 C 3 .   ? 5.283   -5.933  18.379 1.00 19.93 ? 350 5P3 A C6   1 
HETATM 2626 C  C7   . 5P3 C 3 .   ? 6.573   -3.776  18.577 1.00 19.79 ? 350 5P3 A C7   1 
HETATM 2627 O  O8   . 5P3 C 3 .   ? 7.217   -2.832  18.012 1.00 17.18 ? 350 5P3 A O8   1 
HETATM 2628 O  O9   . 5P3 C 3 .   ? 6.309   -3.837  19.802 1.00 15.42 ? 350 5P3 A O9   1 
HETATM 2629 O  O10  . 5P3 C 3 .   ? 5.191   -5.954  19.750 1.00 17.77 ? 350 5P3 A O10  1 
HETATM 2630 CL CL11 . 5P3 C 3 .   ? 3.857   -8.217  18.390 1.00 23.54 ? 350 5P3 A CL11 1 
HETATM 2631 C  C12  . 5P3 C 3 .   ? 5.542   -5.947  14.129 1.00 18.92 ? 350 5P3 A C12  1 
HETATM 2632 C  C13  . 5P3 C 3 .   ? 4.556   -6.542  13.283 1.00 18.13 ? 350 5P3 A C13  1 
HETATM 2633 C  C14  . 5P3 C 3 .   ? 4.828   -6.673  11.931 1.00 20.17 ? 350 5P3 A C14  1 
HETATM 2634 C  C15  . 5P3 C 3 .   ? 6.037   -6.276  11.397 1.00 18.85 ? 350 5P3 A C15  1 
HETATM 2635 C  C16  . 5P3 C 3 .   ? 7.039   -5.778  12.223 1.00 15.94 ? 350 5P3 A C16  1 
HETATM 2636 C  C17  . 5P3 C 3 .   ? 6.749   -5.580  13.567 1.00 18.64 ? 350 5P3 A C17  1 
HETATM 2637 ZN ZN   . ZN  D 4 .   ? 26.555  -10.662 42.388 1.00 23.85 ? 324 ZN  A ZN   1 
HETATM 2638 O  O    . HOH E 5 .   ? 21.059  -17.287 47.294 1.00 32.82 ? 325 HOH A O    1 
HETATM 2639 O  O    . HOH E 5 .   ? 30.255  -6.591  31.083 1.00 42.77 ? 326 HOH A O    1 
HETATM 2640 O  O    . HOH E 5 .   ? -5.008  -19.764 -3.024 1.00 41.92 ? 327 HOH A O    1 
HETATM 2641 O  O    . HOH E 5 .   ? 0.808   -15.914 11.549 1.00 47.76 ? 328 HOH A O    1 
HETATM 2642 O  O    . HOH E 5 .   ? 8.002   -13.571 -2.103 1.00 51.32 ? 329 HOH A O    1 
HETATM 2643 O  O    . HOH E 5 .   ? 2.497   -16.212 -0.118 1.00 49.75 ? 330 HOH A O    1 
HETATM 2644 O  O    . HOH E 5 .   ? 31.250  -8.840  6.632  0.50 28.86 ? 331 HOH A O    1 
HETATM 2645 O  O    . HOH E 5 .   ? 9.812   -16.031 37.293 0.50 23.16 ? 332 HOH A O    1 
HETATM 2646 O  O    . HOH E 5 .   ? 26.969  -8.734  42.389 1.00 17.04 ? 333 HOH A O    1 
HETATM 2647 O  O    . HOH E 5 .   ? 20.487  6.589   36.874 1.00 38.84 ? 334 HOH A O    1 
HETATM 2648 O  O    . HOH E 5 .   ? 18.177  6.490   38.035 1.00 49.37 ? 335 HOH A O    1 
HETATM 2649 O  O    . HOH E 5 .   ? 16.690  6.799   34.671 0.50 28.69 ? 336 HOH A O    1 
HETATM 2650 O  O    . HOH E 5 .   ? 24.020  17.596  19.943 1.00 29.78 ? 337 HOH A O    1 
HETATM 2651 O  O    . HOH E 5 .   ? -6.482  0.223   38.026 1.00 45.24 ? 338 HOH A O    1 
HETATM 2652 O  O    . HOH E 5 .   ? -6.995  5.440   36.364 1.00 47.87 ? 339 HOH A O    1 
HETATM 2653 O  O    . HOH E 5 .   ? -6.304  2.055   41.265 1.00 46.33 ? 340 HOH A O    1 
HETATM 2654 O  O    . HOH E 5 .   ? 9.226   21.050  2.043  1.00 46.40 ? 341 HOH A O    1 
HETATM 2655 O  O    . HOH E 5 .   ? 6.557   19.978  0.249  1.00 49.86 ? 342 HOH A O    1 
HETATM 2656 O  O    . HOH E 5 .   ? -2.996  17.638  18.435 0.50 19.51 ? 343 HOH A O    1 
HETATM 2657 O  O    . HOH E 5 .   ? -8.368  -2.499  7.800  1.00 29.04 ? 344 HOH A O    1 
HETATM 2658 O  O    . HOH E 5 .   ? -6.298  -4.817  4.530  1.00 36.34 ? 345 HOH A O    1 
HETATM 2659 O  O    . HOH E 5 .   ? -1.627  -13.842 -4.728 1.00 41.49 ? 346 HOH A O    1 
HETATM 2660 O  O    . HOH E 5 .   ? 19.557  10.046  -4.233 1.00 49.54 ? 347 HOH A O    1 
HETATM 2661 O  O    . HOH E 5 .   ? 28.868  10.671  -0.439 0.50 28.51 ? 348 HOH A O    1 
HETATM 2662 O  O    . HOH E 5 .   ? 31.394  5.189   10.640 1.00 39.19 ? 349 HOH A O    1 
HETATM 2663 O  O    . HOH E 5 .   ? 11.742  -13.334 42.247 1.00 56.55 ? 352 HOH A O    1 
HETATM 2664 O  O    . HOH E 5 .   ? 1.739   21.414  20.066 1.00 45.79 ? 353 HOH A O    1 
HETATM 2665 O  O    . HOH E 5 .   ? 25.057  -0.113  22.554 1.00 28.16 ? 354 HOH A O    1 
HETATM 2666 O  O    . HOH E 5 .   ? -9.146  -13.501 -5.531 0.50 15.52 ? 355 HOH A O    1 
HETATM 2667 O  O    . HOH E 5 .   ? -4.873  -5.679  33.525 1.00 48.86 ? 356 HOH A O    1 
HETATM 2668 O  O    . HOH E 5 .   ? 20.956  -6.124  45.761 1.00 42.76 ? 357 HOH A O    1 
HETATM 2669 O  O    . HOH E 5 .   ? 23.434  -3.572  45.956 1.00 42.93 ? 358 HOH A O    1 
HETATM 2670 O  O    . HOH E 5 .   ? -2.640  -5.834  17.019 0.50 21.09 ? 359 HOH A O    1 
HETATM 2671 O  O    . HOH E 5 .   ? -0.992  -9.173  36.611 1.00 41.03 ? 360 HOH A O    1 
HETATM 2672 O  O    . HOH E 5 .   ? 0.319   16.415  4.072  1.00 46.88 ? 361 HOH A O    1 
HETATM 2673 O  O    . HOH E 5 .   ? -6.686  8.628   13.633 0.50 26.35 ? 362 HOH A O    1 
HETATM 2674 O  O    . HOH E 5 .   ? 26.485  4.824   29.477 0.50 16.30 ? 363 HOH A O    1 
HETATM 2675 O  O    . HOH E 5 .   ? 27.496  3.513   23.863 1.00 32.01 ? 364 HOH A O    1 
HETATM 2676 O  O    . HOH E 5 .   ? 21.290  17.550  26.067 1.00 53.56 ? 365 HOH A O    1 
HETATM 2677 O  O    . HOH E 5 .   ? -0.501  14.154  4.337  1.00 36.32 ? 366 HOH A O    1 
HETATM 2678 O  O    . HOH E 5 .   ? -2.192  19.483  17.553 1.00 51.34 ? 367 HOH A O    1 
HETATM 2679 O  O    . HOH E 5 .   ? -2.056  -9.911  -3.579 1.00 39.54 ? 368 HOH A O    1 
HETATM 2680 O  O    . HOH E 5 .   ? -9.497  -7.517  -5.393 1.00 29.31 ? 369 HOH A O    1 
HETATM 2681 O  O    . HOH E 5 .   ? 22.291  1.384   -2.141 1.00 47.74 ? 370 HOH A O    1 
HETATM 2682 O  O    . HOH E 5 .   ? 6.666   -22.485 26.827 1.00 38.54 ? 371 HOH A O    1 
HETATM 2683 O  O    . HOH E 5 .   ? 5.387   -22.864 28.906 1.00 38.34 ? 372 HOH A O    1 
HETATM 2684 O  O    . HOH E 5 .   ? 23.355  -18.600 43.922 1.00 31.02 ? 373 HOH A O    1 
HETATM 2685 O  O    . HOH E 5 .   ? 25.875  -0.928  44.207 1.00 40.64 ? 374 HOH A O    1 
HETATM 2686 O  O    . HOH E 5 .   ? 16.276  19.585  17.244 1.00 23.42 ? 375 HOH A O    1 
HETATM 2687 O  O    . HOH E 5 .   ? -0.340  13.752  36.155 0.50 21.11 ? 376 HOH A O    1 
HETATM 2688 O  O    . HOH E 5 .   ? 11.440  4.100   -3.531 0.50 21.50 ? 377 HOH A O    1 
HETATM 2689 O  O    . HOH E 5 .   ? 29.620  8.955   8.559  1.00 37.29 ? 378 HOH A O    1 
HETATM 2690 O  O    . HOH E 5 .   ? 33.179  -9.124  31.978 1.00 39.06 ? 379 HOH A O    1 
HETATM 2691 O  O    . HOH E 5 .   ? 9.694   -15.444 27.464 1.00 14.64 ? 380 HOH A O    1 
HETATM 2692 O  O    . HOH E 5 .   ? 30.296  -11.337 30.042 1.00 22.57 ? 381 HOH A O    1 
HETATM 2693 O  O    . HOH E 5 .   ? 5.305   2.416   14.008 1.00 18.40 ? 382 HOH A O    1 
HETATM 2694 O  O    . HOH E 5 .   ? 4.068   -5.623  25.728 1.00 19.43 ? 383 HOH A O    1 
HETATM 2695 O  O    . HOH E 5 .   ? 23.931  1.555   38.098 0.50 9.95  ? 384 HOH A O    1 
HETATM 2696 O  O    . HOH E 5 .   ? -10.265 -6.206  25.461 1.00 17.22 ? 385 HOH A O    1 
HETATM 2697 O  O    . HOH E 5 .   ? -8.972  -4.787  22.079 1.00 26.19 ? 386 HOH A O    1 
HETATM 2698 O  O    . HOH E 5 .   ? 2.018   8.428   11.951 1.00 19.54 ? 387 HOH A O    1 
HETATM 2699 O  O    . HOH E 5 .   ? 2.430   8.955   5.840  1.00 21.98 ? 388 HOH A O    1 
HETATM 2700 O  O    . HOH E 5 .   ? 2.217   5.601   8.779  1.00 20.80 ? 389 HOH A O    1 
HETATM 2701 O  O    . HOH E 5 .   ? 31.884  -6.447  14.410 1.00 31.45 ? 390 HOH A O    1 
