data_3NY5
# 
_entry.id   3NY5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3NY5         
RCSB  RCSB060425   
WWPDB D_1000060425 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          HR4694F 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3NY5 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-14 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vorobiev, S.'                                    1  
'Su, M.'                                          2  
'Seetharaman, J.'                                 3  
'Patel, P.'                                       4  
'Xiao, R.'                                        5  
'Ciccosanti, C.'                                  6  
'Shastry, R.'                                     7  
'Everett, J.K.'                                   8  
'Nair, R.'                                        9  
'Acton, T.B.'                                     10 
'Rost, B.'                                        11 
'Montelione, G.T.'                                12 
'Hunt, J.F.'                                      13 
'Tong, L.'                                        14 
'Northeast Structural Genomics Consortium (NESG)' 15 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vorobiev, S.'     1  
primary 'Su, M.'           2  
primary 'Seetharaman, J.'  3  
primary 'Patel, P.'        4  
primary 'Xiao, R.'         5  
primary 'Ciccosanti, C.'   6  
primary 'Shastry, R.'      7  
primary 'Everett, J.K.'    8  
primary 'Nair, R.'         9  
primary 'Acton, T.B.'      10 
primary 'Rost, B.'         11 
primary 'Montelione, G.T.' 12 
primary 'Hunt, J.F.'       13 
primary 'Tong, L.'         14 
# 
_cell.entry_id           3NY5 
_cell.length_a           39.805 
_cell.length_b           69.418 
_cell.length_c           114.607 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3NY5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Serine/threonine-protein kinase B-raf' 11261.486 4   2.7.11.1 ? 'RBD domain residues 153-237' ? 
2 water   nat water                                   18.015    250 ?        ? ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Proto-oncogene B-Raf, p94, v-Raf murine sarcoma viral oncogene homolog B1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)GHHHHHHSH(MSE)QKPIVRVFLPNKQRTVVPARCGVTVRDSLKKAL(MSE)(MSE)RGLIPECCAVYRIQDGEK
KPIGWDTDISWLTGEELHVEVLENVPLTTHNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHSHMQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEE
LHVEVLENVPLTTHNF
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         HR4694F 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MSE n 
1 2  GLY n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  SER n 
1 10 HIS n 
1 11 MSE n 
1 12 GLN n 
1 13 LYS n 
1 14 PRO n 
1 15 ILE n 
1 16 VAL n 
1 17 ARG n 
1 18 VAL n 
1 19 PHE n 
1 20 LEU n 
1 21 PRO n 
1 22 ASN n 
1 23 LYS n 
1 24 GLN n 
1 25 ARG n 
1 26 THR n 
1 27 VAL n 
1 28 VAL n 
1 29 PRO n 
1 30 ALA n 
1 31 ARG n 
1 32 CYS n 
1 33 GLY n 
1 34 VAL n 
1 35 THR n 
1 36 VAL n 
1 37 ARG n 
1 38 ASP n 
1 39 SER n 
1 40 LEU n 
1 41 LYS n 
1 42 LYS n 
1 43 ALA n 
1 44 LEU n 
1 45 MSE n 
1 46 MSE n 
1 47 ARG n 
1 48 GLY n 
1 49 LEU n 
1 50 ILE n 
1 51 PRO n 
1 52 GLU n 
1 53 CYS n 
1 54 CYS n 
1 55 ALA n 
1 56 VAL n 
1 57 TYR n 
1 58 ARG n 
1 59 ILE n 
1 60 GLN n 
1 61 ASP n 
1 62 GLY n 
1 63 GLU n 
1 64 LYS n 
1 65 LYS n 
1 66 PRO n 
1 67 ILE n 
1 68 GLY n 
1 69 TRP n 
1 70 ASP n 
1 71 THR n 
1 72 ASP n 
1 73 ILE n 
1 74 SER n 
1 75 TRP n 
1 76 LEU n 
1 77 THR n 
1 78 GLY n 
1 79 GLU n 
1 80 GLU n 
1 81 LEU n 
1 82 HIS n 
1 83 VAL n 
1 84 GLU n 
1 85 VAL n 
1 86 LEU n 
1 87 GLU n 
1 88 ASN n 
1 89 VAL n 
1 90 PRO n 
1 91 LEU n 
1 92 THR n 
1 93 THR n 
1 94 HIS n 
1 95 ASN n 
1 96 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BRAF, BRAF1, RAFB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)+ Magic' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'pET 14-15C' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRAF_HUMAN 
_struct_ref.pdbx_db_accession          P15056 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNF
;
_struct_ref.pdbx_align_begin           153 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3NY5 A 12 ? 96 ? P15056 153 ? 237 ? 153 237 
2 1 3NY5 B 12 ? 96 ? P15056 153 ? 237 ? 153 237 
3 1 3NY5 C 12 ? 96 ? P15056 153 ? 237 ? 153 237 
4 1 3NY5 D 12 ? 96 ? P15056 153 ? 237 ? 153 237 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3NY5 MSE A 1  ? UNP P15056 ? ? 'EXPRESSION TAG' 142 1  
1 3NY5 GLY A 2  ? UNP P15056 ? ? 'EXPRESSION TAG' 143 2  
1 3NY5 HIS A 3  ? UNP P15056 ? ? 'EXPRESSION TAG' 144 3  
1 3NY5 HIS A 4  ? UNP P15056 ? ? 'EXPRESSION TAG' 145 4  
1 3NY5 HIS A 5  ? UNP P15056 ? ? 'EXPRESSION TAG' 146 5  
1 3NY5 HIS A 6  ? UNP P15056 ? ? 'EXPRESSION TAG' 147 6  
1 3NY5 HIS A 7  ? UNP P15056 ? ? 'EXPRESSION TAG' 148 7  
1 3NY5 HIS A 8  ? UNP P15056 ? ? 'EXPRESSION TAG' 149 8  
1 3NY5 SER A 9  ? UNP P15056 ? ? 'EXPRESSION TAG' 150 9  
1 3NY5 HIS A 10 ? UNP P15056 ? ? 'EXPRESSION TAG' 151 10 
1 3NY5 MSE A 11 ? UNP P15056 ? ? 'EXPRESSION TAG' 152 11 
2 3NY5 MSE B 1  ? UNP P15056 ? ? 'EXPRESSION TAG' 142 12 
2 3NY5 GLY B 2  ? UNP P15056 ? ? 'EXPRESSION TAG' 143 13 
2 3NY5 HIS B 3  ? UNP P15056 ? ? 'EXPRESSION TAG' 144 14 
2 3NY5 HIS B 4  ? UNP P15056 ? ? 'EXPRESSION TAG' 145 15 
2 3NY5 HIS B 5  ? UNP P15056 ? ? 'EXPRESSION TAG' 146 16 
2 3NY5 HIS B 6  ? UNP P15056 ? ? 'EXPRESSION TAG' 147 17 
2 3NY5 HIS B 7  ? UNP P15056 ? ? 'EXPRESSION TAG' 148 18 
2 3NY5 HIS B 8  ? UNP P15056 ? ? 'EXPRESSION TAG' 149 19 
2 3NY5 SER B 9  ? UNP P15056 ? ? 'EXPRESSION TAG' 150 20 
2 3NY5 HIS B 10 ? UNP P15056 ? ? 'EXPRESSION TAG' 151 21 
2 3NY5 MSE B 11 ? UNP P15056 ? ? 'EXPRESSION TAG' 152 22 
3 3NY5 MSE C 1  ? UNP P15056 ? ? 'EXPRESSION TAG' 142 23 
3 3NY5 GLY C 2  ? UNP P15056 ? ? 'EXPRESSION TAG' 143 24 
3 3NY5 HIS C 3  ? UNP P15056 ? ? 'EXPRESSION TAG' 144 25 
3 3NY5 HIS C 4  ? UNP P15056 ? ? 'EXPRESSION TAG' 145 26 
3 3NY5 HIS C 5  ? UNP P15056 ? ? 'EXPRESSION TAG' 146 27 
3 3NY5 HIS C 6  ? UNP P15056 ? ? 'EXPRESSION TAG' 147 28 
3 3NY5 HIS C 7  ? UNP P15056 ? ? 'EXPRESSION TAG' 148 29 
3 3NY5 HIS C 8  ? UNP P15056 ? ? 'EXPRESSION TAG' 149 30 
3 3NY5 SER C 9  ? UNP P15056 ? ? 'EXPRESSION TAG' 150 31 
3 3NY5 HIS C 10 ? UNP P15056 ? ? 'EXPRESSION TAG' 151 32 
3 3NY5 MSE C 11 ? UNP P15056 ? ? 'EXPRESSION TAG' 152 33 
4 3NY5 MSE D 1  ? UNP P15056 ? ? 'EXPRESSION TAG' 142 34 
4 3NY5 GLY D 2  ? UNP P15056 ? ? 'EXPRESSION TAG' 143 35 
4 3NY5 HIS D 3  ? UNP P15056 ? ? 'EXPRESSION TAG' 144 36 
4 3NY5 HIS D 4  ? UNP P15056 ? ? 'EXPRESSION TAG' 145 37 
4 3NY5 HIS D 5  ? UNP P15056 ? ? 'EXPRESSION TAG' 146 38 
4 3NY5 HIS D 6  ? UNP P15056 ? ? 'EXPRESSION TAG' 147 39 
4 3NY5 HIS D 7  ? UNP P15056 ? ? 'EXPRESSION TAG' 148 40 
4 3NY5 HIS D 8  ? UNP P15056 ? ? 'EXPRESSION TAG' 149 41 
4 3NY5 SER D 9  ? UNP P15056 ? ? 'EXPRESSION TAG' 150 42 
4 3NY5 HIS D 10 ? UNP P15056 ? ? 'EXPRESSION TAG' 151 43 
4 3NY5 MSE D 11 ? UNP P15056 ? ? 'EXPRESSION TAG' 152 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3NY5 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'Microbatch under Paraffin oil' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    '28% PEG 2000, 0.1M Bis-tris, pH 6.5, Microbatch under Paraffin oil, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2010-04-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97903 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_wavelength_list        0.97903 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
# 
_reflns.entry_id                     3NY5 
_reflns.B_iso_Wilson_estimate        23.160 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.00 
_reflns.d_resolution_low             50 
_reflns.number_all                   41777 
_reflns.number_obs                   41610 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        38.6 
_reflns.pdbx_redundancy              7.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.199 
_reflns_shell.meanI_over_sigI_obs    9.1 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.number_unique_all      4119 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3NY5 
_refine.ls_d_res_high                            1.993 
_refine.ls_d_res_low                             37.602 
_refine.pdbx_ls_sigma_F                          1.23 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.100 
_refine.ls_number_reflns_obs                     41488 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_R_work                       0.210 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.140 
_refine.ls_number_reflns_R_free                  2132 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               31.144 
_refine.solvent_model_param_bsol                 60.594 
_refine.solvent_model_param_ksol                 0.384 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -6.197 
_refine.aniso_B[2][2]                            -3.228 
_refine.aniso_B[3][3]                            9.425 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.310 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                132.85 
_refine.B_iso_min                                5.26 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.34 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 28.35 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2550 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             250 
_refine_hist.number_atoms_total               2800 
_refine_hist.d_res_high                       1.993 
_refine_hist.d_res_low                        37.602 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           2629 0.015  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          3569 1.521  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     423  0.104  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      446  0.007  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 1007 15.316 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.993 2.039  15 93.000  2422 . 0.187 0.250 . 128 . 2550 . . 'X-RAY DIFFRACTION' 
2.039 2.090  15 100.000 2691 . 0.195 0.245 . 150 . 2841 . . 'X-RAY DIFFRACTION' 
2.090 2.147  15 100.000 2625 . 0.202 0.283 . 121 . 2746 . . 'X-RAY DIFFRACTION' 
2.147 2.210  15 100.000 2652 . 0.186 0.295 . 155 . 2807 . . 'X-RAY DIFFRACTION' 
2.210 2.281  15 100.000 2622 . 0.202 0.232 . 133 . 2755 . . 'X-RAY DIFFRACTION' 
2.281 2.363  15 100.000 2685 . 0.192 0.282 . 126 . 2811 . . 'X-RAY DIFFRACTION' 
2.363 2.457  15 100.000 2635 . 0.213 0.275 . 144 . 2779 . . 'X-RAY DIFFRACTION' 
2.457 2.569  15 100.000 2635 . 0.207 0.286 . 156 . 2791 . . 'X-RAY DIFFRACTION' 
2.569 2.705  15 100.000 2606 . 0.213 0.289 . 169 . 2775 . . 'X-RAY DIFFRACTION' 
2.705 2.874  15 100.000 2661 . 0.211 0.290 . 136 . 2797 . . 'X-RAY DIFFRACTION' 
2.874 3.096  15 100.000 2648 . 0.204 0.253 . 151 . 2799 . . 'X-RAY DIFFRACTION' 
3.096 3.407  15 100.000 2605 . 0.185 0.273 . 167 . 2772 . . 'X-RAY DIFFRACTION' 
3.407 3.900  15 100.000 2671 . 0.183 0.236 . 126 . 2797 . . 'X-RAY DIFFRACTION' 
3.900 4.912  15 100.000 2624 . 0.180 0.231 . 143 . 2767 . . 'X-RAY DIFFRACTION' 
4.912 37.608 15 96.000  2574 . 0.254 0.283 . 127 . 2701 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3NY5 
_struct.title                     
;Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens. Northeast Structural Genomics Consortium Target HR4694F
;
_struct.pdbx_descriptor           'Serine/threonine-protein kinase B-raf (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3NY5 
_struct_keywords.text            
'NESG, Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'Dimer according to aggregation screening' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 35 ? MSE A 46 ? THR A 176 MSE A 187 1 ? 12 
HELX_P HELX_P2  2  ILE A 50 ? GLU A 52 ? ILE A 191 GLU A 193 5 ? 3  
HELX_P HELX_P3  3  ASP A 72 ? THR A 77 ? ASP A 213 THR A 218 5 ? 6  
HELX_P HELX_P4  4  THR B 35 ? MSE B 46 ? THR B 176 MSE B 187 1 ? 12 
HELX_P HELX_P5  5  ILE B 50 ? GLU B 52 ? ILE B 191 GLU B 193 5 ? 3  
HELX_P HELX_P6  6  ASP B 72 ? THR B 77 ? ASP B 213 THR B 218 5 ? 6  
HELX_P HELX_P7  7  THR C 35 ? MSE C 46 ? THR C 176 MSE C 187 1 ? 12 
HELX_P HELX_P8  8  ILE C 50 ? GLU C 52 ? ILE C 191 GLU C 193 5 ? 3  
HELX_P HELX_P9  9  ASP C 72 ? THR C 77 ? ASP C 213 THR C 218 5 ? 6  
HELX_P HELX_P10 10 THR D 35 ? ARG D 47 ? THR D 176 ARG D 188 1 ? 13 
HELX_P HELX_P11 11 ILE D 50 ? GLU D 52 ? ILE D 191 GLU D 193 5 ? 3  
HELX_P HELX_P12 12 ASP D 72 ? THR D 77 ? ASP D 213 THR D 218 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 11 C ? ? ? 1_555 A GLN 12 N ? ? A MSE 152 A GLN 153 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2  covale ? ? A LEU 44 C ? ? ? 1_555 A MSE 45 N A ? A LEU 185 A MSE 186 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3  covale ? ? A LEU 44 C ? ? ? 1_555 A MSE 45 N B ? A LEU 185 A MSE 186 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale4  covale ? ? A MSE 45 C A ? ? 1_555 A MSE 46 N ? ? A MSE 186 A MSE 187 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5  covale ? ? A MSE 45 C B ? ? 1_555 A MSE 46 N ? ? A MSE 186 A MSE 187 1_555 ? ? ? ? ? ? ? 1.320 ? 
covale6  covale ? ? A MSE 46 C ? ? ? 1_555 A ARG 47 N ? ? A MSE 187 A ARG 188 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale7  covale ? ? B HIS 10 C ? ? ? 1_555 B MSE 11 N ? ? B HIS 151 B MSE 152 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale8  covale ? ? B MSE 11 C ? ? ? 1_555 B GLN 12 N ? ? B MSE 152 B GLN 153 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale9  covale ? ? B LEU 44 C ? ? ? 1_555 B MSE 45 N A ? B LEU 185 B MSE 186 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale10 covale ? ? B LEU 44 C ? ? ? 1_555 B MSE 45 N B ? B LEU 185 B MSE 186 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale11 covale ? ? B MSE 45 C A ? ? 1_555 B MSE 46 N ? ? B MSE 186 B MSE 187 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12 covale ? ? B MSE 45 C B ? ? 1_555 B MSE 46 N ? ? B MSE 186 B MSE 187 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale13 covale ? ? B MSE 46 C ? ? ? 1_555 B ARG 47 N ? ? B MSE 187 B ARG 188 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale14 covale ? ? C MSE 11 C ? ? ? 1_555 C GLN 12 N ? ? C MSE 152 C GLN 153 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale15 covale ? ? C LEU 44 C ? ? ? 1_555 C MSE 45 N ? ? C LEU 185 C MSE 186 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale16 covale ? ? C MSE 45 C ? ? ? 1_555 C MSE 46 N ? ? C MSE 186 C MSE 187 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale17 covale ? ? C MSE 46 C ? ? ? 1_555 C ARG 47 N ? ? C MSE 187 C ARG 188 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale18 covale ? ? D HIS 10 C ? ? ? 1_555 D MSE 11 N ? ? D HIS 151 D MSE 152 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale19 covale ? ? D LEU 44 C ? ? ? 1_555 D MSE 45 N A ? D LEU 185 D MSE 186 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale20 covale ? ? D LEU 44 C ? ? ? 1_555 D MSE 45 N B ? D LEU 185 D MSE 186 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale21 covale ? ? D MSE 45 C A ? ? 1_555 D MSE 46 N ? ? D MSE 186 D MSE 187 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale22 covale ? ? D MSE 45 C B ? ? 1_555 D MSE 46 N ? ? D MSE 186 D MSE 187 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale23 covale ? ? D MSE 46 C ? ? ? 1_555 D ARG 47 N ? ? D MSE 187 D ARG 188 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale24 covale ? ? A HIS 10 C ? ? ? 1_555 A MSE 11 N ? ? A HIS 151 A MSE 152 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale25 covale ? ? D MSE 11 C ? ? ? 1_555 D GLN 12 N ? ? D MSE 152 D GLN 153 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 24 ? PRO A 29 ? GLN A 165 PRO A 170 
A 2 ILE A 15 ? LEU A 20 ? ILE A 156 LEU A 161 
A 3 GLU A 80 ? VAL A 85 ? GLU A 221 VAL A 226 
A 4 CYS A 54 ? ARG A 58 ? CYS A 195 ARG A 199 
A 5 LYS A 65 ? ILE A 67 ? LYS A 206 ILE A 208 
B 1 GLN B 24 ? PRO B 29 ? GLN B 165 PRO B 170 
B 2 ILE B 15 ? LEU B 20 ? ILE B 156 LEU B 161 
B 3 GLU B 80 ? VAL B 85 ? GLU B 221 VAL B 226 
B 4 CYS B 54 ? ARG B 58 ? CYS B 195 ARG B 199 
B 5 LYS B 65 ? ILE B 67 ? LYS B 206 ILE B 208 
C 1 GLN C 24 ? PRO C 29 ? GLN C 165 PRO C 170 
C 2 ILE C 15 ? LEU C 20 ? ILE C 156 LEU C 161 
C 3 GLU C 80 ? VAL C 85 ? GLU C 221 VAL C 226 
C 4 CYS C 54 ? ARG C 58 ? CYS C 195 ARG C 199 
C 5 LYS C 65 ? ILE C 67 ? LYS C 206 ILE C 208 
D 1 GLN D 24 ? PRO D 29 ? GLN D 165 PRO D 170 
D 2 ILE D 15 ? LEU D 20 ? ILE D 156 LEU D 161 
D 3 GLU D 80 ? VAL D 85 ? GLU D 221 VAL D 226 
D 4 CYS D 54 ? ARG D 58 ? CYS D 195 ARG D 199 
D 5 LYS D 65 ? PRO D 66 ? LYS D 206 PRO D 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 24 ? O GLN A 165 N LEU A 20 ? N LEU A 161 
A 2 3 N PHE A 19 ? N PHE A 160 O LEU A 81 ? O LEU A 222 
A 3 4 O GLU A 84 ? O GLU A 225 N ALA A 55 ? N ALA A 196 
A 4 5 N ARG A 58 ? N ARG A 199 O LYS A 65 ? O LYS A 206 
B 1 2 O THR B 26 ? O THR B 167 N VAL B 18 ? N VAL B 159 
B 2 3 N PHE B 19 ? N PHE B 160 O LEU B 81 ? O LEU B 222 
B 3 4 O GLU B 84 ? O GLU B 225 N ALA B 55 ? N ALA B 196 
B 4 5 N ARG B 58 ? N ARG B 199 O LYS B 65 ? O LYS B 206 
C 1 2 O THR C 26 ? O THR C 167 N VAL C 18 ? N VAL C 159 
C 2 3 N PHE C 19 ? N PHE C 160 O LEU C 81 ? O LEU C 222 
C 3 4 O HIS C 82 ? O HIS C 223 N TYR C 57 ? N TYR C 198 
C 4 5 N ARG C 58 ? N ARG C 199 O LYS C 65 ? O LYS C 206 
D 1 2 O GLN D 24 ? O GLN D 165 N LEU D 20 ? N LEU D 161 
D 2 3 N PHE D 19 ? N PHE D 160 O LEU D 81 ? O LEU D 222 
D 3 4 O GLU D 84 ? O GLU D 225 N ALA D 55 ? N ALA D 196 
D 4 5 N ARG D 58 ? N ARG D 199 O LYS D 65 ? O LYS D 206 
# 
_atom_sites.entry_id                    3NY5 
_atom_sites.fract_transf_matrix[1][1]   0.025122 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014405 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008725 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 10 ? 5.470   60.870 54.783  1.00 53.22  ? 151 HIS A N   1 
ATOM   2    C  CA  . HIS A 1 10 ? 5.803   62.269 54.553  1.00 44.30  ? 151 HIS A CA  1 
ATOM   3    C  C   . HIS A 1 10 ? 6.477   62.930 55.779  1.00 39.46  ? 151 HIS A C   1 
ATOM   4    O  O   . HIS A 1 10 ? 6.487   62.404 56.899  1.00 36.12  ? 151 HIS A O   1 
ATOM   5    C  CB  . HIS A 1 10 ? 4.567   63.056 54.091  1.00 39.07  ? 151 HIS A CB  1 
HETATM 6    N  N   . MSE A 1 11 ? 7.064   64.087 55.543  1.00 38.40  ? 152 MSE A N   1 
HETATM 7    C  CA  . MSE A 1 11 ? 7.794   64.795 56.593  1.00 43.88  ? 152 MSE A CA  1 
HETATM 8    C  C   . MSE A 1 11 ? 6.910   65.022 57.831  1.00 46.96  ? 152 MSE A C   1 
HETATM 9    O  O   . MSE A 1 11 ? 7.385   65.010 58.978  1.00 46.66  ? 152 MSE A O   1 
HETATM 10   C  CB  . MSE A 1 11 ? 8.339   66.133 56.065  1.00 35.30  ? 152 MSE A CB  1 
HETATM 11   C  CG  . MSE A 1 11 ? 9.161   66.895 57.099  1.00 41.45  ? 152 MSE A CG  1 
HETATM 12   SE SE  . MSE A 1 11 ? 10.649  65.796 57.774  1.00 85.51  ? 152 MSE A SE  1 
HETATM 13   C  CE  . MSE A 1 11 ? 12.106  66.518 56.649  1.00 49.90  ? 152 MSE A CE  1 
ATOM   14   N  N   . GLN A 1 12 ? 5.618   65.205 57.586  1.00 39.04  ? 153 GLN A N   1 
ATOM   15   C  CA  . GLN A 1 12 ? 4.694   65.593 58.630  1.00 38.34  ? 153 GLN A CA  1 
ATOM   16   C  C   . GLN A 1 12 ? 4.125   64.371 59.292  1.00 34.45  ? 153 GLN A C   1 
ATOM   17   O  O   . GLN A 1 12 ? 3.972   64.321 60.517  1.00 38.53  ? 153 GLN A O   1 
ATOM   18   C  CB  . GLN A 1 12 ? 3.530   66.382 58.017  1.00 43.95  ? 153 GLN A CB  1 
ATOM   19   C  CG  . GLN A 1 12 ? 3.407   67.773 58.548  1.00 54.43  ? 153 GLN A CG  1 
ATOM   20   C  CD  . GLN A 1 12 ? 4.650   68.567 58.300  1.00 62.65  ? 153 GLN A CD  1 
ATOM   21   O  OE1 . GLN A 1 12 ? 5.122   68.654 57.165  1.00 66.51  ? 153 GLN A OE1 1 
ATOM   22   N  NE2 . GLN A 1 12 ? 5.210   69.141 59.362  1.00 66.11  ? 153 GLN A NE2 1 
ATOM   23   N  N   . LYS A 1 13 ? 3.751   63.412 58.448  1.00 23.22  ? 154 LYS A N   1 
ATOM   24   C  CA  . LYS A 1 13 ? 2.983   62.259 58.884  1.00 26.31  ? 154 LYS A CA  1 
ATOM   25   C  C   . LYS A 1 13 ? 3.615   60.965 58.360  1.00 24.31  ? 154 LYS A C   1 
ATOM   26   O  O   . LYS A 1 13 ? 3.203   60.429 57.329  1.00 28.35  ? 154 LYS A O   1 
ATOM   27   C  CB  . LYS A 1 13 ? 1.526   62.388 58.440  1.00 28.14  ? 154 LYS A CB  1 
ATOM   28   C  CG  . LYS A 1 13 ? 0.643   63.165 59.459  1.00 37.30  ? 154 LYS A CG  1 
ATOM   29   C  CD  . LYS A 1 13 ? -0.034  64.339 58.807  1.00 36.65  ? 154 LYS A CD  1 
ATOM   30   C  CE  . LYS A 1 13 ? -1.066  64.986 59.724  1.00 42.24  ? 154 LYS A CE  1 
ATOM   31   N  NZ  . LYS A 1 13 ? -0.529  65.361 61.065  1.00 41.45  ? 154 LYS A NZ  1 
ATOM   32   N  N   . PRO A 1 14 ? 4.640   60.507 59.055  1.00 22.95  ? 155 PRO A N   1 
ATOM   33   C  CA  . PRO A 1 14 ? 5.400   59.288 58.701  1.00 26.45  ? 155 PRO A CA  1 
ATOM   34   C  C   . PRO A 1 14 ? 4.493   58.057 58.905  1.00 21.35  ? 155 PRO A C   1 
ATOM   35   O  O   . PRO A 1 14 ? 4.040   57.812 60.036  1.00 19.16  ? 155 PRO A O   1 
ATOM   36   C  CB  . PRO A 1 14 ? 6.530   59.271 59.736  1.00 28.02  ? 155 PRO A CB  1 
ATOM   37   C  CG  . PRO A 1 14 ? 5.977   60.091 60.909  1.00 28.35  ? 155 PRO A CG  1 
ATOM   38   C  CD  . PRO A 1 14 ? 5.121   61.135 60.301  1.00 26.04  ? 155 PRO A CD  1 
ATOM   39   N  N   . ILE A 1 15 ? 4.239   57.305 57.839  1.00 19.49  ? 156 ILE A N   1 
ATOM   40   C  CA  . ILE A 1 15 ? 3.378   56.111 57.958  1.00 23.47  ? 156 ILE A CA  1 
ATOM   41   C  C   . ILE A 1 15 ? 4.011   54.859 57.348  1.00 16.41  ? 156 ILE A C   1 
ATOM   42   O  O   . ILE A 1 15 ? 5.011   54.934 56.645  1.00 16.74  ? 156 ILE A O   1 
ATOM   43   C  CB  . ILE A 1 15 ? 2.014   56.385 57.307  1.00 20.43  ? 156 ILE A CB  1 
ATOM   44   C  CG1 . ILE A 1 15 ? 2.226   56.926 55.885  1.00 28.37  ? 156 ILE A CG1 1 
ATOM   45   C  CG2 . ILE A 1 15 ? 1.209   57.416 58.126  1.00 14.89  ? 156 ILE A CG2 1 
ATOM   46   C  CD1 . ILE A 1 15 ? 2.122   55.862 54.824  1.00 30.24  ? 156 ILE A CD1 1 
ATOM   47   N  N   . VAL A 1 16 ? 3.423   53.708 57.622  1.00 11.37  ? 157 VAL A N   1 
ATOM   48   C  CA  . VAL A 1 16 ? 3.805   52.476 56.932  1.00 14.73  ? 157 VAL A CA  1 
ATOM   49   C  C   . VAL A 1 16 ? 2.503   51.892 56.393  1.00 8.14   ? 157 VAL A C   1 
ATOM   50   O  O   . VAL A 1 16 ? 1.473   51.844 57.088  1.00 12.92  ? 157 VAL A O   1 
ATOM   51   C  CB  . VAL A 1 16 ? 4.550   51.456 57.900  1.00 16.77  ? 157 VAL A CB  1 
ATOM   52   C  CG1 . VAL A 1 16 ? 4.867   50.160 57.203  1.00 18.95  ? 157 VAL A CG1 1 
ATOM   53   C  CG2 . VAL A 1 16 ? 5.773   52.066 58.480  1.00 11.26  ? 157 VAL A CG2 1 
ATOM   54   N  N   . ARG A 1 17 ? 2.547   51.483 55.133  1.00 13.71  ? 158 ARG A N   1 
ATOM   55   C  CA  . ARG A 1 17 ? 1.447   50.808 54.472  1.00 14.42  ? 158 ARG A CA  1 
ATOM   56   C  C   . ARG A 1 17 ? 1.566   49.298 54.692  1.00 15.77  ? 158 ARG A C   1 
ATOM   57   O  O   . ARG A 1 17 ? 2.614   48.703 54.459  1.00 12.82  ? 158 ARG A O   1 
ATOM   58   C  CB  . ARG A 1 17 ? 1.442   51.080 52.959  1.00 12.36  ? 158 ARG A CB  1 
ATOM   59   C  CG  . ARG A 1 17 ? 1.190   52.524 52.589  1.00 22.83  ? 158 ARG A CG  1 
ATOM   60   C  CD  . ARG A 1 17 ? 1.434   52.714 51.105  1.00 35.79  ? 158 ARG A CD  1 
ATOM   61   N  NE  . ARG A 1 17 ? 2.847   52.543 50.791  1.00 46.09  ? 158 ARG A NE  1 
ATOM   62   C  CZ  . ARG A 1 17 ? 3.346   52.391 49.569  1.00 59.51  ? 158 ARG A CZ  1 
ATOM   63   N  NH1 . ARG A 1 17 ? 2.540   52.392 48.513  1.00 66.30  ? 158 ARG A NH1 1 
ATOM   64   N  NH2 . ARG A 1 17 ? 4.659   52.239 49.407  1.00 61.19  ? 158 ARG A NH2 1 
ATOM   65   N  N   . VAL A 1 18 ? 0.467   48.675 55.093  1.00 10.55  ? 159 VAL A N   1 
ATOM   66   C  CA  . VAL A 1 18 ? 0.567   47.294 55.436  1.00 8.58   ? 159 VAL A CA  1 
ATOM   67   C  C   . VAL A 1 18 ? -0.466  46.521 54.647  1.00 9.12   ? 159 VAL A C   1 
ATOM   68   O  O   . VAL A 1 18 ? -1.629  46.809 54.736  1.00 14.16  ? 159 VAL A O   1 
ATOM   69   C  CB  . VAL A 1 18 ? 0.359   47.053 56.937  1.00 16.12  ? 159 VAL A CB  1 
ATOM   70   C  CG1 . VAL A 1 18 ? 0.486   45.532 57.237  1.00 14.41  ? 159 VAL A CG1 1 
ATOM   71   C  CG2 . VAL A 1 18 ? 1.382   47.896 57.787  1.00 11.87  ? 159 VAL A CG2 1 
ATOM   72   N  N   . PHE A 1 19 ? -0.018  45.517 53.903  1.00 8.11   ? 160 PHE A N   1 
ATOM   73   C  CA  . PHE A 1 19 ? -0.947  44.619 53.227  1.00 10.19  ? 160 PHE A CA  1 
ATOM   74   C  C   . PHE A 1 19 ? -1.250  43.398 54.100  1.00 13.49  ? 160 PHE A C   1 
ATOM   75   O  O   . PHE A 1 19 ? -0.329  42.776 54.682  1.00 17.02  ? 160 PHE A O   1 
ATOM   76   C  CB  . PHE A 1 19 ? -0.331  44.223 51.899  1.00 15.69  ? 160 PHE A CB  1 
ATOM   77   C  CG  . PHE A 1 19 ? -0.211  45.370 50.947  1.00 20.60  ? 160 PHE A CG  1 
ATOM   78   C  CD1 . PHE A 1 19 ? 0.907   46.198 50.965  1.00 22.17  ? 160 PHE A CD1 1 
ATOM   79   C  CD2 . PHE A 1 19 ? -1.251  45.659 50.069  1.00 20.14  ? 160 PHE A CD2 1 
ATOM   80   C  CE1 . PHE A 1 19 ? 0.996   47.288 50.097  1.00 22.03  ? 160 PHE A CE1 1 
ATOM   81   C  CE2 . PHE A 1 19 ? -1.178  46.741 49.212  1.00 19.62  ? 160 PHE A CE2 1 
ATOM   82   C  CZ  . PHE A 1 19 ? -0.055  47.552 49.209  1.00 17.25  ? 160 PHE A CZ  1 
ATOM   83   N  N   . LEU A 1 20 ? -2.528  43.060 54.201  1.00 17.22  ? 161 LEU A N   1 
ATOM   84   C  CA  . LEU A 1 20 ? -3.021  42.051 55.127  1.00 20.53  ? 161 LEU A CA  1 
ATOM   85   C  C   . LEU A 1 20 ? -3.601  40.849 54.348  1.00 18.58  ? 161 LEU A C   1 
ATOM   86   O  O   . LEU A 1 20 ? -3.876  40.944 53.164  1.00 16.36  ? 161 LEU A O   1 
ATOM   87   C  CB  . LEU A 1 20 ? -4.093  42.655 56.060  1.00 18.16  ? 161 LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 20 ? -3.583  43.814 56.931  1.00 22.48  ? 161 LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 20 ? -4.722  44.623 57.617  1.00 15.23  ? 161 LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 20 ? -2.533  43.368 57.908  1.00 17.91  ? 161 LEU A CD2 1 
ATOM   91   N  N   . PRO A 1 21 ? -3.765  39.714 55.027  1.00 18.59  ? 162 PRO A N   1 
ATOM   92   C  CA  . PRO A 1 21 ? -4.397  38.534 54.406  1.00 27.74  ? 162 PRO A CA  1 
ATOM   93   C  C   . PRO A 1 21 ? -5.718  38.877 53.716  1.00 22.58  ? 162 PRO A C   1 
ATOM   94   O  O   . PRO A 1 21 ? -6.411  39.825 54.123  1.00 22.37  ? 162 PRO A O   1 
ATOM   95   C  CB  . PRO A 1 21 ? -4.692  37.637 55.607  1.00 25.09  ? 162 PRO A CB  1 
ATOM   96   C  CG  . PRO A 1 21 ? -3.622  37.950 56.570  1.00 20.56  ? 162 PRO A CG  1 
ATOM   97   C  CD  . PRO A 1 21 ? -3.360  39.452 56.420  1.00 15.24  ? 162 PRO A CD  1 
ATOM   98   N  N   . ASN A 1 22 ? -6.067  38.121 52.682  1.00 26.64  ? 163 ASN A N   1 
ATOM   99   C  CA  . ASN A 1 22 ? -7.379  38.258 52.052  1.00 33.82  ? 163 ASN A CA  1 
ATOM   100  C  C   . ASN A 1 22 ? -7.574  39.600 51.367  1.00 30.28  ? 163 ASN A C   1 
ATOM   101  O  O   . ASN A 1 22 ? -8.670  40.177 51.391  1.00 29.74  ? 163 ASN A O   1 
ATOM   102  C  CB  . ASN A 1 22 ? -8.482  38.043 53.086  1.00 44.74  ? 163 ASN A CB  1 
ATOM   103  C  CG  . ASN A 1 22 ? -8.550  36.607 53.566  1.00 61.44  ? 163 ASN A CG  1 
ATOM   104  O  OD1 . ASN A 1 22 ? -9.202  36.303 54.566  1.00 68.08  ? 163 ASN A OD1 1 
ATOM   105  N  ND2 . ASN A 1 22 ? -7.865  35.710 52.852  1.00 65.91  ? 163 ASN A ND2 1 
ATOM   106  N  N   . LYS A 1 23 ? -6.501  40.105 50.777  1.00 25.18  ? 164 LYS A N   1 
ATOM   107  C  CA  . LYS A 1 23 ? -6.581  41.306 49.968  1.00 26.67  ? 164 LYS A CA  1 
ATOM   108  C  C   . LYS A 1 23 ? -6.967  42.511 50.802  1.00 23.64  ? 164 LYS A C   1 
ATOM   109  O  O   . LYS A 1 23 ? -7.525  43.474 50.280  1.00 28.71  ? 164 LYS A O   1 
ATOM   110  C  CB  . LYS A 1 23 ? -7.621  41.093 48.860  1.00 35.67  ? 164 LYS A CB  1 
ATOM   111  C  CG  . LYS A 1 23 ? -7.402  39.815 48.036  1.00 43.94  ? 164 LYS A CG  1 
ATOM   112  C  CD  . LYS A 1 23 ? -6.468  40.042 46.860  1.00 52.98  ? 164 LYS A CD  1 
ATOM   113  C  CE  . LYS A 1 23 ? -6.274  38.765 46.033  1.00 59.71  ? 164 LYS A CE  1 
ATOM   114  N  NZ  . LYS A 1 23 ? -5.728  39.064 44.665  1.00 63.12  ? 164 LYS A NZ  1 
ATOM   115  N  N   . GLN A 1 24 ? -6.682  42.481 52.097  1.00 15.60  ? 165 GLN A N   1 
ATOM   116  C  CA  . GLN A 1 24 ? -6.976  43.654 52.911  1.00 18.36  ? 165 GLN A CA  1 
ATOM   117  C  C   . GLN A 1 24 ? -5.726  44.539 53.195  1.00 14.20  ? 165 GLN A C   1 
ATOM   118  O  O   . GLN A 1 24 ? -4.580  44.161 52.876  1.00 15.26  ? 165 GLN A O   1 
ATOM   119  C  CB  . GLN A 1 24 ? -7.780  43.276 54.162  1.00 18.71  ? 165 GLN A CB  1 
ATOM   120  C  CG  . GLN A 1 24 ? -9.273  43.015 53.862  1.00 23.05  ? 165 GLN A CG  1 
ATOM   121  C  CD  . GLN A 1 24 ? -10.107 42.700 55.106  1.00 24.00  ? 165 GLN A CD  1 
ATOM   122  O  OE1 . GLN A 1 24 ? -9.876  43.261 56.170  1.00 21.88  ? 165 GLN A OE1 1 
ATOM   123  N  NE2 . GLN A 1 24 ? -11.075 41.774 54.971  1.00 26.36  ? 165 GLN A NE2 1 
ATOM   124  N  N   . ARG A 1 25 ? -5.944  45.728 53.745  1.00 15.26  ? 166 ARG A N   1 
ATOM   125  C  CA  . ARG A 1 25 ? -4.816  46.654 53.981  1.00 17.55  ? 166 ARG A CA  1 
ATOM   126  C  C   . ARG A 1 25 ? -5.100  47.678 55.093  1.00 12.51  ? 166 ARG A C   1 
ATOM   127  O  O   . ARG A 1 25 ? -6.241  47.895 55.495  1.00 16.00  ? 166 ARG A O   1 
ATOM   128  C  CB  . ARG A 1 25 ? -4.468  47.363 52.666  1.00 19.55  ? 166 ARG A CB  1 
ATOM   129  C  CG  . ARG A 1 25 ? -5.708  47.899 52.023  1.00 26.98  ? 166 ARG A CG  1 
ATOM   130  C  CD  . ARG A 1 25 ? -5.458  48.591 50.714  1.00 32.80  ? 166 ARG A CD  1 
ATOM   131  N  NE  . ARG A 1 25 ? -5.153  47.716 49.583  1.00 28.59  ? 166 ARG A NE  1 
ATOM   132  C  CZ  . ARG A 1 25 ? -5.388  48.043 48.316  1.00 30.72  ? 166 ARG A CZ  1 
ATOM   133  N  NH1 . ARG A 1 25 ? -5.979  49.205 47.999  1.00 34.38  ? 166 ARG A NH1 1 
ATOM   134  N  NH2 . ARG A 1 25 ? -5.059  47.200 47.354  1.00 36.52  ? 166 ARG A NH2 1 
ATOM   135  N  N   . THR A 1 26 ? -4.024  48.224 55.626  1.00 11.87  ? 167 THR A N   1 
ATOM   136  C  CA  . THR A 1 26 ? -4.113  49.250 56.612  1.00 18.38  ? 167 THR A CA  1 
ATOM   137  C  C   . THR A 1 26 ? -2.892  50.182 56.566  1.00 13.82  ? 167 THR A C   1 
ATOM   138  O  O   . THR A 1 26 ? -1.827  49.826 56.069  1.00 11.76  ? 167 THR A O   1 
ATOM   139  C  CB  . THR A 1 26 ? -4.313  48.645 58.003  1.00 13.97  ? 167 THR A CB  1 
ATOM   140  O  OG1 . THR A 1 26 ? -4.762  49.678 58.862  1.00 18.40  ? 167 THR A OG1 1 
ATOM   141  C  CG2 . THR A 1 26 ? -3.023  48.050 58.529  1.00 13.49  ? 167 THR A CG2 1 
ATOM   142  N  N   . VAL A 1 27 ? -3.038  51.358 57.148  1.00 11.03  ? 168 VAL A N   1 
ATOM   143  C  CA  . VAL A 1 27 ? -1.911  52.248 57.303  1.00 13.48  ? 168 VAL A CA  1 
ATOM   144  C  C   . VAL A 1 27 ? -1.686  52.367 58.792  1.00 17.24  ? 168 VAL A C   1 
ATOM   145  O  O   . VAL A 1 27 ? -2.648  52.423 59.523  1.00 20.37  ? 168 VAL A O   1 
ATOM   146  C  CB  . VAL A 1 27 ? -2.174  53.662 56.747  1.00 19.92  ? 168 VAL A CB  1 
ATOM   147  C  CG1 . VAL A 1 27 ? -0.974  54.598 57.088  1.00 20.48  ? 168 VAL A CG1 1 
ATOM   148  C  CG2 . VAL A 1 27 ? -2.355  53.596 55.248  1.00 26.61  ? 168 VAL A CG2 1 
ATOM   149  N  N   . VAL A 1 28 ? -0.426  52.355 59.238  1.00 14.82  ? 169 VAL A N   1 
ATOM   150  C  CA  . VAL A 1 28 ? -0.158  52.609 60.644  1.00 12.92  ? 169 VAL A CA  1 
ATOM   151  C  C   . VAL A 1 28 ? 0.880   53.715 60.731  1.00 14.50  ? 169 VAL A C   1 
ATOM   152  O  O   . VAL A 1 28 ? 1.675   53.897 59.799  1.00 13.04  ? 169 VAL A O   1 
ATOM   153  C  CB  . VAL A 1 28 ? 0.344   51.344 61.402  1.00 18.13  ? 169 VAL A CB  1 
ATOM   154  C  CG1 . VAL A 1 28 ? -0.694  50.247 61.369  1.00 16.83  ? 169 VAL A CG1 1 
ATOM   155  C  CG2 . VAL A 1 28 ? 1.648   50.859 60.815  1.00 16.36  ? 169 VAL A CG2 1 
ATOM   156  N  N   . PRO A 1 29 ? 0.879   54.452 61.845  1.00 15.27  ? 170 PRO A N   1 
ATOM   157  C  CA  . PRO A 1 29 ? 1.897   55.478 62.095  1.00 21.23  ? 170 PRO A CA  1 
ATOM   158  C  C   . PRO A 1 29 ? 3.273   54.858 62.350  1.00 22.42  ? 170 PRO A C   1 
ATOM   159  O  O   . PRO A 1 29 ? 3.391   53.797 62.956  1.00 19.65  ? 170 PRO A O   1 
ATOM   160  C  CB  . PRO A 1 29 ? 1.386   56.189 63.354  1.00 24.37  ? 170 PRO A CB  1 
ATOM   161  C  CG  . PRO A 1 29 ? 0.482   55.257 64.007  1.00 24.31  ? 170 PRO A CG  1 
ATOM   162  C  CD  . PRO A 1 29 ? -0.148  54.427 62.903  1.00 18.42  ? 170 PRO A CD  1 
ATOM   163  N  N   . ALA A 1 30 ? 4.306   55.512 61.849  1.00 22.12  ? 171 ALA A N   1 
ATOM   164  C  CA  . ALA A 1 30 ? 5.636   54.967 61.983  1.00 26.61  ? 171 ALA A CA  1 
ATOM   165  C  C   . ALA A 1 30 ? 6.250   55.653 63.206  1.00 24.26  ? 171 ALA A C   1 
ATOM   166  O  O   . ALA A 1 30 ? 7.095   56.501 63.055  1.00 27.39  ? 171 ALA A O   1 
ATOM   167  C  CB  . ALA A 1 30 ? 6.432   55.282 60.734  1.00 27.72  ? 171 ALA A CB  1 
ATOM   168  N  N   . ARG A 1 31 ? 5.774   55.293 64.398  1.00 25.21  ? 172 ARG A N   1 
ATOM   169  C  CA  . ARG A 1 31 ? 6.164   55.964 65.646  1.00 32.26  ? 172 ARG A CA  1 
ATOM   170  C  C   . ARG A 1 31 ? 7.437   55.450 66.301  1.00 21.69  ? 172 ARG A C   1 
ATOM   171  O  O   . ARG A 1 31 ? 7.612   54.255 66.540  1.00 20.92  ? 172 ARG A O   1 
ATOM   172  C  CB  . ARG A 1 31 ? 5.015   55.893 66.674  1.00 37.15  ? 172 ARG A CB  1 
ATOM   173  C  CG  . ARG A 1 31 ? 3.672   56.425 66.176  1.00 39.48  ? 172 ARG A CG  1 
ATOM   174  C  CD  . ARG A 1 31 ? 2.683   56.688 67.333  1.00 42.99  ? 172 ARG A CD  1 
ATOM   175  N  NE  . ARG A 1 31 ? 2.526   55.526 68.201  1.00 48.07  ? 172 ARG A NE  1 
ATOM   176  C  CZ  . ARG A 1 31 ? 2.163   55.583 69.482  1.00 50.36  ? 172 ARG A CZ  1 
ATOM   177  N  NH1 . ARG A 1 31 ? 1.912   56.757 70.059  1.00 51.16  ? 172 ARG A NH1 1 
ATOM   178  N  NH2 . ARG A 1 31 ? 2.054   54.461 70.190  1.00 48.58  ? 172 ARG A NH2 1 
ATOM   179  N  N   . CYS A 1 32 ? 8.333   56.353 66.660  1.00 18.02  ? 173 CYS A N   1 
ATOM   180  C  CA  . CYS A 1 32 ? 9.562   55.903 67.270  1.00 15.26  ? 173 CYS A CA  1 
ATOM   181  C  C   . CYS A 1 32 ? 9.248   55.119 68.506  1.00 19.79  ? 173 CYS A C   1 
ATOM   182  O  O   . CYS A 1 32 ? 8.355   55.482 69.269  1.00 22.99  ? 173 CYS A O   1 
ATOM   183  C  CB  . CYS A 1 32 ? 10.442  57.105 67.648  1.00 26.67  ? 173 CYS A CB  1 
ATOM   184  S  SG  . CYS A 1 32 ? 11.334  57.741 66.250  1.00 39.26  ? 173 CYS A SG  1 
ATOM   185  N  N   . GLY A 1 33 ? 9.981   54.027 68.706  1.00 15.56  ? 174 GLY A N   1 
ATOM   186  C  CA  . GLY A 1 33 ? 9.794   53.215 69.896  1.00 15.97  ? 174 GLY A CA  1 
ATOM   187  C  C   . GLY A 1 33 ? 8.616   52.235 69.919  1.00 23.88  ? 174 GLY A C   1 
ATOM   188  O  O   . GLY A 1 33 ? 8.410   51.578 70.944  1.00 28.33  ? 174 GLY A O   1 
ATOM   189  N  N   . VAL A 1 34 ? 7.844   52.147 68.829  1.00 19.67  ? 175 VAL A N   1 
ATOM   190  C  CA  . VAL A 1 34 ? 6.688   51.255 68.762  1.00 19.08  ? 175 VAL A CA  1 
ATOM   191  C  C   . VAL A 1 34 ? 7.075   50.008 67.901  1.00 17.82  ? 175 VAL A C   1 
ATOM   192  O  O   . VAL A 1 34 ? 7.574   50.144 66.779  1.00 18.56  ? 175 VAL A O   1 
ATOM   193  C  CB  . VAL A 1 34 ? 5.432   51.994 68.186  1.00 25.51  ? 175 VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 34 ? 4.254   51.049 68.073  1.00 19.31  ? 175 VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 34 ? 5.046   53.266 69.034  1.00 24.77  ? 175 VAL A CG2 1 
ATOM   196  N  N   . THR A 1 35 ? 6.908   48.810 68.438  1.00 16.31  ? 176 THR A N   1 
ATOM   197  C  CA  . THR A 1 35 ? 7.160   47.602 67.643  1.00 19.41  ? 176 THR A CA  1 
ATOM   198  C  C   . THR A 1 35 ? 6.163   47.484 66.500  1.00 14.82  ? 176 THR A C   1 
ATOM   199  O  O   . THR A 1 35 ? 5.082   48.041 66.553  1.00 16.27  ? 176 THR A O   1 
ATOM   200  C  CB  . THR A 1 35 ? 7.120   46.275 68.483  1.00 12.32  ? 176 THR A CB  1 
ATOM   201  O  OG1 . THR A 1 35 ? 5.818   46.138 69.066  1.00 11.86  ? 176 THR A OG1 1 
ATOM   202  C  CG2 . THR A 1 35 ? 8.153   46.275 69.612  1.00 23.76  ? 176 THR A CG2 1 
ATOM   203  N  N   . VAL A 1 36 ? 6.554   46.732 65.469  1.00 9.04   ? 177 VAL A N   1 
ATOM   204  C  CA  . VAL A 1 36 ? 5.652   46.340 64.410  1.00 7.94   ? 177 VAL A CA  1 
ATOM   205  C  C   . VAL A 1 36 ? 4.471   45.591 64.997  1.00 13.88  ? 177 VAL A C   1 
ATOM   206  O  O   . VAL A 1 36 ? 3.342   45.773 64.587  1.00 11.57  ? 177 VAL A O   1 
ATOM   207  C  CB  . VAL A 1 36 ? 6.470   45.467 63.365  1.00 10.04  ? 177 VAL A CB  1 
ATOM   208  C  CG1 . VAL A 1 36 ? 5.550   44.855 62.343  1.00 14.81  ? 177 VAL A CG1 1 
ATOM   209  C  CG2 . VAL A 1 36 ? 7.526   46.379 62.683  1.00 9.30   ? 177 VAL A CG2 1 
ATOM   210  N  N   . ARG A 1 37 ? 4.764   44.718 65.959  1.00 14.59  ? 178 ARG A N   1 
ATOM   211  C  CA  . ARG A 1 37 ? 3.759   43.921 66.653  1.00 16.09  ? 178 ARG A CA  1 
ATOM   212  C  C   . ARG A 1 37 ? 2.666   44.807 67.243  1.00 18.09  ? 178 ARG A C   1 
ATOM   213  O  O   . ARG A 1 37 ? 1.472   44.620 66.971  1.00 11.71  ? 178 ARG A O   1 
ATOM   214  C  CB  . ARG A 1 37 ? 4.420   43.121 67.790  1.00 19.20  ? 178 ARG A CB  1 
ATOM   215  C  CG  . ARG A 1 37 ? 3.489   42.076 68.456  1.00 29.48  ? 178 ARG A CG  1 
ATOM   216  C  CD  . ARG A 1 37 ? 4.009   41.591 69.804  1.00 31.56  ? 178 ARG A CD  1 
ATOM   217  N  NE  . ARG A 1 37 ? 5.358   41.071 69.715  1.00 31.00  ? 178 ARG A NE  1 
ATOM   218  C  CZ  . ARG A 1 37 ? 5.673   39.844 69.314  1.00 32.92  ? 178 ARG A CZ  1 
ATOM   219  N  NH1 . ARG A 1 37 ? 4.724   38.982 68.935  1.00 32.64  ? 178 ARG A NH1 1 
ATOM   220  N  NH2 . ARG A 1 37 ? 6.944   39.490 69.259  1.00 27.78  ? 178 ARG A NH2 1 
ATOM   221  N  N   . ASP A 1 38 ? 3.083   45.769 68.065  1.00 12.14  ? 179 ASP A N   1 
ATOM   222  C  CA  . ASP A 1 38 ? 2.143   46.733 68.637  1.00 15.75  ? 179 ASP A CA  1 
ATOM   223  C  C   . ASP A 1 38 ? 1.488   47.672 67.606  1.00 17.35  ? 179 ASP A C   1 
ATOM   224  O  O   . ASP A 1 38 ? 0.340   48.002 67.730  1.00 20.07  ? 179 ASP A O   1 
ATOM   225  C  CB  . ASP A 1 38 ? 2.815   47.546 69.752  1.00 21.20  ? 179 ASP A CB  1 
ATOM   226  C  CG  . ASP A 1 38 ? 3.095   46.715 70.996  1.00 29.87  ? 179 ASP A CG  1 
ATOM   227  O  OD1 . ASP A 1 38 ? 2.447   45.654 71.202  1.00 33.39  ? 179 ASP A OD1 1 
ATOM   228  O  OD2 . ASP A 1 38 ? 3.969   47.125 71.771  1.00 32.59  ? 179 ASP A OD2 1 
ATOM   229  N  N   . SER A 1 39 ? 2.216   48.070 66.576  1.00 14.87  ? 180 SER A N   1 
ATOM   230  C  CA  . SER A 1 39 ? 1.614   48.836 65.503  1.00 15.65  ? 180 SER A CA  1 
ATOM   231  C  C   . SER A 1 39 ? 0.465   48.131 64.806  1.00 15.57  ? 180 SER A C   1 
ATOM   232  O  O   . SER A 1 39 ? -0.481  48.765 64.366  1.00 15.57  ? 180 SER A O   1 
ATOM   233  C  CB  . SER A 1 39 ? 2.652   49.174 64.452  1.00 15.06  ? 180 SER A CB  1 
ATOM   234  O  OG  . SER A 1 39 ? 3.607   50.066 64.942  1.00 18.18  ? 180 SER A OG  1 
ATOM   235  N  N   . LEU A 1 40 ? 0.556   46.818 64.678  1.00 13.32  ? 181 LEU A N   1 
ATOM   236  C  CA  . LEU A 1 40 ? -0.434  46.081 63.919  1.00 11.58  ? 181 LEU A CA  1 
ATOM   237  C  C   . LEU A 1 40 ? -1.427  45.247 64.758  1.00 12.97  ? 181 LEU A C   1 
ATOM   238  O  O   . LEU A 1 40 ? -2.315  44.661 64.209  1.00 16.54  ? 181 LEU A O   1 
ATOM   239  C  CB  . LEU A 1 40 ? 0.296   45.148 62.917  1.00 18.07  ? 181 LEU A CB  1 
ATOM   240  C  CG  . LEU A 1 40 ? 0.934   45.825 61.689  1.00 17.77  ? 181 LEU A CG  1 
ATOM   241  C  CD1 . LEU A 1 40 ? 1.758   44.813 60.850  1.00 12.85  ? 181 LEU A CD1 1 
ATOM   242  C  CD2 . LEU A 1 40 ? -0.154  46.463 60.822  1.00 19.06  ? 181 LEU A CD2 1 
ATOM   243  N  N   . LYS A 1 41 ? -1.222  45.170 66.063  1.00 20.09  ? 182 LYS A N   1 
ATOM   244  C  CA  . LYS A 1 41 ? -2.067  44.369 66.975  1.00 26.07  ? 182 LYS A CA  1 
ATOM   245  C  C   . LYS A 1 41 ? -3.583  44.550 66.722  1.00 22.71  ? 182 LYS A C   1 
ATOM   246  O  O   . LYS A 1 41 ? -4.338  43.581 66.569  1.00 22.36  ? 182 LYS A O   1 
ATOM   247  C  CB  . LYS A 1 41 ? -1.732  44.797 68.405  1.00 32.24  ? 182 LYS A CB  1 
ATOM   248  C  CG  . LYS A 1 41 ? -2.174  43.891 69.553  1.00 43.12  ? 182 LYS A CG  1 
ATOM   249  C  CD  . LYS A 1 41 ? -1.430  44.341 70.822  1.00 47.26  ? 182 LYS A CD  1 
ATOM   250  C  CE  . LYS A 1 41 ? -1.373  45.863 70.873  1.00 48.85  ? 182 LYS A CE  1 
ATOM   251  N  NZ  . LYS A 1 41 ? -0.374  46.480 71.800  1.00 45.77  ? 182 LYS A NZ  1 
ATOM   252  N  N   . LYS A 1 42 ? -4.018  45.798 66.649  1.00 25.04  ? 183 LYS A N   1 
ATOM   253  C  CA  . LYS A 1 42 ? -5.425  46.085 66.450  1.00 26.29  ? 183 LYS A CA  1 
ATOM   254  C  C   . LYS A 1 42 ? -5.945  45.682 65.078  1.00 20.79  ? 183 LYS A C   1 
ATOM   255  O  O   . LYS A 1 42 ? -7.005  45.046 64.971  1.00 21.52  ? 183 LYS A O   1 
ATOM   256  C  CB  . LYS A 1 42 ? -5.702  47.564 66.730  1.00 37.12  ? 183 LYS A CB  1 
ATOM   257  C  CG  . LYS A 1 42 ? -5.489  47.935 68.192  1.00 49.46  ? 183 LYS A CG  1 
ATOM   258  C  CD  . LYS A 1 42 ? -6.157  49.245 68.545  1.00 51.60  ? 183 LYS A CD  1 
ATOM   259  C  CE  . LYS A 1 42 ? -7.660  49.093 68.505  1.00 56.93  ? 183 LYS A CE  1 
ATOM   260  N  NZ  . LYS A 1 42 ? -8.201  48.264 69.636  1.00 55.99  ? 183 LYS A NZ  1 
ATOM   261  N  N   . ALA A 1 43 ? -5.233  46.076 64.025  1.00 20.57  ? 184 ALA A N   1 
ATOM   262  C  CA  . ALA A 1 43 ? -5.621  45.676 62.688  1.00 18.64  ? 184 ALA A CA  1 
ATOM   263  C  C   . ALA A 1 43 ? -5.749  44.157 62.580  1.00 20.60  ? 184 ALA A C   1 
ATOM   264  O  O   . ALA A 1 43 ? -6.669  43.626 61.906  1.00 26.53  ? 184 ALA A O   1 
ATOM   265  C  CB  . ALA A 1 43 ? -4.619  46.198 61.673  1.00 24.11  ? 184 ALA A CB  1 
ATOM   266  N  N   . LEU A 1 44 ? -4.832  43.443 63.226  1.00 18.52  ? 185 LEU A N   1 
ATOM   267  C  CA  . LEU A 1 44 ? -4.846  41.979 63.166  1.00 20.08  ? 185 LEU A CA  1 
ATOM   268  C  C   . LEU A 1 44 ? -6.050  41.417 63.930  1.00 23.35  ? 185 LEU A C   1 
ATOM   269  O  O   . LEU A 1 44 ? -6.791  40.583 63.421  1.00 19.08  ? 185 LEU A O   1 
ATOM   270  C  CB  . LEU A 1 44 ? -3.545  41.420 63.740  1.00 26.90  ? 185 LEU A CB  1 
ATOM   271  C  CG  . LEU A 1 44 ? -2.479  40.953 62.734  1.00 29.09  ? 185 LEU A CG  1 
ATOM   272  C  CD1 . LEU A 1 44 ? -2.553  41.702 61.466  1.00 29.16  ? 185 LEU A CD1 1 
ATOM   273  C  CD2 . LEU A 1 44 ? -1.060  41.003 63.288  1.00 26.82  ? 185 LEU A CD2 1 
HETATM 274  N  N   A MSE A 1 45 ? -6.225  41.886 65.160  0.34 23.67  ? 186 MSE A N   1 
HETATM 275  N  N   B MSE A 1 45 ? -6.196  41.856 65.173  0.66 23.36  ? 186 MSE A N   1 
HETATM 276  C  CA  A MSE A 1 45 ? -7.336  41.452 65.997  0.34 25.36  ? 186 MSE A CA  1 
HETATM 277  C  CA  B MSE A 1 45 ? -7.336  41.502 66.006  0.66 25.22  ? 186 MSE A CA  1 
HETATM 278  C  C   A MSE A 1 45 ? -8.693  41.703 65.327  0.34 26.57  ? 186 MSE A C   1 
HETATM 279  C  C   B MSE A 1 45 ? -8.673  41.691 65.284  0.66 26.65  ? 186 MSE A C   1 
HETATM 280  O  O   A MSE A 1 45 ? -9.593  40.859 65.400  0.34 28.72  ? 186 MSE A O   1 
HETATM 281  O  O   B MSE A 1 45 ? -9.540  40.799 65.275  0.66 29.41  ? 186 MSE A O   1 
HETATM 282  C  CB  A MSE A 1 45 ? -7.274  42.122 67.373  0.34 26.35  ? 186 MSE A CB  1 
HETATM 283  C  CB  B MSE A 1 45 ? -7.318  42.338 67.280  0.66 24.36  ? 186 MSE A CB  1 
HETATM 284  C  CG  A MSE A 1 45 ? -8.060  41.387 68.467  0.34 31.20  ? 186 MSE A CG  1 
HETATM 285  C  CG  B MSE A 1 45 ? -8.579  42.209 68.106  0.66 30.65  ? 186 MSE A CG  1 
HETATM 286  SE SE  A MSE A 1 45 ? -7.075  39.921 69.316  0.34 73.73  ? 186 MSE A SE  1 
HETATM 287  SE SE  B MSE A 1 45 ? -8.526  43.406 69.630  0.66 75.94  ? 186 MSE A SE  1 
HETATM 288  C  CE  A MSE A 1 45 ? -7.399  38.471 68.029  0.34 18.78  ? 186 MSE A CE  1 
HETATM 289  C  CE  B MSE A 1 45 ? -8.440  45.114 68.675  0.66 32.44  ? 186 MSE A CE  1 
HETATM 290  N  N   . MSE A 1 46 ? -8.845  42.838 64.653  1.00 23.46  ? 187 MSE A N   1 
HETATM 291  C  CA  . MSE A 1 46 ? -10.096 43.097 63.950  1.00 28.84  ? 187 MSE A CA  1 
HETATM 292  C  C   . MSE A 1 46 ? -10.408 42.012 62.931  1.00 26.04  ? 187 MSE A C   1 
HETATM 293  O  O   . MSE A 1 46 ? -11.535 41.908 62.446  1.00 24.64  ? 187 MSE A O   1 
HETATM 294  C  CB  . MSE A 1 46 ? -10.040 44.407 63.189  1.00 27.39  ? 187 MSE A CB  1 
HETATM 295  C  CG  . MSE A 1 46 ? -10.819 45.503 63.833  1.00 37.30  ? 187 MSE A CG  1 
HETATM 296  SE SE  . MSE A 1 46 ? -10.074 47.202 63.244  1.00 90.06  ? 187 MSE A SE  1 
HETATM 297  C  CE  . MSE A 1 46 ? -9.817  46.800 61.352  1.00 15.72  ? 187 MSE A CE  1 
ATOM   298  N  N   . ARG A 1 47 ? -9.394  41.254 62.539  1.00 23.72  ? 188 ARG A N   1 
ATOM   299  C  CA  . ARG A 1 47 ? -9.573  40.295 61.467  1.00 25.27  ? 188 ARG A CA  1 
ATOM   300  C  C   . ARG A 1 47 ? -9.397  38.912 62.037  1.00 26.38  ? 188 ARG A C   1 
ATOM   301  O  O   . ARG A 1 47 ? -9.273  37.934 61.309  1.00 27.03  ? 188 ARG A O   1 
ATOM   302  C  CB  . ARG A 1 47 ? -8.575  40.561 60.338  1.00 29.38  ? 188 ARG A CB  1 
ATOM   303  C  CG  . ARG A 1 47 ? -8.965  41.741 59.495  1.00 30.58  ? 188 ARG A CG  1 
ATOM   304  C  CD  . ARG A 1 47 ? -7.808  42.300 58.786  1.00 30.85  ? 188 ARG A CD  1 
ATOM   305  N  NE  . ARG A 1 47 ? -8.147  43.432 57.941  1.00 31.69  ? 188 ARG A NE  1 
ATOM   306  C  CZ  . ARG A 1 47 ? -8.012  44.712 58.280  1.00 28.71  ? 188 ARG A CZ  1 
ATOM   307  N  NH1 . ARG A 1 47 ? -7.572  45.064 59.482  1.00 23.92  ? 188 ARG A NH1 1 
ATOM   308  N  NH2 . ARG A 1 47 ? -8.315  45.645 57.389  1.00 29.77  ? 188 ARG A NH2 1 
ATOM   309  N  N   . GLY A 1 48 ? -9.418  38.843 63.354  1.00 24.50  ? 189 GLY A N   1 
ATOM   310  C  CA  . GLY A 1 48 ? -9.230  37.584 64.055  1.00 28.85  ? 189 GLY A CA  1 
ATOM   311  C  C   . GLY A 1 48 ? -7.848  36.953 63.909  1.00 32.00  ? 189 GLY A C   1 
ATOM   312  O  O   . GLY A 1 48 ? -7.726  35.742 63.985  1.00 27.26  ? 189 GLY A O   1 
ATOM   313  N  N   . LEU A 1 49 ? -6.814  37.775 63.709  1.00 26.24  ? 190 LEU A N   1 
ATOM   314  C  CA  . LEU A 1 49 ? -5.444  37.296 63.579  1.00 26.22  ? 190 LEU A CA  1 
ATOM   315  C  C   . LEU A 1 49 ? -4.643  37.720 64.794  1.00 26.47  ? 190 LEU A C   1 
ATOM   316  O  O   . LEU A 1 49 ? -4.993  38.692 65.470  1.00 25.07  ? 190 LEU A O   1 
ATOM   317  C  CB  . LEU A 1 49 ? -4.800  37.902 62.331  1.00 25.94  ? 190 LEU A CB  1 
ATOM   318  C  CG  . LEU A 1 49 ? -5.538  37.462 61.092  1.00 32.97  ? 190 LEU A CG  1 
ATOM   319  C  CD1 . LEU A 1 49 ? -5.061  38.255 59.899  1.00 41.67  ? 190 LEU A CD1 1 
ATOM   320  C  CD2 . LEU A 1 49 ? -5.322  35.979 60.921  1.00 35.64  ? 190 LEU A CD2 1 
ATOM   321  N  N   . ILE A 1 50 ? -3.549  37.018 65.060  1.00 22.69  ? 191 ILE A N   1 
ATOM   322  C  CA  . ILE A 1 50 ? -2.615  37.489 66.079  1.00 27.37  ? 191 ILE A CA  1 
ATOM   323  C  C   . ILE A 1 50 ? -1.209  37.420 65.519  1.00 18.03  ? 191 ILE A C   1 
ATOM   324  O  O   . ILE A 1 50 ? -0.927  36.556 64.718  1.00 19.29  ? 191 ILE A O   1 
ATOM   325  C  CB  . ILE A 1 50 ? -2.709  36.706 67.407  1.00 33.02  ? 191 ILE A CB  1 
ATOM   326  C  CG1 . ILE A 1 50 ? -2.667  35.204 67.139  1.00 38.76  ? 191 ILE A CG1 1 
ATOM   327  C  CG2 . ILE A 1 50 ? -3.984  37.096 68.149  1.00 32.51  ? 191 ILE A CG2 1 
ATOM   328  C  CD1 . ILE A 1 50 ? -2.194  34.399 68.326  1.00 47.69  ? 191 ILE A CD1 1 
ATOM   329  N  N   . PRO A 1 51 ? -0.327  38.338 65.943  1.00 19.28  ? 192 PRO A N   1 
ATOM   330  C  CA  . PRO A 1 51 ? 1.035   38.350 65.378  1.00 17.92  ? 192 PRO A CA  1 
ATOM   331  C  C   . PRO A 1 51 ? 1.724   36.995 65.504  1.00 21.89  ? 192 PRO A C   1 
ATOM   332  O  O   . PRO A 1 51 ? 2.483   36.571 64.629  1.00 22.70  ? 192 PRO A O   1 
ATOM   333  C  CB  . PRO A 1 51 ? 1.773   39.427 66.204  1.00 23.77  ? 192 PRO A CB  1 
ATOM   334  C  CG  . PRO A 1 51 ? 0.736   40.272 66.785  1.00 30.41  ? 192 PRO A CG  1 
ATOM   335  C  CD  . PRO A 1 51 ? -0.517  39.363 66.977  1.00 19.27  ? 192 PRO A CD  1 
ATOM   336  N  N   . GLU A 1 52 ? 1.461   36.284 66.594  1.00 26.27  ? 193 GLU A N   1 
ATOM   337  C  CA  . GLU A 1 52 ? 2.171   35.030 66.817  1.00 24.79  ? 193 GLU A CA  1 
ATOM   338  C  C   . GLU A 1 52 ? 1.759   33.946 65.825  1.00 22.96  ? 193 GLU A C   1 
ATOM   339  O  O   . GLU A 1 52 ? 2.400   32.916 65.760  1.00 28.26  ? 193 GLU A O   1 
ATOM   340  C  CB  . GLU A 1 52 ? 1.956   34.523 68.251  1.00 34.16  ? 193 GLU A CB  1 
ATOM   341  C  CG  . GLU A 1 52 ? 2.358   35.514 69.324  1.00 43.95  ? 193 GLU A CG  1 
ATOM   342  C  CD  . GLU A 1 52 ? 1.455   36.743 69.372  1.00 47.91  ? 193 GLU A CD  1 
ATOM   343  O  OE1 . GLU A 1 52 ? 0.225   36.575 69.237  1.00 45.06  ? 193 GLU A OE1 1 
ATOM   344  O  OE2 . GLU A 1 52 ? 1.974   37.874 69.544  1.00 51.32  ? 193 GLU A OE2 1 
ATOM   345  N  N   . CYS A 1 53 ? 0.704   34.178 65.044  1.00 21.13  ? 194 CYS A N   1 
ATOM   346  C  CA  . CYS A 1 53 ? 0.244   33.166 64.098  1.00 21.06  ? 194 CYS A CA  1 
ATOM   347  C  C   . CYS A 1 53 ? 0.526   33.674 62.689  1.00 15.45  ? 194 CYS A C   1 
ATOM   348  O  O   . CYS A 1 53 ? 0.098   33.109 61.700  1.00 16.00  ? 194 CYS A O   1 
ATOM   349  C  CB  . CYS A 1 53 ? -1.250  32.799 64.345  1.00 32.30  ? 194 CYS A CB  1 
ATOM   350  S  SG  . CYS A 1 53 ? -2.531  34.032 63.742  1.00 61.72  ? 194 CYS A SG  1 
ATOM   351  N  N   . CYS A 1 54 ? 1.314   34.736 62.610  1.00 12.94  ? 195 CYS A N   1 
ATOM   352  C  CA  . CYS A 1 54 ? 1.556   35.396 61.314  1.00 14.31  ? 195 CYS A CA  1 
ATOM   353  C  C   . CYS A 1 54 ? 3.039   35.749 61.139  1.00 12.50  ? 195 CYS A C   1 
ATOM   354  O  O   . CYS A 1 54 ? 3.769   35.792 62.106  1.00 15.31  ? 195 CYS A O   1 
ATOM   355  C  CB  . CYS A 1 54 ? 0.780   36.719 61.221  1.00 13.29  ? 195 CYS A CB  1 
ATOM   356  S  SG  . CYS A 1 54 ? -0.970  36.659 61.253  1.00 17.75  ? 195 CYS A SG  1 
ATOM   357  N  N   . ALA A 1 55 ? 3.467   35.971 59.897  1.00 14.79  ? 196 ALA A N   1 
ATOM   358  C  CA  . ALA A 1 55 ? 4.826   36.456 59.605  1.00 15.47  ? 196 ALA A CA  1 
ATOM   359  C  C   . ALA A 1 55 ? 4.683   37.831 58.971  1.00 12.62  ? 196 ALA A C   1 
ATOM   360  O  O   . ALA A 1 55 ? 3.689   38.123 58.284  1.00 13.75  ? 196 ALA A O   1 
ATOM   361  C  CB  . ALA A 1 55 ? 5.605   35.478 58.603  1.00 5.71   ? 196 ALA A CB  1 
ATOM   362  N  N   . VAL A 1 56 ? 5.656   38.692 59.168  1.00 10.86  ? 197 VAL A N   1 
ATOM   363  C  CA  . VAL A 1 56 ? 5.596   39.951 58.465  1.00 12.02  ? 197 VAL A CA  1 
ATOM   364  C  C   . VAL A 1 56 ? 6.862   40.136 57.609  1.00 12.45  ? 197 VAL A C   1 
ATOM   365  O  O   . VAL A 1 56 ? 7.969   39.680 57.969  1.00 9.74   ? 197 VAL A O   1 
ATOM   366  C  CB  . VAL A 1 56 ? 5.376   41.113 59.464  1.00 13.42  ? 197 VAL A CB  1 
ATOM   367  C  CG1 . VAL A 1 56 ? 6.354   41.032 60.592  1.00 14.87  ? 197 VAL A CG1 1 
ATOM   368  C  CG2 . VAL A 1 56 ? 5.436   42.458 58.741  1.00 14.48  ? 197 VAL A CG2 1 
ATOM   369  N  N   . TYR A 1 57 ? 6.693   40.775 56.452  1.00 11.16  ? 198 TYR A N   1 
ATOM   370  C  CA  . TYR A 1 57 ? 7.807   40.996 55.567  1.00 12.44  ? 198 TYR A CA  1 
ATOM   371  C  C   . TYR A 1 57 ? 7.793   42.375 54.972  1.00 21.50  ? 198 TYR A C   1 
ATOM   372  O  O   . TYR A 1 57 ? 6.750   42.981 54.812  1.00 20.42  ? 198 TYR A O   1 
ATOM   373  C  CB  . TYR A 1 57 ? 7.688   40.138 54.351  1.00 21.89  ? 198 TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 57 ? 7.460   38.737 54.607  1.00 20.34  ? 198 TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 57 ? 8.514   37.843 54.575  1.00 26.28  ? 198 TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 57 ? 6.169   38.259 54.842  1.00 28.46  ? 198 TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 57 ? 8.318   36.509 54.797  1.00 31.81  ? 198 TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 57 ? 5.958   36.897 55.060  1.00 32.75  ? 198 TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 57 ? 7.041   36.044 55.025  1.00 28.21  ? 198 TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 57 ? 6.866   34.723 55.225  1.00 35.88  ? 198 TYR A OH  1 
ATOM   381  N  N   . ARG A 1 58 ? 8.971   42.847 54.592  1.00 17.94  ? 199 ARG A N   1 
ATOM   382  C  CA  . ARG A 1 58 ? 9.041   44.125 53.906  1.00 28.99  ? 199 ARG A CA  1 
ATOM   383  C  C   . ARG A 1 58 ? 9.283   43.774 52.451  1.00 38.37  ? 199 ARG A C   1 
ATOM   384  O  O   . ARG A 1 58 ? 9.502   42.613 52.100  1.00 42.60  ? 199 ARG A O   1 
ATOM   385  C  CB  . ARG A 1 58 ? 10.210  44.926 54.410  1.00 31.30  ? 199 ARG A CB  1 
ATOM   386  C  CG  . ARG A 1 58 ? 11.463  44.451 53.744  1.00 39.48  ? 199 ARG A CG  1 
ATOM   387  C  CD  . ARG A 1 58 ? 12.683  44.908 54.457  1.00 47.27  ? 199 ARG A CD  1 
ATOM   388  N  NE  . ARG A 1 58 ? 12.853  46.348 54.421  1.00 47.74  ? 199 ARG A NE  1 
ATOM   389  C  CZ  . ARG A 1 58 ? 13.981  46.948 54.768  1.00 45.43  ? 199 ARG A CZ  1 
ATOM   390  N  NH1 . ARG A 1 58 ? 15.024  46.213 55.157  1.00 41.67  ? 199 ARG A NH1 1 
ATOM   391  N  NH2 . ARG A 1 58 ? 14.067  48.268 54.708  1.00 42.50  ? 199 ARG A NH2 1 
ATOM   392  N  N   . ILE A 1 59 ? 9.218   44.775 51.595  1.00 44.18  ? 200 ILE A N   1 
ATOM   393  C  CA  . ILE A 1 59 ? 9.590   44.577 50.213  1.00 54.53  ? 200 ILE A CA  1 
ATOM   394  C  C   . ILE A 1 59 ? 10.795  45.456 49.945  1.00 53.69  ? 200 ILE A C   1 
ATOM   395  O  O   . ILE A 1 59 ? 10.764  46.653 50.252  1.00 45.48  ? 200 ILE A O   1 
ATOM   396  C  CB  . ILE A 1 59 ? 8.445   44.915 49.266  1.00 63.38  ? 200 ILE A CB  1 
ATOM   397  C  CG1 . ILE A 1 59 ? 8.009   43.646 48.535  1.00 63.74  ? 200 ILE A CG1 1 
ATOM   398  C  CG2 . ILE A 1 59 ? 8.854   46.010 48.285  1.00 66.91  ? 200 ILE A CG2 1 
ATOM   399  C  CD1 . ILE A 1 59 ? 7.499   42.569 49.460  1.00 59.69  ? 200 ILE A CD1 1 
ATOM   400  N  N   . GLN A 1 60 ? 11.844  44.831 49.403  1.00 58.99  ? 201 GLN A N   1 
ATOM   401  C  CA  . GLN A 1 60 ? 13.166  45.429 49.220  1.00 62.23  ? 201 GLN A CA  1 
ATOM   402  C  C   . GLN A 1 60 ? 14.031  45.221 50.456  1.00 63.28  ? 201 GLN A C   1 
ATOM   403  O  O   . GLN A 1 60 ? 14.686  46.154 50.931  1.00 64.33  ? 201 GLN A O   1 
ATOM   404  C  CB  . GLN A 1 60 ? 13.064  46.921 48.883  1.00 66.75  ? 201 GLN A CB  1 
ATOM   405  N  N   . LYS A 1 64 ? 10.227  40.194 49.247  1.00 44.07  ? 205 LYS A N   1 
ATOM   406  C  CA  . LYS A 1 64 ? 9.992   38.992 50.048  1.00 43.15  ? 205 LYS A CA  1 