HETATM 2702 O  O    . HOH E 5 .   ? 28.615  -18.804 13.236 1.00 41.65 ? 391 HOH A O    1 
HETATM 2703 O  O    . HOH E 5 .   ? 17.697  2.403   40.887 1.00 46.56 ? 392 HOH A O    1 
HETATM 2704 O  O    . HOH E 5 .   ? -8.956  8.983   24.986 1.00 37.16 ? 393 HOH A O    1 
HETATM 2705 O  O    . HOH E 5 .   ? 31.102  -14.960 28.064 1.00 38.87 ? 394 HOH A O    1 
HETATM 2706 O  O    . HOH E 5 .   ? 10.718  16.898  4.394  1.00 32.86 ? 395 HOH A O    1 
HETATM 2707 O  O    . HOH E 5 .   ? -1.387  3.929   9.688  1.00 38.16 ? 396 HOH A O    1 
HETATM 2708 O  O    . HOH E 5 .   ? 22.551  -11.540 2.515  0.50 25.16 ? 397 HOH A O    1 
HETATM 2709 O  O    . HOH E 5 .   ? 33.869  -12.257 38.831 1.00 33.08 ? 398 HOH A O    1 
HETATM 2710 O  O    . HOH E 5 .   ? 36.613  -2.685  23.324 1.00 30.24 ? 399 HOH A O    1 
HETATM 2711 O  O    . HOH E 5 .   ? 13.528  19.589  6.449  1.00 34.42 ? 400 HOH A O    1 
HETATM 2712 O  O    . HOH E 5 .   ? -4.613  14.061  22.478 1.00 25.82 ? 401 HOH A O    1 
HETATM 2713 O  O    . HOH E 5 .   ? -9.862  -8.508  29.264 1.00 25.74 ? 402 HOH A O    1 
HETATM 2714 O  O    . HOH E 5 .   ? 19.794  -11.209 10.670 1.00 27.25 ? 403 HOH A O    1 
HETATM 2715 O  O    . HOH E 5 .   ? 20.309  15.701  24.994 1.00 31.33 ? 404 HOH A O    1 
HETATM 2716 O  O    . HOH E 5 .   ? -0.654  7.172   2.539  1.00 29.27 ? 405 HOH A O    1 
HETATM 2717 O  O    . HOH E 5 .   ? -7.531  -8.335  -3.689 1.00 28.23 ? 406 HOH A O    1 
HETATM 2718 O  O    . HOH E 5 .   ? 14.767  -7.668  16.306 1.00 17.88 ? 407 HOH A O    1 
HETATM 2719 O  O    . HOH E 5 .   ? 10.416  -18.386 11.258 1.00 40.06 ? 408 HOH A O    1 
HETATM 2720 O  O    . HOH E 5 .   ? -6.337  -12.608 7.289  1.00 46.35 ? 409 HOH A O    1 
HETATM 2721 O  O    . HOH E 5 .   ? 28.955  -2.832  23.832 1.00 19.24 ? 410 HOH A O    1 
HETATM 2722 O  O    . HOH E 5 .   ? -0.674  -5.350  29.482 1.00 20.07 ? 411 HOH A O    1 
HETATM 2723 O  O    . HOH E 5 .   ? 28.388  -2.334  36.752 1.00 31.71 ? 412 HOH A O    1 
HETATM 2724 O  O    . HOH E 5 .   ? 24.667  10.159  33.118 1.00 41.95 ? 413 HOH A O    1 
HETATM 2725 O  O    . HOH E 5 .   ? -1.413  -1.981  38.585 1.00 26.74 ? 414 HOH A O    1 
HETATM 2726 O  O    . HOH E 5 .   ? 13.206  -13.048 2.706  1.00 39.44 ? 415 HOH A O    1 
HETATM 2727 O  O    . HOH E 5 .   ? 31.299  5.845   3.445  1.00 44.80 ? 416 HOH A O    1 
HETATM 2728 O  O    . HOH E 5 .   ? 0.357   1.206   -3.847 1.00 41.48 ? 417 HOH A O    1 
HETATM 2729 O  O    . HOH E 5 .   ? -1.196  -22.146 21.519 1.00 45.05 ? 418 HOH A O    1 
HETATM 2730 O  O    . HOH E 5 .   ? 5.052   -13.503 12.687 1.00 22.42 ? 419 HOH A O    1 
HETATM 2731 O  O    . HOH E 5 .   ? 18.856  -19.020 12.513 1.00 40.11 ? 420 HOH A O    1 
HETATM 2732 O  O    . HOH E 5 .   ? 6.694   -18.433 15.045 1.00 56.94 ? 421 HOH A O    1 
HETATM 2733 O  O    . HOH E 5 .   ? 30.663  -12.730 10.878 0.50 23.42 ? 422 HOH A O    1 
HETATM 2734 O  O    . HOH E 5 .   ? -4.712  7.952   14.417 1.00 30.69 ? 423 HOH A O    1 
HETATM 2735 O  O    . HOH E 5 .   ? 16.837  -6.097  47.337 1.00 28.90 ? 424 HOH A O    1 
HETATM 2736 O  O    . HOH E 5 .   ? 4.459   -7.553  44.225 1.00 36.40 ? 425 HOH A O    1 
HETATM 2737 O  O    . HOH E 5 .   ? -0.258  -1.967  42.963 1.00 33.92 ? 426 HOH A O    1 
HETATM 2738 O  O    . HOH E 5 .   ? 0.608   9.338   7.720  1.00 28.70 ? 427 HOH A O    1 
HETATM 2739 O  O    . HOH E 5 .   ? 5.151   7.666   13.097 1.00 22.09 ? 428 HOH A O    1 
HETATM 2740 O  O    . HOH E 5 .   ? -2.327  0.591   32.873 1.00 32.13 ? 429 HOH A O    1 
HETATM 2741 O  O    . HOH E 5 .   ? -13.857 -9.494  -2.181 1.00 30.47 ? 430 HOH A O    1 
HETATM 2742 O  O    . HOH E 5 .   ? 24.092  -14.965 6.695  1.00 42.93 ? 431 HOH A O    1 
HETATM 2743 O  O    . HOH E 5 .   ? 12.530  -23.868 21.378 1.00 38.31 ? 432 HOH A O    1 
HETATM 2744 O  O    . HOH E 5 .   ? 22.962  10.706  13.918 1.00 21.90 ? 433 HOH A O    1 
HETATM 2745 O  O    . HOH E 5 .   ? 12.606  -20.706 8.574  1.00 47.29 ? 434 HOH A O    1 
HETATM 2746 O  O    . HOH E 5 .   ? -2.018  10.449  38.209 1.00 48.72 ? 435 HOH A O    1 
HETATM 2747 O  O    . HOH E 5 .   ? 26.277  11.095  11.928 1.00 30.86 ? 436 HOH A O    1 
HETATM 2748 O  O    . HOH E 5 .   ? 8.525   13.245  3.929  1.00 21.17 ? 437 HOH A O    1 
HETATM 2749 O  O    . HOH E 5 .   ? 20.424  11.672  14.929 1.00 17.73 ? 438 HOH A O    1 
HETATM 2750 O  O    . HOH E 5 .   ? 6.340   -12.685 14.811 1.00 20.39 ? 439 HOH A O    1 
HETATM 2751 O  O    . HOH E 5 .   ? 4.320   5.905   10.948 1.00 20.41 ? 440 HOH A O    1 
HETATM 2752 O  O    . HOH E 5 .   ? 23.076  -14.979 26.847 1.00 17.61 ? 441 HOH A O    1 
HETATM 2753 O  O    . HOH E 5 .   ? 17.681  -8.808  28.713 1.00 13.91 ? 442 HOH A O    1 
HETATM 2754 O  O    . HOH E 5 .   ? 12.056  -5.014  26.794 1.00 20.59 ? 443 HOH A O    1 
HETATM 2755 O  O    . HOH E 5 .   ? 17.392  -8.665  15.358 1.00 21.00 ? 444 HOH A O    1 
HETATM 2756 O  O    . HOH E 5 .   ? 24.789  6.704   18.935 1.00 19.43 ? 445 HOH A O    1 
HETATM 2757 O  O    . HOH E 5 .   ? 18.122  -7.519  13.157 1.00 17.67 ? 446 HOH A O    1 
HETATM 2758 O  O    . HOH E 5 .   ? 20.193  -9.353  12.450 1.00 18.01 ? 447 HOH A O    1 
HETATM 2759 O  O    . HOH E 5 .   ? 24.196  0.575   28.972 1.00 24.61 ? 448 HOH A O    1 
HETATM 2760 O  O    . HOH E 5 .   ? 17.502  12.945  21.073 1.00 22.60 ? 449 HOH A O    1 
HETATM 2761 O  O    . HOH E 5 .   ? 10.832  -11.127 37.448 1.00 22.75 ? 450 HOH A O    1 
HETATM 2762 O  O    . HOH E 5 .   ? 15.261  2.963   20.553 1.00 17.37 ? 451 HOH A O    1 
HETATM 2763 O  O    . HOH E 5 .   ? -1.658  6.121   17.071 1.00 22.61 ? 452 HOH A O    1 
HETATM 2764 O  O    . HOH E 5 .   ? 27.623  -9.729  27.655 1.00 17.18 ? 453 HOH A O    1 
HETATM 2765 O  O    . HOH E 5 .   ? 13.177  -10.328 16.928 1.00 19.16 ? 454 HOH A O    1 
HETATM 2766 O  O    . HOH E 5 .   ? 2.971   -17.199 23.100 1.00 26.50 ? 455 HOH A O    1 
HETATM 2767 O  O    . HOH E 5 .   ? 18.219  5.536   32.366 1.00 22.56 ? 456 HOH A O    1 
HETATM 2768 O  O    . HOH E 5 .   ? 0.344   4.882   18.595 1.00 20.33 ? 457 HOH A O    1 
HETATM 2769 O  O    . HOH E 5 .   ? 27.376  -11.847 25.168 1.00 20.87 ? 458 HOH A O    1 
HETATM 2770 O  O    . HOH E 5 .   ? 23.673  -10.748 16.606 1.00 20.69 ? 459 HOH A O    1 
HETATM 2771 O  O    . HOH E 5 .   ? 33.272  -10.399 21.057 1.00 25.59 ? 460 HOH A O    1 
HETATM 2772 O  O    . HOH E 5 .   ? 26.324  1.210   38.286 1.00 31.42 ? 461 HOH A O    1 
HETATM 2773 O  O    . HOH E 5 .   ? 8.640   0.783   9.482  1.00 21.29 ? 462 HOH A O    1 
HETATM 2774 O  O    . HOH E 5 .   ? 8.546   -1.479  33.086 1.00 25.05 ? 463 HOH A O    1 
HETATM 2775 O  O    . HOH E 5 .   ? -0.184  7.825   15.910 1.00 24.40 ? 464 HOH A O    1 
HETATM 2776 O  O    . HOH E 5 .   ? 0.171   14.191  8.753  1.00 25.22 ? 465 HOH A O    1 
HETATM 2777 O  O    . HOH E 5 .   ? 7.726   18.280  22.394 1.00 27.00 ? 466 HOH A O    1 