ATOM   407  C  C   . LYS A 1 64 ? 10.961  38.842 51.231  1.00 34.03  ? 205 LYS A C   1 
ATOM   408  O  O   . LYS A 1 64 ? 11.551  37.786 51.404  1.00 38.59  ? 205 LYS A O   1 
ATOM   409  C  CB  . LYS A 1 64 ? 10.090  37.759 49.145  1.00 47.31  ? 205 LYS A CB  1 
ATOM   410  N  N   . LYS A 1 65 ? 11.162  39.892 52.021  1.00 28.23  ? 206 LYS A N   1 
ATOM   411  C  CA  . LYS A 1 65 ? 12.216  39.848 53.055  1.00 23.04  ? 206 LYS A CA  1 
ATOM   412  C  C   . LYS A 1 65 ? 11.601  39.882 54.436  1.00 18.45  ? 206 LYS A C   1 
ATOM   413  O  O   . LYS A 1 65 ? 10.903  40.837 54.772  1.00 18.10  ? 206 LYS A O   1 
ATOM   414  C  CB  . LYS A 1 65 ? 13.187  41.024 52.894  1.00 24.12  ? 206 LYS A CB  1 
ATOM   415  C  CG  . LYS A 1 65 ? 13.934  41.045 51.561  1.00 28.77  ? 206 LYS A CG  1 
ATOM   416  C  CD  . LYS A 1 65 ? 14.813  39.791 51.454  1.00 34.22  ? 206 LYS A CD  1 
ATOM   417  C  CE  . LYS A 1 65 ? 15.914  39.984 50.440  1.00 44.99  ? 206 LYS A CE  1 
ATOM   418  N  NZ  . LYS A 1 65 ? 15.391  40.332 49.088  1.00 49.02  ? 206 LYS A NZ  1 
ATOM   419  N  N   . PRO A 1 66 ? 11.836  38.833 55.227  1.00 17.40  ? 207 PRO A N   1 
ATOM   420  C  CA  . PRO A 1 66 ? 11.167  38.727 56.536  1.00 15.39  ? 207 PRO A CA  1 
ATOM   421  C  C   . PRO A 1 66 ? 11.695  39.691 57.632  1.00 7.39   ? 207 PRO A C   1 
ATOM   422  O  O   . PRO A 1 66 ? 12.887  39.858 57.827  1.00 8.24   ? 207 PRO A O   1 
ATOM   423  C  CB  . PRO A 1 66 ? 11.439  37.286 56.954  1.00 13.56  ? 207 PRO A CB  1 
ATOM   424  C  CG  . PRO A 1 66 ? 12.775  36.949 56.223  1.00 14.09  ? 207 PRO A CG  1 
ATOM   425  C  CD  . PRO A 1 66 ? 12.633  37.625 54.896  1.00 16.57  ? 207 PRO A CD  1 
ATOM   426  N  N   . ILE A 1 67 ? 10.808  40.212 58.449  1.00 12.61  ? 208 ILE A N   1 
ATOM   427  C  CA  . ILE A 1 67 ? 11.317  41.054 59.519  1.00 11.53  ? 208 ILE A CA  1 
ATOM   428  C  C   . ILE A 1 67 ? 10.725  40.617 60.806  1.00 9.22   ? 208 ILE A C   1 
ATOM   429  O  O   . ILE A 1 67 ? 9.659   40.021 60.825  1.00 12.69  ? 208 ILE A O   1 
ATOM   430  C  CB  . ILE A 1 67 ? 11.012  42.513 59.307  1.00 20.16  ? 208 ILE A CB  1 
ATOM   431  C  CG1 . ILE A 1 67 ? 9.539   42.773 59.391  1.00 18.27  ? 208 ILE A CG1 1 
ATOM   432  C  CG2 . ILE A 1 67 ? 11.512  43.033 57.958  1.00 23.89  ? 208 ILE A CG2 1 
ATOM   433  C  CD1 . ILE A 1 67 ? 9.312   44.262 59.711  1.00 20.35  ? 208 ILE A CD1 1 
ATOM   434  N  N   . GLY A 1 68 ? 11.443  40.914 61.873  1.00 12.41  ? 209 GLY A N   1 
ATOM   435  C  CA  . GLY A 1 68 ? 11.064  40.490 63.200  1.00 18.68  ? 209 GLY A CA  1 
ATOM   436  C  C   . GLY A 1 68 ? 9.894   41.306 63.690  1.00 13.97  ? 209 GLY A C   1 
ATOM   437  O  O   . GLY A 1 68 ? 9.749   42.470 63.347  1.00 15.29  ? 209 GLY A O   1 
ATOM   438  N  N   . TRP A 1 69 ? 9.043   40.677 64.470  1.00 11.55  ? 210 TRP A N   1 
ATOM   439  C  CA  . TRP A 1 69 ? 7.849   41.361 65.017  1.00 13.76  ? 210 TRP A CA  1 
ATOM   440  C  C   . TRP A 1 69 ? 8.248   42.477 65.989  1.00 13.78  ? 210 TRP A C   1 
ATOM   441  O  O   . TRP A 1 69 ? 7.562   43.507 66.124  1.00 13.95  ? 210 TRP A O   1 
ATOM   442  C  CB  . TRP A 1 69 ? 6.923   40.305 65.691  1.00 9.45   ? 210 TRP A CB  1 
ATOM   443  C  CG  . TRP A 1 69 ? 5.980   39.634 64.701  1.00 11.42  ? 210 TRP A CG  1 
ATOM   444  C  CD1 . TRP A 1 69 ? 5.965   38.291 64.325  1.00 13.32  ? 210 TRP A CD1 1 
ATOM   445  C  CD2 . TRP A 1 69 ? 4.915   40.259 63.981  1.00 10.28  ? 210 TRP A CD2 1 
ATOM   446  N  NE1 . TRP A 1 69 ? 4.978   38.078 63.399  1.00 13.38  ? 210 TRP A NE1 1 
ATOM   447  C  CE2 . TRP A 1 69 ? 4.304   39.254 63.174  1.00 11.60  ? 210 TRP A CE2 1 
ATOM   448  C  CE3 . TRP A 1 69 ? 4.361   41.565 63.987  1.00 8.08   ? 210 TRP A CE3 1 
ATOM   449  C  CZ2 . TRP A 1 69 ? 3.204   39.521 62.368  1.00 15.17  ? 210 TRP A CZ2 1 
ATOM   450  C  CZ3 . TRP A 1 69 ? 3.310   41.835 63.179  1.00 12.39  ? 210 TRP A CZ3 1 
ATOM   451  C  CH2 . TRP A 1 69 ? 2.702   40.811 62.392  1.00 13.38  ? 210 TRP A CH2 1 
ATOM   452  N  N   . ASP A 1 70 ? 9.404   42.325 66.616  1.00 14.54  ? 211 ASP A N   1 
ATOM   453  C  CA  . ASP A 1 70 ? 9.841   43.325 67.624  1.00 15.97  ? 211 ASP A CA  1 
ATOM   454  C  C   . ASP A 1 70 ? 10.657  44.483 67.046  1.00 15.76  ? 211 ASP A C   1 
ATOM   455  O  O   . ASP A 1 70 ? 11.109  45.341 67.792  1.00 15.69  ? 211 ASP A O   1 
ATOM   456  C  CB  . ASP A 1 70 ? 10.620  42.637 68.747  1.00 23.49  ? 211 ASP A CB  1 
ATOM   457  C  CG  . ASP A 1 70 ? 9.747   41.640 69.528  1.00 33.54  ? 211 ASP A CG  1 
ATOM   458  O  OD1 . ASP A 1 70 ? 8.596   41.996 69.805  1.00 37.04  ? 211 ASP A OD1 1 
ATOM   459  O  OD2 . ASP A 1 70 ? 10.184  40.505 69.822  1.00 42.81  ? 211 ASP A OD2 1 
ATOM   460  N  N   . THR A 1 71 ? 10.813  44.503 65.717  1.00 14.49  ? 212 THR A N   1 
ATOM   461  C  CA  . THR A 1 71 ? 11.412  45.650 64.991  1.00 16.20  ? 212 THR A CA  1 
ATOM   462  C  C   . THR A 1 71 ? 10.807  46.978 65.381  1.00 12.93  ? 212 THR A C   1 
ATOM   463  O  O   . THR A 1 71 ? 9.601   47.084 65.535  1.00 18.24  ? 212 THR A O   1 
ATOM   464  C  CB  . THR A 1 71 ? 11.147  45.492 63.448  1.00 8.37   ? 212 THR A CB  1 
ATOM   465  O  OG1 . THR A 1 71 ? 11.716  44.270 63.014  1.00 16.10  ? 212 THR A OG1 1 
ATOM   466  C  CG2 . THR A 1 71 ? 11.785  46.643 62.689  1.00 11.35  ? 212 THR A CG2 1 
ATOM   467  N  N   . ASP A 1 72 ? 11.614  48.017 65.500  1.00 11.49  ? 213 ASP A N   1 
ATOM   468  C  CA  . ASP A 1 72 ? 11.017  49.350 65.682  1.00 11.77  ? 213 ASP A CA  1 
ATOM   469  C  C   . ASP A 1 72 ? 10.453  49.875 64.362  1.00 11.29  ? 213 ASP A C   1 
ATOM   470  O  O   . ASP A 1 72 ? 11.193  50.049 63.388  1.00 14.40  ? 213 ASP A O   1 
ATOM   471  C  CB  . ASP A 1 72 ? 12.046  50.273 66.351  1.00 11.09  ? 213 ASP A CB  1 
ATOM   472  C  CG  . ASP A 1 72 ? 11.494  51.645 66.693  1.00 19.98  ? 213 ASP A CG  1 
ATOM   473  O  OD1 . ASP A 1 72 ? 10.692  52.241 65.931  1.00 18.30  ? 213 ASP A OD1 1 
ATOM   474  O  OD2 . ASP A 1 72 ? 11.878  52.122 67.780  1.00 34.60  ? 213 ASP A OD2 1 
ATOM   475  N  N   . ILE A 1 73 ? 9.140   50.050 64.332  1.00 9.35   ? 214 ILE A N   1 
ATOM   476  C  CA  . ILE A 1 73 ? 8.426   50.453 63.099  1.00 17.68  ? 214 ILE A CA  1 
ATOM   477  C  C   . ILE A 1 73 ? 8.918   51.802 62.463  1.00 13.33  ? 214 ILE A C   1 
ATOM   478  O  O   . ILE A 1 73 ? 8.792   52.018 61.249  1.00 8.97   ? 214 ILE A O   1 
ATOM   479  C  CB  . ILE A 1 73 ? 6.887   50.476 63.283  1.00 15.21  ? 214 ILE A CB  1 
ATOM   480  C  CG1 . ILE A 1 73 ? 6.218   50.654 61.923  1.00 25.14  ? 214 ILE A CG1 1 
ATOM   481  C  CG2 . ILE A 1 73 ? 6.426   51.642 64.194  1.00 12.07  ? 214 ILE A CG2 1 
ATOM   482  C  CD1 . ILE A 1 73 ? 5.079   49.811 61.691  1.00 18.10  ? 214 ILE A CD1 1 
ATOM   483  N  N   . SER A 1 74 ? 9.484   52.697 63.270  1.00 14.05  ? 215 SER A N   1 
ATOM   484  C  CA  . SER A 1 74 ? 9.919   54.014 62.728  1.00 14.74  ? 215 SER A CA  1 
ATOM   485  C  C   . SER A 1 74 ? 11.042  53.857 61.680  1.00 13.55  ? 215 SER A C   1 
ATOM   486  O  O   . SER A 1 74 ? 11.175  54.717 60.796  1.00 10.69  ? 215 SER A O   1 
ATOM   487  C  CB  . SER A 1 74 ? 10.409  54.963 63.853  1.00 13.92  ? 215 SER A CB  1 
ATOM   488  O  OG  . SER A 1 74 ? 11.474  54.329 64.563  1.00 20.51  ? 215 SER A OG  1 
ATOM   489  N  N   . TRP A 1 75 ? 11.824  52.771 61.783  1.00 12.39  ? 216 TRP A N   1 
ATOM   490  C  CA  . TRP A 1 75 ? 12.872  52.450 60.791  1.00 13.10  ? 216 TRP A CA  1 
ATOM   491  C  C   . TRP A 1 75 ? 12.335  52.129 59.381  1.00 19.10  ? 216 TRP A C   1 
ATOM   492  O  O   . TRP A 1 75 ? 13.071  52.252 58.400  1.00 20.76  ? 216 TRP A O   1 
ATOM   493  C  CB  . TRP A 1 75 ? 13.812  51.333 61.275  1.00 13.14  ? 216 TRP A CB  1 
ATOM   494  C  CG  . TRP A 1 75 ? 14.533  51.701 62.504  1.00 13.05  ? 216 TRP A CG  1 
ATOM   495  C  CD1 . TRP A 1 75 ? 14.214  51.361 63.794  1.00 20.35  ? 216 TRP A CD1 1 
ATOM   496  C  CD2 . TRP A 1 75 ? 15.724  52.506 62.582  1.00 13.95  ? 216 TRP A CD2 1 
ATOM   497  N  NE1 . TRP A 1 75 ? 15.108  51.940 64.674  1.00 23.00  ? 216 TRP A NE1 1 
ATOM   498  C  CE2 . TRP A 1 75 ? 16.045  52.644 63.961  1.00 19.82  ? 216 TRP A CE2 1 
ATOM   499  C  CE3 . TRP A 1 75 ? 16.507  53.144 61.636  1.00 8.72   ? 216 TRP A CE3 1 
ATOM   500  C  CZ2 . TRP A 1 75 ? 17.149  53.373 64.410  1.00 21.86  ? 216 TRP A CZ2 1 
ATOM   501  C  CZ3 . TRP A 1 75 ? 17.610  53.893 62.081  1.00 20.55  ? 216 TRP A CZ3 1 
ATOM   502  C  CH2 . TRP A 1 75 ? 17.932  53.985 63.455  1.00 24.99  ? 216 TRP A CH2 1 
ATOM   503  N  N   . LEU A 1 76 ? 11.043  51.812 59.297  1.00 10.97  ? 217 LEU A N   1 
ATOM   504  C  CA  . LEU A 1 76 ? 10.369  51.369 58.085  1.00 13.76  ? 217 LEU A CA  1 
ATOM   505  C  C   . LEU A 1 76 ? 9.441   52.410 57.461  1.00 17.28  ? 217 LEU A C   1 
ATOM   506  O  O   . LEU A 1 76 ? 8.689   52.102 56.526  1.00 16.97  ? 217 LEU A O   1 
ATOM   507  C  CB  . LEU A 1 76 ? 9.583   50.072 58.384  1.00 17.14  ? 217 LEU A CB  1 
ATOM   508  C  CG  . LEU A 1 76 ? 10.430  48.959 59.048  1.00 20.34  ? 217 LEU A CG  1 
ATOM   509  C  CD1 . LEU A 1 76 ? 9.566   47.806 59.583  1.00 20.19  ? 217 LEU A CD1 1 
ATOM   510  C  CD2 . LEU A 1 76 ? 11.511  48.392 58.116  1.00 21.59  ? 217 LEU A CD2 1 
ATOM   511  N  N   . THR A 1 77 ? 9.462   53.628 57.993  1.00 20.51  ? 218 THR A N   1 
ATOM   512  C  CA  . THR A 1 77 ? 8.661   54.741 57.448  1.00 20.57  ? 218 THR A CA  1 
ATOM   513  C  C   . THR A 1 77 ? 8.786   54.819 55.964  1.00 26.65  ? 218 THR A C   1 
ATOM   514  O  O   . THR A 1 77 ? 9.886   54.832 55.455  1.00 29.93  ? 218 THR A O   1 
ATOM   515  C  CB  . THR A 1 77 ? 9.141   56.105 57.991  1.00 22.68  ? 218 THR A CB  1 
ATOM   516  O  OG1 . THR A 1 77 ? 8.951   56.148 59.399  1.00 26.40  ? 218 THR A OG1 1 
ATOM   517  C  CG2 . THR A 1 77 ? 8.371   57.233 57.370  1.00 22.09  ? 218 THR A CG2 1 
ATOM   518  N  N   . GLY A 1 78 ? 7.651   54.877 55.265  1.00 24.91  ? 219 GLY A N   1 
ATOM   519  C  CA  . GLY A 1 78 ? 7.660   54.940 53.815  1.00 27.16  ? 219 GLY A CA  1 
ATOM   520  C  C   . GLY A 1 78 ? 7.530   53.591 53.114  1.00 27.77  ? 219 GLY A C   1 
ATOM   521  O  O   . GLY A 1 78 ? 7.119   53.513 51.950  1.00 32.60  ? 219 GLY A O   1 
ATOM   522  N  N   . GLU A 1 79 ? 7.874   52.523 53.831  1.00 22.54  ? 220 GLU A N   1 
ATOM   523  C  CA  . GLU A 1 79 ? 7.872   51.177 53.272  1.00 27.19  ? 220 GLU A CA  1 
ATOM   524  C  C   . GLU A 1 79 ? 6.497   50.502 53.220  1.00 21.24  ? 220 GLU A C   1 
ATOM   525  O  O   . GLU A 1 79 ? 5.509   50.996 53.779  1.00 21.45  ? 220 GLU A O   1 
ATOM   526  C  CB  . GLU A 1 79 ? 8.819   50.299 54.084  1.00 35.93  ? 220 GLU A CB  1 
ATOM   527  C  CG  . GLU A 1 79 ? 10.294  50.717 54.039  1.00 42.52  ? 220 GLU A CG  1 
ATOM   528  C  CD  . GLU A 1 79 ? 11.091  49.852 53.088  1.00 56.66  ? 220 GLU A CD  1 
ATOM   529  O  OE1 . GLU A 1 79 ? 10.694  48.675 52.866  1.00 59.05  ? 220 GLU A OE1 1 
ATOM   530  O  OE2 . GLU A 1 79 ? 12.109  50.350 52.560  1.00 63.63  ? 220 GLU A OE2 1 
ATOM   531  N  N   . GLU A 1 80 ? 6.441   49.393 52.504  1.00 22.28  ? 221 GLU A N   1 
ATOM   532  C  CA  . GLU A 1 80 ? 5.267   48.506 52.496  1.00 19.76  ? 221 GLU A CA  1 
ATOM   533  C  C   . GLU A 1 80 ? 5.611   47.212 53.227  1.00 18.67  ? 221 GLU A C   1 
ATOM   534  O  O   . GLU A 1 80 ? 6.619   46.611 52.910  1.00 23.52  ? 221 GLU A O   1 
ATOM   535  C  CB  . GLU A 1 80 ? 4.915   48.115 51.065  1.00 26.24  ? 221 GLU A CB  1 
ATOM   536  C  CG  . GLU A 1 80 ? 4.597   49.300 50.170  1.00 37.48  ? 221 GLU A CG  1 
ATOM   537  C  CD  . GLU A 1 80 ? 4.075   48.881 48.806  1.00 44.69  ? 221 GLU A CD  1 
ATOM   538  O  OE1 . GLU A 1 80 ? 4.079   47.662 48.512  1.00 44.39  ? 221 GLU A OE1 1 
ATOM   539  O  OE2 . GLU A 1 80 ? 3.646   49.771 48.043  1.00 49.30  ? 221 GLU A OE2 1 
ATOM   540  N  N   . LEU A 1 81 ? 4.788   46.794 54.194  1.00 10.96  ? 222 LEU A N   1 
ATOM   541  C  CA  . LEU A 1 81 ? 4.966   45.531 54.846  1.00 10.28  ? 222 LEU A CA  1 
ATOM   542  C  C   . LEU A 1 81 ? 3.885   44.605 54.354  1.00 16.37  ? 222 LEU A C   1 
ATOM   543  O  O   . LEU A 1 81 ? 2.875   45.065 53.900  1.00 16.45  ? 222 LEU A O   1 
ATOM   544  C  CB  . LEU A 1 81 ? 4.874   45.673 56.385  1.00 11.33  ? 222 LEU A CB  1 
ATOM   545  C  CG  . LEU A 1 81 ? 5.876   46.698 56.883  1.00 15.22  ? 222 LEU A CG  1 
ATOM   546  C  CD1 . LEU A 1 81 ? 5.823   46.886 58.379  1.00 12.50  ? 222 LEU A CD1 1 
ATOM   547  C  CD2 . LEU A 1 81 ? 7.311   46.234 56.462  1.00 13.28  ? 222 LEU A CD2 1 
ATOM   548  N  N   . HIS A 1 82 ? 4.101   43.294 54.473  1.00 8.56   ? 223 HIS A N   1 
ATOM   549  C  CA  . HIS A 1 82 ? 3.074   42.360 54.128  1.00 7.75   ? 223 HIS A CA  1 
ATOM   550  C  C   . HIS A 1 82 ? 2.961   41.410 55.299  1.00 12.20  ? 223 HIS A C   1 
ATOM   551  O  O   . HIS A 1 82 ? 3.971   41.003 55.839  1.00 16.59  ? 223 HIS A O   1 
ATOM   552  C  CB  . HIS A 1 82 ? 3.457   41.632 52.841  1.00 16.45  ? 223 HIS A CB  1 
ATOM   553  C  CG  . HIS A 1 82 ? 3.531   42.537 51.658  1.00 30.61  ? 223 HIS A CG  1 
ATOM   554  N  ND1 . HIS A 1 82 ? 2.655   42.446 50.595  1.00 32.48  ? 223 HIS A ND1 1 
ATOM   555  C  CD2 . HIS A 1 82 ? 4.347   43.588 51.385  1.00 29.26  ? 223 HIS A CD2 1 
ATOM   556  C  CE1 . HIS A 1 82 ? 2.952   43.374 49.708  1.00 26.63  ? 223 HIS A CE1 1 
ATOM   557  N  NE2 . HIS A 1 82 ? 3.981   44.076 50.158  1.00 27.01  ? 223 HIS A NE2 1 
ATOM   558  N  N   . VAL A 1 83 ? 1.749   41.035 55.657  1.00 9.90   ? 224 VAL A N   1 
ATOM   559  C  CA  . VAL A 1 83 ? 1.529   40.119 56.782  1.00 7.73   ? 224 VAL A CA  1 
ATOM   560  C  C   . VAL A 1 83 ? 0.864   38.905 56.208  1.00 13.55  ? 224 VAL A C   1 
ATOM   561  O  O   . VAL A 1 83 ? -0.097  39.027 55.498  1.00 10.58  ? 224 VAL A O   1 
ATOM   562  C  CB  . VAL A 1 83 ? 0.576   40.695 57.871  1.00 18.32  ? 224 VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 83 ? 0.160   39.571 58.915  1.00 9.25   ? 224 VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 83 ? 1.262   41.854 58.608  1.00 12.82  ? 224 VAL A CG2 1 
ATOM   565  N  N   . GLU A 1 84 ? 1.438   37.741 56.488  1.00 14.62  ? 225 GLU A N   1 
ATOM   566  C  CA  . GLU A 1 84 ? 0.894   36.453 56.048  1.00 16.85  ? 225 GLU A CA  1 
ATOM   567  C  C   . GLU A 1 84 ? 0.628   35.604 57.243  1.00 13.93  ? 225 GLU A C   1 
ATOM   568  O  O   . GLU A 1 84 ? 1.349   35.653 58.229  1.00 10.49  ? 225 GLU A O   1 
ATOM   569  C  CB  . GLU A 1 84 ? 1.919   35.698 55.192  1.00 22.70  ? 225 GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 84 ? 1.966   36.253 53.823  1.00 37.35  ? 225 GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 84 ? 2.941   35.523 52.934  1.00 47.28  ? 225 GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 84 ? 3.494   34.483 53.353  1.00 43.56  ? 225 GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 84 ? 3.137   36.006 51.805  1.00 55.06  ? 225 GLU A OE2 1 
ATOM   574  N  N   . VAL A 1 85 ? -0.406  34.787 57.146  1.00 17.61  ? 226 VAL A N   1 
ATOM   575  C  CA  . VAL A 1 85 ? -0.669  33.834 58.198  1.00 14.57  ? 226 VAL A CA  1 
ATOM   576  C  C   . VAL A 1 85 ? 0.366   32.660 58.136  1.00 12.41  ? 226 VAL A C   1 
ATOM   577  O  O   . VAL A 1 85 ? 0.790   32.257 57.053  1.00 16.17  ? 226 VAL A O   1 
ATOM   578  C  CB  . VAL A 1 85 ? -2.114  33.378 58.067  1.00 16.95  ? 226 VAL A CB  1 
ATOM   579  C  CG1 . VAL A 1 85 ? -2.474  32.313 59.119  1.00 17.17  ? 226 VAL A CG1 1 
ATOM   580  C  CG2 . VAL A 1 85 ? -3.060  34.609 58.148  1.00 15.76  ? 226 VAL A CG2 1 
ATOM   581  N  N   . LEU A 1 86 ? 0.846   32.197 59.293  1.00 10.11  ? 227 LEU A N   1 
ATOM   582  C  CA  . LEU A 1 86 ? 1.794   31.055 59.331  1.00 14.86  ? 227 LEU A CA  1 
ATOM   583  C  C   . LEU A 1 86 ? 1.084   29.787 58.815  1.00 11.48  ? 227 LEU A C   1 
ATOM   584  O  O   . LEU A 1 86 ? -0.129  29.648 58.930  1.00 14.43  ? 227 LEU A O   1 
ATOM   585  C  CB  . LEU A 1 86 ? 2.319   30.780 60.746  1.00 15.71  ? 227 LEU A CB  1 
ATOM   586  C  CG  . LEU A 1 86 ? 3.254   31.843 61.366  1.00 20.13  ? 227 LEU A CG  1 
ATOM   587  C  CD1 . LEU A 1 86 ? 3.690   31.445 62.773  1.00 22.47  ? 227 LEU A CD1 1 
ATOM   588  C  CD2 . LEU A 1 86 ? 4.442   32.080 60.458  1.00 14.69  ? 227 LEU A CD2 1 
ATOM   589  N  N   . GLU A 1 87 ? 1.861   28.892 58.214  1.00 13.55  ? 228 GLU A N   1 
ATOM   590  C  CA  . GLU A 1 87 ? 1.369   27.565 57.834  1.00 16.55  ? 228 GLU A CA  1 
ATOM   591  C  C   . GLU A 1 87 ? 0.745   26.890 59.037  1.00 16.67  ? 228 GLU A C   1 
ATOM   592  O  O   . GLU A 1 87 ? 1.206   26.975 60.166  1.00 17.00  ? 228 GLU A O   1 
ATOM   593  C  CB  . GLU A 1 87 ? 2.507   26.701 57.261  1.00 22.91  ? 228 GLU A CB  1 
ATOM   594  C  CG  . GLU A 1 87 ? 3.024   27.217 55.931  1.00 31.88  ? 228 GLU A CG  1 
ATOM   595  C  CD  . GLU A 1 87 ? 1.978   27.110 54.827  1.00 37.04  ? 228 GLU A CD  1 
ATOM   596  O  OE1 . GLU A 1 87 ? 1.796   25.999 54.271  1.00 41.53  ? 228 GLU A OE1 1 
ATOM   597  O  OE2 . GLU A 1 87 ? 1.342   28.128 54.520  1.00 33.42  ? 228 GLU A OE2 1 
ATOM   598  N  N   . ASN A 1 88 ? -0.346  26.224 58.776  1.00 15.23  ? 229 ASN A N   1 
ATOM   599  C  CA  . ASN A 1 88 ? -1.115  25.595 59.816  1.00 17.56  ? 229 ASN A CA  1 
ATOM   600  C  C   . ASN A 1 88 ? -0.498  24.197 60.052  1.00 23.78  ? 229 ASN A C   1 
ATOM   601  O  O   . ASN A 1 88 ? -0.860  23.204 59.360  1.00 22.47  ? 229 ASN A O   1 
ATOM   602  C  CB  . ASN A 1 88 ? -2.576  25.497 59.322  1.00 23.59  ? 229 ASN A CB  1 
ATOM   603  C  CG  . ASN A 1 88 ? -3.565  25.158 60.432  1.00 25.71  ? 229 ASN A CG  1 
ATOM   604  O  OD1 . ASN A 1 88 ? -3.172  24.987 61.566  1.00 25.32  ? 229 ASN A OD1 1 
ATOM   605  N  ND2 . ASN A 1 88 ? -4.858  25.090 60.101  1.00 25.08  ? 229 ASN A ND2 1 
ATOM   606  N  N   . VAL A 1 89 ? 0.470   24.140 60.975  1.00 17.98  ? 230 VAL A N   1 
ATOM   607  C  CA  . VAL A 1 89 ? 1.110   22.890 61.368  1.00 22.12  ? 230 VAL A CA  1 
ATOM   608  C  C   . VAL A 1 89 ? 1.157   22.895 62.879  1.00 22.72  ? 230 VAL A C   1 
ATOM   609  O  O   . VAL A 1 89 ? 1.505   23.899 63.500  1.00 19.11  ? 230 VAL A O   1 
ATOM   610  C  CB  . VAL A 1 89 ? 2.517   22.746 60.813  1.00 22.44  ? 230 VAL A CB  1 
ATOM   611  C  CG1 . VAL A 1 89 ? 3.151   21.309 61.121  1.00 18.48  ? 230 VAL A CG1 1 
ATOM   612  C  CG2 . VAL A 1 89 ? 2.548   23.047 59.333  1.00 29.15  ? 230 VAL A CG2 1 
ATOM   613  N  N   . PRO A 1 90 ? 0.795   21.778 63.486  1.00 22.00  ? 231 PRO A N   1 
ATOM   614  C  CA  . PRO A 1 90 ? 0.736   21.735 64.953  1.00 25.81  ? 231 PRO A CA  1 
ATOM   615  C  C   . PRO A 1 90 ? 2.025   22.081 65.656  1.00 24.43  ? 231 PRO A C   1 
ATOM   616  O  O   . PRO A 1 90 ? 3.089   21.689 65.200  1.00 20.84  ? 231 PRO A O   1 
ATOM   617  C  CB  . PRO A 1 90 ? 0.409   20.272 65.223  1.00 25.58  ? 231 PRO A CB  1 
ATOM   618  C  CG  . PRO A 1 90 ? -0.396  19.879 64.001  1.00 28.29  ? 231 PRO A CG  1 
ATOM   619  C  CD  . PRO A 1 90 ? 0.337   20.519 62.879  1.00 21.35  ? 231 PRO A CD  1 
ATOM   620  N  N   . LEU A 1 91 ? 1.913   22.774 66.781  1.00 25.44  ? 232 LEU A N   1 
ATOM   621  C  CA  . LEU A 1 91 ? 3.065   23.065 67.632  1.00 26.33  ? 232 LEU A CA  1 
ATOM   622  C  C   . LEU A 1 91 ? 3.326   21.847 68.514  1.00 24.51  ? 232 LEU A C   1 
ATOM   623  O  O   . LEU A 1 91 ? 2.474   20.964 68.636  1.00 25.39  ? 232 LEU A O   1 
ATOM   624  C  CB  . LEU A 1 91 ? 2.811   24.276 68.514  1.00 28.27  ? 232 LEU A CB  1 
ATOM   625  C  CG  . LEU A 1 91 ? 2.259   25.534 67.815  1.00 35.07  ? 232 LEU A CG  1 
ATOM   626  C  CD1 . LEU A 1 91 ? 2.078   26.655 68.825  1.00 38.99  ? 232 LEU A CD1 1 
ATOM   627  C  CD2 . LEU A 1 91 ? 3.141   26.003 66.689  1.00 33.59  ? 232 LEU A CD2 1 
ATOM   628  N  N   . THR A 1 92 ? 4.522   21.805 69.087  1.00 25.60  ? 233 THR A N   1 
ATOM   629  C  CA  . THR A 1 92 ? 4.946   20.742 69.985  1.00 33.80  ? 233 THR A CA  1 
ATOM   630  C  C   . THR A 1 92 ? 4.173   20.706 71.300  1.00 41.19  ? 233 THR A C   1 
ATOM   631  O  O   . THR A 1 92 ? 3.298   19.864 71.486  1.00 39.45  ? 233 THR A O   1 
ATOM   632  C  CB  . THR A 1 92 ? 6.470   20.854 70.243  1.00 36.75  ? 233 THR A CB  1 
ATOM   633  O  OG1 . THR A 1 92 ? 7.172   20.339 69.096  1.00 31.10  ? 233 THR A OG1 1 
ATOM   634  C  CG2 . THR A 1 92 ? 6.875   20.087 71.450  1.00 46.01  ? 233 THR A CG2 1 
ATOM   635  N  N   . SER B 1 9  ? 11.851  4.617  52.122  1.00 59.43  ? 150 SER B N   1 
ATOM   636  C  CA  . SER B 1 9  ? 13.002  5.460  52.481  1.00 58.46  ? 150 SER B CA  1 
ATOM   637  C  C   . SER B 1 9  ? 12.875  6.072  53.884  1.00 48.69  ? 150 SER B C   1 
ATOM   638  O  O   . SER B 1 9  ? 13.619  5.725  54.831  1.00 41.97  ? 150 SER B O   1 
ATOM   639  C  CB  . SER B 1 9  ? 13.179  6.577  51.450  1.00 59.24  ? 150 SER B CB  1 
ATOM   640  O  OG  . SER B 1 9  ? 14.044  7.586  51.946  1.00 62.27  ? 150 SER B OG  1 
ATOM   641  N  N   . HIS B 1 10 ? 11.923  6.991  53.994  1.00 41.63  ? 151 HIS B N   1 
ATOM   642  C  CA  . HIS B 1 10 ? 11.582  7.645  55.247  1.00 36.22  ? 151 HIS B CA  1 
ATOM   643  C  C   . HIS B 1 10 ? 10.932  6.703  56.245  1.00 29.90  ? 151 HIS B C   1 
ATOM   644  O  O   . HIS B 1 10 ? 10.791  7.035  57.431  1.00 30.41  ? 151 HIS B O   1 
ATOM   645  C  CB  . HIS B 1 10 ? 10.613  8.800  54.971  1.00 37.32  ? 151 HIS B CB  1 
ATOM   646  C  CG  . HIS B 1 10 ? 11.275  9.994  54.364  1.00 35.01  ? 151 HIS B CG  1 
ATOM   647  N  ND1 . HIS B 1 10 ? 11.909  10.949 55.130  1.00 23.75  ? 151 HIS B ND1 1 
ATOM   648  C  CD2 . HIS B 1 10 ? 11.434  10.373 53.069  1.00 33.24  ? 151 HIS B CD2 1 
ATOM   649  C  CE1 . HIS B 1 10 ? 12.417  11.877 54.334  1.00 29.69  ? 151 HIS B CE1 1 
ATOM   650  N  NE2 . HIS B 1 10 ? 12.139  11.556 53.080  1.00 31.03  ? 151 HIS B NE2 1 
HETATM 651  N  N   . MSE B 1 11 ? 10.501  5.541  55.769  1.00 31.28  ? 152 MSE B N   1 
HETATM 652  C  CA  . MSE B 1 11 ? 9.774   4.613  56.654  1.00 34.54  ? 152 MSE B CA  1 
HETATM 653  C  C   . MSE B 1 11 ? 10.639  4.291  57.863  1.00 39.26  ? 152 MSE B C   1 
HETATM 654  O  O   . MSE B 1 11 ? 10.173  4.300  59.006  1.00 43.95  ? 152 MSE B O   1 
HETATM 655  C  CB  . MSE B 1 11 ? 9.352   3.320  55.955  1.00 24.91  ? 152 MSE B CB  1 
HETATM 656  C  CG  . MSE B 1 11 ? 8.528   2.421  56.891  1.00 31.95  ? 152 MSE B CG  1 
HETATM 657  SE SE  . MSE B 1 11 ? 6.950   3.355  57.685  1.00 89.64  ? 152 MSE B SE  1 
HETATM 658  C  CE  . MSE B 1 11 ? 5.601   2.896  56.321  1.00 50.78  ? 152 MSE B CE  1 
ATOM   659  N  N   . GLN B 1 12 ? 11.909  4.025  57.607  1.00 30.57  ? 153 GLN B N   1 
ATOM   660  C  CA  . GLN B 1 12 ? 12.815  3.719  58.691  1.00 35.66  ? 153 GLN B CA  1 
ATOM   661  C  C   . GLN B 1 12 ? 13.486  4.972  59.249  1.00 32.12  ? 153 GLN B C   1 
ATOM   662  O  O   . GLN B 1 12 ? 13.732  5.062  60.455  1.00 36.71  ? 153 GLN B O   1 
ATOM   663  C  CB  . GLN B 1 12 ? 13.887  2.708  58.247  1.00 39.64  ? 153 GLN B CB  1 
ATOM   664  C  CG  . GLN B 1 12 ? 13.316  1.354  57.873  1.00 43.87  ? 153 GLN B CG  1 
ATOM   665  C  CD  . GLN B 1 12 ? 12.673  1.392  56.511  1.00 49.00  ? 153 GLN B CD  1 
ATOM   666  O  OE1 . GLN B 1 12 ? 13.008  2.247  55.678  1.00 51.38  ? 153 GLN B OE1 1 
ATOM   667  N  NE2 . GLN B 1 12 ? 11.740  0.474  56.266  1.00 50.52  ? 153 GLN B NE2 1 
ATOM   668  N  N   . LYS B 1 13 ? 13.794  5.923  58.368  1.00 24.61  ? 154 LYS B N   1 
ATOM   669  C  CA  . LYS B 1 13 ? 14.571  7.094  58.772  1.00 22.19  ? 154 LYS B CA  1 
ATOM   670  C  C   . LYS B 1 13 ? 13.981  8.405  58.238  1.00 25.85  ? 154 LYS B C   1 
ATOM   671  O  O   . LYS B 1 13 ? 14.468  8.938  57.233  1.00 26.84  ? 154 LYS B O   1 
ATOM   672  C  CB  . LYS B 1 13 ? 16.031  6.919  58.362  1.00 24.10  ? 154 LYS B CB  1 
ATOM   673  C  CG  . LYS B 1 13 ? 16.758  5.926  59.315  1.00 38.42  ? 154 LYS B CG  1 
ATOM   674  C  CD  . LYS B 1 13 ? 17.943  5.259  58.694  1.00 40.58  ? 154 LYS B CD  1 
ATOM   675  C  CE  . LYS B 1 13 ? 18.862  4.661  59.780  1.00 42.95  ? 154 LYS B CE  1 
ATOM   676  N  NZ  . LYS B 1 13 ? 18.087  3.956  60.816  1.00 40.59  ? 154 LYS B NZ  1 
ATOM   677  N  N   . PRO B 1 14 ? 12.910  8.885  58.891  1.00 22.65  ? 155 PRO B N   1 
ATOM   678  C  CA  . PRO B 1 14 ? 12.181  10.128 58.558  1.00 26.65  ? 155 PRO B CA  1 
ATOM   679  C  C   . PRO B 1 14 ? 13.085  11.341 58.795  1.00 22.14  ? 155 PRO B C   1 
ATOM   680  O  O   . PRO B 1 14 ? 13.574  11.524 59.919  1.00 17.79  ? 155 PRO B O   1 
ATOM   681  C  CB  . PRO B 1 14 ? 11.040  10.158 59.582  1.00 30.81  ? 155 PRO B CB  1 
ATOM   682  C  CG  . PRO B 1 14 ? 11.561  9.301  60.745  1.00 32.72  ? 155 PRO B CG  1 
ATOM   683  C  CD  . PRO B 1 14 ? 12.368  8.230  60.097  1.00 27.79  ? 155 PRO B CD  1 
ATOM   684  N  N   . ILE B 1 15 ? 13.283  12.152 57.762  1.00 22.61  ? 156 ILE B N   1 
ATOM   685  C  CA  . ILE B 1 15 ? 14.193  13.283 57.886  1.00 19.54  ? 156 ILE B CA  1 
ATOM   686  C  C   . ILE B 1 15 ? 13.565  14.516 57.254  1.00 14.71  ? 156 ILE B C   1 
ATOM   687  O  O   . ILE B 1 15 ? 12.593  14.415 56.503  1.00 15.23  ? 156 ILE B O   1 
ATOM   688  C  CB  . ILE B 1 15 ? 15.561  12.975 57.203  1.00 20.20  ? 156 ILE B CB  1 
ATOM   689  C  CG1 . ILE B 1 15 ? 15.370  12.542 55.751  1.00 28.47  ? 156 ILE B CG1 1 
ATOM   690  C  CG2 . ILE B 1 15 ? 16.387  11.943 57.948  1.00 19.64  ? 156 ILE B CG2 1 
ATOM   691  C  CD1 . ILE B 1 15 ? 15.550  13.696 54.781  1.00 34.10  ? 156 ILE B CD1 1 
ATOM   692  N  N   . VAL B 1 16 ? 14.143  15.689 57.526  1.00 13.86  ? 157 VAL B N   1 
ATOM   693  C  CA  . VAL B 1 16 ? 13.696  16.914 56.839  1.00 12.22  ? 157 VAL B CA  1 
ATOM   694  C  C   . VAL B 1 16 ? 15.008  17.512 56.293  1.00 10.87  ? 157 VAL B C   1 
ATOM   695  O  O   . VAL B 1 16 ? 16.033  17.539 56.991  1.00 16.43  ? 157 VAL B O   1 
ATOM   696  C  CB  . VAL B 1 16 ? 13.006  17.933 57.832  1.00 14.94  ? 157 VAL B CB  1 
ATOM   697  C  CG1 . VAL B 1 16 ? 12.619  19.186 57.131  1.00 22.84  ? 157 VAL B CG1 1 
ATOM   698  C  CG2 . VAL B 1 16 ? 11.809  17.346 58.586  1.00 9.84   ? 157 VAL B CG2 1 
ATOM   699  N  N   . ARG B 1 17 ? 14.979  17.938 55.042  1.00 16.13  ? 158 ARG B N   1 
ATOM   700  C  CA  . ARG B 1 17 ? 16.086  18.596 54.418  1.00 15.76  ? 158 ARG B CA  1 
ATOM   701  C  C   . ARG B 1 17 ? 15.959  20.110 54.659  1.00 16.50  ? 158 ARG B C   1 
ATOM   702  O  O   . ARG B 1 17 ? 14.896  20.724 54.466  1.00 16.36  ? 158 ARG B O   1 
ATOM   703  C  CB  . ARG B 1 17 ? 16.111  18.303 52.924  1.00 15.87  ? 158 ARG B CB  1 
ATOM   704  C  CG  . ARG B 1 17 ? 16.367  16.837 52.566  1.00 25.65  ? 158 ARG B CG  1 
ATOM   705  C  CD  . ARG B 1 17 ? 16.181  16.640 51.069  1.00 32.53  ? 158 ARG B CD  1 
ATOM   706  N  NE  . ARG B 1 17 ? 14.768  16.737 50.718  1.00 44.82  ? 158 ARG B NE  1 
ATOM   707  C  CZ  . ARG B 1 17 ? 14.267  16.535 49.504  1.00 56.66  ? 158 ARG B CZ  1 
ATOM   708  N  NH1 . ARG B 1 17 ? 15.068  16.222 48.488  1.00 62.08  ? 158 ARG B NH1 1 
ATOM   709  N  NH2 . ARG B 1 17 ? 12.958  16.647 49.309  1.00 59.13  ? 158 ARG B NH2 1 
ATOM   710  N  N   . VAL B 1 18 ? 17.060  20.715 55.069  1.00 14.07  ? 159 VAL B N   1 
ATOM   711  C  CA  . VAL B 1 18 ? 16.982  22.118 55.421  1.00 15.18  ? 159 VAL B CA  1 
ATOM   712  C  C   . VAL B 1 18 ? 18.011  22.878 54.656  1.00 10.06  ? 159 VAL B C   1 
ATOM   713  O  O   . VAL B 1 18 ? 19.193  22.614 54.763  1.00 13.78  ? 159 VAL B O   1 
ATOM   714  C  CB  . VAL B 1 18 ? 17.181  22.355 56.927  1.00 14.71  ? 159 VAL B CB  1 
ATOM   715  C  CG1 . VAL B 1 18 ? 17.009  23.860 57.237  1.00 15.50  ? 159 VAL B CG1 1 
ATOM   716  C  CG2 . VAL B 1 18 ? 16.165  21.472 57.774  1.00 13.97  ? 159 VAL B CG2 1 
ATOM   717  N  N   . PHE B 1 19 ? 17.556  23.863 53.925  1.00 9.66   ? 160 PHE B N   1 
ATOM   718  C  CA  . PHE B 1 19 ? 18.474  24.762 53.268  1.00 9.78   ? 160 PHE B CA  1 
ATOM   719  C  C   . PHE B 1 19 ? 18.774  25.971 54.154  1.00 11.37  ? 160 PHE B C   1 
ATOM   720  O  O   . PHE B 1 19 ? 17.873  26.600 54.686  1.00 13.55  ? 160 PHE B O   1 
ATOM   721  C  CB  . PHE B 1 19 ? 17.864  25.170 51.908  1.00 15.53  ? 160 PHE B CB  1 
ATOM   722  C  CG  . PHE B 1 19 ? 17.740  24.002 50.965  1.00 23.03  ? 160 PHE B CG  1 
ATOM   723  C  CD1 . PHE B 1 19 ? 16.599  23.219 50.935  1.00 28.18  ? 160 PHE B CD1 1 
ATOM   724  C  CD2 . PHE B 1 19 ? 18.826  23.619 50.188  1.00 19.48  ? 160 PHE B CD2 1 
ATOM   725  C  CE1 . PHE B 1 19 ? 16.517  22.119 50.081  1.00 24.63  ? 160 PHE B CE1 1 
ATOM   726  C  CE2 . PHE B 1 19 ? 18.769  22.524 49.342  1.00 15.80  ? 160 PHE B CE2 1 
ATOM   727  C  CZ  . PHE B 1 19 ? 17.614  21.777 49.272  1.00 18.01  ? 160 PHE B CZ  1 
ATOM   728  N  N   . LEU B 1 20 ? 20.042  26.348 54.221  1.00 17.41  ? 161 LEU B N   1 
ATOM   729  C  CA  . LEU B 1 20 ? 20.535  27.368 55.164  1.00 17.97  ? 161 LEU B CA  1 
ATOM   730  C  C   . LEU B 1 20 ? 21.129  28.569 54.412  1.00 17.24  ? 161 LEU B C   1 
ATOM   731  O  O   . LEU B 1 20 ? 21.404  28.494 53.220  1.00 14.57  ? 161 LEU B O   1 
ATOM   732  C  CB  . LEU B 1 20 ? 21.612  26.719 56.059  1.00 14.21  ? 161 LEU B CB  1 
ATOM   733  C  CG  . LEU B 1 20 ? 21.108  25.595 56.974  1.00 19.74  ? 161 LEU B CG  1 
ATOM   734  C  CD1 . LEU B 1 20 ? 22.294  24.790 57.672  1.00 15.78  ? 161 LEU B CD1 1 
ATOM   735  C  CD2 . LEU B 1 20 ? 20.027  26.037 57.946  1.00 14.92  ? 161 LEU B CD2 1 
ATOM   736  N  N   . PRO B 1 21 ? 21.346  29.687 55.115  1.00 19.44  ? 162 PRO B N   1 
ATOM   737  C  CA  . PRO B 1 21 ? 21.952  30.866 54.481  1.00 26.21  ? 162 PRO B CA  1 
ATOM   738  C  C   . PRO B 1 21 ? 23.296  30.531 53.802  1.00 27.41  ? 162 PRO B C   1 
ATOM   739  O  O   . PRO B 1 21 ? 23.903  29.528 54.169  1.00 22.06  ? 162 PRO B O   1 
ATOM   740  C  CB  . PRO B 1 21 ? 22.158  31.809 55.668  1.00 25.42  ? 162 PRO B CB  1 
ATOM   741  C  CG  . PRO B 1 21 ? 21.027  31.448 56.592  1.00 17.83  ? 162 PRO B CG  1 
ATOM   742  C  CD  . PRO B 1 21 ? 20.996  29.928 56.520  1.00 15.72  ? 162 PRO B CD  1 
ATOM   743  N  N   . ASN B 1 22 ? 23.708  31.328 52.812  1.00 27.62  ? 163 ASN B N   1 
ATOM   744  C  CA  . ASN B 1 22 ? 25.028  31.214 52.175  1.00 28.09  ? 163 ASN B CA  1 
ATOM   745  C  C   . ASN B 1 22 ? 25.216  29.835 51.529  1.00 27.83  ? 163 ASN B C   1 
ATOM   746  O  O   . ASN B 1 22 ? 26.249  29.205 51.661  1.00 24.85  ? 163 ASN B O   1 
ATOM   747  C  CB  . ASN B 1 22 ? 26.160  31.594 53.175  1.00 37.75  ? 163 ASN B CB  1 
ATOM   748  C  CG  . ASN B 1 22 ? 27.558  31.779 52.508  1.00 53.22  ? 163 ASN B CG  1 
ATOM   749  O  OD1 . ASN B 1 22 ? 27.696  31.930 51.284  1.00 49.92  ? 163 ASN B OD1 1 
ATOM   750  N  ND2 . ASN B 1 22 ? 28.599  31.779 53.343  1.00 51.79  ? 163 ASN B ND2 1 
ATOM   751  N  N   . LYS B 1 23 ? 24.169  29.385 50.847  1.00 26.87  ? 164 LYS B N   1 
ATOM   752  C  CA  . LYS B 1 23 ? 24.182  28.164 50.059  1.00 28.54  ? 164 LYS B CA  1 
ATOM   753  C  C   . LYS B 1 23 ? 24.500  26.917 50.874  1.00 24.36  ? 164 LYS B C   1 
ATOM   754  O  O   . LYS B 1 23 ? 25.045  25.965 50.329  1.00 24.99  ? 164 LYS B O   1 
ATOM   755  C  CB  . LYS B 1 23 ? 25.206  28.284 48.929  1.00 38.88  ? 164 LYS B CB  1 
ATOM   756  C  CG  . LYS B 1 23 ? 25.055  29.534 48.071  1.00 46.99  ? 164 LYS B CG  1 
ATOM   757  C  CD  . LYS B 1 23 ? 24.168  29.310 46.847  1.00 55.48  ? 164 LYS B CD  1 
ATOM   758  C  CE  . LYS B 1 23 ? 23.900  30.642 46.120  1.00 61.31  ? 164 LYS B CE  1 
ATOM   759  N  NZ  . LYS B 1 23 ? 23.041  30.522 44.898  1.00 62.55  ? 164 LYS B NZ  1 
ATOM   760  N  N   . GLN B 1 24 ? 24.193  26.922 52.164  1.00 15.94  ? 165 GLN B N   1 
ATOM   761  C  CA  . GLN B 1 24 ? 24.473  25.742 52.975  1.00 18.42  ? 165 GLN B CA  1 
ATOM   762  C  C   . GLN B 1 24 ? 23.244  24.842 53.220  1.00 15.92  ? 165 GLN B C   1 
ATOM   763  O  O   . GLN B 1 24 ? 22.130  25.191 52.889  1.00 14.09  ? 165 GLN B O   1 
ATOM   764  C  CB  . GLN B 1 24 ? 25.192  26.114 54.264  1.00 13.93  ? 165 GLN B CB  1 
ATOM   765  C  CG  . GLN B 1 24 ? 26.638  26.551 53.937  1.00 20.99  ? 165 GLN B CG  1 
ATOM   766  C  CD  . GLN B 1 24 ? 27.524  26.750 55.150  1.00 21.97  ? 165 GLN B CD  1 
ATOM   767  O  OE1 . GLN B 1 24 ? 27.246  26.237 56.220  1.00 21.64  ? 165 GLN B OE1 1 
ATOM   768  N  NE2 . GLN B 1 24 ? 28.620  27.515 54.976  1.00 22.11  ? 165 GLN B NE2 1 
ATOM   769  N  N   . ARG B 1 25 ? 23.457  23.689 53.820  1.00 16.18  ? 166 ARG B N   1 
ATOM   770  C  CA  . ARG B 1 25 ? 22.356  22.790 54.004  1.00 16.60  ? 166 ARG B CA  1 
ATOM   771  C  C   . ARG B 1 25 ? 22.655  21.772 55.098  1.00 15.88  ? 166 ARG B C   1 
ATOM   772  O  O   . ARG B 1 25 ? 23.794  21.592 55.519  1.00 22.12  ? 166 ARG B O   1 
ATOM   773  C  CB  . ARG B 1 25 ? 22.032  22.059 52.667  1.00 21.82  ? 166 ARG B CB  1 
ATOM   774  C  CG  . ARG B 1 25 ? 23.186  21.345 52.155  1.00 22.19  ? 166 ARG B CG  1 
ATOM   775  C  CD  . ARG B 1 25 ? 22.947  20.696 50.824  1.00 31.60  ? 166 ARG B CD  1 
ATOM   776  N  NE  . ARG B 1 25 ? 22.702  21.636 49.729  1.00 29.67  ? 166 ARG B NE  1 
ATOM   777  C  CZ  . ARG B 1 25 ? 22.782  21.288 48.452  1.00 30.31  ? 166 ARG B CZ  1 
ATOM   778  N  NH1 . ARG B 1 25 ? 23.115  20.042 48.118  1.00 33.98  ? 166 ARG B NH1 1 
ATOM   779  N  NH2 . ARG B 1 25 ? 22.543  22.173 47.512  1.00 34.59  ? 166 ARG B NH2 1 
ATOM   780  N  N   . THR B 1 26 ? 21.592  21.145 55.562  1.00 10.40  ? 167 THR B N   1 
ATOM   781  C  CA  . THR B 1 26 ? 21.666  20.163 56.601  1.00 16.69  ? 167 THR B CA  1 
ATOM   782  C  C   . THR B 1 26 ? 20.452  19.238 56.579  1.00 14.80  ? 167 THR B C   1 
ATOM   783  O  O   . THR B 1 26 ? 19.392  19.608 56.069  1.00 15.07  ? 167 THR B O   1 
ATOM   784  C  CB  . THR B 1 26 ? 21.786  20.806 57.973  1.00 17.09  ? 167 THR B CB  1 
ATOM   785  O  OG1 . THR B 1 26 ? 22.175  19.794 58.886  1.00 21.16  ? 167 THR B OG1 1 
ATOM   786  C  CG2 . THR B 1 26 ? 20.463  21.456 58.425  1.00 14.17  ? 167 THR B CG2 1 
ATOM   787  N  N   . VAL B 1 27 ? 20.602  18.045 57.170  1.00 11.22  ? 168 VAL B N   1 
ATOM   788  C  CA  . VAL B 1 27 ? 19.462  17.148 57.304  1.00 14.24  ? 168 VAL B CA  1 
ATOM   789  C  C   . VAL B 1 27 ? 19.169  16.996 58.785  1.00 20.70  ? 168 VAL B C   1 
ATOM   790  O  O   . VAL B 1 27 ? 20.085  16.877 59.559  1.00 21.05  ? 168 VAL B O   1 
ATOM   791  C  CB  . VAL B 1 27 ? 19.746  15.730 56.738  1.00 22.58  ? 168 VAL B CB  1 
ATOM   792  C  CG1 . VAL B 1 27 ? 18.614  14.772 57.163  1.00 21.43  ? 168 VAL B CG1 1 
ATOM   793  C  CG2 . VAL B 1 27 ? 19.860  15.774 55.226  1.00 26.06  ? 168 VAL B CG2 1 
ATOM   794  N  N   . VAL B 1 28 ? 17.903  16.989 59.197  1.00 20.05  ? 169 VAL B N   1 
ATOM   795  C  CA  . VAL B 1 28 ? 17.653  16.782 60.615  1.00 12.46  ? 169 VAL B CA  1 
ATOM   796  C  C   . VAL B 1 28 ? 16.637  15.643 60.721  1.00 12.66  ? 169 VAL B C   1 
ATOM   797  O  O   . VAL B 1 28 ? 15.859  15.420 59.795  1.00 12.27  ? 169 VAL B O   1 
ATOM   798  C  CB  . VAL B 1 28 ? 17.102  18.063 61.340  1.00 18.08  ? 169 VAL B CB  1 
ATOM   799  C  CG1 . VAL B 1 28 ? 18.141  19.188 61.349  1.00 19.84  ? 169 VAL B CG1 1 
ATOM   800  C  CG2 . VAL B 1 28 ? 15.726  18.489 60.753  1.00 16.53  ? 169 VAL B CG2 1 
ATOM   801  N  N   . PRO B 1 29 ? 16.658  14.930 61.841  1.00 15.81  ? 170 PRO B N   1 
ATOM   802  C  CA  . PRO B 1 29 ? 15.709  13.848 62.104  1.00 20.65  ? 170 PRO B CA  1 
ATOM   803  C  C   . PRO B 1 29 ? 14.333  14.454 62.322  1.00 23.52  ? 170 PRO B C   1 
ATOM   804  O  O   . PRO B 1 29 ? 14.209  15.528 62.940  1.00 22.57  ? 170 PRO B O   1 
ATOM   805  C  CB  . PRO B 1 29 ? 16.251  13.222 63.398  1.00 24.82  ? 170 PRO B CB  1 
ATOM   806  C  CG  . PRO B 1 29 ? 17.101  14.230 63.996  1.00 24.04  ? 170 PRO B CG  1 
ATOM   807  C  CD  . PRO B 1 29 ? 17.716  14.986 62.861  1.00 18.68  ? 170 PRO B CD  1 
ATOM   808  N  N   . ALA B 1 30 ? 13.301  13.825 61.766  1.00 21.81  ? 171 ALA B N   1 
ATOM   809  C  CA  . ALA B 1 30 ? 11.982  14.402 61.946  1.00 25.84  ? 171 ALA B CA  1 
ATOM   810  C  C   . ALA B 1 30 ? 11.283  13.656 63.093  1.00 24.12  ? 171 ALA B C   1 
ATOM   811  O  O   . ALA B 1 30 ? 10.367  12.905 62.846  1.00 23.20  ? 171 ALA B O   1 
ATOM   812  C  CB  . ALA B 1 30 ? 11.163  14.336 60.632  1.00 20.24  ? 171 ALA B CB  1 
ATOM   813  N  N   . ARG B 1 31 ? 11.717  13.886 64.328  1.00 28.65  ? 172 ARG B N   1 
ATOM   814  C  CA  . ARG B 1 31 ? 11.265  13.054 65.452  1.00 35.22  ? 172 ARG B CA  1 
ATOM   815  C  C   . ARG B 1 31 ? 10.064  13.668 66.113  1.00 25.88  ? 172 ARG B C   1 
ATOM   816  O  O   . ARG B 1 31 ? 10.077  14.860 66.421  1.00 21.58  ? 172 ARG B O   1 
ATOM   817  C  CB  . ARG B 1 31 ? 12.385  12.903 66.489  1.00 43.99  ? 172 ARG B CB  1 
ATOM   818  C  CG  . ARG B 1 31 ? 13.765  12.931 65.881  1.00 54.55  ? 172 ARG B CG  1 
ATOM   819  C  CD  . ARG B 1 31 ? 14.833  12.633 66.917  1.00 62.60  ? 172 ARG B CD  1 
ATOM   820  N  NE  . ARG B 1 31 ? 14.689  13.514 68.064  1.00 65.60  ? 172 ARG B NE  1 
ATOM   821  C  CZ  . ARG B 1 31 ? 15.224  13.284 69.253  1.00 67.43  ? 172 ARG B CZ  1 
ATOM   822  N  NH1 . ARG B 1 31 ? 15.950  12.195 69.468  1.00 72.76  ? 172 ARG B NH1 1 
ATOM   823  N  NH2 . ARG B 1 31 ? 15.029  14.147 70.226  1.00 65.09  ? 172 ARG B NH2 1 
ATOM   824  N  N   . CYS B 1 32 ? 9.010   12.879 66.328  1.00 22.90  ? 173 CYS B N   1 
ATOM   825  C  CA  . CYS B 1 32 ? 7.818   13.399 66.980  1.00 21.31  ? 173 CYS B CA  1 
ATOM   826  C  C   . CYS B 1 32 ? 8.234   14.098 68.234  1.00 23.01  ? 173 CYS B C   1 
ATOM   827  O  O   . CYS B 1 32 ? 9.160   13.659 68.930  1.00 21.86  ? 173 CYS B O   1 
ATOM   828  C  CB  . CYS B 1 32 ? 6.845   12.275 67.383  1.00 32.23  ? 173 CYS B CB  1 
ATOM   829  S  SG  . CYS B 1 32 ? 6.045   11.549 66.017  1.00 42.52  ? 173 CYS B SG  1 
ATOM   830  N  N   . GLY B 1 33 ? 7.560   15.204 68.519  1.00 20.43  ? 174 GLY B N   1 
ATOM   831  C  CA  . GLY B 1 33 ? 7.780   15.903 69.765  1.00 19.88  ? 174 GLY B CA  1 
ATOM   832  C  C   . GLY B 1 33 ? 8.927   16.898 69.831  1.00 27.29  ? 174 GLY B C   1 
ATOM   833  O  O   . GLY B 1 33 ? 9.208   17.409 70.911  1.00 32.29  ? 174 GLY B O   1 
ATOM   834  N  N   . VAL B 1 34 ? 9.604   17.154 68.707  1.00 21.37  ? 175 VAL B N   1 
ATOM   835  C  CA  . VAL B 1 34 ? 10.762  18.049 68.699  1.00 17.53  ? 175 VAL B CA  1 
ATOM   836  C  C   . VAL B 1 34 ? 10.385  19.292 67.846  1.00 17.28  ? 175 VAL B C   1 
ATOM   837  O  O   . VAL B 1 34 ? 9.862   19.158 66.751  1.00 15.62  ? 175 VAL B O   1 
ATOM   838  C  CB  . VAL B 1 34 ? 12.035  17.327 68.150  1.00 24.54  ? 175 VAL B CB  1 
ATOM   839  C  CG1 . VAL B 1 34 ? 13.233  18.258 68.070  1.00 24.34  ? 175 VAL B CG1 1 
ATOM   840  C  CG2 . VAL B 1 34 ? 12.381  16.026 68.970  1.00 22.11  ? 175 VAL B CG2 1 
ATOM   841  N  N   . THR B 1 35 ? 10.669  20.490 68.339  1.00 18.58  ? 176 THR B N   1 
ATOM   842  C  CA  . THR B 1 35 ? 10.403  21.684 67.532  1.00 19.94  ? 176 THR B CA  1 
ATOM   843  C  C   . THR B 1 35 ? 11.394  21.845 66.397  1.00 17.38  ? 176 THR B C   1 
ATOM   844  O  O   . THR B 1 35 ? 12.518  21.330 66.446  1.00 20.36  ? 176 THR B O   1 
ATOM   845  C  CB  . THR B 1 35 ? 10.400  23.024 68.343  1.00 15.40  ? 176 THR B CB  1 
ATOM   846  O  OG1 . THR B 1 35 ? 11.710  23.261 68.915  1.00 15.55  ? 176 THR B OG1 1 
ATOM   847  C  CG2 . THR B 1 35 ? 9.332   23.011 69.444  1.00 19.26  ? 176 THR B CG2 1 
ATOM   848  N  N   . VAL B 1 36 ? 10.967  22.603 65.390  1.00 11.27  ? 177 VAL B N   1 
ATOM   849  C  CA  . VAL B 1 36 ? 11.852  23.048 64.347  1.00 11.91  ? 177 VAL B CA  1 
ATOM   850  C  C   . VAL B 1 36 ? 13.059  23.778 64.963  1.00 13.36  ? 177 VAL B C   1 
ATOM   851  O  O   . VAL B 1 36 ? 14.181  23.531 64.588  1.00 12.01  ? 177 VAL B O   1 
ATOM   852  C  CB  . VAL B 1 36 ? 11.059  23.900 63.309  1.00 5.26   ? 177 VAL B CB  1 
ATOM   853  C  CG1 . VAL B 1 36 ? 11.975  24.422 62.238  1.00 13.46  ? 177 VAL B CG1 1 
ATOM   854  C  CG2 . VAL B 1 36 ? 9.986   22.960 62.695  1.00 9.84   ? 177 VAL B CG2 1 
ATOM   855  N  N   . ARG B 1 37 ? 12.782  24.691 65.885  1.00 16.08  ? 178 ARG B N   1 
ATOM   856  C  CA  . ARG B 1 37 ? 13.807  25.463 66.589  1.00 17.93  ? 178 ARG B CA  1 
ATOM   857  C  C   . ARG B 1 37 ? 14.878  24.533 67.155  1.00 19.68  ? 178 ARG B C   1 
ATOM   858  O  O   . ARG B 1 37 ? 16.066  24.667 66.861  1.00 16.25  ? 178 ARG B O   1 
ATOM   859  C  CB  . ARG B 1 37 ? 13.147  26.216 67.745  1.00 20.79  ? 178 ARG B CB  1 
ATOM   860  C  CG  . ARG B 1 37 ? 14.041  27.210 68.487  1.00 28.97  ? 178 ARG B CG  1 
ATOM   861  C  CD  . ARG B 1 37 ? 13.420  27.619 69.840  1.00 28.77  ? 178 ARG B CD  1 
ATOM   862  N  NE  . ARG B 1 37 ? 12.091  28.168 69.686  1.00 27.14  ? 178 ARG B NE  1 
ATOM   863  C  CZ  . ARG B 1 37 ? 11.836  29.411 69.305  1.00 31.31  ? 178 ARG B CZ  1 
ATOM   864  N  NH1 . ARG B 1 37 ? 12.836  30.274 69.028  1.00 27.98  ? 178 ARG B NH1 1 
ATOM   865  N  NH2 . ARG B 1 37 ? 10.575  29.787 69.183  1.00 29.93  ? 178 ARG B NH2 1 
ATOM   866  N  N   . ASP B 1 38 ? 14.456  23.577 67.970  1.00 17.48  ? 179 ASP B N   1 
ATOM   867  C  CA  . ASP B 1 38 ? 15.407  22.648 68.558  1.00 21.74  ? 179 ASP B CA  1 
ATOM   868  C  C   . ASP B 1 38 ? 16.012  21.699 67.517  1.00 20.47  ? 179 ASP B C   1 
ATOM   869  O  O   . ASP B 1 38 ? 17.166  21.328 67.617  1.00 19.04  ? 179 ASP B O   1 
ATOM   870  C  CB  . ASP B 1 38 ? 14.729  21.857 69.686  1.00 31.12  ? 179 ASP B CB  1 
ATOM   871  C  CG  . ASP B 1 38 ? 14.317  22.742 70.857  1.00 33.22  ? 179 ASP B CG  1 
ATOM   872  O  OD1 . ASP B 1 38 ? 14.986  23.761 71.103  1.00 34.35  ? 179 ASP B OD1 1 
ATOM   873  O  OD2 . ASP B 1 38 ? 13.322  22.429 71.537  1.00 35.36  ? 179 ASP B OD2 1 
ATOM   874  N  N   . SER B 1 39 ? 15.273  21.315 66.490  1.00 18.35  ? 180 SER B N   1 
ATOM   875  C  CA  . SER B 1 39 ? 15.903  20.434 65.500  1.00 18.50  ? 180 SER B CA  1 
ATOM   876  C  C   . SER B 1 39 ? 17.076  21.159 64.845  1.00 18.66  ? 180 SER B C   1 
ATOM   877  O  O   . SER B 1 39 ? 18.032  20.531 64.418  1.00 17.91  ? 180 SER B O   1 
ATOM   878  C  CB  . SER B 1 39 ? 14.933  19.993 64.399  1.00 17.49  ? 180 SER B CB  1 
ATOM   879  O  OG  . SER B 1 39 ? 13.819  19.293 64.915  1.00 16.77  ? 180 SER B OG  1 
ATOM   880  N  N   . LEU B 1 40 ? 16.955  22.485 64.729  1.00 14.71  ? 181 LEU B N   1 
ATOM   881  C  CA  . LEU B 1 40 ? 17.893  23.257 63.939  1.00 12.25  ? 181 LEU B CA  1 
ATOM   882  C  C   . LEU B 1 40 ? 18.895  24.076 64.755  1.00 16.36  ? 181 LEU B C   1 
ATOM   883  O  O   . LEU B 1 40 ? 19.859  24.575 64.188  1.00 16.79  ? 181 LEU B O   1 
ATOM   884  C  CB  . LEU B 1 40 ? 17.123  24.202 62.989  1.00 15.07  ? 181 LEU B CB  1 
ATOM   885  C  CG  . LEU B 1 40 ? 16.619  23.548 61.693  1.00 17.85  ? 181 LEU B CG  1 
ATOM   886  C  CD1 . LEU B 1 40 ? 15.710  24.495 60.888  1.00 15.90  ? 181 LEU B CD1 1 
ATOM   887  C  CD2 . LEU B 1 40 ? 17.799  23.132 60.830  1.00 19.44  ? 181 LEU B CD2 1 
ATOM   888  N  N   . LYS B 1 41 ? 18.632  24.232 66.052  1.00 25.05  ? 182 LYS B N   1 
ATOM   889  C  CA  . LYS B 1 41 ? 19.537  24.936 66.986  1.00 26.68  ? 182 LYS B CA  1 
ATOM   890  C  C   . LYS B 1 41 ? 21.028  24.735 66.733  1.00 17.74  ? 182 LYS B C   1 
ATOM   891  O  O   . LYS B 1 41 ? 21.800  25.684 66.541  1.00 22.73  ? 182 LYS B O   1 
ATOM   892  C  CB  . LYS B 1 41 ? 19.233  24.501 68.418  1.00 34.08  ? 182 LYS B CB  1 
ATOM   893  C  CG  . LYS B 1 41 ? 19.850  25.439 69.437  1.00 47.21  ? 182 LYS B CG  1 
ATOM   894  C  CD  . LYS B 1 41 ? 19.469  25.116 70.864  1.00 54.92  ? 182 LYS B CD  1 
ATOM   895  C  CE  . LYS B 1 41 ? 20.015  26.228 71.774  1.00 61.65  ? 182 LYS B CE  1 
ATOM   896  N  NZ  . LYS B 1 41 ? 19.561  26.169 73.188  1.00 63.59  ? 182 LYS B NZ  1 
ATOM   897  N  N   . LYS B 1 42 ? 21.459  23.488 66.688  1.00 24.92  ? 183 LYS B N   1 
ATOM   898  C  CA  . LYS B 1 42 ? 22.877  23.222 66.524  1.00 23.94  ? 183 LYS B CA  1 
ATOM   899  C  C   . LYS B 1 42 ? 23.416  23.618 65.147  1.00 19.71  ? 183 LYS B C   1 
ATOM   900  O  O   . LYS B 1 42 ? 24.496  24.253 65.032  1.00 16.91  ? 183 LYS B O   1 
ATOM   901  C  CB  . LYS B 1 42 ? 23.148  21.745 66.833  1.00 29.87  ? 183 LYS B CB  1 
ATOM   902  C  CG  . LYS B 1 42 ? 24.621  21.389 66.951  1.00 35.37  ? 183 LYS B CG  1 
ATOM   903  C  CD  . LYS B 1 42 ? 24.814  20.015 67.586  1.00 44.79  ? 183 LYS B CD  1 
ATOM   904  C  CE  . LYS B 1 42 ? 24.999  18.921 66.529  1.00 48.92  ? 183 LYS B CE  1 
ATOM   905  N  NZ  . LYS B 1 42 ? 23.722  18.516 65.851  1.00 51.27  ? 183 LYS B NZ  1 
ATOM   906  N  N   . ALA B 1 43 ? 22.700  23.235 64.083  1.00 19.68  ? 184 ALA B N   1 
ATOM   907  C  CA  . ALA B 1 43 ? 23.129  23.675 62.764  1.00 21.70  ? 184 ALA B CA  1 
ATOM   908  C  C   . ALA B 1 43 ? 23.289  25.201 62.668  1.00 22.93  ? 184 ALA B C   1 
ATOM   909  O  O   . ALA B 1 43 ? 24.259  25.704 62.041  1.00 28.72  ? 184 ALA B O   1 
ATOM   910  C  CB  . ALA B 1 43 ? 22.224  23.157 61.661  1.00 21.67  ? 184 ALA B CB  1 
ATOM   911  N  N   . LEU B 1 44 ? 22.346  25.932 63.256  1.00 19.20  ? 185 LEU B N   1 
ATOM   912  C  CA  . LEU B 1 44 ? 22.396  27.394 63.205  1.00 21.56  ? 185 LEU B CA  1 
ATOM   913  C  C   . LEU B 1 44 ? 23.611  27.897 63.989  1.00 25.04  ? 185 LEU B C   1 
ATOM   914  O  O   . LEU B 1 44 ? 24.360  28.729 63.502  1.00 22.73  ? 185 LEU B O   1 
ATOM   915  C  CB  . LEU B 1 44 ? 21.093  28.039 63.716  1.00 23.23  ? 185 LEU B CB  1 
ATOM   916  C  CG  . LEU B 1 44 ? 19.884  27.902 62.761  1.00 23.53  ? 185 LEU B CG  1 
ATOM   917  C  CD1 . LEU B 1 44 ? 18.590  28.480 63.350  1.00 23.99  ? 185 LEU B CD1 1 
ATOM   918  C  CD2 . LEU B 1 44 ? 20.191  28.483 61.448  1.00 26.93  ? 185 LEU B CD2 1 
HETATM 919  N  N   A MSE B 1 45 ? 23.799  27.359 65.189  0.37 24.72  ? 186 MSE B N   1 
HETATM 920  N  N   B MSE B 1 45 ? 23.800  27.377 65.196  0.63 24.58  ? 186 MSE B N   1 
HETATM 921  C  CA  A MSE B 1 45 ? 24.902  27.764 66.053  0.37 25.56  ? 186 MSE B CA  1 
HETATM 922  C  CA  B MSE B 1 45 ? 24.916  27.800 66.038  0.63 25.36  ? 186 MSE B CA  1 
HETATM 923  C  C   A MSE B 1 45 ? 26.267  27.585 65.384  0.37 27.00  ? 186 MSE B C   1 
HETATM 924  C  C   B MSE B 1 45 ? 26.275  27.597 65.360  0.63 27.16  ? 186 MSE B C   1 
HETATM 925  O  O   A MSE B 1 45 ? 27.147  28.442 65.508  0.37 28.54  ? 186 MSE B O   1 
HETATM 926  O  O   B MSE B 1 45 ? 27.161  28.456 65.443  0.63 28.76  ? 186 MSE B O   1 
HETATM 927  C  CB  A MSE B 1 45 ? 24.859  27.002 67.373  0.37 25.97  ? 186 MSE B CB  1 
HETATM 928  C  CB  B MSE B 1 45 ? 24.882  27.092 67.386  0.63 26.67  ? 186 MSE B CB  1 
HETATM 929  C  CG  A MSE B 1 45 ? 25.878  27.490 68.390  0.37 31.04  ? 186 MSE B CG  1 
HETATM 930  C  CG  B MSE B 1 45 ? 26.129  27.348 68.237  0.63 33.15  ? 186 MSE B CG  1 
HETATM 931  SE SE  A MSE B 1 45 ? 25.193  28.937 69.499  0.37 66.58  ? 186 MSE B SE  1 
HETATM 932  SE SE  B MSE B 1 45 ? 26.185  26.056 69.690  0.63 62.67  ? 186 MSE B SE  1 
HETATM 933  C  CE  A MSE B 1 45 ? 25.260  30.417 68.215  0.37 38.74  ? 186 MSE B CE  1 
HETATM 934  C  CE  B MSE B 1 45 ? 26.025  24.425 68.590  0.63 42.15  ? 186 MSE B CE  1 
HETATM 935  N  N   . MSE B 1 46 ? 26.442  26.485 64.660  1.00 25.46  ? 187 MSE B N   1 
HETATM 936  C  CA  . MSE B 1 46 ? 27.664  26.268 63.923  1.00 25.23  ? 187 MSE B CA  1 
HETATM 937  C  C   . MSE B 1 46 ? 27.923  27.365 62.934  1.00 24.47  ? 187 MSE B C   1 
HETATM 938  O  O   . MSE B 1 46 ? 29.052  27.527 62.447  1.00 21.31  ? 187 MSE B O   1 
HETATM 939  C  CB  . MSE B 1 46 ? 27.615  24.980 63.155  1.00 25.98  ? 187 MSE B CB  1 
HETATM 940  C  CG  . MSE B 1 46 ? 28.344  23.896 63.885  1.00 38.75  ? 187 MSE B CG  1 
HETATM 941  SE SE  . MSE B 1 46 ? 27.605  22.207 63.343  1.00 96.68  ? 187 MSE B SE  1 
HETATM 942  C  CE  . MSE B 1 46 ? 27.331  22.547 61.436  1.00 23.62  ? 187 MSE B CE  1 
ATOM   943  N  N   . ARG B 1 47 ? 26.879  28.097 62.585  1.00 22.26  ? 188 ARG B N   1 
ATOM   944  C  CA  . ARG B 1 47 ? 27.058  29.133 61.586  1.00 26.92  ? 188 ARG B CA  1 
ATOM   945  C  C   . ARG B 1 47 ? 26.919  30.524 62.201  1.00 26.13  ? 188 ARG B C   1 
ATOM   946  O  O   . ARG B 1 47 ? 26.808  31.516 61.490  1.00 23.97  ? 188 ARG B O   1 
ATOM   947  C  CB  . ARG B 1 47 ? 26.108  28.930 60.403  1.00 29.88  ? 188 ARG B CB  1 
ATOM   948  C  CG  . ARG B 1 47 ? 26.463  27.712 59.552  1.00 27.83  ? 188 ARG B CG  1 
ATOM   949  C  CD  . ARG B 1 47 ? 25.263  27.076 58.925  1.00 28.47  ? 188 ARG B CD  1 
ATOM   950  N  NE  . ARG B 1 47 ? 25.608  25.994 58.003  1.00 30.19  ? 188 ARG B NE  1 
ATOM   951  C  CZ  . ARG B 1 47 ? 25.582  24.705 58.307  1.00 27.34  ? 188 ARG B CZ  1 
ATOM   952  N  NH1 . ARG B 1 47 ? 25.236  24.316 59.526  1.00 22.21  ? 188 ARG B NH1 1 
ATOM   953  N  NH2 . ARG B 1 47 ? 25.886  23.801 57.376  1.00 25.29  ? 188 ARG B NH2 1 
ATOM   954  N  N   . GLY B 1 48 ? 26.947  30.573 63.529  1.00 26.47  ? 189 GLY B N   1 
ATOM   955  C  CA  . GLY B 1 48 ? 26.794  31.823 64.261  1.00 27.08  ? 189 GLY B CA  1 
ATOM   956  C  C   . GLY B 1 48 ? 25.408  32.425 64.092  1.00 32.58  ? 189 GLY B C   1 
ATOM   957  O  O   . GLY B 1 48 ? 25.250  33.649 64.064  1.00 31.67  ? 189 GLY B O   1 
ATOM   958  N  N   . LEU B 1 49 ? 24.397  31.566 63.961  1.00 29.32  ? 190 LEU B N   1 
ATOM   959  C  CA  . LEU B 1 49 ? 23.025  32.044 63.859  1.00 30.70  ? 190 LEU B CA  1 
ATOM   960  C  C   . LEU B 1 49 ? 22.175  31.599 65.023  1.00 27.82  ? 190 LEU B C   1 
ATOM   961  O  O   . LEU B 1 49 ? 22.479  30.661 65.723  1.00 23.17  ? 190 LEU B O   1 
ATOM   962  C  CB  . LEU B 1 49 ? 22.354  31.515 62.599  1.00 28.78  ? 190 LEU B CB  1 
ATOM   963  C  CG  . LEU B 1 49 ? 22.992  31.884 61.286  1.00 30.30  ? 190 LEU B CG  1 
ATOM   964  C  CD1 . LEU B 1 49 ? 22.309  31.097 60.176  1.00 39.65  ? 190 LEU B CD1 1 
ATOM   965  C  CD2 . LEU B 1 49 ? 22.862  33.334 61.092  1.00 26.96  ? 190 LEU B CD2 1 
ATOM   966  N  N   . ILE B 1 50 ? 21.037  32.247 65.160  1.00 28.98  ? 191 ILE B N   1 
ATOM   967  C  CA  . ILE B 1 50 ? 20.170  31.930 66.248  1.00 31.04  ? 191 ILE B CA  1 
ATOM   968  C  C   . ILE B 1 50 ? 18.763  31.981 65.640  1.00 21.92  ? 191 ILE B C   1 
ATOM   969  O  O   . ILE B 1 50 ? 18.519  32.799 64.751  1.00 20.65  ? 191 ILE B O   1 
ATOM   970  C  CB  . ILE B 1 50 ? 20.464  32.948 67.383  1.00 46.27  ? 191 ILE B CB  1 
ATOM   971  C  CG1 . ILE B 1 50 ? 20.424  32.266 68.747  1.00 52.51  ? 191 ILE B CG1 1 
ATOM   972  C  CG2 . ILE B 1 50 ? 19.632  34.228 67.246  1.00 39.00  ? 191 ILE B CG2 1 
ATOM   973  C  CD1 . ILE B 1 50 ? 20.659  33.205 69.900  1.00 57.79  ? 191 ILE B CD1 1 
ATOM   974  N  N   . PRO B 1 51 ? 17.874  31.057 66.027  1.00 21.33  ? 192 PRO B N   1 
ATOM   975  C  CA  . PRO B 1 51 ? 16.549  30.988 65.386  1.00 22.07  ? 192 PRO B CA  1 
ATOM   976  C  C   . PRO B 1 51 ? 15.811  32.316 65.496  1.00 27.07  ? 192 PRO B C   1 
ATOM   977  O  O   . PRO B 1 51 ? 15.062  32.707 64.597  1.00 26.09  ? 192 PRO B O   1 
ATOM   978  C  CB  . PRO B 1 51 ? 15.818  29.898 66.185  1.00 18.87  ? 192 PRO B CB  1 
ATOM   979  C  CG  . PRO B 1 51 ? 16.887  29.070 66.772  1.00 24.62  ? 192 PRO B CG  1 
ATOM   980  C  CD  . PRO B 1 51 ? 18.075  29.985 67.013  1.00 19.95  ? 192 PRO B CD  1 
ATOM   981  N  N   . GLU B 1 52 ? 16.042  33.019 66.599  1.00 28.12  ? 193 GLU B N   1 
ATOM   982  C  CA  . GLU B 1 52 ? 15.362  34.278 66.840  1.00 30.91  ? 193 GLU B CA  1 
ATOM   983  C  C   . GLU B 1 52 ? 15.808  35.378 65.872  1.00 26.10  ? 193 GLU B C   1 
ATOM   984  O  O   . GLU B 1 52 ? 15.136  36.396 65.742  1.00 29.78  ? 193 GLU B O   1 
ATOM   985  C  CB  . GLU B 1 52 ? 15.543  34.717 68.300  1.00 40.36  ? 193 GLU B CB  1 
ATOM   986  C  CG  . GLU B 1 52 ? 15.127  33.649 69.320  1.00 46.30  ? 193 GLU B CG  1 
ATOM   987  C  CD  . GLU B 1 52 ? 16.090  32.464 69.358  1.00 48.02  ? 193 GLU B CD  1 
ATOM   988  O  OE1 . GLU B 1 52 ? 17.312  32.706 69.384  1.00 44.15  ? 193 GLU B OE1 1 
ATOM   989  O  OE2 . GLU B 1 52 ? 15.634  31.296 69.360  1.00 51.57  ? 193 GLU B OE2 1 
ATOM   990  N  N   . CYS B 1 53 ? 16.933  35.176 65.191  1.00 23.96  ? 194 CYS B N   1 
ATOM   991  C  CA  . CYS B 1 53 ? 17.397  36.164 64.215  1.00 24.60  ? 194 CYS B CA  1 
ATOM   992  C  C   . CYS B 1 53 ? 17.059  35.698 62.805  1.00 18.07  ? 194 CYS B C   1 
ATOM   993  O  O   . CYS B 1 53 ? 17.485  36.297 61.828  1.00 16.92  ? 194 CYS B O   1 
ATOM   994  C  CB  . CYS B 1 53 ? 18.908  36.464 64.371  1.00 29.94  ? 194 CYS B CB  1 
ATOM   995  S  SG  . CYS B 1 53 ? 20.132  35.204 63.758  1.00 55.03  ? 194 CYS B SG  1 
ATOM   996  N  N   . CYS B 1 54 ? 16.272  34.627 62.711  1.00 10.71  ? 195 CYS B N   1 
ATOM   997  C  CA  . CYS B 1 54 ? 15.984  34.023 61.410  1.00 12.34  ? 195 CYS B CA  1 
ATOM   998  C  C   . CYS B 1 54 ? 14.509  33.718 61.252  1.00 12.84  ? 195 CYS B C   1 
ATOM   999  O  O   . CYS B 1 54 ? 13.765  33.713 62.231  1.00 14.77  ? 195 CYS B O   1 
ATOM   1000 C  CB  . CYS B 1 54 ? 16.764  32.724 61.233  1.00 15.17  ? 195 CYS B CB  1 
ATOM   1001 S  SG  . CYS B 1 54 ? 18.538  32.824 61.424  1.00 18.26  ? 195 CYS B SG  1 
ATOM   1002 N  N   . ALA B 1 55 ? 14.105  33.457 60.007  1.00 13.60  ? 196 ALA B N   1 
ATOM   1003 C  CA  . ALA B 1 55 ? 12.771  32.957 59.691  1.00 12.10  ? 196 ALA B CA  1 
ATOM   1004 C  C   . ALA B 1 55 ? 12.869  31.575 59.044  1.00 9.61   ? 196 ALA B C   1 
ATOM   1005 O  O   . ALA B 1 55 ? 13.847  31.253 58.373  1.00 13.14  ? 196 ALA B O   1 
ATOM   1006 C  CB  . ALA B 1 55 ? 12.041  33.925 58.737  1.00 10.21  ? 196 ALA B CB  1 
ATOM   1007 N  N   . VAL B 1 56 ? 11.850  30.760 59.239  1.00 10.47  ? 197 VAL B N   1 
ATOM   1008 C  CA  . VAL B 1 56 ? 11.842  29.474 58.569  1.00 11.44  ? 197 VAL B CA  1 
ATOM   1009 C  C   . VAL B 1 56 ? 10.611  29.271 57.693  1.00 10.34  ? 197 VAL B C   1 
ATOM   1010 O  O   . VAL B 1 56 ? 9.490   29.680 58.012  1.00 9.20   ? 197 VAL B O   1 
ATOM   1011 C  CB  . VAL B 1 56 ? 12.072  28.318 59.593  1.00 12.53  ? 197 VAL B CB  1 
ATOM   1012 C  CG1 . VAL B 1 56 ? 11.104  28.466 60.766  1.00 14.40  ? 197 VAL B CG1 1 
ATOM   1013 C  CG2 . VAL B 1 56 ? 12.026  26.906 58.890  1.00 13.65  ? 197 VAL B CG2 1 
ATOM   1014 N  N   . TYR B 1 57 ? 10.839  28.635 56.550  1.00 15.41  ? 198 TYR B N   1 
ATOM   1015 C  CA  . TYR B 1 57 ? 9.763   28.394 55.596  1.00 15.41  ? 198 TYR B CA  1 
ATOM   1016 C  C   . TYR B 1 57 ? 9.734   26.961 55.100  1.00 24.02  ? 198 TYR B C   1 
ATOM   1017 O  O   . TYR B 1 57 ? 10.776  26.290 55.022  1.00 21.94  ? 198 TYR B O   1 
ATOM   1018 C  CB  . TYR B 1 57 ? 9.999   29.208 54.352  1.00 16.25  ? 198 TYR B CB  1 
ATOM   1019 C  CG  . TYR B 1 57 ? 10.198  30.631 54.584  1.00 19.54  ? 198 TYR B CG  1 
ATOM   1020 C  CD1 . TYR B 1 57 ? 9.126   31.478 54.608  1.00 20.64  ? 198 TYR B CD1 1 
ATOM   1021 C  CD2 . TYR B 1 57 ? 11.484  31.171 54.696  1.00 24.75  ? 198 TYR B CD2 1 
ATOM   1022 C  CE1 . TYR B 1 57 ? 9.277   32.788 54.823  1.00 23.84  ? 198 TYR B CE1 1 
ATOM   1023 C  CE2 . TYR B 1 57 ? 11.653  32.535 54.886  1.00 31.70  ? 198 TYR B CE2 1 
ATOM   1024 C  CZ  . TYR B 1 57 ? 10.539  33.334 54.941  1.00 27.39  ? 198 TYR B CZ  1 
ATOM   1025 O  OH  . TYR B 1 57 ? 10.649  34.685 55.112  1.00 33.73  ? 198 TYR B OH  1 
ATOM   1026 N  N   . ARG B 1 58 ? 8.552   26.511 54.694  1.00 20.18  ? 199 ARG B N   1 
ATOM   1027 C  CA  . ARG B 1 58 ? 8.474   25.211 54.027  1.00 25.81  ? 199 ARG B CA  1 
ATOM   1028 C  C   . ARG B 1 58 ? 8.261   25.499 52.564  1.00 27.31  ? 199 ARG B C   1 
ATOM   1029 O  O   . ARG B 1 58 ? 7.760   26.567 52.187  1.00 35.82  ? 199 ARG B O   1 
ATOM   1030 C  CB  . ARG B 1 58 ? 7.315   24.392 54.554  1.00 29.65  ? 199 ARG B CB  1 
ATOM   1031 C  CG  . ARG B 1 58 ? 6.057   24.810 53.884  1.00 42.55  ? 199 ARG B CG  1 
ATOM   1032 C  CD  . ARG B 1 58 ? 4.861   24.266 54.576  1.00 50.70  ? 199 ARG B CD  1 
ATOM   1033 N  NE  . ARG B 1 58 ? 4.755   22.823 54.463  1.00 50.81  ? 199 ARG B NE  1 
ATOM   1034 C  CZ  . ARG B 1 58 ? 3.637   22.171 54.736  1.00 47.71  ? 199 ARG B CZ  1 
ATOM   1035 N  NH1 . ARG B 1 58 ? 2.556   22.856 55.120  1.00 46.41  ? 199 ARG B NH1 1 
ATOM   1036 N  NH2 . ARG B 1 58 ? 3.597   20.855 54.622  1.00 41.79  ? 199 ARG B NH2 1 
ATOM   1037 N  N   . ILE B 1 59 ? 8.683   24.571 51.726  1.00 33.30  ? 200 ILE B N   1 
ATOM   1038 C  CA  . ILE B 1 59 ? 8.413   24.679 50.304  1.00 40.18  ? 200 ILE B CA  1 
ATOM   1039 C  C   . ILE B 1 59 ? 7.088   24.004 49.980  1.00 43.96  ? 200 ILE B C   1 
ATOM   1040 O  O   . ILE B 1 59 ? 6.871   22.842 50.347  1.00 40.84  ? 200 ILE B O   1 
ATOM   1041 C  CB  . ILE B 1 59 ? 9.513   24.067 49.457  1.00 45.09  ? 200 ILE B CB  1 
ATOM   1042 C  CG1 . ILE B 1 59 ? 10.842  24.755 49.748  1.00 45.17  ? 200 ILE B CG1 1 
ATOM   1043 C  CG2 . ILE B 1 59 ? 9.169   24.268 47.984  1.00 48.07  ? 200 ILE B CG2 1 
ATOM   1044 C  CD1 . ILE B 1 59 ? 10.845  26.246 49.324  1.00 58.48  ? 200 ILE B CD1 1 
ATOM   1045 N  N   . GLN B 1 60 ? 6.200   24.751 49.321  1.00 48.31  ? 201 GLN B N   1 
ATOM   1046 C  CA  . GLN B 1 60 ? 4.874   24.242 48.960  1.00 51.71  ? 201 GLN B CA  1 
ATOM   1047 C  C   . GLN B 1 60 ? 4.444   24.774 47.601  1.00 53.84  ? 201 GLN B C   1 
ATOM   1048 O  O   . GLN B 1 60 ? 4.200   25.965 47.449  1.00 54.70  ? 201 GLN B O   1 
ATOM   1049 C  CB  . GLN B 1 60 ? 3.834   24.630 50.009  1.00 52.65  ? 201 GLN B CB  1 
ATOM   1050 C  CG  . GLN B 1 60 ? 2.634   23.705 50.062  1.00 58.27  ? 201 GLN B CG  1 
ATOM   1051 C  CD  . GLN B 1 60 ? 2.956   22.361 50.697  1.00 61.63  ? 201 GLN B CD  1 
ATOM   1052 O  OE1 . GLN B 1 60 ? 4.078   22.130 51.161  1.00 64.37  ? 201 GLN B OE1 1 
ATOM   1053 N  NE2 . GLN B 1 60 ? 1.970   21.464 50.723  1.00 61.81  ? 201 GLN B NE2 1 
ATOM   1054 N  N   . GLU B 1 63 ? 5.498   29.671 46.798  1.00 54.04  ? 204 GLU B N   1 
ATOM   1055 C  CA  . GLU B 1 63 ? 6.248   28.443 47.034  1.00 55.93  ? 204 GLU B CA  1 
ATOM   1056 C  C   . GLU B 1 63 ? 6.998   28.433 48.378  1.00 52.55  ? 204 GLU B C   1 
ATOM   1057 O  O   . GLU B 1 63 ? 7.294   27.361 48.909  1.00 52.00  ? 204 GLU B O   1 
ATOM   1058 C  CB  . GLU B 1 63 ? 7.206   28.159 45.875  1.00 57.28  ? 204 GLU B CB  1 
ATOM   1059 N  N   . LYS B 1 64 ? 7.312   29.616 48.911  1.00 49.32  ? 205 LYS B N   1 
ATOM   1060 C  CA  . LYS B 1 64 ? 7.898   29.721 50.259  1.00 43.78  ? 205 LYS B CA  1 
ATOM   1061 C  C   . LYS B 1 64 ? 6.868   30.214 51.271  1.00 30.62  ? 205 LYS B C   1 
ATOM   1062 O  O   . LYS B 1 64 ? 6.385   31.341 51.200  1.00 36.99  ? 205 LYS B O   1 
ATOM   1063 C  CB  . LYS B 1 64 ? 9.137   30.601 50.267  1.00 46.13  ? 205 LYS B CB  1 
ATOM   1064 N  N   . LYS B 1 65 ? 6.518   29.343 52.200  1.00 24.50  ? 206 LYS B N   1 
ATOM   1065 C  CA  . LYS B 1 65 ? 5.428   29.605 53.142  1.00 19.83  ? 206 LYS B CA  1 
ATOM   1066 C  C   . LYS B 1 65 ? 6.016   29.511 54.521  1.00 12.99  ? 206 LYS B C   1 
ATOM   1067 O  O   . LYS B 1 65 ? 6.629   28.483 54.858  1.00 14.35  ? 206 LYS B O   1 
ATOM   1068 C  CB  . LYS B 1 65 ? 4.354   28.508 53.033  1.00 21.34  ? 206 LYS B CB  1 
ATOM   1069 C  CG  . LYS B 1 65 ? 3.775   28.321 51.641  1.00 28.22  ? 206 LYS B CG  1 
ATOM   1070 C  CD  . LYS B 1 65 ? 3.017   29.557 51.170  1.00 35.91  ? 206 LYS B CD  1 
ATOM   1071 C  CE  . LYS B 1 65 ? 2.269   29.229 49.885  1.00 45.84  ? 206 LYS B CE  1 
ATOM   1072 N  NZ  . LYS B 1 65 ? 1.733   30.432 49.209  1.00 53.23  ? 206 LYS B NZ  1 
ATOM   1073 N  N   . PRO B 1 66 ? 5.802   30.548 55.326  1.00 15.15  ? 207 PRO B N   1 
ATOM   1074 C  CA  . PRO B 1 66 ? 6.428   30.721 56.651  1.00 16.82  ? 207 PRO B CA  1 
ATOM   1075 C  C   . PRO B 1 66 ? 5.855   29.754 57.697  1.00 10.62  ? 207 PRO B C   1 
ATOM   1076 O  O   . PRO B 1 66 ? 4.657   29.560 57.827  1.00 9.09   ? 207 PRO B O   1 
ATOM   1077 C  CB  . PRO B 1 66 ? 6.075   32.185 57.027  1.00 9.64   ? 207 PRO B CB  1 
ATOM   1078 C  CG  . PRO B 1 66 ? 4.861   32.445 56.296  1.00 12.79  ? 207 PRO B CG  1 
ATOM   1079 C  CD  . PRO B 1 66 ? 4.953   31.711 54.975  1.00 16.11  ? 207 PRO B CD  1 
ATOM   1080 N  N   . ILE B 1 67 ? 6.740   29.129 58.447  1.00 11.86  ? 208 ILE B N   1 
ATOM   1081 C  CA  . ILE B 1 67 ? 6.250   28.320 59.515  1.00 19.88  ? 208 ILE B CA  1 
ATOM   1082 C  C   . ILE B 1 67 ? 6.830   28.807 60.809  1.00 11.79  ? 208 ILE B C   1 
ATOM   1083 O  O   . ILE B 1 67 ? 7.870   29.458 60.840  1.00 12.74  ? 208 ILE B O   1 
ATOM   1084 C  CB  . ILE B 1 67 ? 6.535   26.848 59.292  1.00 21.29  ? 208 ILE B CB  1 
ATOM   1085 C  CG1 . ILE B 1 67 ? 7.962   26.534 59.623  1.00 16.71  ? 208 ILE B CG1 1 
ATOM   1086 C  CG2 . ILE B 1 67 ? 6.289   26.470 57.808  1.00 27.93  ? 208 ILE B CG2 1 
ATOM   1087 C  CD1 . ILE B 1 67 ? 8.214   24.991 59.696  1.00 18.39  ? 208 ILE B CD1 1 
ATOM   1088 N  N   . GLY B 1 68 ? 6.122   28.454 61.867  1.00 11.80  ? 209 GLY B N   1 
ATOM   1089 C  CA  . GLY B 1 68 ? 6.488   28.860 63.199  1.00 15.63  ? 209 GLY B CA  1 
ATOM   1090 C  C   . GLY B 1 68 ? 7.659   28.041 63.673  1.00 14.16  ? 209 GLY B C   1 
ATOM   1091 O  O   . GLY B 1 68 ? 7.813   26.842 63.349  1.00 12.44  ? 209 GLY B O   1 
ATOM   1092 N  N   . TRP B 1 69 ? 8.526   28.699 64.431  1.00 15.51  ? 210 TRP B N   1 
ATOM   1093 C  CA  . TRP B 1 69 ? 9.691   28.016 65.012  1.00 17.96  ? 210 TRP B CA  1 
ATOM   1094 C  C   . TRP B 1 69 ? 9.274   26.893 65.981  1.00 16.34  ? 210 TRP B C   1 
ATOM   1095 O  O   . TRP B 1 69 ? 9.973   25.917 66.135  1.00 15.20  ? 210 TRP B O   1 
ATOM   1096 C  CB  . TRP B 1 69 ? 10.610  29.039 65.709  1.00 10.90  ? 210 TRP B CB  1 
ATOM   1097 C  CG  . TRP B 1 69 ? 11.575  29.717 64.730  1.00 16.06  ? 210 TRP B CG  1 
ATOM   1098 C  CD1 . TRP B 1 69 ? 11.593  31.067 64.366  1.00 15.33  ? 210 TRP B CD1 1 
ATOM   1099 C  CD2 . TRP B 1 69 ? 12.648  29.104 64.004  1.00 10.37  ? 210 TRP B CD2 1 
ATOM   1100 N  NE1 . TRP B 1 69 ? 12.603  31.300 63.458  1.00 17.30  ? 210 TRP B NE1 1 
ATOM   1101 C  CE2 . TRP B 1 69 ? 13.281  30.134 63.231  1.00 13.96  ? 210 TRP B CE2 1 
ATOM   1102 C  CE3 . TRP B 1 69 ? 13.168  27.797 63.945  1.00 13.90  ? 210 TRP B CE3 1 
ATOM   1103 C  CZ2 . TRP B 1 69 ? 14.385  29.884 62.412  1.00 12.24  ? 210 TRP B CZ2 1 
ATOM   1104 C  CZ3 . TRP B 1 69 ? 14.270  27.555 63.134  1.00 19.28  ? 210 TRP B CZ3 1 
ATOM   1105 C  CH2 . TRP B 1 69 ? 14.876  28.611 62.369  1.00 16.34  ? 210 TRP B CH2 1 
ATOM   1106 N  N   . ASP B 1 70 ? 8.109   27.010 66.600  1.00 13.25  ? 211 ASP B N   1 
ATOM   1107 C  CA  . ASP B 1 70 ? 7.716   25.998 67.583  1.00 18.57  ? 211 ASP B CA  1 
ATOM   1108 C  C   . ASP B 1 70 ? 6.882   24.849 67.016  1.00 20.88  ? 211 ASP B C   1 
ATOM   1109 O  O   . ASP B 1 70 ? 6.428   23.961 67.744  1.00 19.80  ? 211 ASP B O   1 
ATOM   1110 C  CB  . ASP B 1 70 ? 7.046   26.693 68.768  1.00 23.17  ? 211 ASP B CB  1 
ATOM   1111 C  CG  . ASP B 1 70 ? 8.021   27.632 69.484  1.00 31.89  ? 211 ASP B CG  1 
ATOM   1112 O  OD1 . ASP B 1 70 ? 9.168   27.193 69.750  1.00 35.30  ? 211 ASP B OD1 1 
ATOM   1113 O  OD2 . ASP B 1 70 ? 7.667   28.799 69.728  1.00 40.28  ? 211 ASP B OD2 1 
ATOM   1114 N  N   . THR B 1 71 ? 6.727   24.858 65.696  1.00 16.61  ? 212 THR B N   1 
ATOM   1115 C  CA  . THR B 1 71 ? 6.157   23.726 64.968  1.00 20.51  ? 212 THR B CA  1 
ATOM   1116 C  C   . THR B 1 71 ? 6.769   22.348 65.341  1.00 13.92  ? 212 THR B C   1 
ATOM   1117 O  O   . THR B 1 71 ? 7.977   22.178 65.385  1.00 13.74  ? 212 THR B O   1 
ATOM   1118 C  CB  . THR B 1 71 ? 6.375   23.903 63.457  1.00 11.21  ? 212 THR B CB  1 
ATOM   1119 O  OG1 . THR B 1 71 ? 5.820   25.158 63.032  1.00 19.58  ? 212 THR B OG1 1 
ATOM   1120 C  CG2 . THR B 1 71 ? 5.734   22.723 62.705  1.00 13.23  ? 212 THR B CG2 1 
ATOM   1121 N  N   . ASP B 1 72 ? 5.949   21.334 65.524  1.00 13.47  ? 213 ASP B N   1 
ATOM   1122 C  CA  . ASP B 1 72 ? 6.545   19.999 65.624  1.00 15.87  ? 213 ASP B CA  1 
ATOM   1123 C  C   . ASP B 1 72 ? 7.097   19.495 64.284  1.00 15.05  ? 213 ASP B C   1 
ATOM   1124 O  O   . ASP B 1 72 ? 6.353   19.382 63.313  1.00 16.62  ? 213 ASP B O   1 
ATOM   1125 C  CB  . ASP B 1 72 ? 5.538   18.992 66.181  1.00 19.60  ? 213 ASP B CB  1 
ATOM   1126 C  CG  . ASP B 1 72 ? 6.172   17.619 66.429  1.00 23.04  ? 213 ASP B CG  1 
ATOM   1127 O  OD1 . ASP B 1 72 ? 7.002   17.126 65.627  1.00 21.25  ? 213 ASP B OD1 1 
ATOM   1128 O  OD2 . ASP B 1 72 ? 5.821   17.019 67.444  1.00 36.47  ? 213 ASP B OD2 1 
ATOM   1129 N  N   . ILE B 1 73 ? 8.402   19.257 64.249  1.00 13.79  ? 214 ILE B N   1 
ATOM   1130 C  CA  . ILE B 1 73 ? 9.150   18.967 63.031  1.00 18.98  ? 214 ILE B CA  1 
ATOM   1131 C  C   . ILE B 1 73 ? 8.627   17.649 62.381  1.00 14.56  ? 214 ILE B C   1 
ATOM   1132 O  O   . ILE B 1 73 ? 8.747   17.448 61.178  1.00 12.75  ? 214 ILE B O   1 
ATOM   1133 C  CB  . ILE B 1 73 ? 10.685  18.868 63.337  1.00 18.22  ? 214 ILE B CB  1 
ATOM   1134 C  CG1 . ILE B 1 73 ? 11.510  18.487 62.107  1.00 24.71  ? 214 ILE B CG1 1 
ATOM   1135 C  CG2 . ILE B 1 73 ? 10.951  17.672 64.249  1.00 22.20  ? 214 ILE B CG2 1 
ATOM   1136 C  CD1 . ILE B 1 73 ? 12.131  19.586 61.337  1.00 14.79  ? 214 ILE B CD1 1 
ATOM   1137 N  N   . SER B 1 74 ? 8.057   16.751 63.195  1.00 16.34  ? 215 SER B N   1 
ATOM   1138 C  CA  . SER B 1 74 ? 7.615   15.431 62.668  1.00 19.36  ? 215 SER B CA  1 
ATOM   1139 C  C   . SER B 1 74 ? 6.459   15.585 61.640  1.00 13.55  ? 215 SER B C   1 
ATOM   1140 O  O   . SER B 1 74 ? 6.290   14.753 60.761  1.00 13.71  ? 215 SER B O   1 
ATOM   1141 C  CB  . SER B 1 74 ? 7.153   14.471 63.803  1.00 17.18  ? 215 SER B CB  1 
ATOM   1142 O  OG  . SER B 1 74 ? 6.045   15.061 64.486  1.00 25.28  ? 215 SER B OG  1 
ATOM   1143 N  N   . TRP B 1 75 ? 5.696   16.662 61.739  1.00 9.88   ? 216 TRP B N   1 
ATOM   1144 C  CA  . TRP B 1 75 ? 4.677   16.956 60.703  1.00 15.28  ? 216 TRP B CA  1 
ATOM   1145 C  C   . TRP B 1 75 ? 5.273   17.253 59.306  1.00 21.84  ? 216 TRP B C   1 
ATOM   1146 O  O   . TRP B 1 75 ? 4.577   17.157 58.279  1.00 21.38  ? 216 TRP B O   1 
ATOM   1147 C  CB  . TRP B 1 75 ? 3.740   18.102 61.143  1.00 19.95  ? 216 TRP B CB  1 
ATOM   1148 C  CG  . TRP B 1 75 ? 2.956   17.759 62.389  1.00 17.51  ? 216 TRP B CG  1 
ATOM   1149 C  CD1 . TRP B 1 75 ? 3.233   18.148 63.681  1.00 20.12  ? 216 TRP B CD1 1 
ATOM   1150 C  CD2 . TRP B 1 75 ? 1.778   16.941 62.464  1.00 13.53  ? 216 TRP B CD2 1 
ATOM   1151 N  NE1 . TRP B 1 75 ? 2.310   17.609 64.547  1.00 25.77  ? 216 TRP B NE1 1 
ATOM   1152 C  CE2 . TRP B 1 75 ? 1.420   16.846 63.832  1.00 21.39  ? 216 TRP B CE2 1 
ATOM   1153 C  CE3 . TRP B 1 75 ? 1.040   16.238 61.526  1.00 9.78   ? 216 TRP B CE3 1 
ATOM   1154 C  CZ2 . TRP B 1 75 ? 0.303   16.118 64.272  1.00 24.84  ? 216 TRP B CZ2 1 
ATOM   1155 C  CZ3 . TRP B 1 75 ? -0.071  15.507 61.967  1.00 20.99  ? 216 TRP B CZ3 1 
ATOM   1156 C  CH2 . TRP B 1 75 ? -0.422  15.447 63.324  1.00 23.87  ? 216 TRP B CH2 1 
ATOM   1157 N  N   . LEU B 1 76 ? 6.569   17.551 59.265  1.00 12.36  ? 217 LEU B N   1 
ATOM   1158 C  CA  . LEU B 1 76 ? 7.244   18.003 58.031  1.00 18.23  ? 217 LEU B CA  1 
ATOM   1159 C  C   . LEU B 1 76 ? 8.178   16.946 57.356  1.00 14.91  ? 217 LEU B C   1 
ATOM   1160 O  O   . LEU B 1 76 ? 8.930   17.259 56.400  1.00 15.62  ? 217 LEU B O   1 
ATOM   1161 C  CB  . LEU B 1 76 ? 8.014   19.312 58.321  1.00 18.82  ? 217 LEU B CB  1 
ATOM   1162 C  CG  . LEU B 1 76 ? 7.187   20.381 59.068  1.00 20.83  ? 217 LEU B CG  1 
ATOM   1163 C  CD1 . LEU B 1 76 ? 8.016   21.564 59.581  1.00 19.79  ? 217 LEU B CD1 1 
ATOM   1164 C  CD2 . LEU B 1 76 ? 6.030   20.898 58.238  1.00 21.50  ? 217 LEU B CD2 1 
ATOM   1165 N  N   . THR B 1 77 ? 8.144   15.722 57.864  1.00 18.99  ? 218 THR B N   1 
ATOM   1166 C  CA  . THR B 1 77 ? 8.926   14.601 57.304  1.00 18.73  ? 218 THR B CA  1 
ATOM   1167 C  C   . THR B 1 77 ? 8.787   14.560 55.808  1.00 26.97  ? 218 THR B C   1 
ATOM   1168 O  O   . THR B 1 77 ? 7.680   14.645 55.296  1.00 29.28  ? 218 THR B O   1 
ATOM   1169 C  CB  . THR B 1 77 ? 8.445   13.221 57.822  1.00 29.15  ? 218 THR B CB  1 
ATOM   1170 O  OG1 . THR B 1 77 ? 8.586   13.160 59.238  1.00 25.82  ? 218 THR B OG1 1 
ATOM   1171 C  CG2 . THR B 1 77 ? 9.267   12.091 57.170  1.00 33.79  ? 218 THR B CG2 1 
ATOM   1172 N  N   . GLY B 1 78 ? 9.909   14.429 55.106  1.00 26.01  ? 219 GLY B N   1 
ATOM   1173 C  CA  . GLY B 1 78 ? 9.908   14.442 53.658  1.00 28.66  ? 219 GLY B CA  1 
ATOM   1174 C  C   . GLY B 1 78 ? 9.931   15.830 53.021  1.00 27.62  ? 219 GLY B C   1 
ATOM   1175 O  O   . GLY B 1 78 ? 10.138  15.977 51.817  1.00 31.51  ? 219 GLY B O   1 
ATOM   1176 N  N   . GLU B 1 79 ? 9.719   16.865 53.813  1.00 20.69  ? 220 GLU B N   1 
ATOM   1177 C  CA  . GLU B 1 79 ? 9.660   18.218 53.249  1.00 20.44  ? 220 GLU B CA  1 
ATOM   1178 C  C   . GLU B 1 79 ? 11.038  18.913 53.245  1.00 16.69  ? 220 GLU B C   1 
ATOM   1179 O  O   . GLU B 1 79 ? 11.994  18.431 53.845  1.00 23.86  ? 220 GLU B O   1 
ATOM   1180 C  CB  . GLU B 1 79 ? 8.633   19.062 54.003  1.00 28.26  ? 220 GLU B CB  1 
ATOM   1181 C  CG  . GLU B 1 79 ? 7.153   18.728 53.705  1.00 38.48  ? 220 GLU B CG  1 
ATOM   1182 C  CD  . GLU B 1 79 ? 6.502   19.693 52.688  1.00 52.22  ? 220 GLU B CD  1 
ATOM   1183 O  OE1 . GLU B 1 79 ? 6.857   20.898 52.697  1.00 54.69  ? 220 GLU B OE1 1 
ATOM   1184 O  OE2 . GLU B 1 79 ? 5.639   19.250 51.882  1.00 57.10  ? 220 GLU B OE2 1 
ATOM   1185 N  N   . GLU B 1 80 ? 11.143  20.002 52.506  1.00 16.24  ? 221 GLU B N   1 
ATOM   1186 C  CA  . GLU B 1 80 ? 12.326  20.855 52.477  1.00 16.35  ? 221 GLU B CA  1 
ATOM   1187 C  C   . GLU B 1 80 ? 11.959  22.150 53.172  1.00 16.97  ? 221 GLU B C   1 
ATOM   1188 O  O   . GLU B 1 80 ? 10.938  22.762 52.849  1.00 22.22  ? 221 GLU B O   1 
ATOM   1189 C  CB  . GLU B 1 80 ? 12.750  21.196 51.057  1.00 20.67  ? 221 GLU B CB  1 
ATOM   1190 C  CG  . GLU B 1 80 ? 13.380  20.018 50.360  1.00 35.03  ? 221 GLU B CG  1 
ATOM   1191 C  CD  . GLU B 1 80 ? 13.568  20.195 48.869  1.00 40.74  ? 221 GLU B CD  1 
ATOM   1192 O  OE1 . GLU B 1 80 ? 13.121  21.217 48.314  1.00 41.59  ? 221 GLU B OE1 1 
ATOM   1193 O  OE2 . GLU B 1 80 ? 14.180  19.291 48.256  1.00 49.93  ? 221 GLU B OE2 1 
ATOM   1194 N  N   . LEU B 1 81 ? 12.779  22.538 54.138  1.00 11.38  ? 222 LEU B N   1 
ATOM   1195 C  CA  . LEU B 1 81 ? 12.637  23.828 54.804  1.00 12.50  ? 222 LEU B CA  1 
ATOM   1196 C  C   . LEU B 1 81 ? 13.751  24.755 54.360  1.00 13.44  ? 222 LEU B C   1 
ATOM   1197 O  O   . LEU B 1 81 ? 14.789  24.291 53.917  1.00 13.65  ? 222 LEU B O   1 
ATOM   1198 C  CB  . LEU B 1 81 ? 12.732  23.637 56.322  1.00 14.57  ? 222 LEU B CB  1 
ATOM   1199 C  CG  . LEU B 1 81 ? 11.668  22.724 56.886  1.00 17.34  ? 222 LEU B CG  1 
ATOM   1200 C  CD1 . LEU B 1 81 ? 11.824  22.507 58.383  1.00 15.63  ? 222 LEU B CD1 1 
ATOM   1201 C  CD2 . LEU B 1 81 ? 10.298  23.264 56.509  1.00 15.29  ? 222 LEU B CD2 1 
ATOM   1202 N  N   . HIS B 1 82 ? 13.523  26.058 54.468  1.00 8.71   ? 223 HIS B N   1 
ATOM   1203 C  CA  . HIS B 1 82 ? 14.548  27.036 54.173  1.00 10.95  ? 223 HIS B CA  1 
ATOM   1204 C  C   . HIS B 1 82 ? 14.634  27.992 55.338  1.00 10.46  ? 223 HIS B C   1 
ATOM   1205 O  O   . HIS B 1 82 ? 13.621  28.442 55.824  1.00 13.43  ? 223 HIS B O   1 
ATOM   1206 C  CB  . HIS B 1 82 ? 14.125  27.805 52.932  1.00 17.81  ? 223 HIS B CB  1 
ATOM   1207 C  CG  . HIS B 1 82 ? 14.242  27.030 51.668  1.00 28.39  ? 223 HIS B CG  1 
ATOM   1208 N  ND1 . HIS B 1 82 ? 13.447  25.933 51.386  1.00 33.72  ? 223 HIS B ND1 1 
ATOM   1209 C  CD2 . HIS B 1 82 ? 15.040  27.209 50.591  1.00 26.93  ? 223 HIS B CD2 1 
ATOM   1210 C  CE1 . HIS B 1 82 ? 13.764  25.467 50.192  1.00 24.44  ? 223 HIS B CE1 1 
ATOM   1211 N  NE2 . HIS B 1 82 ? 14.729  26.221 49.693  1.00 24.91  ? 223 HIS B NE2 1 
ATOM   1212 N  N   . VAL B 1 83 ? 15.838  28.363 55.734  1.00 9.46   ? 224 VAL B N   1 
ATOM   1213 C  CA  . VAL B 1 83 ? 16.035  29.280 56.856  1.00 8.63   ? 224 VAL B CA  1 
ATOM   1214 C  C   . VAL B 1 83 ? 16.718  30.509 56.259  1.00 13.74  ? 224 VAL B C   1 
ATOM   1215 O  O   . VAL B 1 83 ? 17.745  30.385 55.559  1.00 12.07  ? 224 VAL B O   1 
ATOM   1216 C  CB  . VAL B 1 83 ? 16.987  28.692 57.946  1.00 15.87  ? 224 VAL B CB  1 
ATOM   1217 C  CG1 . VAL B 1 83 ? 17.334  29.775 59.021  1.00 14.16  ? 224 VAL B CG1 1 
ATOM   1218 C  CG2 . VAL B 1 83 ? 16.350  27.435 58.629  1.00 10.92  ? 224 VAL B CG2 1 
ATOM   1219 N  N   . GLU B 1 84 ? 16.141  31.666 56.550  1.00 14.44  ? 225 GLU B N   1 
ATOM   1220 C  CA  . GLU B 1 84 ? 16.664  32.978 56.119  1.00 18.12  ? 225 GLU B CA  1 
ATOM   1221 C  C   . GLU B 1 84 ? 16.925  33.846 57.331  1.00 14.09  ? 225 GLU B C   1 
ATOM   1222 O  O   . GLU B 1 84 ? 16.233  33.774 58.325  1.00 9.94   ? 225 GLU B O   1 
ATOM   1223 C  CB  . GLU B 1 84 ? 15.648  33.695 55.210  1.00 18.46  ? 225 GLU B CB  1 
ATOM   1224 C  CG  . GLU B 1 84 ? 15.725  33.229 53.808  1.00 33.70  ? 225 GLU B CG  1 
ATOM   1225 C  CD  . GLU B 1 84 ? 14.692  33.888 52.907  1.00 45.90  ? 225 GLU B CD  1 
ATOM   1226 O  OE1 . GLU B 1 84 ? 14.024  34.858 53.342  1.00 46.04  ? 225 GLU B OE1 1 
ATOM   1227 O  OE2 . GLU B 1 84 ? 14.559  33.421 51.756  1.00 50.86  ? 225 GLU B OE2 1 
ATOM   1228 N  N   . VAL B 1 85 ? 17.942  34.681 57.233  1.00 15.78  ? 226 VAL B N   1 
ATOM   1229 C  CA  . VAL B 1 85 ? 18.259  35.567 58.319  1.00 12.50  ? 226 VAL B CA  1 
ATOM   1230 C  C   . VAL B 1 85 ? 17.221  36.721 58.232  1.00 12.57  ? 226 VAL B C   1 
ATOM   1231 O  O   . VAL B 1 85 ? 16.857  37.133 57.141  1.00 10.63  ? 226 VAL B O   1 
ATOM   1232 C  CB  . VAL B 1 85 ? 19.715  36.012 58.153  1.00 14.63  ? 226 VAL B CB  1 
ATOM   1233 C  CG1 . VAL B 1 85 ? 20.121  37.089 59.146  1.00 18.41  ? 226 VAL B CG1 1 
ATOM   1234 C  CG2 . VAL B 1 85 ? 20.687  34.735 58.236  1.00 18.83  ? 226 VAL B CG2 1 
ATOM   1235 N  N   . LEU B 1 86 ? 16.707  37.185 59.372  1.00 10.02  ? 227 LEU B N   1 
ATOM   1236 C  CA  . LEU B 1 86 ? 15.774  38.324 59.341  1.00 14.82  ? 227 LEU B CA  1 
ATOM   1237 C  C   . LEU B 1 86 ? 16.465  39.624 58.781  1.00 16.91  ? 227 LEU B C   1 
ATOM   1238 O  O   . LEU B 1 86 ? 17.676  39.790 58.867  1.00 13.98  ? 227 LEU B O   1 
ATOM   1239 C  CB  . LEU B 1 86 ? 15.228  38.617 60.740  1.00 17.49  ? 227 LEU B CB  1 
ATOM   1240 C  CG  . LEU B 1 86 ? 14.277  37.590 61.372  1.00 16.54  ? 227 LEU B CG  1 
ATOM   1241 C  CD1 . LEU B 1 86 ? 13.978  37.952 62.830  1.00 20.90  ? 227 LEU B CD1 1 
ATOM   1242 C  CD2 . LEU B 1 86 ? 12.996  37.393 60.557  1.00 11.33  ? 227 LEU B CD2 1 
ATOM   1243 N  N   . GLU B 1 87 ? 15.673  40.539 58.242  1.00 11.82  ? 228 GLU B N   1 
ATOM   1244 C  CA  . GLU B 1 87 ? 16.191  41.871 57.857  1.00 15.59  ? 228 GLU B CA  1 
ATOM   1245 C  C   . GLU B 1 87 ? 16.839  42.530 59.052  1.00 14.80  ? 228 GLU B C   1 
ATOM   1246 O  O   . GLU B 1 87 ? 16.374  42.410 60.171  1.00 11.11  ? 228 GLU B O   1 
ATOM   1247 C  CB  . GLU B 1 87 ? 15.078  42.770 57.336  1.00 19.96  ? 228 GLU B CB  1 
ATOM   1248 C  CG  . GLU B 1 87 ? 14.533  42.322 56.005  1.00 32.08  ? 228 GLU B CG  1 
ATOM   1249 C  CD  . GLU B 1 87 ? 15.591  42.413 54.929  1.00 39.02  ? 228 GLU B CD  1 
ATOM   1250 O  OE1 . GLU B 1 87 ? 15.791  43.539 54.404  1.00 43.50  ? 228 GLU B OE1 1 
ATOM   1251 O  OE2 . GLU B 1 87 ? 16.218  41.365 54.640  1.00 31.34  ? 228 GLU B OE2 1 
ATOM   1252 N  N   . ASN B 1 88 ? 17.922  43.237 58.789  1.00 14.66  ? 229 ASN B N   1 
ATOM   1253 C  CA  . ASN B 1 88 ? 18.735  43.841 59.825  1.00 14.83  ? 229 ASN B CA  1 
ATOM   1254 C  C   . ASN B 1 88 ? 18.106  45.230 60.093  1.00 19.77  ? 229 ASN B C   1 
ATOM   1255 O  O   . ASN B 1 88 ? 18.386  46.209 59.375  1.00 18.40  ? 229 ASN B O   1 
ATOM   1256 C  CB  . ASN B 1 88 ? 20.170  43.974 59.277  1.00 22.14  ? 229 ASN B CB  1 
ATOM   1257 C  CG  . ASN B 1 88 ? 21.200  44.315 60.352  1.00 24.31  ? 229 ASN B CG  1 
ATOM   1258 O  OD1 . ASN B 1 88 ? 20.829  44.649 61.449  1.00 22.65  ? 229 ASN B OD1 1 
ATOM   1259 N  ND2 . ASN B 1 88 ? 22.510  44.210 60.023  1.00 29.20  ? 229 ASN B ND2 1 
ATOM   1260 N  N   . VAL B 1 89 ? 17.185  45.276 61.054  1.00 13.82  ? 230 VAL B N   1 
ATOM   1261 C  CA  . VAL B 1 89 ? 16.462  46.518 61.392  1.00 15.28  ? 230 VAL B CA  1 
ATOM   1262 C  C   . VAL B 1 89 ? 16.390  46.580 62.896  1.00 16.86  ? 230 VAL B C   1 
ATOM   1263 O  O   . VAL B 1 89 ? 15.984  45.623 63.540  1.00 14.49  ? 230 VAL B O   1 
ATOM   1264 C  CB  . VAL B 1 89 ? 15.036  46.554 60.845  1.00 18.41  ? 230 VAL B CB  1 
ATOM   1265 C  CG1 . VAL B 1 89 ? 14.356  47.978 61.037  1.00 14.04  ? 230 VAL B CG1 1 
ATOM   1266 C  CG2 . VAL B 1 89 ? 15.004  46.119 59.405  1.00 22.82  ? 230 VAL B CG2 1 
ATOM   1267 N  N   . PRO B 1 90 ? 16.784  47.718 63.479  1.00 17.90  ? 231 PRO B N   1 
ATOM   1268 C  CA  . PRO B 1 90 ? 16.859  47.743 64.952  1.00 20.19  ? 231 PRO B CA  1 
ATOM   1269 C  C   . PRO B 1 90 ? 15.555  47.361 65.674  1.00 17.85  ? 231 PRO B C   1 
ATOM   1270 O  O   . PRO B 1 90 ? 14.454  47.658 65.211  1.00 14.01  ? 231 PRO B O   1 
ATOM   1271 C  CB  . PRO B 1 90 ? 17.168  49.205 65.241  1.00 21.18  ? 231 PRO B CB  1 
ATOM   1272 C  CG  . PRO B 1 90 ? 17.839  49.691 63.944  1.00 25.63  ? 231 PRO B CG  1 
ATOM   1273 C  CD  . PRO B 1 90 ? 17.049  49.035 62.880  1.00 17.57  ? 231 PRO B CD  1 
ATOM   1274 N  N   . LEU B 1 91 ? 15.697  46.747 66.839  1.00 19.44  ? 232 LEU B N   1 
ATOM   1275 C  CA  . LEU B 1 91 ? 14.568  46.576 67.738  1.00 23.74  ? 232 LEU B CA  1 
ATOM   1276 C  C   . LEU B 1 91 ? 14.248  47.883 68.536  1.00 18.79  ? 232 LEU B C   1 
ATOM   1277 O  O   . LEU B 1 91 ? 15.068  48.821 68.582  1.00 19.58  ? 232 LEU B O   1 
ATOM   1278 C  CB  . LEU B 1 91 ? 14.880  45.419 68.662  1.00 24.87  ? 232 LEU B CB  1 
ATOM   1279 C  CG  . LEU B 1 91 ? 15.215  44.088 67.955  1.00 30.84  ? 232 LEU B CG  1 
ATOM   1280 C  CD1 . LEU B 1 91 ? 15.565  43.031 68.997  1.00 31.03  ? 232 LEU B CD1 1 
ATOM   1281 C  CD2 . LEU B 1 91 ? 14.085  43.564 67.084  1.00 29.29  ? 232 LEU B CD2 1 
ATOM   1282 N  N   . THR B 1 92 ? 13.085  47.953 69.182  1.00 19.08  ? 233 THR B N   1 
ATOM   1283 C  CA  . THR B 1 92 ? 12.764  49.152 69.962  1.00 21.40  ? 233 THR B CA  1 
ATOM   1284 C  C   . THR B 1 92 ? 13.725  49.345 71.145  1.00 23.45  ? 233 THR B C   1 
ATOM   1285 O  O   . THR B 1 92 ? 13.944  50.461 71.604  1.00 28.79  ? 233 THR B O   1 
ATOM   1286 C  CB  . THR B 1 92 ? 11.304  49.172 70.484  1.00 23.15  ? 233 THR B CB  1 
ATOM   1287 O  OG1 . THR B 1 92 ? 11.105  48.050 71.340  1.00 26.51  ? 233 THR B OG1 1 
ATOM   1288 C  CG2 . THR B 1 92 ? 10.289  49.127 69.315  1.00 15.26  ? 233 THR B CG2 1 
ATOM   1289 N  N   . THR B 1 93 ? 14.286  48.244 71.612  1.00 31.80  ? 234 THR B N   1 
ATOM   1290 C  CA  . THR B 1 93 ? 15.180  48.238 72.759  1.00 40.09  ? 234 THR B CA  1 
ATOM   1291 C  C   . THR B 1 93 ? 16.603  48.637 72.373  1.00 45.05  ? 234 THR B C   1 
ATOM   1292 O  O   . THR B 1 93 ? 17.436  48.895 73.235  1.00 49.65  ? 234 THR B O   1 
ATOM   1293 C  CB  . THR B 1 93 ? 15.156  46.860 73.498  1.00 33.54  ? 234 THR B CB  1 
ATOM   1294 O  OG1 . THR B 1 93 ? 15.193  45.783 72.546  1.00 33.16  ? 234 THR B OG1 1 
ATOM   1295 C  CG2 . THR B 1 93 ? 13.895  46.722 74.323  1.00 34.75  ? 234 THR B CG2 1 
ATOM   1296 N  N   . HIS B 1 94 ? 16.884  48.710 71.080  1.00 45.27  ? 235 HIS B N   1 
ATOM   1297 C  CA  . HIS B 1 94 ? 18.187  49.192 70.648  1.00 48.73  ? 235 HIS B CA  1 
ATOM   1298 C  C   . HIS B 1 94 ? 18.282  50.706 70.865  1.00 58.90  ? 235 HIS B C   1 
ATOM   1299 O  O   . HIS B 1 94 ? 19.323  51.201 71.296  1.00 66.64  ? 235 HIS B O   1 
ATOM   1300 C  CB  . HIS B 1 94 ? 18.473  48.802 69.191  1.00 47.07  ? 235 HIS B CB  1 
ATOM   1301 C  CG  . HIS B 1 94 ? 18.641  47.326 68.984  1.00 47.04  ? 235 HIS B CG  1 
ATOM   1302 N  ND1 . HIS B 1 94 ? 18.549  46.729 67.742  1.00 41.79  ? 235 HIS B ND1 1 
ATOM   1303 C  CD2 . HIS B 1 94 ? 18.873  46.323 69.866  1.00 48.00  ? 235 HIS B CD2 1 
ATOM   1304 C  CE1 . HIS B 1 94 ? 18.732  45.427 67.870  1.00 42.58  ? 235 HIS B CE1 1 
ATOM   1305 N  NE2 . HIS B 1 94 ? 18.930  45.153 69.148  1.00 44.47  ? 235 HIS B NE2 1 
HETATM 1306 N  N   . MSE C 1 11 ? 7.324   44.080 88.529  1.00 73.05  ? 152 MSE C N   1 
HETATM 1307 C  CA  . MSE C 1 11 ? 7.184   44.734 87.229  1.00 70.95  ? 152 MSE C CA  1 
HETATM 1308 C  C   . MSE C 1 11 ? 6.910   43.737 86.113  1.00 71.07  ? 152 MSE C C   1 
HETATM 1309 O  O   . MSE C 1 11 ? 5.812   43.184 86.009  1.00 71.20  ? 152 MSE C O   1 
HETATM 1310 C  CB  . MSE C 1 11 ? 8.430   45.558 86.885  1.00 67.07  ? 152 MSE C CB  1 
HETATM 1311 C  CG  . MSE C 1 11 ? 8.588   46.806 87.726  1.00 70.69  ? 152 MSE C CG  1 
HETATM 1312 SE SE  . MSE C 1 11 ? 7.656   48.389 86.996  1.00 69.87  ? 152 MSE C SE  1 
HETATM 1313 C  CE  . MSE C 1 11 ? 6.940   49.192 88.652  1.00 37.66  ? 152 MSE C CE  1 
ATOM   1314 N  N   . GLN C 1 12 ? 7.922   43.528 85.276  1.00 69.88  ? 153 GLN C N   1 
ATOM   1315 C  CA  . GLN C 1 12 ? 7.803   42.689 84.082  1.00 68.38  ? 153 GLN C CA  1 
ATOM   1316 C  C   . GLN C 1 12 ? 6.874   43.284 83.004  1.00 64.67  ? 153 GLN C C   1 
ATOM   1317 O  O   . GLN C 1 12 ? 6.908   42.875 81.837  1.00 70.04  ? 153 GLN C O   1 
ATOM   1318 C  CB  . GLN C 1 12 ? 7.458   41.246 84.444  1.00 69.13  ? 153 GLN C CB  1 
ATOM   1319 C  CG  . GLN C 1 12 ? 8.641   40.504 85.055  1.00 69.84  ? 153 GLN C CG  1 
ATOM   1320 C  CD  . GLN C 1 12 ? 8.502   39.011 84.936  1.00 70.90  ? 153 GLN C CD  1 
ATOM   1321 O  OE1 . GLN C 1 12 ? 7.392   38.487 84.988  1.00 73.59  ? 153 GLN C OE1 1 
ATOM   1322 N  NE2 . GLN C 1 12 ? 9.626   38.310 84.764  1.00 68.27  ? 153 GLN C NE2 1 
ATOM   1323 N  N   . LYS C 1 13 ? 6.049   44.246 83.406  1.00 50.91  ? 154 LYS C N   1 
ATOM   1324 C  CA  . LYS C 1 13 ? 5.567   45.260 82.487  1.00 38.39  ? 154 LYS C CA  1 
ATOM   1325 C  C   . LYS C 1 13 ? 6.149   46.572 83.026  1.00 32.51  ? 154 LYS C C   1 
ATOM   1326 O  O   . LYS C 1 13 ? 5.852   46.977 84.145  1.00 24.91  ? 154 LYS C O   1 
ATOM   1327 C  CB  . LYS C 1 13 ? 4.051   45.334 82.471  1.00 45.82  ? 154 LYS C CB  1 
ATOM   1328 C  CG  . LYS C 1 13 ? 3.363   44.488 81.424  1.00 49.43  ? 154 LYS C CG  1 
ATOM   1329 C  CD  . LYS C 1 13 ? 1.846   44.477 81.658  1.00 54.73  ? 154 LYS C CD  1 
ATOM   1330 C  CE  . LYS C 1 13 ? 1.103   43.730 80.545  1.00 57.10  ? 154 LYS C CE  1 
ATOM   1331 N  NZ  . LYS C 1 13 ? -0.385  43.729 80.698  1.00 55.64  ? 154 LYS C NZ  1 
ATOM   1332 N  N   . PRO C 1 14 ? 7.000   47.229 82.238  1.00 29.84  ? 155 PRO C N   1 
ATOM   1333 C  CA  . PRO C 1 14 ? 7.591   48.483 82.744  1.00 20.66  ? 155 PRO C CA  1 
ATOM   1334 C  C   . PRO C 1 14 ? 6.529   49.602 82.757  1.00 19.68  ? 155 PRO C C   1 
ATOM   1335 O  O   . PRO C 1 14 ? 5.944   49.893 81.703  1.00 17.93  ? 155 PRO C O   1 
ATOM   1336 C  CB  . PRO C 1 14 ? 8.662   48.774 81.721  1.00 20.55  ? 155 PRO C CB  1 
ATOM   1337 C  CG  . PRO C 1 14 ? 8.144   48.203 80.427  1.00 27.74  ? 155 PRO C CG  1 
ATOM   1338 C  CD  . PRO C 1 14 ? 7.221   47.045 80.787  1.00 25.60  ? 155 PRO C CD  1 
ATOM   1339 N  N   . ILE C 1 15 ? 6.275   50.181 83.930  1.00 22.67  ? 156 ILE C N   1 
ATOM   1340 C  CA  . ILE C 1 15 ? 5.350   51.344 84.074  1.00 21.06  ? 156 ILE C CA  1 
ATOM   1341 C  C   . ILE C 1 15 ? 5.884   52.535 84.917  1.00 25.11  ? 156 ILE C C   1 
ATOM   1342 O  O   . ILE C 1 15 ? 6.857   52.413 85.657  1.00 25.94  ? 156 ILE C O   1 
ATOM   1343 C  CB  . ILE C 1 15 ? 3.949   50.894 84.637  1.00 32.16  ? 156 ILE C CB  1 
ATOM   1344 C  CG1 . ILE C 1 15 ? 4.083   50.206 86.002  1.00 32.52  ? 156 ILE C CG1 1 
ATOM   1345 C  CG2 . ILE C 1 15 ? 3.260   49.949 83.658  1.00 28.53  ? 156 ILE C CG2 1 
ATOM   1346 C  CD1 . ILE C 1 15 ? 3.691   51.070 87.183  1.00 38.11  ? 156 ILE C CD1 1 
ATOM   1347 N  N   . VAL C 1 16 ? 5.233   53.689 84.802  1.00 18.09  ? 157 VAL C N   1 
ATOM   1348 C  CA  . VAL C 1 16 ? 5.596   54.869 85.583  1.00 19.12  ? 157 VAL C CA  1 
ATOM   1349 C  C   . VAL C 1 16 ? 4.292   55.398 86.157  1.00 17.20  ? 157 VAL C C   1 
ATOM   1350 O  O   . VAL C 1 16 ? 3.276   55.450 85.441  1.00 20.69  ? 157 VAL C O   1 
ATOM   1351 C  CB  . VAL C 1 16 ? 6.265   55.958 84.655  1.00 26.87  ? 157 VAL C CB  1 
ATOM   1352 C  CG1 . VAL C 1 16 ? 6.226   57.364 85.276  1.00 24.64  ? 157 VAL C CG1 1 
ATOM   1353 C  CG2 . VAL C 1 16 ? 7.706   55.551 84.311  1.00 25.87  ? 157 VAL C CG2 1 
ATOM   1354 N  N   . ARG C 1 17 ? 4.308   55.751 87.439  1.00 17.00  ? 158 ARG C N   1 
ATOM   1355 C  CA  . ARG C 1 17 ? 3.171   56.432 88.104  1.00 24.82  ? 158 ARG C CA  1 
ATOM   1356 C  C   . ARG C 1 17 ? 3.276   57.952 87.964  1.00 24.55  ? 158 ARG C C   1 
ATOM   1357 O  O   . ARG C 1 17 ? 4.304   58.559 88.294  1.00 27.87  ? 158 ARG C O   1 
ATOM   1358 C  CB  . ARG C 1 17 ? 3.084   56.047 89.590  1.00 22.44  ? 158 ARG C CB  1 
ATOM   1359 C  CG  . ARG C 1 17 ? 3.069   54.552 89.788  1.00 29.43  ? 158 ARG C CG  1 
ATOM   1360 C  CD  . ARG C 1 17 ? 3.002   54.221 91.283  1.00 39.69  ? 158 ARG C CD  1 
ATOM   1361 N  NE  . ARG C 1 17 ? 4.187   54.699 91.979  1.00 42.65  ? 158 ARG C NE  1 
ATOM   1362 C  CZ  . ARG C 1 17 ? 5.393   54.176 91.792  1.00 54.66  ? 158 ARG C CZ  1 
ATOM   1363 N  NH1 . ARG C 1 17 ? 5.548   53.167 90.937  1.00 55.56  ? 158 ARG C NH1 1 
ATOM   1364 N  NH2 . ARG C 1 17 ? 6.444   54.662 92.445  1.00 60.07  ? 158 ARG C NH2 1 
ATOM   1365 N  N   . VAL C 1 18 ? 2.205   58.561 87.469  1.00 24.36  ? 159 VAL C N   1 
ATOM   1366 C  CA  . VAL C 1 18 ? 2.243   59.961 87.107  1.00 21.64  ? 159 VAL C CA  1 
ATOM   1367 C  C   . VAL C 1 18 ? 1.180   60.731 87.859  1.00 21.14  ? 159 VAL C C   1 
ATOM   1368 O  O   . VAL C 1 18 ? -0.013  60.466 87.706  1.00 24.65  ? 159 VAL C O   1 
ATOM   1369 C  CB  . VAL C 1 18 ? 2.021   60.180 85.605  1.00 21.89  ? 159 VAL C CB  1 
ATOM   1370 C  CG1 . VAL C 1 18 ? 2.143   61.730 85.239  1.00 18.73  ? 159 VAL C CG1 1 
ATOM   1371 C  CG2 . VAL C 1 18 ? 3.037   59.361 84.790  1.00 20.20  ? 159 VAL C CG2 1 
ATOM   1372 N  N   . PHE C 1 19 ? 1.623   61.683 88.677  1.00 21.94  ? 160 PHE C N   1 
ATOM   1373 C  CA  . PHE C 1 19 ? 0.706   62.575 89.387  1.00 27.09  ? 160 PHE C CA  1 
ATOM   1374 C  C   . PHE C 1 19 ? 0.375   63.771 88.526  1.00 28.58  ? 160 PHE C C   1 
ATOM   1375 O  O   . PHE C 1 19 ? 1.258   64.387 87.921  1.00 29.26  ? 160 PHE C O   1 
ATOM   1376 C  CB  . PHE C 1 19 ? 1.277   62.993 90.749  1.00 25.67  ? 160 PHE C CB  1 
ATOM   1377 C  CG  . PHE C 1 19 ? 1.361   61.864 91.712  1.00 30.78  ? 160 PHE C CG  1 
ATOM   1378 C  CD1 . PHE C 1 19 ? 2.489   61.048 91.760  1.00 33.95  ? 160 PHE C CD1 1 
ATOM   1379 C  CD2 . PHE C 1 19 ? 0.286   61.557 92.535  1.00 33.53  ? 160 PHE C CD2 1 
ATOM   1380 C  CE1 . PHE C 1 19 ? 2.547   59.987 92.646  1.00 37.89  ? 160 PHE C CE1 1 
ATOM   1381 C  CE2 . PHE C 1 19 ? 0.344   60.484 93.420  1.00 34.37  ? 160 PHE C CE2 1 
ATOM   1382 C  CZ  . PHE C 1 19 ? 1.463   59.706 93.475  1.00 33.59  ? 160 PHE C CZ  1 
ATOM   1383 N  N   . LEU C 1 20 ? -0.911  64.082 88.448  1.00 27.62  ? 161 LEU C N   1 
ATOM   1384 C  CA  . LEU C 1 20 ? -1.379  65.109 87.553  1.00 26.71  ? 161 LEU C CA  1 
ATOM   1385 C  C   . LEU C 1 20 ? -1.994  66.258 88.337  1.00 31.39  ? 161 LEU C C   1 
ATOM   1386 O  O   . LEU C 1 20 ? -2.233  66.157 89.535  1.00 32.11  ? 161 LEU C O   1 
ATOM   1387 C  CB  . LEU C 1 20 ? -2.393  64.530 86.566  1.00 23.32  ? 161 LEU C CB  1 
ATOM   1388 C  CG  . LEU C 1 20 ? -1.795  63.384 85.737  1.00 25.54  ? 161 LEU C CG  1 
ATOM   1389 C  CD1 . LEU C 1 20 ? -2.915  62.587 85.072  1.00 22.74  ? 161 LEU C CD1 1 
ATOM   1390 C  CD2 . LEU C 1 20 ? -0.809  63.974 84.727  1.00 25.81  ? 161 LEU C CD2 1 
ATOM   1391 N  N   . PRO C 1 21 ? -2.234  67.367 87.654  1.00 33.78  ? 162 PRO C N   1 
ATOM   1392 C  CA  . PRO C 1 21 ? -2.904  68.514 88.281  1.00 38.46  ? 162 PRO C CA  1 
ATOM   1393 C  C   . PRO C 1 21 ? -4.277  68.150 88.881  1.00 38.85  ? 162 PRO C C   1 
ATOM   1394 O  O   . PRO C 1 21 ? -4.951  67.214 88.421  1.00 35.19  ? 162 PRO C O   1 
ATOM   1395 C  CB  . PRO C 1 21 ? -3.069  69.495 87.123  1.00 42.24  ? 162 PRO C CB  1 
ATOM   1396 C  CG  . PRO C 1 21 ? -2.069  69.049 86.096  1.00 40.64  ? 162 PRO C CG  1 
ATOM   1397 C  CD  . PRO C 1 21 ? -1.970  67.577 86.224  1.00 34.89  ? 162 PRO C CD  1 
ATOM   1398 N  N   . ASN C 1 22 ? -4.669  68.879 89.925  1.00 38.95  ? 163 ASN C N   1 
ATOM   1399 C  CA  . ASN C 1 22 ? -5.971  68.689 90.555  1.00 44.90  ? 163 ASN C CA  1 
ATOM   1400 C  C   . ASN C 1 22 ? -6.095  67.362 91.260  1.00 41.05  ? 163 ASN C C   1 
ATOM   1401 O  O   . ASN C 1 22 ? -7.128  66.724 91.180  1.00 38.85  ? 163 ASN C O   1 
ATOM   1402 C  CB  . ASN C 1 22 ? -7.101  68.830 89.544  1.00 46.85  ? 163 ASN C CB  1 
ATOM   1403 C  CG  . ASN C 1 22 ? -7.369  70.267 89.197  1.00 61.56  ? 163 ASN C CG  1 
ATOM   1404 O  OD1 . ASN C 1 22 ? -8.469  70.627 88.764  1.00 70.13  ? 163 ASN C OD1 1 
ATOM   1405 N  ND2 . ASN C 1 22 ? -6.362  71.117 89.403  1.00 63.31  ? 163 ASN C ND2 1 
ATOM   1406 N  N   . LYS C 1 23 ? -5.028  66.962 91.943  1.00 41.98  ? 164 LYS C N   1 
ATOM   1407 C  CA  . LYS C 1 23 ? -5.040  65.739 92.726  1.00 39.44  ? 164 LYS C CA  1 
ATOM   1408 C  C   . LYS C 1 23 ? -5.376  64.547 91.834  1.00 31.29  ? 164 LYS C C   1 
ATOM   1409 O  O   . LYS C 1 23 ? -5.931  63.572 92.295  1.00 34.67  ? 164 LYS C O   1 
ATOM   1410 C  CB  . LYS C 1 23 ? -6.083  65.851 93.842  1.00 44.58  ? 164 LYS C CB  1 
ATOM   1411 C  CG  . LYS C 1 23 ? -5.768  66.900 94.882  1.00 56.98  ? 164 LYS C CG  1 
ATOM   1412 C  CD  . LYS C 1 23 ? -4.681  66.412 95.815  1.00 65.10  ? 164 LYS C CD  1 
ATOM   1413 C  CE  . LYS C 1 23 ? -4.487  67.356 96.989  1.00 71.18  ? 164 LYS C CE  1 
ATOM   1414 N  NZ  . LYS C 1 23 ? -3.398  66.871 97.887  1.00 74.03  ? 164 LYS C NZ  1 
ATOM   1415 N  N   . GLN C 1 24 ? -5.090  64.635 90.545  1.00 26.57  ? 165 GLN C N   1 
ATOM   1416 C  CA  . GLN C 1 24 ? -5.362  63.481 89.684  1.00 31.52  ? 165 GLN C CA  1 
ATOM   1417 C  C   . GLN C 1 24 ? -4.110  62.615 89.412  1.00 27.34  ? 165 GLN C C   1 
ATOM   1418 O  O   . GLN C 1 24 ? -2.983  62.946 89.848  1.00 24.32  ? 165 GLN C O   1 
ATOM   1419 C  CB  . GLN C 1 24 ? -6.038  63.904 88.400  1.00 28.76  ? 165 GLN C CB  1 
ATOM   1420 C  CG  . GLN C 1 24 ? -7.539  64.206 88.632  1.00 30.80  ? 165 GLN C CG  1 
ATOM   1421 C  CD  . GLN C 1 24 ? -8.293  64.498 87.375  1.00 34.99  ? 165 GLN C CD  1 
ATOM   1422 O  OE1 . GLN C 1 24 ? -7.984  63.965 86.318  1.00 39.08  ? 165 GLN C OE1 1 
ATOM   1423 N  NE2 . GLN C 1 24 ? -9.315  65.351 87.480  1.00 38.41  ? 165 GLN C NE2 1 
ATOM   1424 N  N   . ARG C 1 25 ? -4.315  61.508 88.708  1.00 26.00  ? 166 ARG C N   1 
ATOM   1425 C  CA  . ARG C 1 25 ? -3.195  60.614 88.442  1.00 23.71  ? 166 ARG C CA  1 
ATOM   1426 C  C   . ARG C 1 25 ? -3.456  59.546 87.370  1.00 24.11  ? 166 ARG C C   1 
ATOM   1427 O  O   . ARG C 1 25 ? -4.595  59.327 86.961  1.00 28.43  ? 166 ARG C O   1 
ATOM   1428 C  CB  . ARG C 1 25 ? -2.771  59.976 89.741  1.00 22.78  ? 166 ARG C CB  1 
ATOM   1429 C  CG  . ARG C 1 25 ? -3.958  59.542 90.539  1.00 30.60  ? 166 ARG C CG  1 
ATOM   1430 C  CD  . ARG C 1 25 ? -3.494  58.821 91.767  1.00 40.78  ? 166 ARG C CD  1 
ATOM   1431 N  NE  . ARG C 1 25 ? -3.469  59.702 92.927  1.00 44.37  ? 166 ARG C NE  1 
ATOM   1432 C  CZ  . ARG C 1 25 ? -3.370  59.238 94.162  1.00 47.79  ? 166 ARG C CZ  1 
ATOM   1433 N  NH1 . ARG C 1 25 ? -3.313  57.926 94.355  1.00 47.12  ? 166 ARG C NH1 1 
ATOM   1434 N  NH2 . ARG C 1 25 ? -3.337  60.072 95.189  1.00 50.55  ? 166 ARG C NH2 1 
ATOM   1435 N  N   . THR C 1 26 ? -2.374  58.905 86.914  1.00 18.71  ? 167 THR C N   1 
ATOM   1436 C  CA  . THR C 1 26 ? -2.490  57.848 85.925  1.00 21.91  ? 167 THR C CA  1 
ATOM   1437 C  C   . THR C 1 26 ? -1.213  57.003 85.970  1.00 23.17  ? 167 THR C C   1 
ATOM   1438 O  O   . THR C 1 26 ? -0.191  57.394 86.573  1.00 22.62  ? 167 THR C O   1 
ATOM   1439 C  CB  . THR C 1 26 ? -2.697  58.448 84.527  1.00 25.38  ? 167 THR C CB  1 
ATOM   1440 O  OG1 . THR C 1 26 ? -2.948  57.408 83.589  1.00 33.54  ? 167 THR C OG1 1 
ATOM   1441 C  CG2 . THR C 1 26 ? -1.422  59.242 84.068  1.00 20.04  ? 167 THR C CG2 1 
ATOM   1442 N  N   . VAL C 1 27 ? -1.304  55.828 85.366  1.00 18.04  ? 168 VAL C N   1 
ATOM   1443 C  CA  . VAL C 1 27 ? -0.190  54.936 85.227  1.00 22.83  ? 168 VAL C CA  1 
ATOM   1444 C  C   . VAL C 1 27 ? 0.050   54.765 83.716  1.00 24.15  ? 168 VAL C C   1 
ATOM   1445 O  O   . VAL C 1 27 ? -0.880  54.549 82.945  1.00 27.64  ? 168 VAL C O   1 
ATOM   1446 C  CB  . VAL C 1 27 ? -0.495  53.562 85.873  1.00 24.27  ? 168 VAL C CB  1 
ATOM   1447 C  CG1 . VAL C 1 27 ? 0.686   52.623 85.667  1.00 22.71  ? 168 VAL C CG1 1 
ATOM   1448 C  CG2 . VAL C 1 27 ? -0.767  53.727 87.360  1.00 25.34  ? 168 VAL C CG2 1 
ATOM   1449 N  N   . VAL C 1 28 ? 1.290   54.884 83.277  1.00 21.39  ? 169 VAL C N   1 
ATOM   1450 C  CA  . VAL C 1 28 ? 1.539   54.739 81.862  1.00 22.23  ? 169 VAL C CA  1 
ATOM   1451 C  C   . VAL C 1 28 ? 2.596   53.667 81.625  1.00 22.14  ? 169 VAL C C   1 
ATOM   1452 O  O   . VAL C 1 28 ? 3.464   53.430 82.478  1.00 21.04  ? 169 VAL C O   1 
ATOM   1453 C  CB  . VAL C 1 28 ? 1.984   56.064 81.236  1.00 25.01  ? 169 VAL C CB  1 
ATOM   1454 C  CG1 . VAL C 1 28 ? 0.892   57.107 81.419  1.00 28.60  ? 169 VAL C CG1 1 
ATOM   1455 C  CG2 . VAL C 1 28 ? 3.308   56.530 81.863  1.00 24.33  ? 169 VAL C CG2 1 
ATOM   1456 N  N   . PRO C 1 29 ? 2.507   53.000 80.475  1.00 25.68  ? 170 PRO C N   1 
ATOM   1457 C  CA  . PRO C 1 29 ? 3.617   52.114 80.070  1.00 25.67  ? 170 PRO C CA  1 
ATOM   1458 C  C   . PRO C 1 29 ? 4.890   52.926 79.817  1.00 27.63  ? 170 PRO C C   1 
ATOM   1459 O  O   . PRO C 1 29 ? 4.829   54.058 79.282  1.00 26.73  ? 170 PRO C O   1 
ATOM   1460 C  CB  . PRO C 1 29 ? 3.135   51.475 78.767  1.00 20.82  ? 170 PRO C CB  1 
ATOM   1461 C  CG  . PRO C 1 29 ? 1.687   51.819 78.632  1.00 27.47  ? 170 PRO C CG  1 
ATOM   1462 C  CD  . PRO C 1 29 ? 1.385   53.016 79.516  1.00 28.11  ? 170 PRO C CD  1 
ATOM   1463 N  N   . ALA C 1 30 ? 6.025   52.336 80.205  1.00 26.03  ? 171 ALA C N   1 
ATOM   1464 C  CA  . ALA C 1 30 ? 7.327   52.957 80.070  1.00 32.45  ? 171 ALA C CA  1 
ATOM   1465 C  C   . ALA C 1 30 ? 8.164   52.140 79.094  1.00 27.75  ? 171 ALA C C   1 
ATOM   1466 O  O   . ALA C 1 30 ? 8.925   51.263 79.492  1.00 31.03  ? 171 ALA C O   1 
ATOM   1467 C  CB  . ALA C 1 30 ? 8.008   53.025 81.427  1.00 28.78  ? 171 ALA C CB  1 
ATOM   1468 N  N   . ARG C 1 31 ? 8.039   52.429 77.806  1.00 24.48  ? 172 ARG C N   1 
ATOM   1469 C  CA  . ARG C 1 31 ? 8.664   51.535 76.849  1.00 25.41  ? 172 ARG C CA  1 
ATOM   1470 C  C   . ARG C 1 31 ? 9.826   52.202 76.181  1.00 25.68  ? 172 ARG C C   1 
ATOM   1471 O  O   . ARG C 1 31 ? 9.848   53.421 75.994  1.00 30.35  ? 172 ARG C O   1 
ATOM   1472 C  CB  . ARG C 1 31 ? 7.650   50.983 75.845  1.00 32.98  ? 172 ARG C CB  1 
ATOM   1473 C  CG  . ARG C 1 31 ? 6.907   52.027 75.093  1.00 43.35  ? 172 ARG C CG  1 
ATOM   1474 C  CD  . ARG C 1 31 ? 5.520   52.274 75.666  1.00 56.55  ? 172 ARG C CD  1 
ATOM   1475 N  NE  . ARG C 1 31 ? 4.805   53.301 74.898  1.00 65.45  ? 172 ARG C NE  1 
ATOM   1476 C  CZ  . ARG C 1 31 ? 3.597   53.767 75.203  1.00 73.46  ? 172 ARG C CZ  1 
ATOM   1477 N  NH1 . ARG C 1 31 ? 2.947   53.294 76.258  1.00 79.05  ? 172 ARG C NH1 1 
ATOM   1478 N  NH2 . ARG C 1 31 ? 3.035   54.707 74.454  1.00 75.54  ? 172 ARG C NH2 1 
ATOM   1479 N  N   . CYS C 1 32 ? 10.813  51.398 75.823  1.00 23.74  ? 173 CYS C N   1 
ATOM   1480 C  CA  . CYS C 1 32 ? 12.052  51.938 75.312  1.00 23.17  ? 173 CYS C CA  1 
ATOM   1481 C  C   . CYS C 1 32 ? 11.834  52.720 74.051  1.00 20.05  ? 173 CYS C C   1 
ATOM   1482 O  O   . CYS C 1 32 ? 11.127  52.276 73.127  1.00 23.17  ? 173 CYS C O   1 
ATOM   1483 C  CB  . CYS C 1 32 ? 13.050  50.801 75.023  1.00 29.11  ? 173 CYS C CB  1 
ATOM   1484 S  SG  . CYS C 1 32 ? 13.423  49.804 76.460  1.00 32.03  ? 173 CYS C SG  1 
ATOM   1485 N  N   . GLY C 1 33 ? 12.463  53.870 73.986  1.00 18.14  ? 174 GLY C N   1 
ATOM   1486 C  CA  . GLY C 1 33 ? 12.412  54.658 72.764  1.00 23.83  ? 174 GLY C CA  1 
ATOM   1487 C  C   . GLY C 1 33 ? 11.190  55.535 72.664  1.00 26.31  ? 174 GLY C C   1 
ATOM   1488 O  O   . GLY C 1 33 ? 11.015  56.253 71.680  1.00 30.60  ? 174 GLY C O   1 
ATOM   1489 N  N   . VAL C 1 34 ? 10.328  55.484 73.670  1.00 25.84  ? 175 VAL C N   1 
ATOM   1490 C  CA  . VAL C 1 34 ? 9.164   56.380 73.686  1.00 27.56  ? 175 VAL C CA  1 
ATOM   1491 C  C   . VAL C 1 34 ? 9.387   57.600 74.605  1.00 26.44  ? 175 VAL C C   1 
ATOM   1492 O  O   . VAL C 1 34 ? 9.775   57.441 75.775  1.00 21.98  ? 175 VAL C O   1 
ATOM   1493 C  CB  . VAL C 1 34 ? 7.890   55.611 74.114  1.00 24.83  ? 175 VAL C CB  1 
ATOM   1494 C  CG1 . VAL C 1 34 ? 6.703   56.547 74.157  1.00 23.94  ? 175 VAL C CG1 1 
ATOM   1495 C  CG2 . VAL C 1 34 ? 7.620   54.395 73.181  1.00 20.11  ? 175 VAL C CG2 1 
ATOM   1496 N  N   . THR C 1 35 ? 9.161   58.810 74.095  1.00 22.26  ? 176 THR C N   1 
ATOM   1497 C  CA  . THR C 1 35 ? 9.366   60.005 74.933  1.00 22.42  ? 176 THR C CA  1 
ATOM   1498 C  C   . THR C 1 35 ? 8.282   60.162 76.032  1.00 17.02  ? 176 THR C C   1 
ATOM   1499 O  O   . THR C 1 35 ? 7.198   59.576 75.965  1.00 22.23  ? 176 THR C O   1 
ATOM   1500 C  CB  . THR C 1 35 ? 9.405   61.298 74.138  1.00 17.62  ? 176 THR C CB  1 
ATOM   1501 O  OG1 . THR C 1 35 ? 8.130   61.467 73.523  1.00 23.07  ? 176 THR C OG1 1 
ATOM   1502 C  CG2 . THR C 1 35 ? 10.510  61.288 73.062  1.00 22.33  ? 176 THR C CG2 1 
ATOM   1503 N  N   . VAL C 1 36 ? 8.620   60.922 77.071  1.00 18.10  ? 177 VAL C N   1 
ATOM   1504 C  CA  . VAL C 1 36 ? 7.732   61.125 78.198  1.00 13.64  ? 177 VAL C CA  1 
ATOM   1505 C  C   . VAL C 1 36 ? 6.502   61.854 77.659  1.00 18.63  ? 177 VAL C C   1 
ATOM   1506 O  O   . VAL C 1 36 ? 5.349   61.556 78.000  1.00 14.71  ? 177 VAL C O   1 
ATOM   1507 C  CB  . VAL C 1 36 ? 8.490   61.978 79.277  1.00 14.84  ? 177 VAL C CB  1 
ATOM   1508 C  CG1 . VAL C 1 36 ? 7.536   62.678 80.242  1.00 20.51  ? 177 VAL C CG1 1 
ATOM   1509 C  CG2 . VAL C 1 36 ? 9.457   61.078 80.010  1.00 10.09  ? 177 VAL C CG2 1 
ATOM   1510 N  N   . ARG C 1 37 ? 6.794   62.815 76.792  1.00 18.69  ? 178 ARG C N   1 
ATOM   1511 C  CA  . ARG C 1 37 ? 5.792   63.601 76.099  1.00 23.49  ? 178 ARG C CA  1 
ATOM   1512 C  C   . ARG C 1 37 ? 4.816   62.702 75.376  1.00 24.82  ? 178 ARG C C   1 
ATOM   1513 O  O   . ARG C 1 37 ? 3.604   62.849 75.549  1.00 26.60  ? 178 ARG C O   1 
ATOM   1514 C  CB  . ARG C 1 37 ? 6.477   64.524 75.069  1.00 29.54  ? 178 ARG C CB  1 
ATOM   1515 C  CG  . ARG C 1 37 ? 5.536   65.495 74.406  1.00 34.25  ? 178 ARG C CG  1 
ATOM   1516 C  CD  . ARG C 1 37 ? 6.110   66.034 73.113  1.00 37.05  ? 178 ARG C CD  1 
ATOM   1517 N  NE  . ARG C 1 37 ? 7.376   66.726 73.306  1.00 42.26  ? 178 ARG C NE  1 
ATOM   1518 C  CZ  . ARG C 1 37 ? 7.487   67.950 73.805  1.00 43.60  ? 178 ARG C CZ  1 
ATOM   1519 N  NH1 . ARG C 1 37 ? 6.400   68.631 74.182  1.00 43.86  ? 178 ARG C NH1 1 
ATOM   1520 N  NH2 . ARG C 1 37 ? 8.695   68.497 73.930  1.00 40.46  ? 178 ARG C NH2 1 
ATOM   1521 N  N   . ASP C 1 38 ? 5.322   61.776 74.560  1.00 17.61  ? 179 ASP C N   1 
ATOM   1522 C  CA  . ASP C 1 38 ? 4.387   60.886 73.866  1.00 25.16  ? 179 ASP C CA  1 
ATOM   1523 C  C   . ASP C 1 38 ? 3.699   59.871 74.771  1.00 27.76  ? 179 ASP C C   1 
ATOM   1524 O  O   . ASP C 1 38 ? 2.576   59.435 74.475  1.00 28.74  ? 179 ASP C O   1 
ATOM   1525 C  CB  . ASP C 1 38 ? 5.019   60.241 72.637  1.00 34.09  ? 179 ASP C CB  1 
ATOM   1526 C  CG  . ASP C 1 38 ? 5.296   61.262 71.542  1.00 42.53  ? 179 ASP C CG  1 
ATOM   1527 O  OD1 . ASP C 1 38 ? 4.481   62.220 71.388  1.00 42.61  ? 179 ASP C OD1 1 
ATOM   1528 O  OD2 . ASP C 1 38 ? 6.341   61.127 70.869  1.00 43.57  ? 179 ASP C OD2 1 
ATOM   1529 N  N   . SER C 1 39 ? 4.324   59.545 75.903  1.00 26.13  ? 180 SER C N   1 
ATOM   1530 C  CA  . SER C 1 39 ? 3.705   58.615 76.832  1.00 25.52  ? 180 SER C CA  1 
ATOM   1531 C  C   . SER C 1 39 ? 2.531   59.302 77.557  1.00 28.44  ? 180 SER C C   1 
ATOM   1532 O  O   . SER C 1 39 ? 1.590   58.636 78.000  1.00 29.25  ? 180 SER C O   1 
ATOM   1533 C  CB  . SER C 1 39 ? 4.708   58.019 77.861  1.00 18.89  ? 180 SER C CB  1 
ATOM   1534 O  OG  . SER C 1 39 ? 5.894   57.474 77.273  1.00 23.47  ? 180 SER C OG  1 
ATOM   1535 N  N   . LEU C 1 40 ? 2.582   60.626 77.680  1.00 23.08  ? 181 LEU C N   1 
ATOM   1536 C  CA  . LEU C 1 40 ? 1.608   61.329 78.523  1.00 21.49  ? 181 LEU C CA  1 
ATOM   1537 C  C   . LEU C 1 40 ? 0.603   62.159 77.728  1.00 25.52  ? 181 LEU C C   1 
ATOM   1538 O  O   . LEU C 1 40 ? -0.347  62.676 78.285  1.00 26.39  ? 181 LEU C O   1 
ATOM   1539 C  CB  . LEU C 1 40 ? 2.334   62.254 79.537  1.00 36.08  ? 181 LEU C CB  1 
ATOM   1540 C  CG  . LEU C 1 40 ? 3.052   61.580 80.718  1.00 36.65  ? 181 LEU C CG  1 
ATOM   1541 C  CD1 . LEU C 1 40 ? 3.641   62.609 81.729  1.00 24.33  ? 181 LEU C CD1 1 
ATOM   1542 C  CD2 . LEU C 1 40 ? 2.040   60.656 81.399  1.00 40.22  ? 181 LEU C CD2 1 
ATOM   1543 N  N   . LYS C 1 41 ? 0.844   62.329 76.441  1.00 31.95  ? 182 LYS C N   1 
ATOM   1544 C  CA  . LYS C 1 41 ? -0.021  63.194 75.635  1.00 43.81  ? 182 LYS C CA  1 
ATOM   1545 C  C   . LYS C 1 41 ? -1.530  62.880 75.836  1.00 37.56  ? 182 LYS C C   1 
ATOM   1546 O  O   . LYS C 1 41 ? -2.355  63.760 75.976  1.00 36.01  ? 182 LYS C O   1 
ATOM   1547 C  CB  . LYS C 1 41 ? 0.409   63.111 74.158  1.00 52.25  ? 182 LYS C CB  1 
ATOM   1548 C  CG  . LYS C 1 41 ? -0.665  63.432 73.141  1.00 62.82  ? 182 LYS C CG  1 
ATOM   1549 C  CD  . LYS C 1 41 ? -0.071  63.623 71.741  1.00 69.91  ? 182 LYS C CD  1 
ATOM   1550 C  CE  . LYS C 1 41 ? 0.199   65.100 71.442  1.00 71.51  ? 182 LYS C CE  1 
ATOM   1551 N  NZ  . LYS C 1 41 ? 0.456   65.366 69.991  1.00 71.08  ? 182 LYS C NZ  1 
ATOM   1552 N  N   . LYS C 1 42 ? -1.864  61.600 75.878  1.00 36.06  ? 183 LYS C N   1 
ATOM   1553 C  CA  . LYS C 1 42 ? -3.232  61.170 76.026  1.00 35.39  ? 183 LYS C CA  1 
ATOM   1554 C  C   . LYS C 1 42 ? -3.806  61.552 77.396  1.00 32.37  ? 183 LYS C C   1 
ATOM   1555 O  O   . LYS C 1 42 ? -4.880  62.159 77.483  1.00 34.52  ? 183 LYS C O   1 
ATOM   1556 C  CB  . LYS C 1 42 ? -3.290  59.665 75.773  1.00 33.51  ? 183 LYS C CB  1 
ATOM   1557 C  CG  . LYS C 1 42 ? -4.497  58.935 76.271  1.00 40.31  ? 183 LYS C CG  1 
ATOM   1558 C  CD  . LYS C 1 42 ? -4.566  57.604 75.533  1.00 46.81  ? 183 LYS C CD  1 
ATOM   1559 C  CE  . LYS C 1 42 ? -5.580  56.657 76.146  1.00 50.47  ? 183 LYS C CE  1 
ATOM   1560 N  NZ  . LYS C 1 42 ? -5.069  56.086 77.417  1.00 50.87  ? 183 LYS C NZ  1 
ATOM   1561 N  N   . ALA C 1 43 ? -3.102  61.186 78.462  1.00 31.58  ? 184 ALA C N   1 
ATOM   1562 C  CA  . ALA C 1 43 ? -3.590  61.442 79.794  1.00 33.02  ? 184 ALA C CA  1 
ATOM   1563 C  C   . ALA C 1 43 ? -3.803  62.944 79.990  1.00 38.15  ? 184 ALA C C   1 
ATOM   1564 O  O   . ALA C 1 43 ? -4.754  63.365 80.669  1.00 41.10  ? 184 ALA C O   1 
ATOM   1565 C  CB  . ALA C 1 43 ? -2.642  60.883 80.823  1.00 33.65  ? 184 ALA C CB  1 
ATOM   1566 N  N   . LEU C 1 44 ? -2.927  63.748 79.386  1.00 35.65  ? 185 LEU C N   1 
ATOM   1567 C  CA  . LEU C 1 44 ? -2.989  65.196 79.562  1.00 34.44  ? 185 LEU C CA  1 
ATOM   1568 C  C   . LEU C 1 44 ? -4.180  65.755 78.805  1.00 34.02  ? 185 LEU C C   1 
ATOM   1569 O  O   . LEU C 1 44 ? -4.988  66.524 79.341  1.00 32.48  ? 185 LEU C O   1 
ATOM   1570 C  CB  . LEU C 1 44 ? -1.710  65.871 79.049  1.00 33.83  ? 185 LEU C CB  1 
ATOM   1571 C  CG  . LEU C 1 44 ? -0.519  65.945 79.996  1.00 31.21  ? 185 LEU C CG  1 
ATOM   1572 C  CD1 . LEU C 1 44 ? 0.611   66.694 79.291  1.00 32.03  ? 185 LEU C CD1 1 
ATOM   1573 C  CD2 . LEU C 1 44 ? -0.937  66.659 81.259  1.00 29.93  ? 185 LEU C CD2 1 
HETATM 1574 N  N   . MSE C 1 45 ? -4.262  65.379 77.540  1.00 35.26  ? 186 MSE C N   1 
HETATM 1575 C  CA  . MSE C 1 45 ? -5.301  65.899 76.670  1.00 41.30  ? 186 MSE C CA  1 
HETATM 1576 C  C   . MSE C 1 45 ? -6.684  65.542 77.243  1.00 42.24  ? 186 MSE C C   1 
HETATM 1577 O  O   . MSE C 1 45 ? -7.600  66.356 77.237  1.00 43.26  ? 186 MSE C O   1 
HETATM 1578 C  CB  . MSE C 1 45 ? -5.117  65.357 75.252  1.00 44.39  ? 186 MSE C CB  1 
HETATM 1579 C  CG  . MSE C 1 45 ? -5.942  66.089 74.199  1.00 51.94  ? 186 MSE C CG  1 
HETATM 1580 SE SE  . MSE C 1 45 ? -6.361  64.937 72.704  1.00 132.85 ? 186 MSE C SE  1 
HETATM 1581 C  CE  . MSE C 1 45 ? -5.110  65.593 71.365  1.00 95.73  ? 186 MSE C CE  1 
HETATM 1582 N  N   . MSE C 1 46 ? -6.799  64.339 77.781  1.00 45.47  ? 187 MSE C N   1 
HETATM 1583 C  CA  . MSE C 1 46 ? -7.999  63.900 78.485  1.00 50.63  ? 187 MSE C CA  1 
HETATM 1584 C  C   . MSE C 1 46 ? -8.483  64.961 79.451  1.00 52.28  ? 187 MSE C C   1 
HETATM 1585 O  O   . MSE C 1 46 ? -9.667  65.027 79.757  1.00 54.57  ? 187 MSE C O   1 
HETATM 1586 C  CB  . MSE C 1 46 ? -7.672  62.637 79.265  1.00 54.51  ? 187 MSE C CB  1 
HETATM 1587 C  CG  . MSE C 1 46 ? -8.833  61.705 79.502  1.00 61.96  ? 187 MSE C CG  1 
HETATM 1588 SE SE  . MSE C 1 46 ? -8.117  59.955 79.965  1.00 125.36 ? 187 MSE C SE  1 
HETATM 1589 C  CE  . MSE C 1 46 ? -7.550  59.373 78.190  1.00 64.48  ? 187 MSE C CE  1 
ATOM   1590 N  N   . ARG C 1 47 ? -7.566  65.788 79.948  1.00 49.97  ? 188 ARG C N   1 
ATOM   1591 C  CA  . ARG C 1 47 ? -7.927  66.824 80.915  1.00 51.68  ? 188 ARG C CA  1 
ATOM   1592 C  C   . ARG C 1 47 ? -7.710  68.230 80.374  1.00 50.67  ? 188 ARG C C   1 
ATOM   1593 O  O   . ARG C 1 47 ? -7.569  69.186 81.142  1.00 51.46  ? 188 ARG C O   1 
ATOM   1594 C  CB  . ARG C 1 47 ? -7.160  66.650 82.224  1.00 51.64  ? 188 ARG C CB  1 
ATOM   1595 C  CG  . ARG C 1 47 ? -7.428  65.347 82.897  1.00 53.39  ? 188 ARG C CG  1 
ATOM   1596 C  CD  . ARG C 1 47 ? -6.177  64.810 83.521  1.00 51.25  ? 188 ARG C CD  1 
ATOM   1597 N  NE  . ARG C 1 47 ? -6.437  63.612 84.302  1.00 49.59  ? 188 ARG C NE  1 
ATOM   1598 C  CZ  . ARG C 1 47 ? -6.291  62.381 83.845  1.00 46.53  ? 188 ARG C CZ  1 
ATOM   1599 N  NH1 . ARG C 1 47 ? -5.881  62.178 82.598  1.00 44.71  ? 188 ARG C NH1 1 
ATOM   1600 N  NH2 . ARG C 1 47 ? -6.535  61.359 84.646  1.00 49.16  ? 188 ARG C NH2 1 
ATOM   1601 N  N   . GLY C 1 48 ? -7.697  68.350 79.053  1.00 50.45  ? 189 GLY C N   1 
ATOM   1602 C  CA  . GLY C 1 48 ? -7.529  69.641 78.409  1.00 50.32  ? 189 GLY C CA  1 
ATOM   1603 C  C   . GLY C 1 48 ? -6.156  70.276 78.587  1.00 49.28  ? 189 GLY C C   1 
ATOM   1604 O  O   . GLY C 1 48 ? -6.017  71.503 78.543  1.00 51.66  ? 189 GLY C O   1 
ATOM   1605 N  N   . LEU C 1 49 ? -5.135  69.450 78.776  1.00 41.60  ? 190 LEU C N   1 
ATOM   1606 C  CA  . LEU C 1 49 ? -3.779  69.961 78.896  1.00 38.71  ? 190 LEU C CA  1 
ATOM   1607 C  C   . LEU C 1 49 ? -2.930  69.486 77.745  1.00 41.87  ? 190 LEU C C   1 
ATOM   1608 O  O   . LEU C 1 49 ? -3.199  68.440 77.147  1.00 41.82  ? 190 LEU C O   1 
ATOM   1609 C  CB  . LEU C 1 49 ? -3.136  69.527 80.210  1.00 39.46  ? 190 LEU C CB  1 
ATOM   1610 C  CG  . LEU C 1 49 ? -3.806  70.086 81.460  1.00 44.00  ? 190 LEU C CG  1 
ATOM   1611 C  CD1 . LEU C 1 49 ? -3.260  69.429 82.728  1.00 45.54  ? 190 LEU C CD1 1 
ATOM   1612 C  CD2 . LEU C 1 49 ? -3.644  71.597 81.500  1.00 46.50  ? 190 LEU C CD2 1 
ATOM   1613 N  N   . ILE C 1 50 ? -1.903  70.277 77.444  1.00 40.67  ? 191 ILE C N   1 
ATOM   1614 C  CA  . ILE C 1 50 ? -0.894  69.942 76.454  1.00 42.37  ? 191 ILE C CA  1 
ATOM   1615 C  C   . ILE C 1 50 ? 0.484   69.992 77.138  1.00 29.77  ? 191 ILE C C   1 
ATOM   1616 O  O   . ILE C 1 50 ? 0.695   70.789 78.055  1.00 27.11  ? 191 ILE C O   1 
ATOM   1617 C  CB  . ILE C 1 50 ? -0.945  70.931 75.278  1.00 53.85  ? 191 ILE C CB  1 
ATOM   1618 C  CG1 . ILE C 1 50 ? 0.090   70.575 74.215  1.00 60.61  ? 191 ILE C CG1 1 
ATOM   1619 C  CG2 . ILE C 1 50 ? -0.700  72.346 75.761  1.00 54.23  ? 191 ILE C CG2 1 
ATOM   1620 C  CD1 . ILE C 1 50 ? 0.100   71.540 73.055  1.00 65.11  ? 191 ILE C CD1 1 
ATOM   1621 N  N   . PRO C 1 51 ? 1.398   69.105 76.725  1.00 30.54  ? 192 PRO C N   1 
ATOM   1622 C  CA  . PRO C 1 51 ? 2.755   69.084 77.294  1.00 31.55  ? 192 PRO C CA  1 
ATOM   1623 C  C   . PRO C 1 51 ? 3.406   70.474 77.252  1.00 34.87  ? 192 PRO C C   1 
ATOM   1624 O  O   . PRO C 1 51 ? 3.930   70.901 78.263  1.00 34.84  ? 192 PRO C O   1 
ATOM   1625 C  CB  . PRO C 1 51 ? 3.493   68.107 76.389  1.00 32.86  ? 192 PRO C CB  1 