HETATM 2778 O  O    . HOH E 5 .   ? 2.303   -11.347 0.029  1.00 37.14 ? 467 HOH A O    1 
HETATM 2779 O  O    . HOH E 5 .   ? -7.493  13.157  23.791 1.00 32.20 ? 468 HOH A O    1 
HETATM 2780 O  O    . HOH E 5 .   ? 5.333   11.743  39.658 1.00 47.04 ? 469 HOH A O    1 
HETATM 2781 O  O    . HOH E 5 .   ? 26.707  16.912  23.407 1.00 21.91 ? 470 HOH A O    1 
HETATM 2782 O  O    . HOH E 5 .   ? 0.694   5.321   4.210  1.00 23.75 ? 471 HOH A O    1 
HETATM 2783 O  O    . HOH E 5 .   ? 36.112  -1.611  20.396 1.00 23.54 ? 472 HOH A O    1 
HETATM 2784 O  O    . HOH E 5 .   ? 24.168  -13.706 15.724 1.00 32.17 ? 473 HOH A O    1 
HETATM 2785 O  O    . HOH E 5 .   ? 30.246  -8.643  14.557 1.00 27.31 ? 474 HOH A O    1 
HETATM 2786 O  O    . HOH E 5 .   ? -2.300  13.180  23.417 1.00 25.02 ? 475 HOH A O    1 
HETATM 2787 O  O    . HOH E 5 .   ? -3.198  7.496   19.245 1.00 11.63 ? 476 HOH A O    1 
HETATM 2788 O  O    . HOH E 5 .   ? 16.678  14.669  22.831 1.00 30.39 ? 477 HOH A O    1 
HETATM 2789 O  O    . HOH E 5 .   ? 1.900   17.626  13.818 1.00 24.40 ? 478 HOH A O    1 
HETATM 2790 O  O    . HOH E 5 .   ? 25.269  -5.028  44.106 1.00 21.69 ? 479 HOH A O    1 
HETATM 2791 O  O    . HOH E 5 .   ? -2.197  0.346   4.155  1.00 26.75 ? 480 HOH A O    1 
HETATM 2792 O  O    . HOH E 5 .   ? 33.292  -3.875  18.076 1.00 30.48 ? 481 HOH A O    1 
HETATM 2793 O  O    . HOH E 5 .   ? 13.370  3.965   22.321 1.00 21.39 ? 482 HOH A O    1 
HETATM 2794 O  O    . HOH E 5 .   ? 5.139   4.742   40.235 1.00 29.34 ? 483 HOH A O    1 
HETATM 2795 O  O    . HOH E 5 .   ? 2.678   -7.167  27.462 1.00 20.01 ? 484 HOH A O    1 
HETATM 2796 O  O    . HOH E 5 .   ? -3.651  5.033   15.653 1.00 25.73 ? 485 HOH A O    1 
HETATM 2797 O  O    . HOH E 5 .   ? 23.293  -8.859  7.189  1.00 24.88 ? 486 HOH A O    1 
HETATM 2798 O  O    . HOH E 5 .   ? 21.717  -13.758 19.178 1.00 27.07 ? 487 HOH A O    1 
HETATM 2799 O  O    . HOH E 5 .   ? -0.286  7.525   -0.424 1.00 30.18 ? 488 HOH A O    1 
HETATM 2800 O  O    . HOH E 5 .   ? -4.110  -3.811  14.329 1.00 27.19 ? 489 HOH A O    1 
HETATM 2801 O  O    . HOH E 5 .   ? -9.836  1.894   26.307 1.00 32.56 ? 490 HOH A O    1 
HETATM 2802 O  O    . HOH E 5 .   ? 7.932   -6.957  -1.092 1.00 29.65 ? 491 HOH A O    1 
HETATM 2803 O  O    . HOH E 5 .   ? 14.919  23.527  9.474  1.00 35.59 ? 492 HOH A O    1 
HETATM 2804 O  O    . HOH E 5 .   ? 8.595   -17.141 18.173 1.00 20.21 ? 493 HOH A O    1 
HETATM 2805 O  O    . HOH E 5 .   ? 20.058  -10.652 14.654 1.00 24.54 ? 494 HOH A O    1 
HETATM 2806 O  O    . HOH E 5 .   ? 23.743  15.038  30.467 1.00 41.35 ? 495 HOH A O    1 
HETATM 2807 O  O    . HOH E 5 .   ? -5.642  12.707  18.258 1.00 38.03 ? 496 HOH A O    1 
HETATM 2808 O  O    . HOH E 5 .   ? 0.576   -11.440 26.201 1.00 33.89 ? 497 HOH A O    1 
HETATM 2809 O  O    . HOH E 5 .   ? -0.894  0.216   24.399 1.00 22.97 ? 498 HOH A O    1 
HETATM 2810 O  O    . HOH E 5 .   ? 16.477  17.878  14.866 1.00 20.57 ? 499 HOH A O    1 
HETATM 2811 O  O    . HOH E 5 .   ? 0.571   9.510   4.102  1.00 28.59 ? 500 HOH A O    1 
HETATM 2812 O  O    . HOH E 5 .   ? 11.507  -21.257 20.744 1.00 39.65 ? 501 HOH A O    1 
HETATM 2813 O  O    . HOH E 5 .   ? 29.134  -19.242 30.394 1.00 40.42 ? 502 HOH A O    1 
HETATM 2814 O  O    . HOH E 5 .   ? 25.788  -0.068  -0.247 1.00 46.00 ? 503 HOH A O    1 
HETATM 2815 O  O    . HOH E 5 .   ? -4.798  7.644   34.950 1.00 58.32 ? 504 HOH A O    1 
HETATM 2816 O  O    . HOH E 5 .   ? -3.254  7.122   5.202  1.00 32.19 ? 505 HOH A O    1 
HETATM 2817 O  O    . HOH E 5 .   ? 24.411  2.308   33.600 0.50 28.38 ? 506 HOH A O    1 
HETATM 2818 O  O    . HOH E 5 .   ? 26.499  -15.595 41.801 1.00 31.04 ? 507 HOH A O    1 
HETATM 2819 O  O    . HOH E 5 .   ? 27.699  14.801  16.882 1.00 34.37 ? 508 HOH A O    1 
HETATM 2820 O  O    . HOH E 5 .   ? 14.643  6.256   32.250 1.00 20.04 ? 509 HOH A O    1 
HETATM 2821 O  O    . HOH E 5 .   ? 18.391  -14.556 12.564 1.00 34.17 ? 510 HOH A O    1 
HETATM 2822 O  O    . HOH E 5 .   ? 9.686   21.174  16.654 1.00 33.75 ? 511 HOH A O    1 
HETATM 2823 O  O    . HOH E 5 .   ? 6.513   -11.836 -0.548 1.00 33.70 ? 512 HOH A O    1 
HETATM 2824 O  O    . HOH E 5 .   ? -1.404  15.142  11.104 1.00 32.00 ? 513 HOH A O    1 
HETATM 2825 O  O    . HOH E 5 .   ? 1.901   24.951  20.452 1.00 46.79 ? 514 HOH A O    1 
HETATM 2826 O  O    . HOH E 5 .   ? 11.475  -5.649  1.008  1.00 34.99 ? 515 HOH A O    1 
HETATM 2827 O  O    . HOH E 5 .   ? 26.452  -8.692  6.162  1.00 39.86 ? 516 HOH A O    1 
HETATM 2828 O  O    . HOH E 5 .   ? 1.607   18.591  17.869 1.00 29.78 ? 517 HOH A O    1 
HETATM 2829 O  O    . HOH E 5 .   ? 5.992   20.143  23.331 1.00 33.59 ? 518 HOH A O    1 
HETATM 2830 O  O    . HOH E 5 .   ? 30.033  -6.251  33.486 1.00 29.77 ? 519 HOH A O    1 
HETATM 2831 O  O    . HOH E 5 .   ? 14.162  -16.116 42.118 1.00 35.89 ? 520 HOH A O    1 
HETATM 2832 O  O    . HOH E 5 .   ? 13.602  16.203  25.531 1.00 29.18 ? 521 HOH A O    1 
HETATM 2833 O  O    . HOH E 5 .   ? 1.410   13.110  40.087 1.00 41.96 ? 522 HOH A O    1 
HETATM 2834 O  O    . HOH E 5 .   ? 22.911  16.527  16.288 1.00 24.62 ? 523 HOH A O    1 
HETATM 2835 O  O    . HOH E 5 .   ? 28.484  -14.656 18.702 1.00 35.68 ? 524 HOH A O    1 
HETATM 2836 O  O    . HOH E 5 .   ? 5.450   1.632   1.517  1.00 30.03 ? 525 HOH A O    1 
HETATM 2837 O  O    . HOH E 5 .   ? 26.935  -1.219  1.494  1.00 50.21 ? 526 HOH A O    1 
HETATM 2838 O  O    . HOH E 5 .   ? 27.714  8.379   27.080 1.00 30.27 ? 527 HOH A O    1 
HETATM 2839 O  O    . HOH E 5 .   ? -7.850  6.798   27.819 1.00 37.79 ? 528 HOH A O    1 
HETATM 2840 O  O    . HOH E 5 .   ? 20.889  -13.132 14.434 1.00 29.14 ? 529 HOH A O    1 
HETATM 2841 O  O    . HOH E 5 .   ? 24.595  -3.862  2.139  1.00 35.79 ? 530 HOH A O    1 
HETATM 2842 O  O    . HOH E 5 .   ? 4.891   -13.115 1.238  0.70 36.31 ? 531 HOH A O    1 
HETATM 2843 O  O    . HOH E 5 .   ? 33.683  -8.396  39.060 1.00 30.01 ? 532 HOH A O    1 
HETATM 2844 O  O    . HOH E 5 .   ? 4.288   16.923  5.720  1.00 39.86 ? 533 HOH A O    1 
HETATM 2845 O  O    . HOH E 5 .   ? -4.657  0.041   2.940  1.00 26.65 ? 534 HOH A O    1 
HETATM 2846 O  O    . HOH E 5 .   ? 4.033   -11.663 40.166 1.00 40.73 ? 535 HOH A O    1 
HETATM 2847 O  O    . HOH E 5 .   ? 25.227  14.821  14.254 1.00 49.34 ? 536 HOH A O    1 
HETATM 2848 O  O    . HOH E 5 .   ? 0.017   -19.361 18.396 1.00 31.87 ? 537 HOH A O    1 
HETATM 2849 O  O    . HOH E 5 .   ? 15.885  -17.012 11.671 0.50 30.13 ? 538 HOH A O    1 
HETATM 2850 O  O    . HOH E 5 .   ? 13.082  -21.364 42.816 1.00 48.97 ? 539 HOH A O    1 
HETATM 2851 O  O    . HOH E 5 .   ? 1.205   -6.043  16.634 1.00 38.49 ? 540 HOH A O    1 
HETATM 2852 O  O    . HOH E 5 .   ? -5.147  8.633   17.880 1.00 37.69 ? 541 HOH A O    1 
HETATM 2853 O  O    . HOH E 5 .   ? 30.397  3.075   -0.404 1.00 44.67 ? 542 HOH A O    1 
HETATM 2854 O  O    . HOH E 5 .   ? 16.441  -15.870 13.916 1.00 37.78 ? 543 HOH A O    1 