ATOM   1626 C  CG  . PRO C 1 51 ? 2.398   67.144 75.947  1.00 32.33  ? 192 PRO C CG  1 
ATOM   1627 C  CD  . PRO C 1 51 ? 1.164   67.983 75.798  1.00 30.58  ? 192 PRO C CD  1 
ATOM   1628 N  N   . GLU C 1 52 ? 3.334   71.162 76.116  1.00 39.79  ? 193 GLU C N   1 
ATOM   1629 C  CA  . GLU C 1 52 ? 3.811   72.534 75.996  1.00 42.92  ? 193 GLU C CA  1 
ATOM   1630 C  C   . GLU C 1 52 ? 3.385   73.498 77.120  1.00 37.51  ? 193 GLU C C   1 
ATOM   1631 O  O   . GLU C 1 52 ? 4.106   74.458 77.397  1.00 38.95  ? 193 GLU C O   1 
ATOM   1632 C  CB  . GLU C 1 52 ? 3.413   73.124 74.633  1.00 55.08  ? 193 GLU C CB  1 
ATOM   1633 C  CG  . GLU C 1 52 ? 4.174   72.553 73.453  1.00 65.03  ? 193 GLU C CG  1 
ATOM   1634 C  CD  . GLU C 1 52 ? 5.676   72.803 73.545  1.00 72.09  ? 193 GLU C CD  1 
ATOM   1635 O  OE1 . GLU C 1 52 ? 6.074   73.909 73.988  1.00 76.33  ? 193 GLU C OE1 1 
ATOM   1636 O  OE2 . GLU C 1 52 ? 6.456   71.892 73.178  1.00 72.74  ? 193 GLU C OE2 1 
ATOM   1637 N  N   . CYS C 1 53 ? 2.232   73.263 77.749  1.00 30.92  ? 194 CYS C N   1 
ATOM   1638 C  CA  . CYS C 1 53 ? 1.755   74.138 78.828  1.00 31.92  ? 194 CYS C CA  1 
ATOM   1639 C  C   . CYS C 1 53 ? 1.978   73.555 80.222  1.00 29.77  ? 194 CYS C C   1 
ATOM   1640 O  O   . CYS C 1 53 ? 1.430   74.033 81.200  1.00 27.32  ? 194 CYS C O   1 
ATOM   1641 C  CB  . CYS C 1 53 ? 0.263   74.536 78.648  1.00 35.54  ? 194 CYS C CB  1 
ATOM   1642 S  SG  . CYS C 1 53 ? -1.028  73.314 79.193  1.00 61.55  ? 194 CYS C SG  1 
ATOM   1643 N  N   . CYS C 1 54 ? 2.811   72.529 80.320  1.00 28.06  ? 195 CYS C N   1 
ATOM   1644 C  CA  . CYS C 1 54 ? 3.064   71.922 81.620  1.00 27.75  ? 195 CYS C CA  1 
ATOM   1645 C  C   . CYS C 1 54 ? 4.562   71.696 81.798  1.00 23.55  ? 195 CYS C C   1 
ATOM   1646 O  O   . CYS C 1 54 ? 5.276   71.763 80.850  1.00 22.37  ? 195 CYS C O   1 
ATOM   1647 C  CB  . CYS C 1 54 ? 2.341   70.575 81.718  1.00 27.60  ? 195 CYS C CB  1 
ATOM   1648 S  SG  . CYS C 1 54 ? 0.542   70.676 81.580  1.00 28.64  ? 195 CYS C SG  1 
ATOM   1649 N  N   . ALA C 1 55 ? 4.983   71.367 83.015  1.00 23.69  ? 196 ALA C N   1 
ATOM   1650 C  CA  . ALA C 1 55 ? 6.340   70.904 83.286  1.00 22.18  ? 196 ALA C CA  1 
ATOM   1651 C  C   . ALA C 1 55 ? 6.209   69.535 83.927  1.00 17.27  ? 196 ALA C C   1 
ATOM   1652 O  O   . ALA C 1 55 ? 5.198   69.233 84.535  1.00 20.13  ? 196 ALA C O   1 
ATOM   1653 C  CB  . ALA C 1 55 ? 7.025   71.851 84.259  1.00 18.69  ? 196 ALA C CB  1 
ATOM   1654 N  N   . VAL C 1 56 ? 7.230   68.700 83.805  1.00 21.39  ? 197 VAL C N   1 
ATOM   1655 C  CA  . VAL C 1 56 ? 7.149   67.388 84.421  1.00 18.92  ? 197 VAL C CA  1 
ATOM   1656 C  C   . VAL C 1 56 ? 8.373   67.210 85.301  1.00 21.31  ? 197 VAL C C   1 
ATOM   1657 O  O   . VAL C 1 56 ? 9.450   67.759 85.013  1.00 22.63  ? 197 VAL C O   1 
ATOM   1658 C  CB  . VAL C 1 56 ? 6.964   66.271 83.331  1.00 20.84  ? 197 VAL C CB  1 
ATOM   1659 C  CG1 . VAL C 1 56 ? 7.950   66.458 82.159  1.00 18.60  ? 197 VAL C CG1 1 
ATOM   1660 C  CG2 . VAL C 1 56 ? 7.010   64.845 83.908  1.00 13.28  ? 197 VAL C CG2 1 
ATOM   1661 N  N   . TYR C 1 57 ? 8.196   66.502 86.413  1.00 21.82  ? 198 TYR C N   1 
ATOM   1662 C  CA  . TYR C 1 57 ? 9.271   66.287 87.366  1.00 19.93  ? 198 TYR C CA  1 
ATOM   1663 C  C   . TYR C 1 57 ? 9.346   64.845 87.817  1.00 25.60  ? 198 TYR C C   1 
ATOM   1664 O  O   . TYR C 1 57 ? 8.316   64.153 87.966  1.00 22.29  ? 198 TYR C O   1 
ATOM   1665 C  CB  . TYR C 1 57 ? 9.104   67.117 88.627  1.00 24.01  ? 198 TYR C CB  1 
ATOM   1666 C  CG  . TYR C 1 57 ? 8.896   68.565 88.455  1.00 26.09  ? 198 TYR C CG  1 
ATOM   1667 C  CD1 . TYR C 1 57 ? 9.920   69.447 88.639  1.00 32.58  ? 198 TYR C CD1 1 
ATOM   1668 C  CD2 . TYR C 1 57 ? 7.629   69.073 88.179  1.00 35.81  ? 198 TYR C CD2 1 
ATOM   1669 C  CE1 . TYR C 1 57 ? 9.723   70.799 88.502  1.00 34.49  ? 198 TYR C CE1 1 
ATOM   1670 C  CE2 . TYR C 1 57 ? 7.425   70.411 88.054  1.00 37.12  ? 198 TYR C CE2 1 
ATOM   1671 C  CZ  . TYR C 1 57 ? 8.480   71.268 88.219  1.00 32.40  ? 198 TYR C CZ  1 
ATOM   1672 O  OH  . TYR C 1 57 ? 8.303   72.602 88.089  1.00 40.43  ? 198 TYR C OH  1 
ATOM   1673 N  N   . ARG C 1 58 ? 10.580  64.406 88.029  1.00 29.10  ? 199 ARG C N   1 
ATOM   1674 C  CA  . ARG C 1 58 ? 10.856  63.129 88.655  1.00 33.66  ? 199 ARG C CA  1 
ATOM   1675 C  C   . ARG C 1 58 ? 10.987  63.452 90.120  1.00 40.77  ? 199 ARG C C   1 
ATOM   1676 O  O   . ARG C 1 58 ? 11.452  64.528 90.511  1.00 42.07  ? 199 ARG C O   1 
ATOM   1677 C  CB  . ARG C 1 58 ? 12.158  62.553 88.128  1.00 40.26  ? 199 ARG C CB  1 
ATOM   1678 C  CG  . ARG C 1 58 ? 12.412  61.100 88.523  1.00 47.31  ? 199 ARG C CG  1 
ATOM   1679 C  CD  . ARG C 1 58 ? 13.561  61.004 89.490  1.00 49.44  ? 199 ARG C CD  1 
ATOM   1680 N  NE  . ARG C 1 58 ? 14.790  61.586 88.960  1.00 45.44  ? 199 ARG C NE  1 
ATOM   1681 C  CZ  . ARG C 1 58 ? 15.765  60.870 88.409  1.00 44.94  ? 199 ARG C CZ  1 
ATOM   1682 N  NH1 . ARG C 1 58 ? 15.642  59.547 88.320  1.00 34.18  ? 199 ARG C NH1 1 
ATOM   1683 N  NH2 . ARG C 1 58 ? 16.869  61.471 87.960  1.00 43.79  ? 199 ARG C NH2 1 
ATOM   1684 N  N   . ILE C 1 59 ? 10.546  62.537 90.952  1.00 46.08  ? 200 ILE C N   1 
ATOM   1685 C  CA  . ILE C 1 59 ? 10.632  62.790 92.365  1.00 47.41  ? 200 ILE C CA  1 
ATOM   1686 C  C   . ILE C 1 59 ? 11.854  62.020 92.918  1.00 47.36  ? 200 ILE C C   1 
ATOM   1687 O  O   . ILE C 1 59 ? 12.136  60.888 92.512  1.00 46.04  ? 200 ILE C O   1 
ATOM   1688 C  CB  . ILE C 1 59 ? 9.268   62.513 93.028  1.00 52.68  ? 200 ILE C CB  1 
ATOM   1689 C  CG1 . ILE C 1 59 ? 9.266   62.989 94.478  1.00 57.60  ? 200 ILE C CG1 1 
ATOM   1690 C  CG2 . ILE C 1 59 ? 8.831   61.092 92.799  1.00 53.63  ? 200 ILE C CG2 1 
ATOM   1691 C  CD1 . ILE C 1 59 ? 9.097   64.501 94.574  1.00 59.13  ? 200 ILE C CD1 1 
ATOM   1692 N  N   . GLN C 1 60 ? 12.625  62.673 93.780  1.00 46.79  ? 201 GLN C N   1 
ATOM   1693 C  CA  . GLN C 1 60 ? 13.931  62.149 94.184  1.00 51.17  ? 201 GLN C CA  1 
ATOM   1694 C  C   . GLN C 1 60 ? 14.179  62.396 95.678  1.00 53.49  ? 201 GLN C C   1 
ATOM   1695 O  O   . GLN C 1 60 ? 14.741  63.428 96.069  1.00 55.12  ? 201 GLN C O   1 
ATOM   1696 C  CB  . GLN C 1 60 ? 15.057  62.784 93.334  1.00 52.08  ? 201 GLN C CB  1 
ATOM   1697 C  CG  . GLN C 1 60 ? 16.378  61.985 93.244  1.00 56.57  ? 201 GLN C CG  1 
ATOM   1698 C  CD  . GLN C 1 60 ? 16.384  60.915 92.133  1.00 60.35  ? 201 GLN C CD  1 
ATOM   1699 O  OE1 . GLN C 1 60 ? 15.331  60.453 91.685  1.00 60.48  ? 201 GLN C OE1 1 
ATOM   1700 N  NE2 . GLN C 1 60 ? 17.576  60.520 91.700  1.00 58.45  ? 201 GLN C NE2 1 
ATOM   1701 N  N   . LYS C 1 64 ? 10.997  67.321 93.832  1.00 39.01  ? 205 LYS C N   1 
ATOM   1702 C  CA  . LYS C 1 64 ? 10.731  67.631 92.430  1.00 37.73  ? 205 LYS C CA  1 
ATOM   1703 C  C   . LYS C 1 64 ? 11.979  68.031 91.669  1.00 32.42  ? 205 LYS C C   1 
ATOM   1704 O  O   . LYS C 1 64 ? 12.502  69.136 91.858  1.00 36.05  ? 205 LYS C O   1 
ATOM   1705 C  CB  . LYS C 1 64 ? 9.646   68.737 92.292  1.00 37.65  ? 205 LYS C CB  1 
ATOM   1706 N  N   . LYS C 1 65 ? 12.436  67.151 90.783  1.00 24.64  ? 206 LYS C N   1 
ATOM   1707 C  CA  . LYS C 1 65 ? 13.546  67.479 89.891  1.00 22.97  ? 206 LYS C CA  1 
ATOM   1708 C  C   . LYS C 1 65 ? 13.012  67.466 88.464  1.00 21.21  ? 206 LYS C C   1 
ATOM   1709 O  O   . LYS C 1 65 ? 12.427  66.448 88.003  1.00 20.80  ? 206 LYS C O   1 
ATOM   1710 C  CB  . LYS C 1 65 ? 14.675  66.447 90.025  1.00 23.60  ? 206 LYS C CB  1 
ATOM   1711 C  CG  . LYS C 1 65 ? 15.351  66.417 91.395  1.00 34.81  ? 206 LYS C CG  1 
ATOM   1712 C  CD  . LYS C 1 65 ? 16.389  67.534 91.489  1.00 42.39  ? 206 LYS C CD  1 
ATOM   1713 C  CE  . LYS C 1 65 ? 17.046  67.567 92.852  1.00 49.45  ? 206 LYS C CE  1 
ATOM   1714 N  NZ  . LYS C 1 65 ? 18.104  68.633 92.897  1.00 53.32  ? 206 LYS C NZ  1 
ATOM   1715 N  N   . PRO C 1 66 ? 13.192  68.576 87.755  1.00 26.12  ? 207 PRO C N   1 
ATOM   1716 C  CA  . PRO C 1 66 ? 12.543  68.706 86.439  1.00 23.41  ? 207 PRO C CA  1 
ATOM   1717 C  C   . PRO C 1 66 ? 13.189  67.781 85.403  1.00 22.17  ? 207 PRO C C   1 
ATOM   1718 O  O   . PRO C 1 66 ? 14.434  67.644 85.337  1.00 18.97  ? 207 PRO C O   1 
ATOM   1719 C  CB  . PRO C 1 66 ? 12.816  70.171 86.058  1.00 21.60  ? 207 PRO C CB  1 
ATOM   1720 C  CG  . PRO C 1 66 ? 14.143  70.489 86.807  1.00 22.89  ? 207 PRO C CG  1 
ATOM   1721 C  CD  . PRO C 1 66 ? 13.912  69.812 88.141  1.00 27.32  ? 207 PRO C CD  1 
ATOM   1722 N  N   . ILE C 1 67 ? 12.361  67.183 84.554  1.00 21.04  ? 208 ILE C N   1 
ATOM   1723 C  CA  . ILE C 1 67 ? 12.930  66.427 83.441  1.00 20.25  ? 208 ILE C CA  1 
ATOM   1724 C  C   . ILE C 1 67 ? 12.423  66.974 82.140  1.00 17.50  ? 208 ILE C C   1 
ATOM   1725 O  O   . ILE C 1 67 ? 11.363  67.583 82.105  1.00 21.38  ? 208 ILE C O   1 
ATOM   1726 C  CB  . ILE C 1 67 ? 12.627  64.916 83.522  1.00 27.10  ? 208 ILE C CB  1 
ATOM   1727 C  CG1 . ILE C 1 67 ? 11.183  64.619 83.102  1.00 20.72  ? 208 ILE C CG1 1 
ATOM   1728 C  CG2 . ILE C 1 67 ? 12.929  64.366 84.931  1.00 26.10  ? 208 ILE C CG2 1 
ATOM   1729 C  CD1 . ILE C 1 67 ? 10.843  63.142 83.202  1.00 22.14  ? 208 ILE C CD1 1 
ATOM   1730 N  N   . GLY C 1 68 ? 13.194  66.747 81.087  1.00 20.20  ? 209 GLY C N   1 
ATOM   1731 C  CA  . GLY C 1 68 ? 12.795  67.077 79.740  1.00 20.35  ? 209 GLY C CA  1 
ATOM   1732 C  C   . GLY C 1 68 ? 11.645  66.254 79.222  1.00 21.47  ? 209 GLY C C   1 
ATOM   1733 O  O   . GLY C 1 68 ? 11.527  65.059 79.532  1.00 21.45  ? 209 GLY C O   1 
ATOM   1734 N  N   . TRP C 1 69 ? 10.754  66.916 78.474  1.00 22.44  ? 210 TRP C N   1 
ATOM   1735 C  CA  . TRP C 1 69 ? 9.615   66.253 77.834  1.00 23.05  ? 210 TRP C CA  1 
ATOM   1736 C  C   . TRP C 1 69 ? 10.096  65.208 76.824  1.00 24.11  ? 210 TRP C C   1 
ATOM   1737 O  O   . TRP C 1 69 ? 9.418   64.206 76.581  1.00 22.24  ? 210 TRP C O   1 
ATOM   1738 C  CB  . TRP C 1 69 ? 8.703   67.276 77.133  1.00 17.83  ? 210 TRP C CB  1 
ATOM   1739 C  CG  . TRP C 1 69 ? 7.676   67.865 78.066  1.00 24.64  ? 210 TRP C CG  1 
ATOM   1740 C  CD1 . TRP C 1 69 ? 7.565   69.172 78.447  1.00 27.22  ? 210 TRP C CD1 1 
ATOM   1741 C  CD2 . TRP C 1 69 ? 6.635   67.157 78.771  1.00 25.61  ? 210 TRP C CD2 1 
ATOM   1742 N  NE1 . TRP C 1 69 ? 6.517   69.328 79.320  1.00 26.69  ? 210 TRP C NE1 1 
ATOM   1743 C  CE2 . TRP C 1 69 ? 5.924   68.114 79.538  1.00 21.88  ? 210 TRP C CE2 1 
ATOM   1744 C  CE3 . TRP C 1 69 ? 6.231   65.817 78.816  1.00 22.58  ? 210 TRP C CE3 1 
ATOM   1745 C  CZ2 . TRP C 1 69 ? 4.831   67.773 80.340  1.00 19.73  ? 210 TRP C CZ2 1 
ATOM   1746 C  CZ3 . TRP C 1 69 ? 5.140   65.474 79.615  1.00 21.78  ? 210 TRP C CZ3 1 
ATOM   1747 C  CH2 . TRP C 1 69 ? 4.462   66.448 80.375  1.00 24.22  ? 210 TRP C CH2 1 
ATOM   1748 N  N   . ASP C 1 70 ? 11.287  65.432 76.266  1.00 25.74  ? 211 ASP C N   1 
ATOM   1749 C  CA  . ASP C 1 70 ? 11.836  64.528 75.253  1.00 28.12  ? 211 ASP C CA  1 
ATOM   1750 C  C   . ASP C 1 70 ? 12.691  63.380 75.804  1.00 28.05  ? 211 ASP C C   1 
ATOM   1751 O  O   . ASP C 1 70 ? 13.241  62.595 75.054  1.00 26.62  ? 211 ASP C O   1 
ATOM   1752 C  CB  . ASP C 1 70 ? 12.614  65.312 74.209  1.00 34.46  ? 211 ASP C CB  1 
ATOM   1753 C  CG  . ASP C 1 70 ? 11.714  66.152 73.350  1.00 45.75  ? 211 ASP C CG  1 
ATOM   1754 O  OD1 . ASP C 1 70 ? 10.532  65.780 73.202  1.00 48.27  ? 211 ASP C OD1 1 
ATOM   1755 O  OD2 . ASP C 1 70 ? 12.185  67.188 72.834  1.00 56.38  ? 211 ASP C OD2 1 
ATOM   1756 N  N   . THR C 1 71 ? 12.778  63.284 77.123  1.00 28.95  ? 212 THR C N   1 
ATOM   1757 C  CA  . THR C 1 71 ? 13.376  62.132 77.801  1.00 22.44  ? 212 THR C CA  1 
ATOM   1758 C  C   . THR C 1 71 ? 12.759  60.793 77.351  1.00 19.22  ? 212 THR C C   1 
ATOM   1759 O  O   . THR C 1 71 ? 11.545  60.682 77.223  1.00 19.44  ? 212 THR C O   1 
ATOM   1760 C  CB  . THR C 1 71 ? 13.138  62.287 79.334  1.00 22.95  ? 212 THR C CB  1 
ATOM   1761 O  OG1 . THR C 1 71 ? 13.684  63.532 79.803  1.00 25.92  ? 212 THR C OG1 1 
ATOM   1762 C  CG2 . THR C 1 71 ? 13.739  61.111 80.102  1.00 21.18  ? 212 THR C CG2 1 
ATOM   1763 N  N   . ASP C 1 72 ? 13.584  59.772 77.131  1.00 21.54  ? 213 ASP C N   1 
ATOM   1764 C  CA  . ASP C 1 72 ? 13.108  58.391 76.938  1.00 17.68  ? 213 ASP C CA  1 
ATOM   1765 C  C   . ASP C 1 72 ? 12.592  57.853 78.282  1.00 21.68  ? 213 ASP C C   1 
ATOM   1766 O  O   . ASP C 1 72 ? 13.333  57.738 79.293  1.00 19.42  ? 213 ASP C O   1 
ATOM   1767 C  CB  . ASP C 1 72 ? 14.262  57.541 76.357  1.00 19.62  ? 213 ASP C CB  1 
ATOM   1768 C  CG  . ASP C 1 72 ? 13.907  56.067 76.124  1.00 23.55  ? 213 ASP C CG  1 
ATOM   1769 O  OD1 . ASP C 1 72 ? 12.860  55.581 76.571  1.00 26.02  ? 213 ASP C OD1 1 
ATOM   1770 O  OD2 . ASP C 1 72 ? 14.750  55.343 75.519  1.00 26.24  ? 213 ASP C OD2 1 
ATOM   1771 N  N   . ILE C 1 73 ? 11.302  57.551 78.310  1.00 21.39  ? 214 ILE C N   1 
ATOM   1772 C  CA  . ILE C 1 73 ? 10.619  57.289 79.581  1.00 19.72  ? 214 ILE C CA  1 
ATOM   1773 C  C   . ILE C 1 73 ? 11.059  55.919 80.144  1.00 19.17  ? 214 ILE C C   1 
ATOM   1774 O  O   . ILE C 1 73 ? 10.904  55.630 81.322  1.00 15.64  ? 214 ILE C O   1 
ATOM   1775 C  CB  . ILE C 1 73 ? 9.094   57.374 79.393  1.00 21.23  ? 214 ILE C CB  1 
ATOM   1776 C  CG1 . ILE C 1 73 ? 8.399   57.537 80.743  1.00 21.17  ? 214 ILE C CG1 1 
ATOM   1777 C  CG2 . ILE C 1 73 ? 8.557   56.157 78.572  1.00 30.56  ? 214 ILE C CG2 1 
ATOM   1778 C  CD1 . ILE C 1 73 ? 6.901   57.631 80.652  1.00 19.65  ? 214 ILE C CD1 1 
ATOM   1779 N  N   . SER C 1 74 ? 11.638  55.084 79.286  1.00 21.87  ? 215 SER C N   1 
ATOM   1780 C  CA  . SER C 1 74 ? 12.116  53.766 79.739  1.00 21.48  ? 215 SER C CA  1 
ATOM   1781 C  C   . SER C 1 74 ? 13.142  53.863 80.879  1.00 20.55  ? 215 SER C C   1 
ATOM   1782 O  O   . SER C 1 74 ? 13.159  53.001 81.768  1.00 19.81  ? 215 SER C O   1 
ATOM   1783 C  CB  . SER C 1 74 ? 12.676  52.934 78.564  1.00 13.53  ? 215 SER C CB  1 
ATOM   1784 O  OG  . SER C 1 74 ? 13.872  53.478 78.112  1.00 16.75  ? 215 SER C OG  1 
ATOM   1785 N  N   . TRP C 1 75 ? 13.995  54.902 80.858  1.00 19.08  ? 216 TRP C N   1 
ATOM   1786 C  CA  . TRP C 1 75 ? 14.974  55.089 81.935  1.00 19.76  ? 216 TRP C CA  1 
ATOM   1787 C  C   . TRP C 1 75 ? 14.319  55.374 83.313  1.00 21.86  ? 216 TRP C C   1 
ATOM   1788 O  O   . TRP C 1 75 ? 14.958  55.200 84.338  1.00 20.25  ? 216 TRP C O   1 
ATOM   1789 C  CB  . TRP C 1 75 ? 15.956  56.213 81.578  1.00 21.04  ? 216 TRP C CB  1 
ATOM   1790 C  CG  . TRP C 1 75 ? 16.684  55.911 80.322  1.00 22.55  ? 216 TRP C CG  1 
ATOM   1791 C  CD1 . TRP C 1 75 ? 16.405  56.391 79.071  1.00 25.65  ? 216 TRP C CD1 1 
ATOM   1792 C  CD2 . TRP C 1 75 ? 17.767  54.986 80.164  1.00 18.17  ? 216 TRP C CD2 1 
ATOM   1793 N  NE1 . TRP C 1 75 ? 17.279  55.856 78.158  1.00 24.05  ? 216 TRP C NE1 1 
ATOM   1794 C  CE2 . TRP C 1 75 ? 18.119  54.983 78.799  1.00 20.58  ? 216 TRP C CE2 1 
ATOM   1795 C  CE3 . TRP C 1 75 ? 18.511  54.199 81.057  1.00 17.61  ? 216 TRP C CE3 1 
ATOM   1796 C  CZ2 . TRP C 1 75 ? 19.185  54.212 78.295  1.00 27.87  ? 216 TRP C CZ2 1 
ATOM   1797 C  CZ3 . TRP C 1 75 ? 19.581  53.437 80.560  1.00 21.18  ? 216 TRP C CZ3 1 
ATOM   1798 C  CH2 . TRP C 1 75 ? 19.900  53.453 79.198  1.00 26.42  ? 216 TRP C CH2 1 
ATOM   1799 N  N   . LEU C 1 76 ? 13.072  55.819 83.309  1.00 18.75  ? 217 LEU C N   1 
ATOM   1800 C  CA  . LEU C 1 76 ? 12.295  56.175 84.518  1.00 21.88  ? 217 LEU C CA  1 
ATOM   1801 C  C   . LEU C 1 76 ? 11.318  55.104 85.069  1.00 22.81  ? 217 LEU C C   1 
ATOM   1802 O  O   . LEU C 1 76 ? 10.544  55.369 86.018  1.00 18.42  ? 217 LEU C O   1 
ATOM   1803 C  CB  . LEU C 1 76 ? 11.500  57.453 84.260  1.00 25.04  ? 217 LEU C CB  1 
ATOM   1804 C  CG  . LEU C 1 76 ? 12.317  58.555 83.600  1.00 28.12  ? 217 LEU C CG  1 
ATOM   1805 C  CD1 . LEU C 1 76 ? 11.400  59.686 83.130  1.00 29.99  ? 217 LEU C CD1 1 
ATOM   1806 C  CD2 . LEU C 1 76 ? 13.371  59.037 84.578  1.00 23.50  ? 217 LEU C CD2 1 
ATOM   1807 N  N   . THR C 1 77 ? 11.357  53.910 84.489  1.00 20.75  ? 218 THR C N   1 
ATOM   1808 C  CA  . THR C 1 77 ? 10.510  52.816 84.919  1.00 24.70  ? 218 THR C CA  1 
ATOM   1809 C  C   . THR C 1 77 ? 10.575  52.709 86.427  1.00 27.35  ? 218 THR C C   1 
ATOM   1810 O  O   . THR C 1 77 ? 11.669  52.768 87.006  1.00 27.51  ? 218 THR C O   1 
ATOM   1811 C  CB  . THR C 1 77 ? 10.986  51.507 84.280  1.00 30.58  ? 218 THR C CB  1 
ATOM   1812 O  OG1 . THR C 1 77 ? 10.865  51.646 82.860  1.00 33.77  ? 218 THR C OG1 1 
ATOM   1813 C  CG2 . THR C 1 77 ? 10.193  50.263 84.805  1.00 25.92  ? 218 THR C CG2 1 
ATOM   1814 N  N   . GLY C 1 78 ? 9.396   52.589 87.049  1.00 24.68  ? 219 GLY C N   1 
ATOM   1815 C  CA  . GLY C 1 78 ? 9.272   52.413 88.491  1.00 24.98  ? 219 GLY C CA  1 
ATOM   1816 C  C   . GLY C 1 78 ? 9.281   53.692 89.314  1.00 25.35  ? 219 GLY C C   1 
ATOM   1817 O  O   . GLY C 1 78 ? 9.020   53.667 90.516  1.00 26.73  ? 219 GLY C O   1 
ATOM   1818 N  N   . GLU C 1 79 ? 9.603   54.809 88.668  1.00 22.66  ? 220 GLU C N   1 
ATOM   1819 C  CA  . GLU C 1 79 ? 9.704   56.090 89.356  1.00 26.12  ? 220 GLU C CA  1 
ATOM   1820 C  C   . GLU C 1 79 ? 8.348   56.761 89.371  1.00 23.08  ? 220 GLU C C   1 
ATOM   1821 O  O   . GLU C 1 79 ? 7.439   56.300 88.724  1.00 24.02  ? 220 GLU C O   1 
ATOM   1822 C  CB  . GLU C 1 79 ? 10.740  56.968 88.665  1.00 28.18  ? 220 GLU C CB  1 
ATOM   1823 C  CG  . GLU C 1 79 ? 12.165  56.522 88.939  1.00 40.15  ? 220 GLU C CG  1 
ATOM   1824 C  CD  . GLU C 1 79 ? 12.678  57.089 90.248  1.00 54.92  ? 220 GLU C CD  1 
ATOM   1825 O  OE1 . GLU C 1 79 ? 12.636  58.336 90.404  1.00 61.99  ? 220 GLU C OE1 1 
ATOM   1826 O  OE2 . GLU C 1 79 ? 13.115  56.304 91.123  1.00 58.52  ? 220 GLU C OE2 1 
ATOM   1827 N  N   . GLU C 1 80 ? 8.197   57.813 90.152  1.00 24.29  ? 221 GLU C N   1 
ATOM   1828 C  CA  . GLU C 1 80 ? 6.981   58.610 90.123  1.00 23.16  ? 221 GLU C CA  1 
ATOM   1829 C  C   . GLU C 1 80 ? 7.288   59.880 89.349  1.00 25.36  ? 221 GLU C C   1 
ATOM   1830 O  O   . GLU C 1 80 ? 8.315   60.506 89.624  1.00 29.27  ? 221 GLU C O   1 
ATOM   1831 C  CB  . GLU C 1 80 ? 6.589   59.020 91.539  1.00 29.90  ? 221 GLU C CB  1 
ATOM   1832 C  CG  . GLU C 1 80 ? 6.531   57.872 92.537  1.00 43.94  ? 221 GLU C CG  1 
ATOM   1833 C  CD  . GLU C 1 80 ? 5.767   58.257 93.776  1.00 50.81  ? 221 GLU C CD  1 
ATOM   1834 O  OE1 . GLU C 1 80 ? 5.926   59.419 94.214  1.00 51.89  ? 221 GLU C OE1 1 
ATOM   1835 O  OE2 . GLU C 1 80 ? 4.991   57.414 94.286  1.00 56.80  ? 221 GLU C OE2 1 
ATOM   1836 N  N   . LEU C 1 81 ? 6.431   60.263 88.401  1.00 16.88  ? 222 LEU C N   1 
ATOM   1837 C  CA  . LEU C 1 81 ? 6.549   61.580 87.782  1.00 18.57  ? 222 LEU C CA  1 
ATOM   1838 C  C   . LEU C 1 81 ? 5.443   62.490 88.290  1.00 19.50  ? 222 LEU C C   1 
ATOM   1839 O  O   . LEU C 1 81 ? 4.373   62.021 88.726  1.00 19.13  ? 222 LEU C O   1 
ATOM   1840 C  CB  . LEU C 1 81 ? 6.432   61.485 86.239  1.00 17.73  ? 222 LEU C CB  1 
ATOM   1841 C  CG  . LEU C 1 81 ? 7.425   60.602 85.518  1.00 20.95  ? 222 LEU C CG  1 
ATOM   1842 C  CD1 . LEU C 1 81 ? 7.219   60.673 84.011  1.00 23.69  ? 222 LEU C CD1 1 
ATOM   1843 C  CD2 . LEU C 1 81 ? 8.917   60.851 85.947  1.00 18.29  ? 222 LEU C CD2 1 
ATOM   1844 N  N   . HIS C 1 82 ? 5.671   63.785 88.183  1.00 22.74  ? 223 HIS C N   1 
ATOM   1845 C  CA  . HIS C 1 82 ? 4.709   64.742 88.664  1.00 19.99  ? 223 HIS C CA  1 
ATOM   1846 C  C   . HIS C 1 82 ? 4.540   65.751 87.578  1.00 23.66  ? 223 HIS C C   1 
ATOM   1847 O  O   . HIS C 1 82 ? 5.537   66.246 87.056  1.00 18.35  ? 223 HIS C O   1 
ATOM   1848 C  CB  . HIS C 1 82 ? 5.189   65.386 89.971  1.00 23.62  ? 223 HIS C CB  1 
ATOM   1849 C  CG  . HIS C 1 82 ? 4.922   64.557 91.181  1.00 34.94  ? 223 HIS C CG  1 
ATOM   1850 N  ND1 . HIS C 1 82 ? 5.605   63.389 91.456  1.00 38.02  ? 223 HIS C ND1 1 
ATOM   1851 C  CD2 . HIS C 1 82 ? 4.037   64.722 92.196  1.00 40.48  ? 223 HIS C CD2 1 
ATOM   1852 C  CE1 . HIS C 1 82 ? 5.159   62.874 92.590  1.00 38.66  ? 223 HIS C CE1 1 
ATOM   1853 N  NE2 . HIS C 1 82 ? 4.210   63.665 93.061  1.00 40.26  ? 223 HIS C NE2 1 
ATOM   1854 N  N   . VAL C 1 83 ? 3.283   66.064 87.223  1.00 19.82  ? 224 VAL C N   1 
ATOM   1855 C  CA  . VAL C 1 83 ? 3.042   66.993 86.141  1.00 18.97  ? 224 VAL C CA  1 
ATOM   1856 C  C   . VAL C 1 83 ? 2.319   68.249 86.672  1.00 20.11  ? 224 VAL C C   1 
ATOM   1857 O  O   . VAL C 1 83 ? 1.294   68.148 87.324  1.00 22.27  ? 224 VAL C O   1 
ATOM   1858 C  CB  . VAL C 1 83 ? 2.201   66.404 85.018  1.00 24.12  ? 224 VAL C CB  1 
ATOM   1859 C  CG1 . VAL C 1 83 ? 1.765   67.555 84.075  1.00 27.48  ? 224 VAL C CG1 1 
ATOM   1860 C  CG2 . VAL C 1 83 ? 2.991   65.308 84.240  1.00 24.00  ? 224 VAL C CG2 1 
ATOM   1861 N  N   . GLU C 1 84 ? 2.885   69.409 86.393  1.00 22.92  ? 225 GLU C N   1 
ATOM   1862 C  CA  . GLU C 1 84 ? 2.330   70.677 86.890  1.00 29.72  ? 225 GLU C CA  1 
ATOM   1863 C  C   . GLU C 1 84 ? 2.027   71.591 85.717  1.00 27.15  ? 225 GLU C C   1 
ATOM   1864 O  O   . GLU C 1 84 ? 2.756   71.574 84.708  1.00 23.60  ? 225 GLU C O   1 
ATOM   1865 C  CB  . GLU C 1 84 ? 3.317   71.358 87.851  1.00 36.55  ? 225 GLU C CB  1 
ATOM   1866 C  CG  . GLU C 1 84 ? 3.350   70.727 89.216  1.00 44.53  ? 225 GLU C CG  1 
ATOM   1867 C  CD  . GLU C 1 84 ? 4.290   71.441 90.159  1.00 48.54  ? 225 GLU C CD  1 
ATOM   1868 O  OE1 . GLU C 1 84 ? 4.812   72.498 89.766  1.00 52.02  ? 225 GLU C OE1 1 
ATOM   1869 O  OE2 . GLU C 1 84 ? 4.521   70.936 91.280  1.00 48.45  ? 225 GLU C OE2 1 
ATOM   1870 N  N   . VAL C 1 85 ? 0.960   72.390 85.847  1.00 27.39  ? 226 VAL C N   1 
ATOM   1871 C  CA  . VAL C 1 85 ? 0.634   73.377 84.831  1.00 27.40  ? 226 VAL C CA  1 
ATOM   1872 C  C   . VAL C 1 85 ? 1.570   74.580 84.957  1.00 26.99  ? 226 VAL C C   1 
ATOM   1873 O  O   . VAL C 1 85 ? 1.832   75.043 86.069  1.00 28.13  ? 226 VAL C O   1 
ATOM   1874 C  CB  . VAL C 1 85 ? -0.832  73.823 84.880  1.00 28.79  ? 226 VAL C CB  1 
ATOM   1875 C  CG1 . VAL C 1 85 ? -1.118  74.710 83.696  1.00 36.37  ? 226 VAL C CG1 1 
ATOM   1876 C  CG2 . VAL C 1 85 ? -1.748  72.593 84.824  1.00 27.33  ? 226 VAL C CG2 1 
ATOM   1877 N  N   . LEU C 1 86 ? 2.085   75.040 83.820  1.00 18.76  ? 227 LEU C N   1 
ATOM   1878 C  CA  . LEU C 1 86 ? 2.968   76.212 83.798  1.00 21.92  ? 227 LEU C CA  1 
ATOM   1879 C  C   . LEU C 1 86 ? 2.159   77.427 84.253  1.00 24.47  ? 227 LEU C C   1 
ATOM   1880 O  O   . LEU C 1 86 ? 0.951   77.488 84.025  1.00 23.63  ? 227 LEU C O   1 
ATOM   1881 C  CB  . LEU C 1 86 ? 3.498   76.512 82.390  1.00 28.55  ? 227 LEU C CB  1 
ATOM   1882 C  CG  . LEU C 1 86 ? 4.414   75.446 81.791  1.00 33.61  ? 227 LEU C CG  1 
ATOM   1883 C  CD1 . LEU C 1 86 ? 4.836   75.831 80.377  1.00 36.05  ? 227 LEU C CD1 1 
ATOM   1884 C  CD2 . LEU C 1 86 ? 5.621   75.220 82.705  1.00 32.37  ? 227 LEU C CD2 1 
ATOM   1885 N  N   . GLU C 1 87 ? 2.838   78.348 84.932  1.00 27.67  ? 228 GLU C N   1 
ATOM   1886 C  CA  . GLU C 1 87 ? 2.226   79.578 85.433  1.00 34.44  ? 228 GLU C CA  1 
ATOM   1887 C  C   . GLU C 1 87 ? 1.630   80.368 84.289  1.00 34.61  ? 228 GLU C C   1 
ATOM   1888 O  O   . GLU C 1 87 ? 2.236   80.532 83.227  1.00 39.65  ? 228 GLU C O   1 
ATOM   1889 C  CB  . GLU C 1 87 ? 3.251   80.428 86.174  1.00 39.74  ? 228 GLU C CB  1 
ATOM   1890 C  CG  . GLU C 1 87 ? 3.662   79.825 87.508  1.00 48.35  ? 228 GLU C CG  1 
ATOM   1891 C  CD  . GLU C 1 87 ? 2.549   79.918 88.548  1.00 55.21  ? 228 GLU C CD  1 
ATOM   1892 O  OE1 . GLU C 1 87 ? 2.407   81.005 89.150  1.00 60.10  ? 228 GLU C OE1 1 
ATOM   1893 O  OE2 . GLU C 1 87 ? 1.821   78.922 88.762  1.00 52.38  ? 228 GLU C OE2 1 
ATOM   1894 N  N   . ASN C 1 88 ? 0.438   80.875 84.537  1.00 29.67  ? 229 ASN C N   1 
ATOM   1895 C  CA  . ASN C 1 88 ? -0.305  81.607 83.544  1.00 28.23  ? 229 ASN C CA  1 
ATOM   1896 C  C   . ASN C 1 88 ? 0.238   83.033 83.357  1.00 32.98  ? 229 ASN C C   1 
ATOM   1897 O  O   . ASN C 1 88 ? -0.324  84.005 83.877  1.00 37.59  ? 229 ASN C O   1 
ATOM   1898 C  CB  . ASN C 1 88 ? -1.766  81.672 83.960  1.00 36.25  ? 229 ASN C CB  1 
ATOM   1899 C  CG  . ASN C 1 88 ? -2.642  82.239 82.877  1.00 49.02  ? 229 ASN C CG  1 
ATOM   1900 O  OD1 . ASN C 1 88 ? -2.208  82.401 81.732  1.00 51.57  ? 229 ASN C OD1 1 
ATOM   1901 N  ND2 . ASN C 1 88 ? -3.893  82.529 83.221  1.00 56.91  ? 229 ASN C ND2 1 
ATOM   1902 N  N   . VAL C 1 89 ? 1.341   83.149 82.638  1.00 37.49  ? 230 VAL C N   1 
ATOM   1903 C  CA  . VAL C 1 89 ? 1.942   84.448 82.377  1.00 37.54  ? 230 VAL C CA  1 
ATOM   1904 C  C   . VAL C 1 89 ? 2.180   84.508 80.886  1.00 39.19  ? 230 VAL C C   1 
ATOM   1905 O  O   . VAL C 1 89 ? 2.783   83.601 80.322  1.00 39.66  ? 230 VAL C O   1 
ATOM   1906 C  CB  . VAL C 1 89 ? 3.265   84.625 83.128  1.00 37.92  ? 230 VAL C CB  1 
ATOM   1907 C  CG1 . VAL C 1 89 ? 3.965   85.925 82.670  1.00 36.23  ? 230 VAL C CG1 1 
ATOM   1908 C  CG2 . VAL C 1 89 ? 3.028   84.626 84.632  1.00 36.81  ? 230 VAL C CG2 1 
ATOM   1909 N  N   . PRO C 1 90 ? 1.700   85.576 80.242  1.00 37.24  ? 231 PRO C N   1 
ATOM   1910 C  CA  . PRO C 1 90 ? 1.652   85.621 78.772  1.00 39.40  ? 231 PRO C CA  1 
ATOM   1911 C  C   . PRO C 1 90 ? 2.985   85.290 78.071  1.00 36.94  ? 231 PRO C C   1 
ATOM   1912 O  O   . PRO C 1 90 ? 4.062   85.686 78.512  1.00 28.69  ? 231 PRO C O   1 
ATOM   1913 C  CB  . PRO C 1 90 ? 1.211   87.065 78.470  1.00 39.55  ? 231 PRO C CB  1 
ATOM   1914 C  CG  . PRO C 1 90 ? 0.523   87.537 79.728  1.00 41.00  ? 231 PRO C CG  1 
ATOM   1915 C  CD  . PRO C 1 90 ? 1.177   86.807 80.872  1.00 41.77  ? 231 PRO C CD  1 
ATOM   1916 N  N   . LEU C 1 91 ? 2.878   84.558 76.970  1.00 41.28  ? 232 LEU C N   1 
ATOM   1917 C  CA  . LEU C 1 91 ? 4.010   84.193 76.121  1.00 40.58  ? 232 LEU C CA  1 
ATOM   1918 C  C   . LEU C 1 91 ? 4.110   85.215 74.976  1.00 40.48  ? 232 LEU C C   1 
ATOM   1919 O  O   . LEU C 1 91 ? 3.095   85.797 74.587  1.00 44.44  ? 232 LEU C O   1 
ATOM   1920 C  CB  . LEU C 1 91 ? 3.777   82.790 75.557  1.00 41.36  ? 232 LEU C CB  1 
ATOM   1921 C  CG  . LEU C 1 91 ? 3.437   81.635 76.519  1.00 41.73  ? 232 LEU C CG  1 
ATOM   1922 C  CD1 . LEU C 1 91 ? 3.178   80.344 75.743  1.00 40.83  ? 232 LEU C CD1 1 
ATOM   1923 C  CD2 . LEU C 1 91 ? 4.536   81.409 77.575  1.00 41.39  ? 232 LEU C CD2 1 
ATOM   1924 N  N   . THR C 1 92 ? 5.296   85.445 74.421  1.00 29.51  ? 233 THR C N   1 
ATOM   1925 C  CA  . THR C 1 92 ? 5.417   86.506 73.409  1.00 31.30  ? 233 THR C CA  1 
ATOM   1926 C  C   . THR C 1 92 ? 4.597   86.355 72.102  1.00 81.06  ? 233 THR C C   1 
ATOM   1927 O  O   . THR C 1 92 ? 4.815   87.094 71.136  1.00 78.56  ? 233 THR C O   1 
ATOM   1928 C  CB  . THR C 1 92 ? 6.875   86.791 73.022  1.00 34.30  ? 233 THR C CB  1 
ATOM   1929 O  OG1 . THR C 1 92 ? 7.510   85.573 72.621  1.00 37.53  ? 233 THR C OG1 1 
ATOM   1930 C  CG2 . THR C 1 92 ? 7.646   87.455 74.188  1.00 33.15  ? 233 THR C CG2 1 
ATOM   1931 N  N   . THR C 1 93 ? 3.657   85.420 72.057  1.00 86.04  ? 234 THR C N   1 
ATOM   1932 C  CA  . THR C 1 93 ? 2.768   85.340 70.892  1.00 88.91  ? 234 THR C CA  1 
ATOM   1933 C  C   . THR C 1 93 ? 1.415   86.029 71.112  1.00 92.96  ? 234 THR C C   1 
ATOM   1934 O  O   . THR C 1 93 ? 0.434   85.728 70.431  1.00 92.96  ? 234 THR C O   1 
ATOM   1935 C  CB  . THR C 1 93 ? 2.526   83.891 70.464  1.00 83.53  ? 234 THR C CB  1 
ATOM   1936 O  OG1 . THR C 1 93 ? 2.101   83.134 71.600  1.00 83.03  ? 234 THR C OG1 1 
ATOM   1937 C  CG2 . THR C 1 93 ? 3.800   83.291 69.898  1.00 81.43  ? 234 THR C CG2 1 
ATOM   1938 N  N   . HIS C 1 94 ? 1.371   86.957 72.061  1.00 95.18  ? 235 HIS C N   1 
ATOM   1939 C  CA  . HIS C 1 94 ? 0.120   87.609 72.426  1.00 97.37  ? 235 HIS C CA  1 
ATOM   1940 C  C   . HIS C 1 94 ? 0.358   89.045 72.910  1.00 97.60  ? 235 HIS C C   1 
ATOM   1941 O  O   . HIS C 1 94 ? 0.881   89.894 72.184  1.00 97.46  ? 235 HIS C O   1 
ATOM   1942 C  CB  . HIS C 1 94 ? -0.610  86.794 73.505  1.00 98.75  ? 235 HIS C CB  1 
ATOM   1943 C  CG  . HIS C 1 94 ? -0.322  85.322 73.459  1.00 98.72  ? 235 HIS C CG  1 
ATOM   1944 N  ND1 . HIS C 1 94 ? 0.411   84.675 74.432  1.00 97.70  ? 235 HIS C ND1 1 
ATOM   1945 C  CD2 . HIS C 1 94 ? -0.668  84.371 72.558  1.00 98.59  ? 235 HIS C CD2 1 
ATOM   1946 C  CE1 . HIS C 1 94 ? 0.505   83.391 74.133  1.00 96.66  ? 235 HIS C CE1 1 
ATOM   1947 N  NE2 . HIS C 1 94 ? -0.141  83.181 73.000  1.00 97.63  ? 235 HIS C NE2 1 
ATOM   1948 N  N   . HIS D 1 10 ? 26.233  66.708 82.511  1.00 53.36  ? 151 HIS D N   1 
ATOM   1949 C  CA  . HIS D 1 10 ? 27.078  65.670 83.105  1.00 54.86  ? 151 HIS D CA  1 
ATOM   1950 C  C   . HIS D 1 10 ? 28.159  66.221 84.047  1.00 48.93  ? 151 HIS D C   1 
ATOM   1951 O  O   . HIS D 1 10 ? 28.588  65.538 84.986  1.00 36.15  ? 151 HIS D O   1 
ATOM   1952 C  CB  . HIS D 1 10 ? 27.701  64.775 82.029  1.00 62.69  ? 151 HIS D CB  1 
ATOM   1953 C  CG  . HIS D 1 10 ? 27.685  63.318 82.387  1.00 70.65  ? 151 HIS D CG  1 
ATOM   1954 N  ND1 . HIS D 1 10 ? 26.742  62.438 81.896  1.00 71.60  ? 151 HIS D ND1 1 
ATOM   1955 C  CD2 . HIS D 1 10 ? 28.474  62.595 83.215  1.00 72.45  ? 151 HIS D CD2 1 
ATOM   1956 C  CE1 . HIS D 1 10 ? 26.956  61.237 82.399  1.00 68.51  ? 151 HIS D CE1 1 
ATOM   1957 N  NE2 . HIS D 1 10 ? 27.999  61.306 83.204  1.00 70.80  ? 151 HIS D NE2 1 
HETATM 1958 N  N   . MSE D 1 11 ? 28.600  67.451 83.789  1.00 51.44  ? 152 MSE D N   1 
HETATM 1959 C  CA  . MSE D 1 11 ? 29.472  68.145 84.729  1.00 52.74  ? 152 MSE D CA  1 
HETATM 1960 C  C   . MSE D 1 11 ? 28.719  68.357 86.019  1.00 48.39  ? 152 MSE D C   1 
HETATM 1961 O  O   . MSE D 1 11 ? 29.228  68.091 87.110  1.00 41.87  ? 152 MSE D O   1 
HETATM 1962 C  CB  . MSE D 1 11 ? 29.873  69.512 84.193  1.00 56.74  ? 152 MSE D CB  1 
HETATM 1963 C  CG  . MSE D 1 11 ? 30.756  70.284 85.151  1.00 60.91  ? 152 MSE D CG  1 
HETATM 1964 SE SE  . MSE D 1 11 ? 32.387  69.282 85.554  1.00 104.33 ? 152 MSE D SE  1 
HETATM 1965 C  CE  . MSE D 1 11 ? 33.600  70.763 85.925  1.00 77.54  ? 152 MSE D CE  1 
ATOM   1966 N  N   . GLN D 1 12 ? 27.493  68.847 85.873  1.00 48.02  ? 153 GLN D N   1 
ATOM   1967 C  CA  . GLN D 1 12 ? 26.624  69.080 87.010  1.00 47.83  ? 153 GLN D CA  1 
ATOM   1968 C  C   . GLN D 1 12 ? 26.037  67.770 87.542  1.00 45.38  ? 153 GLN D C   1 
ATOM   1969 O  O   . GLN D 1 12 ? 26.046  67.536 88.749  1.00 49.89  ? 153 GLN D O   1 
ATOM   1970 C  CB  . GLN D 1 12 ? 25.510  70.070 86.643  1.00 51.68  ? 153 GLN D CB  1 
ATOM   1971 N  N   . LYS D 1 13 ? 25.535  66.910 86.663  1.00 36.09  ? 154 LYS D N   1 
ATOM   1972 C  CA  . LYS D 1 13 ? 24.886  65.688 87.146  1.00 31.32  ? 154 LYS D CA  1 
ATOM   1973 C  C   . LYS D 1 13 ? 25.466  64.399 86.565  1.00 27.25  ? 154 LYS D C   1 
ATOM   1974 O  O   . LYS D 1 13 ? 25.022  63.918 85.506  1.00 29.53  ? 154 LYS D O   1 
ATOM   1975 C  CB  . LYS D 1 13 ? 23.373  65.757 86.919  1.00 34.44  ? 154 LYS D CB  1 
ATOM   1976 C  CG  . LYS D 1 13 ? 22.669  66.802 87.773  1.00 38.14  ? 154 LYS D CG  1 
ATOM   1977 C  CD  . LYS D 1 13 ? 21.330  67.222 87.155  1.00 41.56  ? 154 LYS D CD  1 
ATOM   1978 C  CE  . LYS D 1 13 ? 20.743  68.464 87.845  1.00 44.17  ? 154 LYS D CE  1 
ATOM   1979 N  NZ  . LYS D 1 13 ? 20.519  68.313 89.318  1.00 42.46  ? 154 LYS D NZ  1 
ATOM   1980 N  N   . PRO D 1 14 ? 26.450  63.825 87.263  1.00 29.06  ? 155 PRO D N   1 
ATOM   1981 C  CA  . PRO D 1 14 ? 27.006  62.557 86.762  1.00 28.23  ? 155 PRO D CA  1 
ATOM   1982 C  C   . PRO D 1 14 ? 26.043  61.417 87.043  1.00 23.00  ? 155 PRO D C   1 
ATOM   1983 O  O   . PRO D 1 14 ? 25.555  61.259 88.187  1.00 22.19  ? 155 PRO D O   1 
ATOM   1984 C  CB  . PRO D 1 14 ? 28.264  62.362 87.605  1.00 27.69  ? 155 PRO D CB  1 
ATOM   1985 C  CG  . PRO D 1 14 ? 27.949  63.058 88.903  1.00 31.94  ? 155 PRO D CG  1 
ATOM   1986 C  CD  . PRO D 1 14 ? 27.096  64.253 88.526  1.00 29.83  ? 155 PRO D CD  1 
ATOM   1987 N  N   . ILE D 1 15 ? 25.815  60.605 86.009  1.00 21.10  ? 156 ILE D N   1 
ATOM   1988 C  CA  . ILE D 1 15 ? 24.908  59.453 86.126  1.00 18.70  ? 156 ILE D CA  1 
ATOM   1989 C  C   . ILE D 1 15 ? 25.538  58.215 85.467  1.00 19.30  ? 156 ILE D C   1 
ATOM   1990 O  O   . ILE D 1 15 ? 26.529  58.306 84.756  1.00 19.04  ? 156 ILE D O   1 
ATOM   1991 C  CB  . ILE D 1 15 ? 23.504  59.762 85.487  1.00 24.13  ? 156 ILE D CB  1 
ATOM   1992 C  CG1 . ILE D 1 15 ? 23.663  60.241 84.037  1.00 26.80  ? 156 ILE D CG1 1 
ATOM   1993 C  CG2 . ILE D 1 15 ? 22.772  60.857 86.262  1.00 19.88  ? 156 ILE D CG2 1 
ATOM   1994 C  CD1 . ILE D 1 15 ? 23.300  59.216 82.987  1.00 25.33  ? 156 ILE D CD1 1 
ATOM   1995 N  N   . VAL D 1 16 ? 24.915  57.064 85.675  1.00 15.48  ? 157 VAL D N   1 
ATOM   1996 C  CA  . VAL D 1 16 ? 25.334  55.843 85.046  1.00 13.15  ? 157 VAL D CA  1 
ATOM   1997 C  C   . VAL D 1 16 ? 24.053  55.241 84.515  1.00 15.77  ? 157 VAL D C   1 
ATOM   1998 O  O   . VAL D 1 16 ? 23.001  55.189 85.212  1.00 14.82  ? 157 VAL D O   1 
ATOM   1999 C  CB  . VAL D 1 16 ? 25.986  54.867 86.102  1.00 21.72  ? 157 VAL D CB  1 
ATOM   2000 C  CG1 . VAL D 1 16 ? 26.245  53.517 85.509  1.00 18.65  ? 157 VAL D CG1 1 
ATOM   2001 C  CG2 . VAL D 1 16 ? 27.313  55.460 86.643  1.00 25.88  ? 157 VAL D CG2 1 
ATOM   2002 N  N   . ARG D 1 17 ? 24.128  54.817 83.265  1.00 14.33  ? 158 ARG D N   1 
ATOM   2003 C  CA  . ARG D 1 17 ? 23.021  54.149 82.602  1.00 15.02  ? 158 ARG D CA  1 
ATOM   2004 C  C   . ARG D 1 17 ? 23.112  52.657 82.917  1.00 20.20  ? 158 ARG D C   1 
ATOM   2005 O  O   . ARG D 1 17 ? 24.178  52.042 82.742  1.00 20.75  ? 158 ARG D O   1 
ATOM   2006 C  CB  . ARG D 1 17 ? 23.159  54.376 81.080  1.00 21.86  ? 158 ARG D CB  1 
ATOM   2007 C  CG  . ARG D 1 17 ? 22.977  55.846 80.640  1.00 25.51  ? 158 ARG D CG  1 
ATOM   2008 C  CD  . ARG D 1 17 ? 23.389  56.019 79.170  1.00 33.29  ? 158 ARG D CD  1 
ATOM   2009 N  NE  . ARG D 1 17 ? 24.815  55.763 79.049  1.00 45.60  ? 158 ARG D NE  1 
ATOM   2010 C  CZ  . ARG D 1 17 ? 25.535  55.891 77.940  1.00 57.03  ? 158 ARG D CZ  1 
ATOM   2011 N  NH1 . ARG D 1 17 ? 24.973  56.273 76.801  1.00 58.67  ? 158 ARG D NH1 1 
ATOM   2012 N  NH2 . ARG D 1 17 ? 26.836  55.625 77.978  1.00 62.42  ? 158 ARG D NH2 1 
ATOM   2013 N  N   . VAL D 1 18 ? 22.005  52.068 83.358  1.00 20.78  ? 159 VAL D N   1 
ATOM   2014 C  CA  . VAL D 1 18 ? 22.008  50.662 83.798  1.00 16.45  ? 159 VAL D CA  1 
ATOM   2015 C  C   . VAL D 1 18 ? 20.987  49.839 83.030  1.00 16.19  ? 159 VAL D C   1 
ATOM   2016 O  O   . VAL D 1 18 ? 19.792  50.053 83.155  1.00 21.35  ? 159 VAL D O   1 
ATOM   2017 C  CB  . VAL D 1 18 ? 21.693  50.525 85.313  1.00 16.36  ? 159 VAL D CB  1 
ATOM   2018 C  CG1 . VAL D 1 18 ? 21.738  49.020 85.763  1.00 19.73  ? 159 VAL D CG1 1 
ATOM   2019 C  CG2 . VAL D 1 18 ? 22.689  51.390 86.145  1.00 18.39  ? 159 VAL D CG2 1 
ATOM   2020 N  N   . PHE D 1 19 ? 21.461  48.862 82.273  1.00 20.46  ? 160 PHE D N   1 
ATOM   2021 C  CA  . PHE D 1 19 ? 20.560  47.923 81.655  1.00 20.12  ? 160 PHE D CA  1 
ATOM   2022 C  C   . PHE D 1 19 ? 20.180  46.799 82.589  1.00 23.36  ? 160 PHE D C   1 
ATOM   2023 O  O   . PHE D 1 19 ? 21.037  46.150 83.182  1.00 26.27  ? 160 PHE D O   1 
ATOM   2024 C  CB  . PHE D 1 19 ? 21.178  47.394 80.360  1.00 21.80  ? 160 PHE D CB  1 
ATOM   2025 C  CG  . PHE D 1 19 ? 21.285  48.430 79.340  1.00 21.96  ? 160 PHE D CG  1 
ATOM   2026 C  CD1 . PHE D 1 19 ? 22.386  49.273 79.312  1.00 18.30  ? 160 PHE D CD1 1 
ATOM   2027 C  CD2 . PHE D 1 19 ? 20.225  48.680 78.480  1.00 27.76  ? 160 PHE D CD2 1 
ATOM   2028 C  CE1 . PHE D 1 19 ? 22.484  50.276 78.377  1.00 26.88  ? 160 PHE D CE1 1 
ATOM   2029 C  CE2 . PHE D 1 19 ? 20.321  49.715 77.545  1.00 29.12  ? 160 PHE D CE2 1 
ATOM   2030 C  CZ  . PHE D 1 19 ? 21.447  50.504 77.492  1.00 28.07  ? 160 PHE D CZ  1 
ATOM   2031 N  N   . LEU D 1 20 ? 18.874  46.578 82.731  1.00 24.97  ? 161 LEU D N   1 
ATOM   2032 C  CA  . LEU D 1 20 ? 18.361  45.578 83.666  1.00 24.75  ? 161 LEU D CA  1 
ATOM   2033 C  C   . LEU D 1 20 ? 17.837  44.359 82.917  1.00 28.42  ? 161 LEU D C   1 
ATOM   2034 O  O   . LEU D 1 20 ? 17.617  44.397 81.691  1.00 20.56  ? 161 LEU D O   1 
ATOM   2035 C  CB  . LEU D 1 20 ? 17.250  46.168 84.560  1.00 20.17  ? 161 LEU D CB  1 
ATOM   2036 C  CG  . LEU D 1 20 ? 17.820  47.349 85.356  1.00 24.95  ? 161 LEU D CG  1 
ATOM   2037 C  CD1 . LEU D 1 20 ? 16.747  48.147 86.144  1.00 15.35  ? 161 LEU D CD1 1 
ATOM   2038 C  CD2 . LEU D 1 20 ? 18.926  46.835 86.283  1.00 22.05  ? 161 LEU D CD2 1 
ATOM   2039 N  N   . PRO D 1 21 ? 17.637  43.267 83.658  1.00 30.25  ? 162 PRO D N   1 
ATOM   2040 C  CA  . PRO D 1 21 ? 16.984  42.062 83.119  1.00 35.49  ? 162 PRO D CA  1 
ATOM   2041 C  C   . PRO D 1 21 ? 15.616  42.394 82.444  1.00 29.58  ? 162 PRO D C   1 
ATOM   2042 O  O   . PRO D 1 21 ? 14.964  43.423 82.762  1.00 24.02  ? 162 PRO D O   1 
ATOM   2043 C  CB  . PRO D 1 21 ? 16.778  41.175 84.362  1.00 34.98  ? 162 PRO D CB  1 
ATOM   2044 C  CG  . PRO D 1 21 ? 17.706  41.693 85.393  1.00 28.96  ? 162 PRO D CG  1 
ATOM   2045 C  CD  . PRO D 1 21 ? 17.937  43.171 85.095  1.00 27.67  ? 162 PRO D CD  1 
ATOM   2046 N  N   . ASN D 1 22 ? 15.203  41.554 81.492  1.00 28.31  ? 163 ASN D N   1 
ATOM   2047 C  CA  . ASN D 1 22 ? 13.929  41.742 80.766  1.00 35.35  ? 163 ASN D CA  1 
ATOM   2048 C  C   . ASN D 1 22 ? 13.786  42.997 79.886  1.00 32.17  ? 163 ASN D C   1 
ATOM   2049 O  O   . ASN D 1 22 ? 12.702  43.563 79.793  1.00 29.43  ? 163 ASN D O   1 
ATOM   2050 C  CB  . ASN D 1 22 ? 12.758  41.667 81.738  1.00 40.61  ? 163 ASN D CB  1 
ATOM   2051 C  CG  . ASN D 1 22 ? 12.634  40.303 82.354  1.00 50.76  ? 163 ASN D CG  1 
ATOM   2052 O  OD1 . ASN D 1 22 ? 12.424  40.175 83.556  1.00 54.05  ? 163 ASN D OD1 1 
ATOM   2053 N  ND2 . ASN D 1 22 ? 12.814  39.260 81.536  1.00 51.42  ? 163 ASN D ND2 1 
ATOM   2054 N  N   . LYS D 1 23 ? 14.874  43.414 79.247  1.00 31.12  ? 164 LYS D N   1 
ATOM   2055 C  CA  . LYS D 1 23 ? 14.863  44.574 78.346  1.00 30.33  ? 164 LYS D CA  1 
ATOM   2056 C  C   . LYS D 1 23 ? 14.556  45.878 79.075  1.00 24.52  ? 164 LYS D C   1 
ATOM   2057 O  O   . LYS D 1 23 ? 14.100  46.854 78.461  1.00 27.78  ? 164 LYS D O   1 
ATOM   2058 C  CB  . LYS D 1 23 ? 13.858  44.372 77.206  1.00 33.37  ? 164 LYS D CB  1 
ATOM   2059 C  CG  . LYS D 1 23 ? 14.109  43.136 76.368  1.00 44.06  ? 164 LYS D CG  1 
ATOM   2060 C  CD  . LYS D 1 23 ? 15.601  42.910 76.138  1.00 51.49  ? 164 LYS D CD  1 
ATOM   2061 C  CE  . LYS D 1 23 ? 15.898  41.510 75.574  1.00 58.53  ? 164 LYS D CE  1 
ATOM   2062 N  NZ  . LYS D 1 23 ? 15.324  41.275 74.205  1.00 62.87  ? 164 LYS D NZ  1 
ATOM   2063 N  N   . GLN D 1 24 ? 14.811  45.919 80.368  1.00 19.13  ? 165 GLN D N   1 
ATOM   2064 C  CA  . GLN D 1 24 ? 14.446  47.117 81.162  1.00 21.12  ? 165 GLN D CA  1 
ATOM   2065 C  C   . GLN D 1 24 ? 15.689  47.963 81.556  1.00 13.42  ? 165 GLN D C   1 
ATOM   2066 O  O   . GLN D 1 24 ? 16.827  47.527 81.394  1.00 16.61  ? 165 GLN D O   1 
ATOM   2067 C  CB  . GLN D 1 24 ? 13.646  46.712 82.391  1.00 24.66  ? 165 GLN D CB  1 
ATOM   2068 C  CG  . GLN D 1 24 ? 12.253  46.176 82.031  1.00 25.43  ? 165 GLN D CG  1 
ATOM   2069 C  CD  . GLN D 1 24 ? 11.288  46.099 83.205  1.00 25.54  ? 165 GLN D CD  1 
ATOM   2070 O  OE1 . GLN D 1 24 ? 11.518  46.689 84.266  1.00 28.55  ? 165 GLN D OE1 1 
ATOM   2071 N  NE2 . GLN D 1 24 ? 10.175  45.359 83.011  1.00 28.52  ? 165 GLN D NE2 1 
ATOM   2072 N  N   . ARG D 1 25 ? 15.469  49.192 81.986  1.00 19.65  ? 166 ARG D N   1 
ATOM   2073 C  CA  . ARG D 1 25 ? 16.621  50.087 82.288  1.00 22.36  ? 166 ARG D CA  1 
ATOM   2074 C  C   . ARG D 1 25 ? 16.362  51.054 83.430  1.00 21.60  ? 166 ARG D C   1 
ATOM   2075 O  O   . ARG D 1 25 ? 15.230  51.206 83.880  1.00 26.61  ? 166 ARG D O   1 
ATOM   2076 C  CB  . ARG D 1 25 ? 17.050  50.879 81.039  1.00 30.71  ? 166 ARG D CB  1 
ATOM   2077 C  CG  . ARG D 1 25 ? 16.098  50.734 79.871  1.00 37.06  ? 166 ARG D CG  1 
ATOM   2078 C  CD  . ARG D 1 25 ? 16.378  51.735 78.780  1.00 34.92  ? 166 ARG D CD  1 
ATOM   2079 N  NE  . ARG D 1 25 ? 16.714  51.078 77.534  1.00 31.43  ? 166 ARG D NE  1 
ATOM   2080 C  CZ  . ARG D 1 25 ? 16.551  51.622 76.329  1.00 34.78  ? 166 ARG D CZ  1 
ATOM   2081 N  NH1 . ARG D 1 25 ? 16.024  52.839 76.202  1.00 35.01  ? 166 ARG D NH1 1 
ATOM   2082 N  NH2 . ARG D 1 25 ? 16.896  50.930 75.241  1.00 31.52  ? 166 ARG D NH2 1 
ATOM   2083 N  N   . THR D 1 26 ? 17.430  51.705 83.879  1.00 24.79  ? 167 THR D N   1 
ATOM   2084 C  CA  . THR D 1 26 ? 17.351  52.729 84.890  1.00 22.93  ? 167 THR D CA  1 
ATOM   2085 C  C   . THR D 1 26 ? 18.623  53.598 84.830  1.00 21.24  ? 167 THR D C   1 
ATOM   2086 O  O   . THR D 1 26 ? 19.660  53.217 84.253  1.00 18.92  ? 167 THR D O   1 
ATOM   2087 C  CB  . THR D 1 26 ? 17.133  52.125 86.329  1.00 21.33  ? 167 THR D CB  1 
ATOM   2088 O  OG1 . THR D 1 26 ? 16.844  53.192 87.260  1.00 24.20  ? 167 THR D OG1 1 
ATOM   2089 C  CG2 . THR D 1 26 ? 18.373  51.370 86.791  1.00 23.97  ? 167 THR D CG2 1 
ATOM   2090 N  N   . VAL D 1 27 ? 18.517  54.785 85.403  1.00 21.47  ? 168 VAL D N   1 
ATOM   2091 C  CA  . VAL D 1 27 ? 19.643  55.697 85.546  1.00 22.84  ? 168 VAL D CA  1 
ATOM   2092 C  C   . VAL D 1 27 ? 19.848  55.899 87.054  1.00 28.18  ? 168 VAL D C   1 
ATOM   2093 O  O   . VAL D 1 27 ? 18.859  56.033 87.805  1.00 28.37  ? 168 VAL D O   1 
ATOM   2094 C  CB  . VAL D 1 27 ? 19.360  57.088 84.859  1.00 29.39  ? 168 VAL D CB  1 
ATOM   2095 C  CG1 . VAL D 1 27 ? 20.370  58.157 85.303  1.00 33.61  ? 168 VAL D CG1 1 
ATOM   2096 C  CG2 . VAL D 1 27 ? 19.394  56.965 83.360  1.00 25.24  ? 168 VAL D CG2 1 
ATOM   2097 N  N   . VAL D 1 28 ? 21.116  55.925 87.479  1.00 22.04  ? 169 VAL D N   1 
ATOM   2098 C  CA  . VAL D 1 28 ? 21.467  56.119 88.880  1.00 15.97  ? 169 VAL D CA  1 
ATOM   2099 C  C   . VAL D 1 28 ? 22.479  57.231 88.963  1.00 17.42  ? 169 VAL D C   1 
ATOM   2100 O  O   . VAL D 1 28 ? 23.275  57.417 88.050  1.00 16.39  ? 169 VAL D O   1 
ATOM   2101 C  CB  . VAL D 1 28 ? 22.018  54.817 89.601  1.00 29.11  ? 169 VAL D CB  1 
ATOM   2102 C  CG1 . VAL D 1 28 ? 21.068  53.620 89.415  1.00 28.11  ? 169 VAL D CG1 1 
ATOM   2103 C  CG2 . VAL D 1 28 ? 23.483  54.462 89.200  1.00 20.00  ? 169 VAL D CG2 1 
ATOM   2104 N  N   . PRO D 1 29 ? 22.405  58.029 90.030  1.00 24.19  ? 170 PRO D N   1 
ATOM   2105 C  CA  . PRO D 1 29 ? 23.372  59.127 90.155  1.00 24.88  ? 170 PRO D CA  1 
ATOM   2106 C  C   . PRO D 1 29 ? 24.729  58.504 90.465  1.00 28.97  ? 170 PRO D C   1 
ATOM   2107 O  O   . PRO D 1 29 ? 24.847  57.415 91.075  1.00 28.53  ? 170 PRO D O   1 
ATOM   2108 C  CB  . PRO D 1 29 ? 22.855  59.926 91.358  1.00 24.00  ? 170 PRO D CB  1 
ATOM   2109 C  CG  . PRO D 1 29 ? 22.078  58.950 92.154  1.00 26.66  ? 170 PRO D CG  1 
ATOM   2110 C  CD  . PRO D 1 29 ? 21.423  58.014 91.132  1.00 24.68  ? 170 PRO D CD  1 
ATOM   2111 N  N   . ALA D 1 30 ? 25.765  59.169 90.017  1.00 24.28  ? 171 ALA D N   1 
ATOM   2112 C  CA  . ALA D 1 30 ? 27.089  58.597 90.178  1.00 28.93  ? 171 ALA D CA  1 
ATOM   2113 C  C   . ALA D 1 30 ? 27.862  59.312 91.300  1.00 26.29  ? 171 ALA D C   1 
ATOM   2114 O  O   . ALA D 1 30 ? 28.834  59.971 91.043  1.00 30.83  ? 171 ALA D O   1 
ATOM   2115 C  CB  . ALA D 1 30 ? 27.833  58.641 88.862  1.00 29.39  ? 171 ALA D CB  1 
ATOM   2116 N  N   . ARG D 1 31 ? 27.410  59.138 92.541  1.00 30.41  ? 172 ARG D N   1 
ATOM   2117 C  CA  . ARG D 1 31 ? 27.964  59.851 93.694  1.00 37.17  ? 172 ARG D CA  1 
ATOM   2118 C  C   . ARG D 1 31 ? 29.174  59.168 94.291  1.00 30.92  ? 172 ARG D C   1 
ATOM   2119 O  O   . ARG D 1 31 ? 29.143  57.968 94.524  1.00 31.35  ? 172 ARG D O   1 
ATOM   2120 C  CB  . ARG D 1 31 ? 26.916  59.977 94.801  1.00 48.81  ? 172 ARG D CB  1 
ATOM   2121 C  CG  . ARG D 1 31 ? 25.795  60.973 94.511  1.00 60.99  ? 172 ARG D CG  1 
ATOM   2122 C  CD  . ARG D 1 31 ? 24.904  61.180 95.733  1.00 67.95  ? 172 ARG D CD  1 
ATOM   2123 N  NE  . ARG D 1 31 ? 24.675  59.935 96.463  1.00 72.12  ? 172 ARG D NE  1 
ATOM   2124 C  CZ  . ARG D 1 31 ? 23.899  59.827 97.539  1.00 75.88  ? 172 ARG D CZ  1 
ATOM   2125 N  NH1 . ARG D 1 31 ? 23.251  60.890 98.015  1.00 74.89  ? 172 ARG D NH1 1 
ATOM   2126 N  NH2 . ARG D 1 31 ? 23.763  58.649 98.133  1.00 77.04  ? 172 ARG D NH2 1 
ATOM   2127 N  N   . CYS D 1 32 ? 30.217  59.942 94.611  1.00 28.17  ? 173 CYS D N   1 
ATOM   2128 C  CA  . CYS D 1 32 ? 31.403  59.380 95.291  1.00 30.95  ? 173 CYS D CA  1 
ATOM   2129 C  C   . CYS D 1 32 ? 31.051  58.649 96.594  1.00 28.84  ? 173 CYS D C   1 
ATOM   2130 O  O   . CYS D 1 32 ? 30.243  59.131 97.385  1.00 26.96  ? 173 CYS D O   1 
ATOM   2131 C  CB  . CYS D 1 32 ? 32.457  60.473 95.582  1.00 32.86  ? 173 CYS D CB  1 
ATOM   2132 S  SG  . CYS D 1 32 ? 33.082  61.246 94.117  1.00 58.23  ? 173 CYS D SG  1 
ATOM   2133 N  N   . GLY D 1 33 ? 31.645  57.472 96.783  1.00 27.53  ? 174 GLY D N   1 
ATOM   2134 C  CA  . GLY D 1 33 ? 31.609  56.783 98.055  1.00 26.53  ? 174 GLY D CA  1 
ATOM   2135 C  C   . GLY D 1 33 ? 30.461  55.803 98.110  1.00 33.17  ? 174 GLY D C   1 
ATOM   2136 O  O   . GLY D 1 33 ? 30.232  55.176 99.150  1.00 37.88  ? 174 GLY D O   1 
ATOM   2137 N  N   . VAL D 1 34 ? 29.716  55.706 97.005  1.00 27.15  ? 175 VAL D N   1 
ATOM   2138 C  CA  . VAL D 1 34 ? 28.521  54.863 96.945  1.00 26.56  ? 175 VAL D CA  1 
ATOM   2139 C  C   . VAL D 1 34 ? 28.832  53.634 96.078  1.00 27.49  ? 175 VAL D C   1 
ATOM   2140 O  O   . VAL D 1 34 ? 29.376  53.753 94.973  1.00 27.85  ? 175 VAL D O   1 
ATOM   2141 C  CB  . VAL D 1 34 ? 27.295  55.603 96.359  1.00 31.54  ? 175 VAL D CB  1 
ATOM   2142 C  CG1 . VAL D 1 34 ? 26.046  54.776 96.552  1.00 33.35  ? 175 VAL D CG1 1 
ATOM   2143 C  CG2 . VAL D 1 34 ? 27.131  56.976 96.985  1.00 38.99  ? 175 VAL D CG2 1 
ATOM   2144 N  N   . THR D 1 35 ? 28.509  52.462 96.596  1.00 21.16  ? 176 THR D N   1 
ATOM   2145 C  CA  . THR D 1 35 ? 28.694  51.244 95.848  1.00 21.88  ? 176 THR D CA  1 
ATOM   2146 C  C   . THR D 1 35 ? 27.664  51.108 94.749  1.00 20.76  ? 176 THR D C   1 
ATOM   2147 O  O   . THR D 1 35 ? 26.622  51.770 94.764  1.00 21.81  ? 176 THR D O   1 
ATOM   2148 C  CB  . THR D 1 35 ? 28.635  49.971 96.751  1.00 27.04  ? 176 THR D CB  1 
ATOM   2149 O  OG1 . THR D 1 35 ? 27.300  49.792 97.258  1.00 27.33  ? 176 THR D OG1 1 
ATOM   2150 C  CG2 . THR D 1 35 ? 29.693  50.042 97.890  1.00 17.93  ? 176 THR D CG2 1 
ATOM   2151 N  N   . VAL D 1 36 ? 27.983  50.230 93.791  1.00 20.21  ? 177 VAL D N   1 
ATOM   2152 C  CA  . VAL D 1 36 ? 27.097  49.887 92.696  1.00 17.27  ? 177 VAL D CA  1 
ATOM   2153 C  C   . VAL D 1 36 ? 25.899  49.169 93.310  1.00 19.87  ? 177 VAL D C   1 
ATOM   2154 O  O   . VAL D 1 36 ? 24.729  49.408 92.968  1.00 16.63  ? 177 VAL D O   1 
ATOM   2155 C  CB  . VAL D 1 36 ? 27.872  48.959 91.676  1.00 21.10  ? 177 VAL D CB  1 
ATOM   2156 C  CG1 . VAL D 1 36 ? 26.937  48.397 90.644  1.00 19.09  ? 177 VAL D CG1 1 
ATOM   2157 C  CG2 . VAL D 1 36 ? 28.988  49.747 91.002  1.00 26.72  ? 177 VAL D CG2 1 
ATOM   2158 N  N   . ARG D 1 37 ? 26.218  48.256 94.219  1.00 23.03  ? 178 ARG D N   1 
ATOM   2159 C  CA  . ARG D 1 37 ? 25.208  47.569 95.026  1.00 27.91  ? 178 ARG D CA  1 
ATOM   2160 C  C   . ARG D 1 37 ? 24.197  48.580 95.577  1.00 25.49  ? 178 ARG D C   1 
ATOM   2161 O  O   . ARG D 1 37 ? 23.006  48.543 95.249  1.00 22.63  ? 178 ARG D O   1 
ATOM   2162 C  CB  . ARG D 1 37 ? 25.907  46.792 96.171  1.00 34.34  ? 178 ARG D CB  1 
ATOM   2163 C  CG  . ARG D 1 37 ? 24.987  45.974 97.086  1.00 38.80  ? 178 ARG D CG  1 
ATOM   2164 C  CD  . ARG D 1 37 ? 25.731  45.520 98.355  1.00 37.36  ? 178 ARG D CD  1 
ATOM   2165 N  NE  . ARG D 1 37 ? 26.872  44.689 98.015  1.00 34.36  ? 178 ARG D NE  1 
ATOM   2166 C  CZ  . ARG D 1 37 ? 26.814  43.364 97.902  1.00 31.96  ? 178 ARG D CZ  1 
ATOM   2167 N  NH1 . ARG D 1 37 ? 25.684  42.711 98.146  1.00 36.03  ? 178 ARG D NH1 1 
ATOM   2168 N  NH2 . ARG D 1 37 ? 27.887  42.691 97.571  1.00 27.33  ? 178 ARG D NH2 1 
ATOM   2169 N  N   . ASP D 1 38 ? 24.669  49.517 96.388  1.00 24.89  ? 179 ASP D N   1 
ATOM   2170 C  CA  . ASP D 1 38 ? 23.745  50.502 96.950  1.00 26.46  ? 179 ASP D CA  1 
ATOM   2171 C  C   . ASP D 1 38 ? 23.022  51.383 95.938  1.00 23.81  ? 179 ASP D C   1 
ATOM   2172 O  O   . ASP D 1 38 ? 21.854  51.735 96.140  1.00 23.30  ? 179 ASP D O   1 
ATOM   2173 C  CB  . ASP D 1 38 ? 24.431  51.338 98.016  1.00 36.53  ? 179 ASP D CB  1 
ATOM   2174 C  CG  . ASP D 1 38 ? 24.502  50.608 99.326  1.00 49.43  ? 179 ASP D CG  1 
ATOM   2175 O  OD1 . ASP D 1 38 ? 23.675  49.690 99.519  1.00 50.79  ? 179 ASP D OD1 1 
ATOM   2176 O  OD2 . ASP D 1 38 ? 25.373  50.937 100.150 1.00 57.41  ? 179 ASP D OD2 1 
ATOM   2177 N  N   . SER D 1 39 ? 23.690  51.715 94.839  1.00 21.53  ? 180 SER D N   1 
ATOM   2178 C  CA  . SER D 1 39 ? 23.050  52.516 93.804  1.00 22.68  ? 180 SER D CA  1 
ATOM   2179 C  C   . SER D 1 39 ? 21.872  51.784 93.146  1.00 23.26  ? 180 SER D C   1 
ATOM   2180 O  O   . SER D 1 39 ? 20.882  52.401 92.720  1.00 17.98  ? 180 SER D O   1 
ATOM   2181 C  CB  . SER D 1 39 ? 24.071  52.902 92.733  1.00 16.00  ? 180 SER D CB  1 
ATOM   2182 O  OG  . SER D 1 39 ? 25.166  53.553 93.302  1.00 24.25  ? 180 SER D OG  1 
ATOM   2183 N  N   . LEU D 1 40 ? 21.991  50.470 93.011  1.00 26.97  ? 181 LEU D N   1 
ATOM   2184 C  CA  . LEU D 1 40 ? 20.992  49.722 92.240  1.00 26.86  ? 181 LEU D CA  1 
ATOM   2185 C  C   . LEU D 1 40 ? 19.970  48.932 93.070  1.00 29.56  ? 181 LEU D C   1 
ATOM   2186 O  O   . LEU D 1 40 ? 19.080  48.276 92.516  1.00 25.44  ? 181 LEU D O   1 
ATOM   2187 C  CB  . LEU D 1 40 ? 21.697  48.768 91.263  1.00 26.84  ? 181 LEU D CB  1 
ATOM   2188 C  CG  . LEU D 1 40 ? 22.342  49.419 90.035  1.00 27.37  ? 181 LEU D CG  1 
ATOM   2189 C  CD1 . LEU D 1 40 ? 23.257  48.463 89.316  1.00 23.22  ? 181 LEU D CD1 1 
ATOM   2190 C  CD2 . LEU D 1 40 ? 21.250  49.937 89.126  1.00 24.24  ? 181 LEU D CD2 1 
ATOM   2191 N  N   . LYS D 1 41 ? 20.125  48.972 94.385  1.00 29.38  ? 182 LYS D N   1 
ATOM   2192 C  CA  . LYS D 1 41 ? 19.320  48.158 95.295  1.00 25.68  ? 182 LYS D CA  1 
ATOM   2193 C  C   . LYS D 1 41 ? 17.791  48.367 95.121  1.00 25.86  ? 182 LYS D C   1 
ATOM   2194 O  O   . LYS D 1 41 ? 16.989  47.417 95.119  1.00 23.83  ? 182 LYS D O   1 
ATOM   2195 C  CB  . LYS D 1 41 ? 19.755  48.510 96.723  1.00 35.99  ? 182 LYS D CB  1 
ATOM   2196 C  CG  . LYS D 1 41 ? 18.901  47.946 97.829  1.00 49.77  ? 182 LYS D CG  1 
ATOM   2197 C  CD  . LYS D 1 41 ? 19.419  48.419 99.184  1.00 55.95  ? 182 LYS D CD  1 
ATOM   2198 C  CE  . LYS D 1 41 ? 20.830  47.912 99.443  1.00 56.69  ? 182 LYS D CE  1 
ATOM   2199 N  NZ  . LYS D 1 41 ? 21.335  48.296 100.793 1.00 57.19  ? 182 LYS D NZ  1 
ATOM   2200 N  N   . LYS D 1 42 ? 17.402  49.627 94.978  1.00 24.83  ? 183 LYS D N   1 
ATOM   2201 C  CA  . LYS D 1 42 ? 15.995  49.970 94.840  1.00 33.51  ? 183 LYS D CA  1 
ATOM   2202 C  C   . LYS D 1 42 ? 15.415  49.477 93.507  1.00 29.00  ? 183 LYS D C   1 
ATOM   2203 O  O   . LYS D 1 42 ? 14.362  48.827 93.486  1.00 26.35  ? 183 LYS D O   1 
ATOM   2204 C  CB  . LYS D 1 42 ? 15.777  51.479 95.016  1.00 36.97  ? 183 LYS D CB  1 
ATOM   2205 C  CG  . LYS D 1 42 ? 14.297  51.841 95.104  1.00 47.82  ? 183 LYS D CG  1 
ATOM   2206 C  CD  . LYS D 1 42 ? 14.082  53.338 95.307  1.00 58.19  ? 183 LYS D CD  1 
ATOM   2207 C  CE  . LYS D 1 42 ? 14.136  54.116 93.989  1.00 63.88  ? 183 LYS D CE  1 
ATOM   2208 N  NZ  . LYS D 1 42 ? 15.488  54.113 93.337  1.00 65.19  ? 183 LYS D NZ  1 
ATOM   2209 N  N   . ALA D 1 43 ? 16.112  49.752 92.405  1.00 26.04  ? 184 ALA D N   1 
ATOM   2210 C  CA  . ALA D 1 43 ? 15.696  49.260 91.085  1.00 25.76  ? 184 ALA D CA  1 
ATOM   2211 C  C   . ALA D 1 43 ? 15.535  47.722 91.067  1.00 27.10  ? 184 ALA D C   1 
ATOM   2212 O  O   . ALA D 1 43 ? 14.605  47.168 90.467  1.00 29.47  ? 184 ALA D O   1 
ATOM   2213 C  CB  . ALA D 1 43 ? 16.672  49.733 89.990  1.00 26.50  ? 184 ALA D CB  1 
ATOM   2214 N  N   . LEU D 1 44 ? 16.419  47.023 91.761  1.00 23.59  ? 185 LEU D N   1 
ATOM   2215 C  CA  . LEU D 1 44 ? 16.342  45.571 91.737  1.00 28.69  ? 185 LEU D CA  1 
ATOM   2216 C  C   . LEU D 1 44 ? 15.192  45.067 92.611  1.00 26.19  ? 185 LEU D C   1 
ATOM   2217 O  O   . LEU D 1 44 ? 14.460  44.131 92.228  1.00 27.55  ? 185 LEU D O   1 
ATOM   2218 C  CB  . LEU D 1 44 ? 17.675  44.936 92.157  1.00 28.77  ? 185 LEU D CB  1 
ATOM   2219 C  CG  . LEU D 1 44 ? 18.823  45.021 91.132  1.00 31.66  ? 185 LEU D CG  1 
ATOM   2220 C  CD1 . LEU D 1 44 ? 20.088  44.370 91.698  1.00 32.64  ? 185 LEU D CD1 1 
ATOM   2221 C  CD2 . LEU D 1 44 ? 18.437  44.367 89.824  1.00 26.28  ? 185 LEU D CD2 1 
HETATM 2222 N  N   A MSE D 1 45 ? 15.032  45.687 93.774  0.34 28.23  ? 186 MSE D N   1 
HETATM 2223 N  N   B MSE D 1 45 ? 15.054  45.686 93.778  0.66 27.84  ? 186 MSE D N   1 
HETATM 2224 C  CA  A MSE D 1 45 ? 13.994  45.290 94.723  0.34 30.73  ? 186 MSE D CA  1 
HETATM 2225 C  CA  B MSE D 1 45 ? 13.996  45.350 94.738  0.66 31.07  ? 186 MSE D CA  1 
HETATM 2226 C  C   A MSE D 1 45 ? 12.594  45.411 94.111  0.34 31.60  ? 186 MSE D C   1 
HETATM 2227 C  C   B MSE D 1 45 ? 12.616  45.396 94.082  0.66 31.56  ? 186 MSE D C   1 
HETATM 2228 O  O   A MSE D 1 45 ? 11.712  44.625 94.429  0.34 33.25  ? 186 MSE D O   1 
HETATM 2229 O  O   B MSE D 1 45 ? 11.780  44.544 94.326  0.66 33.41  ? 186 MSE D O   1 
HETATM 2230 C  CB  A MSE D 1 45 ? 14.093  46.121 96.003  0.34 33.44  ? 186 MSE D CB  1 
HETATM 2231 C  CB  B MSE D 1 45 ? 14.032  46.319 95.920  0.66 32.76  ? 186 MSE D CB  1 
HETATM 2232 C  CG  A MSE D 1 45 ? 13.246  45.607 97.167  0.34 37.95  ? 186 MSE D CG  1 
HETATM 2233 C  CG  B MSE D 1 45 ? 12.930  46.090 96.952  0.66 36.88  ? 186 MSE D CG  1 
HETATM 2234 SE SE  A MSE D 1 45 ? 13.929  43.970 98.005  0.34 63.85  ? 186 MSE D SE  1 
HETATM 2235 SE SE  B MSE D 1 45 ? 13.266  47.059 98.616  0.66 127.26 ? 186 MSE D SE  1 