HETATM 2855 O  O    . HOH E 5 .   ? 26.009  -13.282 18.280 1.00 20.18 ? 544 HOH A O    1 
HETATM 2856 O  O    . HOH E 5 .   ? 4.671   4.236   2.107  1.00 38.60 ? 545 HOH A O    1 
HETATM 2857 O  O    . HOH E 5 .   ? 25.523  2.194   25.307 1.00 27.49 ? 546 HOH A O    1 
HETATM 2858 O  O    . HOH E 5 .   ? 18.098  20.546  21.297 1.00 34.14 ? 547 HOH A O    1 
HETATM 2859 O  O    . HOH E 5 .   ? 0.945   -12.758 3.048  1.00 30.02 ? 548 HOH A O    1 
HETATM 2860 O  O    . HOH E 5 .   ? 13.195  -20.597 31.115 1.00 21.99 ? 549 HOH A O    1 
HETATM 2861 O  O    . HOH E 5 .   ? 11.916  -17.462 39.482 1.00 29.09 ? 550 HOH A O    1 
HETATM 2862 O  O    . HOH E 5 .   ? 17.831  -11.058 6.004  1.00 25.64 ? 551 HOH A O    1 
HETATM 2863 O  O    . HOH E 5 .   ? 27.723  -4.983  44.713 1.00 51.43 ? 552 HOH A O    1 
HETATM 2864 O  O    . HOH E 5 .   ? -8.000  -8.526  27.419 1.00 30.29 ? 553 HOH A O    1 
HETATM 2865 O  O    . HOH E 5 .   ? 27.260  16.966  16.590 1.00 33.33 ? 554 HOH A O    1 
HETATM 2866 O  O    . HOH E 5 .   ? 25.970  2.679   28.228 1.00 30.43 ? 555 HOH A O    1 
HETATM 2867 O  O    . HOH E 5 .   ? 31.523  -0.128  0.921  1.00 32.72 ? 556 HOH A O    1 
HETATM 2868 O  O    . HOH E 5 .   ? 21.321  -16.572 20.277 1.00 31.03 ? 557 HOH A O    1 
HETATM 2869 O  O    . HOH E 5 .   ? 20.466  12.791  30.767 1.00 33.59 ? 558 HOH A O    1 
HETATM 2870 O  O    . HOH E 5 .   ? -2.996  20.572  22.661 1.00 36.17 ? 559 HOH A O    1 
HETATM 2871 O  O    . HOH E 5 .   ? -7.098  6.908   20.849 1.00 37.74 ? 560 HOH A O    1 
HETATM 2872 O  O    . HOH E 5 .   ? 35.699  0.342   22.193 1.00 30.95 ? 561 HOH A O    1 
HETATM 2873 O  O    . HOH E 5 .   ? -1.742  -8.299  17.993 1.00 38.99 ? 562 HOH A O    1 
HETATM 2874 O  O    . HOH E 5 .   ? -1.670  -3.491  20.261 1.00 32.80 ? 563 HOH A O    1 
HETATM 2875 O  O    . HOH E 5 .   ? -3.558  -1.975  15.573 1.00 30.42 ? 564 HOH A O    1 
HETATM 2876 O  O    . HOH E 5 .   ? 1.866   19.434  45.435 1.00 43.81 ? 565 HOH A O    1 
HETATM 2877 O  O    . HOH E 5 .   ? -1.723  -13.907 22.839 1.00 31.30 ? 566 HOH A O    1 
HETATM 2878 O  O    . HOH E 5 .   ? 7.083   20.838  34.076 1.00 32.46 ? 567 HOH A O    1 
HETATM 2879 O  O    . HOH E 5 .   ? 29.848  -0.814  35.510 1.00 45.41 ? 568 HOH A O    1 
HETATM 2880 O  O    . HOH E 5 .   ? -1.947  4.094   42.305 1.00 40.93 ? 569 HOH A O    1 
HETATM 2881 O  O    . HOH E 5 .   ? 28.051  -1.317  30.324 1.00 37.89 ? 570 HOH A O    1 
HETATM 2882 O  O    . HOH E 5 .   ? -8.631  6.582   29.878 1.00 29.96 ? 571 HOH A O    1 
HETATM 2883 O  O    . HOH E 5 .   ? -2.479  -4.237  31.955 1.00 33.13 ? 572 HOH A O    1 
HETATM 2884 O  O    . HOH E 5 .   ? 19.374  -23.251 17.664 1.00 38.61 ? 573 HOH A O    1 
HETATM 2885 O  O    . HOH E 5 .   ? 16.480  -22.666 19.812 1.00 36.24 ? 574 HOH A O    1 
HETATM 2886 O  O    . HOH E 5 .   ? 3.548   21.084  16.912 1.00 38.68 ? 575 HOH A O    1 
HETATM 2887 O  O    . HOH E 5 .   ? 27.671  5.794   22.690 1.00 29.56 ? 576 HOH A O    1 
HETATM 2888 O  O    . HOH E 5 .   ? -0.955  -7.944  28.993 1.00 34.68 ? 577 HOH A O    1 
HETATM 2889 O  O    . HOH E 5 .   ? 3.403   -15.973 4.671  1.00 34.81 ? 578 HOH A O    1 
HETATM 2890 O  O    . HOH E 5 .   ? 31.166  10.003  18.216 1.00 26.29 ? 579 HOH A O    1 
HETATM 2891 O  O    . HOH E 5 .   ? 30.565  8.353   14.701 1.00 38.83 ? 580 HOH A O    1 
HETATM 2892 O  O    . HOH E 5 .   ? -2.553  15.529  29.478 1.00 23.59 ? 581 HOH A O    1 
HETATM 2893 O  O    . HOH E 5 .   ? 9.326   -13.469 37.660 1.00 32.49 ? 582 HOH A O    1 
HETATM 2894 O  O    . HOH E 5 .   ? -0.153  -3.366  40.967 1.00 39.24 ? 583 HOH A O    1 
HETATM 2895 O  O    . HOH E 5 .   ? 28.533  14.941  19.055 1.00 28.92 ? 584 HOH A O    1 
HETATM 2896 O  O    . HOH E 5 .   ? -0.754  -2.572  17.022 1.00 31.30 ? 585 HOH A O    1 
HETATM 2897 O  O    . HOH E 5 .   ? -0.517  -1.168  22.195 1.00 30.23 ? 586 HOH A O    1 
HETATM 2898 O  O    . HOH E 5 .   ? 6.811   -14.443 31.419 1.00 42.21 ? 587 HOH A O    1 
HETATM 2899 O  O    . HOH E 5 .   ? 5.803   -17.773 33.759 1.00 38.22 ? 588 HOH A O    1 
HETATM 2900 O  O    . HOH E 5 .   ? 9.420   -14.352 30.111 1.00 29.83 ? 589 HOH A O    1 
HETATM 2901 O  O    . HOH E 5 .   ? 5.988   -11.871 34.114 1.00 33.64 ? 590 HOH A O    1 
HETATM 2902 O  O    . HOH E 5 .   ? 1.819   -13.046 5.862  1.00 33.75 ? 591 HOH A O    1 
HETATM 2903 O  O    . HOH E 5 .   ? 13.807  3.966   42.521 1.00 33.67 ? 592 HOH A O    1 
HETATM 2904 O  O    . HOH E 5 .   ? 24.442  -14.425 20.446 1.00 28.86 ? 593 HOH A O    1 
HETATM 2905 O  O    . HOH E 5 .   ? 18.441  17.137  23.480 1.00 42.68 ? 594 HOH A O    1 
HETATM 2906 O  O    . HOH E 5 .   ? 26.843  1.643   33.887 1.00 36.72 ? 595 HOH A O    1 
HETATM 2907 O  O    . HOH E 5 .   ? 34.151  -13.328 31.701 1.00 40.48 ? 596 HOH A O    1 
HETATM 2908 O  O    . HOH E 5 .   ? -5.078  -1.509  17.988 1.00 21.42 ? 597 HOH A O    1 
HETATM 2909 O  O    . HOH E 5 .   ? 14.247  10.954  -0.197 1.00 32.80 ? 598 HOH A O    1 
HETATM 2910 O  O    . HOH E 5 .   ? 36.873  -11.288 37.361 1.00 38.96 ? 599 HOH A O    1 
HETATM 2911 O  O    . HOH E 5 .   ? -9.945  -0.215  24.147 1.00 40.33 ? 600 HOH A O    1 
HETATM 2912 O  O    . HOH E 5 .   ? -1.249  -6.201  36.187 1.00 28.44 ? 601 HOH A O    1 
HETATM 2913 O  O    . HOH E 5 .   ? 28.161  1.585   22.633 1.00 27.25 ? 602 HOH A O    1 
HETATM 2914 O  O    . HOH E 5 .   ? -4.482  -13.537 -2.958 1.00 29.41 ? 603 HOH A O    1 
HETATM 2915 O  O    . HOH E 5 .   ? -1.507  15.465  38.903 1.00 37.71 ? 604 HOH A O    1 
HETATM 2916 O  O    . HOH E 5 .   ? 20.148  -14.392 3.713  1.00 38.38 ? 605 HOH A O    1 
HETATM 2917 O  O    . HOH E 5 .   ? 25.663  -15.859 14.593 1.00 35.60 ? 606 HOH A O    1 
HETATM 2918 O  O    . HOH E 5 .   ? -2.639  -7.443  12.265 1.00 39.55 ? 607 HOH A O    1 
HETATM 2919 O  O    . HOH E 5 .   ? 30.836  1.677   7.213  1.00 41.09 ? 608 HOH A O    1 
HETATM 2920 O  O    . HOH E 5 .   ? 9.606   -22.361 29.426 1.00 35.81 ? 609 HOH A O    1 
HETATM 2921 O  O    . HOH E 5 .   ? 27.246  -17.337 46.344 1.00 42.80 ? 610 HOH A O    1 
HETATM 2922 O  O    . HOH E 5 .   ? 10.831  -18.463 19.993 1.00 34.91 ? 611 HOH A O    1 
HETATM 2923 O  O    . HOH E 5 .   ? 20.570  -17.849 44.909 1.00 29.75 ? 612 HOH A O    1 
HETATM 2924 O  O    . HOH E 5 .   ? 4.723   -9.018  40.691 1.00 40.50 ? 613 HOH A O    1 
HETATM 2925 O  O    . HOH E 5 .   ? -3.425  -11.663 18.076 1.00 41.08 ? 614 HOH A O    1 
HETATM 2926 O  O    . HOH E 5 .   ? 30.812  -13.802 40.936 1.00 29.71 ? 615 HOH A O    1 
HETATM 2927 O  O    . HOH E 5 .   ? 0.155   -15.585 25.455 1.00 32.69 ? 616 HOH A O    1 
HETATM 2928 O  O    . HOH E 5 .   ? 3.364   -10.451 30.109 1.00 33.27 ? 617 HOH A O    1 
HETATM 2929 O  O    . HOH E 5 .   ? 9.535   19.998  36.844 1.00 49.03 ? 618 HOH A O    1 
HETATM 2930 O  O    . HOH E 5 .   ? 21.877  -16.497 13.159 1.00 38.46 ? 619 HOH A O    1 