HETATM 2236 C  CE  A MSE D 1 45 ? 13.105  42.660 96.815  0.34 38.79  ? 186 MSE D CE  1 
HETATM 2237 C  CE  B MSE D 1 45 ? 15.158  46.606 98.890  0.66 51.41  ? 186 MSE D CE  1 
HETATM 2238 N  N   . MSE D 1 46 ? 12.402  46.383 93.221  1.00 30.59  ? 187 MSE D N   1 
HETATM 2239 C  CA  . MSE D 1 46 ? 11.131  46.541 92.528  1.00 33.61  ? 187 MSE D CA  1 
HETATM 2240 C  C   . MSE D 1 46 ? 10.827  45.368 91.615  1.00 33.16  ? 187 MSE D C   1 
HETATM 2241 O  O   . MSE D 1 46 ? 9.675   45.096 91.328  1.00 29.38  ? 187 MSE D O   1 
HETATM 2242 C  CB  . MSE D 1 46 ? 11.126  47.828 91.693  1.00 31.23  ? 187 MSE D CB  1 
HETATM 2243 C  CG  . MSE D 1 46 ? 11.268  49.082 92.526  1.00 37.99  ? 187 MSE D CG  1 
HETATM 2244 SE SE  . MSE D 1 46 ? 10.987  50.707 91.450  1.00 108.22 ? 187 MSE D SE  1 
HETATM 2245 C  CE  . MSE D 1 46 ? 12.149  50.295 89.921  1.00 29.25  ? 187 MSE D CE  1 
ATOM   2246 N  N   . ARG D 1 47 ? 11.864  44.689 91.143  1.00 27.61  ? 188 ARG D N   1 
ATOM   2247 C  CA  . ARG D 1 47 ? 11.661  43.621 90.190  1.00 31.83  ? 188 ARG D CA  1 
ATOM   2248 C  C   . ARG D 1 47 ? 11.852  42.259 90.873  1.00 35.68  ? 188 ARG D C   1 
ATOM   2249 O  O   . ARG D 1 47 ? 11.999  41.234 90.205  1.00 38.81  ? 188 ARG D O   1 
ATOM   2250 C  CB  . ARG D 1 47 ? 12.610  43.810 89.011  1.00 31.91  ? 188 ARG D CB  1 
ATOM   2251 C  CG  . ARG D 1 47 ? 12.491  45.199 88.432  1.00 34.97  ? 188 ARG D CG  1 
ATOM   2252 C  CD  . ARG D 1 47 ? 13.680  45.572 87.617  1.00 32.62  ? 188 ARG D CD  1 
ATOM   2253 N  NE  . ARG D 1 47 ? 13.298  46.508 86.579  1.00 30.78  ? 188 ARG D NE  1 
ATOM   2254 C  CZ  . ARG D 1 47 ? 13.253  47.820 86.761  1.00 29.93  ? 188 ARG D CZ  1 
ATOM   2255 N  NH1 . ARG D 1 47 ? 13.578  48.334 87.945  1.00 21.99  ? 188 ARG D NH1 1 
ATOM   2256 N  NH2 . ARG D 1 47 ? 12.901  48.604 85.763  1.00 28.24  ? 188 ARG D NH2 1 
ATOM   2257 N  N   . GLY D 1 48 ? 11.847  42.281 92.207  1.00 33.83  ? 189 GLY D N   1 
ATOM   2258 C  CA  . GLY D 1 48 ? 12.028  41.093 93.032  1.00 38.04  ? 189 GLY D CA  1 
ATOM   2259 C  C   . GLY D 1 48 ? 13.455  40.542 93.097  1.00 38.31  ? 189 GLY D C   1 
ATOM   2260 O  O   . GLY D 1 48 ? 13.644  39.338 93.285  1.00 39.20  ? 189 GLY D O   1 
ATOM   2261 N  N   . LEU D 1 49 ? 14.446  41.421 92.958  1.00 32.06  ? 190 LEU D N   1 
ATOM   2262 C  CA  . LEU D 1 49 ? 15.849  41.000 92.897  1.00 35.77  ? 190 LEU D CA  1 
ATOM   2263 C  C   . LEU D 1 49 ? 16.739  41.664 93.958  1.00 32.23  ? 190 LEU D C   1 
ATOM   2264 O  O   . LEU D 1 49 ? 16.416  42.703 94.490  1.00 31.88  ? 190 LEU D O   1 
ATOM   2265 C  CB  . LEU D 1 49 ? 16.414  41.331 91.512  1.00 38.52  ? 190 LEU D CB  1 
ATOM   2266 C  CG  . LEU D 1 49 ? 15.663  40.774 90.312  1.00 41.94  ? 190 LEU D CG  1 
ATOM   2267 C  CD1 . LEU D 1 49 ? 16.301  41.278 89.045  1.00 42.82  ? 190 LEU D CD1 1 
ATOM   2268 C  CD2 . LEU D 1 49 ? 15.685  39.253 90.353  1.00 45.75  ? 190 LEU D CD2 1 
ATOM   2269 N  N   . ILE D 1 50 ? 17.887  41.067 94.229  1.00 36.96  ? 191 ILE D N   1 
ATOM   2270 C  CA  . ILE D 1 50 ? 18.873  41.653 95.122  1.00 36.91  ? 191 ILE D CA  1 
ATOM   2271 C  C   . ILE D 1 50 ? 20.245  41.433 94.500  1.00 34.91  ? 191 ILE D C   1 
ATOM   2272 O  O   . ILE D 1 50 ? 20.428  40.484 93.737  1.00 26.72  ? 191 ILE D O   1 
ATOM   2273 C  CB  . ILE D 1 50 ? 18.850  40.985 96.491  1.00 44.07  ? 191 ILE D CB  1 
ATOM   2274 C  CG1 . ILE D 1 50 ? 18.858  39.456 96.331  1.00 46.56  ? 191 ILE D CG1 1 
ATOM   2275 C  CG2 . ILE D 1 50 ? 17.614  41.410 97.252  1.00 44.63  ? 191 ILE D CG2 1 
ATOM   2276 C  CD1 . ILE D 1 50 ? 19.062  38.698 97.620  1.00 49.23  ? 191 ILE D CD1 1 
ATOM   2277 N  N   . PRO D 1 51 ? 21.217  42.314 94.818  1.00 34.38  ? 192 PRO D N   1 
ATOM   2278 C  CA  . PRO D 1 51 ? 22.504  42.256 94.097  1.00 22.28  ? 192 PRO D CA  1 
ATOM   2279 C  C   . PRO D 1 51 ? 23.181  40.875 94.212  1.00 34.38  ? 192 PRO D C   1 
ATOM   2280 O  O   . PRO D 1 51 ? 23.792  40.413 93.231  1.00 30.36  ? 192 PRO D O   1 
ATOM   2281 C  CB  . PRO D 1 51 ? 23.325  43.371 94.725  1.00 30.90  ? 192 PRO D CB  1 
ATOM   2282 C  CG  . PRO D 1 51 ? 22.301  44.330 95.360  1.00 36.15  ? 192 PRO D CG  1 
ATOM   2283 C  CD  . PRO D 1 51 ? 21.112  43.467 95.732  1.00 37.29  ? 192 PRO D CD  1 
ATOM   2284 N  N   . GLU D 1 52 ? 23.026  40.195 95.352  1.00 39.52  ? 193 GLU D N   1 
ATOM   2285 C  CA  . GLU D 1 52 ? 23.573  38.834 95.507  1.00 44.87  ? 193 GLU D CA  1 
ATOM   2286 C  C   . GLU D 1 52 ? 22.963  37.716 94.624  1.00 40.31  ? 193 GLU D C   1 
ATOM   2287 O  O   . GLU D 1 52 ? 23.425  36.575 94.674  1.00 39.70  ? 193 GLU D O   1 
ATOM   2288 C  CB  . GLU D 1 52 ? 23.569  38.405 96.978  1.00 49.66  ? 193 GLU D CB  1 
ATOM   2289 C  CG  . GLU D 1 52 ? 24.594  39.138 97.788  1.00 59.95  ? 193 GLU D CG  1 
ATOM   2290 C  CD  . GLU D 1 52 ? 24.737  38.613 99.203  1.00 71.09  ? 193 GLU D CD  1 
ATOM   2291 O  OE1 . GLU D 1 52 ? 24.159  37.543 99.520  1.00 74.98  ? 193 GLU D OE1 1 
ATOM   2292 O  OE2 . GLU D 1 52 ? 25.440  39.283 99.998  1.00 73.50  ? 193 GLU D OE2 1 
ATOM   2293 N  N   . CYS D 1 53 ? 21.925  38.016 93.846  1.00 35.48  ? 194 CYS D N   1 
ATOM   2294 C  CA  . CYS D 1 53 ? 21.385  37.022 92.917  1.00 30.49  ? 194 CYS D CA  1 
ATOM   2295 C  C   . CYS D 1 53 ? 21.635  37.413 91.479  1.00 24.97  ? 194 CYS D C   1 
ATOM   2296 O  O   . CYS D 1 53 ? 21.131  36.777 90.564  1.00 27.78  ? 194 CYS D O   1 
ATOM   2297 C  CB  . CYS D 1 53 ? 19.881  36.722 93.151  1.00 35.36  ? 194 CYS D CB  1 
ATOM   2298 S  SG  . CYS D 1 53 ? 18.639  38.004 92.709  1.00 52.32  ? 194 CYS D SG  1 
ATOM   2299 N  N   . CYS D 1 54 ? 22.455  38.442 91.293  1.00 22.89  ? 195 CYS D N   1 
ATOM   2300 C  CA  . CYS D 1 54 ? 22.696  39.002 89.967  1.00 24.38  ? 195 CYS D CA  1 
ATOM   2301 C  C   . CYS D 1 54 ? 24.193  39.194 89.731  1.00 22.17  ? 195 CYS D C   1 
ATOM   2302 O  O   . CYS D 1 54 ? 24.963  39.208 90.673  1.00 23.35  ? 195 CYS D O   1 
ATOM   2303 C  CB  . CYS D 1 54 ? 22.004  40.375 89.829  1.00 23.98  ? 195 CYS D CB  1 
ATOM   2304 S  SG  . CYS D 1 54 ? 20.222  40.348 89.915  1.00 27.64  ? 195 CYS D SG  1 
ATOM   2305 N  N   . ALA D 1 55 ? 24.576  39.376 88.473  1.00 22.00  ? 196 ALA D N   1 
ATOM   2306 C  CA  . ALA D 1 55 ? 25.910  39.883 88.174  1.00 23.80  ? 196 ALA D CA  1 
ATOM   2307 C  C   . ALA D 1 55 ? 25.841  41.255 87.503  1.00 17.07  ? 196 ALA D C   1 
ATOM   2308 O  O   . ALA D 1 55 ? 24.836  41.615 86.859  1.00 16.18  ? 196 ALA D O   1 
ATOM   2309 C  CB  . ALA D 1 55 ? 26.679  38.892 87.307  1.00 23.59  ? 196 ALA D CB  1 
ATOM   2310 N  N   . VAL D 1 56 ? 26.893  42.037 87.657  1.00 18.13  ? 197 VAL D N   1 
ATOM   2311 C  CA  . VAL D 1 56 ? 26.913  43.348 87.005  1.00 14.68  ? 197 VAL D CA  1 
ATOM   2312 C  C   . VAL D 1 56 ? 28.155  43.484 86.137  1.00 21.28  ? 197 VAL D C   1 
ATOM   2313 O  O   . VAL D 1 56 ? 29.221  42.977 86.500  1.00 18.66  ? 197 VAL D O   1 
ATOM   2314 C  CB  . VAL D 1 56 ? 26.747  44.512 88.043  1.00 20.17  ? 197 VAL D CB  1 
ATOM   2315 C  CG1 . VAL D 1 56 ? 27.778  44.436 89.150  1.00 20.65  ? 197 VAL D CG1 1 
ATOM   2316 C  CG2 . VAL D 1 56 ? 26.794  45.879 87.344  1.00 24.47  ? 197 VAL D CG2 1 
ATOM   2317 N  N   . TYR D 1 57 ? 28.000  44.124 84.975  1.00 21.32  ? 198 TYR D N   1 
ATOM   2318 C  CA  . TYR D 1 57 ? 29.105  44.338 84.032  1.00 23.95  ? 198 TYR D CA  1 
ATOM   2319 C  C   . TYR D 1 57 ? 29.174  45.763 83.522  1.00 30.82  ? 198 TYR D C   1 
ATOM   2320 O  O   . TYR D 1 57 ? 28.162  46.492 83.490  1.00 23.28  ? 198 TYR D O   1 
ATOM   2321 C  CB  . TYR D 1 57 ? 28.981  43.439 82.836  1.00 23.70  ? 198 TYR D CB  1 
ATOM   2322 C  CG  . TYR D 1 57 ? 28.640  42.027 83.184  1.00 28.66  ? 198 TYR D CG  1 
ATOM   2323 C  CD1 . TYR D 1 57 ? 29.616  41.041 83.206  1.00 36.21  ? 198 TYR D CD1 1 
ATOM   2324 C  CD2 . TYR D 1 57 ? 27.333  41.669 83.462  1.00 25.72  ? 198 TYR D CD2 1 
ATOM   2325 C  CE1 . TYR D 1 57 ? 29.297  39.734 83.523  1.00 39.10  ? 198 TYR D CE1 1 
ATOM   2326 C  CE2 . TYR D 1 57 ? 27.002  40.372 83.785  1.00 32.92  ? 198 TYR D CE2 1 
ATOM   2327 C  CZ  . TYR D 1 57 ? 27.973  39.406 83.799  1.00 36.98  ? 198 TYR D CZ  1 
ATOM   2328 O  OH  . TYR D 1 57 ? 27.615  38.115 84.133  1.00 40.35  ? 198 TYR D OH  1 
ATOM   2329 N  N   . ARG D 1 58 ? 30.376  46.179 83.135  1.00 26.97  ? 199 ARG D N   1 
ATOM   2330 C  CA  . ARG D 1 58 ? 30.516  47.449 82.447  1.00 28.69  ? 199 ARG D CA  1 
ATOM   2331 C  C   . ARG D 1 58 ? 30.722  47.019 81.033  1.00 38.08  ? 199 ARG D C   1 
ATOM   2332 O  O   . ARG D 1 58 ? 30.948  45.833 80.771  1.00 47.28  ? 199 ARG D O   1 
ATOM   2333 C  CB  . ARG D 1 58 ? 31.721  48.246 82.950  1.00 30.47  ? 199 ARG D CB  1 
ATOM   2334 C  CG  . ARG D 1 58 ? 33.031  47.507 82.787  1.00 43.67  ? 199 ARG D CG  1 
ATOM   2335 C  CD  . ARG D 1 58 ? 34.207  48.301 83.350  1.00 54.60  ? 199 ARG D CD  1 
ATOM   2336 N  NE  . ARG D 1 58 ? 34.274  49.677 82.866  1.00 61.23  ? 199 ARG D NE  1 
ATOM   2337 C  CZ  . ARG D 1 58 ? 35.301  50.489 83.108  1.00 69.02  ? 199 ARG D CZ  1 
ATOM   2338 N  NH1 . ARG D 1 58 ? 36.337  50.046 83.818  1.00 71.15  ? 199 ARG D NH1 1 
ATOM   2339 N  NH2 . ARG D 1 58 ? 35.304  51.733 82.638  1.00 71.32  ? 199 ARG D NH2 1 
ATOM   2340 N  N   . ILE D 1 59 ? 30.608  47.956 80.109  1.00 40.57  ? 200 ILE D N   1 
ATOM   2341 C  CA  . ILE D 1 59 ? 30.973  47.687 78.725  1.00 46.67  ? 200 ILE D CA  1 
ATOM   2342 C  C   . ILE D 1 59 ? 32.222  48.488 78.393  1.00 48.31  ? 200 ILE D C   1 
ATOM   2343 O  O   . ILE D 1 59 ? 32.318  49.655 78.781  1.00 48.97  ? 200 ILE D O   1 
ATOM   2344 C  CB  . ILE D 1 59 ? 29.846  48.069 77.747  1.00 48.26  ? 200 ILE D CB  1 
ATOM   2345 C  CG1 . ILE D 1 59 ? 28.531  47.393 78.163  1.00 43.47  ? 200 ILE D CG1 1 
ATOM   2346 C  CG2 . ILE D 1 59 ? 30.254  47.708 76.291  1.00 38.28  ? 200 ILE D CG2 1 
ATOM   2347 C  CD1 . ILE D 1 59 ? 28.566  45.863 78.084  1.00 37.31  ? 200 ILE D CD1 1 
ATOM   2348 N  N   . LYS D 1 64 ? 31.227  42.333 77.569  1.00 43.08  ? 205 LYS D N   1 
ATOM   2349 C  CA  . LYS D 1 64 ? 30.856  42.690 78.936  1.00 43.68  ? 205 LYS D CA  1 
ATOM   2350 C  C   . LYS D 1 64 ? 31.973  42.303 79.897  1.00 40.57  ? 205 LYS D C   1 
ATOM   2351 O  O   . LYS D 1 64 ? 32.451  41.174 79.881  1.00 40.54  ? 205 LYS D O   1 
ATOM   2352 C  CB  . LYS D 1 64 ? 29.550  42.001 79.358  1.00 46.17  ? 205 LYS D CB  1 
ATOM   2353 C  CG  . LYS D 1 64 ? 28.278  42.724 78.944  1.00 49.68  ? 205 LYS D CG  1 
ATOM   2354 C  CD  . LYS D 1 64 ? 27.071  42.139 79.666  1.00 53.62  ? 205 LYS D CD  1 
ATOM   2355 C  CE  . LYS D 1 64 ? 27.036  40.631 79.515  1.00 58.69  ? 205 LYS D CE  1 
ATOM   2356 N  NZ  . LYS D 1 64 ? 26.020  40.196 78.518  1.00 62.65  ? 205 LYS D NZ  1 
ATOM   2357 N  N   . LYS D 1 65 ? 32.386  43.242 80.736  1.00 34.58  ? 206 LYS D N   1 
ATOM   2358 C  CA  . LYS D 1 65 ? 33.457  42.957 81.686  1.00 33.84  ? 206 LYS D CA  1 
ATOM   2359 C  C   . LYS D 1 65 ? 32.888  43.070 83.085  1.00 29.98  ? 206 LYS D C   1 
ATOM   2360 O  O   . LYS D 1 65 ? 32.310  44.102 83.437  1.00 27.09  ? 206 LYS D O   1 
ATOM   2361 C  CB  . LYS D 1 65 ? 34.655  43.915 81.492  1.00 35.61  ? 206 LYS D CB  1 
ATOM   2362 C  CG  . LYS D 1 65 ? 35.415  43.768 80.150  1.00 41.55  ? 206 LYS D CG  1 
ATOM   2363 C  CD  . LYS D 1 65 ? 34.936  44.747 79.060  1.00 47.16  ? 206 LYS D CD  1 
ATOM   2364 C  CE  . LYS D 1 65 ? 35.699  46.106 79.083  1.00 88.08  ? 206 LYS D CE  1 
ATOM   2365 N  NZ  . LYS D 1 65 ? 35.283  47.138 78.040  1.00 86.35  ? 206 LYS D NZ  1 
ATOM   2366 N  N   . PRO D 1 66 ? 33.065  42.021 83.897  1.00 20.32  ? 207 PRO D N   1 
ATOM   2367 C  CA  . PRO D 1 66 ? 32.393  41.993 85.212  1.00 23.43  ? 207 PRO D CA  1 
ATOM   2368 C  C   . PRO D 1 66 ? 32.999  42.957 86.221  1.00 20.41  ? 207 PRO D C   1 
ATOM   2369 O  O   . PRO D 1 66 ? 34.218  43.083 86.299  1.00 18.59  ? 207 PRO D O   1 
ATOM   2370 C  CB  . PRO D 1 66 ? 32.616  40.565 85.688  1.00 22.35  ? 207 PRO D CB  1 
ATOM   2371 C  CG  . PRO D 1 66 ? 33.939  40.148 84.994  1.00 17.80  ? 207 PRO D CG  1 
ATOM   2372 C  CD  . PRO D 1 66 ? 33.877  40.811 83.644  1.00 21.01  ? 207 PRO D CD  1 
ATOM   2373 N  N   . ILE D 1 67 ? 32.157  43.586 87.034  1.00 21.15  ? 208 ILE D N   1 
ATOM   2374 C  CA  . ILE D 1 67 ? 32.702  44.447 88.080  1.00 22.94  ? 208 ILE D CA  1 
ATOM   2375 C  C   . ILE D 1 67 ? 32.147  44.029 89.409  1.00 18.82  ? 208 ILE D C   1 
ATOM   2376 O  O   . ILE D 1 67 ? 31.075  43.413 89.484  1.00 19.70  ? 208 ILE D O   1 
ATOM   2377 C  CB  . ILE D 1 67 ? 32.395  45.911 87.842  1.00 31.87  ? 208 ILE D CB  1 
ATOM   2378 C  CG1 . ILE D 1 67 ? 30.870  46.168 87.878  1.00 23.21  ? 208 ILE D CG1 1 
ATOM   2379 C  CG2 . ILE D 1 67 ? 33.080  46.390 86.537  1.00 32.72  ? 208 ILE D CG2 1 
ATOM   2380 C  CD1 . ILE D 1 67 ? 30.548  47.725 87.997  1.00 20.32  ? 208 ILE D CD1 1 
ATOM   2381 N  N   . GLY D 1 68 ? 32.877  44.341 90.470  1.00 18.15  ? 209 GLY D N   1 
ATOM   2382 C  CA  . GLY D 1 68 ? 32.389  43.956 91.784  1.00 18.97  ? 209 GLY D CA  1 
ATOM   2383 C  C   . GLY D 1 68 ? 31.220  44.851 92.170  1.00 26.23  ? 209 GLY D C   1 
ATOM   2384 O  O   . GLY D 1 68 ? 31.168  46.066 91.845  1.00 21.29  ? 209 GLY D O   1 
ATOM   2385 N  N   . TRP D 1 69 ? 30.286  44.233 92.887  1.00 30.59  ? 210 TRP D N   1 
ATOM   2386 C  CA  . TRP D 1 69 ? 29.152  44.923 93.475  1.00 30.21  ? 210 TRP D CA  1 
ATOM   2387 C  C   . TRP D 1 69 ? 29.593  46.055 94.409  1.00 27.40  ? 210 TRP D C   1 
ATOM   2388 O  O   . TRP D 1 69 ? 28.819  46.965 94.644  1.00 22.96  ? 210 TRP D O   1 
ATOM   2389 C  CB  . TRP D 1 69 ? 28.237  43.912 94.202  1.00 27.71  ? 210 TRP D CB  1 
ATOM   2390 C  CG  . TRP D 1 69 ? 27.303  43.227 93.258  1.00 28.68  ? 210 TRP D CG  1 
ATOM   2391 C  CD1 . TRP D 1 69 ? 27.280  41.900 92.907  1.00 31.19  ? 210 TRP D CD1 1 
ATOM   2392 C  CD2 . TRP D 1 69 ? 26.275  43.858 92.500  1.00 25.91  ? 210 TRP D CD2 1 
ATOM   2393 N  NE1 . TRP D 1 69 ? 26.283  41.666 91.995  1.00 29.48  ? 210 TRP D NE1 1 
ATOM   2394 C  CE2 . TRP D 1 69 ? 25.638  42.850 91.735  1.00 25.28  ? 210 TRP D CE2 1 
ATOM   2395 C  CE3 . TRP D 1 69 ? 25.799  45.179 92.426  1.00 23.01  ? 210 TRP D CE3 1 
ATOM   2396 C  CZ2 . TRP D 1 69 ? 24.571  43.119 90.892  1.00 24.40  ? 210 TRP D CZ2 1 
ATOM   2397 C  CZ3 . TRP D 1 69 ? 24.722  45.458 91.578  1.00 24.11  ? 210 TRP D CZ3 1 
ATOM   2398 C  CH2 . TRP D 1 69 ? 24.117  44.424 90.825  1.00 24.76  ? 210 TRP D CH2 1 
ATOM   2399 N  N   . ASP D 1 70 ? 30.816  45.983 94.951  1.00 21.36  ? 211 ASP D N   1 
ATOM   2400 C  CA  . ASP D 1 70 ? 31.289  46.997 95.893  1.00 24.16  ? 211 ASP D CA  1 
ATOM   2401 C  C   . ASP D 1 70 ? 32.042  48.139 95.231  1.00 26.63  ? 211 ASP D C   1 
ATOM   2402 O  O   . ASP D 1 70 ? 32.627  48.965 95.937  1.00 24.98  ? 211 ASP D O   1 
ATOM   2403 C  CB  . ASP D 1 70 ? 32.211  46.411 96.947  1.00 34.45  ? 211 ASP D CB  1 
ATOM   2404 C  CG  . ASP D 1 70 ? 31.556  45.334 97.756  1.00 41.19  ? 211 ASP D CG  1 
ATOM   2405 O  OD1 . ASP D 1 70 ? 30.611  45.654 98.487  1.00 41.00  ? 211 ASP D OD1 1 
ATOM   2406 O  OD2 . ASP D 1 70 ? 31.981  44.161 97.651  1.00 53.61  ? 211 ASP D OD2 1 
ATOM   2407 N  N   . THR D 1 71 ? 32.064  48.151 93.898  1.00 26.52  ? 212 THR D N   1 
ATOM   2408 C  CA  . THR D 1 71 ? 32.753  49.181 93.120  1.00 23.54  ? 212 THR D CA  1 
ATOM   2409 C  C   . THR D 1 71 ? 32.137  50.530 93.477  1.00 17.36  ? 212 THR D C   1 
ATOM   2410 O  O   . THR D 1 71 ? 30.891  50.691 93.620  1.00 17.41  ? 212 THR D O   1 
ATOM   2411 C  CB  . THR D 1 71 ? 32.599  48.941 91.589  1.00 18.28  ? 212 THR D CB  1 
ATOM   2412 O  OG1 . THR D 1 71 ? 33.222  47.716 91.239  1.00 24.01  ? 212 THR D OG1 1 
ATOM   2413 C  CG2 . THR D 1 71 ? 33.222  50.058 90.777  1.00 21.51  ? 212 THR D CG2 1 
ATOM   2414 N  N   . ASP D 1 72 ? 32.994  51.517 93.626  1.00 19.81  ? 213 ASP D N   1 
ATOM   2415 C  CA  . ASP D 1 72 ? 32.494  52.852 93.880  1.00 24.39  ? 213 ASP D CA  1 
ATOM   2416 C  C   . ASP D 1 72 ? 31.895  53.400 92.589  1.00 20.22  ? 213 ASP D C   1 
ATOM   2417 O  O   . ASP D 1 72 ? 32.613  53.618 91.638  1.00 22.48  ? 213 ASP D O   1 
ATOM   2418 C  CB  . ASP D 1 72 ? 33.629  53.747 94.339  1.00 26.22  ? 213 ASP D CB  1 
ATOM   2419 C  CG  . ASP D 1 72 ? 33.167  55.158 94.662  1.00 30.03  ? 213 ASP D CG  1 
ATOM   2420 O  OD1 . ASP D 1 72 ? 32.226  55.684 94.009  1.00 30.35  ? 213 ASP D OD1 1 
ATOM   2421 O  OD2 . ASP D 1 72 ? 33.785  55.763 95.556  1.00 35.59  ? 213 ASP D OD2 1 
ATOM   2422 N  N   . ILE D 1 73 ? 30.592  53.660 92.588  1.00 17.52  ? 214 ILE D N   1 
ATOM   2423 C  CA  . ILE D 1 73 ? 29.882  53.993 91.344  1.00 19.76  ? 214 ILE D CA  1 
ATOM   2424 C  C   . ILE D 1 73 ? 30.412  55.230 90.602  1.00 17.96  ? 214 ILE D C   1 
ATOM   2425 O  O   . ILE D 1 73 ? 30.243  55.356 89.391  1.00 15.83  ? 214 ILE D O   1 
ATOM   2426 C  CB  . ILE D 1 73 ? 28.368  54.163 91.589  1.00 21.02  ? 214 ILE D CB  1 
ATOM   2427 C  CG1 . ILE D 1 73 ? 27.658  54.354 90.262  1.00 23.12  ? 214 ILE D CG1 1 
ATOM   2428 C  CG2 . ILE D 1 73 ? 28.090  55.372 92.462  1.00 20.67  ? 214 ILE D CG2 1 
ATOM   2429 C  CD1 . ILE D 1 73 ? 26.774  53.253 89.885  1.00 17.34  ? 214 ILE D CD1 1 
ATOM   2430 N  N   . SER D 1 74 ? 31.002  56.170 91.336  1.00 18.58  ? 215 SER D N   1 
ATOM   2431 C  CA  . SER D 1 74 ? 31.523  57.396 90.722  1.00 23.85  ? 215 SER D CA  1 
ATOM   2432 C  C   . SER D 1 74 ? 32.655  57.113 89.760  1.00 26.76  ? 215 SER D C   1 
ATOM   2433 O  O   . SER D 1 74 ? 32.895  57.905 88.835  1.00 21.62  ? 215 SER D O   1 
ATOM   2434 C  CB  . SER D 1 74 ? 31.997  58.420 91.761  1.00 19.45  ? 215 SER D CB  1 
ATOM   2435 O  OG  . SER D 1 74 ? 33.176  57.935 92.359  1.00 24.55  ? 215 SER D OG  1 
ATOM   2436 N  N   . TRP D 1 75 ? 33.366  56.000 89.949  1.00 18.78  ? 216 TRP D N   1 
ATOM   2437 C  CA  . TRP D 1 75 ? 34.355  55.657 88.935  1.00 22.43  ? 216 TRP D CA  1 
ATOM   2438 C  C   . TRP D 1 75 ? 33.718  55.381 87.553  1.00 23.50  ? 216 TRP D C   1 
ATOM   2439 O  O   . TRP D 1 75 ? 34.404  55.476 86.514  1.00 26.91  ? 216 TRP D O   1 
ATOM   2440 C  CB  . TRP D 1 75 ? 35.271  54.488 89.384  1.00 27.14  ? 216 TRP D CB  1 
ATOM   2441 C  CG  . TRP D 1 75 ? 36.130  54.824 90.589  1.00 28.87  ? 216 TRP D CG  1 
ATOM   2442 C  CD1 . TRP D 1 75 ? 35.897  54.439 91.888  1.00 33.53  ? 216 TRP D CD1 1 
ATOM   2443 C  CD2 . TRP D 1 75 ? 37.326  55.619 90.621  1.00 26.43  ? 216 TRP D CD2 1 
ATOM   2444 N  NE1 . TRP D 1 75 ? 36.867  54.946 92.715  1.00 29.27  ? 216 TRP D NE1 1 
ATOM   2445 C  CE2 . TRP D 1 75 ? 37.754  55.673 91.966  1.00 31.15  ? 216 TRP D CE2 1 
ATOM   2446 C  CE3 . TRP D 1 75 ? 38.071  56.287 89.656  1.00 19.01  ? 216 TRP D CE3 1 
ATOM   2447 C  CZ2 . TRP D 1 75 ? 38.904  56.343 92.350  1.00 27.93  ? 216 TRP D CZ2 1 
ATOM   2448 C  CZ3 . TRP D 1 75 ? 39.197  56.955 90.031  1.00 21.24  ? 216 TRP D CZ3 1 
ATOM   2449 C  CH2 . TRP D 1 75 ? 39.614  56.983 91.368  1.00 25.66  ? 216 TRP D CH2 1 
ATOM   2450 N  N   . LEU D 1 76 ? 32.424  55.050 87.544  1.00 17.94  ? 217 LEU D N   1 
ATOM   2451 C  CA  . LEU D 1 76 ? 31.743  54.605 86.320  1.00 21.71  ? 217 LEU D CA  1 
ATOM   2452 C  C   . LEU D 1 76 ? 30.888  55.668 85.606  1.00 22.78  ? 217 LEU D C   1 
ATOM   2453 O  O   . LEU D 1 76 ? 30.104  55.356 84.696  1.00 21.73  ? 217 LEU D O   1 
ATOM   2454 C  CB  . LEU D 1 76 ? 30.925  53.337 86.593  1.00 22.14  ? 217 LEU D CB  1 
ATOM   2455 C  CG  . LEU D 1 76 ? 31.724  52.191 87.229  1.00 28.33  ? 217 LEU D CG  1 
ATOM   2456 C  CD1 . LEU D 1 76 ? 30.782  51.099 87.645  1.00 27.47  ? 217 LEU D CD1 1 
ATOM   2457 C  CD2 . LEU D 1 76 ? 32.808  51.625 86.281  1.00 28.00  ? 217 LEU D CD2 1 
ATOM   2458 N  N   . THR D 1 77 ? 31.058  56.921 86.010  1.00 22.67  ? 218 THR D N   1 
ATOM   2459 C  CA  . THR D 1 77 ? 30.270  58.011 85.441  1.00 32.04  ? 218 THR D CA  1 
ATOM   2460 C  C   . THR D 1 77 ? 30.358  57.974 83.945  1.00 33.33  ? 218 THR D C   1 
ATOM   2461 O  O   . THR D 1 77 ? 31.447  57.893 83.403  1.00 34.90  ? 218 THR D O   1 
ATOM   2462 C  CB  . THR D 1 77 ? 30.742  59.395 85.942  1.00 32.17  ? 218 THR D CB  1 
ATOM   2463 O  OG1 . THR D 1 77 ? 30.307  59.568 87.290  1.00 35.10  ? 218 THR D OG1 1 
ATOM   2464 C  CG2 . THR D 1 77 ? 30.155  60.523 85.086  1.00 31.23  ? 218 THR D CG2 1 
ATOM   2465 N  N   . GLY D 1 78 ? 29.204  57.998 83.284  1.00 35.02  ? 219 GLY D N   1 
ATOM   2466 C  CA  . GLY D 1 78 ? 29.156  57.985 81.834  1.00 37.04  ? 219 GLY D CA  1 
ATOM   2467 C  C   . GLY D 1 78 ? 29.175  56.612 81.172  1.00 34.39  ? 219 GLY D C   1 
ATOM   2468 O  O   . GLY D 1 78 ? 28.902  56.482 79.971  1.00 33.88  ? 219 GLY D O   1 
ATOM   2469 N  N   . GLU D 1 79 ? 29.485  55.581 81.944  1.00 34.17  ? 220 GLU D N   1 
ATOM   2470 C  CA  . GLU D 1 79 ? 29.480  54.219 81.414  1.00 34.71  ? 220 GLU D CA  1 
ATOM   2471 C  C   . GLU D 1 79 ? 28.074  53.572 81.370  1.00 29.24  ? 220 GLU D C   1 
ATOM   2472 O  O   . GLU D 1 79 ? 27.114  54.038 82.004  1.00 29.44  ? 220 GLU D O   1 
ATOM   2473 C  CB  . GLU D 1 79 ? 30.435  53.345 82.221  1.00 42.49  ? 220 GLU D CB  1 
ATOM   2474 C  CG  . GLU D 1 79 ? 31.837  53.915 82.408  1.00 54.04  ? 220 GLU D CG  1 
ATOM   2475 C  CD  . GLU D 1 79 ? 32.780  53.593 81.253  1.00 62.69  ? 220 GLU D CD  1 
ATOM   2476 O  OE1 . GLU D 1 79 ? 32.374  52.811 80.366  1.00 64.23  ? 220 GLU D OE1 1 
ATOM   2477 O  OE2 . GLU D 1 79 ? 33.925  54.118 81.237  1.00 64.33  ? 220 GLU D OE2 1 
ATOM   2478 N  N   . GLU D 1 80 ? 27.944  52.513 80.589  1.00 25.14  ? 221 GLU D N   1 
ATOM   2479 C  CA  . GLU D 1 80 ? 26.733  51.686 80.643  1.00 29.62  ? 221 GLU D CA  1 
ATOM   2480 C  C   . GLU D 1 80 ? 27.058  50.449 81.450  1.00 23.74  ? 221 GLU D C   1 
ATOM   2481 O  O   . GLU D 1 80 ? 28.080  49.819 81.184  1.00 28.33  ? 221 GLU D O   1 
ATOM   2482 C  CB  . GLU D 1 80 ? 26.341  51.223 79.246  1.00 38.78  ? 221 GLU D CB  1 
ATOM   2483 C  CG  . GLU D 1 80 ? 25.888  52.315 78.298  1.00 44.59  ? 221 GLU D CG  1 
ATOM   2484 C  CD  . GLU D 1 80 ? 25.477  51.748 76.946  1.00 51.95  ? 221 GLU D CD  1 
ATOM   2485 O  OE1 . GLU D 1 80 ? 25.830  50.571 76.644  1.00 50.70  ? 221 GLU D OE1 1 
ATOM   2486 O  OE2 . GLU D 1 80 ? 24.792  52.483 76.194  1.00 58.44  ? 221 GLU D OE2 1 
ATOM   2487 N  N   . LEU D 1 81 ? 26.222  50.099 82.419  1.00 17.93  ? 222 LEU D N   1 
ATOM   2488 C  CA  . LEU D 1 81 ? 26.376  48.826 83.167  1.00 19.49  ? 222 LEU D CA  1 
ATOM   2489 C  C   . LEU D 1 81 ? 25.265  47.888 82.711  1.00 19.05  ? 222 LEU D C   1 
ATOM   2490 O  O   . LEU D 1 81 ? 24.196  48.348 82.334  1.00 20.52  ? 222 LEU D O   1 
ATOM   2491 C  CB  . LEU D 1 81 ? 26.223  49.047 84.704  1.00 17.14  ? 222 LEU D CB  1 
ATOM   2492 C  CG  . LEU D 1 81 ? 27.254  49.945 85.396  1.00 23.58  ? 222 LEU D CG  1 
ATOM   2493 C  CD1 . LEU D 1 81 ? 27.063  50.092 86.921  1.00 20.63  ? 222 LEU D CD1 1 
ATOM   2494 C  CD2 . LEU D 1 81 ? 28.632  49.428 85.099  1.00 25.06  ? 222 LEU D CD2 1 
ATOM   2495 N  N   . HIS D 1 82 ? 25.469  46.588 82.819  1.00 20.02  ? 223 HIS D N   1 
ATOM   2496 C  CA  . HIS D 1 82 ? 24.406  45.619 82.538  1.00 20.40  ? 223 HIS D CA  1 
ATOM   2497 C  C   . HIS D 1 82 ? 24.223  44.738 83.794  1.00 19.69  ? 223 HIS D C   1 
ATOM   2498 O  O   . HIS D 1 82 ? 25.201  44.429 84.462  1.00 22.35  ? 223 HIS D O   1 
ATOM   2499 C  CB  . HIS D 1 82 ? 24.762  44.744 81.330  1.00 23.85  ? 223 HIS D CB  1 
ATOM   2500 C  CG  . HIS D 1 82 ? 24.570  45.415 80.014  1.00 27.89  ? 223 HIS D CG  1 
ATOM   2501 N  ND1 . HIS D 1 82 ? 25.362  46.463 79.585  1.00 36.23  ? 223 HIS D ND1 1 
ATOM   2502 C  CD2 . HIS D 1 82 ? 23.679  45.185 79.022  1.00 30.11  ? 223 HIS D CD2 1 
ATOM   2503 C  CE1 . HIS D 1 82 ? 24.953  46.858 78.394  1.00 35.59  ? 223 HIS D CE1 1 
ATOM   2504 N  NE2 . HIS D 1 82 ? 23.931  46.099 78.031  1.00 33.84  ? 223 HIS D NE2 1 
ATOM   2505 N  N   . VAL D 1 83 ? 22.982  44.422 84.148  1.00 18.51  ? 224 VAL D N   1 
ATOM   2506 C  CA  . VAL D 1 83 ? 22.714  43.589 85.320  1.00 23.94  ? 224 VAL D CA  1 
ATOM   2507 C  C   . VAL D 1 83 ? 21.988  42.365 84.829  1.00 27.24  ? 224 VAL D C   1 
ATOM   2508 O  O   . VAL D 1 83 ? 21.018  42.479 84.079  1.00 24.02  ? 224 VAL D O   1 
ATOM   2509 C  CB  . VAL D 1 83 ? 21.839  44.291 86.382  1.00 22.18  ? 224 VAL D CB  1 
ATOM   2510 C  CG1 . VAL D 1 83 ? 21.536  43.348 87.486  1.00 19.23  ? 224 VAL D CG1 1 
ATOM   2511 C  CG2 . VAL D 1 83 ? 22.568  45.571 86.915  1.00 18.92  ? 224 VAL D CG2 1 
ATOM   2512 N  N   . GLU D 1 84 ? 22.485  41.200 85.222  1.00 25.48  ? 225 GLU D N   1 
ATOM   2513 C  CA  . GLU D 1 84 ? 21.917  39.925 84.785  1.00 26.07  ? 225 GLU D CA  1 
ATOM   2514 C  C   . GLU D 1 84 ? 21.581  39.061 85.969  1.00 28.76  ? 225 GLU D C   1 
ATOM   2515 O  O   . GLU D 1 84 ? 22.195  39.137 87.024  1.00 23.40  ? 225 GLU D O   1 
ATOM   2516 C  CB  . GLU D 1 84 ? 22.888  39.161 83.915  1.00 24.06  ? 225 GLU D CB  1 
ATOM   2517 C  CG  . GLU D 1 84 ? 22.766  39.422 82.466  1.00 33.27  ? 225 GLU D CG  1 
ATOM   2518 C  CD  . GLU D 1 84 ? 23.992  38.927 81.720  1.00 48.30  ? 225 GLU D CD  1 
ATOM   2519 O  OE1 . GLU D 1 84 ? 24.596  37.918 82.154  1.00 44.46  ? 225 GLU D OE1 1 
ATOM   2520 O  OE2 . GLU D 1 84 ? 24.364  39.560 80.710  1.00 57.17  ? 225 GLU D OE2 1 
ATOM   2521 N  N   . VAL D 1 85 ? 20.595  38.208 85.797  1.00 25.62  ? 226 VAL D N   1 
ATOM   2522 C  CA  . VAL D 1 85 ? 20.269  37.344 86.890  1.00 24.08  ? 226 VAL D CA  1 
ATOM   2523 C  C   . VAL D 1 85 ? 21.269  36.173 86.829  1.00 24.88  ? 226 VAL D C   1 
ATOM   2524 O  O   . VAL D 1 85 ? 21.550  35.696 85.746  1.00 25.52  ? 226 VAL D O   1 
ATOM   2525 C  CB  . VAL D 1 85 ? 18.822  36.852 86.726  1.00 26.49  ? 226 VAL D CB  1 
ATOM   2526 C  CG1 . VAL D 1 85 ? 18.495  35.830 87.824  1.00 25.84  ? 226 VAL D CG1 1 
ATOM   2527 C  CG2 . VAL D 1 85 ? 17.860  38.073 86.747  1.00 29.98  ? 226 VAL D CG2 1 
ATOM   2528 N  N   . LEU D 1 86 ? 21.817  35.747 87.969  1.00 22.84  ? 227 LEU D N   1 
ATOM   2529 C  CA  . LEU D 1 86 ? 22.696  34.559 88.009  1.00 22.33  ? 227 LEU D CA  1 
ATOM   2530 C  C   . LEU D 1 86 ? 21.919  33.296 87.563  1.00 24.43  ? 227 LEU D C   1 
ATOM   2531 O  O   . LEU D 1 86 ? 20.690  33.241 87.649  1.00 21.90  ? 227 LEU D O   1 
ATOM   2532 C  CB  . LEU D 1 86 ? 23.191  34.297 89.430  1.00 28.26  ? 227 LEU D CB  1 
ATOM   2533 C  CG  . LEU D 1 86 ? 24.161  35.343 90.011  1.00 29.18  ? 227 LEU D CG  1 
ATOM   2534 C  CD1 . LEU D 1 86 ? 24.617  34.974 91.433  1.00 30.13  ? 227 LEU D CD1 1 
ATOM   2535 C  CD2 . LEU D 1 86 ? 25.344  35.572 89.061  1.00 23.67  ? 227 LEU D CD2 1 
ATOM   2536 N  N   . GLU D 1 87 ? 22.639  32.279 87.092  1.00 23.06  ? 228 GLU D N   1 
ATOM   2537 C  CA  . GLU D 1 87 ? 21.990  31.013 86.773  1.00 27.24  ? 228 GLU D CA  1 
ATOM   2538 C  C   . GLU D 1 87 ? 21.242  30.443 87.953  1.00 28.62  ? 228 GLU D C   1 
ATOM   2539 O  O   . GLU D 1 87 ? 21.669  30.520 89.110  1.00 26.52  ? 228 GLU D O   1 
ATOM   2540 C  CB  . GLU D 1 87 ? 22.993  29.992 86.247  1.00 32.54  ? 228 GLU D CB  1 
ATOM   2541 C  CG  . GLU D 1 87 ? 23.576  30.429 84.937  1.00 37.58  ? 228 GLU D CG  1 
ATOM   2542 C  CD  . GLU D 1 87 ? 22.543  30.383 83.821  1.00 44.06  ? 228 GLU D CD  1 
ATOM   2543 O  OE1 . GLU D 1 87 ? 22.502  29.341 83.118  1.00 47.17  ? 228 GLU D OE1 1 
ATOM   2544 O  OE2 . GLU D 1 87 ? 21.784  31.378 83.660  1.00 36.90  ? 228 GLU D OE2 1 
ATOM   2545 N  N   . ASN D 1 88 ? 20.104  29.849 87.641  1.00 24.26  ? 229 ASN D N   1 
ATOM   2546 C  CA  . ASN D 1 88 ? 19.342  29.175 88.632  1.00 22.22  ? 229 ASN D CA  1 
ATOM   2547 C  C   . ASN D 1 88 ? 19.970  27.786 88.886  1.00 26.40  ? 229 ASN D C   1 
ATOM   2548 O  O   . ASN D 1 88 ? 19.660  26.812 88.194  1.00 26.01  ? 229 ASN D O   1 
ATOM   2549 C  CB  . ASN D 1 88 ? 17.901  29.065 88.147  1.00 29.77  ? 229 ASN D CB  1 
ATOM   2550 C  CG  . ASN D 1 88 ? 16.959  28.633 89.250  1.00 38.79  ? 229 ASN D CG  1 
ATOM   2551 O  OD1 . ASN D 1 88 ? 17.398  28.332 90.365  1.00 40.81  ? 229 ASN D OD1 1 
ATOM   2552 N  ND2 . ASN D 1 88 ? 15.656  28.602 88.950  1.00 39.52  ? 229 ASN D ND2 1 
ATOM   2553 N  N   . VAL D 1 89 ? 20.901  27.742 89.845  1.00 26.37  ? 230 VAL D N   1 
ATOM   2554 C  CA  . VAL D 1 89 ? 21.594  26.523 90.238  1.00 29.87  ? 230 VAL D CA  1 
ATOM   2555 C  C   . VAL D 1 89 ? 21.554  26.475 91.749  1.00 34.14  ? 230 VAL D C   1 
ATOM   2556 O  O   . VAL D 1 89 ? 21.869  27.468 92.397  1.00 34.00  ? 230 VAL D O   1 
ATOM   2557 C  CB  . VAL D 1 89 ? 23.069  26.513 89.816  1.00 29.18  ? 230 VAL D CB  1 
ATOM   2558 C  CG1 . VAL D 1 89 ? 23.735  25.144 90.227  1.00 26.38  ? 230 VAL D CG1 1 
ATOM   2559 C  CG2 . VAL D 1 89 ? 23.201  26.808 88.304  1.00 22.49  ? 230 VAL D CG2 1 
ATOM   2560 N  N   . PRO D 1 90 ? 21.170  25.319 92.315  1.00 27.80  ? 231 PRO D N   1 
ATOM   2561 C  CA  . PRO D 1 90 ? 20.899  25.220 93.756  1.00 36.75  ? 231 PRO D CA  1 
ATOM   2562 C  C   . PRO D 1 90 ? 22.057  25.526 94.716  1.00 40.17  ? 231 PRO D C   1 
ATOM   2563 O  O   . PRO D 1 90 ? 23.240  25.530 94.343  1.00 28.30  ? 231 PRO D O   1 
ATOM   2564 C  CB  . PRO D 1 90 ? 20.466  23.756 93.929  1.00 35.63  ? 231 PRO D CB  1 
ATOM   2565 C  CG  . PRO D 1 90 ? 20.016  23.333 92.600  1.00 37.04  ? 231 PRO D CG  1 
ATOM   2566 C  CD  . PRO D 1 90 ? 20.884  24.050 91.623  1.00 30.79  ? 231 PRO D CD  1 
ATOM   2567 N  N   . LEU D 1 91 ? 21.645  25.712 95.976  1.00 55.98  ? 232 LEU D N   1 
ATOM   2568 C  CA  . LEU D 1 91 ? 22.472  26.006 97.151  1.00 61.08  ? 232 LEU D CA  1 
ATOM   2569 C  C   . LEU D 1 91 ? 23.195  27.327 96.986  1.00 67.95  ? 232 LEU D C   1 
ATOM   2570 O  O   . LEU D 1 91 ? 22.839  28.328 97.610  1.00 67.54  ? 232 LEU D O   1 
ATOM   2571 C  CB  . LEU D 1 91 ? 23.436  24.860 97.500  1.00 59.99  ? 232 LEU D CB  1 
ATOM   2572 C  CG  . LEU D 1 91 ? 24.133  24.953 98.870  1.00 64.08  ? 232 LEU D CG  1 
ATOM   2573 C  CD1 . LEU D 1 91 ? 23.292  24.330 99.984  1.00 67.20  ? 232 LEU D CD1 1 
ATOM   2574 C  CD2 . LEU D 1 91 ? 25.538  24.327 98.864  1.00 67.82  ? 232 LEU D CD2 1 
HETATM 2575 O  O   . HOH E 2 .  ? 9.513   37.773 64.911  1.00 15.38  ? 303 HOH A O   1 
HETATM 2576 O  O   . HOH E 2 .  ? -4.002  65.100 59.594  1.00 31.79  ? 309 HOH A O   1 
HETATM 2577 O  O   . HOH E 2 .  ? -3.174  48.127 64.057  1.00 20.44  ? 310 HOH A O   1 
HETATM 2578 O  O   . HOH E 2 .  ? 8.637   36.158 62.650  1.00 28.33  ? 312 HOH A O   1 
HETATM 2579 O  O   . HOH E 2 .  ? 7.946   37.725 60.625  1.00 20.39  ? 314 HOH A O   1 
HETATM 2580 O  O   . HOH E 2 .  ? 17.497  46.454 56.572  1.00 17.77  ? 315 HOH A O   1 
HETATM 2581 O  O   . HOH E 2 .  ? 14.240  43.443 63.551  1.00 22.05  ? 317 HOH A O   1 
HETATM 2582 O  O   . HOH E 2 .  ? -1.056  25.474 55.928  1.00 23.27  ? 318 HOH A O   1 
HETATM 2583 O  O   . HOH E 2 .  ? 6.545   34.798 62.584  1.00 24.30  ? 319 HOH A O   1 
HETATM 2584 O  O   . HOH E 2 .  ? 18.317  47.940 54.512  1.00 30.85  ? 323 HOH A O   1 
HETATM 2585 O  O   . HOH E 2 .  ? 5.746   48.829 71.155  1.00 29.05  ? 325 HOH A O   1 
HETATM 2586 O  O   . HOH E 2 .  ? -9.677  33.110 64.130  1.00 36.46  ? 326 HOH A O   1 
HETATM 2587 O  O   . HOH E 2 .  ? -3.456  42.981 50.356  1.00 29.57  ? 328 HOH A O   1 
HETATM 2588 O  O   . HOH E 2 .  ? -1.920  34.705 54.520  1.00 23.86  ? 330 HOH A O   1 
HETATM 2589 O  O   . HOH E 2 .  ? 8.648   48.792 50.816  1.00 31.59  ? 334 HOH A O   1 
HETATM 2590 O  O   . HOH E 2 .  ? 2.621   23.479 72.973  1.00 47.13  ? 335 HOH A O   1 
HETATM 2591 O  O   . HOH E 2 .  ? -4.506  49.942 61.824  1.00 31.97  ? 337 HOH A O   1 
HETATM 2592 O  O   . HOH E 2 .  ? 11.109  57.589 60.685  1.00 15.60  ? 340 HOH A O   1 
HETATM 2593 O  O   . HOH E 2 .  ? 11.547  40.472 66.432  1.00 22.93  ? 341 HOH A O   1 
HETATM 2594 O  O   . HOH E 2 .  ? -1.132  51.290 64.867  1.00 27.82  ? 343 HOH A O   1 
HETATM 2595 O  O   . HOH E 2 .  ? -1.278  29.003 61.181  1.00 35.24  ? 350 HOH A O   1 
HETATM 2596 O  O   . HOH E 2 .  ? 9.225   60.208 64.331  1.00 40.59  ? 352 HOH A O   1 
HETATM 2597 O  O   . HOH E 2 .  ? -2.519  48.288 67.138  1.00 23.67  ? 354 HOH A O   1 
HETATM 2598 O  O   . HOH E 2 .  ? 9.300   35.950 59.652  1.00 36.80  ? 355 HOH A O   1 
HETATM 2599 O  O   . HOH E 2 .  ? -6.708  48.536 45.351  1.00 43.81  ? 359 HOH A O   1 
HETATM 2600 O  O   . HOH E 2 .  ? 15.199  51.538 67.458  1.00 28.44  ? 363 HOH A O   1 
HETATM 2601 O  O   . HOH E 2 .  ? 13.456  52.486 55.947  1.00 43.35  ? 373 HOH A O   1 
HETATM 2602 O  O   . HOH E 2 .  ? 11.130  42.589 48.534  1.00 56.57  ? 375 HOH A O   1 
HETATM 2603 O  O   . HOH E 2 .  ? 1.985   30.356 55.117  1.00 32.95  ? 376 HOH A O   1 
HETATM 2604 O  O   . HOH E 2 .  ? 4.064   55.536 71.369  1.00 29.47  ? 377 HOH A O   1 
HETATM 2605 O  O   . HOH E 2 .  ? 2.818   52.626 64.942  1.00 30.56  ? 381 HOH A O   1 
HETATM 2606 O  O   . HOH E 2 .  ? 3.470   27.248 61.421  1.00 31.92  ? 383 HOH A O   1 
HETATM 2607 O  O   . HOH E 2 .  ? -5.719  28.591 67.271  1.00 44.75  ? 389 HOH A O   1 
HETATM 2608 O  O   . HOH E 2 .  ? 8.292   37.057 67.421  1.00 42.75  ? 390 HOH A O   1 
HETATM 2609 O  O   . HOH E 2 .  ? -7.157  49.566 74.225  1.00 64.99  ? 394 HOH A O   1 
HETATM 2610 O  O   . HOH E 2 .  ? -1.861  41.507 49.615  1.00 45.97  ? 396 HOH A O   1 
HETATM 2611 O  O   . HOH E 2 .  ? -4.790  34.081 53.955  1.00 44.40  ? 397 HOH A O   1 
HETATM 2612 O  O   . HOH E 2 .  ? 12.184  53.206 53.357  1.00 49.83  ? 402 HOH A O   1 
HETATM 2613 O  O   . HOH E 2 .  ? 5.550   35.895 67.070  1.00 43.56  ? 407 HOH A O   1 
HETATM 2614 O  O   . HOH E 2 .  ? 9.427   58.093 62.389  1.00 29.50  ? 409 HOH A O   1 
HETATM 2615 O  O   . HOH E 2 .  ? 12.569  55.087 57.116  1.00 44.90  ? 424 HOH A O   1 
HETATM 2616 O  O   . HOH E 2 .  ? -0.748  23.012 67.640  1.00 40.22  ? 425 HOH A O   1 
HETATM 2617 O  O   . HOH E 2 .  ? 4.082   25.506 71.657  1.00 25.84  ? 426 HOH A O   1 
HETATM 2618 O  O   . HOH E 2 .  ? -3.935  38.973 50.600  1.00 40.53  ? 427 HOH A O   1 
HETATM 2619 O  O   . HOH E 2 .  ? -6.711  50.781 70.948  1.00 57.76  ? 428 HOH A O   1 
HETATM 2620 O  O   . HOH E 2 .  ? -1.973  38.484 70.981  1.00 36.93  ? 430 HOH A O   1 
HETATM 2621 O  O   . HOH E 2 .  ? 1.811   43.337 71.829  1.00 48.91  ? 433 HOH A O   1 
HETATM 2622 O  O   . HOH E 2 .  ? -3.761  40.927 67.066  1.00 34.29  ? 434 HOH A O   1 
HETATM 2623 O  O   . HOH E 2 .  ? 6.257   57.033 70.082  1.00 41.16  ? 440 HOH A O   1 
HETATM 2624 O  O   . HOH E 2 .  ? -0.801  47.846 52.323  1.00 83.57  ? 465 HOH A O   1 
HETATM 2625 O  O   . HOH E 2 .  ? 0.959   52.885 66.577  1.00 44.34  ? 467 HOH A O   1 
HETATM 2626 O  O   . HOH E 2 .  ? -0.124  26.470 63.427  1.00 62.81  ? 468 HOH A O   1 
HETATM 2627 O  O   . HOH E 2 .  ? -7.444  48.006 60.180  1.00 45.18  ? 471 HOH A O   1 
HETATM 2628 O  O   . HOH E 2 .  ? 5.070   45.482 48.048  1.00 56.39  ? 478 HOH A O   1 
HETATM 2629 O  O   . HOH E 2 .  ? 5.480   34.792 64.605  1.00 28.96  ? 480 HOH A O   1 
HETATM 2630 O  O   . HOH E 2 .  ? 6.737   42.646 70.799  1.00 46.23  ? 482 HOH A O   1 
HETATM 2631 O  O   . HOH E 2 .  ? -11.524 41.374 52.176  1.00 53.46  ? 492 HOH A O   1 
HETATM 2632 O  O   . HOH E 2 .  ? -2.885  67.118 60.704  1.00 67.13  ? 494 HOH A O   1 
HETATM 2633 O  O   . HOH E 2 .  ? 10.460  60.150 69.586  1.00 53.60  ? 497 HOH A O   1 
HETATM 2634 O  O   . HOH E 2 .  ? -1.486  36.846 52.648  1.00 41.30  ? 498 HOH A O   1 
HETATM 2635 O  O   . HOH E 2 .  ? -6.438  51.595 44.236  1.00 37.52  ? 500 HOH A O   1 
HETATM 2636 O  O   . HOH E 2 .  ? 16.532  49.247 53.549  1.00 44.95  ? 501 HOH A O   1 
HETATM 2637 O  O   . HOH E 2 .  ? 0.328   40.896 70.360  1.00 43.15  ? 503 HOH A O   1 
HETATM 2638 O  O   . HOH E 2 .  ? 7.594   58.990 66.671  1.00 33.76  ? 512 HOH A O   1 
HETATM 2639 O  O   . HOH E 2 .  ? -3.368  52.454 62.864  1.00 41.29  ? 519 HOH A O   1 
HETATM 2640 O  O   . HOH E 2 .  ? -2.166  22.612 62.723  1.00 37.14  ? 523 HOH A O   1 
HETATM 2641 O  O   . HOH E 2 .  ? 11.095  34.530 51.376  1.00 47.57  ? 528 HOH A O   1 
HETATM 2642 O  O   . HOH E 2 .  ? 6.533   35.151 51.401  1.00 54.52  ? 529 HOH A O   1 
HETATM 2643 O  O   . HOH E 2 .  ? 2.731   68.831 60.806  1.00 42.83  ? 540 HOH A O   1 
HETATM 2644 O  O   . HOH E 2 .  ? 1.928   58.865 65.856  1.00 34.62  ? 548 HOH A O   1 
HETATM 2645 O  O   . HOH E 2 .  ? 5.570   44.559 71.170  1.00 37.40  ? 550 HOH A O   1 
HETATM 2646 O  O   . HOH E 2 .  ? 12.686  43.163 44.775  1.00 45.23  ? 553 HOH A O   1 
HETATM 2647 O  O   . HOH E 2 .  ? -4.283  36.487 51.764  1.00 39.91  ? 560 HOH A O   1 
HETATM 2648 O  O   . HOH E 2 .  ? 9.543   60.385 67.232  1.00 48.72  ? 568 HOH A O   1 
HETATM 2649 O  O   . HOH E 2 .  ? -10.250 37.522 51.271  1.00 39.78  ? 573 HOH A O   1 
HETATM 2650 O  O   . HOH E 2 .  ? 12.602  49.826 50.018  1.00 51.65  ? 582 HOH A O   1 
HETATM 2651 O  O   . HOH E 2 .  ? 5.558   33.286 68.008  1.00 43.28  ? 585 HOH A O   1 
HETATM 2652 O  O   . HOH E 2 .  ? 9.393   50.161 72.979  1.00 39.95  ? 590 HOH A O   1 
HETATM 2653 O  O   . HOH E 2 .  ? -3.173  47.847 69.879  1.00 45.51  ? 591 HOH A O   1 
HETATM 2654 O  O   . HOH E 2 .  ? -1.484  41.124 73.494  1.00 55.03  ? 596 HOH A O   1 
HETATM 2655 O  O   . HOH E 2 .  ? -2.954  40.605 69.700  1.00 47.16  ? 602 HOH A O   1 
HETATM 2656 O  O   . HOH E 2 .  ? 6.769   44.862 39.496  1.00 59.25  ? 610 HOH A O   1 
HETATM 2657 O  O   . HOH F 2 .  ? 8.094   31.497 64.904  1.00 21.08  ? 304 HOH B O   1 
HETATM 2658 O  O   . HOH F 2 .  ? 9.644   31.674 60.632  1.00 17.61  ? 308 HOH B O   1 
HETATM 2659 O  O   . HOH F 2 .  ? 20.690  21.160 64.190  1.00 23.25  ? 313 HOH B O   1 
HETATM 2660 O  O   . HOH F 2 .  ? 19.552  34.606 54.571  1.00 17.87  ? 320 HOH B O   1 
HETATM 2661 O  O   . HOH F 2 .  ? 20.192  21.132 66.918  1.00 22.63  ? 324 HOH B O   1 
HETATM 2662 O  O   . HOH F 2 .  ? 18.413  44.016 55.932  1.00 26.04  ? 336 HOH B O   1 
HETATM 2663 O  O   . HOH F 2 .  ? 6.153   28.917 66.579  1.00 26.80  ? 339 HOH B O   1 
HETATM 2664 O  O   . HOH F 2 .  ? 9.055   33.064 62.880  1.00 28.36  ? 342 HOH B O   1 
HETATM 2665 O  O   . HOH F 2 .  ? 6.436   11.878 60.684  1.00 18.35  ? 344 HOH B O   1 
HETATM 2666 O  O   . HOH F 2 .  ? 21.928  19.479 61.612  1.00 26.73  ? 349 HOH B O   1 
HETATM 2667 O  O   . HOH F 2 .  ? 11.024  34.666 62.713  1.00 22.71  ? 353 HOH B O   1 
HETATM 2668 O  O   . HOH F 2 .  ? 0.196   22.912 56.554  1.00 24.34  ? 361 HOH B O   1 
HETATM 2669 O  O   . HOH F 2 .  ? 8.259   11.234 62.002  1.00 41.87  ? 366 HOH B O   1 
HETATM 2670 O  O   . HOH F 2 .  ? 22.538  48.731 62.937  1.00 41.79  ? 368 HOH B O   1 
HETATM 2671 O  O   . HOH F 2 .  ? 2.328   17.882 67.518  1.00 34.70  ? 369 HOH B O   1 
HETATM 2672 O  O   . HOH F 2 .  ? 18.587  17.973 64.968  1.00 29.59  ? 370 HOH B O   1 
HETATM 2673 O  O   . HOH F 2 .  ? 14.050  42.140 61.476  1.00 28.53  ? 372 HOH B O   1 
HETATM 2674 O  O   . HOH F 2 .  ? 25.315  20.982 57.836  1.00 50.44  ? 388 HOH B O   1 
HETATM 2675 O  O   . HOH F 2 .  ? 3.380   25.849 63.342  1.00 27.58  ? 392 HOH B O   1 
HETATM 2676 O  O   . HOH F 2 .  ? 13.902  1.326  48.368  1.00 52.31  ? 398 HOH B O   1 
HETATM 2677 O  O   . HOH F 2 .  ? 11.636  45.648 70.728  1.00 37.04  ? 399 HOH B O   1 
HETATM 2678 O  O   . HOH F 2 .  ? 20.903  26.527 50.202  1.00 33.19  ? 403 HOH B O   1 
HETATM 2679 O  O   . HOH F 2 .  ? 8.355   33.558 59.570  1.00 38.09  ? 410 HOH B O   1 
HETATM 2680 O  O   . HOH F 2 .  ? 14.845  16.844 64.878  1.00 28.79  ? 412 HOH B O   1 
HETATM 2681 O  O   . HOH F 2 .  ? 9.102   20.521 50.629  1.00 40.20  ? 415 HOH B O   1 
HETATM 2682 O  O   . HOH F 2 .  ? 16.943  16.765 66.888  1.00 34.23  ? 422 HOH B O   1 
HETATM 2683 O  O   . HOH F 2 .  ? 12.188  34.470 64.677  1.00 28.89  ? 429 HOH B O   1 
HETATM 2684 O  O   . HOH F 2 .  ? 21.663  30.541 50.735  1.00 34.78  ? 438 HOH B O   1 
HETATM 2685 O  O   . HOH F 2 .  ? 19.246  32.687 52.607  1.00 39.74  ? 439 HOH B O   1 
HETATM 2686 O  O   . HOH F 2 .  ? 29.037  28.015 52.283  1.00 49.14  ? 447 HOH B O   1 
HETATM 2687 O  O   . HOH F 2 .  ? 4.067   17.236 55.690  1.00 55.39  ? 449 HOH B O   1 
HETATM 2688 O  O   . HOH F 2 .  ? 21.404  28.514 67.167  1.00 30.46  ? 451 HOH B O   1 
HETATM 2689 O  O   . HOH F 2 .  ? -0.593  21.538 54.484  1.00 39.34  ? 460 HOH B O   1 
HETATM 2690 O  O   . HOH F 2 .  ? 26.913  38.178 64.888  1.00 40.90  ? 461 HOH B O   1 
HETATM 2691 O  O   . HOH F 2 .  ? 17.969  41.093 52.750  1.00 61.83  ? 462 HOH B O   1 
HETATM 2692 O  O   . HOH F 2 .  ? 9.194   32.421 67.559  1.00 36.05  ? 463 HOH B O   1 
HETATM 2693 O  O   . HOH F 2 .  ? 15.602  4.675  52.875  1.00 44.32  ? 466 HOH B O   1 
HETATM 2694 O  O   . HOH F 2 .  ? 21.070  14.588 61.401  1.00 38.53  ? 476 HOH B O   1 
HETATM 2695 O  O   . HOH F 2 .  ? 31.975  31.784 50.911  1.00 61.27  ? 479 HOH B O   1 
HETATM 2696 O  O   . HOH F 2 .  ? 25.538  45.658 59.395  1.00 23.91  ? 493 HOH B O   1 
HETATM 2697 O  O   . HOH F 2 .  ? 8.667   34.525 43.184  1.00 50.15  ? 499 HOH B O   1 
HETATM 2698 O  O   . HOH F 2 .  ? 20.093  47.327 62.436  1.00 38.94  ? 504 HOH B O   1 
HETATM 2699 O  O   . HOH F 2 .  ? 13.071  43.877 71.771  1.00 31.55  ? 513 HOH B O   1 
HETATM 2700 O  O   . HOH F 2 .  ? 17.069  18.330 48.102  1.00 47.33  ? 515 HOH B O   1 
HETATM 2701 O  O   . HOH F 2 .  ? 27.463  35.645 64.498  1.00 37.62  ? 518 HOH B O   1 
HETATM 2702 O  O   . HOH F 2 .  ? 12.047  33.480 67.298  1.00 50.36  ? 525 HOH B O   1 
HETATM 2703 O  O   . HOH F 2 .  ? 20.255  47.227 65.709  1.00 40.32  ? 532 HOH B O   1 
HETATM 2704 O  O   . HOH F 2 .  ? 15.710  26.265 71.446  1.00 63.90  ? 535 HOH B O   1 
HETATM 2705 O  O   . HOH F 2 .  ? 11.279  7.380  49.351  1.00 42.45  ? 538 HOH B O   1 
HETATM 2706 O  O   . HOH F 2 .  ? 4.895   26.365 44.484  1.00 51.42  ? 551 HOH B O   1 
HETATM 2707 O  O   . HOH F 2 .  ? 15.344  3.364  49.565  1.00 43.92  ? 555 HOH B O   1 
HETATM 2708 O  O   . HOH F 2 .  ? 9.388   47.576 73.539  1.00 47.54  ? 558 HOH B O   1 
HETATM 2709 O  O   . HOH F 2 .  ? 25.023  21.319 60.477  1.00 38.52  ? 565 HOH B O   1 
HETATM 2710 O  O   . HOH F 2 .  ? 25.147  46.513 61.568  1.00 36.97  ? 566 HOH B O   1 
HETATM 2711 O  O   . HOH F 2 .  ? 19.430  53.214 74.060  1.00 55.05  ? 575 HOH B O   1 
HETATM 2712 O  O   . HOH F 2 .  ? 22.255  33.286 51.826  1.00 41.55  ? 579 HOH B O   1 
HETATM 2713 O  O   . HOH F 2 .  ? 15.799  9.765  60.928  1.00 42.10  ? 595 HOH B O   1 
HETATM 2714 O  O   . HOH F 2 .  ? 12.867  30.377 50.441  1.00 56.85  ? 613 HOH B O   1 
HETATM 2715 O  O   . HOH G 2 .  ? 10.978  69.639 78.177  1.00 21.40  ? 305 HOH C O   1 
HETATM 2716 O  O   . HOH G 2 .  ? 0.618   75.160 76.185  1.00 49.77  ? 311 HOH C O   1 
HETATM 2717 O  O   . HOH G 2 .  ? 6.845   61.985 97.011  1.00 64.71  ? 321 HOH C O   1 
HETATM 2718 O  O   . HOH G 2 .  ? 13.509  67.310 76.434  1.00 30.33  ? 332 HOH C O   1 
HETATM 2719 O  O   . HOH G 2 .  ? 4.527   81.748 72.037  1.00 36.27  ? 345 HOH C O   1 
HETATM 2720 O  O   . HOH G 2 .  ? 0.909   55.830 77.027  1.00 30.17  ? 346 HOH C O   1 
HETATM 2721 O  O   . HOH G 2 .  ? 2.187   61.894 96.101  1.00 63.22  ? 348 HOH C O   1 
HETATM 2722 O  O   . HOH G 2 .  ? -1.147  59.129 78.536  1.00 24.72  ? 380 HOH C O   1 
HETATM 2723 O  O   . HOH G 2 .  ? 13.939  62.171 72.425  1.00 33.33  ? 384 HOH C O   1 
HETATM 2724 O  O   . HOH G 2 .  ? 16.344  64.195 79.135  1.00 44.68  ? 385 HOH C O   1 
HETATM 2725 O  O   . HOH G 2 .  ? 3.005   74.373 89.776  1.00 51.65  ? 386 HOH C O   1 
HETATM 2726 O  O   . HOH G 2 .  ? 15.488  65.369 81.608  1.00 38.35  ? 393 HOH C O   1 
HETATM 2727 O  O   . HOH G 2 .  ? -9.498  66.001 90.152  1.00 32.18  ? 395 HOH C O   1 
HETATM 2728 O  O   . HOH G 2 .  ? -0.632  81.720 88.264  1.00 40.27  ? 405 HOH C O   1 
HETATM 2729 O  O   . HOH G 2 .  ? 19.116  61.114 86.469  1.00 34.89  ? 406 HOH C O   1 
HETATM 2730 O  O   . HOH G 2 .  ? 5.756   54.914 77.026  1.00 31.57  ? 408 HOH C O   1 
HETATM 2731 O  O   . HOH G 2 .  ? 9.975   48.374 76.119  1.00 34.94  ? 418 HOH C O   1 
HETATM 2732 O  O   . HOH G 2 .  ? 0.023   59.209 75.424  1.00 40.10  ? 419 HOH C O   1 
HETATM 2733 O  O   . HOH G 2 .  ? 12.808  49.943 81.877  1.00 22.91  ? 432 HOH C O   1 
HETATM 2734 O  O   . HOH G 2 .  ? 11.159  49.853 79.781  1.00 28.85  ? 435 HOH C O   1 
HETATM 2735 O  O   . HOH G 2 .  ? -5.354  66.655 85.859  1.00 44.04  ? 441 HOH C O   1 
HETATM 2736 O  O   . HOH G 2 .  ? 2.969   48.634 76.396  1.00 36.32  ? 445 HOH C O   1 
HETATM 2737 O  O   . HOH G 2 .  ? 3.165   69.636 73.468  1.00 69.68  ? 446 HOH C O   1 
HETATM 2738 O  O   . HOH G 2 .  ? 16.384  62.949 98.539  1.00 49.48  ? 448 HOH C O   1 
HETATM 2739 O  O   . HOH G 2 .  ? 1.603   76.697 73.837  1.00 54.81  ? 450 HOH C O   1 
HETATM 2740 O  O   . HOH G 2 .  ? 1.402   43.564 85.299  1.00 48.21  ? 453 HOH C O   1 
HETATM 2741 O  O   . HOH G 2 .  ? 3.243   50.481 72.488  1.00 40.29  ? 454 HOH C O   1 
HETATM 2742 O  O   . HOH G 2 .  ? -0.617  72.229 88.390  1.00 25.80  ? 456 HOH C O   1 
HETATM 2743 O  O   . HOH G 2 .  ? 10.426  77.243 70.953  1.00 60.43  ? 457 HOH C O   1 
HETATM 2744 O  O   . HOH G 2 .  ? 8.175   63.989 72.184  1.00 41.43  ? 473 HOH C O   1 
HETATM 2745 O  O   . HOH G 2 .  ? 17.659  56.498 75.364  1.00 35.13  ? 474 HOH C O   1 
HETATM 2746 O  O   . HOH G 2 .  ? 4.532   76.883 74.558  1.00 50.04  ? 481 HOH C O   1 
HETATM 2747 O  O   . HOH G 2 .  ? 6.916   42.958 91.487  1.00 48.91  ? 483 HOH C O   1 
HETATM 2748 O  O   . HOH G 2 .  ? -1.294  83.076 90.645  1.00 43.57  ? 496 HOH C O   1 
HETATM 2749 O  O   . HOH G 2 .  ? 8.403   58.973 71.431  1.00 34.83  ? 511 HOH C O   1 
HETATM 2750 O  O   . HOH G 2 .  ? 7.562   71.588 76.288  1.00 53.56  ? 527 HOH C O   1 
HETATM 2751 O  O   . HOH G 2 .  ? -1.828  64.398 92.559  1.00 36.11  ? 530 HOH C O   1 
HETATM 2752 O  O   . HOH G 2 .  ? 2.842   76.828 88.048  1.00 39.05  ? 542 HOH C O   1 
HETATM 2753 O  O   . HOH G 2 .  ? 3.142   50.661 75.078  1.00 43.02  ? 552 HOH C O   1 
HETATM 2754 O  O   . HOH G 2 .  ? -2.670  56.936 80.924  1.00 41.63  ? 554 HOH C O   1 
HETATM 2755 O  O   . HOH G 2 .  ? 7.216   74.436 76.256  1.00 55.24  ? 563 HOH C O   1 
HETATM 2756 O  O   . HOH G 2 .  ? -1.039  46.204 80.191  1.00 50.27  ? 564 HOH C O   1 
HETATM 2757 O  O   . HOH G 2 .  ? 6.364   38.594 87.450  1.00 56.80  ? 569 HOH C O   1 
HETATM 2758 O  O   . HOH G 2 .  ? -0.647  89.224 70.213  1.00 50.88  ? 584 HOH C O   1 
HETATM 2759 O  O   . HOH G 2 .  ? -10.782 69.440 80.765  1.00 61.68  ? 599 HOH C O   1 
HETATM 2760 O  O   . HOH G 2 .  ? 1.221   80.556 71.952  1.00 62.27  ? 600 HOH C O   1 
HETATM 2761 O  O   . HOH G 2 .  ? 0.231   64.266 94.646  1.00 72.27  ? 607 HOH C O   1 
HETATM 2762 O  O   . HOH G 2 .  ? 2.646   66.284 72.263  1.00 49.20  ? 617 HOH C O   1 
HETATM 2763 O  O   . HOH H 2 .  ? 28.102  55.312 100.817 1.00 22.65  ? 302 HOH D O   1 
HETATM 2764 O  O   . HOH H 2 .  ? 30.691  41.415 93.413  1.00 26.81  ? 306 HOH D O   1 
HETATM 2765 O  O   . HOH H 2 .  ? 36.257  54.788 95.838  1.00 35.85  ? 307 HOH D O   1 
HETATM 2766 O  O   . HOH H 2 .  ? 27.531  38.460 91.596  1.00 30.97  ? 329 HOH D O   1 
HETATM 2767 O  O   . HOH H 2 .  ? 18.221  51.749 92.241  1.00 25.55  ? 331 HOH D O   1 
HETATM 2768 O  O   . HOH H 2 .  ? 16.641  39.487 80.353  1.00 37.62  ? 333 HOH D O   1 
HETATM 2769 O  O   . HOH H 2 .  ? 32.882  60.636 88.602  1.00 24.78  ? 338 HOH D O   1 
HETATM 2770 O  O   . HOH H 2 .  ? 18.986  52.023 95.555  1.00 26.02  ? 351 HOH D O   1 
HETATM 2771 O  O   . HOH H 2 .  ? 30.056  39.785 91.546  1.00 37.96  ? 357 HOH D O   1 
HETATM 2772 O  O   . HOH H 2 .  ? 32.917  43.954 94.836  1.00 32.93  ? 358 HOH D O   1 
HETATM 2773 O  O   . HOH H 2 .  ? 19.686  29.019 84.740  1.00 26.52  ? 360 HOH D O   1 
HETATM 2774 O  O   . HOH H 2 .  ? 28.713  60.932 98.416  1.00 73.99  ? 362 HOH D O   1 
HETATM 2775 O  O   . HOH H 2 .  ? 29.201  41.065 89.069  1.00 33.95  ? 364 HOH D O   1 
HETATM 2776 O  O   . HOH H 2 .  ? 10.941  42.022 85.450  1.00 43.83  ? 367 HOH D O   1 
HETATM 2777 O  O   . HOH H 2 .  ? 13.439  44.263 84.978  1.00 32.10  ? 371 HOH D O   1 
HETATM 2778 O  O   . HOH H 2 .  ? 16.999  53.406 89.960  1.00 28.65  ? 378 HOH D O   1 
HETATM 2779 O  O   . HOH H 2 .  ? 34.088  46.337 75.772  1.00 53.85  ? 379 HOH D O   1 
HETATM 2780 O  O   . HOH H 2 .  ? 19.896  35.348 95.068  1.00 36.56  ? 387 HOH D O   1 
HETATM 2781 O  O   . HOH H 2 .  ? 10.166  44.910 79.820  1.00 41.90  ? 391 HOH D O   1 
HETATM 2782 O  O   . HOH H 2 .  ? 26.127  36.374 94.757  1.00 28.63  ? 400 HOH D O   1 
HETATM 2783 O  O   . HOH H 2 .  ? 20.137  59.806 88.540  1.00 33.32  ? 404 HOH D O   1 
HETATM 2784 O  O   . HOH H 2 .  ? 18.045  45.912 79.223  1.00 32.76  ? 413 HOH D O   1 
HETATM 2785 O  O   . HOH H 2 .  ? 30.159  52.007 79.005  1.00 59.63  ? 414 HOH D O   1 
HETATM 2786 O  O   . HOH H 2 .  ? 27.609  52.549 99.167  1.00 41.93  ? 421 HOH D O   1 
HETATM 2787 O  O   . HOH H 2 .  ? 27.414  38.860 94.707  1.00 46.01  ? 423 HOH D O   1 
HETATM 2788 O  O   . HOH H 2 .  ? 17.825  44.879 95.987  1.00 38.85  ? 437 HOH D O   1 
HETATM 2789 O  O   . HOH H 2 .  ? 31.706  37.729 91.382  1.00 32.96  ? 442 HOH D O   1 
HETATM 2790 O  O   . HOH H 2 .  ? 13.857  51.003 85.980  1.00 42.10  ? 443 HOH D O   1 
HETATM 2791 O  O   . HOH H 2 .  ? 29.693  39.486 87.283  1.00 45.39  ? 444 HOH D O   1 
HETATM 2792 O  O   . HOH H 2 .  ? 18.347  55.975 91.040  1.00 35.26  ? 452 HOH D O   1 
HETATM 2793 O  O   . HOH H 2 .  ? 19.580  40.833 81.713  1.00 44.40  ? 469 HOH D O   1 
HETATM 2794 O  O   . HOH H 2 .  ? 18.432  47.291 102.024 1.00 53.48  ? 475 HOH D O   1 
HETATM 2795 O  O   . HOH H 2 .  ? 8.875   40.722 92.851  1.00 43.94  ? 477 HOH D O   1 
HETATM 2796 O  O   . HOH H 2 .  ? 22.081  60.490 95.378  1.00 55.86  ? 484 HOH D O   1 
HETATM 2797 O  O   . HOH H 2 .  ? 30.059  36.521 86.783  1.00 40.84  ? 488 HOH D O   1 
HETATM 2798 O  O   . HOH H 2 .  ? 19.499  44.358 78.175  1.00 36.19  ? 491 HOH D O   1 
HETATM 2799 O  O   . HOH H 2 .  ? 29.637  36.582 90.891  1.00 43.04  ? 495 HOH D O   1 
HETATM 2800 O  O   . HOH H 2 .  ? 30.920  61.384 90.275  1.00 31.71  ? 502 HOH D O   1 
HETATM 2801 O  O   . HOH H 2 .  ? 16.527  48.137 76.703  1.00 41.28  ? 505 HOH D O   1 
HETATM 2802 O  O   . HOH H 2 .  ? 35.235  45.611 90.320  1.00 39.23  ? 506 HOH D O   1 
HETATM 2803 O  O   . HOH H 2 .  ? 24.152  56.310 93.223  1.00 33.87  ? 507 HOH D O   1 
HETATM 2804 O  O   . HOH H 2 .  ? 15.944  52.274 73.009  1.00 48.57  ? 508 HOH D O   1 
HETATM 2805 O  O   . HOH H 2 .  ? 14.433  54.268 87.077  1.00 45.18  ? 509 HOH D O   1 
HETATM 2806 O  O   . HOH H 2 .  ? 30.713  41.029 96.148  1.00 47.71  ? 510 HOH D O   1 
HETATM 2807 O  O   . HOH H 2 .  ? 22.492  54.263 76.636  1.00 47.90  ? 517 HOH D O   1 
HETATM 2808 O  O   . HOH H 2 .  ? 23.004  42.866 98.165  1.00 39.96  ? 522 HOH D O   1 
HETATM 2809 O  O   . HOH H 2 .  ? 19.111  38.459 83.110  1.00 26.50  ? 524 HOH D O   1 
HETATM 2810 O  O   . HOH H 2 .  ? 33.921  46.502 72.785  1.00 54.28  ? 531 HOH D O   1 
HETATM 2811 O  O   . HOH H 2 .  ? 18.549  33.081 90.330  1.00 48.76  ? 534 HOH D O   1 
HETATM 2812 O  O   . HOH H 2 .  ? 30.147  35.014 89.338  1.00 37.58  ? 537 HOH D O   1 
HETATM 2813 O  O   . HOH H 2 .  ? 35.179  43.189 94.774  1.00 35.91  ? 539 HOH D O   1 
HETATM 2814 O  O   . HOH H 2 .  ? 31.977  44.702 77.368  1.00 42.79  ? 543 HOH D O   1 
HETATM 2815 O  O   . HOH H 2 .  ? 22.676  33.912 94.919  1.00 47.15  ? 549 HOH D O   1 
HETATM 2816 O  O   . HOH H 2 .  ? 11.365  40.654 79.672  1.00 49.64  ? 571 HOH D O   1 
HETATM 2817 O  O   . HOH H 2 .  ? 26.862  48.947 99.766  1.00 43.06  ? 572 HOH D O   1 
HETATM 2818 O  O   . HOH H 2 .  ? 22.261  33.860 83.583  1.00 70.65  ? 577 HOH D O   1 
HETATM 2819 O  O   . HOH H 2 .  ? 23.297  29.833 95.542  1.00 46.92  ? 580 HOH D O   1 
HETATM 2820 O  O   . HOH H 2 .  ? 24.005  62.981 89.485  1.00 37.37  ? 589 HOH D O   1 
HETATM 2821 O  O   . HOH H 2 .  ? 33.245  38.044 93.238  1.00 48.84  ? 601 HOH D O   1 
HETATM 2822 O  O   . HOH H 2 .  ? 33.511  56.661 80.854  1.00 55.52  ? 606 HOH D O   1 
HETATM 2823 O  O   . HOH H 2 .  ? 35.971  54.876 84.601  1.00 46.82  ? 609 HOH D O   1 
HETATM 2824 O  O   . HOH H 2 .  ? 18.457  27.506 82.984  1.00 60.52  ? 612 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . HIS A 10 ? 0.7082 0.5993 0.7145 -0.0254 -0.0093 0.0522  151 HIS A N   
2    C  CA  . HIS A 10 ? 0.5950 0.4752 0.6130 -0.0291 -0.0123 0.0587  151 HIS A CA  
3    C  C   . HIS A 10 ? 0.5336 0.4053 0.5603 -0.0325 -0.0141 0.0503  151 HIS A C   
4    O  O   . HIS A 10 ? 0.4922 0.3653 0.5151 -0.0308 -0.0134 0.0388  151 HIS A O   
5    C  CB  . HIS A 10 ? 0.5299 0.4010 0.5535 -0.0247 -0.0154 0.0629  151 HIS A CB  
6    N  N   . MSE A 11 ? 0.5193 0.3822 0.5576 -0.0375 -0.0168 0.0565  152 MSE A N   
7    C  CA  . MSE A 11 ? 0.5883 0.4427 0.6362 -0.0415 -0.0197 0.0490  152 MSE A CA  
8    C  C   . MSE A 11 ? 0.6302 0.4753 0.6788 -0.0359 -0.0218 0.0347  152 MSE A C   
9    O  O   . MSE A 11 ? 0.6269 0.4703 0.6757 -0.0371 -0.0230 0.0237  152 MSE A O   
10   C  CB  . MSE A 11 ? 0.4780 0.3221 0.5412 -0.0474 -0.0231 0.0587  152 MSE A CB  
11   C  CG  . MSE A 11 ? 0.5552 0.3900 0.6299 -0.0523 -0.0271 0.0507  152 MSE A CG  
12   SE SE  . MSE A 11 ? 1.1101 0.9609 1.1779 -0.0576 -0.0246 0.0447  152 MSE A SE  
13   C  CE  . MSE A 11 ? 0.6530 0.5074 0.7357 -0.0685 -0.0245 0.0623  152 MSE A CE  
14   N  N   . GLN A 12 ? 0.5315 0.3718 0.5801 -0.0296 -0.0221 0.0349  153 GLN A N   
15   C  CA  . GLN A 12 ? 0.5247 0.3559 0.5761 -0.0237 -0.0235 0.0227  153 GLN A CA  
16   C  C   . GLN A 12 ? 0.4762 0.3180 0.5149 -0.0186 -0.0196 0.0140  153 GLN A C   
17   O  O   . GLN A 12 ? 0.5293 0.3690 0.5658 -0.0160 -0.0194 0.0016  153 GLN A O   
18   C  CB  . GLN A 12 ? 0.5961 0.4181 0.6558 -0.0188 -0.0256 0.0279  153 GLN A CB  
19   C  CG  . GLN A 12 ? 0.7297 0.5341 0.8041 -0.0184 -0.0302 0.0230  153 GLN A CG  
20   C  CD  . GLN A 12 ? 0.8328 0.6306 0.9171 -0.0269 -0.0335 0.0291  153 GLN A CD  
21   O  OE1 . GLN A 12 ? 0.8798 0.6811 0.9660 -0.0315 -0.0333 0.0438  153 GLN A OE1 