HETATM 2931 O  O    . HOH E 5 .   ? 14.283  -18.725 17.275 1.00 33.74 ? 620 HOH A O    1 
HETATM 2932 O  O    . HOH E 5 .   ? 14.629  9.019   37.008 1.00 33.11 ? 621 HOH A O    1 
HETATM 2933 O  O    . HOH E 5 .   ? -3.442  9.905   -2.871 1.00 44.63 ? 622 HOH A O    1 
HETATM 2934 O  O    . HOH E 5 .   ? -5.146  11.276  9.514  1.00 49.31 ? 623 HOH A O    1 
HETATM 2935 O  O    . HOH E 5 .   ? 1.714   6.923   -2.167 1.00 38.94 ? 624 HOH A O    1 
HETATM 2936 O  O    . HOH E 5 .   ? 31.276  -13.449 18.413 1.00 43.62 ? 625 HOH A O    1 
HETATM 2937 O  O    . HOH E 5 .   ? 30.263  3.880   8.841  1.00 29.19 ? 626 HOH A O    1 
HETATM 2938 O  O    . HOH E 5 .   ? 10.335  -5.308  -2.168 1.00 41.33 ? 627 HOH A O    1 
HETATM 2939 O  O    . HOH E 5 .   ? 11.264  14.308  4.822  1.00 32.21 ? 628 HOH A O    1 
HETATM 2940 O  O    . HOH E 5 .   ? 10.959  1.893   43.301 1.00 52.48 ? 629 HOH A O    1 
HETATM 2941 O  O    . HOH E 5 .   ? -2.082  2.770   -1.427 1.00 41.73 ? 630 HOH A O    1 
HETATM 2942 O  O    . HOH E 5 .   ? 29.911  14.718  27.175 1.00 35.91 ? 631 HOH A O    1 
HETATM 2943 O  O    . HOH E 5 .   ? -4.161  13.616  14.499 0.50 34.25 ? 632 HOH A O    1 
HETATM 2944 O  O    . HOH E 5 .   ? 18.312  14.099  24.914 1.00 45.29 ? 633 HOH A O    1 
HETATM 2945 O  O    . HOH E 5 .   ? 16.279  14.322  27.373 1.00 51.20 ? 634 HOH A O    1 
HETATM 2946 O  O    . HOH E 5 .   ? -0.255  -6.154  41.153 1.00 43.68 ? 635 HOH A O    1 
HETATM 2947 O  O    . HOH E 5 .   ? 36.403  -8.053  36.656 1.00 36.74 ? 636 HOH A O    1 
HETATM 2948 O  O    . HOH E 5 .   ? 24.704  12.724  13.389 1.00 33.92 ? 637 HOH A O    1 
HETATM 2949 O  O    . HOH E 5 .   ? 7.403   -26.186 35.439 1.00 45.22 ? 638 HOH A O    1 
HETATM 2950 O  O    . HOH E 5 .   ? 11.738  -16.297 1.368  1.00 55.50 ? 639 HOH A O    1 
HETATM 2951 O  O    . HOH E 5 .   ? 30.546  -12.597 24.317 0.50 20.40 ? 640 HOH A O    1 
HETATM 2952 O  O    . HOH E 5 .   ? -1.925  -7.771  40.379 1.00 35.61 ? 641 HOH A O    1 
HETATM 2953 O  O    . HOH E 5 .   ? 8.065   21.861  29.847 1.00 39.09 ? 642 HOH A O    1 
HETATM 2954 O  O    . HOH E 5 .   ? -0.474  10.359  -1.088 1.00 33.29 ? 643 HOH A O    1 
HETATM 2955 O  O    . HOH E 5 .   ? 4.331   -20.047 4.609  1.00 49.60 ? 644 HOH A O    1 
HETATM 2956 O  O    . HOH E 5 .   ? 0.790   16.693  8.339  1.00 32.10 ? 645 HOH A O    1 
HETATM 2957 O  O    . HOH E 5 .   ? 7.223   6.833   44.880 0.50 24.92 ? 646 HOH A O    1 
HETATM 2958 O  O    . HOH E 5 .   ? 25.043  11.722  37.697 1.00 39.81 ? 647 HOH A O    1 
HETATM 2959 O  O    . HOH E 5 .   ? -4.601  -13.501 14.154 1.00 42.41 ? 648 HOH A O    1 
HETATM 2960 O  O    . HOH E 5 .   ? 14.313  -22.011 39.241 1.00 40.58 ? 649 HOH A O    1 
HETATM 2961 O  O    . HOH E 5 .   ? -3.122  14.433  43.232 1.00 50.68 ? 650 HOH A O    1 
HETATM 2962 O  O    . HOH E 5 .   ? -4.882  4.256   -0.146 1.00 42.21 ? 651 HOH A O    1 
HETATM 2963 O  O    . HOH E 5 .   ? 28.882  8.599   20.211 1.00 56.84 ? 652 HOH A O    1 
HETATM 2964 O  O    . HOH E 5 .   ? 5.615   19.883  15.678 0.50 15.64 ? 653 HOH A O    1 
HETATM 2965 O  O    . HOH E 5 .   ? 7.829   17.962  42.579 1.00 47.94 ? 654 HOH A O    1 
HETATM 2966 O  O    . HOH E 5 .   ? -4.835  -0.483  11.272 1.00 34.52 ? 655 HOH A O    1 
HETATM 2967 O  O    . HOH E 5 .   ? -3.457  -18.447 3.270  1.00 42.94 ? 656 HOH A O    1 
HETATM 2968 O  O    . HOH E 5 .   ? -7.219  12.603  37.782 1.00 44.97 ? 657 HOH A O    1 
HETATM 2969 O  O    . HOH E 5 .   ? 0.451   -8.428  30.861 0.50 16.64 ? 658 HOH A O    1 
HETATM 2970 O  O    . HOH E 5 .   ? 27.997  7.257   3.001  0.50 28.85 ? 659 HOH A O    1 
HETATM 2971 O  O    . HOH E 5 .   ? -4.971  5.434   20.557 0.50 15.15 ? 660 HOH A O    1 
HETATM 2972 O  O    . HOH E 5 .   ? -0.248  8.008   39.284 0.50 34.65 ? 661 HOH A O    1 
HETATM 2973 O  O    . HOH E 5 .   ? 20.153  2.495   -2.135 1.00 49.92 ? 662 HOH A O    1 
HETATM 2974 O  O    . HOH E 5 .   ? 22.096  3.548   -1.236 0.50 32.13 ? 663 HOH A O    1 
HETATM 2975 O  O    . HOH E 5 .   ? -5.526  14.912  35.047 1.00 38.81 ? 664 HOH A O    1 
HETATM 2976 O  O    . HOH E 5 .   ? 12.340  -16.345 10.696 1.00 33.76 ? 665 HOH A O    1 
HETATM 2977 O  O    . HOH E 5 .   ? 14.090  -16.417 7.055  1.00 37.74 ? 666 HOH A O    1 
HETATM 2978 O  O    . HOH E 5 .   ? 1.689   -10.349 32.941 1.00 45.37 ? 667 HOH A O    1 
HETATM 2979 O  O    . HOH E 5 .   ? 24.267  12.359  33.381 0.50 22.58 ? 668 HOH A O    1 
HETATM 2980 O  O    . HOH E 5 .   ? 25.067  12.913  30.957 1.00 58.10 ? 669 HOH A O    1 
HETATM 2981 O  O    . HOH E 5 .   ? 16.014  12.891  32.425 1.00 32.89 ? 670 HOH A O    1 
HETATM 2982 O  O    . HOH E 5 .   ? 18.085  9.573   34.246 0.50 30.13 ? 671 HOH A O    1 
HETATM 2983 O  O    . HOH E 5 .   ? 17.462  10.957  32.628 1.00 31.64 ? 672 HOH A O    1 
HETATM 2984 O  O    . HOH E 5 .   ? 20.434  14.205  36.345 1.00 52.15 ? 673 HOH A O    1 
HETATM 2985 O  O    . HOH E 5 .   ? -6.851  5.326   17.522 1.00 39.04 ? 674 HOH A O    1 
HETATM 2986 O  O    . HOH E 5 .   ? 25.158  1.211   31.790 1.00 43.14 ? 675 HOH A O    1 
HETATM 2987 O  O    . HOH E 5 .   ? -11.424 -7.730  1.327  1.00 40.20 ? 676 HOH A O    1 
HETATM 2988 O  O    . HOH E 5 .   ? 21.529  11.303  2.876  1.00 29.73 ? 677 HOH A O    1 
HETATM 2989 O  O    . HOH E 5 .   ? 24.952  -11.953 5.838  1.00 39.59 ? 678 HOH A O    1 
HETATM 2990 O  O    . HOH E 5 .   ? 5.260   -12.740 3.957  1.00 36.94 ? 679 HOH A O    1 
HETATM 2991 O  O    . HOH E 5 .   ? 13.198  -10.858 46.541 1.00 47.54 ? 680 HOH A O    1 
HETATM 2992 O  O    . HOH E 5 .   ? -0.968  0.601   34.885 1.00 29.00 ? 681 HOH A O    1 
HETATM 2993 O  O    . HOH E 5 .   ? -5.899  -3.125  11.872 1.00 41.76 ? 682 HOH A O    1 
HETATM 2994 O  O    . HOH E 5 .   ? 30.250  6.247   1.322  1.00 55.87 ? 683 HOH A O    1 
HETATM 2995 O  O    . HOH E 5 .   ? 11.921  -16.754 41.792 1.00 46.82 ? 684 HOH A O    1 
HETATM 2996 O  O    . HOH E 5 .   ? 11.213  -17.265 43.860 0.50 23.67 ? 685 HOH A O    1 
HETATM 2997 O  O    . HOH E 5 .   ? 9.258   -21.370 18.437 0.50 25.82 ? 686 HOH A O    1 
HETATM 2998 O  O    . HOH E 5 .   ? 15.829  -0.812  0.410  1.00 38.60 ? 687 HOH A O    1 
HETATM 2999 O  O    . HOH E 5 .   ? -0.652  -4.759  15.783 1.00 37.21 ? 688 HOH A O    1 
HETATM 3000 O  O    . HOH E 5 .   ? 32.162  -12.494 22.120 1.00 33.22 ? 689 HOH A O    1 
HETATM 3001 O  O    . HOH E 5 .   ? 5.778   24.887  4.269  1.00 49.03 ? 690 HOH A O    1 
HETATM 3002 O  O    . HOH E 5 .   ? -5.748  -10.730 -5.164 1.00 39.03 ? 691 HOH A O    1 
HETATM 3003 O  O    . HOH E 5 .   ? 8.683   -5.570  -5.941 1.00 47.35 ? 692 HOH A O    1 
HETATM 3004 O  O    . HOH E 5 .   ? 2.250   19.511  29.575 1.00 42.46 ? 693 HOH A O    1 
HETATM 3005 O  O    . HOH E 5 .   ? -1.485  18.292  29.696 1.00 44.87 ? 694 HOH A O    1 
HETATM 3006 O  O    . HOH E 5 .   ? 3.834   19.641  26.865 1.00 29.14 ? 695 HOH A O    1 
HETATM 3007 O  O    . HOH E 5 .   ? 26.986  -18.328 25.446 1.00 36.26 ? 696 HOH A O    1 
HETATM 3008 O  O    . HOH E 5 .   ? 8.255   23.432  21.374 1.00 38.59 ? 697 HOH A O    1 
HETATM 3009 O  O    . HOH E 5 .   ? 13.041  21.459  24.324 1.00 38.12 ? 698 HOH A O    1 
HETATM 3010 O  O    . HOH E 5 .   ? 3.236   -18.686 26.120 1.00 34.33 ? 699 HOH A O    1 
HETATM 3011 O  O    . HOH E 5 .   ? -12.736 -7.468  -3.141 1.00 37.16 ? 700 HOH A O    1 
HETATM 3012 O  O    . HOH E 5 .   ? -11.969 -14.546 -0.966 1.00 44.89 ? 701 HOH A O    1 
HETATM 3013 O  O    . HOH E 5 .   ? -4.107  -9.740  22.182 1.00 32.85 ? 702 HOH A O    1 
HETATM 3014 O  O    . HOH E 5 .   ? 31.530  16.623  22.541 1.00 31.79 ? 703 HOH A O    1 
HETATM 3015 O  O    . HOH E 5 .   ? 29.389  6.201   7.529  1.00 41.21 ? 704 HOH A O    1 
HETATM 3016 O  O    . HOH E 5 .   ? 9.625   -23.448 34.246 1.00 42.77 ? 705 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   TYR 5   5   ?   ?   ?   A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   CYS 7   7   7   CYS CYS A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  HIS 14  14  14  HIS HIS A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ARG 66  66  66  ARG ARG A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  CYS 87  87  87  CYS CYS A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  ARG 91  91  91  ARG ARG A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 HIS 117 117 117 HIS HIS A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 CYS 145 145 145 CYS CYS A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 TRP 148 148 148 TRP TRP A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 CYS 154 154 154 CYS CYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 LYS 179 179 179 LYS LYS A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 CYS 188 188 188 CYS CYS A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 GLN 190 190 190 GLN GLN A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 CYS 193 193 193 CYS CYS A . n 
A 1 194 HIS 194 194 194 HIS HIS A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 ASN 198 198 198 ASN ASN A . n 
A 1 199 GLN 199 199 199 GLN GLN A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 CYS 206 206 206 CYS CYS A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 TYR 216 216 216 TYR TYR A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 GLU 225 225 225 GLU GLU A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 VAL 228 228 228 VAL VAL A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 ASN 231 231 231 ASN ASN A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 PRO 233 233 233 PRO PRO A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 CYS 242 242 242 CYS CYS A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 PRO 252 252 252 PRO PRO A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 TYR 259 259 259 TYR TYR A . n 
A 1 260 GLN 260 260 260 GLN GLN A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 VAL 265 265 265 VAL VAL A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 TYR 272 272 272 TYR TYR A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 GLN 275 275 275 GLN GLN A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 ILE 277 277 277 ILE ILE A . n 
A 1 278 ARG 278 278 278 ARG ARG A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 GLN 287 287 287 GLN GLN A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 ARG 301 301 301 ARG ARG A . n 
A 1 302 ASN 302 302 302 ASN ASN A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 TYR 305 305 305 TYR TYR A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 ILE 310 310 310 ILE ILE A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 GLY 313 313 313 GLY GLY A . n 
A 1 314 PRO 314 314 314 PRO PRO A . n 
A 1 315 PRO 315 315 315 PRO PRO A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 TYR 317 317 317 TYR TYR A . n 
A 1 318 PRO 318 318 318 PRO PRO A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 SER 320 320 320 SER SER A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 GLU 322 322 322 GLU GLU A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OE1 ? A GLU 292 ? A GLU 292 ? 1_555 ZN ? D ZN . ? A ZN 324 ? 1_555 O   ? E HOH .   ? A HOH 333 ? 1_555 105.3 ? 
2 OE1 ? A GLU 292 ? A GLU 292 ? 1_555 ZN ? D ZN . ? A ZN 324 ? 1_555 NE2 ? A HIS 248 ? A HIS 248 ? 1_555 98.3  ? 
3 O   ? E HOH .   ? A HOH 333 ? 1_555 ZN ? D ZN . ? A ZN 324 ? 1_555 NE2 ? A HIS 248 ? A HIS 248 ? 1_555 107.8 ? 
4 OE1 ? A GLU 292 ? A GLU 292 ? 1_555 ZN ? D ZN . ? A ZN 324 ? 1_555 OE2 ? A GLU 292 ? A GLU 292 ? 1_555 55.1  ? 
5 O   ? E HOH .   ? A HOH 333 ? 1_555 ZN ? D ZN . ? A ZN 324 ? 1_555 OE2 ? A GLU 292 ? A GLU 292 ? 1_555 159.4 ? 
6 NE2 ? A HIS 248 ? A HIS 248 ? 1_555 ZN ? D ZN . ? A ZN 324 ? 1_555 OE2 ? A GLU 292 ? A GLU 292 ? 1_555 83.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-04-13 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_pdbx_phasing_MR.entry_id                     3NTY 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.500 
_pdbx_phasing_MR.d_res_low_rotation           28.820 
_pdbx_phasing_MR.d_res_high_translation       3.500 
_pdbx_phasing_MR.d_res_low_translation        28.820 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .    ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 MOLREP      .    ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 
3 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 MAR345dtb   .    ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .    ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     221 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             84.21 
_pdbx_validate_torsion.psi             164.58 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A SER 290 ? CA A A SER 290 CA 
2 1 Y 0 A SER 290 ? CB A A SER 290 CB 
3 1 Y 0 A SER 290 ? OG A A SER 290 OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ASP 2 ? A ASP 2 
3 1 Y 1 A SER 3 ? A SER 3 
4 1 Y 1 A LYS 4 ? A LYS 4 
5 1 Y 1 A TYR 5 ? A TYR 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NAP 
3 '5-chloro-4-hydroxybiphenyl-3-carboxylic acid'     5P3 
4 'ZINC ION'                                         ZN  
5 water                                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAP 1   351 351 NAP NAP A . 
C 3 5P3 1   350 350 5P3 5P3 A . 
D 4 ZN  1   324 1   ZN  ZN  A . 
E 5 HOH 1   325 325 HOH HOH A . 
E 5 HOH 2   326 326 HOH HOH A . 
E 5 HOH 3   327 327 HOH HOH A . 
E 5 HOH 4   328 328 HOH HOH A . 
E 5 HOH 5   329 329 HOH HOH A . 
E 5 HOH 6   330 330 HOH HOH A . 
E 5 HOH 7   331 331 HOH HOH A . 
E 5 HOH 8   332 332 HOH HOH A . 
E 5 HOH 9   333 333 HOH HOH A . 
E 5 HOH 10  334 334 HOH HOH A . 
E 5 HOH 11  335 335 HOH HOH A . 
E 5 HOH 12  336 336 HOH HOH A . 
E 5 HOH 13  337 337 HOH HOH A . 
E 5 HOH 14  338 338 HOH HOH A . 
E 5 HOH 15  339 339 HOH HOH A . 
E 5 HOH 16  340 340 HOH HOH A . 
E 5 HOH 17  341 341 HOH HOH A . 
E 5 HOH 18  342 342 HOH HOH A . 
E 5 HOH 19  343 343 HOH HOH A . 
E 5 HOH 20  344 344 HOH HOH A . 