22   N  NE2 . GLN A 12 ? 0.8774 0.6665 0.9679 -0.0292 -0.0365 0.0180  153 GLN A NE2 
23   N  N   . LYS A 13 ? 0.3329 0.1858 0.3634 -0.0170 -0.0167 0.0210  154 LYS A N   
24   C  CA  . LYS A 13 ? 0.3722 0.2344 0.3930 -0.0118 -0.0132 0.0149  154 LYS A CA  
25   C  C   . LYS A 13 ? 0.3457 0.2220 0.3560 -0.0144 -0.0102 0.0193  154 LYS A C   
26   O  O   . LYS A 13 ? 0.3961 0.2787 0.4025 -0.0131 -0.0094 0.0266  154 LYS A O   
27   C  CB  . LYS A 13 ? 0.3950 0.2552 0.4189 -0.0054 -0.0135 0.0169  154 LYS A CB  
28   C  CG  . LYS A 13 ? 0.5118 0.3623 0.5431 0.0001  -0.0143 0.0068  154 LYS A CG  
29   C  CD  . LYS A 13 ? 0.5032 0.3424 0.5468 0.0025  -0.0180 0.0125  154 LYS A CD  
30   C  CE  . LYS A 13 ? 0.5742 0.4054 0.6255 0.0095  -0.0181 0.0022  154 LYS A CE  
31   N  NZ  . LYS A 13 ? 0.5661 0.3916 0.6171 0.0089  -0.0178 -0.0107 154 LYS A NZ  
32   N  N   . PRO A 14 ? 0.3284 0.2092 0.3346 -0.0179 -0.0092 0.0146  155 PRO A N   
33   C  CA  . PRO A 14 ? 0.3713 0.2650 0.3689 -0.0203 -0.0064 0.0176  155 PRO A CA  
34   C  C   . PRO A 14 ? 0.3066 0.2083 0.2962 -0.0151 -0.0036 0.0139  155 PRO A C   
35   O  O   . PRO A 14 ? 0.2797 0.1808 0.2673 -0.0121 -0.0026 0.0052  155 PRO A O   
36   C  CB  . PRO A 14 ? 0.3909 0.2854 0.3885 -0.0242 -0.0070 0.0112  155 PRO A CB  
37   C  CG  . PRO A 14 ? 0.3972 0.2813 0.3987 -0.0215 -0.0092 0.0013  155 PRO A CG  
38   C  CD  . PRO A 14 ? 0.3686 0.2424 0.3784 -0.0194 -0.0111 0.0052  155 PRO A CD  
39   N  N   . ILE A 15 ? 0.2822 0.1913 0.2672 -0.0142 -0.0023 0.0202  156 ILE A N   
40   C  CA  . ILE A 15 ? 0.3321 0.2483 0.3115 -0.0099 -0.0003 0.0171  156 ILE A CA  
41   C  C   . ILE A 15 ? 0.2415 0.1685 0.2136 -0.0113 0.0016  0.0198  156 ILE A C   
42   O  O   . ILE A 15 ? 0.2450 0.1752 0.2159 -0.0150 0.0018  0.0250  156 ILE A O   
43   C  CB  . ILE A 15 ? 0.2933 0.2068 0.2759 -0.0056 -0.0017 0.0200  156 ILE A CB  
44   C  CG1 . ILE A 15 ? 0.3939 0.3067 0.3774 -0.0075 -0.0039 0.0301  156 ILE A CG1 
45   C  CG2 . ILE A 15 ? 0.2239 0.1276 0.2143 -0.0025 -0.0028 0.0150  156 ILE A CG2 
46   C  CD1 . ILE A 15 ? 0.4169 0.3396 0.3927 -0.0068 -0.0033 0.0343  156 ILE A CD1 
47   N  N   . VAL A 16 ? 0.1770 0.1099 0.1451 -0.0083 0.0032  0.0162  157 VAL A N   
48   C  CA  . VAL A 16 ? 0.2185 0.1606 0.1808 -0.0086 0.0044  0.0181  157 VAL A CA  
49   C  C   . VAL A 16 ? 0.1344 0.0785 0.0964 -0.0046 0.0036  0.0184  157 VAL A C   
50   O  O   . VAL A 16 ? 0.1945 0.1365 0.1600 -0.0016 0.0038  0.0147  157 VAL A O   
51   C  CB  . VAL A 16 ? 0.2434 0.1909 0.2027 -0.0094 0.0066  0.0132  157 VAL A CB  
52   C  CG1 . VAL A 16 ? 0.2697 0.2256 0.2246 -0.0089 0.0076  0.0143  157 VAL A CG1 
53   C  CG2 . VAL A 16 ? 0.1736 0.1196 0.1344 -0.0133 0.0064  0.0125  157 VAL A CG2 
54   N  N   . ARG A 17 ? 0.2046 0.1535 0.1628 -0.0045 0.0026  0.0227  158 ARG A N   
55   C  CA  . ARG A 17 ? 0.2128 0.1648 0.1702 -0.0013 0.0008  0.0228  158 ARG A CA  
56   C  C   . ARG A 17 ? 0.2287 0.1873 0.1833 -0.0005 0.0022  0.0184  158 ARG A C   
57   O  O   . ARG A 17 ? 0.1913 0.1544 0.1413 -0.0022 0.0037  0.0182  158 ARG A O   
58   C  CB  . ARG A 17 ? 0.1874 0.1418 0.1405 -0.0013 -0.0016 0.0291  158 ARG A CB  
59   C  CG  . ARG A 17 ? 0.3209 0.2686 0.2778 -0.0017 -0.0037 0.0352  158 ARG A CG  
60   C  CD  . ARG A 17 ? 0.4859 0.4376 0.4364 -0.0022 -0.0054 0.0428  158 ARG A CD  
61   N  NE  . ARG A 17 ? 0.6166 0.5733 0.5615 -0.0056 -0.0022 0.0450  158 ARG A NE  
62   C  CZ  . ARG A 17 ? 0.7868 0.7504 0.7238 -0.0062 -0.0019 0.0504  158 ARG A CZ  
63   N  NH1 . ARG A 17 ? 0.8737 0.8396 0.8059 -0.0035 -0.0053 0.0541  158 ARG A NH1 
64   N  NH2 . ARG A 17 ? 0.8074 0.7764 0.7411 -0.0091 0.0019  0.0521  158 ARG A NH2 
65   N  N   . VAL A 18 ? 0.1610 0.1202 0.1196 0.0020  0.0016  0.0152  159 VAL A N   
66   C  CA  . VAL A 18 ? 0.1347 0.0987 0.0927 0.0024  0.0028  0.0115  159 VAL A CA  
67   C  C   . VAL A 18 ? 0.1399 0.1069 0.0998 0.0046  -0.0003 0.0109  159 VAL A C   
68   O  O   . VAL A 18 ? 0.2022 0.1678 0.1681 0.0064  -0.0019 0.0112  159 VAL A O   
69   C  CB  . VAL A 18 ? 0.2292 0.1921 0.1913 0.0027  0.0056  0.0082  159 VAL A CB  
70   C  CG1 . VAL A 18 ? 0.2058 0.1735 0.1681 0.0029  0.0065  0.0058  159 VAL A CG1 
71   C  CG2 . VAL A 18 ? 0.1772 0.1368 0.1371 0.0005  0.0076  0.0077  159 VAL A CG2 
72   N  N   . PHE A 19 ? 0.1270 0.0984 0.0826 0.0045  -0.0013 0.0096  160 PHE A N   
73   C  CA  . PHE A 19 ? 0.1517 0.1259 0.1097 0.0063  -0.0049 0.0075  160 PHE A CA  
74   C  C   . PHE A 19 ? 0.1909 0.1662 0.1555 0.0065  -0.0038 0.0038  160 PHE A C   
75   O  O   . PHE A 19 ? 0.2359 0.2120 0.1989 0.0055  -0.0010 0.0023  160 PHE A O   
76   C  CB  . PHE A 19 ? 0.2228 0.2010 0.1721 0.0067  -0.0069 0.0071  160 PHE A CB  
77   C  CG  . PHE A 19 ? 0.2872 0.2653 0.2303 0.0066  -0.0084 0.0123  160 PHE A CG  
78   C  CD1 . PHE A 19 ? 0.3087 0.2862 0.2473 0.0046  -0.0051 0.0161  160 PHE A CD1 
79   C  CD2 . PHE A 19 ? 0.2812 0.2598 0.2243 0.0084  -0.0133 0.0141  160 PHE A CD2 
80   C  CE1 . PHE A 19 ? 0.3087 0.2857 0.2427 0.0042  -0.0063 0.0224  160 PHE A CE1 
81   C  CE2 . PHE A 19 ? 0.2765 0.2549 0.2141 0.0085  -0.0149 0.0202  160 PHE A CE2 
82   C  CZ  . PHE A 19 ? 0.2483 0.2258 0.1814 0.0063  -0.0112 0.0248  160 PHE A CZ  
83   N  N   . LEU A 20 ? 0.2352 0.2109 0.2081 0.0076  -0.0060 0.0030  161 LEU A N   
84   C  CA  . LEU A 20 ? 0.2739 0.2506 0.2555 0.0074  -0.0046 0.0013  161 LEU A CA  
85   C  C   . LEU A 20 ? 0.2468 0.2258 0.2332 0.0078  -0.0093 -0.0017 161 LEU A C   
86   O  O   . LEU A 20 ? 0.2194 0.1995 0.2026 0.0087  -0.0140 -0.0028 161 LEU A O   
87   C  CB  . LEU A 20 ? 0.2413 0.2175 0.2314 0.0082  -0.0026 0.0031  161 LEU A CB  
88   C  CG  . LEU A 20 ? 0.2984 0.2715 0.2843 0.0081  0.0016  0.0044  161 LEU A CG  
89   C  CD1 . LEU A 20 ? 0.2042 0.1768 0.1979 0.0100  0.0033  0.0053  161 LEU A CD1 
90   C  CD2 . LEU A 20 ? 0.2417 0.2150 0.2236 0.0067  0.0055  0.0036  161 LEU A CD2 
91   N  N   . PRO A 21 ? 0.2443 0.2239 0.2384 0.0071  -0.0083 -0.0030 162 PRO A N   
92   C  CA  . PRO A 21 ? 0.3572 0.3379 0.3588 0.0071  -0.0133 -0.0063 162 PRO A CA  
93   C  C   . PRO A 21 ? 0.2891 0.2716 0.2971 0.0078  -0.0183 -0.0062 162 PRO A C   
94   O  O   . PRO A 21 ? 0.2851 0.2682 0.2967 0.0084  -0.0167 -0.0028 162 PRO A O   
95   C  CB  . PRO A 21 ? 0.3199 0.3007 0.3325 0.0057  -0.0103 -0.0048 162 PRO A CB  
96   C  CG  . PRO A 21 ? 0.2652 0.2451 0.2709 0.0054  -0.0046 -0.0026 162 PRO A CG  
97   C  CD  . PRO A 21 ? 0.2011 0.1802 0.1976 0.0061  -0.0030 -0.0012 162 PRO A CD  
98   N  N   . ASN A 22 ? 0.3397 0.3232 0.3495 0.0081  -0.0247 -0.0104 163 ASN A N   
99   C  CA  . ASN A 22 ? 0.4271 0.4131 0.4450 0.0086  -0.0307 -0.0107 163 ASN A CA  
100  C  C   . ASN A 22 ? 0.3845 0.3714 0.3945 0.0103  -0.0325 -0.0079 163 ASN A C   
101  O  O   . ASN A 22 ? 0.3742 0.3630 0.3927 0.0111  -0.0346 -0.0052 163 ASN A O   
102  C  CB  . ASN A 22 ? 0.5590 0.5467 0.5941 0.0074  -0.0287 -0.0076 163 ASN A CB  
103  C  CG  . ASN A 22 ? 0.7671 0.7542 0.8131 0.0053  -0.0289 -0.0095 163 ASN A CG  
104  O  OD1 . ASN A 22 ? 0.8463 0.8352 0.9053 0.0039  -0.0255 -0.0059 163 ASN A OD1 
105  N  ND2 . ASN A 22 ? 0.8263 0.8109 0.8673 0.0052  -0.0326 -0.0149 163 ASN A ND2 
106  N  N   . LYS A 23 ? 0.3254 0.3113 0.3202 0.0111  -0.0314 -0.0078 164 LYS A N   
107  C  CA  . LYS A 23 ? 0.3469 0.3334 0.3333 0.0126  -0.0336 -0.0043 164 LYS A CA  
108  C  C   . LYS A 23 ? 0.3074 0.2918 0.2989 0.0128  -0.0297 0.0012  164 LYS A C   
109  O  O   . LYS A 23 ? 0.3716 0.3563 0.3629 0.0143  -0.0327 0.0047  164 LYS A O   
110  C  CB  . LYS A 23 ? 0.4588 0.4487 0.4479 0.0138  -0.0424 -0.0061 164 LYS A CB  
111  C  CG  . LYS A 23 ? 0.5641 0.5558 0.5496 0.0139  -0.0474 -0.0134 164 LYS A CG  
112  C  CD  . LYS A 23 ? 0.6842 0.6778 0.6511 0.0155  -0.0487 -0.0147 164 LYS A CD  
113  C  CE  . LYS A 23 ? 0.7702 0.7656 0.7330 0.0163  -0.0537 -0.0235 164 LYS A CE  
114  N  NZ  . LYS A 23 ? 0.8181 0.8177 0.7623 0.0187  -0.0565 -0.0248 164 LYS A NZ  
115  N  N   . GLN A 24 ? 0.2048 0.1872 0.2008 0.0118  -0.0233 0.0017  165 GLN A N   
116  C  CA  . GLN A 24 ? 0.2392 0.2194 0.2389 0.0126  -0.0194 0.0054  165 GLN A CA  
117  C  C   . GLN A 24 ? 0.1915 0.1676 0.1804 0.0118  -0.0150 0.0074  165 GLN A C   
118  O  O   . GLN A 24 ? 0.2081 0.1842 0.1876 0.0105  -0.0140 0.0062  165 GLN A O   
119  C  CB  . GLN A 24 ? 0.2388 0.2204 0.2516 0.0125  -0.0157 0.0052  165 GLN A CB  
120  C  CG  . GLN A 24 ? 0.2876 0.2736 0.3145 0.0136  -0.0202 0.0054  165 GLN A CG  
121  C  CD  . GLN A 24 ? 0.2940 0.2831 0.3349 0.0136  -0.0154 0.0061  165 GLN A CD  
122  O  OE1 . GLN A 24 ? 0.2679 0.2557 0.3077 0.0143  -0.0090 0.0072  165 GLN A OE1 
123  N  NE2 . GLN A 24 ? 0.3179 0.3117 0.3721 0.0128  -0.0187 0.0056  165 GLN A NE2 
124  N  N   . ARG A 25 ? 0.2052 0.1781 0.1966 0.0128  -0.0127 0.0100  166 ARG A N   
125  C  CA  . ARG A 25 ? 0.2384 0.2069 0.2216 0.0116  -0.0095 0.0117  166 ARG A CA  
126  C  C   . ARG A 25 ? 0.1742 0.1385 0.1628 0.0126  -0.0058 0.0120  166 ARG A C   
127  O  O   . ARG A 25 ? 0.2149 0.1799 0.2131 0.0150  -0.0058 0.0117  166 ARG A O   
128  C  CB  . ARG A 25 ? 0.2666 0.2342 0.2421 0.0116  -0.0133 0.0157  166 ARG A CB  
129  C  CG  . ARG A 25 ? 0.3584 0.3264 0.3402 0.0142  -0.0182 0.0184  166 ARG A CG  
130  C  CD  . ARG A 25 ? 0.4349 0.4027 0.4087 0.0144  -0.0224 0.0235  166 ARG A CD  
131  N  NE  . ARG A 25 ? 0.3828 0.3561 0.3474 0.0141  -0.0258 0.0224  166 ARG A NE  
132  C  CZ  . ARG A 25 ? 0.4110 0.3868 0.3694 0.0153  -0.0311 0.0263  166 ARG A CZ  
133  N  NH1 . ARG A 25 ? 0.4571 0.4301 0.4190 0.0169  -0.0340 0.0325  166 ARG A NH1 
134  N  NH2 . ARG A 25 ? 0.4859 0.4671 0.4346 0.0154  -0.0337 0.0239  166 ARG A NH2 
135  N  N   . THR A 26 ? 0.1692 0.1298 0.1519 0.0109  -0.0026 0.0119  167 THR A N   
136  C  CA  . THR A 26 ? 0.2522 0.2079 0.2382 0.0119  0.0002  0.0109  167 THR A CA  
137  C  C   . THR A 26 ? 0.1983 0.1487 0.1780 0.0095  0.0007  0.0124  167 THR A C   
138  O  O   . THR A 26 ? 0.1741 0.1262 0.1466 0.0068  0.0005  0.0137  167 THR A O   
139  C  CB  . THR A 26 ? 0.1946 0.1528 0.1835 0.0124  0.0048  0.0070  167 THR A CB  
140  O  OG1 . THR A 26 ? 0.2506 0.2049 0.2436 0.0146  0.0071  0.0051  167 THR A OG1 
141  C  CG2 . THR A 26 ? 0.1908 0.1499 0.1718 0.0095  0.0072  0.0055  167 THR A CG2 
142  N  N   . VAL A 27 ? 0.1639 0.1081 0.1473 0.0105  0.0015  0.0117  168 VAL A N   
143  C  CA  . VAL A 27 ? 0.1979 0.1364 0.1777 0.0078  0.0018  0.0124  168 VAL A CA  
144  C  C   . VAL A 27 ? 0.2461 0.1828 0.2261 0.0080  0.0053  0.0064  168 VAL A C   
145  O  O   . VAL A 27 ? 0.2840 0.2210 0.2690 0.0114  0.0070  0.0030  168 VAL A O   
146  C  CB  . VAL A 27 ? 0.2804 0.2113 0.2651 0.0086  -0.0011 0.0163  168 VAL A CB  
147  C  CG1 . VAL A 27 ? 0.2902 0.2145 0.2734 0.0051  -0.0008 0.0165  168 VAL A CG1 
148  C  CG2 . VAL A 27 ? 0.3650 0.2985 0.3477 0.0084  -0.0049 0.0232  168 VAL A CG2 
149  N  N   . VAL A 28 ? 0.2174 0.1537 0.1921 0.0047  0.0063  0.0050  169 VAL A N   
150  C  CA  . VAL A 28 ? 0.1943 0.1286 0.1680 0.0049  0.0086  -0.0009 169 VAL A CA  
151  C  C   . VAL A 28 ? 0.2166 0.1440 0.1901 0.0017  0.0068  -0.0013 169 VAL A C   
152  O  O   . VAL A 28 ? 0.1985 0.1256 0.1712 -0.0016 0.0050  0.0039  169 VAL A O   
153  C  CB  . VAL A 28 ? 0.2598 0.2013 0.2277 0.0040  0.0112  -0.0032 169 VAL A CB  
154  C  CG1 . VAL A 28 ? 0.2406 0.1883 0.2107 0.0066  0.0129  -0.0025 169 VAL A CG1 
155  C  CG2 . VAL A 28 ? 0.2379 0.1823 0.2013 0.0000  0.0101  -0.0002 169 VAL A CG2 
156  N  N   . PRO A 29 ? 0.2278 0.1501 0.2024 0.0028  0.0073  -0.0074 170 PRO A N   
157  C  CA  . PRO A 29 ? 0.3053 0.2205 0.2809 -0.0007 0.0050  -0.0090 170 PRO A CA  
158  C  C   . PRO A 29 ? 0.3205 0.2410 0.2905 -0.0051 0.0049  -0.0089 170 PRO A C   
159  O  O   . PRO A 29 ? 0.2848 0.2126 0.2491 -0.0044 0.0070  -0.0110 170 PRO A O   
160  C  CB  . PRO A 29 ? 0.3463 0.2562 0.3233 0.0027  0.0057  -0.0177 170 PRO A CB  
161  C  CG  . PRO A 29 ? 0.3443 0.2616 0.3178 0.0068  0.0097  -0.0205 170 PRO A CG  
162  C  CD  . PRO A 29 ? 0.2671 0.1900 0.2427 0.0074  0.0102  -0.0134 170 PRO A CD  
163  N  N   . ALA A 30 ? 0.3169 0.2341 0.2896 -0.0097 0.0024  -0.0057 171 ALA A N   
164  C  CA  . ALA A 30 ? 0.3729 0.2961 0.3423 -0.0139 0.0022  -0.0049 171 ALA A CA  
165  C  C   . ALA A 30 ? 0.3445 0.2631 0.3144 -0.0155 0.0001  -0.0121 171 ALA A C   
166  O  O   . ALA A 30 ? 0.3838 0.2980 0.3591 -0.0198 -0.0028 -0.0112 171 ALA A O   
167  C  CB  . ALA A 30 ? 0.3854 0.3093 0.3584 -0.0180 0.0012  0.0031  171 ALA A CB  
168  N  N   . ARG A 31 ? 0.3577 0.2779 0.3222 -0.0121 0.0014  -0.0192 172 ARG A N   
169  C  CA  . ARG A 31 ? 0.4489 0.3649 0.4120 -0.0126 -0.0010 -0.0278 172 ARG A CA  
170  C  C   . ARG A 31 ? 0.3144 0.2367 0.2731 -0.0161 -0.0028 -0.0295 172 ARG A C   
171  O  O   . ARG A 31 ? 0.3035 0.2350 0.2563 -0.0152 -0.0007 -0.0278 172 ARG A O   
172  C  CB  . ARG A 31 ? 0.5126 0.4282 0.4707 -0.0066 0.0017  -0.0349 172 ARG A CB  
173  C  CG  . ARG A 31 ? 0.5421 0.4521 0.5058 -0.0023 0.0035  -0.0342 172 ARG A CG  
174  C  CD  . ARG A 31 ? 0.5879 0.4968 0.5486 0.0035  0.0061  -0.0429 172 ARG A CD  
175  N  NE  . ARG A 31 ? 0.6519 0.5714 0.6032 0.0056  0.0098  -0.0443 172 ARG A NE  
176  C  CZ  . ARG A 31 ? 0.6825 0.6041 0.6270 0.0093  0.0120  -0.0522 172 ARG A CZ  
177  N  NH1 . ARG A 31 ? 0.6949 0.6083 0.6409 0.0118  0.0107  -0.0610 172 ARG A NH1 
178  N  NH2 . ARG A 31 ? 0.6593 0.5911 0.5954 0.0107  0.0155  -0.0512 172 ARG A NH2 
179  N  N   . CYS A 32 ? 0.2682 0.1855 0.2310 -0.0200 -0.0072 -0.0331 173 CYS A N   
180  C  CA  . CYS A 32 ? 0.2320 0.1560 0.1920 -0.0235 -0.0098 -0.0346 173 CYS A CA  
181  C  C   . CYS A 32 ? 0.2910 0.2210 0.2399 -0.0195 -0.0085 -0.0403 173 CYS A C   
182  O  O   . CYS A 32 ? 0.3344 0.2605 0.2786 -0.0153 -0.0074 -0.0469 173 CYS A O   
183  C  CB  . CYS A 32 ? 0.3765 0.2934 0.3433 -0.0282 -0.0157 -0.0395 173 CYS A CB  
184  S  SG  . CYS A 32 ? 0.5322 0.4467 0.5128 -0.0349 -0.0173 -0.0299 173 CYS A SG  
185  N  N   . GLY A 33 ? 0.2354 0.1755 0.1802 -0.0206 -0.0083 -0.0372 174 GLY A N   
186  C  CA  . GLY A 33 ? 0.2421 0.1887 0.1762 -0.0172 -0.0073 -0.0408 174 GLY A CA  
187  C  C   . GLY A 33 ? 0.3426 0.2934 0.2713 -0.0122 -0.0015 -0.0378 174 GLY A C   
188  O  O   . GLY A 33 ? 0.4000 0.3566 0.3200 -0.0094 -0.0002 -0.0397 174 GLY A O   
189  N  N   . VAL A 34 ? 0.2882 0.2366 0.2224 -0.0111 0.0017  -0.0328 175 VAL A N   
190  C  CA  . VAL A 34 ? 0.2803 0.2325 0.2120 -0.0069 0.0066  -0.0299 175 VAL A CA  
191  C  C   . VAL A 34 ? 0.2614 0.2201 0.1955 -0.0081 0.0077  -0.0222 175 VAL A C   
192  O  O   . VAL A 34 ? 0.2693 0.2269 0.2091 -0.0108 0.0066  -0.0183 175 VAL A O   
193  C  CB  . VAL A 34 ? 0.3624 0.3077 0.2991 -0.0041 0.0087  -0.0306 175 VAL A CB  
194  C  CG1 . VAL A 34 ? 0.2823 0.2325 0.2187 -0.0003 0.0133  -0.0272 175 VAL A CG1 
195  C  CG2 . VAL A 34 ? 0.3559 0.2938 0.2915 -0.0021 0.0077  -0.0393 175 VAL A CG2 
196  N  N   . THR A 35 ? 0.2414 0.2072 0.1713 -0.0062 0.0098  -0.0201 176 THR A N   
197  C  CA  . THR A 35 ? 0.2779 0.2487 0.2109 -0.0067 0.0107  -0.0139 176 THR A CA  
198  C  C   . THR A 35 ? 0.2188 0.1871 0.1570 -0.0053 0.0129  -0.0110 176 THR A C   
199  O  O   . THR A 35 ? 0.2382 0.2027 0.1773 -0.0031 0.0145  -0.0129 176 THR A O   
200  C  CB  . THR A 35 ? 0.1871 0.1650 0.1160 -0.0048 0.0122  -0.0115 176 THR A CB  
201  O  OG1 . THR A 35 ? 0.1820 0.1601 0.1086 -0.0014 0.0159  -0.0120 176 THR A OG1 
202  C  CG2 . THR A 35 ? 0.3327 0.3144 0.2558 -0.0059 0.0093  -0.0135 176 THR A CG2 
203  N  N   . VAL A 36 ? 0.1436 0.1146 0.0852 -0.0063 0.0127  -0.0069 177 VAL A N   
204  C  CA  . VAL A 36 ? 0.1287 0.0989 0.0741 -0.0048 0.0140  -0.0043 177 VAL A CA  
205  C  C   . VAL A 36 ? 0.2032 0.1753 0.1489 -0.0018 0.0165  -0.0040 177 VAL A C   
206  O  O   . VAL A 36 ? 0.1736 0.1436 0.1226 -0.0001 0.0176  -0.0038 177 VAL A O   
207  C  CB  . VAL A 36 ? 0.1532 0.1275 0.1007 -0.0060 0.0132  -0.0011 177 VAL A CB  
208  C  CG1 . VAL A 36 ? 0.2127 0.1870 0.1631 -0.0041 0.0138  0.0006  177 VAL A CG1 
209  C  CG2 . VAL A 36 ? 0.1439 0.1172 0.0923 -0.0091 0.0116  -0.0005 177 VAL A CG2 
210  N  N   . ARG A 37 ? 0.2115 0.1882 0.1546 -0.0013 0.0174  -0.0032 178 ARG A N   
211  C  CA  . ARG A 37 ? 0.2293 0.2090 0.1731 0.0010  0.0203  -0.0015 178 ARG A CA  
212  C  C   . ARG A 37 ? 0.2556 0.2333 0.1983 0.0032  0.0228  -0.0044 178 ARG A C   
213  O  O   . ARG A 37 ? 0.1730 0.1510 0.1210 0.0050  0.0249  -0.0031 178 ARG A O   
214  C  CB  . ARG A 37 ? 0.2685 0.2532 0.2078 0.0011  0.0205  0.0002  178 ARG A CB  
215  C  CG  . ARG A 37 ? 0.3967 0.3855 0.3379 0.0030  0.0238  0.0043  178 ARG A CG  
216  C  CD  . ARG A 37 ? 0.4236 0.4175 0.3581 0.0034  0.0243  0.0064  178 ARG A CD  
217  N  NE  . ARG A 37 ? 0.4162 0.4116 0.3502 0.0019  0.0206  0.0078  178 ARG A NE  
218  C  CZ  . ARG A 37 ? 0.4380 0.4349 0.3780 0.0017  0.0197  0.0122  178 ARG A CZ  
219  N  NH1 . ARG A 37 ? 0.4321 0.4286 0.3795 0.0025  0.0216  0.0156  178 ARG A NH1 
220  N  NH2 . ARG A 37 ? 0.3722 0.3710 0.3123 0.0009  0.0165  0.0129  178 ARG A NH2 
221  N  N   . ASP A 38 ? 0.1828 0.1588 0.1195 0.0032  0.0224  -0.0087 179 ASP A N   
222  C  CA  . ASP A 38 ? 0.2298 0.2034 0.1653 0.0058  0.0247  -0.0130 179 ASP A CA  
223  C  C   . ASP A 38 ? 0.2499 0.2172 0.1922 0.0064  0.0239  -0.0142 179 ASP A C   
224  O  O   . ASP A 38 ? 0.2833 0.2502 0.2290 0.0093  0.0265  -0.0154 179 ASP A O   
225  C  CB  . ASP A 38 ? 0.3019 0.2745 0.2290 0.0058  0.0236  -0.0187 179 ASP A CB  
226  C  CG  . ASP A 38 ? 0.4119 0.3919 0.3310 0.0067  0.0251  -0.0175 179 ASP A CG  
227  O  OD1 . ASP A 38 ? 0.4541 0.4397 0.3747 0.0081  0.0286  -0.0124 179 ASP A OD1 
228  O  OD2 . ASP A 38 ? 0.4487 0.4290 0.3603 0.0058  0.0225  -0.0214 179 ASP A OD2 
229  N  N   . SER A 39 ? 0.2191 0.1822 0.1637 0.0036  0.0203  -0.0132 180 SER A N   
230  C  CA  . SER A 39 ? 0.2287 0.1865 0.1793 0.0041  0.0191  -0.0124 180 SER A CA  
231  C  C   . SER A 39 ? 0.2249 0.1854 0.1815 0.0060  0.0204  -0.0090 180 SER A C   
232  O  O   . SER A 39 ? 0.2241 0.1817 0.1860 0.0080  0.0204  -0.0092 180 SER A O   
233  C  CB  . SER A 39 ? 0.2219 0.1769 0.1734 0.0005  0.0157  -0.0101 180 SER A CB  
234  O  OG  . SER A 39 ? 0.2635 0.2147 0.2125 -0.0017 0.0137  -0.0132 180 SER A OG  
235  N  N   . LEU A 40 ? 0.1944 0.1604 0.1513 0.0054  0.0210  -0.0058 181 LEU A N   
236  C  CA  . LEU A 40 ? 0.1694 0.1377 0.1330 0.0065  0.0211  -0.0029 181 LEU A CA  
237  C  C   . LEU A 40 ? 0.1839 0.1577 0.1513 0.0084  0.0247  -0.0017 181 LEU A C   
238  O  O   . LEU A 40 ? 0.2259 0.2018 0.2007 0.0091  0.0245  0.0005  181 LEU A O   
239  C  CB  . LEU A 40 ? 0.2510 0.2209 0.2145 0.0043  0.0184  -0.0003 181 LEU A CB  
240  C  CG  . LEU A 40 ? 0.2489 0.2154 0.2108 0.0028  0.0153  0.0003  181 LEU A CG  
241  C  CD1 . LEU A 40 ? 0.1860 0.1557 0.1465 0.0014  0.0138  0.0018  181 LEU A CD1 
242  C  CD2 . LEU A 40 ? 0.2646 0.2285 0.2312 0.0044  0.0138  0.0012  181 LEU A CD2 
243  N  N   . LYS A 41 ? 0.2747 0.2513 0.2371 0.0091  0.0278  -0.0028 182 LYS A N   
244  C  CA  . LYS A 41 ? 0.3475 0.3305 0.3126 0.0107  0.0322  -0.0004 182 LYS A CA  
245  C  C   . LYS A 41 ? 0.3009 0.2859 0.2760 0.0132  0.0343  0.0002  182 LYS A C   
246  O  O   . LYS A 41 ? 0.2922 0.2817 0.2756 0.0130  0.0354  0.0041  182 LYS A O   
247  C  CB  . LYS A 41 ? 0.4279 0.4131 0.3838 0.0121  0.0353  -0.0032 182 LYS A CB  
248  C  CG  . LYS A 41 ? 0.5635 0.5567 0.5181 0.0132  0.0401  0.0005  182 LYS A CG  
249  C  CD  . LYS A 41 ? 0.6196 0.6145 0.5614 0.0141  0.0412  -0.0028 182 LYS A CD  
250  C  CE  . LYS A 41 ? 0.6430 0.6320 0.5810 0.0157  0.0402  -0.0107 182 LYS A CE  
251  N  NZ  . LYS A 41 ? 0.6084 0.5963 0.5343 0.0156  0.0386  -0.0160 182 LYS A NZ  
252  N  N   . LYS A 42 ? 0.3314 0.3127 0.3072 0.0155  0.0346  -0.0037 183 LYS A N   
253  C  CA  . LYS A 42 ? 0.3430 0.3266 0.3292 0.0184  0.0365  -0.0034 183 LYS A CA  
254  C  C   . LYS A 42 ? 0.2705 0.2534 0.2661 0.0172  0.0322  -0.0004 183 LYS A C   
255  O  O   . LYS A 42 ? 0.2745 0.2628 0.2805 0.0179  0.0334  0.0024  183 LYS A O   
256  C  CB  . LYS A 42 ? 0.4820 0.4611 0.4672 0.0216  0.0374  -0.0088 183 LYS A CB  
257  C  CG  . LYS A 42 ? 0.6404 0.6218 0.6170 0.0238  0.0421  -0.0131 183 LYS A CG  
258  C  CD  . LYS A 42 ? 0.6677 0.6461 0.6467 0.0283  0.0441  -0.0191 183 LYS A CD  
259  C  CE  . LYS A 42 ? 0.7289 0.7139 0.7204 0.0320  0.0481  -0.0171 183 LYS A CE  
260  N  NZ  . LYS A 42 ? 0.7135 0.7097 0.7041 0.0335  0.0552  -0.0151 183 LYS A NZ  
261  N  N   . ALA A 43 ? 0.2708 0.2476 0.2631 0.0155  0.0271  -0.0008 184 ALA A N   
262  C  CA  . ALA A 43 ? 0.2444 0.2210 0.2430 0.0146  0.0225  0.0016  184 ALA A CA  
263  C  C   . ALA A 43 ? 0.2661 0.2476 0.2689 0.0127  0.0221  0.0043  184 ALA A C   
264  O  O   . ALA A 43 ? 0.3371 0.3213 0.3497 0.0128  0.0198  0.0059  184 ALA A O   
265  C  CB  . ALA A 43 ? 0.3178 0.2886 0.3096 0.0127  0.0180  0.0014  184 ALA A CB  
266  N  N   . LEU A 44 ? 0.2415 0.2240 0.2381 0.0109  0.0238  0.0049  185 LEU A N   
267  C  CA  . LEU A 44 ? 0.2586 0.2444 0.2599 0.0092  0.0232  0.0076  185 LEU A CA  
268  C  C   . LEU A 44 ? 0.2945 0.2865 0.3063 0.0100  0.0271  0.0106  185 LEU A C   
269  O  O   . LEU A 44 ? 0.2360 0.2303 0.2586 0.0091  0.0251  0.0127  185 LEU A O   
270  C  CB  . LEU A 44 ? 0.3480 0.3333 0.3408 0.0075  0.0240  0.0081  185 LEU A CB  
271  C  CG  . LEU A 44 ? 0.3780 0.3603 0.3670 0.0058  0.0196  0.0071  185 LEU A CG  
272  C  CD1 . LEU A 44 ? 0.3802 0.3594 0.3683 0.0061  0.0159  0.0051  185 LEU A CD1 
273  C  CD2 . LEU A 44 ? 0.3526 0.3342 0.3323 0.0049  0.0203  0.0066  185 LEU A CD2 
274  N  N   A MSE A 45 ? 0.2986 0.2936 0.3071 0.0117  0.0327  0.0108  186 MSE A N   
275  N  N   B MSE A 45 ? 0.2948 0.2898 0.3031 0.0117  0.0327  0.0108  186 MSE A N   
276  C  CA  A MSE A 45 ? 0.3145 0.3171 0.3321 0.0128  0.0379  0.0142  186 MSE A CA  
277  C  CA  B MSE A 45 ? 0.3128 0.3153 0.3301 0.0129  0.0380  0.0141  186 MSE A CA  
278  C  C   A MSE A 45 ? 0.3243 0.3294 0.3558 0.0142  0.0369  0.0144  186 MSE A C   
279  C  C   B MSE A 45 ? 0.3253 0.3303 0.3569 0.0141  0.0366  0.0144  186 MSE A C   
280  O  O   A MSE A 45 ? 0.3452 0.3562 0.3896 0.0133  0.0381  0.0185  186 MSE A O   
281  O  O   B MSE A 45 ? 0.3542 0.3646 0.3987 0.0130  0.0373  0.0184  186 MSE A O   
282  C  CB  A MSE A 45 ? 0.3287 0.3346 0.3379 0.0153  0.0443  0.0130  186 MSE A CB  
283  C  CB  B MSE A 45 ? 0.3037 0.3089 0.3129 0.0157  0.0440  0.0121  186 MSE A CB  
284  C  CG  A MSE A 45 ? 0.3850 0.4005 0.4000 0.0159  0.0509  0.0183  186 MSE A CG  
285  C  CG  B MSE A 45 ? 0.3774 0.3916 0.3955 0.0180  0.0506  0.0150  186 MSE A CG  
286  SE SE  A MSE A 45 ? 0.9250 0.9429 0.9337 0.0128  0.0520  0.0249  186 MSE A SE  
287  SE SE  B MSE A 45 ? 0.9542 0.9717 0.9594 0.0227  0.0580  0.0100  186 MSE A SE  
288  C  CE  A MSE A 45 ? 0.2240 0.2395 0.2500 0.0087  0.0459  0.0293  186 MSE A CE  
289  C  CE  B MSE A 45 ? 0.4072 0.4142 0.4112 0.0252  0.0530  0.0017  186 MSE A CE  
290  N  N   . MSE A 46 ? 0.2866 0.2876 0.3171 0.0161  0.0341  0.0107  187 MSE A N   
291  C  CA  . MSE A 46 ? 0.3494 0.3529 0.3934 0.0177  0.0321  0.0111  187 MSE A CA  
292  C  C   . MSE A 46 ? 0.3105 0.3149 0.3639 0.0148  0.0263  0.0133  187 MSE A C   
293  O  O   . MSE A 46 ? 0.2869 0.2953 0.3540 0.0153  0.0242  0.0145  187 MSE A O   
294  C  CB  . MSE A 46 ? 0.3342 0.3315 0.3749 0.0199  0.0284  0.0077  187 MSE A CB  
295  C  CG  . MSE A 46 ? 0.4576 0.4569 0.5026 0.0243  0.0328  0.0057  187 MSE A CG  
296  SE SE  . MSE A 46 ? 1.1330 1.1208 1.1682 0.0262  0.0288  0.0013  187 MSE A SE  
297  C  CE  . MSE A 46 ? 0.1925 0.1764 0.2284 0.0230  0.0190  0.0043  187 MSE A CE  
298  N  N   . ARG A 47 ? 0.2849 0.2852 0.3311 0.0120  0.0231  0.0132  188 ARG A N   
299  C  CA  . ARG A 47 ? 0.3024 0.3021 0.3557 0.0097  0.0167  0.0134  188 ARG A CA  
300  C  C   . ARG A 47 ? 0.3141 0.3159 0.3723 0.0070  0.0184  0.0165  188 ARG A C   
301  O  O   . ARG A 47 ? 0.3214 0.3214 0.3842 0.0049  0.0133  0.0159  188 ARG A O   
302  C  CB  . ARG A 47 ? 0.3605 0.3536 0.4023 0.0092  0.0111  0.0100  188 ARG A CB  
303  C  CG  . ARG A 47 ? 0.3767 0.3680 0.4173 0.0113  0.0077  0.0085  188 ARG A CG  
304  C  CD  . ARG A 47 ? 0.3866 0.3722 0.4134 0.0110  0.0051  0.0066  188 ARG A CD  
305  N  NE  . ARG A 47 ? 0.3984 0.3817 0.4239 0.0129  0.0016  0.0066  188 ARG A NE  
306  C  CZ  . ARG A 47 ? 0.3631 0.3432 0.3847 0.0147  0.0039  0.0067  188 ARG A CZ  
307  N  NH1 . ARG A 47 ? 0.3040 0.2830 0.3218 0.0150  0.0097  0.0058  188 ARG A NH1 
308  N  NH2 . ARG A 47 ? 0.3774 0.3550 0.3990 0.0162  -0.0001 0.0077  188 ARG A NH2 
309  N  N   . GLY A 48 ? 0.2892 0.2952 0.3467 0.0074  0.0254  0.0198  189 GLY A N   
310  C  CA  . GLY A 48 ? 0.3420 0.3502 0.4038 0.0050  0.0276  0.0245  189 GLY A CA  
311  C  C   . GLY A 48 ? 0.3872 0.3897 0.4390 0.0035  0.0250  0.0235  189 GLY A C   
312  O  O   . GLY A 48 ? 0.3250 0.3271 0.3837 0.0013  0.0237  0.0266  189 GLY A O   
313  N  N   . LEU A 49 ? 0.3207 0.3187 0.3577 0.0047  0.0241  0.0195  190 LEU A N   
314  C  CA  . LEU A 49 ? 0.3249 0.3186 0.3528 0.0037  0.0220  0.0184  190 LEU A CA  
315  C  C   . LEU A 49 ? 0.3314 0.3264 0.3480 0.0045  0.0267  0.0198  190 LEU A C   
316  O  O   . LEU A 49 ? 0.3144 0.3117 0.3266 0.0062  0.0306  0.0191  190 LEU A O   
317  C  CB  . LEU A 49 ? 0.3255 0.3143 0.3459 0.0042  0.0171  0.0131  190 LEU A CB  
318  C  CG  . LEU A 49 ? 0.4117 0.3997 0.4412 0.0037  0.0116  0.0111  190 LEU A CG  
319  C  CD1 . LEU A 49 ? 0.5260 0.5107 0.5468 0.0046  0.0076  0.0069  190 LEU A CD1 
320  C  CD2 . LEU A 49 ? 0.4435 0.4304 0.4802 0.0020  0.0090  0.0117  190 LEU A CD2 
321  N  N   . ILE A 50 ? 0.2856 0.2791 0.2973 0.0035  0.0258  0.0210  191 ILE A N   
322  C  CA  . ILE A 50 ? 0.3486 0.3431 0.3482 0.0041  0.0286  0.0214  191 ILE A CA  
323  C  C   . ILE A 50 ? 0.2339 0.2245 0.2264 0.0036  0.0248  0.0185  191 ILE A C   
324  O  O   . ILE A 50 ? 0.2489 0.2373 0.2467 0.0028  0.0214  0.0182  191 ILE A O   
325  C  CB  . ILE A 50 ? 0.4181 0.4177 0.4187 0.0039  0.0327  0.0279  191 ILE A CB  
326  C  CG1 . ILE A 50 ? 0.4876 0.4861 0.4990 0.0022  0.0303  0.0323  191 ILE A CG1 
327  C  CG2 . ILE A 50 ? 0.4084 0.4138 0.4129 0.0051  0.0382  0.0303  191 ILE A CG2 
328  C  CD1 . ILE A 50 ? 0.6003 0.6021 0.6098 0.0019  0.0327  0.0393  191 ILE A CD1 
329  N  N   . PRO A 51 ? 0.2537 0.2439 0.2351 0.0039  0.0254  0.0161  192 PRO A N   
330  C  CA  . PRO A 51 ? 0.2389 0.2267 0.2151 0.0032  0.0221  0.0138  192 PRO A CA  
331  C  C   . PRO A 51 ? 0.2878 0.2764 0.2677 0.0028  0.0206  0.0168  192 PRO A C   
332  O  O   . PRO A 51 ? 0.2982 0.2850 0.2794 0.0028  0.0177  0.0148  192 PRO A O   
333  C  CB  . PRO A 51 ? 0.3164 0.3047 0.2819 0.0032  0.0233  0.0119  192 PRO A CB  
334  C  CG  . PRO A 51 ? 0.4007 0.3897 0.3652 0.0045  0.0265  0.0109  192 PRO A CG  
335  C  CD  . PRO A 51 ? 0.2553 0.2475 0.2293 0.0051  0.0290  0.0152  192 PRO A CD  
336  N  N   . GLU A 52 ? 0.3414 0.3331 0.3235 0.0029  0.0229  0.0221  193 GLU A N   
337  C  CA  . GLU A 52 ? 0.3212 0.3131 0.3074 0.0028  0.0212  0.0259  193 GLU A CA  
338  C  C   . GLU A 52 ? 0.2952 0.2837 0.2936 0.0026  0.0185  0.0256  193 GLU A C   
339  O  O   . GLU A 52 ? 0.3610 0.3482 0.3644 0.0029  0.0163  0.0273  193 GLU A O   
340  C  CB  . GLU A 52 ? 0.4388 0.4350 0.4243 0.0029  0.0242  0.0331  193 GLU A CB  
341  C  CG  . GLU A 52 ? 0.5659 0.5659 0.5382 0.0036  0.0264  0.0325  193 GLU A CG  
342  C  CD  . GLU A 52 ? 0.6172 0.6177 0.5853 0.0041  0.0295  0.0284  193 GLU A CD  
343  O  OE1 . GLU A 52 ? 0.5783 0.5796 0.5541 0.0042  0.0320  0.0302  193 GLU A OE1 
344  O  OE2 . GLU A 52 ? 0.6637 0.6637 0.6224 0.0044  0.0291  0.0235  193 GLU A OE2 
345  N  N   . CYS A 53 ? 0.2707 0.2577 0.2744 0.0022  0.0180  0.0231  194 CYS A N   
346  C  CA  . CYS A 53 ? 0.2670 0.2508 0.2823 0.0019  0.0146  0.0218  194 CYS A CA  
347  C  C   . CYS A 53 ? 0.1981 0.1793 0.2095 0.0026  0.0113  0.0145  194 CYS A C   
348  O  O   . CYS A 53 ? 0.2036 0.1824 0.2219 0.0027  0.0078  0.0112  194 CYS A O   
349  C  CB  . CYS A 53 ? 0.4051 0.3902 0.4319 0.0006  0.0159  0.0255  194 CYS A CB  
350  S  SG  . CYS A 53 ? 0.7772 0.7639 0.8041 0.0008  0.0166  0.0219  194 CYS A SG  
351  N  N   . CYS A 54 ? 0.1698 0.1519 0.1700 0.0031  0.0122  0.0121  195 CYS A N   
352  C  CA  . CYS A 54 ? 0.1892 0.1700 0.1845 0.0036  0.0100  0.0068  195 CYS A CA  
353  C  C   . CYS A 54 ? 0.1687 0.1505 0.1558 0.0040  0.0101  0.0050  195 CYS A C   
354  O  O   . CYS A 54 ? 0.2046 0.1882 0.1888 0.0037  0.0117  0.0076  195 CYS A O   
355  C  CB  . CYS A 54 ? 0.1776 0.1587 0.1689 0.0033  0.0112  0.0063  195 CYS A CB  
356  S  SG  . CYS A 54 ? 0.2306 0.2121 0.2316 0.0031  0.0112  0.0078  195 CYS A SG  
357  N  N   . ALA A 55 ? 0.1988 0.1805 0.1826 0.0047  0.0082  0.0010  196 ALA A N   
358  C  CA  . ALA A 55 ? 0.2090 0.1930 0.1859 0.0048  0.0089  -0.0003 196 ALA A CA  
359  C  C   . ALA A 55 ? 0.1751 0.1591 0.1453 0.0039  0.0093  -0.0009 196 ALA A C   
360  O  O   . ALA A 55 ? 0.1898 0.1721 0.1604 0.0041  0.0079  -0.0019 196 ALA A O   
361  C  CB  . ALA A 55 ? 0.0843 0.0695 0.0633 0.0068  0.0072  -0.0041 196 ALA A CB  
362  N  N   . VAL A 56 ? 0.1541 0.1398 0.1189 0.0027  0.0107  -0.0001 197 VAL A N   
363  C  CA  . VAL A 56 ? 0.1706 0.1557 0.1304 0.0016  0.0108  0.0000  197 VAL A CA  
364  C  C   . VAL A 56 ? 0.1759 0.1650 0.1322 0.0014  0.0114  -0.0004 197 VAL A C   
365  O  O   . VAL A 56 ? 0.1399 0.1325 0.0974 0.0014  0.0123  -0.0005 197 VAL A O   
366  C  CB  . VAL A 56 ? 0.1897 0.1724 0.1476 0.0000  0.0120  0.0017  197 VAL A CB  
367  C  CG1 . VAL A 56 ? 0.2077 0.1924 0.1649 -0.0010 0.0129  0.0024  197 VAL A CG1 
368  C  CG2 . VAL A 56 ? 0.2049 0.1860 0.1592 -0.0013 0.0118  0.0025  197 VAL A CG2 
369  N  N   . TYR A 57 ? 0.1608 0.1503 0.1130 0.0013  0.0110  -0.0003 198 TYR A N   
370  C  CA  . TYR A 57 ? 0.1765 0.1711 0.1251 0.0011  0.0124  0.0001  198 TYR A CA  
371  C  C   . TYR A 57 ? 0.2928 0.2868 0.2372 -0.0009 0.0128  0.0037  198 TYR A C   
372  O  O   . TYR A 57 ? 0.2810 0.2706 0.2245 -0.0010 0.0112  0.0048  198 TYR A O   
373  C  CB  . TYR A 57 ? 0.2960 0.2934 0.2424 0.0039  0.0115  -0.0031 198 TYR A CB  
374  C  CG  . TYR A 57 ? 0.2750 0.2716 0.2265 0.0063  0.0101  -0.0071 198 TYR A CG  
375  C  CD1 . TYR A 57 ? 0.3480 0.3487 0.3019 0.0081  0.0114  -0.0094 198 TYR A CD1 
376  C  CD2 . TYR A 57 ? 0.3780 0.3698 0.3334 0.0069  0.0074  -0.0084 198 TYR A CD2 
377  C  CE1 . TYR A 57 ? 0.4166 0.4154 0.3767 0.0105  0.0097  -0.0129 198 TYR A CE1 
378  C  CE2 . TYR A 57 ? 0.4307 0.4211 0.3927 0.0087  0.0058  -0.0115 198 TYR A CE2 
379  C  CZ  . TYR A 57 ? 0.3715 0.3648 0.3356 0.0105  0.0068  -0.0138 198 TYR A CZ  
380  O  OH  . TYR A 57 ? 0.4668 0.4577 0.4386 0.0124  0.0049  -0.0167 198 TYR A OH  
381  N  N   . ARG A 58 ? 0.2467 0.2455 0.1896 -0.0025 0.0149  0.0059  199 ARG A N   
382  C  CA  . ARG A 58 ? 0.3877 0.3863 0.3276 -0.0047 0.0154  0.0105  199 ARG A CA  
383  C  C   . ARG A 58 ? 0.5063 0.5113 0.4403 -0.0027 0.0165  0.0108  199 ARG A C   
384  O  O   . ARG A 58 ? 0.5588 0.5680 0.4919 0.0002  0.0170  0.0064  199 ARG A O   
385  C  CB  . ARG A 58 ? 0.4152 0.4157 0.3583 -0.0084 0.0171  0.0136  199 ARG A CB  
386  C  CG  . ARG A 58 ? 0.5156 0.5257 0.4586 -0.0081 0.0201  0.0142  199 ARG A CG  
387  C  CD  . ARG A 58 ? 0.6112 0.6246 0.5603 -0.0115 0.0213  0.0162  199 ARG A CD  
388  N  NE  . ARG A 58 ? 0.6175 0.6280 0.5684 -0.0158 0.0211  0.0213  199 ARG A NE  
389  C  CZ  . ARG A 58 ? 0.5850 0.5991 0.5421 -0.0197 0.0219  0.0241  199 ARG A CZ  
390  N  NH1 . ARG A 58 ? 0.5333 0.5550 0.4949 -0.0194 0.0230  0.0222  199 ARG A NH1 
391  N  NH2 . ARG A 58 ? 0.5482 0.5583 0.5083 -0.0239 0.0212  0.0288  199 ARG A NH2 
392  N  N   . ILE A 59 ? 0.5811 0.5867 0.5109 -0.0041 0.0169  0.0159  200 ILE A N   
393  C  CA  . ILE A 59 ? 0.7120 0.7254 0.6345 -0.0024 0.0186  0.0171  200 ILE A CA  
394  C  C   . ILE A 59 ? 0.6991 0.7182 0.6226 -0.0057 0.0225  0.0235  200 ILE A C   
395  O  O   . ILE A 59 ? 0.5956 0.6101 0.5225 -0.0094 0.0219  0.0291  200 ILE A O   
396  C  CB  . ILE A 59 ? 0.8271 0.8382 0.7430 -0.0008 0.0156  0.0188  200 ILE A CB  
397  C  CG1 . ILE A 59 ? 0.8323 0.8468 0.7428 0.0037  0.0139  0.0120  200 ILE A CG1 
398  C  CG2 . ILE A 59 ? 0.8722 0.8873 0.7827 -0.0027 0.0174  0.0270  200 ILE A CG2 
399  C  CD1 . ILE A 59 ? 0.7802 0.7900 0.6975 0.0052  0.0116  0.0052  200 ILE A CD1 
400  N  N   . GLN A 60 ? 0.7634 0.7926 0.6853 -0.0043 0.0264  0.0224  201 GLN A N   
401  C  CA  . GLN A 60 ? 0.8005 0.8378 0.7260 -0.0074 0.0309  0.0281  201 GLN A CA  
402  C  C   . GLN A 60 ? 0.8104 0.8478 0.7462 -0.0095 0.0313  0.0260  201 GLN A C   
403  O  O   . GLN A 60 ? 0.8215 0.8588 0.7641 -0.0142 0.0319  0.0310  201 GLN A O   
404  C  CB  . GLN A 60 ? 0.8587 0.8932 0.7842 -0.0118 0.0309  0.0374  201 GLN A CB  
405  N  N   . LYS A 64 ? 0.5762 0.6022 0.4962 0.0104  0.0192  -0.0053 205 LYS A N   
406  C  CA  . LYS A 64 ? 0.5634 0.5850 0.4911 0.0123  0.0170  -0.0111 205 LYS A CA  
407  C  C   . LYS A 64 ? 0.4447 0.4670 0.3811 0.0108  0.0192  -0.0096 205 LYS A C   
408  O  O   . LYS A 64 ? 0.5002 0.5249 0.4413 0.0135  0.0198  -0.0138 205 LYS A O   
409  C  CB  . LYS A 64 ? 0.6158 0.6410 0.5408 0.0173  0.0164  -0.0191 205 LYS A CB  
410  N  N   . LYS A 65 ? 0.3712 0.3917 0.3098 0.0066  0.0199  -0.0038 206 LYS A N   
411  C  CA  . LYS A 65 ? 0.3022 0.3251 0.2480 0.0050  0.0215  -0.0023 206 LYS A CA  
412  C  C   . LYS A 65 ? 0.2451 0.2603 0.1954 0.0033  0.0188  -0.0015 206 LYS A C   
413  O  O   . LYS A 65 ? 0.2431 0.2530 0.1915 0.0007  0.0176  0.0012  206 LYS A O   
414  C  CB  . LYS A 65 ? 0.3141 0.3426 0.2598 0.0014  0.0244  0.0033  206 LYS A CB  
415  C  CG  . LYS A 65 ? 0.3711 0.4094 0.3124 0.0030  0.0284  0.0040  206 LYS A CG  
416  C  CD  . LYS A 65 ? 0.4363 0.4818 0.3820 0.0072  0.0305  -0.0011 206 LYS A CD  
417  C  CE  . LYS A 65 ? 0.5692 0.6271 0.5131 0.0082  0.0359  0.0007  206 LYS A CE  
418  N  NZ  . LYS A 65 ? 0.6231 0.6837 0.5556 0.0095  0.0373  0.0013  206 LYS A NZ  
419  N  N   . PRO A 66 ? 0.2301 0.2448 0.1862 0.0050  0.0178  -0.0038 207 PRO A N   
420  C  CA  . PRO A 66 ? 0.2057 0.2142 0.1649 0.0038  0.0156  -0.0028 207 PRO A CA  
421  C  C   . PRO A 66 ? 0.1041 0.1126 0.0641 0.0003  0.0157  0.0007  207 PRO A C   
422  O  O   . PRO A 66 ? 0.1121 0.1262 0.0748 -0.0008 0.0167  0.0019  207 PRO A O   
423  C  CB  . PRO A 66 ? 0.1803 0.1893 0.1458 0.0069  0.0147  -0.0052 207 PRO A CB  
424  C  CG  . PRO A 66 ? 0.1836 0.2009 0.1509 0.0089  0.0170  -0.0068 207 PRO A CG  
425  C  CD  . PRO A 66 ? 0.2165 0.2364 0.1768 0.0088  0.0188  -0.0075 207 PRO A CD  
426  N  N   . ILE A 67 ? 0.1727 0.1753 0.1312 -0.0013 0.0145  0.0017  208 ILE A N   
427  C  CA  . ILE A 67 ? 0.1590 0.1614 0.1176 -0.0042 0.0140  0.0035  208 ILE A CA  
428  C  C   . ILE A 67 ? 0.1307 0.1299 0.0897 -0.0035 0.0128  0.0035  208 ILE A C   
429  O  O   . ILE A 67 ? 0.1756 0.1715 0.1350 -0.0017 0.0127  0.0030  208 ILE A O   
430  C  CB  . ILE A 67 ? 0.2705 0.2693 0.2261 -0.0070 0.0141  0.0048  208 ILE A CB  
431  C  CG1 . ILE A 67 ? 0.2496 0.2418 0.2029 -0.0061 0.0135  0.0042  208 ILE A CG1 
432  C  CG2 . ILE A 67 ? 0.3170 0.3193 0.2716 -0.0079 0.0156  0.0065  208 ILE A CG2 
433  C  CD1 . ILE A 67 ? 0.2779 0.2654 0.2297 -0.0087 0.0130  0.0050  208 ILE A CD1 
434  N  N   . GLY A 68 ? 0.1705 0.1716 0.1296 -0.0051 0.0118  0.0042  209 GLY A N   
435  C  CA  . GLY A 68 ? 0.2507 0.2506 0.2086 -0.0044 0.0108  0.0049  209 GLY A CA  
436  C  C   . GLY A 68 ? 0.1942 0.1887 0.1478 -0.0049 0.0114  0.0041  209 GLY A C   
437  O  O   . GLY A 68 ? 0.2126 0.2041 0.1643 -0.0067 0.0115  0.0029  209 GLY A O   
438  N  N   . TRP A 69 ? 0.1642 0.1575 0.1172 -0.0032 0.0120  0.0051  210 TRP A N   
439  C  CA  . TRP A 69 ? 0.1946 0.1840 0.1442 -0.0030 0.0134  0.0042  210 TRP A CA  
440  C  C   . TRP A 69 ? 0.1969 0.1858 0.1410 -0.0045 0.0125  0.0020  210 TRP A C   
441  O  O   . TRP A 69 ? 0.2012 0.1860 0.1429 -0.0047 0.0132  -0.0005 210 TRP A O   
442  C  CB  . TRP A 69 ? 0.1392 0.1294 0.0905 -0.0010 0.0149  0.0068  210 TRP A CB  
443  C  CG  . TRP A 69 ? 0.1628 0.1510 0.1201 0.0002  0.0155  0.0073  210 TRP A CG  
444  C  CD1 . TRP A 69 ? 0.1845 0.1735 0.1480 0.0013  0.0148  0.0090  210 TRP A CD1 
445  C  CD2 . TRP A 69 ? 0.1491 0.1340 0.1076 0.0004  0.0161  0.0057  210 TRP A CD2 
446  N  NE1 . TRP A 69 ? 0.1847 0.1712 0.1527 0.0019  0.0146  0.0079  210 TRP A NE1 
447  C  CE2 . TRP A 69 ? 0.1638 0.1483 0.1288 0.0014  0.0154  0.0063  210 TRP A CE2 
448  C  CE3 . TRP A 69 ? 0.1231 0.1051 0.0787 0.0001  0.0168  0.0038  210 TRP A CE3 
449  C  CZ2 . TRP A 69 ? 0.2088 0.1910 0.1767 0.0019  0.0150  0.0053  210 TRP A CZ2 
450  C  CZ3 . TRP A 69 ? 0.1774 0.1570 0.1364 0.0008  0.0168  0.0034  210 TRP A CZ3 
451  C  CH2 . TRP A 69 ? 0.1877 0.1679 0.1526 0.0017  0.0158  0.0042  210 TRP A CH2 
452  N  N   . ASP A 70 ? 0.2055 0.1985 0.1484 -0.0055 0.0104  0.0023  211 ASP A N   
453  C  CA  . ASP A 70 ? 0.2256 0.2183 0.1630 -0.0071 0.0085  -0.0008 211 ASP A CA  
454  C  C   . ASP A 70 ? 0.2228 0.2136 0.1626 -0.0103 0.0064  -0.0031 211 ASP A C   
455  O  O   . ASP A 70 ? 0.2231 0.2130 0.1600 -0.0120 0.0039  -0.0064 211 ASP A O   
456  C  CB  . ASP A 70 ? 0.3198 0.3184 0.2544 -0.0066 0.0063  0.0008  211 ASP A CB  
457  C  CG  . ASP A 70 ? 0.4475 0.4478 0.3792 -0.0038 0.0086  0.0042  211 ASP A CG  
458  O  OD1 . ASP A 70 ? 0.4938 0.4913 0.4222 -0.0025 0.0115  0.0030  211 ASP A OD1 
459  O  OD2 . ASP A 70 ? 0.5627 0.5672 0.4966 -0.0027 0.0078  0.0086  211 ASP A OD2 
460  N  N   . THR A 71 ? 0.2052 0.1954 0.1501 -0.0111 0.0073  -0.0014 212 THR A N   
461  C  CA  . THR A 71 ? 0.2264 0.2146 0.1745 -0.0144 0.0063  -0.0020 212 THR A CA  
462  C  C   . THR A 71 ? 0.1882 0.1691 0.1341 -0.0155 0.0054  -0.0054 212 THR A C   
463  O  O   . THR A 71 ? 0.2577 0.2343 0.2009 -0.0130 0.0072  -0.0066 212 THR A O   
464  C  CB  . THR A 71 ? 0.1262 0.1141 0.0775 -0.0140 0.0085  0.0008  212 THR A CB  
465  O  OG1 . THR A 71 ? 0.2213 0.2155 0.1750 -0.0125 0.0093  0.0027  212 THR A OG1 
466  C  CG2 . THR A 71 ? 0.1633 0.1499 0.1180 -0.0176 0.0079  0.0020  212 THR A CG2 
467  N  N   . ASP A 72 ? 0.1697 0.1489 0.1181 -0.0190 0.0027  -0.0070 213 ASP A N   
468  C  CA  . ASP A 72 ? 0.1761 0.1467 0.1244 -0.0198 0.0017  -0.0104 213 ASP A CA  
469  C  C   . ASP A 72 ? 0.1702 0.1363 0.1225 -0.0201 0.0035  -0.0070 213 ASP A C   
470  O  O   . ASP A 72 ? 0.2073 0.1756 0.1644 -0.0229 0.0035  -0.0028 213 ASP A O   
471  C  CB  . ASP A 72 ? 0.1671 0.1366 0.1177 -0.0238 -0.0027 -0.0139 213 ASP A CB  
472  C  CG  . ASP A 72 ? 0.2829 0.2424 0.2340 -0.0243 -0.0045 -0.0189 213 ASP A CG  
473  O  OD1 . ASP A 72 ? 0.2628 0.2158 0.2166 -0.0236 -0.0028 -0.0174 213 ASP A OD1 
474  O  OD2 . ASP A 72 ? 0.4692 0.4274 0.4179 -0.0253 -0.0081 -0.0248 213 ASP A OD2 
475  N  N   . ILE A 73 ? 0.1481 0.1090 0.0983 -0.0170 0.0052  -0.0081 214 ILE A N   
476  C  CA  . ILE A 73 ? 0.2538 0.2109 0.2071 -0.0164 0.0063  -0.0045 214 ILE A CA  
477  C  C   . ILE A 73 ? 0.1987 0.1500 0.1576 -0.0201 0.0043  -0.0024 214 ILE A C   
478  O  O   . ILE A 73 ? 0.1429 0.0938 0.1042 -0.0207 0.0050  0.0029  214 ILE A O   
479  C  CB  . ILE A 73 ? 0.2243 0.1774 0.1762 -0.0122 0.0080  -0.0063 214 ILE A CB  
480  C  CG1 . ILE A 73 ? 0.3497 0.3008 0.3045 -0.0114 0.0084  -0.0018 214 ILE A CG1 
481  C  CG2 . ILE A 73 ? 0.1869 0.1325 0.1391 -0.0113 0.0069  -0.0119 214 ILE A CG2 
482  C  CD1 . ILE A 73 ? 0.2601 0.2135 0.2142 -0.0078 0.0101  -0.0012 214 ILE A CD1 
483  N  N   . SER A 74 ? 0.2085 0.1556 0.1697 -0.0227 0.0015  -0.0063 215 SER A N   
484  C  CA  . SER A 74 ? 0.2170 0.1575 0.1857 -0.0267 -0.0009 -0.0040 215 SER A CA  
485  C  C   . SER A 74 ? 0.1982 0.1453 0.1713 -0.0308 -0.0002 0.0033  215 SER A C   
486  O  O   . SER A 74 ? 0.1614 0.1047 0.1403 -0.0336 -0.0006 0.0087  215 SER A O   
487  C  CB  . SER A 74 ? 0.2076 0.1422 0.1791 -0.0291 -0.0049 -0.0107 215 SER A CB  
488  O  OG  . SER A 74 ? 0.2892 0.2316 0.2587 -0.0311 -0.0064 -0.0128 215 SER A OG  
489  N  N   . TRP A 75 ? 0.1809 0.1380 0.1518 -0.0310 0.0010  0.0039  216 TRP A N   
490  C  CA  . TRP A 75 ? 0.1858 0.1514 0.1605 -0.0338 0.0027  0.0102  216 TRP A CA  
491  C  C   . TRP A 75 ? 0.2619 0.2298 0.2341 -0.0318 0.0061  0.0161  216 TRP A C   
492  O  O   . TRP A 75 ? 0.2800 0.2533 0.2554 -0.0343 0.0078  0.0222  216 TRP A O   
493  C  CB  . TRP A 75 ? 0.1832 0.1591 0.1572 -0.0336 0.0030  0.0087  216 TRP A CB  
494  C  CG  . TRP A 75 ? 0.1813 0.1567 0.1580 -0.0362 -0.0010 0.0041  216 TRP A CG  
495  C  CD1 . TRP A 75 ? 0.2761 0.2501 0.2471 -0.0339 -0.0032 -0.0022 216 TRP A CD1 
496  C  CD2 . TRP A 75 ? 0.1889 0.1660 0.1750 -0.0420 -0.0039 0.0053  216 TRP A CD2 
497  N  NE1 . TRP A 75 ? 0.3083 0.2825 0.2832 -0.0375 -0.0078 -0.0058 216 TRP A NE1 
498  C  CE2 . TRP A 75 ? 0.2640 0.2398 0.2492 -0.0427 -0.0086 -0.0015 216 TRP A CE2 
499  C  CE3 . TRP A 75 ? 0.1188 0.0985 0.1142 -0.0466 -0.0030 0.0117  216 TRP A CE3 
500  C  CZ2 . TRP A 75 ? 0.2866 0.2635 0.2806 -0.0482 -0.0132 -0.0028 216 TRP A CZ2 
501  C  CZ3 . TRP A 75 ? 0.2648 0.2456 0.2704 -0.0524 -0.0070 0.0113  216 TRP A CZ3 
502  C  CH2 . TRP A 75 ? 0.3216 0.3010 0.3269 -0.0532 -0.0125 0.0037  216 TRP A CH2 
503  N  N   . LEU A 76 ? 0.1621 0.1259 0.1289 -0.0274 0.0067  0.0144  217 LEU A N   
504  C  CA  . LEU A 76 ? 0.1978 0.1639 0.1609 -0.0247 0.0088  0.0184  217 LEU A CA  
505  C  C   . LEU A 76 ? 0.2448 0.2028 0.2091 -0.0244 0.0077  0.0218  217 LEU A C   
506  O  O   . LEU A 76 ? 0.2417 0.2009 0.2023 -0.0217 0.0084  0.0246  217 LEU A O   
507  C  CB  . LEU A 76 ? 0.2416 0.2104 0.1993 -0.0201 0.0098  0.0144  217 LEU A CB  
508  C  CG  . LEU A 76 ? 0.2799 0.2560 0.2370 -0.0198 0.0105  0.0116  217 LEU A CG  
509  C  CD1 . LEU A 76 ? 0.2789 0.2556 0.2325 -0.0157 0.0110  0.0081  217 LEU A CD1 
510  C  CD2 . LEU A 76 ? 0.2924 0.2777 0.2504 -0.0207 0.0126  0.0150  217 LEU A CD2 
511  N  N   . THR A 77 ? 0.2866 0.2361 0.2565 -0.0268 0.0054  0.0211  218 THR A N   
512  C  CA  . THR A 77 ? 0.2892 0.2299 0.2625 -0.0265 0.0038  0.0248  218 THR A CA  
513  C  C   . THR A 77 ? 0.3653 0.3101 0.3373 -0.0274 0.0050  0.0338  218 THR A C   
514  O  O   . THR A 77 ? 0.4042 0.3553 0.3777 -0.0310 0.0066  0.0386  218 THR A O   
515  C  CB  . THR A 77 ? 0.3160 0.2478 0.2980 -0.0305 0.0009  0.0244  218 THR A CB  
516  O  OG1 . THR A 77 ? 0.3647 0.2921 0.3464 -0.0292 -0.0007 0.0150  218 THR A OG1 
517  C  CG2 . THR A 77 ? 0.3101 0.2323 0.2970 -0.0301 -0.0010 0.0292  218 THR A CG2 
518  N  N   . GLY A 78 ? 0.3450 0.2873 0.3143 -0.0238 0.0044  0.0364  219 GLY A N   
519  C  CA  . GLY A 78 ? 0.3730 0.3198 0.3390 -0.0240 0.0051  0.0451  219 GLY A CA  
520  C  C   . GLY A 78 ? 0.3804 0.3375 0.3372 -0.0209 0.0072  0.0441  219 GLY A C   
521  O  O   . GLY A 78 ? 0.4422 0.4027 0.3939 -0.0192 0.0069  0.0492  219 GLY A O   
522  N  N   . GLU A 79 ? 0.3132 0.2751 0.2681 -0.0199 0.0087  0.0373  220 GLU A N   
523  C  CA  . GLU A 79 ? 0.3715 0.3423 0.3194 -0.0171 0.0103  0.0352  220 GLU A CA  
524  C  C   . GLU A 79 ? 0.2977 0.2667 0.2427 -0.0125 0.0084  0.0313  220 GLU A C   
525  O  O   . GLU A 79 ? 0.3015 0.2632 0.2502 -0.0112 0.0064  0.0297  220 GLU A O   
526  C  CB  . GLU A 79 ? 0.4800 0.4561 0.4290 -0.0178 0.0123  0.0302  220 GLU A CB  
527  C  CG  . GLU A 79 ? 0.5605 0.5416 0.5133 -0.0222 0.0142  0.0338  220 GLU A CG  
528  C  CD  . GLU A 79 ? 0.7372 0.7298 0.6859 -0.0213 0.0176  0.0356  220 GLU A CD  
529  O  OE1 . GLU A 79 ? 0.7680 0.7642 0.7115 -0.0173 0.0180  0.0312  220 GLU A OE1 
530  O  OE2 . GLU A 79 ? 0.8227 0.8209 0.7740 -0.0246 0.0200  0.0412  220 GLU A OE2 
531  N  N   . GLU A 80 ? 0.3104 0.2865 0.2497 -0.0101 0.0090  0.0297  221 GLU A N   
532  C  CA  . GLU A 80 ? 0.2791 0.2547 0.2171 -0.0063 0.0070  0.0252  221 GLU A CA  
533  C  C   . GLU A 80 ? 0.2639 0.2430 0.2026 -0.0053 0.0084  0.0191  221 GLU A C   
534  O  O   . GLU A 80 ? 0.3241 0.3094 0.2603 -0.0057 0.0105  0.0185  221 GLU A O   
535  C  CB  . GLU A 80 ? 0.3618 0.3426 0.2928 -0.0041 0.0055  0.0271  221 GLU A CB  
536  C  CG  . GLU A 80 ? 0.5055 0.4842 0.4344 -0.0047 0.0037  0.0347  221 GLU A CG  
537  C  CD  . GLU A 80 ? 0.5978 0.5819 0.5183 -0.0019 0.0013  0.0362  221 GLU A CD  
538  O  OE1 . GLU A 80 ? 0.5936 0.5831 0.5100 0.0003  0.0012  0.0304  221 GLU A OE1 
539  O  OE2 . GLU A 80 ? 0.6573 0.6400 0.5757 -0.0019 -0.0010 0.0429  221 GLU A OE2 
540  N  N   . LEU A 81 ? 0.1660 0.1415 0.1089 -0.0039 0.0076  0.0151  222 LEU A N   
541  C  CA  . LEU A 81 ? 0.1560 0.1343 0.1003 -0.0028 0.0085  0.0106  222 LEU A CA  
542  C  C   . LEU A 81 ? 0.2328 0.2118 0.1775 0.0000  0.0063  0.0081  222 LEU A C   
543  O  O   . LEU A 81 ? 0.2343 0.2111 0.1798 0.0010  0.0040  0.0094  222 LEU A O   
544  C  CB  . LEU A 81 ? 0.1691 0.1438 0.1175 -0.0035 0.0095  0.0086  222 LEU A CB  
545  C  CG  . LEU A 81 ? 0.2188 0.1920 0.1674 -0.0066 0.0105  0.0102  222 LEU A CG  
546  C  CD1 . LEU A 81 ? 0.1846 0.1548 0.1354 -0.0070 0.0109  0.0074  222 LEU A CD1 
547  C  CD2 . LEU A 81 ? 0.1926 0.1724 0.1395 -0.0081 0.0120  0.0112  222 LEU A CD2 
548  N  N   . HIS A 82 ? 0.1324 0.1146 0.0783 0.0012  0.0065  0.0045  223 HIS A N   
549  C  CA  . HIS A 82 ? 0.1213 0.1034 0.0698 0.0034  0.0038  0.0016  223 HIS A CA  
550  C  C   . HIS A 82 ? 0.1757 0.1570 0.1306 0.0035  0.0049  -0.0004 223 HIS A C   
551  O  O   . HIS A 82 ? 0.2309 0.2139 0.1856 0.0030  0.0069  -0.0009 223 HIS A O   
552  C  CB  . HIS A 82 ? 0.2316 0.2182 0.1751 0.0051  0.0024  -0.0009 223 HIS A CB  
553  C  CG  . HIS A 82 ? 0.4128 0.4014 0.3488 0.0051  0.0015  0.0022  223 HIS A CG  
554  N  ND1 . HIS A 82 ? 0.4372 0.4268 0.3699 0.0069  -0.0025 0.0013  223 HIS A ND1 
555  C  CD2 . HIS A 82 ? 0.3968 0.3868 0.3283 0.0033  0.0039  0.0069  223 HIS A CD2 
556  C  CE1 . HIS A 82 ? 0.3649 0.3567 0.2902 0.0066  -0.0023 0.0059  223 HIS A CE1 
557  N  NE2 . HIS A 82 ? 0.3698 0.3617 0.2948 0.0042  0.0018  0.0096  223 HIS A NE2 
558  N  N   . VAL A 83 ? 0.1452 0.1246 0.1063 0.0043  0.0034  -0.0011 224 VAL A N   
559  C  CA  . VAL A 83 ? 0.1156 0.0947 0.0833 0.0042  0.0047  -0.0015 224 VAL A CA  
560  C  C   . VAL A 83 ? 0.1872 0.1667 0.1608 0.0053  0.0016  -0.0042 224 VAL A C   
561  O  O   . VAL A 83 ? 0.1491 0.1284 0.1247 0.0060  -0.0015 -0.0050 224 VAL A O   
562  C  CB  . VAL A 83 ? 0.2488 0.2262 0.2210 0.0039  0.0065  0.0006  224 VAL A CB  
563  C  CG1 . VAL A 83 ? 0.1311 0.1095 0.1107 0.0040  0.0079  0.0013  224 VAL A CG1 
564  C  CG2 . VAL A 83 ? 0.1814 0.1574 0.1483 0.0029  0.0092  0.0019  224 VAL A CG2 
565  N  N   . GLU A 84 ? 0.1995 0.1796 0.1762 0.0057  0.0018  -0.0057 225 GLU A N   
566  C  CA  . GLU A 84 ? 0.2256 0.2048 0.2097 0.0065  -0.0016 -0.0088 225 GLU A CA  
567  C  C   . GLU A 84 ? 0.1859 0.1640 0.1794 0.0057  -0.0002 -0.0062 225 GLU A C   
568  O  O   . GLU A 84 ? 0.1426 0.1214 0.1344 0.0053  0.0031  -0.0033 225 GLU A O   
569  C  CB  . GLU A 84 ? 0.3006 0.2809 0.2812 0.0083  -0.0029 -0.0134 225 GLU A CB  
570  C  CG  . GLU A 84 ? 0.4883 0.4707 0.4603 0.0094  -0.0049 -0.0163 225 GLU A CG  
571  C  CD  . GLU A 84 ? 0.6147 0.5995 0.5824 0.0118  -0.0055 -0.0215 225 GLU A CD  
572  O  OE1 . GLU A 84 ? 0.5659 0.5497 0.5394 0.0128  -0.0050 -0.0236 225 GLU A OE1 
573  O  OE2 . GLU A 84 ? 0.7151 0.7031 0.6736 0.0130  -0.0063 -0.0233 225 GLU A OE2 
574  N  N   . VAL A 85 ? 0.2295 0.2062 0.2333 0.0054  -0.0029 -0.0069 226 VAL A N   
575  C  CA  . VAL A 85 ? 0.1879 0.1638 0.2020 0.0044  -0.0017 -0.0034 226 VAL A CA  
576  C  C   . VAL A 85 ? 0.1604 0.1343 0.1767 0.0055  -0.0028 -0.0054 226 VAL A C   
577  O  O   . VAL A 85 ? 0.2090 0.1819 0.2233 0.0071  -0.0060 -0.0114 226 VAL A O   
578  C  CB  . VAL A 85 ? 0.2140 0.1895 0.2405 0.0033  -0.0044 -0.0029 226 VAL A CB  
579  C  CG1 . VAL A 85 ? 0.2128 0.1877 0.2519 0.0018  -0.0029 0.0021  226 VAL A CG1 
580  C  CG2 . VAL A 85 ? 0.1987 0.1768 0.2234 0.0030  -0.0029 -0.0009 226 VAL A CG2 
581  N  N   . LEU A 86 ? 0.1303 0.1043 0.1496 0.0050  0.0000  -0.0005 227 LEU A N   
582  C  CA  . LEU A 86 ? 0.1897 0.1617 0.2133 0.0064  -0.0013 -0.0016 227 LEU A CA  
583  C  C   . LEU A 86 ? 0.1438 0.1114 0.1810 0.0064  -0.0059 -0.0044 227 LEU A C   
584  O  O   . LEU A 86 ? 0.1785 0.1454 0.2243 0.0044  -0.0070 -0.0024 227 LEU A O   
585  C  CB  . LEU A 86 ? 0.1995 0.1728 0.2246 0.0059  0.0018  0.0055  227 LEU A CB  
586  C  CG  . LEU A 86 ? 0.2583 0.2356 0.2711 0.0060  0.0052  0.0075  227 LEU A CG  
587  C  CD1 . LEU A 86 ? 0.2870 0.2659 0.3011 0.0056  0.0072  0.0144  227 LEU A CD1 
588  C  CD2 . LEU A 86 ? 0.1911 0.1695 0.1973 0.0078  0.0043  0.0021  227 LEU A CD2 
589  N  N   . GLU A 87 ? 0.1701 0.1348 0.2100 0.0087  -0.0086 -0.0095 228 GLU A N   
590  C  CA  . GLU A 87 ? 0.2051 0.1643 0.2594 0.0089  -0.0134 -0.0127 228 GLU A CA  
591  C  C   . GLU A 87 ? 0.2029 0.1601 0.2705 0.0062  -0.0124 -0.0038 228 GLU A C   
592  O  O   . GLU A 87 ? 0.2068 0.1661 0.2728 0.0058  -0.0085 0.0038  228 GLU A O   
593  C  CB  . GLU A 87 ? 0.2863 0.2427 0.3416 0.0125  -0.0154 -0.0191 228 GLU A CB  
594  C  CG  . GLU A 87 ? 0.4030 0.3622 0.4461 0.0154  -0.0164 -0.0283 228 GLU A CG  
595  C  CD  . GLU A 87 ? 0.4685 0.4258 0.5131 0.0151  -0.0215 -0.0353 228 GLU A CD  
596  O  OE1 . GLU A 87 ? 0.5240 0.4760 0.5781 0.0165  -0.0266 -0.0421 228 GLU A OE1 
597  O  OE2 . GLU A 87 ? 0.4241 0.3849 0.4609 0.0136  -0.0211 -0.0344 228 GLU A OE2 
598  N  N   . ASN A 88 ? 0.1812 0.1350 0.2623 0.0043  -0.0162 -0.0046 229 ASN A N   
599  C  CA  . ASN A 88 ? 0.2063 0.1590 0.3017 0.0011  -0.0151 0.0046  229 ASN A CA  
600  C  C   . ASN A 88 ? 0.2832 0.2294 0.3910 0.0021  -0.0177 0.0057  229 ASN A C   
601  O  O   . ASN A 88 ? 0.2643 0.2039 0.3856 0.0020  -0.0236 0.0002  229 ASN A O   
602  C  CB  . ASN A 88 ? 0.2790 0.2314 0.3858 -0.0017 -0.0186 0.0030  229 ASN A CB  
603  C  CG  . ASN A 88 ? 0.3005 0.2549 0.4215 -0.0055 -0.0157 0.0140  229 ASN A CG  
604  O  OD1 . ASN A 88 ? 0.2951 0.2511 0.4159 -0.0059 -0.0112 0.0228  229 ASN A OD1 
605  N  ND2 . ASN A 88 ? 0.2882 0.2437 0.4212 -0.0083 -0.0184 0.0136  229 ASN A ND2 
606  N  N   . VAL A 89 ? 0.2107 0.1584 0.3141 0.0034  -0.0141 0.0121  230 VAL A N   
607  C  CA  . VAL A 89 ? 0.2612 0.2031 0.3763 0.0047  -0.0162 0.0152  230 VAL A CA  
608  C  C   . VAL A 89 ? 0.2673 0.2130 0.3829 0.0029  -0.0116 0.0289  230 VAL A C   
609  O  O   . VAL A 89 ? 0.2241 0.1768 0.3250 0.0031  -0.0069 0.0323  230 VAL A O   
610  C  CB  . VAL A 89 ? 0.2679 0.2086 0.3761 0.0094  -0.0174 0.0079  230 VAL A CB  
611  C  CG1 . VAL A 89 ? 0.2149 0.1483 0.3388 0.0115  -0.0207 0.0103  230 VAL A CG1 
612  C  CG2 . VAL A 89 ? 0.3553 0.2953 0.4570 0.0116  -0.0204 -0.0055 230 VAL A CG2 
613  N  N   . PRO A 90 ? 0.2540 0.1952 0.3865 0.0011  -0.0130 0.0369  231 PRO A N   
614  C  CA  . PRO A 90 ? 0.3007 0.2466 0.4333 -0.0006 -0.0083 0.0512  231 PRO A CA  
615  C  C   . PRO A 90 ? 0.2863 0.2363 0.4055 0.0023  -0.0060 0.0546  231 PRO A C   
616  O  O   . PRO A 90 ? 0.2421 0.1885 0.3613 0.0058  -0.0091 0.0492  231 PRO A O   
617  C  CB  . PRO A 90 ? 0.2930 0.2312 0.4479 -0.0023 -0.0118 0.0581  231 PRO A CB  
618  C  CG  . PRO A 90 ? 0.3253 0.2571 0.4926 -0.0036 -0.0172 0.0479  231 PRO A CG  
619  C  CD  . PRO A 90 ? 0.2421 0.1740 0.3951 0.0003  -0.0190 0.0336  231 PRO A CD  
620  N  N   . LEU A 91 ? 0.3001 0.2579 0.4086 0.0011  -0.0007 0.0633  232 LEU A N   
621  C  CA  . LEU A 91 ? 0.3138 0.2763 0.4103 0.0034  0.0009  0.0679  232 LEU A CA  
622  C  C   . LEU A 91 ? 0.2876 0.2474 0.3962 0.0035  -0.0005 0.0798  232 LEU A C   
623  O  O   . LEU A 91 ? 0.2947 0.2503 0.4197 0.0010  -0.0013 0.0861  232 LEU A O   
624  C  CB  . LEU A 91 ? 0.3408 0.3127 0.4207 0.0023  0.0064  0.0717  232 LEU A CB  
625  C  CG  . LEU A 91 ? 0.4294 0.4038 0.4992 0.0016  0.0084  0.0624  232 LEU A CG  
626  C  CD1 . LEU A 91 ? 0.4813 0.4641 0.5358 0.0011  0.0138  0.0662  232 LEU A CD1 
627  C  CD2 . LEU A 91 ? 0.4136 0.3858 0.4768 0.0040  0.0055  0.0508  232 LEU A CD2 
628  N  N   . THR A 92 ? 0.3029 0.2652 0.4047 0.0063  -0.0013 0.0831  233 THR A N   
629  C  CA  . THR A 92 ? 0.4041 0.3647 0.5154 0.0071  -0.0031 0.0952  233 THR A CA  
630  C  C   . THR A 92 ? 0.4963 0.4629 0.6057 0.0041  0.0014  0.1100  233 THR A C   
631  O  O   . THR A 92 ? 0.4703 0.4333 0.5954 0.0014  0.0016  0.1181  233 THR A O   
632  C  CB  . THR A 92 ? 0.4432 0.4067 0.5463 0.0112  -0.0054 0.0943  233 THR A CB  
633  O  OG1 . THR A 92 ? 0.3709 0.3274 0.4834 0.0145  -0.0098 0.0838  233 THR A OG1 
634  C  CG2 . THR A 92 ? 0.5586 0.5237 0.6658 0.0119  -0.0064 0.1090  233 THR A CG2 
635  N  N   . SER B 9  ? 0.7402 0.6634 0.8546 -0.0314 -0.0348 -0.0695 150 SER B N   
636  C  CA  . SER B 9  ? 0.7305 0.6565 0.8342 -0.0264 -0.0327 -0.0633 150 SER B CA  
637  C  C   . SER B 9  ? 0.6073 0.5344 0.7084 -0.0286 -0.0300 -0.0513 150 SER B C   
638  O  O   . SER B 9  ? 0.5244 0.4444 0.6260 -0.0273 -0.0284 -0.0440 150 SER B O   
639  C  CB  . SER B 9  ? 0.7403 0.6775 0.8331 -0.0224 -0.0334 -0.0683 150 SER B CB  
640  O  OG  . SER B 9  ? 0.7802 0.7215 0.8643 -0.0192 -0.0310 -0.0612 150 SER B OG  
641  N  N   . HIS B 10 ? 0.5159 0.4521 0.6136 -0.0313 -0.0297 -0.0499 151 HIS B N   
642  C  CA  . HIS B 10 ? 0.4477 0.3863 0.5424 -0.0334 -0.0273 -0.0399 151 HIS B CA  
643  C  C   . HIS B 10 ? 0.3671 0.2977 0.4713 -0.0384 -0.0254 -0.0342 151 HIS B C   
644  O  O   . HIS B 10 ? 0.3746 0.3050 0.4760 -0.0396 -0.0228 -0.0249 151 HIS B O   
645  C  CB  . HIS B 10 ? 0.4593 0.4097 0.5490 -0.0348 -0.0276 -0.0412 151 HIS B CB  
646  C  CG  . HIS B 10 ? 0.4313 0.3892 0.5096 -0.0299 -0.0280 -0.0428 151 HIS B CG  
647  N  ND1 . HIS B 10 ? 0.2906 0.2509 0.3610 -0.0277 -0.0262 -0.0356 151 HIS B ND1 
648  C  CD2 . HIS B 10 ? 0.4089 0.3719 0.4824 -0.0266 -0.0298 -0.0505 151 HIS B CD2 
649  C  CE1 . HIS B 10 ? 0.3665 0.3327 0.4289 -0.0238 -0.0266 -0.0386 151 HIS B CE1 
650  N  NE2 . HIS B 10 ? 0.3826 0.3506 0.4460 -0.0229 -0.0284 -0.0472 151 HIS B NE2 
651  N  N   . MSE B 11 ? 0.3831 0.3071 0.4985 -0.0414 -0.0265 -0.0399 152 MSE B N   
652  C  CA  . MSE B 11 ? 0.4234 0.3393 0.5495 -0.0470 -0.0241 -0.0344 152 MSE B CA  