E 5 HOH 21  345 345 HOH HOH A . 
E 5 HOH 22  346 346 HOH HOH A . 
E 5 HOH 23  347 347 HOH HOH A . 
E 5 HOH 24  348 348 HOH HOH A . 
E 5 HOH 25  349 349 HOH HOH A . 
E 5 HOH 26  352 352 HOH HOH A . 
E 5 HOH 27  353 353 HOH HOH A . 
E 5 HOH 28  354 354 HOH HOH A . 
E 5 HOH 29  355 355 HOH HOH A . 
E 5 HOH 30  356 356 HOH HOH A . 
E 5 HOH 31  357 357 HOH HOH A . 
E 5 HOH 32  358 358 HOH HOH A . 
E 5 HOH 33  359 359 HOH HOH A . 
E 5 HOH 34  360 360 HOH HOH A . 
E 5 HOH 35  361 361 HOH HOH A . 
E 5 HOH 36  362 362 HOH HOH A . 
E 5 HOH 37  363 363 HOH HOH A . 
E 5 HOH 38  364 364 HOH HOH A . 
E 5 HOH 39  365 365 HOH HOH A . 
E 5 HOH 40  366 366 HOH HOH A . 
E 5 HOH 41  367 367 HOH HOH A . 
E 5 HOH 42  368 368 HOH HOH A . 
E 5 HOH 43  369 369 HOH HOH A . 
E 5 HOH 44  370 370 HOH HOH A . 
E 5 HOH 45  371 371 HOH HOH A . 
E 5 HOH 46  372 372 HOH HOH A . 
E 5 HOH 47  373 373 HOH HOH A . 
E 5 HOH 48  374 374 HOH HOH A . 
E 5 HOH 49  375 375 HOH HOH A . 
E 5 HOH 50  376 376 HOH HOH A . 
E 5 HOH 51  377 377 HOH HOH A . 
E 5 HOH 52  378 378 HOH HOH A . 
E 5 HOH 53  379 379 HOH HOH A . 
E 5 HOH 54  380 1   HOH HOH A . 
E 5 HOH 55  381 2   HOH HOH A . 
E 5 HOH 56  382 3   HOH HOH A . 
E 5 HOH 57  383 4   HOH HOH A . 
E 5 HOH 58  384 5   HOH HOH A . 
E 5 HOH 59  385 6   HOH HOH A . 
E 5 HOH 60  386 7   HOH HOH A . 
E 5 HOH 61  387 8   HOH HOH A . 
E 5 HOH 62  388 9   HOH HOH A . 
E 5 HOH 63  389 10  HOH HOH A . 
E 5 HOH 64  390 11  HOH HOH A . 
E 5 HOH 65  391 12  HOH HOH A . 
E 5 HOH 66  392 13  HOH HOH A . 
E 5 HOH 67  393 14  HOH HOH A . 
E 5 HOH 68  394 15  HOH HOH A . 
E 5 HOH 69  395 16  HOH HOH A . 
E 5 HOH 70  396 17  HOH HOH A . 
E 5 HOH 71  397 18  HOH HOH A . 
E 5 HOH 72  398 19  HOH HOH A . 
E 5 HOH 73  399 20  HOH HOH A . 
E 5 HOH 74  400 21  HOH HOH A . 
E 5 HOH 75  401 22  HOH HOH A . 
E 5 HOH 76  402 23  HOH HOH A . 
E 5 HOH 77  403 24  HOH HOH A . 
E 5 HOH 78  404 25  HOH HOH A . 
E 5 HOH 79  405 26  HOH HOH A . 
E 5 HOH 80  406 27  HOH HOH A . 
E 5 HOH 81  407 28  HOH HOH A . 
E 5 HOH 82  408 29  HOH HOH A . 
E 5 HOH 83  409 30  HOH HOH A . 
E 5 HOH 84  410 31  HOH HOH A . 
E 5 HOH 85  411 32  HOH HOH A . 
E 5 HOH 86  412 33  HOH HOH A . 
E 5 HOH 87  413 34  HOH HOH A . 
E 5 HOH 88  414 35  HOH HOH A . 
E 5 HOH 89  415 36  HOH HOH A . 
E 5 HOH 90  416 37  HOH HOH A . 
E 5 HOH 91  417 38  HOH HOH A . 
E 5 HOH 92  418 39  HOH HOH A . 
E 5 HOH 93  419 40  HOH HOH A . 
E 5 HOH 94  420 41  HOH HOH A . 
E 5 HOH 95  421 42  HOH HOH A . 
E 5 HOH 96  422 43  HOH HOH A . 
E 5 HOH 97  423 44  HOH HOH A . 
E 5 HOH 98  424 45  HOH HOH A . 
E 5 HOH 99  425 46  HOH HOH A . 
E 5 HOH 100 426 47  HOH HOH A . 
E 5 HOH 101 427 48  HOH HOH A . 
E 5 HOH 102 428 49  HOH HOH A . 
E 5 HOH 103 429 50  HOH HOH A . 
E 5 HOH 104 430 51  HOH HOH A . 
E 5 HOH 105 431 52  HOH HOH A . 
E 5 HOH 106 432 53  HOH HOH A . 
E 5 HOH 107 433 54  HOH HOH A . 
E 5 HOH 108 434 55  HOH HOH A . 
E 5 HOH 109 435 56  HOH HOH A . 
E 5 HOH 110 436 57  HOH HOH A . 
E 5 HOH 111 437 58  HOH HOH A . 
E 5 HOH 112 438 59  HOH HOH A . 
E 5 HOH 113 439 60  HOH HOH A . 
E 5 HOH 114 440 61  HOH HOH A . 
E 5 HOH 115 441 62  HOH HOH A . 
E 5 HOH 116 442 63  HOH HOH A . 
E 5 HOH 117 443 64  HOH HOH A . 
E 5 HOH 118 444 65  HOH HOH A . 
E 5 HOH 119 445 66  HOH HOH A . 
E 5 HOH 120 446 67  HOH HOH A . 
E 5 HOH 121 447 68  HOH HOH A . 
E 5 HOH 122 448 69  HOH HOH A . 
E 5 HOH 123 449 70  HOH HOH A . 
E 5 HOH 124 450 71  HOH HOH A . 
E 5 HOH 125 451 72  HOH HOH A . 
E 5 HOH 126 452 73  HOH HOH A . 
E 5 HOH 127 453 74  HOH HOH A . 
E 5 HOH 128 454 75  HOH HOH A . 
E 5 HOH 129 455 76  HOH HOH A . 
E 5 HOH 130 456 77  HOH HOH A . 
E 5 HOH 131 457 78  HOH HOH A . 
E 5 HOH 132 458 79  HOH HOH A . 
E 5 HOH 133 459 80  HOH HOH A . 
E 5 HOH 134 460 81  HOH HOH A . 
E 5 HOH 135 461 82  HOH HOH A . 
E 5 HOH 136 462 83  HOH HOH A . 
E 5 HOH 137 463 84  HOH HOH A . 
E 5 HOH 138 464 85  HOH HOH A . 
E 5 HOH 139 465 86  HOH HOH A . 
E 5 HOH 140 466 87  HOH HOH A . 
E 5 HOH 141 467 88  HOH HOH A . 
E 5 HOH 142 468 89  HOH HOH A . 
E 5 HOH 143 469 90  HOH HOH A . 
E 5 HOH 144 470 91  HOH HOH A . 
E 5 HOH 145 471 92  HOH HOH A . 
E 5 HOH 146 472 93  HOH HOH A . 
E 5 HOH 147 473 94  HOH HOH A . 
E 5 HOH 148 474 95  HOH HOH A . 
E 5 HOH 149 475 96  HOH HOH A . 
E 5 HOH 150 476 97  HOH HOH A . 
E 5 HOH 151 477 98  HOH HOH A . 
E 5 HOH 152 478 99  HOH HOH A . 
E 5 HOH 153 479 100 HOH HOH A . 
E 5 HOH 154 480 101 HOH HOH A . 
E 5 HOH 155 481 102 HOH HOH A . 
E 5 HOH 156 482 103 HOH HOH A . 
E 5 HOH 157 483 104 HOH HOH A . 
E 5 HOH 158 484 105 HOH HOH A . 
E 5 HOH 159 485 106 HOH HOH A . 
E 5 HOH 160 486 107 HOH HOH A . 
E 5 HOH 161 487 108 HOH HOH A . 
E 5 HOH 162 488 109 HOH HOH A . 
E 5 HOH 163 489 110 HOH HOH A . 
E 5 HOH 164 490 111 HOH HOH A . 
E 5 HOH 165 491 112 HOH HOH A . 
E 5 HOH 166 492 113 HOH HOH A . 
E 5 HOH 167 493 114 HOH HOH A . 
E 5 HOH 168 494 115 HOH HOH A . 
E 5 HOH 169 495 116 HOH HOH A . 
E 5 HOH 170 496 117 HOH HOH A . 
E 5 HOH 171 497 118 HOH HOH A . 
E 5 HOH 172 498 119 HOH HOH A . 
E 5 HOH 173 499 120 HOH HOH A . 
E 5 HOH 174 500 121 HOH HOH A . 
E 5 HOH 175 501 122 HOH HOH A . 
E 5 HOH 176 502 123 HOH HOH A . 
E 5 HOH 177 503 124 HOH HOH A . 
E 5 HOH 178 504 125 HOH HOH A . 
E 5 HOH 179 505 126 HOH HOH A . 
E 5 HOH 180 506 127 HOH HOH A . 
E 5 HOH 181 507 128 HOH HOH A . 
E 5 HOH 182 508 129 HOH HOH A . 
E 5 HOH 183 509 130 HOH HOH A . 
E 5 HOH 184 510 131 HOH HOH A . 
E 5 HOH 185 511 132 HOH HOH A . 
E 5 HOH 186 512 133 HOH HOH A . 
E 5 HOH 187 513 134 HOH HOH A . 
E 5 HOH 188 514 135 HOH HOH A . 
E 5 HOH 189 515 136 HOH HOH A . 
E 5 HOH 190 516 137 HOH HOH A . 
E 5 HOH 191 517 138 HOH HOH A . 
E 5 HOH 192 518 139 HOH HOH A . 
E 5 HOH 193 519 140 HOH HOH A . 
E 5 HOH 194 520 141 HOH HOH A . 
E 5 HOH 195 521 142 HOH HOH A . 
E 5 HOH 196 522 143 HOH HOH A . 
E 5 HOH 197 523 144 HOH HOH A . 
E 5 HOH 198 524 145 HOH HOH A . 
E 5 HOH 199 525 146 HOH HOH A . 
E 5 HOH 200 526 147 HOH HOH A . 