653  C  C   . MSE B 11 ? 0.4874 0.3941 0.6101 -0.0447 -0.0214 -0.0237 152 MSE B C   
654  O  O   . MSE B 11 ? 0.5473 0.4523 0.6702 -0.0473 -0.0180 -0.0144 152 MSE B O   
655  C  CB  . MSE B 11 ? 0.2996 0.2076 0.4394 -0.0504 -0.0259 -0.0424 152 MSE B CB  
656  C  CG  . MSE B 11 ? 0.3874 0.2872 0.5394 -0.0569 -0.0225 -0.0359 152 MSE B CG  
657  SE SE  . MSE B 11 ? 1.1133 1.0259 1.2668 -0.0631 -0.0189 -0.0297 152 MSE B SE  
658  C  CE  . MSE B 11 ? 0.6135 0.5327 0.7833 -0.0690 -0.0232 -0.0447 152 MSE B CE  
659  N  N   . GLN B 12 ? 0.3804 0.2818 0.4995 -0.0392 -0.0229 -0.0251 153 GLN B N   
660  C  CA  . GLN B 12 ? 0.4486 0.3420 0.5644 -0.0360 -0.0214 -0.0157 153 GLN B CA  
661  C  C   . GLN B 12 ? 0.4053 0.3069 0.5083 -0.0318 -0.0213 -0.0104 153 GLN B C   
662  O  O   . GLN B 12 ? 0.4659 0.3646 0.5645 -0.0306 -0.0197 -0.0009 153 GLN B O   
663  C  CB  . GLN B 12 ? 0.5011 0.3840 0.6210 -0.0318 -0.0232 -0.0194 153 GLN B CB  
664  C  CG  . GLN B 12 ? 0.5539 0.4259 0.6872 -0.0358 -0.0232 -0.0238 153 GLN B CG  
665  C  CD  . GLN B 12 ? 0.6153 0.4934 0.7531 -0.0381 -0.0258 -0.0364 153 GLN B CD  
666  O  OE1 . GLN B 12 ? 0.6446 0.5329 0.7747 -0.0347 -0.0278 -0.0425 153 GLN B OE1 
667  N  NE2 . GLN B 12 ? 0.6323 0.5043 0.7828 -0.0437 -0.0260 -0.0404 153 GLN B NE2 
668  N  N   . LYS B 13 ? 0.3087 0.2203 0.4060 -0.0293 -0.0231 -0.0167 154 LYS B N   
669  C  CA  . LYS B 13 ? 0.2791 0.1979 0.3660 -0.0253 -0.0233 -0.0130 154 LYS B CA  
670  C  C   . LYS B 13 ? 0.3235 0.2546 0.4042 -0.0262 -0.0234 -0.0163 154 LYS B C   
671  O  O   . LYS B 13 ? 0.3352 0.2718 0.4127 -0.0235 -0.0246 -0.0225 154 LYS B O   
672  C  CB  . LYS B 13 ? 0.3044 0.2209 0.3903 -0.0195 -0.0248 -0.0157 154 LYS B CB  
673  C  CG  . LYS B 13 ? 0.4884 0.3937 0.5775 -0.0170 -0.0249 -0.0092 154 LYS B CG  
674  C  CD  . LYS B 13 ? 0.5161 0.4168 0.6090 -0.0121 -0.0264 -0.0139 154 LYS B CD  
675  C  CE  . LYS B 13 ? 0.5488 0.4412 0.6420 -0.0080 -0.0271 -0.0063 154 LYS B CE  
676  N  NZ  . LYS B 13 ? 0.5213 0.4046 0.6163 -0.0112 -0.0255 0.0017  154 LYS B NZ  
677  N  N   . PRO B 14 ? 0.2821 0.2173 0.3614 -0.0299 -0.0218 -0.0120 155 PRO B N   
678  C  CA  . PRO B 14 ? 0.3308 0.2772 0.4047 -0.0309 -0.0218 -0.0140 155 PRO B CA  
679  C  C   . PRO B 14 ? 0.2752 0.2270 0.3392 -0.0266 -0.0221 -0.0116 155 PRO B C   
680  O  O   . PRO B 14 ? 0.2220 0.1716 0.2823 -0.0251 -0.0215 -0.0046 155 PRO B O   
681  C  CB  . PRO B 14 ? 0.3826 0.3300 0.4581 -0.0351 -0.0193 -0.0077 155 PRO B CB  
682  C  CG  . PRO B 14 ? 0.4097 0.3469 0.4865 -0.0346 -0.0177 0.0003  155 PRO B CG  
683  C  CD  . PRO B 14 ? 0.3482 0.2768 0.4310 -0.0329 -0.0194 -0.0039 155 PRO B CD  
684  N  N   . ILE B 15 ? 0.2803 0.2388 0.3402 -0.0247 -0.0231 -0.0173 156 ILE B N   
685  C  CA  . ILE B 15 ? 0.2423 0.2053 0.2947 -0.0211 -0.0231 -0.0154 156 ILE B CA  
686  C  C   . ILE B 15 ? 0.1802 0.1519 0.2267 -0.0212 -0.0229 -0.0181 156 ILE B C   
687  O  O   . ILE B 15 ? 0.1852 0.1600 0.2335 -0.0230 -0.0234 -0.0227 156 ILE B O   
688  C  CB  . ILE B 15 ? 0.2511 0.2117 0.3046 -0.0171 -0.0237 -0.0189 156 ILE B CB  
689  C  CG1 . ILE B 15 ? 0.3549 0.3162 0.4106 -0.0167 -0.0241 -0.0273 156 ILE B CG1 
690  C  CG2 . ILE B 15 ? 0.2453 0.1975 0.3035 -0.0157 -0.0242 -0.0155 156 ILE B CG2 
691  C  CD1 . ILE B 15 ? 0.4259 0.3950 0.4748 -0.0144 -0.0235 -0.0308 156 ILE B CD1 
692  N  N   . VAL B 16 ? 0.1702 0.1460 0.2103 -0.0189 -0.0225 -0.0156 157 VAL B N   
693  C  CA  . VAL B 16 ? 0.1490 0.1321 0.1832 -0.0182 -0.0222 -0.0179 157 VAL B CA  
694  C  C   . VAL B 16 ? 0.1325 0.1165 0.1639 -0.0146 -0.0215 -0.0191 157 VAL B C   
695  O  O   . VAL B 16 ? 0.2033 0.1851 0.2358 -0.0133 -0.0216 -0.0159 157 VAL B O   
696  C  CB  . VAL B 16 ? 0.1838 0.1707 0.2133 -0.0192 -0.0217 -0.0130 157 VAL B CB  
697  C  CG1 . VAL B 16 ? 0.2837 0.2768 0.3073 -0.0179 -0.0214 -0.0151 157 VAL B CG1 
698  C  CG2 . VAL B 16 ? 0.1181 0.1045 0.1512 -0.0227 -0.0213 -0.0106 157 VAL B CG2 
699  N  N   . ARG B 17 ? 0.1990 0.1865 0.2272 -0.0129 -0.0208 -0.0236 158 ARG B N   
700  C  CA  . ARG B 17 ? 0.1947 0.1839 0.2202 -0.0099 -0.0191 -0.0244 158 ARG B CA  
701  C  C   . ARG B 17 ? 0.2047 0.1979 0.2242 -0.0095 -0.0181 -0.0213 158 ARG B C   
702  O  O   . ARG B 17 ? 0.2033 0.1998 0.2183 -0.0102 -0.0184 -0.0215 158 ARG B O   
703  C  CB  . ARG B 17 ? 0.1963 0.1868 0.2199 -0.0076 -0.0183 -0.0305 158 ARG B CB  
704  C  CG  . ARG B 17 ? 0.3197 0.3056 0.3494 -0.0073 -0.0193 -0.0348 158 ARG B CG  
705  C  CD  . ARG B 17 ? 0.4074 0.3953 0.4334 -0.0048 -0.0190 -0.0417 158 ARG B CD  
706  N  NE  . ARG B 17 ? 0.5629 0.5538 0.5863 -0.0064 -0.0212 -0.0444 158 ARG B NE  
707  C  CZ  . ARG B 17 ? 0.7133 0.7067 0.7330 -0.0043 -0.0223 -0.0510 158 ARG B CZ  
708  N  NH1 . ARG B 17 ? 0.7829 0.7757 0.8000 -0.0004 -0.0209 -0.0555 158 ARG B NH1 
709  N  NH2 . ARG B 17 ? 0.7437 0.7406 0.7624 -0.0059 -0.0250 -0.0534 158 ARG B NH2 
710  N  N   . VAL B 18 ? 0.1736 0.1669 0.1939 -0.0084 -0.0170 -0.0187 159 VAL B N   
711  C  CA  . VAL B 18 ? 0.1883 0.1843 0.2042 -0.0084 -0.0163 -0.0158 159 VAL B CA  
712  C  C   . VAL B 18 ? 0.1230 0.1205 0.1385 -0.0064 -0.0134 -0.0163 159 VAL B C   
713  O  O   . VAL B 18 ? 0.1686 0.1654 0.1896 -0.0056 -0.0127 -0.0163 159 VAL B O   
714  C  CB  . VAL B 18 ? 0.1822 0.1770 0.1998 -0.0095 -0.0182 -0.0117 159 VAL B CB  
715  C  CG1 . VAL B 18 ? 0.1930 0.1901 0.2059 -0.0094 -0.0177 -0.0098 159 VAL B CG1 
716  C  CG2 . VAL B 18 ? 0.1733 0.1661 0.1914 -0.0116 -0.0201 -0.0102 159 VAL B CG2 
717  N  N   . PHE B 19 ? 0.1193 0.1190 0.1286 -0.0054 -0.0115 -0.0164 160 PHE B N   
718  C  CA  . PHE B 19 ? 0.1208 0.1215 0.1294 -0.0038 -0.0079 -0.0157 160 PHE B CA  
719  C  C   . PHE B 19 ? 0.1406 0.1412 0.1502 -0.0050 -0.0079 -0.0121 160 PHE B C   
720  O  O   . PHE B 19 ? 0.1697 0.1703 0.1751 -0.0058 -0.0095 -0.0107 160 PHE B O   
721  C  CB  . PHE B 19 ? 0.1958 0.1981 0.1962 -0.0014 -0.0055 -0.0173 160 PHE B CB  
722  C  CG  . PHE B 19 ? 0.2909 0.2934 0.2906 0.0003  -0.0056 -0.0219 160 PHE B CG  
723  C  CD1 . PHE B 19 ? 0.3566 0.3593 0.3549 -0.0005 -0.0091 -0.0248 160 PHE B CD1 
724  C  CD2 . PHE B 19 ? 0.2452 0.2478 0.2470 0.0024  -0.0024 -0.0236 160 PHE B CD2 
725  C  CE1 . PHE B 19 ? 0.3115 0.3140 0.3102 0.0010  -0.0098 -0.0300 160 PHE B CE1 
726  C  CE2 . PHE B 19 ? 0.1989 0.2014 0.1999 0.0044  -0.0027 -0.0286 160 PHE B CE2 
727  C  CZ  . PHE B 19 ? 0.2276 0.2297 0.2269 0.0037  -0.0066 -0.0321 160 PHE B CZ  
728  N  N   . LEU B 20 ? 0.2150 0.2159 0.2306 -0.0050 -0.0059 -0.0113 161 LEU B N   
729  C  CA  . LEU B 20 ? 0.2210 0.2217 0.2401 -0.0064 -0.0068 -0.0091 161 LEU B CA  
730  C  C   . LEU B 20 ? 0.2116 0.2125 0.2310 -0.0060 -0.0021 -0.0077 161 LEU B C   
731  O  O   . LEU B 20 ? 0.1781 0.1797 0.1959 -0.0044 0.0023  -0.0081 161 LEU B O   
732  C  CB  . LEU B 20 ? 0.1701 0.1712 0.1985 -0.0069 -0.0093 -0.0095 161 LEU B CB  
733  C  CG  . LEU B 20 ? 0.2409 0.2405 0.2689 -0.0071 -0.0136 -0.0096 161 LEU B CG  
734  C  CD1 . LEU B 20 ? 0.1876 0.1874 0.2245 -0.0064 -0.0160 -0.0100 161 LEU B CD1 
735  C  CD2 . LEU B 20 ? 0.1820 0.1807 0.2041 -0.0081 -0.0165 -0.0078 161 LEU B CD2 
736  N  N   . PRO B 21 ? 0.2389 0.2389 0.2607 -0.0074 -0.0027 -0.0061 162 PRO B N   
737  C  CA  . PRO B 21 ? 0.3243 0.3235 0.3481 -0.0077 0.0022  -0.0044 162 PRO B CA  
738  C  C   . PRO B 21 ? 0.3357 0.3373 0.3683 -0.0076 0.0065  -0.0049 162 PRO B C   
739  O  O   . PRO B 21 ? 0.2650 0.2689 0.3040 -0.0075 0.0043  -0.0069 162 PRO B O   
740  C  CB  . PRO B 21 ? 0.3131 0.3111 0.3415 -0.0097 -0.0009 -0.0040 162 PRO B CB  
741  C  CG  . PRO B 21 ? 0.2195 0.2169 0.2413 -0.0093 -0.0061 -0.0045 162 PRO B CG  
742  C  CD  . PRO B 21 ? 0.1919 0.1912 0.2141 -0.0086 -0.0076 -0.0059 162 PRO B CD  
743  N  N   . ASN B 22 ? 0.3386 0.3397 0.3710 -0.0071 0.0128  -0.0028 163 ASN B N   
744  C  CA  . ASN B 22 ? 0.3405 0.3444 0.3822 -0.0072 0.0182  -0.0027 163 ASN B CA  
745  C  C   . ASN B 22 ? 0.3366 0.3434 0.3773 -0.0047 0.0189  -0.0053 163 ASN B C   
746  O  O   . ASN B 22 ? 0.2944 0.3045 0.3453 -0.0048 0.0192  -0.0071 163 ASN B O   
747  C  CB  . ASN B 22 ? 0.4572 0.4632 0.5141 -0.0103 0.0163  -0.0036 163 ASN B CB  
748  C  CG  . ASN B 22 ? 0.6477 0.6575 0.7168 -0.0110 0.0229  -0.0031 163 ASN B CG  
749  O  OD1 . ASN B 22 ? 0.6072 0.6169 0.6725 -0.0094 0.0302  -0.0009 163 ASN B OD1 
750  N  ND2 . ASN B 22 ? 0.6234 0.6368 0.7074 -0.0132 0.0202  -0.0051 163 ASN B ND2 
751  N  N   . LYS B 23 ? 0.3291 0.3344 0.3575 -0.0022 0.0186  -0.0059 164 LYS B N   
752  C  CA  . LYS B 23 ? 0.3507 0.3577 0.3761 0.0006  0.0194  -0.0090 164 LYS B CA  
753  C  C   . LYS B 23 ? 0.2949 0.3029 0.3279 0.0000  0.0143  -0.0122 164 LYS B C   
754  O  O   . LYS B 23 ? 0.3013 0.3110 0.3371 0.0020  0.0159  -0.0148 164 LYS B O   
755  C  CB  . LYS B 23 ? 0.4799 0.4893 0.5079 0.0025  0.0272  -0.0083 164 LYS B CB  
756  C  CG  . LYS B 23 ? 0.5856 0.5933 0.6063 0.0035  0.0335  -0.0041 164 LYS B CG  
757  C  CD  . LYS B 23 ? 0.6987 0.7056 0.7038 0.0079  0.0353  -0.0046 164 LYS B CD  
758  C  CE  . LYS B 23 ? 0.7763 0.7804 0.7728 0.0093  0.0409  0.0006  164 LYS B CE  
759  N  NZ  . LYS B 23 ? 0.7976 0.8012 0.7776 0.0146  0.0424  0.0003  164 LYS B NZ  
760  N  N   . GLN B 24 ? 0.1877 0.1945 0.2236 -0.0023 0.0086  -0.0118 165 GLN B N   
761  C  CA  . GLN B 24 ? 0.2170 0.2238 0.2590 -0.0024 0.0038  -0.0139 165 GLN B CA  
762  C  C   . GLN B 24 ? 0.1887 0.1928 0.2236 -0.0022 -0.0004 -0.0151 165 GLN B C   
763  O  O   . GLN B 24 ? 0.1688 0.1718 0.1948 -0.0022 -0.0005 -0.0147 165 GLN B O   
764  C  CB  . GLN B 24 ? 0.1567 0.1645 0.2079 -0.0043 0.0004  -0.0128 165 GLN B CB  
765  C  CG  . GLN B 24 ? 0.2410 0.2529 0.3037 -0.0044 0.0044  -0.0130 165 GLN B CG  
766  C  CD  . GLN B 24 ? 0.2488 0.2630 0.3228 -0.0057 0.0002  -0.0133 165 GLN B CD  
767  O  OE1 . GLN B 24 ? 0.2454 0.2582 0.3187 -0.0056 -0.0059 -0.0136 165 GLN B OE1 
768  N  NE2 . GLN B 24 ? 0.2457 0.2637 0.3306 -0.0069 0.0036  -0.0133 165 GLN B NE2 
769  N  N   . ARG B 25 ? 0.1907 0.1936 0.2303 -0.0019 -0.0039 -0.0165 166 ARG B N   
770  C  CA  . ARG B 25 ? 0.1987 0.1986 0.2334 -0.0022 -0.0071 -0.0175 166 ARG B CA  
771  C  C   . ARG B 25 ? 0.1884 0.1859 0.2290 -0.0025 -0.0113 -0.0171 166 ARG B C   
772  O  O   . ARG B 25 ? 0.2645 0.2631 0.3130 -0.0015 -0.0119 -0.0170 166 ARG B O   
773  C  CB  . ARG B 25 ? 0.2662 0.2659 0.2970 -0.0002 -0.0048 -0.0213 166 ARG B CB  
774  C  CG  . ARG B 25 ? 0.2685 0.2690 0.3058 0.0021  -0.0026 -0.0238 166 ARG B CG  
775  C  CD  . ARG B 25 ? 0.3891 0.3896 0.4218 0.0048  -0.0003 -0.0281 166 ARG B CD  
776  N  NE  . ARG B 25 ? 0.3666 0.3697 0.3910 0.0063  0.0040  -0.0280 166 ARG B NE  
777  C  CZ  . ARG B 25 ? 0.3760 0.3802 0.3955 0.0097  0.0072  -0.0316 166 ARG B CZ  
778  N  NH1 . ARG B 25 ? 0.4217 0.4246 0.4448 0.0117  0.0064  -0.0362 166 ARG B NH1 
779  N  NH2 . ARG B 25 ? 0.4325 0.4386 0.4431 0.0115  0.0111  -0.0306 166 ARG B NH2 
780  N  N   . THR B 26 ? 0.1213 0.1157 0.1582 -0.0036 -0.0141 -0.0167 167 THR B N   
781  C  CA  . THR B 26 ? 0.2009 0.1918 0.2415 -0.0038 -0.0176 -0.0152 167 THR B CA  
782  C  C   . THR B 26 ? 0.1791 0.1663 0.2168 -0.0051 -0.0188 -0.0158 167 THR B C   
783  O  O   . THR B 26 ? 0.1839 0.1725 0.2162 -0.0065 -0.0180 -0.0168 167 THR B O   
784  C  CB  . THR B 26 ? 0.2058 0.1972 0.2463 -0.0045 -0.0204 -0.0115 167 THR B CB  
785  O  OG1 . THR B 26 ? 0.2573 0.2453 0.3016 -0.0034 -0.0235 -0.0099 167 THR B OG1 
786  C  CG2 . THR B 26 ? 0.1715 0.1629 0.2042 -0.0066 -0.0210 -0.0094 167 THR B CG2 
787  N  N   . VAL B 27 ? 0.1340 0.1166 0.1759 -0.0048 -0.0209 -0.0150 168 VAL B N   
788  C  CA  . VAL B 27 ? 0.1738 0.1522 0.2148 -0.0069 -0.0218 -0.0150 168 VAL B CA  
789  C  C   . VAL B 27 ? 0.2570 0.2326 0.2971 -0.0079 -0.0239 -0.0095 168 VAL B C   
790  O  O   . VAL B 27 ? 0.2610 0.2354 0.3035 -0.0059 -0.0255 -0.0071 168 VAL B O   
791  C  CB  . VAL B 27 ? 0.2793 0.2526 0.3259 -0.0057 -0.0220 -0.0184 168 VAL B CB  
792  C  CG1 . VAL B 27 ? 0.2662 0.2342 0.3140 -0.0085 -0.0231 -0.0173 168 VAL B CG1 
793  C  CG2 . VAL B 27 ? 0.3228 0.2988 0.3686 -0.0043 -0.0198 -0.0244 168 VAL B CG2 
794  N  N   . VAL B 28 ? 0.2499 0.2250 0.2868 -0.0106 -0.0239 -0.0075 169 VAL B N   
795  C  CA  . VAL B 28 ? 0.1553 0.1276 0.1905 -0.0110 -0.0251 -0.0019 169 VAL B CA  
796  C  C   . VAL B 28 ? 0.1585 0.1259 0.1964 -0.0137 -0.0244 -0.0008 169 VAL B C   
797  O  O   . VAL B 28 ? 0.1527 0.1211 0.1924 -0.0158 -0.0234 -0.0049 169 VAL B O   
798  C  CB  . VAL B 28 ? 0.2271 0.2042 0.2556 -0.0117 -0.0252 0.0008  169 VAL B CB  
799  C  CG1 . VAL B 28 ? 0.2485 0.2295 0.2758 -0.0095 -0.0261 -0.0001 169 VAL B CG1 
800  C  CG2 . VAL B 28 ? 0.2072 0.1877 0.2330 -0.0144 -0.0235 -0.0010 169 VAL B CG2 
801  N  N   . PRO B 29 ? 0.2002 0.1622 0.2385 -0.0134 -0.0249 0.0045  170 PRO B N   
802  C  CA  . PRO B 29 ? 0.2622 0.2186 0.3039 -0.0164 -0.0235 0.0067  170 PRO B CA  
803  C  C   . PRO B 29 ? 0.2980 0.2592 0.3366 -0.0197 -0.0217 0.0079  170 PRO B C   
804  O  O   . PRO B 29 ? 0.2865 0.2527 0.3185 -0.0188 -0.0218 0.0102  170 PRO B O   
805  C  CB  . PRO B 29 ? 0.3175 0.2676 0.3579 -0.0141 -0.0243 0.0136  170 PRO B CB  
806  C  CG  . PRO B 29 ? 0.3080 0.2626 0.3426 -0.0106 -0.0264 0.0150  170 PRO B CG  
807  C  CD  . PRO B 29 ? 0.2377 0.1979 0.2741 -0.0099 -0.0270 0.0085  170 PRO B CD  
808  N  N   . ALA B 30 ? 0.2746 0.2352 0.3188 -0.0234 -0.0203 0.0055  171 ALA B N   
809  C  CA  . ALA B 30 ? 0.3243 0.2907 0.3669 -0.0264 -0.0187 0.0062  171 ALA B CA  
810  C  C   . ALA B 30 ? 0.3033 0.2652 0.3479 -0.0288 -0.0161 0.0131  171 ALA B C   
811  O  O   . ALA B 30 ? 0.2897 0.2502 0.3418 -0.0328 -0.0144 0.0122  171 ALA B O   
812  C  CB  . ALA B 30 ? 0.2502 0.2207 0.2979 -0.0289 -0.0190 -0.0010 171 ALA B CB  
813  N  N   . ARG B 31 ? 0.3636 0.3236 0.4015 -0.0263 -0.0157 0.0197  172 ARG B N   
814  C  CA  . ARG B 31 ? 0.4485 0.4026 0.4869 -0.0275 -0.0128 0.0274  172 ARG B CA  
815  C  C   . ARG B 31 ? 0.3293 0.2896 0.3645 -0.0296 -0.0095 0.0307  172 ARG B C   
816  O  O   . ARG B 31 ? 0.2752 0.2421 0.3025 -0.0273 -0.0104 0.0304  172 ARG B O   
817  C  CB  . ARG B 31 ? 0.5637 0.5124 0.5954 -0.0227 -0.0142 0.0332  172 ARG B CB  
818  C  CG  . ARG B 31 ? 0.6977 0.6448 0.7301 -0.0191 -0.0182 0.0288  172 ARG B CG  
819  C  CD  . ARG B 31 ? 0.8031 0.7450 0.8305 -0.0141 -0.0203 0.0343  172 ARG B CD  
820  N  NE  . ARG B 31 ? 0.8431 0.7891 0.8602 -0.0119 -0.0203 0.0388  172 ARG B NE  
821  C  CZ  . ARG B 31 ? 0.8699 0.8120 0.8802 -0.0076 -0.0215 0.0451  172 ARG B CZ  
822  N  NH1 . ARG B 31 ? 0.9394 0.8729 0.9522 -0.0051 -0.0227 0.0482  172 ARG B NH1 
823  N  NH2 . ARG B 31 ? 0.8421 0.7886 0.8423 -0.0054 -0.0218 0.0480  172 ARG B NH2 
824  N  N   . CYS B 32 ? 0.2899 0.2483 0.3321 -0.0340 -0.0057 0.0335  173 CYS B N   
825  C  CA  . CYS B 32 ? 0.2681 0.2331 0.3085 -0.0360 -0.0018 0.0369  173 CYS B CA  
826  C  C   . CYS B 32 ? 0.2938 0.2595 0.3212 -0.0313 -0.0014 0.0430  173 CYS B C   
827  O  O   . CYS B 32 ? 0.2833 0.2418 0.3054 -0.0279 -0.0024 0.0477  173 CYS B O   
828  C  CB  . CYS B 32 ? 0.4047 0.3656 0.4544 -0.0409 0.0033  0.0417  173 CYS B CB  
829  S  SG  . CYS B 32 ? 0.5291 0.4911 0.5953 -0.0471 0.0028  0.0337  173 CYS B SG  
830  N  N   . GLY B 33 ? 0.2598 0.2344 0.2819 -0.0307 -0.0003 0.0424  174 GLY B N   
831  C  CA  . GLY B 33 ? 0.2566 0.2326 0.2661 -0.0263 0.0003  0.0475  174 GLY B CA  
832  C  C   . GLY B 33 ? 0.3531 0.3303 0.3535 -0.0212 -0.0049 0.0445  174 GLY B C   
833  O  O   . GLY B 33 ? 0.4197 0.3974 0.4096 -0.0171 -0.0052 0.0483  174 GLY B O   
834  N  N   . VAL B 34 ? 0.2766 0.2543 0.2812 -0.0213 -0.0088 0.0379  175 VAL B N   
835  C  CA  . VAL B 34 ? 0.2296 0.2083 0.2280 -0.0171 -0.0134 0.0349  175 VAL B CA  
836  C  C   . VAL B 34 ? 0.2239 0.2102 0.2224 -0.0177 -0.0144 0.0286  175 VAL B C   
837  O  O   . VAL B 34 ? 0.1999 0.1884 0.2053 -0.0207 -0.0138 0.0245  175 VAL B O   
838  C  CB  . VAL B 34 ? 0.3190 0.2916 0.3219 -0.0159 -0.0166 0.0331  175 VAL B CB  
839  C  CG1 . VAL B 34 ? 0.3170 0.2917 0.3161 -0.0122 -0.0209 0.0297  175 VAL B CG1 
840  C  CG2 . VAL B 34 ? 0.2911 0.2549 0.2942 -0.0148 -0.0157 0.0397  175 VAL B CG2 
841  N  N   . THR B 35 ? 0.2417 0.2316 0.2325 -0.0145 -0.0162 0.0278  176 THR B N   
842  C  CA  . THR B 35 ? 0.2571 0.2527 0.2477 -0.0147 -0.0171 0.0224  176 THR B CA  
843  C  C   . THR B 35 ? 0.2238 0.2181 0.2185 -0.0145 -0.0198 0.0176  176 THR B C   
844  O  O   . THR B 35 ? 0.2625 0.2524 0.2588 -0.0132 -0.0218 0.0180  176 THR B O   
845  C  CB  . THR B 35 ? 0.2014 0.2006 0.1831 -0.0113 -0.0182 0.0223  176 THR B CB  
846  O  OG1 . THR B 35 ? 0.2057 0.2017 0.1836 -0.0081 -0.0219 0.0223  176 THR B OG1 
847  C  CG2 . THR B 35 ? 0.2511 0.2529 0.2277 -0.0109 -0.0148 0.0266  176 THR B CG2 
848  N  N   . VAL B 36 ? 0.1445 0.1430 0.1406 -0.0153 -0.0196 0.0134  177 VAL B N   
849  C  CA  . VAL B 36 ? 0.1521 0.1502 0.1502 -0.0146 -0.0213 0.0092  177 VAL B CA  
850  C  C   . VAL B 36 ? 0.1721 0.1688 0.1668 -0.0118 -0.0238 0.0095  177 VAL B C   
851  O  O   . VAL B 36 ? 0.1545 0.1490 0.1527 -0.0111 -0.0252 0.0081  177 VAL B O   
852  C  CB  . VAL B 36 ? 0.0664 0.0693 0.0642 -0.0151 -0.0204 0.0056  177 VAL B CB  
853  C  CG1 . VAL B 36 ? 0.1702 0.1725 0.1688 -0.0140 -0.0213 0.0022  177 VAL B CG1 
854  C  CG2 . VAL B 36 ? 0.1220 0.1266 0.1251 -0.0179 -0.0189 0.0045  177 VAL B CG2 
855  N  N   . ARG B 37 ? 0.2079 0.2066 0.1964 -0.0101 -0.0243 0.0106  178 ARG B N   
856  C  CA  . ARG B 37 ? 0.2326 0.2306 0.2182 -0.0074 -0.0273 0.0100  178 ARG B CA  
857  C  C   . ARG B 37 ? 0.2553 0.2497 0.2428 -0.0062 -0.0296 0.0119  178 ARG B C   
858  O  O   . ARG B 37 ? 0.2108 0.2043 0.2024 -0.0053 -0.0319 0.0098  178 ARG B O   
859  C  CB  . ARG B 37 ? 0.2707 0.2707 0.2483 -0.0055 -0.0276 0.0114  178 ARG B CB  
860  C  CG  . ARG B 37 ? 0.3756 0.3754 0.3498 -0.0026 -0.0312 0.0095  178 ARG B CG  
861  C  CD  . ARG B 37 ? 0.3757 0.3769 0.3407 0.0002  -0.0316 0.0112  178 ARG B CD  
862  N  NE  . ARG B 37 ? 0.3548 0.3593 0.3169 -0.0004 -0.0284 0.0111  178 ARG B NE  
863  C  CZ  . ARG B 37 ? 0.4074 0.4135 0.3688 0.0001  -0.0286 0.0076  178 ARG B CZ  
864  N  NH1 . ARG B 37 ? 0.3650 0.3693 0.3288 0.0007  -0.0315 0.0041  178 ARG B NH1 
865  N  NH2 . ARG B 37 ? 0.3895 0.3990 0.3487 0.0001  -0.0257 0.0078  178 ARG B NH2 
866  N  N   . ASP B 38 ? 0.2290 0.2212 0.2139 -0.0058 -0.0288 0.0163  179 ASP B N   
867  C  CA  . ASP B 38 ? 0.2840 0.2721 0.2699 -0.0039 -0.0311 0.0188  179 ASP B CA  
868  C  C   . ASP B 38 ? 0.2660 0.2512 0.2606 -0.0054 -0.0308 0.0174  179 ASP B C   
869  O  O   . ASP B 38 ? 0.2474 0.2306 0.2453 -0.0034 -0.0335 0.0170  179 ASP B O   
870  C  CB  . ASP B 38 ? 0.4056 0.3912 0.3856 -0.0029 -0.0295 0.0248  179 ASP B CB  
871  C  CG  . ASP B 38 ? 0.4345 0.4230 0.4045 -0.0001 -0.0301 0.0262  179 ASP B CG  
872  O  OD1 . ASP B 38 ? 0.4490 0.4397 0.4166 0.0022  -0.0337 0.0227  179 ASP B OD1 
873  O  OD2 . ASP B 38 ? 0.4633 0.4520 0.4282 -0.0002 -0.0268 0.0305  179 ASP B OD2 
874  N  N   . SER B 39 ? 0.2377 0.2230 0.2366 -0.0086 -0.0278 0.0159  180 SER B N   
875  C  CA  . SER B 39 ? 0.2380 0.2205 0.2446 -0.0094 -0.0278 0.0137  180 SER B CA  
876  C  C   . SER B 39 ? 0.2382 0.2229 0.2480 -0.0080 -0.0295 0.0096  180 SER B C   
877  O  O   . SER B 39 ? 0.2274 0.2101 0.2429 -0.0070 -0.0304 0.0083  180 SER B O   
878  C  CB  . SER B 39 ? 0.2237 0.2067 0.2342 -0.0127 -0.0250 0.0114  180 SER B CB  
879  O  OG  . SER B 39 ? 0.2152 0.1967 0.2253 -0.0148 -0.0228 0.0149  180 SER B OG  
880  N  N   . LEU B 40 ? 0.1878 0.1766 0.1945 -0.0080 -0.0295 0.0077  181 LEU B N   
881  C  CA  . LEU B 40 ? 0.1546 0.1456 0.1653 -0.0076 -0.0298 0.0040  181 LEU B CA  
882  C  C   . LEU B 40 ? 0.2062 0.1986 0.2170 -0.0055 -0.0331 0.0036  181 LEU B C   
883  O  O   . LEU B 40 ? 0.2092 0.2031 0.2255 -0.0054 -0.0332 0.0009  181 LEU B O   
884  C  CB  . LEU B 40 ? 0.1901 0.1838 0.1985 -0.0091 -0.0273 0.0018  181 LEU B CB  
885  C  CG  . LEU B 40 ? 0.2246 0.2182 0.2353 -0.0105 -0.0247 -0.0001 181 LEU B CG  
886  C  CD1 . LEU B 40 ? 0.2003 0.1969 0.2071 -0.0111 -0.0228 -0.0018 181 LEU B CD1 
887  C  CD2 . LEU B 40 ? 0.2430 0.2358 0.2598 -0.0097 -0.0242 -0.0025 181 LEU B CD2 
888  N  N   . LYS B 41 ? 0.3182 0.3103 0.3231 -0.0039 -0.0354 0.0060  182 LYS B N   
889  C  CA  . LYS B 41 ? 0.3386 0.3321 0.3430 -0.0015 -0.0396 0.0049  182 LYS B CA  
890  C  C   . LYS B 41 ? 0.2220 0.2164 0.2355 -0.0004 -0.0421 0.0026  182 LYS B C   
891  O  O   . LYS B 41 ? 0.2827 0.2799 0.3012 -0.0006 -0.0433 -0.0007 182 LYS B O   
892  C  CB  . LYS B 41 ? 0.4354 0.4274 0.4321 0.0012  -0.0421 0.0085  182 LYS B CB  
893  C  CG  . LYS B 41 ? 0.6020 0.5962 0.5956 0.0041  -0.0469 0.0065  182 LYS B CG  
894  C  CD  . LYS B 41 ? 0.7035 0.6966 0.6869 0.0076  -0.0491 0.0101  182 LYS B CD  
895  C  CE  . LYS B 41 ? 0.7889 0.7847 0.7689 0.0105  -0.0542 0.0065  182 LYS B CE  
896  N  NZ  . LYS B 41 ? 0.8176 0.8131 0.7853 0.0146  -0.0563 0.0092  182 LYS B NZ  
897  N  N   . LYS B 42 ? 0.3126 0.3047 0.3295 0.0008  -0.0425 0.0043  183 LYS B N   
898  C  CA  . LYS B 42 ? 0.2967 0.2903 0.3228 0.0025  -0.0450 0.0021  183 LYS B CA  
899  C  C   . LYS B 42 ? 0.2393 0.2354 0.2740 0.0003  -0.0416 -0.0015 183 LYS B C   
900  O  O   . LYS B 42 ? 0.2001 0.1999 0.2426 0.0006  -0.0430 -0.0044 183 LYS B O   
901  C  CB  . LYS B 42 ? 0.3727 0.3623 0.3998 0.0049  -0.0462 0.0050  183 LYS B CB  
902  C  CG  . LYS B 42 ? 0.4388 0.4303 0.4749 0.0079  -0.0499 0.0032  183 LYS B CG  
903  C  CD  . LYS B 42 ? 0.5601 0.5468 0.5949 0.0114  -0.0521 0.0070  183 LYS B CD  
904  C  CE  . LYS B 42 ? 0.6112 0.5945 0.6529 0.0108  -0.0489 0.0064  183 LYS B CE  
905  N  NZ  . LYS B 42 ? 0.6437 0.6229 0.6813 0.0072  -0.0440 0.0077  183 LYS B NZ  
906  N  N   . ALA B 43 ? 0.2399 0.2342 0.2736 -0.0017 -0.0371 -0.0014 184 ALA B N   
907  C  CA  . ALA B 43 ? 0.2629 0.2595 0.3023 -0.0032 -0.0334 -0.0043 184 ALA B CA  
908  C  C   . ALA B 43 ? 0.2772 0.2769 0.3172 -0.0045 -0.0327 -0.0059 184 ALA B C   
909  O  O   . ALA B 43 ? 0.3469 0.3495 0.3950 -0.0049 -0.0310 -0.0081 184 ALA B O   
910  C  CB  . ALA B 43 ? 0.2641 0.2589 0.3005 -0.0047 -0.0293 -0.0045 184 ALA B CB  
911  N  N   . LEU B 44 ? 0.2328 0.2318 0.2649 -0.0052 -0.0335 -0.0048 185 LEU B N   
912  C  CA  . LEU B 44 ? 0.2622 0.2626 0.2943 -0.0063 -0.0329 -0.0063 185 LEU B CA  
913  C  C   . LEU B 44 ? 0.3030 0.3059 0.3426 -0.0054 -0.0370 -0.0084 185 LEU B C   
914  O  O   . LEU B 44 ? 0.2705 0.2753 0.3177 -0.0068 -0.0356 -0.0105 185 LEU B O   
915  C  CB  . LEU B 44 ? 0.2871 0.2863 0.3093 -0.0066 -0.0331 -0.0051 185 LEU B CB  
916  C  CG  . LEU B 44 ? 0.2931 0.2913 0.3097 -0.0077 -0.0290 -0.0040 185 LEU B CG  
917  C  CD1 . LEU B 44 ? 0.3019 0.2999 0.3098 -0.0075 -0.0293 -0.0028 185 LEU B CD1 
918  C  CD2 . LEU B 44 ? 0.3349 0.3336 0.3548 -0.0086 -0.0251 -0.0052 185 LEU B CD2 
919  N  N   A MSE B 45 ? 0.2997 0.3026 0.3372 -0.0031 -0.0421 -0.0078 186 MSE B N   
920  N  N   B MSE B 45 ? 0.2979 0.3008 0.3354 -0.0031 -0.0421 -0.0078 186 MSE B N   
921  C  CA  A MSE B 45 ? 0.3072 0.3130 0.3511 -0.0015 -0.0473 -0.0105 186 MSE B CA  
922  C  CA  B MSE B 45 ? 0.3045 0.3104 0.3486 -0.0016 -0.0473 -0.0105 186 MSE B CA  
923  C  C   A MSE B 45 ? 0.3195 0.3289 0.3775 -0.0019 -0.0467 -0.0128 186 MSE B C   
924  C  C   B MSE B 45 ? 0.3214 0.3309 0.3796 -0.0020 -0.0466 -0.0128 186 MSE B C   
925  O  O   A MSE B 45 ? 0.3348 0.3476 0.4019 -0.0028 -0.0484 -0.0161 186 MSE B O   
926  O  O   B MSE B 45 ? 0.3375 0.3504 0.4050 -0.0029 -0.0481 -0.0161 186 MSE B O   
927  C  CB  A MSE B 45 ? 0.3146 0.3197 0.3524 0.0021  -0.0528 -0.0087 186 MSE B CB  
928  C  CB  B MSE B 45 ? 0.3233 0.3286 0.3613 0.0020  -0.0529 -0.0090 186 MSE B CB  
929  C  CG  A MSE B 45 ? 0.3761 0.3846 0.4185 0.0045  -0.0595 -0.0121 186 MSE B CG  
930  C  CG  B MSE B 45 ? 0.4017 0.4108 0.4469 0.0045  -0.0594 -0.0123 186 MSE B CG  
931  SE SE  A MSE B 45 ? 0.8294 0.8378 0.8624 0.0050  -0.0631 -0.0145 186 MSE B SE  
932  SE SE  B MSE B 45 ? 0.7791 0.7866 0.8156 0.0104  -0.0657 -0.0089 186 MSE B SE  
933  C  CE  A MSE B 45 ? 0.4738 0.4824 0.5158 -0.0003 -0.0577 -0.0177 186 MSE B CE  
934  C  CE  B MSE B 45 ? 0.5195 0.5231 0.5590 0.0097  -0.0601 -0.0047 186 MSE B CE  
935  N  N   . MSE B 46 ? 0.2993 0.3081 0.3599 -0.0014 -0.0440 -0.0115 187 MSE B N   
936  C  CA  . MSE B 46 ? 0.2907 0.3034 0.3644 -0.0015 -0.0423 -0.0137 187 MSE B CA  
937  C  C   . MSE B 46 ? 0.2785 0.2931 0.3582 -0.0047 -0.0372 -0.0152 187 MSE B C   
938  O  O   . MSE B 46 ? 0.2328 0.2518 0.3252 -0.0052 -0.0355 -0.0173 187 MSE B O   
939  C  CB  . MSE B 46 ? 0.3008 0.3115 0.3746 -0.0003 -0.0393 -0.0123 187 MSE B CB  
940  C  CG  . MSE B 46 ? 0.4611 0.4723 0.5390 0.0034  -0.0441 -0.0121 187 MSE B CG  
941  SE SE  . MSE B 46 ? 1.1989 1.2037 1.2708 0.0048  -0.0414 -0.0093 187 MSE B SE  
942  C  CE  . MSE B 46 ? 0.2727 0.2783 0.3463 0.0016  -0.0329 -0.0113 187 MSE B CE  
943  N  N   . ARG B 47 ? 0.2544 0.2658 0.3254 -0.0066 -0.0341 -0.0139 188 ARG B N   
944  C  CA  . ARG B 47 ? 0.3119 0.3239 0.3871 -0.0092 -0.0286 -0.0144 188 ARG B CA  
945  C  C   . ARG B 47 ? 0.3021 0.3134 0.3772 -0.0109 -0.0305 -0.0156 188 ARG B C   
946  O  O   . ARG B 47 ? 0.2749 0.2848 0.3511 -0.0130 -0.0260 -0.0151 188 ARG B O   
947  C  CB  . ARG B 47 ? 0.3532 0.3623 0.4198 -0.0096 -0.0227 -0.0121 188 ARG B CB  
948  C  CG  . ARG B 47 ? 0.3260 0.3361 0.3953 -0.0082 -0.0199 -0.0122 188 ARG B CG  
949  C  CD  . ARG B 47 ? 0.3389 0.3456 0.3971 -0.0076 -0.0178 -0.0108 188 ARG B CD  
950  N  NE  . ARG B 47 ? 0.3597 0.3670 0.4205 -0.0062 -0.0150 -0.0118 188 ARG B NE  
951  C  CZ  . ARG B 47 ? 0.3240 0.3299 0.3849 -0.0045 -0.0176 -0.0121 188 ARG B CZ  
952  N  NH1 . ARG B 47 ? 0.2606 0.2645 0.3189 -0.0041 -0.0228 -0.0108 188 ARG B NH1 
953  N  NH2 . ARG B 47 ? 0.2973 0.3032 0.3605 -0.0030 -0.0148 -0.0137 188 ARG B NH2 
954  N  N   . GLY B 48 ? 0.3068 0.3185 0.3803 -0.0094 -0.0373 -0.0171 189 GLY B N   
955  C  CA  . GLY B 48 ? 0.3152 0.3259 0.3879 -0.0104 -0.0403 -0.0192 189 GLY B CA  
956  C  C   . GLY B 48 ? 0.3906 0.3966 0.4507 -0.0108 -0.0377 -0.0171 189 GLY B C   
957  O  O   . GLY B 48 ? 0.3796 0.3834 0.4403 -0.0124 -0.0368 -0.0183 189 GLY B O   
958  N  N   . LEU B 49 ? 0.3535 0.3576 0.4028 -0.0094 -0.0365 -0.0141 190 LEU B N   
959  C  CA  . LEU B 49 ? 0.3758 0.3768 0.4138 -0.0094 -0.0345 -0.0123 190 LEU B CA  
960  C  C   . LEU B 49 ? 0.3429 0.3433 0.3708 -0.0072 -0.0385 -0.0114 190 LEU B C   
961  O  O   . LEU B 49 ? 0.2838 0.2854 0.3114 -0.0055 -0.0418 -0.0109 190 LEU B O   
962  C  CB  . LEU B 49 ? 0.3533 0.3532 0.3872 -0.0099 -0.0290 -0.0097 190 LEU B CB  
963  C  CG  . LEU B 49 ? 0.3701 0.3702 0.4108 -0.0115 -0.0236 -0.0096 190 LEU B CG  
964  C  CD1 . LEU B 49 ? 0.4906 0.4903 0.5256 -0.0109 -0.0195 -0.0078 190 LEU B CD1 
965  C  CD2 . LEU B 49 ? 0.3287 0.3263 0.3695 -0.0127 -0.0217 -0.0098 190 LEU B CD2 
966  N  N   . ILE B 50 ? 0.3611 0.3596 0.3804 -0.0069 -0.0375 -0.0107 191 ILE B N   
967  C  CA  . ILE B 50 ? 0.3904 0.3888 0.4000 -0.0048 -0.0402 -0.0096 191 ILE B CA  
968  C  C   . ILE B 50 ? 0.2778 0.2753 0.2799 -0.0052 -0.0361 -0.0074 191 ILE B C   
969  O  O   . ILE B 50 ? 0.2618 0.2581 0.2648 -0.0063 -0.0330 -0.0078 191 ILE B O   
970  C  CB  . ILE B 50 ? 0.5837 0.5821 0.5923 -0.0033 -0.0449 -0.0130 191 ILE B CB  
971  C  CG1 . ILE B 50 ? 0.6644 0.6641 0.6666 -0.0001 -0.0496 -0.0125 191 ILE B CG1 
972  C  CG2 . ILE B 50 ? 0.4938 0.4900 0.4980 -0.0035 -0.0431 -0.0141 191 ILE B CG2 
973  C  CD1 . ILE B 50 ? 0.7322 0.7321 0.7316 0.0022  -0.0549 -0.0165 191 ILE B CD1 
974  N  N   . PRO B 51 ? 0.2722 0.2704 0.2680 -0.0043 -0.0358 -0.0048 192 PRO B N   
975  C  CA  . PRO B 51 ? 0.2831 0.2817 0.2739 -0.0049 -0.0321 -0.0031 192 PRO B CA  
976  C  C   . PRO B 51 ? 0.3481 0.3463 0.3342 -0.0040 -0.0316 -0.0044 192 PRO B C   
977  O  O   . PRO B 51 ? 0.3361 0.3344 0.3207 -0.0044 -0.0286 -0.0040 192 PRO B O   
978  C  CB  . PRO B 51 ? 0.2438 0.2433 0.2298 -0.0042 -0.0325 -0.0003 192 PRO B CB  
979  C  CG  . PRO B 51 ? 0.3159 0.3145 0.3052 -0.0035 -0.0354 0.0003  192 PRO B CG  
980  C  CD  . PRO B 51 ? 0.2553 0.2538 0.2491 -0.0028 -0.0385 -0.0030 192 PRO B CD  
981  N  N   . GLU B 52 ? 0.3623 0.3601 0.3460 -0.0023 -0.0348 -0.0061 193 GLU B N   
982  C  CA  . GLU B 52 ? 0.3994 0.3963 0.3786 -0.0009 -0.0347 -0.0078 193 GLU B CA  
983  C  C   . GLU B 52 ? 0.3378 0.3317 0.3221 -0.0021 -0.0331 -0.0094 193 GLU B C   
984  O  O   . GLU B 52 ? 0.3861 0.3783 0.3670 -0.0010 -0.0321 -0.0102 193 GLU B O   
985  C  CB  . GLU B 52 ? 0.5206 0.5176 0.4954 0.0016  -0.0390 -0.0100 193 GLU B CB  
986  C  CG  . GLU B 52 ? 0.5971 0.5965 0.5655 0.0034  -0.0400 -0.0075 193 GLU B CG  
987  C  CD  . GLU B 52 ? 0.6174 0.6169 0.5904 0.0025  -0.0416 -0.0058 193 GLU B CD  
988  O  OE1 . GLU B 52 ? 0.5664 0.5651 0.5458 0.0023  -0.0447 -0.0085 193 GLU B OE1 
989  O  OE2 . GLU B 52 ? 0.6626 0.6629 0.6338 0.0021  -0.0397 -0.0021 193 GLU B OE2 
990  N  N   . CYS B 53 ? 0.3083 0.3013 0.3008 -0.0042 -0.0325 -0.0096 194 CYS B N   
991  C  CA  . CYS B 53 ? 0.3157 0.3056 0.3133 -0.0055 -0.0298 -0.0102 194 CYS B CA  
992  C  C   . CYS B 53 ? 0.2330 0.2233 0.2302 -0.0063 -0.0251 -0.0075 194 CYS B C   
993  O  O   . CYS B 53 ? 0.2182 0.2061 0.2188 -0.0071 -0.0219 -0.0068 194 CYS B O   
994  C  CB  . CYS B 53 ? 0.3801 0.3692 0.3883 -0.0073 -0.0316 -0.0126 194 CYS B CB  
995  S  SG  . CYS B 53 ? 0.6937 0.6860 0.7111 -0.0091 -0.0305 -0.0116 194 CYS B SG  
996  N  N   . CYS B 54 ? 0.1404 0.1336 0.1331 -0.0058 -0.0247 -0.0059 195 CYS B N   
997  C  CA  . CYS B 54 ? 0.1608 0.1550 0.1531 -0.0062 -0.0213 -0.0044 195 CYS B CA  
998  C  C   . CYS B 54 ? 0.1686 0.1652 0.1541 -0.0050 -0.0207 -0.0035 195 CYS B C   
999  O  O   . CYS B 54 ? 0.1938 0.1919 0.1755 -0.0041 -0.0226 -0.0036 195 CYS B O   
1000 C  CB  . CYS B 54 ? 0.1944 0.1902 0.1919 -0.0075 -0.0215 -0.0043 195 CYS B CB  
1001 S  SG  . CYS B 54 ? 0.2303 0.2254 0.2381 -0.0088 -0.0224 -0.0056 195 CYS B SG  
1002 N  N   . ALA B 55 ? 0.1785 0.1759 0.1625 -0.0047 -0.0181 -0.0029 196 ALA B N   
1003 C  CA  . ALA B 55 ? 0.1597 0.1606 0.1395 -0.0038 -0.0180 -0.0028 196 ALA B CA  
1004 C  C   . ALA B 55 ? 0.1266 0.1294 0.1091 -0.0051 -0.0175 -0.0033 196 ALA B C   
1005 O  O   . ALA B 55 ? 0.1707 0.1720 0.1565 -0.0057 -0.0162 -0.0036 196 ALA B O   
1006 C  CB  . ALA B 55 ? 0.1375 0.1381 0.1123 -0.0014 -0.0163 -0.0026 196 ALA B CB  
1007 N  N   . VAL B 56 ? 0.1366 0.1428 0.1184 -0.0056 -0.0184 -0.0036 197 VAL B N   
1008 C  CA  . VAL B 56 ? 0.1475 0.1548 0.1323 -0.0069 -0.0182 -0.0047 197 VAL B CA  
1009 C  C   . VAL B 56 ? 0.1330 0.1442 0.1157 -0.0061 -0.0181 -0.0065 197 VAL B C   
1010 O  O   . VAL B 56 ? 0.1181 0.1327 0.0986 -0.0054 -0.0187 -0.0064 197 VAL B O   
1011 C  CB  . VAL B 56 ? 0.1602 0.1669 0.1491 -0.0089 -0.0195 -0.0038 197 VAL B CB  
1012 C  CG1 . VAL B 56 ? 0.1839 0.1928 0.1705 -0.0091 -0.0202 -0.0022 197 VAL B CG1 
1013 C  CG2 . VAL B 56 ? 0.1730 0.1798 0.1660 -0.0104 -0.0193 -0.0053 197 VAL B CG2 
1014 N  N   . TYR B 57 ? 0.1969 0.2083 0.1804 -0.0058 -0.0176 -0.0085 198 TYR B N   
1015 C  CA  . TYR B 57 ? 0.1961 0.2116 0.1778 -0.0047 -0.0183 -0.0112 198 TYR B CA  
1016 C  C   . TYR B 57 ? 0.3034 0.3196 0.2897 -0.0064 -0.0192 -0.0142 198 TYR B C   
1017 O  O   . TYR B 57 ? 0.2772 0.2900 0.2666 -0.0073 -0.0185 -0.0144 198 TYR B O   
1018 C  CB  . TYR B 57 ? 0.2090 0.2238 0.1846 -0.0012 -0.0170 -0.0117 198 TYR B CB  
1019 C  CG  . TYR B 57 ? 0.2529 0.2653 0.2242 0.0006  -0.0156 -0.0088 198 TYR B CG  
1020 C  CD1 . TYR B 57 ? 0.2674 0.2822 0.2346 0.0029  -0.0165 -0.0085 198 TYR B CD1 
1021 C  CD2 . TYR B 57 ? 0.3202 0.3278 0.2924 0.0003  -0.0134 -0.0067 198 TYR B CD2 
1022 C  CE1 . TYR B 57 ? 0.3101 0.3218 0.2737 0.0048  -0.0153 -0.0061 198 TYR B CE1 
1023 C  CE2 . TYR B 57 ? 0.4101 0.4147 0.3795 0.0017  -0.0121 -0.0044 198 TYR B CE2 
1024 C  CZ  . TYR B 57 ? 0.3567 0.3628 0.3213 0.0041  -0.0131 -0.0040 198 TYR B CZ  
1025 O  OH  . TYR B 57 ? 0.4393 0.4414 0.4010 0.0058  -0.0119 -0.0019 198 TYR B OH  
1026 N  N   . ARG B 58 ? 0.2527 0.2736 0.2403 -0.0066 -0.0209 -0.0171 199 ARG B N   
1027 C  CA  . ARG B 58 ? 0.3224 0.3437 0.3145 -0.0079 -0.0222 -0.0211 199 ARG B CA  
1028 C  C   . ARG B 58 ? 0.3425 0.3663 0.3289 -0.0042 -0.0229 -0.0248 199 ARG B C   
1029 O  O   . ARG B 58 ? 0.4514 0.4778 0.4316 -0.0011 -0.0230 -0.0241 199 ARG B O   
1030 C  CB  . ARG B 58 ? 0.3675 0.3925 0.3667 -0.0111 -0.0237 -0.0225 199 ARG B CB  
1031 C  CG  . ARG B 58 ? 0.5290 0.5610 0.5268 -0.0093 -0.0257 -0.0256 199 ARG B CG  
1032 C  CD  . ARG B 58 ? 0.6279 0.6647 0.6337 -0.0126 -0.0266 -0.0261 199 ARG B CD  
1033 N  NE  . ARG B 58 ? 0.6267 0.6625 0.6415 -0.0163 -0.0275 -0.0292 199 ARG B NE  
1034 C  CZ  . ARG B 58 ? 0.5828 0.6233 0.6067 -0.0196 -0.0283 -0.0311 199 ARG B CZ  
1035 N  NH1 . ARG B 58 ? 0.5637 0.6113 0.5885 -0.0193 -0.0283 -0.0302 199 ARG B NH1 
1036 N  NH2 . ARG B 58 ? 0.5057 0.5439 0.5385 -0.0233 -0.0290 -0.0339 199 ARG B NH2 
1037 N  N   . ILE B 59 ? 0.4182 0.4408 0.4060 -0.0039 -0.0234 -0.0287 200 ILE B N   
1038 C  CA  . ILE B 59 ? 0.5066 0.5319 0.4881 0.0001  -0.0246 -0.0330 200 ILE B CA  
1039 C  C   . ILE B 59 ? 0.5511 0.5823 0.5370 -0.0008 -0.0287 -0.0385 200 ILE B C   
1040 O  O   . ILE B 59 ? 0.5086 0.5393 0.5037 -0.0047 -0.0300 -0.0410 200 ILE B O   
1041 C  CB  . ILE B 59 ? 0.5705 0.5923 0.5504 0.0017  -0.0231 -0.0355 200 ILE B CB  
1042 C  CG1 . ILE B 59 ? 0.5739 0.5910 0.5514 0.0023  -0.0189 -0.0304 200 ILE B CG1 
1043 C  CG2 . ILE B 59 ? 0.6101 0.6351 0.5812 0.0067  -0.0243 -0.0398 200 ILE B CG2 
1044 C  CD1 . ILE B 59 ? 0.7454 0.7630 0.7137 0.0059  -0.0167 -0.0268 200 ILE B CD1 
1045 N  N   . GLN B 60 ? 0.6063 0.6429 0.5863 0.0029  -0.0307 -0.0401 201 GLN B N   
1046 C  CA  . GLN B 60 ? 0.6454 0.6892 0.6303 0.0025  -0.0352 -0.0458 201 GLN B CA  
1047 C  C   . GLN B 60 ? 0.6741 0.7223 0.6492 0.0088  -0.0379 -0.0497 201 GLN B C   
1048 O  O   . GLN B 60 ? 0.6873 0.7369 0.6543 0.0128  -0.0373 -0.0463 201 GLN B O   
1049 C  CB  . GLN B 60 ? 0.6537 0.7022 0.6447 -0.0001 -0.0356 -0.0433 201 GLN B CB  
1050 C  CG  . GLN B 60 ? 0.7188 0.7740 0.7212 -0.0034 -0.0392 -0.0486 201 GLN B CG  
1051 C  CD  . GLN B 60 ? 0.7592 0.8100 0.7725 -0.0094 -0.0381 -0.0492 201 GLN B CD  
1052 O  OE1 . GLN B 60 ? 0.7970 0.8401 0.8089 -0.0107 -0.0351 -0.0454 201 GLN B OE1 
1053 N  NE2 . GLN B 60 ? 0.7560 0.8117 0.7810 -0.0131 -0.0407 -0.0539 201 GLN B NE2 
1054 N  N   . GLU B 63 ? 0.6922 0.7313 0.6296 0.0249  -0.0283 -0.0306 204 GLU B N   
1055 C  CA  . GLU B 63 ? 0.7145 0.7514 0.6594 0.0202  -0.0275 -0.0331 204 GLU B CA  
1056 C  C   . GLU B 63 ? 0.6706 0.7026 0.6233 0.0148  -0.0244 -0.0287 204 GLU B C   
1057 O  O   . GLU B 63 ? 0.6611 0.6923 0.6223 0.0103  -0.0248 -0.0305 204 GLU B O   
1058 C  CB  . GLU B 63 ? 0.7351 0.7689 0.6724 0.0235  -0.0253 -0.0344 204 GLU B CB  
1059 N  N   . LYS B 64 ? 0.6320 0.6605 0.5816 0.0154  -0.0217 -0.0231 205 LYS B N   
1060 C  CA  . LYS B 64 ? 0.5607 0.5855 0.5170 0.0109  -0.0198 -0.0195 205 LYS B CA  
1061 C  C   . LYS B 64 ? 0.3921 0.4201 0.3513 0.0099  -0.0215 -0.0184 205 LYS B C   
1062 O  O   . LYS B 64 ? 0.4744 0.5027 0.4283 0.0132  -0.0215 -0.0163 205 LYS B O   
1063 C  CB  . LYS B 64 ? 0.5938 0.6121 0.5467 0.0117  -0.0154 -0.0149 205 LYS B CB  
1064 N  N   . LYS B 65 ? 0.3110 0.3412 0.2786 0.0056  -0.0229 -0.0195 206 LYS B N   
1065 C  CA  . LYS B 65 ? 0.2492 0.2839 0.2203 0.0045  -0.0242 -0.0190 206 LYS B CA  
1066 C  C   . LYS B 65 ? 0.1624 0.1934 0.1377 0.0009  -0.0224 -0.0157 206 LYS B C   
1067 O  O   . LYS B 65 ? 0.1788 0.2074 0.1591 -0.0024 -0.0220 -0.0159 206 LYS B O   
1068 C  CB  . LYS B 65 ? 0.2636 0.3053 0.2421 0.0024  -0.0270 -0.0233 206 LYS B CB  
1069 C  CG  . LYS B 65 ? 0.3502 0.3964 0.3257 0.0058  -0.0299 -0.0282 206 LYS B CG  
1070 C  CD  . LYS B 65 ? 0.4488 0.4986 0.4171 0.0113  -0.0311 -0.0277 206 LYS B CD  
1071 C  CE  . LYS B 65 ? 0.5731 0.6291 0.5393 0.0148  -0.0352 -0.0333 206 LYS B CE  
1072 N  NZ  . LYS B 65 ? 0.6692 0.7273 0.6259 0.0216  -0.0365 -0.0323 206 LYS B NZ  
1073 N  N   . PRO B 66 ? 0.1907 0.2212 0.1636 0.0021  -0.0217 -0.0129 207 PRO B N   
1074 C  CA  . PRO B 66 ? 0.2127 0.2393 0.1871 -0.0001 -0.0204 -0.0099 207 PRO B CA  
1075 C  C   . PRO B 66 ? 0.1309 0.1609 0.1116 -0.0035 -0.0206 -0.0097 207 PRO B C   
1076 O  O   . PRO B 66 ? 0.1086 0.1447 0.0921 -0.0038 -0.0212 -0.0109 207 PRO B O   
1077 C  CB  . PRO B 66 ? 0.1237 0.1497 0.0931 0.0031  -0.0200 -0.0083 207 PRO B CB  
1078 C  CG  . PRO B 66 ? 0.1621 0.1940 0.1298 0.0060  -0.0214 -0.0102 207 PRO B CG  
1079 C  CD  . PRO B 66 ? 0.2038 0.2370 0.1714 0.0064  -0.0223 -0.0128 207 PRO B CD  
1080 N  N   . ILE B 67 ? 0.1472 0.1730 0.1303 -0.0061 -0.0200 -0.0080 208 ILE B N   
1081 C  CA  . ILE B 67 ? 0.2468 0.2745 0.2343 -0.0088 -0.0195 -0.0065 208 ILE B CA  
1082 C  C   . ILE B 67 ? 0.1463 0.1708 0.1308 -0.0084 -0.0190 -0.0034 208 ILE B C   
1083 O  O   . ILE B 67 ? 0.1609 0.1808 0.1424 -0.0072 -0.0193 -0.0030 208 ILE B O   
1084 C  CB  . ILE B 67 ? 0.2630 0.2891 0.2567 -0.0121 -0.0197 -0.0073 208 ILE B CB  
1085 C  CG1 . ILE B 67 ? 0.2073 0.2269 0.2007 -0.0125 -0.0195 -0.0056 208 ILE B CG1 
1086 C  CG2 . ILE B 67 ? 0.3459 0.3742 0.3413 -0.0116 -0.0210 -0.0116 208 ILE B CG2 
1087 C  CD1 . ILE B 67 ? 0.2273 0.2444 0.2271 -0.0155 -0.0195 -0.0056 208 ILE B CD1 
1088 N  N   . GLY B 68 ? 0.1452 0.1724 0.1309 -0.0095 -0.0180 -0.0015 209 GLY B N   
1089 C  CA  . GLY B 68 ? 0.1957 0.2208 0.1774 -0.0085 -0.0176 0.0011  209 GLY B CA  
1090 C  C   . GLY B 68 ? 0.1786 0.1982 0.1613 -0.0100 -0.0182 0.0030  209 GLY B C   
1091 O  O   . GLY B 68 ? 0.1555 0.1738 0.1434 -0.0125 -0.0179 0.0033  209 GLY B O   
1092 N  N   . TRP B 69 ? 0.1981 0.2144 0.1766 -0.0081 -0.0194 0.0037  210 TRP B N   
1093 C  CA  . TRP B 69 ? 0.2305 0.2422 0.2097 -0.0086 -0.0207 0.0054  210 TRP B CA  
1094 C  C   . TRP B 69 ? 0.2099 0.2217 0.1894 -0.0097 -0.0194 0.0091  210 TRP B C   
1095 O  O   . TRP B 69 ? 0.1958 0.2039 0.1779 -0.0107 -0.0200 0.0107  210 TRP B O   
1096 C  CB  . TRP B 69 ? 0.1433 0.1525 0.1183 -0.0061 -0.0230 0.0047  210 TRP B CB  
1097 C  CG  . TRP B 69 ? 0.2086 0.2154 0.1864 -0.0061 -0.0239 0.0021  210 TRP B CG  
1098 C  CD1 . TRP B 69 ? 0.2001 0.2065 0.1760 -0.0046 -0.0241 0.0001  210 TRP B CD1 
1099 C  CD2 . TRP B 69 ? 0.1356 0.1399 0.1187 -0.0073 -0.0243 0.0015  210 TRP B CD2 
1100 N  NE1 . TRP B 69 ? 0.2246 0.2284 0.2044 -0.0053 -0.0240 -0.0011 210 TRP B NE1 
1101 C  CE2 . TRP B 69 ? 0.1811 0.1841 0.1653 -0.0068 -0.0241 -0.0006 210 TRP B CE2 
1102 C  CE3 . TRP B 69 ? 0.1793 0.1821 0.1666 -0.0086 -0.0245 0.0025  210 TRP B CE3 
1103 C  CZ2 . TRP B 69 ? 0.1581 0.1593 0.1475 -0.0076 -0.0237 -0.0015 210 TRP B CZ2 
1104 C  CZ3 . TRP B 69 ? 0.2464 0.2473 0.2388 -0.0090 -0.0247 0.0010  210 TRP B CZ3 
1105 C  CH2 . TRP B 69 ? 0.2089 0.2095 0.2023 -0.0086 -0.0240 -0.0009 210 TRP B CH2 
1106 N  N   . ASP B 70 ? 0.1701 0.1860 0.1473 -0.0095 -0.0173 0.0107  211 ASP B N   
1107 C  CA  . ASP B 70 ? 0.2377 0.2532 0.2147 -0.0105 -0.0151 0.0152  211 ASP B CA  
1108 C  C   . ASP B 70 ? 0.2637 0.2808 0.2489 -0.0144 -0.0125 0.0160  211 ASP B C   
1109 O  O   . ASP B 70 ? 0.2497 0.2664 0.2363 -0.0159 -0.0097 0.0202  211 ASP B O   
1110 C  CB  . ASP B 70 ? 0.2972 0.3161 0.2669 -0.0078 -0.0135 0.0170  211 ASP B CB  
1111 C  CG  . ASP B 70 ? 0.4111 0.4273 0.3732 -0.0040 -0.0168 0.0158  211 ASP B CG  
1112 O  OD1 . ASP B 70 ? 0.4561 0.4675 0.4176 -0.0035 -0.0194 0.0166  211 ASP B OD1 
1113 O  OD2 . ASP B 70 ? 0.5180 0.5368 0.4755 -0.0015 -0.0173 0.0135  211 ASP B OD2 
1114 N  N   . THR B 71 ? 0.2073 0.2259 0.1979 -0.0159 -0.0134 0.0119  212 THR B N   
1115 C  CA  . THR B 71 ? 0.2534 0.2728 0.2529 -0.0197 -0.0123 0.0111  212 THR B CA  
1116 C  C   . THR B 71 ? 0.1709 0.1837 0.1741 -0.0217 -0.0117 0.0143  212 THR B C   
1117 O  O   . THR B 71 ? 0.1712 0.1785 0.1723 -0.0203 -0.0137 0.0147  212 THR B O   
1118 C  CB  . THR B 71 ? 0.1345 0.1545 0.1370 -0.0198 -0.0146 0.0057  212 THR B CB  
1119 O  OG1 . THR B 71 ? 0.2400 0.2652 0.2389 -0.0175 -0.0152 0.0032  212 THR B OG1 
1120 C  CG2 . THR B 71 ? 0.1565 0.1776 0.1685 -0.0234 -0.0141 0.0036  212 THR B CG2 
1121 N  N   . ASP B 72 ? 0.1629 0.1762 0.1728 -0.0251 -0.0090 0.0164  213 ASP B N   
1122 C  CA  . ASP B 72 ? 0.1942 0.2000 0.2087 -0.0270 -0.0087 0.0188  213 ASP B CA  
1123 C  C   . ASP B 72 ? 0.1828 0.1859 0.2032 -0.0281 -0.0114 0.0134  213 ASP B C   
1124 O  O   . ASP B 72 ? 0.1993 0.2064 0.2258 -0.0302 -0.0117 0.0088  213 ASP B O   
1125 C  CB  . ASP B 72 ? 0.2393 0.2450 0.2605 -0.0308 -0.0045 0.0229  213 ASP B CB  
1126 C  CG  . ASP B 72 ? 0.2847 0.2810 0.3100 -0.0323 -0.0039 0.0264  213 ASP B CG  
1127 O  OD1 . ASP B 72 ? 0.2625 0.2539 0.2910 -0.0322 -0.0068 0.0230  213 ASP B OD1 
1128 O  OD2 . ASP B 72 ? 0.4557 0.4493 0.4808 -0.0333 -0.0001 0.0329  213 ASP B OD2 
1129 N  N   . ILE B 73 ? 0.1696 0.1665 0.1877 -0.0261 -0.0135 0.0137  214 ILE B N   
1130 C  CA  . ILE B 73 ? 0.2349 0.2295 0.2566 -0.0258 -0.0158 0.0086  214 ILE B CA  
1131 C  C   . ILE B 73 ? 0.1766 0.1686 0.2081 -0.0295 -0.0152 0.0063  214 ILE B C   
1132 O  O   . ILE B 73 ? 0.1523 0.1448 0.1874 -0.0297 -0.0169 0.0005  214 ILE B O   
1133 C  CB  . ILE B 73 ? 0.2282 0.2171 0.2468 -0.0228 -0.0177 0.0100  214 ILE B CB  
1134 C  CG1 . ILE B 73 ? 0.3098 0.2965 0.3325 -0.0223 -0.0194 0.0050  214 ILE B CG1 
1135 C  CG2 . ILE B 73 ? 0.2803 0.2622 0.3011 -0.0233 -0.0168 0.0152  214 ILE B CG2 
1136 C  CD1 . ILE B 73 ? 0.1843 0.1745 0.2032 -0.0199 -0.0206 0.0014  214 ILE B CD1 
1137 N  N   . SER B 74 ? 0.1987 0.1876 0.2347 -0.0322 -0.0127 0.0108  215 SER B N   
1138 C  CA  . SER B 74 ? 0.2346 0.2196 0.2816 -0.0361 -0.0120 0.0088  215 SER B CA  
1139 C  C   . SER B 74 ? 0.1563 0.1488 0.2098 -0.0389 -0.0127 0.0023  215 SER B C   
1140 O  O   . SER B 74 ? 0.1562 0.1468 0.2179 -0.0411 -0.0141 -0.0029 215 SER B O   
1141 C  CB  . SER B 74 ? 0.2074 0.1871 0.2584 -0.0389 -0.0082 0.0160  215 SER B CB  
1142 O  OG  . SER B 74 ? 0.3080 0.2948 0.3578 -0.0403 -0.0051 0.0191  215 SER B OG  
1143 N  N   . TRP B 75 ? 0.1081 0.1093 0.1578 -0.0382 -0.0122 0.0020  216 TRP B N   
1144 C  CA  . TRP B 75 ? 0.1721 0.1815 0.2269 -0.0395 -0.0138 -0.0046 216 TRP B CA  
1145 C  C   . TRP B 75 ? 0.2560 0.2660 0.3078 -0.0367 -0.0177 -0.0117 216 TRP B C   
1146 O  O   . TRP B 75 ? 0.2470 0.2619 0.3035 -0.0376 -0.0199 -0.0182 216 TRP B O   
1147 C  CB  . TRP B 75 ? 0.2295 0.2481 0.2805 -0.0385 -0.0125 -0.0032 216 TRP B CB  
1148 C  CG  . TRP B 75 ? 0.1969 0.2166 0.2518 -0.0414 -0.0080 0.0030  216 TRP B CG  
1149 C  CD1 . TRP B 75 ? 0.2332 0.2510 0.2802 -0.0395 -0.0051 0.0101  216 TRP B CD1 
1150 C  CD2 . TRP B 75 ? 0.1411 0.1643 0.2088 -0.0465 -0.0055 0.0028  216 TRP B CD2 
1151 N  NE1 . TRP B 75 ? 0.3023 0.3218 0.3552 -0.0428 -0.0005 0.0149  216 TRP B NE1 
1152 C  CE2 . TRP B 75 ? 0.2411 0.2638 0.3077 -0.0475 -0.0003 0.0108  216 TRP B CE2 
1153 C  CE3 . TRP B 75 ? 0.0883 0.1146 0.1687 -0.0503 -0.0072 -0.0035 216 TRP B CE3 
1154 C  CZ2 . TRP B 75 ? 0.2798 0.3056 0.3583 -0.0525 0.0041  0.0132  216 TRP B CZ2 
1155 C  CZ3 . TRP B 75 ? 0.2248 0.2543 0.3183 -0.0557 -0.0036 -0.0018 216 TRP B CZ3 
1156 C  CH2 . TRP B 75 ? 0.2617 0.2908 0.3545 -0.0569 0.0025  0.0068  216 TRP B CH2 
1157 N  N   . LEU B 76 ? 0.1401 0.1451 0.1845 -0.0333 -0.0185 -0.0106 217 LEU B N   
1158 C  CA  . LEU B 76 ? 0.2157 0.2214 0.2555 -0.0301 -0.0210 -0.0160 217 LEU B CA  
1159 C  C   . LEU B 76 ? 0.1748 0.1735 0.2182 -0.0298 -0.0222 -0.0194 217 LEU B C   
1160 O  O   . LEU B 76 ? 0.1853 0.1840 0.2243 -0.0266 -0.0234 -0.0231 217 LEU B O   
1161 C  CB  . LEU B 76 ? 0.2263 0.2329 0.2559 -0.0262 -0.0207 -0.0131 217 LEU B CB  
1162 C  CG  . LEU B 76 ? 0.2513 0.2636 0.2767 -0.0258 -0.0196 -0.0100 217 LEU B CG  
1163 C  CD1 . LEU B 76 ? 0.2413 0.2527 0.2580 -0.0225 -0.0193 -0.0069 217 LEU B CD1 
1164 C  CD2 . LEU B 76 ? 0.2568 0.2770 0.2830 -0.0255 -0.0207 -0.0143 217 LEU B CD2 
1165 N  N   . THR B 77 ? 0.2259 0.2187 0.2771 -0.0328 -0.0214 -0.0177 218 THR B N   
1166 C  CA  . THR B 77 ? 0.2234 0.2088 0.2793 -0.0326 -0.0224 -0.0210 218 THR B CA  
1167 C  C   . THR B 77 ? 0.3266 0.3152 0.3829 -0.0313 -0.0250 -0.0297 218 THR B C   
1168 O  O   . THR B 77 ? 0.3528 0.3474 0.4123 -0.0330 -0.0263 -0.0340 218 THR B O   
1169 C  CB  . THR B 77 ? 0.3539 0.3329 0.4206 -0.0370 -0.0214 -0.0195 218 THR B CB  
1170 O  OG1 . THR B 77 ? 0.3136 0.2888 0.3787 -0.0377 -0.0187 -0.0106 218 THR B OG1 
1171 C  CG2 . THR B 77 ? 0.4139 0.3847 0.4854 -0.0362 -0.0229 -0.0237 218 THR B CG2 
1172 N  N   . GLY B 78 ? 0.3165 0.3019 0.3697 -0.0278 -0.0257 -0.0327 219 GLY B N   
1173 C  CA  . GLY B 78 ? 0.3498 0.3382 0.4008 -0.0254 -0.0278 -0.0408 219 GLY B CA  
1174 C  C   . GLY B 78 ? 0.3378 0.3334 0.3784 -0.0217 -0.0277 -0.0415 219 GLY B C   
1175 O  O   . GLY B 78 ? 0.3877 0.3856 0.4239 -0.0184 -0.0288 -0.0472 219 GLY B O   
1176 N  N   . GLU B 79 ? 0.2503 0.2492 0.2866 -0.0218 -0.0263 -0.0357 220 GLU B N   
1177 C  CA  . GLU B 79 ? 0.2483 0.2531 0.2752 -0.0184 -0.0262 -0.0358 220 GLU B CA  
1178 C  C   . GLU B 79 ? 0.2038 0.2061 0.2244 -0.0152 -0.0240 -0.0328 220 GLU B C   
1179 O  O   . GLU B 79 ? 0.2952 0.2924 0.3189 -0.0155 -0.0230 -0.0301 220 GLU B O   
1180 C  CB  . GLU B 79 ? 0.3460 0.3559 0.3717 -0.0199 -0.0259 -0.0322 220 GLU B CB  
1181 C  CG  . GLU B 79 ? 0.4717 0.4873 0.5030 -0.0222 -0.0281 -0.0362 220 GLU B CG  
1182 C  CD  . GLU B 79 ? 0.6455 0.6686 0.6701 -0.0186 -0.0300 -0.0401 220 GLU B CD  
1183 O  OE1 . GLU B 79 ? 0.6793 0.7035 0.6950 -0.0154 -0.0287 -0.0368 220 GLU B OE1 
1184 O  OE2 . GLU B 79 ? 0.7045 0.7320 0.7329 -0.0189 -0.0330 -0.0464 220 GLU B OE2 
1185 N  N   . GLU B 80 ? 0.1995 0.2056 0.2121 -0.0119 -0.0233 -0.0333 221 GLU B N   
1186 C  CA  . GLU B 80 ? 0.2030 0.2077 0.2106 -0.0093 -0.0207 -0.0302 221 GLU B CA  
1187 C  C   . GLU B 80 ? 0.2114 0.2186 0.2147 -0.0094 -0.0201 -0.0255 221 GLU B C   
1188 O  O   . GLU B 80 ? 0.2778 0.2893 0.2773 -0.0086 -0.0210 -0.0264 221 GLU B O   
1189 C  CB  . GLU B 80 ? 0.2592 0.2655 0.2604 -0.0052 -0.0195 -0.0337 221 GLU B CB  
1190 C  CG  . GLU B 80 ? 0.4410 0.4445 0.4456 -0.0042 -0.0196 -0.0386 221 GLU B CG  
1191 C  CD  . GLU B 80 ? 0.5150 0.5208 0.5121 0.0003  -0.0186 -0.0431 221 GLU B CD  
1192 O  OE1 . GLU B 80 ? 0.5273 0.5367 0.5161 0.0027  -0.0180 -0.0423 221 GLU B OE1 
1193 O  OE2 . GLU B 80 ? 0.6314 0.6350 0.6305 0.0018  -0.0183 -0.0474 221 GLU B OE2 
1194 N  N   . LEU B 81 ? 0.1412 0.1458 0.1456 -0.0100 -0.0189 -0.0210 222 LEU B N   
1195 C  CA  . LEU B 81 ? 0.1561 0.1622 0.1565 -0.0096 -0.0183 -0.0172 222 LEU B CA  
1196 C  C   . LEU B 81 ? 0.1695 0.1744 0.1667 -0.0073 -0.0159 -0.0160 222 LEU B C   
1197 O  O   . LEU B 81 ? 0.1718 0.1749 0.1717 -0.0066 -0.0146 -0.0171 222 LEU B O   
1198 C  CB  . LEU B 81 ? 0.1819 0.1860 0.1857 -0.0118 -0.0191 -0.0133 222 LEU B CB  
1199 C  CG  . LEU B 81 ? 0.2155 0.2202 0.2230 -0.0144 -0.0203 -0.0132 222 LEU B CG  
1200 C  CD1 . LEU B 81 ? 0.1941 0.1964 0.2032 -0.0158 -0.0204 -0.0087 222 LEU B CD1 
1201 C  CD2 . LEU B 81 ? 0.1886 0.1987 0.1935 -0.0144 -0.0207 -0.0148 222 LEU B CD2 
1202 N  N   . HIS B 82 ? 0.1108 0.1168 0.1032 -0.0063 -0.0151 -0.0137 223 HIS B N   
1203 C  CA  . HIS B 82 ? 0.1402 0.1447 0.1311 -0.0048 -0.0124 -0.0120 223 HIS B CA  
1204 C  C   . HIS B 82 ? 0.1342 0.1376 0.1255 -0.0058 -0.0131 -0.0089 223 HIS B C   
1205 O  O   . HIS B 82 ? 0.1725 0.1773 0.1606 -0.0058 -0.0145 -0.0082 223 HIS B O   
1206 C  CB  . HIS B 82 ? 0.2292 0.2349 0.2127 -0.0018 -0.0105 -0.0126 223 HIS B CB  
1207 C  CG  . HIS B 82 ? 0.3635 0.3702 0.3450 0.0001  -0.0096 -0.0160 223 HIS B CG  
1208 N  ND1 . HIS B 82 ? 0.4300 0.4387 0.4125 -0.0002 -0.0124 -0.0200 223 HIS B ND1 
1209 C  CD2 . HIS B 82 ? 0.3462 0.3522 0.3247 0.0027  -0.0061 -0.0163 223 HIS B CD2 
1210 C  CE1 . HIS B 82 ? 0.3132 0.3223 0.2929 0.0023  -0.0111 -0.0232 223 HIS B CE1 
1211 N  NE2 . HIS B 82 ? 0.3207 0.3284 0.2974 0.0043  -0.0071 -0.0208 223 HIS B NE2 
1212 N  N   . VAL B 83 ? 0.1209 0.1224 0.1163 -0.0062 -0.0121 -0.0076 224 VAL B N   
1213 C  CA  . VAL B 83 ? 0.1105 0.1108 0.1067 -0.0070 -0.0134 -0.0057 224 VAL B CA  
1214 C  C   . VAL B 83 ? 0.1759 0.1745 0.1718 -0.0061 -0.0103 -0.0046 224 VAL B C   
1215 O  O   . VAL B 83 ? 0.1535 0.1518 0.1533 -0.0060 -0.0076 -0.0048 224 VAL B O   
1216 C  CB  . VAL B 83 ? 0.2003 0.1997 0.2030 -0.0083 -0.0156 -0.0054 224 VAL B CB  
1217 C  CG1 . VAL B 83 ? 0.1788 0.1773 0.1822 -0.0085 -0.0173 -0.0044 224 VAL B CG1 
1218 C  CG2 . VAL B 83 ? 0.1374 0.1372 0.1403 -0.0091 -0.0181 -0.0053 224 VAL B CG2 
1219 N  N   . GLU B 84 ? 0.1864 0.1839 0.1783 -0.0055 -0.0105 -0.0034 225 GLU B N   
1220 C  CA  . GLU B 84 ? 0.2340 0.2286 0.2259 -0.0049 -0.0075 -0.0019 225 GLU B CA  
1221 C  C   . GLU B 84 ? 0.1826 0.1752 0.1775 -0.0060 -0.0098 -0.0018 225 GLU B C   
1222 O  O   . GLU B 84 ? 0.1305 0.1241 0.1231 -0.0060 -0.0131 -0.0025 225 GLU B O   
1223 C  CB  . GLU B 84 ? 0.2414 0.2353 0.2247 -0.0022 -0.0057 -0.0007 225 GLU B CB  
1224 C  CG  . GLU B 84 ? 0.4353 0.4302 0.4151 -0.0004 -0.0026 -0.0008 225 GLU B CG  
1225 C  CD  . GLU B 84 ? 0.5931 0.5877 0.5633 0.0031  -0.0016 0.0003  225 GLU B CD  
1226 O  OE1 . GLU B 84 ? 0.5964 0.5894 0.5636 0.0041  -0.0026 0.0016  225 GLU B OE1 
1227 O  OE2 . GLU B 84 ? 0.6569 0.6531 0.6224 0.0054  0.0000  -0.0003 225 GLU B OE2 
1228 N  N   . VAL B 85 ? 0.2031 0.1930 0.2035 -0.0070 -0.0077 -0.0013 226 VAL B N   
1229 C  CA  . VAL B 85 ? 0.1610 0.1489 0.1651 -0.0080 -0.0103 -0.0022 226 VAL B CA  
1230 C  C   . VAL B 85 ? 0.1654 0.1500 0.1621 -0.0062 -0.0097 -0.0011 226 VAL B C   
1231 O  O   . VAL B 85 ? 0.1430 0.1258 0.1352 -0.0046 -0.0060 0.0010  226 VAL B O   
1232 C  CB  . VAL B 85 ? 0.1850 0.1715 0.1995 -0.0102 -0.0081 -0.0024 226 VAL B CB  
1233 C  CG1 . VAL B 85 ? 0.2320 0.2159 0.2517 -0.0114 -0.0108 -0.0041 226 VAL B CG1 
1234 C  CG2 . VAL B 85 ? 0.2343 0.2250 0.2562 -0.0112 -0.0091 -0.0037 226 VAL B CG2 
1235 N  N   . LEU B 86 ? 0.1340 0.1180 0.1288 -0.0057 -0.0134 -0.0026 227 LEU B N   
1236 C  CA  . LEU B 86 ? 0.1979 0.1787 0.1867 -0.0034 -0.0130 -0.0020 227 LEU B CA  
1237 C  C   . LEU B 86 ? 0.2252 0.1994 0.2178 -0.0040 -0.0096 -0.0007 227 LEU B C   
1238 O  O   . LEU B 86 ? 0.1856 0.1584 0.1873 -0.0066 -0.0088 -0.0013 227 LEU B O   
1239 C  CB  . LEU B 86 ? 0.2322 0.2135 0.2187 -0.0026 -0.0173 -0.0044 227 LEU B CB  
1240 C  CG  . LEU B 86 ? 0.2200 0.2069 0.2015 -0.0016 -0.0197 -0.0048 227 LEU B CG  
1241 C  CD1 . LEU B 86 ? 0.2760 0.2631 0.2552 -0.0005 -0.0234 -0.0070 227 LEU B CD1 
1242 C  CD2 . LEU B 86 ? 0.1554 0.1447 0.1305 0.0004  -0.0179 -0.0033 227 LEU B CD2 
1243 N  N   . GLU B 87 ? 0.1641 0.1345 0.1505 -0.0014 -0.0076 0.0013  228 GLU B N   
1244 C  CA  . GLU B 87 ? 0.2133 0.1760 0.2031 -0.0017 -0.0044 0.0030  228 GLU B CA  
1245 C  C   . GLU B 87 ? 0.2016 0.1615 0.1992 -0.0039 -0.0077 -0.0006 228 GLU B C   
1246 O  O   . GLU B 87 ? 0.1548 0.1171 0.1504 -0.0031 -0.0125 -0.0039 228 GLU B O   
1247 C  CB  . GLU B 87 ? 0.2730 0.2315 0.2538 0.0024  -0.0030 0.0053  228 GLU B CB  
1248 C  CG  . GLU B 87 ? 0.4284 0.3889 0.4014 0.0052  0.0002  0.0088  228 GLU B CG  
1249 C  CD  . GLU B 87 ? 0.5162 0.4736 0.4927 0.0038  0.0060  0.0122  228 GLU B CD  
1250 O  OE1 . GLU B 87 ? 0.5757 0.5254 0.5518 0.0047  0.0099  0.0157  228 GLU B OE1 
1251 O  OE2 . GLU B 87 ? 0.4163 0.3786 0.3960 0.0019  0.0068  0.0116  228 GLU B OE2 
1252 N  N   . ASN B 88 ? 0.1983 0.1534 0.2052 -0.0067 -0.0049 0.0000  229 ASN B N   
1253 C  CA  . ASN B 88 ? 0.1980 0.1508 0.2148 -0.0093 -0.0083 -0.0042 229 ASN B CA  
1254 C  C   . ASN B 88 ? 0.2642 0.2089 0.2781 -0.0074 -0.0087 -0.0048 229 ASN B C   
1255 O  O   . ASN B 88 ? 0.2482 0.1853 0.2655 -0.0081 -0.0041 -0.0018 229 ASN B O   
1256 C  CB  . ASN B 88 ? 0.2864 0.2382 0.3165 -0.0135 -0.0044 -0.0032 229 ASN B CB  
1257 C  CG  . ASN B 88 ? 0.3094 0.2615 0.3526 -0.0168 -0.0088 -0.0086 229 ASN B CG  
1258 O  OD1 . ASN B 88 ? 0.2894 0.2408 0.3305 -0.0157 -0.0145 -0.0130 229 ASN B OD1 
1259 N  ND2 . ASN B 88 ? 0.3662 0.3200 0.4231 -0.0207 -0.0062 -0.0086 229 ASN B ND2 
1260 N  N   . VAL B 89 ? 0.1906 0.1369 0.1975 -0.0046 -0.0135 -0.0080 230 VAL B N   
1261 C  CA  . VAL B 89 ? 0.2128 0.1520 0.2159 -0.0018 -0.0145 -0.0093 230 VAL B CA  
1262 C  C   . VAL B 89 ? 0.2320 0.1733 0.2353 -0.0012 -0.0210 -0.0157 230 VAL B C   
1263 O  O   . VAL B 89 ? 0.2012 0.1500 0.1992 0.0000  -0.0241 -0.0171 230 VAL B O   
1264 C  CB  . VAL B 89 ? 0.2565 0.1960 0.2471 0.0031  -0.0129 -0.0061 230 VAL B CB  
1265 C  CG1 . VAL B 89 ? 0.2050 0.1358 0.1926 0.0065  -0.0131 -0.0069 230 VAL B CG1 
1266 C  CG2 . VAL B 89 ? 0.3131 0.2534 0.3007 0.0034  -0.0076 -0.0003 230 VAL B CG2 
1267 N  N   . PRO B 90 ? 0.2455 0.1798 0.2548 -0.0018 -0.0230 -0.0197 231 PRO B N   
1268 C  CA  . PRO B 90 ? 0.2737 0.2106 0.2830 -0.0010 -0.0298 -0.0267 231 PRO B CA  
1269 C  C   . PRO B 90 ? 0.2467 0.1885 0.2428 0.0040  -0.0324 -0.0278 231 PRO B C   
1270 O  O   . PRO B 90 ? 0.2013 0.1416 0.1896 0.0074  -0.0298 -0.0250 231 PRO B O   
1271 C  CB  . PRO B 90 ? 0.2873 0.2142 0.3033 -0.0014 -0.0309 -0.0306 231 PRO B CB  
1272 C  CG  . PRO B 90 ? 0.3429 0.2633 0.3677 -0.0050 -0.0243 -0.0253 231 PRO B CG  
1273 C  CD  . PRO B 90 ? 0.2431 0.1666 0.2581 -0.0027 -0.0195 -0.0183 231 PRO B CD  
1274 N  N   . LEU B 91 ? 0.2655 0.2134 0.2596 0.0047  -0.0374 -0.0320 232 LEU B N   
1275 C  CA  . LEU B 91 ? 0.3226 0.2744 0.3052 0.0094  -0.0398 -0.0339 232 LEU B CA  
1276 C  C   . LEU B 91 ? 0.2624 0.2080 0.2433 0.0126  -0.0428 -0.0397 232 LEU B C   
1277 O  O   . LEU B 91 ? 0.2720 0.2103 0.2618 0.0106  -0.0443 -0.0434 232 LEU B O   
1278 C  CB  . LEU B 91 ? 0.3349 0.2948 0.3151 0.0093  -0.0434 -0.0353 232 LEU B CB  
1279 C  CG  . LEU B 91 ? 0.4080 0.3734 0.3904 0.0064  -0.0409 -0.0301 232 LEU B CG  
1280 C  CD1 . LEU B 91 ? 0.4090 0.3809 0.3889 0.0069  -0.0450 -0.0316 232 LEU B CD1 
1281 C  CD2 . LEU B 91 ? 0.3896 0.3579 0.3655 0.0076  -0.0362 -0.0247 232 LEU B CD2 
1282 N  N   . THR B 92 ? 0.2688 0.2171 0.2391 0.0176  -0.0435 -0.0411 233 THR B N   
1283 C  CA  . THR B 92 ? 0.3009 0.2434 0.2689 0.0213  -0.0464 -0.0472 233 THR B CA  
1284 C  C   . THR B 92 ? 0.3258 0.2679 0.2973 0.0208  -0.0529 -0.0548 233 THR B C   