E 5 HOH 201 527 148 HOH HOH A . 
E 5 HOH 202 528 149 HOH HOH A . 
E 5 HOH 203 529 150 HOH HOH A . 
E 5 HOH 204 530 151 HOH HOH A . 
E 5 HOH 205 531 152 HOH HOH A . 
E 5 HOH 206 532 153 HOH HOH A . 
E 5 HOH 207 533 154 HOH HOH A . 
E 5 HOH 208 534 155 HOH HOH A . 
E 5 HOH 209 535 156 HOH HOH A . 
E 5 HOH 210 536 157 HOH HOH A . 
E 5 HOH 211 537 158 HOH HOH A . 
E 5 HOH 212 538 159 HOH HOH A . 
E 5 HOH 213 539 160 HOH HOH A . 
E 5 HOH 214 540 161 HOH HOH A . 
E 5 HOH 215 541 162 HOH HOH A . 
E 5 HOH 216 542 163 HOH HOH A . 
E 5 HOH 217 543 164 HOH HOH A . 
E 5 HOH 218 544 165 HOH HOH A . 
E 5 HOH 219 545 166 HOH HOH A . 
E 5 HOH 220 546 167 HOH HOH A . 
E 5 HOH 221 547 168 HOH HOH A . 
E 5 HOH 222 548 169 HOH HOH A . 
E 5 HOH 223 549 170 HOH HOH A . 
E 5 HOH 224 550 171 HOH HOH A . 
E 5 HOH 225 551 172 HOH HOH A . 
E 5 HOH 226 552 173 HOH HOH A . 
E 5 HOH 227 553 174 HOH HOH A . 
E 5 HOH 228 554 175 HOH HOH A . 
E 5 HOH 229 555 176 HOH HOH A . 
E 5 HOH 230 556 177 HOH HOH A . 
E 5 HOH 231 557 178 HOH HOH A . 
E 5 HOH 232 558 179 HOH HOH A . 
E 5 HOH 233 559 180 HOH HOH A . 
E 5 HOH 234 560 181 HOH HOH A . 
E 5 HOH 235 561 182 HOH HOH A . 
E 5 HOH 236 562 183 HOH HOH A . 
E 5 HOH 237 563 184 HOH HOH A . 
E 5 HOH 238 564 185 HOH HOH A . 
E 5 HOH 239 565 186 HOH HOH A . 
E 5 HOH 240 566 187 HOH HOH A . 
E 5 HOH 241 567 188 HOH HOH A . 
E 5 HOH 242 568 189 HOH HOH A . 
E 5 HOH 243 569 190 HOH HOH A . 
E 5 HOH 244 570 191 HOH HOH A . 
E 5 HOH 245 571 192 HOH HOH A . 
E 5 HOH 246 572 193 HOH HOH A . 
E 5 HOH 247 573 194 HOH HOH A . 
E 5 HOH 248 574 195 HOH HOH A . 
E 5 HOH 249 575 196 HOH HOH A . 
E 5 HOH 250 576 197 HOH HOH A . 
E 5 HOH 251 577 198 HOH HOH A . 
E 5 HOH 252 578 199 HOH HOH A . 
E 5 HOH 253 579 200 HOH HOH A . 
E 5 HOH 254 580 201 HOH HOH A . 
E 5 HOH 255 581 202 HOH HOH A . 
E 5 HOH 256 582 203 HOH HOH A . 
E 5 HOH 257 583 204 HOH HOH A . 
E 5 HOH 258 584 205 HOH HOH A . 
E 5 HOH 259 585 206 HOH HOH A . 
E 5 HOH 260 586 207 HOH HOH A . 
E 5 HOH 261 587 208 HOH HOH A . 
E 5 HOH 262 588 209 HOH HOH A . 
E 5 HOH 263 589 210 HOH HOH A . 
E 5 HOH 264 590 211 HOH HOH A . 
E 5 HOH 265 591 212 HOH HOH A . 
E 5 HOH 266 592 213 HOH HOH A . 
E 5 HOH 267 593 214 HOH HOH A . 
E 5 HOH 268 594 215 HOH HOH A . 
E 5 HOH 269 595 216 HOH HOH A . 
E 5 HOH 270 596 217 HOH HOH A . 
E 5 HOH 271 597 218 HOH HOH A . 
E 5 HOH 272 598 219 HOH HOH A . 
E 5 HOH 273 599 220 HOH HOH A . 
E 5 HOH 274 600 221 HOH HOH A . 
E 5 HOH 275 601 222 HOH HOH A . 
E 5 HOH 276 602 223 HOH HOH A . 
E 5 HOH 277 603 224 HOH HOH A . 
E 5 HOH 278 604 225 HOH HOH A . 
E 5 HOH 279 605 226 HOH HOH A . 
E 5 HOH 280 606 227 HOH HOH A . 
E 5 HOH 281 607 228 HOH HOH A . 
E 5 HOH 282 608 229 HOH HOH A . 
E 5 HOH 283 609 230 HOH HOH A . 
E 5 HOH 284 610 231 HOH HOH A . 
E 5 HOH 285 611 232 HOH HOH A . 
E 5 HOH 286 612 233 HOH HOH A . 
E 5 HOH 287 613 234 HOH HOH A . 
E 5 HOH 288 614 235 HOH HOH A . 
E 5 HOH 289 615 236 HOH HOH A . 
E 5 HOH 290 616 237 HOH HOH A . 
E 5 HOH 291 617 238 HOH HOH A . 
E 5 HOH 292 618 239 HOH HOH A . 
E 5 HOH 293 619 240 HOH HOH A . 
E 5 HOH 294 620 241 HOH HOH A . 
E 5 HOH 295 621 242 HOH HOH A . 
E 5 HOH 296 622 243 HOH HOH A . 
E 5 HOH 297 623 244 HOH HOH A . 
E 5 HOH 298 624 245 HOH HOH A . 
E 5 HOH 299 625 246 HOH HOH A . 
E 5 HOH 300 626 247 HOH HOH A . 
E 5 HOH 301 627 248 HOH HOH A . 
E 5 HOH 302 628 249 HOH HOH A . 
E 5 HOH 303 629 250 HOH HOH A . 
E 5 HOH 304 630 251 HOH HOH A . 
E 5 HOH 305 631 252 HOH HOH A . 
E 5 HOH 306 632 253 HOH HOH A . 
E 5 HOH 307 633 254 HOH HOH A . 
E 5 HOH 308 634 255 HOH HOH A . 
E 5 HOH 309 635 256 HOH HOH A . 
E 5 HOH 310 636 257 HOH HOH A . 
E 5 HOH 311 637 258 HOH HOH A . 
E 5 HOH 312 638 259 HOH HOH A . 
E 5 HOH 313 639 260 HOH HOH A . 
E 5 HOH 314 640 261 HOH HOH A . 
E 5 HOH 315 641 262 HOH HOH A . 
E 5 HOH 316 642 263 HOH HOH A . 
E 5 HOH 317 643 264 HOH HOH A . 
E 5 HOH 318 644 265 HOH HOH A . 
E 5 HOH 319 645 266 HOH HOH A . 
E 5 HOH 320 646 267 HOH HOH A . 
E 5 HOH 321 647 268 HOH HOH A . 
E 5 HOH 322 648 269 HOH HOH A . 
E 5 HOH 323 649 270 HOH HOH A . 
E 5 HOH 324 650 271 HOH HOH A . 
E 5 HOH 325 651 272 HOH HOH A . 
E 5 HOH 326 652 273 HOH HOH A . 
E 5 HOH 327 653 274 HOH HOH A . 
E 5 HOH 328 654 275 HOH HOH A . 
E 5 HOH 329 655 276 HOH HOH A . 
E 5 HOH 330 656 277 HOH HOH A . 
E 5 HOH 331 657 278 HOH HOH A . 
E 5 HOH 332 658 279 HOH HOH A . 
E 5 HOH 333 659 280 HOH HOH A . 
E 5 HOH 334 660 281 HOH HOH A . 
E 5 HOH 335 661 282 HOH HOH A . 
E 5 HOH 336 662 283 HOH HOH A . 
E 5 HOH 337 663 284 HOH HOH A . 
E 5 HOH 338 664 285 HOH HOH A . 
E 5 HOH 339 665 286 HOH HOH A . 
E 5 HOH 340 666 287 HOH HOH A . 
E 5 HOH 341 667 288 HOH HOH A . 
E 5 HOH 342 668 289 HOH HOH A . 
E 5 HOH 343 669 290 HOH HOH A . 
E 5 HOH 344 670 291 HOH HOH A . 
E 5 HOH 345 671 292 HOH HOH A . 
E 5 HOH 346 672 293 HOH HOH A . 
E 5 HOH 347 673 294 HOH HOH A . 
E 5 HOH 348 674 295 HOH HOH A . 
E 5 HOH 349 675 296 HOH HOH A . 
E 5 HOH 350 676 297 HOH HOH A . 
E 5 HOH 351 677 298 HOH HOH A . 
E 5 HOH 352 678 299 HOH HOH A . 
E 5 HOH 353 679 300 HOH HOH A . 
E 5 HOH 354 680 301 HOH HOH A . 
E 5 HOH 355 681 302 HOH HOH A . 
E 5 HOH 356 682 303 HOH HOH A . 
E 5 HOH 357 683 304 HOH HOH A . 
E 5 HOH 358 684 305 HOH HOH A . 
E 5 HOH 359 685 306 HOH HOH A . 
E 5 HOH 360 686 307 HOH HOH A . 
E 5 HOH 361 687 308 HOH HOH A . 
E 5 HOH 362 688 309 HOH HOH A . 
E 5 HOH 363 689 310 HOH HOH A . 
E 5 HOH 364 690 311 HOH HOH A . 
E 5 HOH 365 691 312 HOH HOH A . 
E 5 HOH 366 692 313 HOH HOH A . 
E 5 HOH 367 693 314 HOH HOH A . 
E 5 HOH 368 694 315 HOH HOH A . 
E 5 HOH 369 695 316 HOH HOH A . 
E 5 HOH 370 696 317 HOH HOH A . 
E 5 HOH 371 697 318 HOH HOH A . 
E 5 HOH 372 698 319 HOH HOH A . 
E 5 HOH 373 699 320 HOH HOH A . 
E 5 HOH 374 700 321 HOH HOH A . 
E 5 HOH 375 701 322 HOH HOH A . 
E 5 HOH 376 702 323 HOH HOH A . 
E 5 HOH 377 703 324 HOH HOH A . 
E 5 HOH 378 704 350 HOH HOH A . 
E 5 HOH 379 705 351 HOH HOH A . 
#