1285 O  O   . THR B 92 ? 0.3948 0.3298 0.3694 0.0219  -0.0559 -0.0610 233 THR B O   
1286 C  CB  . THR B 92 ? 0.3256 0.2724 0.2816 0.0274  -0.0457 -0.0475 233 THR B CB  
1287 O  OG1 . THR B 92 ? 0.3672 0.3237 0.3164 0.0284  -0.0473 -0.0474 233 THR B OG1 
1288 C  CG2 . THR B 92 ? 0.2263 0.1738 0.1797 0.0286  -0.0403 -0.0410 233 THR B CG2 
1289 N  N   . THR B 93 ? 0.4292 0.3788 0.4004 0.0192  -0.0552 -0.0545 234 THR B N   
1290 C  CA  . THR B 93 ? 0.5331 0.4841 0.5062 0.0195  -0.0620 -0.0614 234 THR B CA  
1291 C  C   . THR B 93 ? 0.5921 0.5387 0.5810 0.0140  -0.0640 -0.0640 234 THR B C   
1292 O  O   . THR B 93 ? 0.6487 0.5954 0.6422 0.0139  -0.0703 -0.0711 234 THR B O   
1293 C  CB  . THR B 93 ? 0.4495 0.4103 0.4146 0.0210  -0.0639 -0.0596 234 THR B CB  
1294 O  OG1 . THR B 93 ? 0.4425 0.4072 0.4101 0.0176  -0.0593 -0.0518 234 THR B OG1 
1295 C  CG2 . THR B 93 ? 0.4684 0.4332 0.4186 0.0270  -0.0633 -0.0597 234 THR B CG2 
1296 N  N   . HIS B 94 ? 0.5932 0.5363 0.5906 0.0097  -0.0586 -0.0585 235 HIS B N   
1297 C  CA  . HIS B 94 ? 0.6330 0.5717 0.6468 0.0043  -0.0592 -0.0605 235 HIS B CA  
1298 C  C   . HIS B 94 ? 0.7632 0.6917 0.7830 0.0044  -0.0609 -0.0665 235 HIS B C   
1299 O  O   . HIS B 94 ? 0.8580 0.7842 0.8897 0.0016  -0.0654 -0.0729 235 HIS B O   
1300 C  CB  . HIS B 94 ? 0.6100 0.5481 0.6302 0.0001  -0.0520 -0.0523 235 HIS B CB  
1301 C  CG  . HIS B 94 ? 0.6075 0.5548 0.6250 -0.0008 -0.0510 -0.0478 235 HIS B CG  
1302 N  ND1 . HIS B 94 ? 0.5404 0.4889 0.5584 -0.0028 -0.0447 -0.0404 235 HIS B ND1 
1303 C  CD2 . HIS B 94 ? 0.6183 0.5736 0.6319 0.0006  -0.0556 -0.0497 235 HIS B CD2 
1304 C  CE1 . HIS B 94 ? 0.5486 0.5051 0.5643 -0.0030 -0.0455 -0.0384 235 HIS B CE1 
1305 N  NE2 . HIS B 94 ? 0.5721 0.5325 0.5850 -0.0010 -0.0520 -0.0435 235 HIS B NE2 
1306 N  N   . MSE C 11 ? 0.9841 0.8554 0.9360 -0.0082 0.0186  0.0082  152 MSE C N   
1307 C  CA  . MSE C 11 ? 0.9541 0.8328 0.9089 -0.0061 0.0163  -0.0024 152 MSE C CA  
1308 C  C   . MSE C 11 ? 0.9596 0.8235 0.9174 -0.0052 0.0138  -0.0100 152 MSE C C   
1309 O  O   . MSE C 11 ? 0.9624 0.8178 0.9253 -0.0130 0.0139  -0.0124 152 MSE C O   
1310 C  CB  . MSE C 11 ? 0.9024 0.7936 0.8525 0.0027  0.0148  -0.0031 152 MSE C CB  
1311 C  CG  . MSE C 11 ? 0.9433 0.8513 0.8913 0.0007  0.0167  0.0010  152 MSE C CG  
1312 SE SE  . MSE C 11 ? 0.9248 0.8500 0.8800 -0.0043 0.0161  -0.0071 152 MSE C SE  
1313 C  CE  . MSE C 11 ? 0.5130 0.4480 0.4698 -0.0127 0.0217  -0.0020 152 MSE C CE  
1314 N  N   . GLN C 12 ? 0.9462 0.8081 0.9008 0.0039  0.0116  -0.0145 153 GLN C N   
1315 C  CA  . GLN C 12 ? 0.9307 0.7805 0.8868 0.0056  0.0095  -0.0242 153 GLN C CA  
1316 C  C   . GLN C 12 ? 0.8796 0.7388 0.8386 -0.0004 0.0073  -0.0337 153 GLN C C   
1317 O  O   . GLN C 12 ? 0.9493 0.8045 0.9073 0.0012  0.0050  -0.0433 153 GLN C O   
1318 C  CB  . GLN C 12 ? 0.9470 0.7734 0.9061 0.0032  0.0101  -0.0222 153 GLN C CB  
1319 C  CG  . GLN C 12 ? 0.9603 0.7761 0.9174 0.0123  0.0107  -0.0148 153 GLN C CG  
1320 C  CD  . GLN C 12 ? 0.9810 0.7710 0.9421 0.0127  0.0103  -0.0162 153 GLN C CD  
1321 O  OE1 . GLN C 12 ? 1.0173 0.7964 0.9823 0.0031  0.0103  -0.0174 153 GLN C OE1 
1322 N  NE2 . GLN C 12 ? 0.9508 0.7307 0.9124 0.0238  0.0099  -0.0163 153 GLN C NE2 
1323 N  N   . LYS C 13 ? 0.6999 0.5721 0.6626 -0.0071 0.0078  -0.0310 154 LYS C N   
1324 C  CA  . LYS C 13 ? 0.5352 0.4230 0.5004 -0.0096 0.0051  -0.0367 154 LYS C CA  
1325 C  C   . LYS C 13 ? 0.4557 0.3601 0.4194 -0.0063 0.0062  -0.0312 154 LYS C C   
1326 O  O   . LYS C 13 ? 0.3575 0.2655 0.3235 -0.0096 0.0092  -0.0250 154 LYS C O   
1327 C  CB  . LYS C 13 ? 0.6257 0.5154 0.5997 -0.0199 0.0045  -0.0386 154 LYS C CB  
1328 C  CG  . LYS C 13 ? 0.6737 0.5545 0.6499 -0.0245 0.0013  -0.0472 154 LYS C CG  
1329 C  CD  . LYS C 13 ? 0.7366 0.6197 0.7231 -0.0354 0.0012  -0.0472 154 LYS C CD  
1330 C  CE  . LYS C 13 ? 0.7680 0.6448 0.7569 -0.0413 -0.0030 -0.0564 154 LYS C CE  
1331 N  NZ  . LYS C 13 ? 0.7442 0.6255 0.7445 -0.0523 -0.0036 -0.0564 154 LYS C NZ  
1332 N  N   . PRO C 14 ? 0.4199 0.3346 0.3794 -0.0004 0.0040  -0.0337 155 PRO C N   
1333 C  CA  . PRO C 14 ? 0.2991 0.2285 0.2576 0.0020  0.0049  -0.0286 155 PRO C CA  
1334 C  C   . PRO C 14 ? 0.2799 0.2209 0.2468 -0.0045 0.0041  -0.0288 155 PRO C C   
1335 O  O   . PRO C 14 ? 0.2547 0.2010 0.2255 -0.0070 0.0004  -0.0335 155 PRO C O   
1336 C  CB  . PRO C 14 ? 0.2970 0.2339 0.2499 0.0087  0.0024  -0.0318 155 PRO C CB  
1337 C  CG  . PRO C 14 ? 0.3894 0.3224 0.3424 0.0068  -0.0006 -0.0402 155 PRO C CG  
1338 C  CD  . PRO C 14 ? 0.3665 0.2829 0.3232 0.0019  0.0005  -0.0420 155 PRO C CD  
1339 N  N   . ILE C 15 ? 0.3154 0.2605 0.2853 -0.0072 0.0075  -0.0239 156 ILE C N   
1340 C  CA  . ILE C 15 ? 0.2880 0.2445 0.2678 -0.0121 0.0077  -0.0244 156 ILE C CA  
1341 C  C   . ILE C 15 ? 0.3360 0.3026 0.3156 -0.0107 0.0102  -0.0208 156 ILE C C   
1342 O  O   . ILE C 15 ? 0.3496 0.3150 0.3210 -0.0075 0.0123  -0.0170 156 ILE C O   
1343 C  CB  . ILE C 15 ? 0.4270 0.3795 0.4155 -0.0199 0.0104  -0.0250 156 ILE C CB  
1344 C  CG1 . ILE C 15 ? 0.4357 0.3805 0.4194 -0.0217 0.0157  -0.0200 156 ILE C CG1 
1345 C  CG2 . ILE C 15 ? 0.3827 0.3275 0.3737 -0.0229 0.0070  -0.0297 156 ILE C CG2 
1346 C  CD1 . ILE C 15 ? 0.5019 0.4563 0.4898 -0.0254 0.0207  -0.0177 156 ILE C CD1 
1347 N  N   . VAL C 16 ? 0.2404 0.2171 0.2298 -0.0132 0.0095  -0.0223 157 VAL C N   
1348 C  CA  . VAL C 16 ? 0.2501 0.2352 0.2411 -0.0128 0.0120  -0.0206 157 VAL C CA  
1349 C  C   . VAL C 16 ? 0.2200 0.2095 0.2241 -0.0182 0.0153  -0.0228 157 VAL C C   
1350 O  O   . VAL C 16 ? 0.2599 0.2514 0.2748 -0.0206 0.0127  -0.0253 157 VAL C O   
1351 C  CB  . VAL C 16 ? 0.3452 0.3388 0.3371 -0.0092 0.0073  -0.0204 157 VAL C CB  
1352 C  CG1 . VAL C 16 ? 0.3118 0.3135 0.3110 -0.0103 0.0091  -0.0203 157 VAL C CG1 
1353 C  CG2 . VAL C 16 ? 0.3372 0.3296 0.3163 -0.0036 0.0056  -0.0181 157 VAL C CG2 
1354 N  N   . ARG C 17 ? 0.2169 0.2090 0.2202 -0.0204 0.0211  -0.0223 158 ARG C N   
1355 C  CA  . ARG C 17 ? 0.3093 0.3079 0.3257 -0.0250 0.0256  -0.0257 158 ARG C CA  
1356 C  C   . ARG C 17 ? 0.3001 0.3071 0.3255 -0.0230 0.0246  -0.0281 158 ARG C C   
1357 O  O   . ARG C 17 ? 0.3439 0.3528 0.3620 -0.0207 0.0248  -0.0271 158 ARG C O   
1358 C  CB  . ARG C 17 ? 0.2813 0.2797 0.2918 -0.0293 0.0330  -0.0248 158 ARG C CB  
1359 C  CG  . ARG C 17 ? 0.3760 0.3646 0.3777 -0.0314 0.0336  -0.0207 158 ARG C CG  
1360 C  CD  . ARG C 17 ? 0.5077 0.4976 0.5027 -0.0365 0.0405  -0.0181 158 ARG C CD  
1361 N  NE  . ARG C 17 ? 0.5478 0.5413 0.5314 -0.0341 0.0414  -0.0158 158 ARG C NE  
1362 C  CZ  . ARG C 17 ? 0.7058 0.6936 0.6775 -0.0293 0.0376  -0.0106 158 ARG C CZ  
1363 N  NH1 . ARG C 17 ? 0.7211 0.6986 0.6912 -0.0261 0.0334  -0.0083 158 ARG C NH1 
1364 N  NH2 . ARG C 17 ? 0.7755 0.7687 0.7380 -0.0277 0.0381  -0.0084 158 ARG C NH2 
1365 N  N   . VAL C 18 ? 0.2904 0.3025 0.3328 -0.0241 0.0233  -0.0310 159 VAL C N   
1366 C  CA  . VAL C 18 ? 0.2502 0.2682 0.3036 -0.0216 0.0208  -0.0323 159 VAL C CA  
1367 C  C   . VAL C 18 ? 0.2363 0.2604 0.3066 -0.0240 0.0264  -0.0374 159 VAL C C   
1368 O  O   . VAL C 18 ? 0.2754 0.3027 0.3587 -0.0262 0.0271  -0.0392 159 VAL C O   
1369 C  CB  . VAL C 18 ? 0.2505 0.2702 0.3112 -0.0194 0.0123  -0.0299 159 VAL C CB  
1370 C  CG1 . VAL C 18 ? 0.2045 0.2295 0.2775 -0.0168 0.0091  -0.0293 159 VAL C CG1 
1371 C  CG2 . VAL C 18 ? 0.2362 0.2511 0.2803 -0.0171 0.0075  -0.0263 159 VAL C CG2 
1372 N  N   . PHE C 19 ? 0.2455 0.2720 0.3162 -0.0236 0.0306  -0.0405 160 PHE C N   
1373 C  CA  . PHE C 19 ? 0.3030 0.3355 0.3909 -0.0249 0.0365  -0.0472 160 PHE C CA  
1374 C  C   . PHE C 19 ? 0.3147 0.3496 0.4216 -0.0212 0.0312  -0.0474 160 PHE C C   
1375 O  O   . PHE C 19 ? 0.3254 0.3577 0.4286 -0.0183 0.0256  -0.0438 160 PHE C O   
1376 C  CB  . PHE C 19 ? 0.2874 0.3215 0.3665 -0.0272 0.0442  -0.0519 160 PHE C CB  
1377 C  CG  . PHE C 19 ? 0.3574 0.3912 0.4209 -0.0318 0.0498  -0.0510 160 PHE C CG  
1378 C  CD1 . PHE C 19 ? 0.4063 0.4347 0.4491 -0.0315 0.0472  -0.0448 160 PHE C CD1 
1379 C  CD2 . PHE C 19 ? 0.3881 0.4275 0.4584 -0.0364 0.0576  -0.0554 160 PHE C CD2 
1380 C  CE1 . PHE C 19 ? 0.4609 0.4883 0.4904 -0.0357 0.0517  -0.0423 160 PHE C CE1 
1381 C  CE2 . PHE C 19 ? 0.4037 0.4429 0.4594 -0.0416 0.0624  -0.0529 160 PHE C CE2 
1382 C  CZ  . PHE C 19 ? 0.4027 0.4352 0.4382 -0.0412 0.0592  -0.0459 160 PHE C CZ  
1383 N  N   . LEU C 20 ? 0.2935 0.3341 0.4217 -0.0212 0.0326  -0.0507 161 LEU C N   
1384 C  CA  . LEU C 20 ? 0.2744 0.3174 0.4231 -0.0174 0.0265  -0.0492 161 LEU C CA  
1385 C  C   . LEU C 20 ? 0.3257 0.3725 0.4945 -0.0161 0.0329  -0.0571 161 LEU C C   
1386 O  O   . LEU C 20 ? 0.3345 0.3841 0.5016 -0.0188 0.0426  -0.0645 161 LEU C O   
1387 C  CB  . LEU C 20 ? 0.2262 0.2737 0.3861 -0.0177 0.0207  -0.0454 161 LEU C CB  
1388 C  CG  . LEU C 20 ? 0.2623 0.3053 0.4026 -0.0191 0.0146  -0.0393 161 LEU C CG  
1389 C  CD1 . LEU C 20 ? 0.2224 0.2701 0.3717 -0.0217 0.0112  -0.0380 161 LEU C CD1 
1390 C  CD2 . LEU C 20 ? 0.2688 0.3091 0.4029 -0.0159 0.0062  -0.0332 161 LEU C CD2 
1391 N  N   . PRO C 21 ? 0.3494 0.3966 0.5375 -0.0118 0.0275  -0.0554 162 PRO C N   
1392 C  CA  . PRO C 21 ? 0.4000 0.4499 0.6115 -0.0094 0.0331  -0.0634 162 PRO C CA  
1393 C  C   . PRO C 21 ? 0.3963 0.4559 0.6241 -0.0106 0.0406  -0.0702 162 PRO C C   
1394 O  O   . PRO C 21 ? 0.3479 0.4127 0.5766 -0.0126 0.0382  -0.0662 162 PRO C O   
1395 C  CB  . PRO C 21 ? 0.4418 0.4903 0.6727 -0.0045 0.0231  -0.0567 162 PRO C CB  
1396 C  CG  . PRO C 21 ? 0.4296 0.4739 0.6407 -0.0053 0.0136  -0.0463 162 PRO C CG  
1397 C  CD  . PRO C 21 ? 0.3632 0.4089 0.5535 -0.0093 0.0157  -0.0457 162 PRO C CD  
1398 N  N   . ASN C 22 ? 0.3923 0.4549 0.6326 -0.0100 0.0503  -0.0809 163 ASN C N   
1399 C  CA  . ASN C 22 ? 0.4579 0.5318 0.7161 -0.0110 0.0587  -0.0885 163 ASN C CA  
1400 C  C   . ASN C 22 ? 0.4141 0.4925 0.6531 -0.0180 0.0653  -0.0894 163 ASN C C   
1401 O  O   . ASN C 22 ? 0.3798 0.4672 0.6293 -0.0200 0.0669  -0.0890 163 ASN C O   
1402 C  CB  . ASN C 22 ? 0.4713 0.5522 0.7565 -0.0071 0.0518  -0.0835 163 ASN C CB  
1403 C  CG  . ASN C 22 ? 0.6489 0.7283 0.9618 0.0001  0.0487  -0.0851 163 ASN C CG  
1404 O  OD1 . ASN C 22 ? 0.7450 0.8328 1.0867 0.0041  0.0464  -0.0845 163 ASN C OD1 
1405 N  ND2 . ASN C 22 ? 0.6771 0.7457 0.9827 0.0017  0.0484  -0.0870 163 ASN C ND2 
1406 N  N   . LYS C 23 ? 0.4369 0.5095 0.6487 -0.0219 0.0685  -0.0898 164 LYS C N   
1407 C  CA  . LYS C 23 ? 0.4101 0.4858 0.6026 -0.0288 0.0748  -0.0897 164 LYS C CA  
1408 C  C   . LYS C 23 ? 0.3086 0.3834 0.4970 -0.0306 0.0678  -0.0803 164 LYS C C   
1409 O  O   . LYS C 23 ? 0.3513 0.4308 0.5350 -0.0360 0.0726  -0.0801 164 LYS C O   
1410 C  CB  . LYS C 23 ? 0.4668 0.5550 0.6722 -0.0321 0.0874  -0.1001 164 LYS C CB  
1411 C  CG  . LYS C 23 ? 0.6229 0.7126 0.8296 -0.0317 0.0961  -0.1117 164 LYS C CG  
1412 C  CD  . LYS C 23 ? 0.7372 0.8237 0.9128 -0.0376 0.1001  -0.1116 164 LYS C CD  
1413 C  CE  . LYS C 23 ? 0.8128 0.9036 0.9883 -0.0393 0.1101  -0.1249 164 LYS C CE  
1414 N  NZ  . LYS C 23 ? 0.8597 0.9491 1.0041 -0.0457 0.1128  -0.1236 164 LYS C NZ  
1415 N  N   . GLN C 24 ? 0.2499 0.3192 0.4405 -0.0266 0.0565  -0.0727 165 GLN C N   
1416 C  CA  . GLN C 24 ? 0.3149 0.3829 0.4999 -0.0289 0.0499  -0.0653 165 GLN C CA  
1417 C  C   . GLN C 24 ? 0.2751 0.3321 0.4316 -0.0301 0.0454  -0.0588 165 GLN C C   
1418 O  O   . GLN C 24 ? 0.2437 0.2952 0.3851 -0.0290 0.0466  -0.0590 165 GLN C O   
1419 C  CB  . GLN C 24 ? 0.2718 0.3436 0.4774 -0.0251 0.0405  -0.0612 165 GLN C CB  
1420 C  CG  . GLN C 24 ? 0.2836 0.3685 0.5179 -0.0252 0.0449  -0.0662 165 GLN C CG  
1421 C  CD  . GLN C 24 ? 0.3278 0.4185 0.5830 -0.0222 0.0348  -0.0608 165 GLN C CD  
1422 O  OE1 . GLN C 24 ? 0.3843 0.4711 0.6297 -0.0229 0.0252  -0.0534 165 GLN C OE1 
1423 N  NE2 . GLN C 24 ? 0.3577 0.4589 0.6428 -0.0186 0.0370  -0.0648 165 GLN C NE2 
1424 N  N   . ARG C 25 ? 0.2610 0.3155 0.4113 -0.0325 0.0403  -0.0536 166 ARG C N   
1425 C  CA  . ARG C 25 ? 0.2437 0.2879 0.3693 -0.0330 0.0366  -0.0483 166 ARG C CA  
1426 C  C   . ARG C 25 ? 0.2511 0.2917 0.3731 -0.0347 0.0295  -0.0438 166 ARG C C   
1427 O  O   . ARG C 25 ? 0.2988 0.3455 0.4360 -0.0372 0.0279  -0.0445 166 ARG C O   
1428 C  CB  . ARG C 25 ? 0.2383 0.2798 0.3475 -0.0371 0.0450  -0.0496 166 ARG C CB  
1429 C  CG  . ARG C 25 ? 0.3317 0.3806 0.4505 -0.0429 0.0529  -0.0532 166 ARG C CG  
1430 C  CD  . ARG C 25 ? 0.4676 0.5140 0.5680 -0.0478 0.0602  -0.0524 166 ARG C CD  
1431 N  NE  . ARG C 25 ? 0.5098 0.5639 0.6121 -0.0487 0.0689  -0.0589 166 ARG C NE  
1432 C  CZ  . ARG C 25 ? 0.5564 0.6132 0.6462 -0.0545 0.0769  -0.0595 166 ARG C CZ  
1433 N  NH1 . ARG C 25 ? 0.5541 0.6056 0.6308 -0.0593 0.0768  -0.0528 166 ARG C NH1 
1434 N  NH2 . ARG C 25 ? 0.5883 0.6532 0.6791 -0.0558 0.0849  -0.0667 166 ARG C NH2 
1435 N  N   . THR C 26 ? 0.1925 0.2238 0.2948 -0.0333 0.0252  -0.0398 167 THR C N   
1436 C  CA  . THR C 26 ? 0.2364 0.2629 0.3331 -0.0349 0.0190  -0.0371 167 THR C CA  
1437 C  C   . THR C 26 ? 0.2638 0.2791 0.3374 -0.0335 0.0184  -0.0343 167 THR C C   
1438 O  O   . THR C 26 ? 0.2610 0.2742 0.3241 -0.0306 0.0210  -0.0334 167 THR C O   
1439 C  CB  . THR C 26 ? 0.2755 0.3069 0.3819 -0.0322 0.0096  -0.0353 167 THR C CB  
1440 O  OG1 . THR C 26 ? 0.3815 0.4098 0.4829 -0.0350 0.0040  -0.0343 167 THR C OG1 
1441 C  CG2 . THR C 26 ? 0.2116 0.2410 0.3087 -0.0267 0.0055  -0.0324 167 THR C CG2 
1442 N  N   . VAL C 27 ? 0.2034 0.2118 0.2701 -0.0356 0.0152  -0.0334 168 VAL C N   
1443 C  CA  . VAL C 27 ? 0.2740 0.2715 0.3218 -0.0334 0.0139  -0.0312 168 VAL C CA  
1444 C  C   . VAL C 27 ? 0.2919 0.2885 0.3371 -0.0312 0.0056  -0.0315 168 VAL C C   
1445 O  O   . VAL C 27 ? 0.3320 0.3319 0.3864 -0.0345 0.0015  -0.0333 168 VAL C O   
1446 C  CB  . VAL C 27 ? 0.2975 0.2854 0.3392 -0.0383 0.0180  -0.0306 168 VAL C CB  
1447 C  CG1 . VAL C 27 ? 0.2876 0.2632 0.3120 -0.0347 0.0162  -0.0283 168 VAL C CG1 
1448 C  CG2 . VAL C 27 ? 0.3095 0.3005 0.3525 -0.0416 0.0264  -0.0297 168 VAL C CG2 
1449 N  N   . VAL C 28 ? 0.2618 0.2560 0.2947 -0.0260 0.0030  -0.0300 169 VAL C N   
1450 C  CA  . VAL C 28 ? 0.2733 0.2688 0.3026 -0.0244 -0.0042 -0.0308 169 VAL C CA  
1451 C  C   . VAL C 28 ? 0.2812 0.2663 0.2938 -0.0213 -0.0041 -0.0315 169 VAL C C   
1452 O  O   . VAL C 28 ? 0.2720 0.2517 0.2759 -0.0183 0.0002  -0.0294 169 VAL C O   
1453 C  CB  . VAL C 28 ? 0.3040 0.3096 0.3367 -0.0211 -0.0085 -0.0283 169 VAL C CB  
1454 C  CG1 . VAL C 28 ? 0.3400 0.3546 0.3919 -0.0232 -0.0089 -0.0278 169 VAL C CG1 
1455 C  CG2 . VAL C 28 ? 0.2991 0.3035 0.3218 -0.0164 -0.0054 -0.0258 169 VAL C CG2 
1456 N  N   . PRO C 29 ? 0.3280 0.3110 0.3368 -0.0222 -0.0089 -0.0348 170 PRO C N   
1457 C  CA  . PRO C 29 ? 0.3355 0.3101 0.3297 -0.0178 -0.0090 -0.0367 170 PRO C CA  
1458 C  C   . PRO C 29 ? 0.3603 0.3422 0.3473 -0.0117 -0.0099 -0.0339 170 PRO C C   
1459 O  O   . PRO C 29 ? 0.3433 0.3370 0.3352 -0.0119 -0.0135 -0.0318 170 PRO C O   
1460 C  CB  . PRO C 29 ? 0.2747 0.2488 0.2677 -0.0208 -0.0142 -0.0423 170 PRO C CB  
1461 C  CG  . PRO C 29 ? 0.3520 0.3327 0.3591 -0.0277 -0.0169 -0.0425 170 PRO C CG  
1462 C  CD  . PRO C 29 ? 0.3537 0.3426 0.3717 -0.0272 -0.0143 -0.0374 170 PRO C CD  
1463 N  N   . ALA C 30 ? 0.3458 0.3210 0.3223 -0.0065 -0.0069 -0.0333 171 ALA C N   
1464 C  CA  . ALA C 30 ? 0.4271 0.4095 0.3966 -0.0009 -0.0071 -0.0306 171 ALA C CA  
1465 C  C   . ALA C 30 ? 0.3715 0.3517 0.3311 0.0034  -0.0086 -0.0348 171 ALA C C   
1466 O  O   . ALA C 30 ? 0.4180 0.3896 0.3715 0.0081  -0.0056 -0.0353 171 ALA C O   
1467 C  CB  . ALA C 30 ? 0.3825 0.3619 0.3492 0.0017  -0.0023 -0.0260 171 ALA C CB  
1468 N  N   . ARG C 31 ? 0.3278 0.3164 0.2861 0.0020  -0.0131 -0.0378 172 ARG C N   
1469 C  CA  . ARG C 31 ? 0.3433 0.3297 0.2923 0.0052  -0.0137 -0.0441 172 ARG C CA  
1470 C  C   . ARG C 31 ? 0.3446 0.3444 0.2869 0.0093  -0.0147 -0.0425 172 ARG C C   
1471 O  O   . ARG C 31 ? 0.3986 0.4108 0.3439 0.0074  -0.0174 -0.0372 172 ARG C O   
1472 C  CB  . ARG C 31 ? 0.4396 0.4242 0.3895 -0.0004 -0.0175 -0.0509 172 ARG C CB  
1473 C  CG  . ARG C 31 ? 0.5643 0.5631 0.5196 -0.0059 -0.0231 -0.0484 172 ARG C CG  
1474 C  CD  . ARG C 31 ? 0.7280 0.7245 0.6963 -0.0118 -0.0242 -0.0461 172 ARG C CD  
1475 N  NE  . ARG C 31 ? 0.8336 0.8443 0.8091 -0.0163 -0.0305 -0.0428 172 ARG C NE  
1476 C  CZ  . ARG C 31 ? 0.9294 0.9429 0.9188 -0.0210 -0.0324 -0.0402 172 ARG C CZ  
1477 N  NH1 . ARG C 31 ? 1.0010 1.0048 0.9976 -0.0226 -0.0280 -0.0409 172 ARG C NH1 
1478 N  NH2 . ARG C 31 ? 0.9488 0.9756 0.9457 -0.0240 -0.0388 -0.0363 172 ARG C NH2 
1479 N  N   . CYS C 32 ? 0.3235 0.3210 0.2576 0.0151  -0.0124 -0.0471 173 CYS C N   
1480 C  CA  . CYS C 32 ? 0.3137 0.3249 0.2416 0.0195  -0.0122 -0.0455 173 CYS C CA  
1481 C  C   . CYS C 32 ? 0.2700 0.2966 0.1954 0.0149  -0.0170 -0.0457 173 CYS C C   
1482 O  O   . CYS C 32 ? 0.3103 0.3367 0.2334 0.0108  -0.0198 -0.0519 173 CYS C O   
1483 C  CB  . CYS C 32 ? 0.3928 0.3993 0.3139 0.0269  -0.0086 -0.0521 173 CYS C CB  
1484 S  SG  . CYS C 32 ? 0.4347 0.4232 0.3590 0.0331  -0.0038 -0.0499 173 CYS C SG  
1485 N  N   . GLY C 33 ? 0.2412 0.2814 0.1666 0.0149  -0.0183 -0.0387 174 GLY C N   
1486 C  CA  . GLY C 33 ? 0.3090 0.3652 0.2312 0.0104  -0.0231 -0.0370 174 GLY C CA  
1487 C  C   . GLY C 33 ? 0.3366 0.3950 0.2679 0.0035  -0.0286 -0.0318 174 GLY C C   
1488 O  O   . GLY C 33 ? 0.3871 0.4585 0.3172 -0.0009 -0.0337 -0.0284 174 GLY C O   
1489 N  N   . VAL C 34 ? 0.3314 0.3781 0.2724 0.0024  -0.0276 -0.0307 175 VAL C N   
1490 C  CA  . VAL C 34 ? 0.3484 0.3978 0.3010 -0.0032 -0.0322 -0.0257 175 VAL C CA  
1491 C  C   . VAL C 34 ? 0.3307 0.3819 0.2920 -0.0025 -0.0313 -0.0178 175 VAL C C   
1492 O  O   . VAL C 34 ? 0.2765 0.3198 0.2386 0.0007  -0.0261 -0.0179 175 VAL C O   
1493 C  CB  . VAL C 34 ? 0.3154 0.3531 0.2752 -0.0061 -0.0318 -0.0302 175 VAL C CB  
1494 C  CG1 . VAL C 34 ? 0.2977 0.3400 0.2719 -0.0109 -0.0362 -0.0252 175 VAL C CG1 
1495 C  CG2 . VAL C 34 ? 0.2593 0.2940 0.2109 -0.0079 -0.0330 -0.0391 175 VAL C CG2 
1496 N  N   . THR C 35 ? 0.2723 0.3336 0.2400 -0.0057 -0.0365 -0.0110 176 THR C N   
1497 C  CA  . THR C 35 ? 0.2711 0.3327 0.2479 -0.0054 -0.0356 -0.0047 176 THR C CA  
1498 C  C   . THR C 35 ? 0.2013 0.2536 0.1918 -0.0064 -0.0333 -0.0058 176 THR C C   
1499 O  O   . THR C 35 ? 0.2669 0.3150 0.2626 -0.0084 -0.0341 -0.0094 176 THR C O   
1500 C  CB  . THR C 35 ? 0.2048 0.2778 0.1868 -0.0086 -0.0419 0.0036  176 THR C CB  
1501 O  OG1 . THR C 35 ? 0.2699 0.3451 0.2616 -0.0124 -0.0477 0.0050  176 THR C OG1 
1502 C  CG2 . THR C 35 ? 0.2649 0.3500 0.2334 -0.0087 -0.0438 0.0058  176 THR C CG2 
1503 N  N   . VAL C 36 ? 0.2141 0.2638 0.2098 -0.0052 -0.0300 -0.0035 177 VAL C N   
1504 C  CA  . VAL C 36 ? 0.1561 0.1985 0.1636 -0.0061 -0.0265 -0.0054 177 VAL C CA  
1505 C  C   . VAL C 36 ? 0.2126 0.2590 0.2362 -0.0091 -0.0317 -0.0029 177 VAL C C   
1506 O  O   . VAL C 36 ? 0.1607 0.2038 0.1943 -0.0106 -0.0307 -0.0059 177 VAL C O   
1507 C  CB  . VAL C 36 ? 0.1712 0.2126 0.1800 -0.0049 -0.0225 -0.0037 177 VAL C CB  
1508 C  CG1 . VAL C 36 ? 0.2393 0.2768 0.2633 -0.0066 -0.0198 -0.0054 177 VAL C CG1 
1509 C  CG2 . VAL C 36 ? 0.1170 0.1543 0.1122 -0.0021 -0.0173 -0.0063 177 VAL C CG2 
1510 N  N   . ARG C 37 ? 0.2098 0.2643 0.2361 -0.0101 -0.0376 0.0036  178 ARG C N   
1511 C  CA  . ARG C 37 ? 0.2637 0.3237 0.3052 -0.0125 -0.0444 0.0084  178 ARG C CA  
1512 C  C   . ARG C 37 ? 0.2796 0.3420 0.3214 -0.0148 -0.0478 0.0057  178 ARG C C   
1513 O  O   . ARG C 37 ? 0.2970 0.3593 0.3544 -0.0161 -0.0491 0.0052  178 ARG C O   
1514 C  CB  . ARG C 37 ? 0.3380 0.4072 0.3772 -0.0139 -0.0510 0.0172  178 ARG C CB  
1515 C  CG  . ARG C 37 ? 0.3900 0.4648 0.4466 -0.0161 -0.0588 0.0246  178 ARG C CG  
1516 C  CD  . ARG C 37 ? 0.4239 0.5097 0.4741 -0.0189 -0.0664 0.0339  178 ARG C CD  
1517 N  NE  . ARG C 37 ? 0.4919 0.5781 0.5358 -0.0185 -0.0647 0.0379  178 ARG C NE  
1518 C  CZ  . ARG C 37 ? 0.5058 0.5879 0.5629 -0.0183 -0.0652 0.0429  178 ARG C CZ  
1519 N  NH1 . ARG C 37 ? 0.5037 0.5809 0.5821 -0.0175 -0.0670 0.0440  178 ARG C NH1 
1520 N  NH2 . ARG C 37 ? 0.4681 0.5512 0.5180 -0.0190 -0.0638 0.0463  178 ARG C NH2 
1521 N  N   . ASP C 38 ? 0.1928 0.2581 0.2184 -0.0155 -0.0491 0.0033  179 ASP C N   
1522 C  CA  . ASP C 38 ? 0.2879 0.3550 0.3131 -0.0187 -0.0525 -0.0005 179 ASP C CA  
1523 C  C   . ASP C 38 ? 0.3234 0.3800 0.3513 -0.0187 -0.0467 -0.0081 179 ASP C C   
1524 O  O   . ASP C 38 ? 0.3329 0.3908 0.3683 -0.0222 -0.0495 -0.0104 179 ASP C O   
1525 C  CB  . ASP C 38 ? 0.4044 0.4784 0.4123 -0.0202 -0.0558 -0.0020 179 ASP C CB  
1526 C  CG  . ASP C 38 ? 0.5068 0.5946 0.5146 -0.0226 -0.0635 0.0071  179 ASP C CG  
1527 O  OD1 . ASP C 38 ? 0.5008 0.5934 0.5248 -0.0245 -0.0692 0.0144  179 ASP C OD1 
1528 O  OD2 . ASP C 38 ? 0.5230 0.6171 0.5155 -0.0224 -0.0636 0.0075  179 ASP C OD2 
1529 N  N   . SER C 39 ? 0.3077 0.3548 0.3304 -0.0154 -0.0390 -0.0113 180 SER C N   
1530 C  CA  . SER C 39 ? 0.3024 0.3397 0.3273 -0.0161 -0.0333 -0.0170 180 SER C CA  
1531 C  C   . SER C 39 ? 0.3325 0.3709 0.3772 -0.0178 -0.0322 -0.0159 180 SER C C   
1532 O  O   . SER C 39 ? 0.3419 0.3766 0.3928 -0.0205 -0.0297 -0.0197 180 SER C O   
1533 C  CB  . SER C 39 ? 0.2255 0.2533 0.2389 -0.0124 -0.0259 -0.0194 180 SER C CB  
1534 O  OG  . SER C 39 ? 0.2888 0.3166 0.2862 -0.0095 -0.0262 -0.0204 180 SER C OG  
1535 N  N   . LEU C 40 ? 0.2593 0.3029 0.3146 -0.0164 -0.0338 -0.0111 181 LEU C N   
1536 C  CA  . LEU C 40 ? 0.2326 0.2766 0.3074 -0.0168 -0.0310 -0.0115 181 LEU C CA  
1537 C  C   . LEU C 40 ? 0.2742 0.3276 0.3678 -0.0181 -0.0385 -0.0070 181 LEU C C   
1538 O  O   . LEU C 40 ? 0.2783 0.3335 0.3907 -0.0180 -0.0367 -0.0078 181 LEU C O   
1539 C  CB  . LEU C 40 ? 0.4180 0.4589 0.4940 -0.0140 -0.0258 -0.0110 181 LEU C CB  
1540 C  CG  . LEU C 40 ? 0.4323 0.4652 0.4950 -0.0131 -0.0175 -0.0153 181 LEU C CG  
1541 C  CD1 . LEU C 40 ? 0.2758 0.3075 0.3412 -0.0116 -0.0129 -0.0155 181 LEU C CD1 
1542 C  CD2 . LEU C 40 ? 0.4774 0.5067 0.5443 -0.0157 -0.0126 -0.0201 181 LEU C CD2 
1543 N  N   . LYS C 41 ? 0.3549 0.4153 0.4438 -0.0191 -0.0468 -0.0017 182 LYS C N   
1544 C  CA  . LYS C 41 ? 0.4959 0.5662 0.6025 -0.0203 -0.0552 0.0048  182 LYS C CA  
1545 C  C   . LYS C 41 ? 0.4095 0.4834 0.5343 -0.0225 -0.0555 0.0020  182 LYS C C   
1546 O  O   . LYS C 41 ? 0.3808 0.4597 0.5278 -0.0212 -0.0575 0.0051  182 LYS C O   
1547 C  CB  . LYS C 41 ? 0.6039 0.6828 0.6987 -0.0228 -0.0641 0.0104  182 LYS C CB  
1548 C  CG  . LYS C 41 ? 0.7291 0.8199 0.8377 -0.0260 -0.0740 0.0163  182 LYS C CG  
1549 C  CD  . LYS C 41 ? 0.8199 0.9207 0.9157 -0.0288 -0.0828 0.0235  182 LYS C CD  
1550 C  CE  . LYS C 41 ? 0.8348 0.9403 0.9419 -0.0272 -0.0883 0.0351  182 LYS C CE  
1551 N  NZ  . LYS C 41 ? 0.8278 0.9466 0.9264 -0.0314 -0.0985 0.0444  182 LYS C NZ  
1552 N  N   . LYS C 42 ? 0.3942 0.4654 0.5103 -0.0257 -0.0531 -0.0042 183 LYS C N   
1553 C  CA  . LYS C 42 ? 0.3792 0.4547 0.5107 -0.0290 -0.0533 -0.0071 183 LYS C CA  
1554 C  C   . LYS C 42 ? 0.3365 0.4091 0.4843 -0.0269 -0.0448 -0.0106 183 LYS C C   
1555 O  O   . LYS C 42 ? 0.3533 0.4339 0.5244 -0.0267 -0.0464 -0.0091 183 LYS C O   
1556 C  CB  . LYS C 42 ? 0.3621 0.4330 0.4781 -0.0336 -0.0524 -0.0132 183 LYS C CB  
1557 C  CG  . LYS C 42 ? 0.4442 0.5156 0.5717 -0.0379 -0.0494 -0.0179 183 LYS C CG  
1558 C  CD  . LYS C 42 ? 0.5323 0.6009 0.6454 -0.0434 -0.0525 -0.0225 183 LYS C CD  
1559 C  CE  . LYS C 42 ? 0.5770 0.6428 0.6977 -0.0487 -0.0482 -0.0278 183 LYS C CE  
1560 N  NZ  . LYS C 42 ? 0.5897 0.6415 0.7016 -0.0472 -0.0377 -0.0315 183 LYS C NZ  
1561 N  N   . ALA C 43 ? 0.3340 0.3961 0.4698 -0.0255 -0.0356 -0.0153 184 ALA C N   
1562 C  CA  . ALA C 43 ? 0.3488 0.4091 0.4966 -0.0247 -0.0266 -0.0196 184 ALA C CA  
1563 C  C   . ALA C 43 ? 0.4056 0.4707 0.5732 -0.0205 -0.0273 -0.0169 184 ALA C C   
1564 O  O   . ALA C 43 ? 0.4347 0.5043 0.6226 -0.0199 -0.0230 -0.0200 184 ALA C O   
1565 C  CB  . ALA C 43 ? 0.3667 0.4161 0.4959 -0.0242 -0.0180 -0.0235 184 ALA C CB  
1566 N  N   . LEU C 44 ? 0.3758 0.4401 0.5386 -0.0176 -0.0326 -0.0114 185 LEU C N   
1567 C  CA  . LEU C 44 ? 0.3539 0.4199 0.5349 -0.0137 -0.0335 -0.0085 185 LEU C CA  
1568 C  C   . LEU C 44 ? 0.3366 0.4132 0.5426 -0.0132 -0.0413 -0.0035 185 LEU C C   
1569 O  O   . LEU C 44 ? 0.3080 0.3877 0.5381 -0.0104 -0.0387 -0.0053 185 LEU C O   
1570 C  CB  . LEU C 44 ? 0.3514 0.4138 0.5202 -0.0119 -0.0378 -0.0025 185 LEU C CB  
1571 C  CG  . LEU C 44 ? 0.3265 0.3799 0.4795 -0.0108 -0.0302 -0.0065 185 LEU C CG  
1572 C  CD1 . LEU C 44 ? 0.3398 0.3925 0.4845 -0.0098 -0.0360 0.0007  185 LEU C CD1 
1573 C  CD2 . LEU C 44 ? 0.3060 0.3566 0.4744 -0.0090 -0.0221 -0.0128 185 LEU C CD2 
1574 N  N   . MSE C 45 ? 0.3522 0.4351 0.5524 -0.0158 -0.0510 0.0027  186 MSE C N   
1575 C  CA  . MSE C 45 ? 0.4174 0.5121 0.6396 -0.0159 -0.0605 0.0096  186 MSE C CA  
1576 C  C   . MSE C 45 ? 0.4203 0.5216 0.6629 -0.0168 -0.0565 0.0040  186 MSE C C   
1577 O  O   . MSE C 45 ? 0.4215 0.5306 0.6917 -0.0139 -0.0591 0.0068  186 MSE C O   
1578 C  CB  . MSE C 45 ? 0.4590 0.5606 0.6668 -0.0202 -0.0710 0.0158  186 MSE C CB  
1579 C  CG  . MSE C 45 ? 0.5435 0.6585 0.7714 -0.0205 -0.0831 0.0261  186 MSE C CG  
1580 SE SE  . MSE C 45 ? 1.5688 1.6967 1.7822 -0.0287 -0.0940 0.0287  186 MSE C SE  
1581 C  CE  . MSE C 45 ? 1.1038 1.2352 1.2982 -0.0297 -0.1041 0.0406  186 MSE C CE  
1582 N  N   . MSE C 46 ? 0.4666 0.5646 0.6965 -0.0208 -0.0498 -0.0036 187 MSE C N   
1583 C  CA  . MSE C 46 ? 0.5245 0.6282 0.7710 -0.0228 -0.0441 -0.0095 187 MSE C CA  
1584 C  C   . MSE C 46 ? 0.5367 0.6422 0.8075 -0.0175 -0.0373 -0.0125 187 MSE C C   
1585 O  O   . MSE C 46 ? 0.5547 0.6702 0.8487 -0.0176 -0.0353 -0.0150 187 MSE C O   
1586 C  CB  . MSE C 46 ? 0.5835 0.6783 0.8094 -0.0270 -0.0351 -0.0170 187 MSE C CB  
1587 C  CG  . MSE C 46 ? 0.6726 0.7740 0.9074 -0.0326 -0.0326 -0.0212 187 MSE C CG  
1588 SE SE  . MSE C 46 ? 1.4913 1.5780 1.6938 -0.0387 -0.0261 -0.0268 187 MSE C SE  
1589 C  CE  . MSE C 46 ? 0.7267 0.8128 0.9105 -0.0414 -0.0394 -0.0223 187 MSE C CE  
1590 N  N   . ARG C 47 ? 0.5121 0.6085 0.7780 -0.0132 -0.0336 -0.0131 188 ARG C N   
1591 C  CA  . ARG C 47 ? 0.5265 0.6229 0.8141 -0.0082 -0.0263 -0.0179 188 ARG C CA  
1592 C  C   . ARG C 47 ? 0.5087 0.6042 0.8123 -0.0026 -0.0333 -0.0109 188 ARG C C   
1593 O  O   . ARG C 47 ? 0.5163 0.6069 0.8318 0.0018  -0.0274 -0.0153 188 ARG C O   
1594 C  CB  . ARG C 47 ? 0.5348 0.6211 0.8060 -0.0087 -0.0141 -0.0266 188 ARG C CB  
1595 C  CG  . ARG C 47 ? 0.5613 0.6479 0.8194 -0.0142 -0.0065 -0.0325 188 ARG C CG  
1596 C  CD  . ARG C 47 ? 0.5477 0.6227 0.7766 -0.0160 -0.0010 -0.0351 188 ARG C CD  
1597 N  NE  . ARG C 47 ? 0.5307 0.6050 0.7484 -0.0212 0.0067  -0.0400 188 ARG C NE  
1598 C  CZ  . ARG C 47 ? 0.4986 0.5696 0.6996 -0.0256 0.0037  -0.0377 188 ARG C CZ  
1599 N  NH1 . ARG C 47 ? 0.4788 0.5483 0.6715 -0.0253 -0.0064 -0.0317 188 ARG C NH1 
1600 N  NH2 . ARG C 47 ? 0.5355 0.6046 0.7279 -0.0305 0.0110  -0.0415 188 ARG C NH2 
1601 N  N   . GLY C 48 ? 0.5042 0.6047 0.8081 -0.0032 -0.0459 -0.0002 189 GLY C N   
1602 C  CA  . GLY C 48 ? 0.4975 0.5977 0.8169 0.0013  -0.0543 0.0091  189 GLY C CA  
1603 C  C   . GLY C 48 ? 0.4939 0.5812 0.7973 0.0026  -0.0528 0.0104  189 GLY C C   
1604 O  O   . GLY C 48 ? 0.5200 0.6033 0.8397 0.0069  -0.0555 0.0147  189 GLY C O   
1605 N  N   . LEU C 49 ? 0.4091 0.4899 0.6817 -0.0011 -0.0488 0.0071  190 LEU C N   
1606 C  CA  . LEU C 49 ? 0.3812 0.4520 0.6375 -0.0006 -0.0479 0.0087  190 LEU C CA  
1607 C  C   . LEU C 49 ? 0.4284 0.5011 0.6616 -0.0041 -0.0561 0.0171  190 LEU C C   
1608 O  O   . LEU C 49 ? 0.4293 0.5082 0.6514 -0.0076 -0.0592 0.0175  190 LEU C O   
1609 C  CB  . LEU C 49 ? 0.3989 0.4612 0.6392 -0.0014 -0.0355 -0.0024 190 LEU C CB  
1610 C  CG  . LEU C 49 ? 0.4504 0.5110 0.7105 0.0014  -0.0257 -0.0122 190 LEU C CG  
1611 C  CD1 . LEU C 49 ? 0.4781 0.5332 0.7191 -0.0010 -0.0140 -0.0225 190 LEU C CD1 
1612 C  CD2 . LEU C 49 ? 0.4774 0.5327 0.7567 0.0057  -0.0278 -0.0100 190 LEU C CD2 
1613 N  N   . ILE C 50 ? 0.4170 0.4848 0.6435 -0.0036 -0.0594 0.0232  191 ILE C N   
1614 C  CA  . ILE C 50 ? 0.4455 0.5156 0.6488 -0.0069 -0.0656 0.0304  191 ILE C CA  
1615 C  C   . ILE C 50 ? 0.2953 0.3564 0.4793 -0.0071 -0.0588 0.0263  191 ILE C C   
1616 O  O   . ILE C 50 ? 0.2611 0.3146 0.4542 -0.0049 -0.0533 0.0224  191 ILE C O   
1617 C  CB  . ILE C 50 ? 0.5852 0.6610 0.7998 -0.0072 -0.0775 0.0444  191 ILE C CB  
1618 C  CG1 . ILE C 50 ? 0.6775 0.7583 0.8672 -0.0114 -0.0834 0.0516  191 ILE C CG1 
1619 C  CG2 . ILE C 50 ? 0.5870 0.6544 0.8193 -0.0039 -0.0769 0.0472  191 ILE C CG2 
1620 C  CD1 . ILE C 50 ? 0.7292 0.8168 0.9278 -0.0128 -0.0953 0.0668  191 ILE C CD1 
1621 N  N   . PRO C 51 ? 0.3132 0.3758 0.4712 -0.0097 -0.0588 0.0264  192 PRO C N   
1622 C  CA  . PRO C 51 ? 0.3343 0.3907 0.4739 -0.0098 -0.0532 0.0236  192 PRO C CA  
1623 C  C   . PRO C 51 ? 0.3747 0.4279 0.5223 -0.0096 -0.0560 0.0301  192 PRO C C   
1624 O  O   . PRO C 51 ? 0.3769 0.4227 0.5243 -0.0088 -0.0495 0.0247  192 PRO C O   
1625 C  CB  . PRO C 51 ? 0.3568 0.4189 0.4728 -0.0122 -0.0562 0.0259  192 PRO C CB  
1626 C  CG  . PRO C 51 ? 0.3477 0.4146 0.4661 -0.0134 -0.0583 0.0233  192 PRO C CG  
1627 C  CD  . PRO C 51 ? 0.3156 0.3858 0.4606 -0.0125 -0.0631 0.0274  192 PRO C CD  
1628 N  N   . GLU C 52 ? 0.4327 0.4916 0.5875 -0.0108 -0.0658 0.0416  193 GLU C N   
1629 C  CA  . GLU C 52 ? 0.4701 0.5249 0.6357 -0.0111 -0.0697 0.0494  193 GLU C CA  
1630 C  C   . GLU C 52 ? 0.3979 0.4420 0.5854 -0.0080 -0.0644 0.0434  193 GLU C C   
1631 O  O   . GLU C 52 ? 0.4174 0.4548 0.6080 -0.0088 -0.0641 0.0455  193 GLU C O   
1632 C  CB  . GLU C 52 ? 0.6181 0.6811 0.7937 -0.0128 -0.0818 0.0638  193 GLU C CB  
1633 C  CG  . GLU C 52 ? 0.7481 0.8220 0.9007 -0.0173 -0.0874 0.0712  193 GLU C CG  
1634 C  CD  . GLU C 52 ? 0.8438 0.9161 0.9792 -0.0197 -0.0847 0.0728  193 GLU C CD  
1635 O  OE1 . GLU C 52 ? 0.8965 0.9609 1.0426 -0.0197 -0.0843 0.0758  193 GLU C OE1 
1636 O  OE2 . GLU C 52 ? 0.8576 0.9366 0.9696 -0.0216 -0.0827 0.0705  193 GLU C OE2 
1637 N  N   . CYS C 53 ? 0.3097 0.3528 0.5125 -0.0048 -0.0601 0.0355  194 CYS C N   
1638 C  CA  . CYS C 53 ? 0.3181 0.3524 0.5423 -0.0016 -0.0540 0.0279  194 CYS C CA  
1639 C  C   . CYS C 53 ? 0.2959 0.3257 0.5093 -0.0016 -0.0417 0.0134  194 CYS C C   
1640 O  O   . CYS C 53 ? 0.2613 0.2863 0.4904 0.0007  -0.0349 0.0043  194 CYS C O   
1641 C  CB  . CYS C 53 ? 0.3528 0.3903 0.6072 0.0024  -0.0572 0.0291  194 CYS C CB  
1642 S  SG  . CYS C 53 ? 0.6784 0.7236 0.9368 0.0037  -0.0506 0.0186  194 CYS C SG  
1643 N  N   . CYS C 54 ? 0.2825 0.3145 0.4691 -0.0043 -0.0387 0.0113  195 CYS C N   
1644 C  CA  . CYS C 54 ? 0.2836 0.3122 0.4585 -0.0048 -0.0279 -0.0005 195 CYS C CA  
1645 C  C   . CYS C 54 ? 0.2390 0.2661 0.3898 -0.0075 -0.0265 0.0003  195 CYS C C   
1646 O  O   . CYS C 54 ? 0.2260 0.2562 0.3679 -0.0088 -0.0331 0.0091  195 CYS C O   
1647 C  CB  . CYS C 54 ? 0.2823 0.3160 0.4505 -0.0050 -0.0248 -0.0046 195 CYS C CB  
1648 S  SG  . CYS C 54 ? 0.2843 0.3230 0.4808 -0.0025 -0.0259 -0.0062 195 CYS C SG  
1649 N  N   . ALA C 55 ? 0.2452 0.2693 0.3855 -0.0085 -0.0177 -0.0088 196 ALA C N   
1650 C  CA  . ALA C 55 ? 0.2337 0.2585 0.3505 -0.0107 -0.0159 -0.0085 196 ALA C CA  
1651 C  C   . ALA C 55 ? 0.1758 0.2023 0.2781 -0.0106 -0.0098 -0.0141 196 ALA C C   
1652 O  O   . ALA C 55 ? 0.2094 0.2353 0.3202 -0.0101 -0.0049 -0.0203 196 ALA C O   
1653 C  CB  . ALA C 55 ? 0.1909 0.2106 0.3087 -0.0127 -0.0116 -0.0137 196 ALA C CB  
1654 N  N   . VAL C 56 ? 0.2341 0.2630 0.3155 -0.0112 -0.0100 -0.0117 197 VAL C N   
1655 C  CA  . VAL C 56 ? 0.2072 0.2361 0.2756 -0.0110 -0.0047 -0.0159 197 VAL C CA  
1656 C  C   . VAL C 56 ? 0.2428 0.2719 0.2948 -0.0123 -0.0007 -0.0175 197 VAL C C   
1657 O  O   . VAL C 56 ? 0.2608 0.2920 0.3071 -0.0129 -0.0038 -0.0136 197 VAL C O   
1658 C  CB  . VAL C 56 ? 0.2332 0.2646 0.2941 -0.0096 -0.0092 -0.0115 197 VAL C CB  
1659 C  CG1 . VAL C 56 ? 0.2060 0.2420 0.2586 -0.0092 -0.0160 -0.0040 197 VAL C CG1 
1660 C  CG2 . VAL C 56 ? 0.1427 0.1721 0.1898 -0.0095 -0.0044 -0.0149 197 VAL C CG2 
1661 N  N   . TYR C 57 ? 0.2520 0.2798 0.2971 -0.0133 0.0061  -0.0229 198 TYR C N   
1662 C  CA  . TYR C 57 ? 0.2327 0.2620 0.2626 -0.0148 0.0097  -0.0241 198 TYR C CA  
1663 C  C   . TYR C 57 ? 0.3092 0.3381 0.3254 -0.0142 0.0128  -0.0237 198 TYR C C   
1664 O  O   . TYR C 57 ? 0.2668 0.2931 0.2869 -0.0144 0.0154  -0.0259 198 TYR C O   
1665 C  CB  . TYR C 57 ? 0.2830 0.3117 0.3178 -0.0183 0.0157  -0.0316 198 TYR C CB  
1666 C  CG  . TYR C 57 ? 0.3046 0.3311 0.3554 -0.0191 0.0142  -0.0341 198 TYR C CG  
1667 C  CD1 . TYR C 57 ? 0.3877 0.4148 0.4355 -0.0215 0.0127  -0.0338 198 TYR C CD1 
1668 C  CD2 . TYR C 57 ? 0.4220 0.4458 0.4928 -0.0178 0.0144  -0.0370 198 TYR C CD2 
1669 C  CE1 . TYR C 57 ? 0.4079 0.4309 0.4716 -0.0225 0.0112  -0.0361 198 TYR C CE1 
1670 C  CE2 . TYR C 57 ? 0.4341 0.4546 0.5217 -0.0179 0.0129  -0.0390 198 TYR C CE2 
1671 C  CZ  . TYR C 57 ? 0.3760 0.3951 0.4598 -0.0204 0.0114  -0.0386 198 TYR C CZ  
1672 O  OH  . TYR C 57 ? 0.4737 0.4875 0.5748 -0.0208 0.0097  -0.0404 198 TYR C OH  
1673 N  N   . ARG C 58 ? 0.3576 0.3892 0.3587 -0.0135 0.0122  -0.0203 199 ARG C N   
1674 C  CA  . ARG C 58 ? 0.4200 0.4508 0.4080 -0.0128 0.0150  -0.0190 199 ARG C CA  
1675 C  C   . ARG C 58 ? 0.5107 0.5439 0.4944 -0.0171 0.0206  -0.0229 199 ARG C C   
1676 O  O   . ARG C 58 ? 0.5255 0.5620 0.5110 -0.0197 0.0210  -0.0255 199 ARG C O   
1677 C  CB  . ARG C 58 ? 0.5066 0.5406 0.4826 -0.0092 0.0113  -0.0131 199 ARG C CB  
1678 C  CG  . ARG C 58 ? 0.6006 0.6317 0.5654 -0.0069 0.0129  -0.0105 199 ARG C CG  
1679 C  CD  . ARG C 58 ? 0.6293 0.6660 0.5831 -0.0074 0.0142  -0.0078 199 ARG C CD  
1680 N  NE  . ARG C 58 ? 0.5769 0.6213 0.5281 -0.0056 0.0103  -0.0048 199 ARG C NE  
1681 C  CZ  . ARG C 58 ? 0.5718 0.6195 0.5163 -0.0006 0.0076  -0.0001 199 ARG C CZ  
1682 N  NH1 . ARG C 58 ? 0.4389 0.4808 0.3791 0.0035  0.0082  0.0017  199 ARG C NH1 
1683 N  NH2 . ARG C 58 ? 0.5547 0.6116 0.4977 0.0003  0.0045  0.0025  199 ARG C NH2 
1684 N  N   . ILE C 59 ? 0.5805 0.6120 0.5584 -0.0186 0.0251  -0.0235 200 ILE C N   
1685 C  CA  . ILE C 59 ? 0.5979 0.6334 0.5700 -0.0236 0.0306  -0.0272 200 ILE C CA  
1686 C  C   . ILE C 59 ? 0.6017 0.6409 0.5569 -0.0231 0.0294  -0.0209 200 ILE C C   
1687 O  O   . ILE C 59 ? 0.5881 0.6240 0.5373 -0.0192 0.0270  -0.0148 200 ILE C O   
1688 C  CB  . ILE C 59 ? 0.6632 0.6969 0.6414 -0.0270 0.0369  -0.0322 200 ILE C CB  
1689 C  CG1 . ILE C 59 ? 0.7252 0.7650 0.6982 -0.0332 0.0434  -0.0379 200 ILE C CG1 
1690 C  CG2 . ILE C 59 ? 0.6782 0.7070 0.6524 -0.0255 0.0367  -0.0273 200 ILE C CG2 
1691 C  CD1 . ILE C 59 ? 0.7401 0.7818 0.7247 -0.0349 0.0450  -0.0465 200 ILE C CD1 
1692 N  N   . GLN C 60 ? 0.5943 0.6406 0.5429 -0.0268 0.0305  -0.0224 201 GLN C N   
1693 C  CA  . GLN C 60 ? 0.6525 0.7048 0.5871 -0.0260 0.0278  -0.0157 201 GLN C CA  
1694 C  C   . GLN C 60 ? 0.6825 0.7426 0.6074 -0.0329 0.0318  -0.0181 201 GLN C C   
1695 O  O   . GLN C 60 ? 0.7014 0.7677 0.6253 -0.0369 0.0317  -0.0223 201 GLN C O   
1696 C  CB  . GLN C 60 ? 0.6621 0.7187 0.5980 -0.0230 0.0222  -0.0130 201 GLN C CB  
1697 C  CG  . GLN C 60 ? 0.7205 0.7830 0.6460 -0.0189 0.0181  -0.0045 201 GLN C CG  
1698 C  CD  . GLN C 60 ? 0.7699 0.8265 0.6968 -0.0112 0.0153  0.0004  201 GLN C CD  
1699 O  OE1 . GLN C 60 ? 0.7727 0.8203 0.7051 -0.0099 0.0167  -0.0016 201 GLN C OE1 
1700 N  NE2 . GLN C 60 ? 0.7453 0.8079 0.6677 -0.0064 0.0115  0.0062  201 GLN C NE2 
1701 N  N   . LYS C 64 ? 0.4821 0.5249 0.4754 -0.0354 0.0364  -0.0503 205 LYS C N   
1702 C  CA  . LYS C 64 ? 0.4632 0.5008 0.4696 -0.0305 0.0306  -0.0460 205 LYS C CA  
1703 C  C   . LYS C 64 ? 0.3967 0.4361 0.3989 -0.0295 0.0238  -0.0394 205 LYS C C   
1704 O  O   . LYS C 64 ? 0.4415 0.4813 0.4471 -0.0326 0.0229  -0.0425 205 LYS C O   
1705 C  CB  . LYS C 64 ? 0.4567 0.4896 0.4844 -0.0306 0.0327  -0.0535 205 LYS C CB  
1706 N  N   . LYS C 65 ? 0.3001 0.3407 0.2955 -0.0253 0.0191  -0.0310 206 LYS C N   
1707 C  CA  . LYS C 65 ? 0.2787 0.3228 0.2712 -0.0239 0.0128  -0.0243 206 LYS C CA  
1708 C  C   . LYS C 65 ? 0.2543 0.2952 0.2564 -0.0200 0.0080  -0.0199 206 LYS C C   
1709 O  O   . LYS C 65 ? 0.2502 0.2892 0.2509 -0.0167 0.0078  -0.0180 206 LYS C O   
1710 C  CB  . LYS C 65 ? 0.2901 0.3407 0.2660 -0.0221 0.0116  -0.0185 206 LYS C CB  
1711 C  CG  . LYS C 65 ? 0.4338 0.4902 0.3987 -0.0263 0.0149  -0.0209 206 LYS C CG  
1712 C  CD  . LYS C 65 ? 0.5280 0.5900 0.4927 -0.0304 0.0123  -0.0211 206 LYS C CD  
1713 C  CE  . LYS C 65 ? 0.6187 0.6879 0.5722 -0.0357 0.0150  -0.0239 206 LYS C CE  
1714 N  NZ  . LYS C 65 ? 0.6657 0.7410 0.6193 -0.0405 0.0119  -0.0242 206 LYS C NZ  
1715 N  N   . PRO C 66 ? 0.3133 0.3538 0.3251 -0.0211 0.0038  -0.0177 207 PRO C N   
1716 C  CA  . PRO C 66 ? 0.2763 0.3146 0.2985 -0.0184 -0.0012 -0.0132 207 PRO C CA  
1717 C  C   . PRO C 66 ? 0.2625 0.3063 0.2737 -0.0152 -0.0053 -0.0061 207 PRO C C   
1718 O  O   . PRO C 66 ? 0.2233 0.2738 0.2236 -0.0153 -0.0066 -0.0025 207 PRO C O   
1719 C  CB  . PRO C 66 ? 0.2501 0.2870 0.2837 -0.0213 -0.0050 -0.0112 207 PRO C CB  
1720 C  CG  . PRO C 66 ? 0.2685 0.3101 0.2912 -0.0251 -0.0038 -0.0119 207 PRO C CG  
1721 C  CD  . PRO C 66 ? 0.3273 0.3686 0.3421 -0.0257 0.0031  -0.0194 207 PRO C CD  
1722 N  N   . ILE C 67 ? 0.2474 0.2896 0.2622 -0.0125 -0.0075 -0.0045 208 ILE C N   
1723 C  CA  . ILE C 67 ? 0.2388 0.2864 0.2442 -0.0098 -0.0114 0.0009  208 ILE C CA  
1724 C  C   . ILE C 67 ? 0.2003 0.2496 0.2149 -0.0102 -0.0175 0.0057  208 ILE C C   
1725 O  O   . ILE C 67 ? 0.2462 0.2909 0.2752 -0.0112 -0.0185 0.0046  208 ILE C O   
1726 C  CB  . ILE C 67 ? 0.3293 0.3746 0.3259 -0.0065 -0.0088 -0.0015 208 ILE C CB  
1727 C  CG1 . ILE C 67 ? 0.2468 0.2871 0.2533 -0.0063 -0.0095 -0.0036 208 ILE C CG1 
1728 C  CG2 . ILE C 67 ? 0.3199 0.3629 0.3089 -0.0066 -0.0029 -0.0051 208 ILE C CG2 
1729 C  CD1 . ILE C 67 ? 0.2688 0.3052 0.2674 -0.0041 -0.0071 -0.0061 208 ILE C CD1 
1730 N  N   . GLY C 68 ? 0.2347 0.2916 0.2411 -0.0095 -0.0214 0.0111  209 GLY C N   
1731 C  CA  . GLY C 68 ? 0.2336 0.2946 0.2450 -0.0104 -0.0277 0.0167  209 GLY C CA  
1732 C  C   . GLY C 68 ? 0.2478 0.3062 0.2617 -0.0088 -0.0288 0.0143  209 GLY C C   
1733 O  O   . GLY C 68 ? 0.2511 0.3067 0.2570 -0.0063 -0.0252 0.0094  209 GLY C O   
1734 N  N   . TRP C 69 ? 0.2556 0.3148 0.2821 -0.0105 -0.0342 0.0183  210 TRP C N   
1735 C  CA  . TRP C 69 ? 0.2621 0.3211 0.2924 -0.0101 -0.0368 0.0171  210 TRP C CA  
1736 C  C   . TRP C 69 ? 0.2786 0.3444 0.2932 -0.0094 -0.0386 0.0173  210 TRP C C   
1737 O  O   . TRP C 69 ? 0.2564 0.3203 0.2684 -0.0087 -0.0383 0.0129  210 TRP C O   
1738 C  CB  . TRP C 69 ? 0.1897 0.2507 0.2370 -0.0122 -0.0436 0.0233  210 TRP C CB  
1739 C  CG  . TRP C 69 ? 0.2723 0.3256 0.3384 -0.0115 -0.0409 0.0196  210 TRP C CG  
1740 C  CD1 . TRP C 69 ? 0.3010 0.3505 0.3825 -0.0121 -0.0418 0.0220  210 TRP C CD1 
1741 C  CD2 . TRP C 69 ? 0.2842 0.3327 0.3560 -0.0102 -0.0363 0.0121  210 TRP C CD2 
1742 N  NE1 . TRP C 69 ? 0.2912 0.3348 0.3879 -0.0107 -0.0376 0.0156  210 TRP C NE1 
1743 C  CE2 . TRP C 69 ? 0.2322 0.2760 0.3232 -0.0098 -0.0341 0.0099  210 TRP C CE2 
1744 C  CE3 . TRP C 69 ? 0.2490 0.2967 0.3122 -0.0098 -0.0336 0.0070  210 TRP C CE3 
1745 C  CZ2 . TRP C 69 ? 0.2026 0.2431 0.3039 -0.0090 -0.0290 0.0028  210 TRP C CZ2 
1746 C  CZ3 . TRP C 69 ? 0.2369 0.2803 0.3103 -0.0096 -0.0291 0.0010  210 TRP C CZ3 
1747 C  CH2 . TRP C 69 ? 0.2625 0.3034 0.3544 -0.0093 -0.0266 -0.0011 210 TRP C CH2 
1748 N  N   . ASP C 70 ? 0.2999 0.3739 0.3043 -0.0099 -0.0400 0.0216  211 ASP C N   
1749 C  CA  . ASP C 70 ? 0.3322 0.4144 0.3219 -0.0092 -0.0411 0.0209  211 ASP C CA  
1750 C  C   . ASP C 70 ? 0.3363 0.4163 0.3131 -0.0048 -0.0348 0.0144  211 ASP C C   
1751 O  O   . ASP C 70 ? 0.3200 0.4061 0.2853 -0.0032 -0.0345 0.0123  211 ASP C O   
1752 C  CB  . ASP C 70 ? 0.4096 0.5045 0.3954 -0.0123 -0.0460 0.0293  211 ASP C CB  
1753 C  CG  . ASP C 70 ? 0.5478 0.6463 0.5443 -0.0165 -0.0537 0.0367  211 ASP C CG  
1754 O  OD1 . ASP C 70 ? 0.5787 0.6734 0.5819 -0.0165 -0.0558 0.0342  211 ASP C OD1 
1755 O  OD2 . ASP C 70 ? 0.6792 0.7847 0.6784 -0.0199 -0.0581 0.0459  211 ASP C OD2 
1756 N  N   . THR C 71 ? 0.3498 0.4212 0.3289 -0.0029 -0.0297 0.0112  212 THR C N   
1757 C  CA  . THR C 71 ? 0.2720 0.3394 0.2414 0.0014  -0.0241 0.0060  212 THR C CA  
1758 C  C   . THR C 71 ? 0.2346 0.2967 0.1992 0.0033  -0.0235 0.0002  212 THR C C   
1759 O  O   . THR C 71 ? 0.2367 0.2937 0.2085 0.0011  -0.0252 -0.0016 212 THR C O   
1760 C  CB  . THR C 71 ? 0.2797 0.3381 0.2543 0.0015  -0.0196 0.0039  212 THR C CB  
1761 O  OG1 . THR C 71 ? 0.3146 0.3766 0.2938 -0.0010 -0.0200 0.0077  212 THR C OG1 
1762 C  CG2 . THR C 71 ? 0.2619 0.3160 0.2269 0.0056  -0.0146 0.0005  212 THR C CG2 
1763 N  N   . ASP C 72 ? 0.2671 0.3305 0.2208 0.0075  -0.0210 -0.0030 213 ASP C N   
1764 C  CA  . ASP C 72 ? 0.2225 0.2775 0.1718 0.0098  -0.0193 -0.0097 213 ASP C CA  
1765 C  C   . ASP C 72 ? 0.2762 0.3181 0.2294 0.0106  -0.0152 -0.0116 213 ASP C C   
1766 O  O   . ASP C 72 ? 0.2491 0.2889 0.1997 0.0134  -0.0115 -0.0102 213 ASP C O   
1767 C  CB  . ASP C 72 ? 0.2490 0.3091 0.1872 0.0149  -0.0174 -0.0128 213 ASP C CB  
1768 C  CG  . ASP C 72 ? 0.3036 0.3536 0.2375 0.0177  -0.0154 -0.0206 213 ASP C CG  
1769 O  OD1 . ASP C 72 ? 0.3373 0.3754 0.2759 0.0157  -0.0150 -0.0231 213 ASP C OD1 
1770 O  OD2 . ASP C 72 ? 0.3390 0.3928 0.2652 0.0223  -0.0137 -0.0248 213 ASP C OD2 
1771 N  N   . ILE C 73 ? 0.2729 0.3074 0.2325 0.0075  -0.0159 -0.0143 214 ILE C N   
1772 C  CA  . ILE C 73 ? 0.2534 0.2777 0.2184 0.0064  -0.0121 -0.0152 214 ILE C CA  
1773 C  C   . ILE C 73 ? 0.2522 0.2668 0.2095 0.0102  -0.0081 -0.0178 214 ILE C C   
1774 O  O   . ILE C 73 ? 0.2094 0.2171 0.1677 0.0099  -0.0043 -0.0168 214 ILE C O   
1775 C  CB  . ILE C 73 ? 0.2699 0.2912 0.2455 0.0016  -0.0141 -0.0170 214 ILE C CB  
1776 C  CG1 . ILE C 73 ? 0.2686 0.2839 0.2519 -0.0006 -0.0097 -0.0171 214 ILE C CG1 
1777 C  CG2 . ILE C 73 ? 0.3911 0.4071 0.3630 0.0009  -0.0156 -0.0222 214 ILE C CG2 
1778 C  CD1 . ILE C 73 ? 0.2456 0.2597 0.2414 -0.0050 -0.0109 -0.0189 214 ILE C CD1 
1779 N  N   . SER C 74 ? 0.2890 0.3034 0.2387 0.0139  -0.0088 -0.0209 215 SER C N   
1780 C  CA  . SER C 74 ? 0.2894 0.2934 0.2335 0.0186  -0.0054 -0.0232 215 SER C CA  
1781 C  C   . SER C 74 ? 0.2781 0.2832 0.2195 0.0224  -0.0023 -0.0181 215 SER C C   
1782 O  O   . SER C 74 ? 0.2725 0.2674 0.2127 0.0241  0.0005  -0.0170 215 SER C O   
1783 C  CB  . SER C 74 ? 0.1907 0.1954 0.1281 0.0227  -0.0062 -0.0288 215 SER C CB  
1784 O  OG  . SER C 74 ? 0.2286 0.2465 0.1614 0.0264  -0.0066 -0.0268 215 SER C OG  
1785 N  N   . TRP C 75 ? 0.2556 0.2734 0.1959 0.0230  -0.0032 -0.0143 216 TRP C N   
1786 C  CA  . TRP C 75 ? 0.2640 0.2852 0.2018 0.0256  -0.0010 -0.0095 216 TRP C CA  
1787 C  C   . TRP C 75 ? 0.2913 0.3070 0.2324 0.0211  0.0013  -0.0070 216 TRP C C   
1788 O  O   . TRP C 75 ? 0.2719 0.2879 0.2096 0.0226  0.0033  -0.0033 216 TRP C O   
1789 C  CB  . TRP C 75 ? 0.2755 0.3120 0.2122 0.0257  -0.0028 -0.0063 216 TRP C CB  
1790 C  CG  . TRP C 75 ? 0.2933 0.3377 0.2259 0.0297  -0.0041 -0.0085 216 TRP C CG  
1791 C  CD1 . TRP C 75 ? 0.3302 0.3815 0.2628 0.0271  -0.0071 -0.0103 216 TRP C CD1 
1792 C  CD2 . TRP C 75 ? 0.2387 0.2852 0.1665 0.0372  -0.0022 -0.0096 216 TRP C CD2 
1793 N  NE1 . TRP C 75 ? 0.3093 0.3682 0.2363 0.0318  -0.0066 -0.0130 216 TRP C NE1 
1794 C  CE2 . TRP C 75 ? 0.2671 0.3230 0.1919 0.0386  -0.0034 -0.0132 216 TRP C CE2 
1795 C  CE3 . TRP C 75 ? 0.2332 0.2761 0.1597 0.0429  0.0002  -0.0073 216 TRP C CE3 
1796 C  CZ2 . TRP C 75 ? 0.3588 0.4204 0.2799 0.0460  -0.0013 -0.0161 216 TRP C CZ2 
1797 C  CZ3 . TRP C 75 ? 0.2775 0.3255 0.2018 0.0509  0.0015  -0.0092 216 TRP C CZ3 
1798 C  CH2 . TRP C 75 ? 0.3416 0.3987 0.2634 0.0526  0.0012  -0.0142 216 TRP C CH2 
1799 N  N   . LEU C 76 ? 0.2508 0.2631 0.1987 0.0156  0.0010  -0.0091 217 LEU C N   
1800 C  CA  . LEU C 76 ? 0.2901 0.2990 0.2423 0.0107  0.0040  -0.0083 217 LEU C CA  
1801 C  C   . LEU C 76 ? 0.3054 0.3024 0.2589 0.0086  0.0067  -0.0097 217 LEU C C   
1802 O  O   . LEU C 76 ? 0.2489 0.2444 0.2064 0.0039  0.0098  -0.0097 217 LEU C O   
1803 C  CB  . LEU C 76 ? 0.3252 0.3393 0.2871 0.0061  0.0025  -0.0098 217 LEU C CB  
1804 C  CG  . LEU C 76 ? 0.3606 0.3851 0.3227 0.0069  -0.0008 -0.0077 217 LEU C CG  
1805 C  CD1 . LEU C 76 ? 0.3796 0.4069 0.3532 0.0029  -0.0033 -0.0085 217 LEU C CD1 
1806 C  CD2 . LEU C 76 ? 0.3020 0.3318 0.2593 0.0072  0.0012  -0.0049 217 LEU C CD2 
1807 N  N   . THR C 77 ? 0.2831 0.2719 0.2333 0.0118  0.0059  -0.0112 218 THR C N   
1808 C  CA  . THR C 77 ? 0.3370 0.3133 0.2884 0.0094  0.0079  -0.0119 218 THR C CA  
1809 C  C   . THR C 77 ? 0.3720 0.3465 0.3208 0.0072  0.0118  -0.0070 218 THR C C   
1810 O  O   . THR C 77 ? 0.3747 0.3534 0.3173 0.0106  0.0122  -0.0026 218 THR C O   
1811 C  CB  . THR C 77 ? 0.4162 0.3828 0.3629 0.0146  0.0069  -0.0135 218 THR C CB  
1812 O  OG1 . THR C 77 ? 0.4550 0.4252 0.4029 0.0155  0.0036  -0.0191 218 THR C OG1 
1813 C  CG2 . THR C 77 ? 0.3619 0.3130 0.3099 0.0119  0.0089  -0.0132 218 THR C CG2 
1814 N  N   . GLY C 78 ? 0.3379 0.3083 0.2917 0.0009  0.0146  -0.0076 219 GLY C N   
1815 C  CA  . GLY C 78 ? 0.3430 0.3125 0.2937 -0.0029 0.0188  -0.0032 219 GLY C CA  
1816 C  C   . GLY C 78 ? 0.3434 0.3246 0.2952 -0.0064 0.0214  -0.0035 219 GLY C C   
1817 O  O   . GLY C 78 ? 0.3612 0.3440 0.3104 -0.0110 0.0255  -0.0012 219 GLY C O   
1818 N  N   . GLU C 79 ? 0.3054 0.2950 0.2607 -0.0046 0.0190  -0.0064 220 GLU C N   
1819 C  CA  . GLU C 79 ? 0.3453 0.3446 0.3025 -0.0076 0.0210  -0.0078 220 GLU C CA  
1820 C  C   . GLU C 79 ? 0.3021 0.3031 0.2716 -0.0124 0.0233  -0.0130 220 GLU C C   
1821 O  O   . GLU C 79 ? 0.3133 0.3096 0.2896 -0.0132 0.0223  -0.0149 220 GLU C O   
1822 C  CB  . GLU C 79 ? 0.3692 0.3759 0.3254 -0.0037 0.0171  -0.0076 220 GLU C CB  
1823 C  CG  . GLU C 79 ? 0.5237 0.5329 0.4690 0.0006  0.0158  -0.0024 220 GLU C CG  
1824 C  CD  . GLU C 79 ? 0.7101 0.7264 0.6501 -0.0029 0.0185  -0.0006 220 GLU C CD  
1825 O  OE1 . GLU C 79 ? 0.7960 0.8190 0.7402 -0.0060 0.0190  -0.0040 220 GLU C OE1 
1826 O  OE2 . GLU C 79 ? 0.7588 0.7740 0.6906 -0.0027 0.0198  0.0043  220 GLU C OE2 
1827 N  N   . GLU C 80 ? 0.3140 0.3219 0.2869 -0.0158 0.0266  -0.0159 221 GLU C N   
1828 C  CA  . GLU C 80 ? 0.2939 0.3046 0.2813 -0.0191 0.0289  -0.0215 221 GLU C CA  
1829 C  C   . GLU C 80 ? 0.3177 0.3329 0.3129 -0.0167 0.0249  -0.0233 221 GLU C C   
1830 O  O   . GLU C 80 ? 0.3680 0.3870 0.3571 -0.0158 0.0242  -0.0223 221 GLU C O   
1831 C  CB  . GLU C 80 ? 0.3777 0.3932 0.3651 -0.0244 0.0360  -0.0249 221 GLU C CB  
1832 C  CG  . GLU C 80 ? 0.5600 0.5730 0.5366 -0.0279 0.0401  -0.0212 221 GLU C CG  
1833 C  CD  . GLU C 80 ? 0.6440 0.6636 0.6231 -0.0344 0.0479  -0.0257 221 GLU C CD  
1834 O  OE1 . GLU C 80 ? 0.6543 0.6807 0.6364 -0.0356 0.0502  -0.0313 221 GLU C OE1 
1835 O  OE2 . GLU C 80 ? 0.7205 0.7385 0.6990 -0.0387 0.0518  -0.0243 221 GLU C OE2 
1836 N  N   . LEU C 81 ? 0.2058 0.2211 0.2144 -0.0160 0.0219  -0.0251 222 LEU C N   
1837 C  CA  . LEU C 81 ? 0.2226 0.2420 0.2410 -0.0147 0.0183  -0.0259 222 LEU C CA  
1838 C  C   . LEU C 81 ? 0.2280 0.2500 0.2631 -0.0172 0.0222  -0.0315 222 LEU C C   
1839 O  O   . LEU C 81 ? 0.2212 0.2432 0.2626 -0.0197 0.0263  -0.0346 222 LEU C O   
1840 C  CB  . LEU C 81 ? 0.2106 0.2299 0.2331 -0.0120 0.0109  -0.0228 222 LEU C CB  
1841 C  CG  . LEU C 81 ? 0.2568 0.2743 0.2650 -0.0089 0.0073  -0.0188 222 LEU C CG  
1842 C  CD1 . LEU C 81 ? 0.2894 0.3090 0.3018 -0.0075 0.0005  -0.0169 222 LEU C CD1 
1843 C  CD2 . LEU C 81 ? 0.2262 0.2464 0.2224 -0.0071 0.0077  -0.0162 222 LEU C CD2 
1844 N  N   . HIS C 82 ? 0.2654 0.2897 0.3090 -0.0165 0.0207  -0.0330 223 HIS C N   
1845 C  CA  . HIS C 82 ? 0.2240 0.2502 0.2852 -0.0179 0.0246  -0.0392 223 HIS C CA  
1846 C  C   . HIS C 82 ? 0.2655 0.2919 0.3416 -0.0152 0.0179  -0.0366 223 HIS C C   
1847 O  O   . HIS C 82 ? 0.2003 0.2262 0.2708 -0.0141 0.0131  -0.0323 223 HIS C O   
1848 C  CB  . HIS C 82 ? 0.2710 0.2987 0.3277 -0.0207 0.0311  -0.0450 223 HIS C CB  
1849 C  CG  . HIS C 82 ? 0.4170 0.4466 0.4641 -0.0244 0.0387  -0.0483 223 HIS C CG  
1850 N  ND1 . HIS C 82 ? 0.4626 0.4910 0.4909 -0.0253 0.0386  -0.0432 223 HIS C ND1 
1851 C  CD2 . HIS C 82 ? 0.4836 0.5170 0.5376 -0.0279 0.0468  -0.0558 223 HIS C CD2 
1852 C  CE1 . HIS C 82 ? 0.4715 0.5025 0.4949 -0.0296 0.0458  -0.0462 223 HIS C CE1 
1853 N  NE2 . HIS C 82 ? 0.4856 0.5204 0.5236 -0.0315 0.0512  -0.0542 223 HIS C NE2 
1854 N  N   . VAL C 83 ? 0.2097 0.2378 0.3054 -0.0145 0.0173  -0.0383 224 VAL C N   
1855 C  CA  . VAL C 83 ? 0.1935 0.2223 0.3048 -0.0119 0.0099  -0.0341 224 VAL C CA  
1856 C  C   . VAL C 83 ? 0.2005 0.2294 0.3342 -0.0110 0.0133  -0.0400 224 VAL C C   
1857 O  O   . VAL C 83 ? 0.2231 0.2547 0.3683 -0.0115 0.0193  -0.0465 224 VAL C O   
1858 C  CB  . VAL C 83 ? 0.2555 0.2874 0.3738 -0.0111 0.0038  -0.0294 224 VAL C CB  
1859 C  CG1 . VAL C 83 ? 0.2906 0.3245 0.4289 -0.0088 -0.0036 -0.0247 224 VAL C CG1 
1860 C  CG2 . VAL C 83 ? 0.2611 0.2921 0.3587 -0.0113 -0.0007 -0.0240 224 VAL C CG2 
1861 N  N   . GLU C 84 ? 0.2350 0.2608 0.3750 -0.0099 0.0096  -0.0380 225 GLU C N   
1862 C  CA  . GLU C 84 ? 0.3145 0.3381 0.4765 -0.0086 0.0127  -0.0442 225 GLU C CA  
1863 C  C   . GLU C 84 ? 0.2761 0.2984 0.4571 -0.0054 0.0035  -0.0364 225 GLU C C   
1864 O  O   . GLU C 84 ? 0.2342 0.2564 0.4061 -0.0057 -0.0047 -0.0266 225 GLU C O   
1865 C  CB  . GLU C 84 ? 0.4055 0.4247 0.5587 -0.0110 0.0176  -0.0502 225 GLU C CB  
1866 C  CG  . GLU C 84 ? 0.5100 0.5318 0.6501 -0.0143 0.0277  -0.0594 225 GLU C CG  
1867 C  CD  . GLU C 84 ? 0.5646 0.5837 0.6962 -0.0176 0.0319  -0.0658 225 GLU C CD  
1868 O  OE1 . GLU C 84 ? 0.6079 0.6218 0.7469 -0.0171 0.0275  -0.0640 225 GLU C OE1 
1869 O  OE2 . GLU C 84 ? 0.5671 0.5895 0.6843 -0.0213 0.0393  -0.0721 225 GLU C OE2 
1870 N  N   . VAL C 85 ? 0.2702 0.2924 0.4780 -0.0025 0.0049  -0.0404 226 VAL C N   
1871 C  CA  . VAL C 85 ? 0.2638 0.2843 0.4928 0.0007  -0.0041 -0.0322 226 VAL C CA  
1872 C  C   . VAL C 85 ? 0.2610 0.2725 0.4918 0.0002  -0.0056 -0.0316 226 VAL C C   
1873 O  O   . VAL C 85 ? 0.2771 0.2838 0.5078 -0.0010 0.0025  -0.0423 226 VAL C O   
1874 C  CB  . VAL C 85 ? 0.2701 0.2940 0.5299 0.0050  -0.0029 -0.0357 226 VAL C CB  
1875 C  CG1 . VAL C 85 ? 0.3597 0.3826 0.6398 0.0083  -0.0141 -0.0242 226 VAL C CG1 
1876 C  CG2 . VAL C 85 ? 0.2491 0.2827 0.5066 0.0043  -0.0010 -0.0368 226 VAL C CG2 
1877 N  N   . LEU C 86 ? 0.1572 0.1672 0.3883 0.0000  -0.0159 -0.0191 227 LEU C N   
1878 C  CA  . LEU C 86 ? 0.1992 0.2004 0.4334 -0.0014 -0.0186 -0.0165 227 LEU C CA  
1879 C  C   . LEU C 86 ? 0.2237 0.2173 0.4888 0.0024  -0.0162 -0.0227 227 LEU C C   
1880 O  O   . LEU C 86 ? 0.2047 0.2016 0.4917 0.0069  -0.0172 -0.0227 227 LEU C O   
1881 C  CB  . LEU C 86 ? 0.2834 0.2860 0.5153 -0.0025 -0.0306 -0.0002 227 LEU C CB  
1882 C  CG  . LEU C 86 ? 0.3547 0.3650 0.5575 -0.0059 -0.0335 0.0061  227 LEU C CG  
1883 C  CD1 . LEU C 86 ? 0.3846 0.3983 0.5867 -0.0074 -0.0449 0.0218  227 LEU C CD1 
1884 C  CD2 . LEU C 86 ? 0.3468 0.3548 0.5281 -0.0094 -0.0268 -0.0008 227 LEU C CD2 
1885 N  N   . GLU C 87 ? 0.2668 0.2507 0.5336 0.0004  -0.0127 -0.0290 228 GLU C N   
1886 C  CA  . GLU C 87 ? 0.3462 0.3205 0.6419 0.0038  -0.0097 -0.0368 228 GLU C CA  
1887 C  C   . GLU C 87 ? 0.3407 0.3118 0.6626 0.0081  -0.0204 -0.0237 228 GLU C C   
1888 O  O   . GLU C 87 ? 0.4066 0.3776 0.7223 0.0059  -0.0306 -0.0085 228 GLU C O   
1889 C  CB  . GLU C 87 ? 0.4187 0.3823 0.7088 -0.0006 -0.0060 -0.0441 228 GLU C CB  
1890 C  CG  . GLU C 87 ? 0.5336 0.5006 0.8027 -0.0046 0.0054  -0.0591 228 GLU C CG  
1891 C  CD  . GLU C 87 ? 0.6148 0.5828 0.9003 -0.0013 0.0162  -0.0754 228 GLU C CD  
1892 O  OE1 . GLU C 87 ? 0.6740 0.6323 0.9774 -0.0004 0.0206  -0.0860 228 GLU C OE1 
1893 O  OE2 . GLU C 87 ? 0.5768 0.5553 0.8579 0.0003  0.0206  -0.0781 228 GLU C OE2 
1894 N  N   . ASN C 88 ? 0.2687 0.2382 0.6206 0.0143  -0.0178 -0.0295 229 ASN C N   
1895 C  CA  . ASN C 88 ? 0.2414 0.2090 0.6221 0.0195  -0.0278 -0.0173 229 ASN C CA  
1896 C  C   . ASN C 88 ? 0.3016 0.2532 0.6984 0.0193  -0.0328 -0.0126 229 ASN C C   
1897 O  O   . ASN C 88 ? 0.3538 0.2953 0.7790 0.0242  -0.0292 -0.0211 229 ASN C O   
1898 C  CB  . ASN C 88 ? 0.3318 0.3041 0.7416 0.0267  -0.0226 -0.0261 229 ASN C CB  
1899 C  CG  . ASN C 88 ? 0.4829 0.4569 0.9228 0.0326  -0.0339 -0.0118 229 ASN C CG  
1900 O  OD1 . ASN C 88 ? 0.5167 0.4907 0.9520 0.0305  -0.0462 0.0059  229 ASN C OD1 
1901 N  ND2 . ASN C 88 ? 0.5712 0.5485 1.0424 0.0399  -0.0300 -0.0190 229 ASN C ND2 
1902 N  N   . VAL C 89 ? 0.3654 0.3146 0.7443 0.0136  -0.0407 0.0002  230 VAL C N   
1903 C  CA  . VAL C 89 ? 0.3668 0.3009 0.7586 0.0119  -0.0464 0.0068  230 VAL C CA  
1904 C  C   . VAL C 89 ? 0.3868 0.3258 0.7765 0.0099  -0.0608 0.0299  230 VAL C C   
1905 O  O   . VAL C 89 ? 0.3981 0.3487 0.7601 0.0052  -0.0638 0.0373  230 VAL C O   
1906 C  CB  . VAL C 89 ? 0.3815 0.3083 0.7510 0.0044  -0.0408 -0.0015 230 VAL C CB  
1907 C  CG1 . VAL C 89 ? 0.3611 0.2729 0.7425 0.0010  -0.0484 0.0083  230 VAL C CG1 
1908 C  CG2 . VAL C 89 ? 0.3683 0.2912 0.7392 0.0054  -0.0267 -0.0247 230 VAL C CG2 
1909 N  N   . PRO C 90 ? 0.3550 0.2855 0.7744 0.0134  -0.0696 0.0413  231 PRO C N   
1910 C  CA  . PRO C 90 ? 0.3793 0.3173 0.8004 0.0122  -0.0839 0.0646  231 PRO C CA  
1911 C  C   . PRO C 90 ? 0.3571 0.3006 0.7459 0.0028  -0.0892 0.0764  231 PRO C C   
1912 O  O   . PRO C 90 ? 0.2595 0.1944 0.6363 -0.0028 -0.0859 0.0726  231 PRO C O   
1913 C  CB  . PRO C 90 ? 0.3740 0.2966 0.8322 0.0163  -0.0913 0.0735  231 PRO C CB  
1914 C  CG  . PRO C 90 ? 0.3881 0.2994 0.8703 0.0232  -0.0799 0.0526  231 PRO C CG  
1915 C  CD  . PRO C 90 ? 0.4067 0.3200 0.8604 0.0189  -0.0665 0.0329  231 PRO C CD  
1916 N  N   . LEU C 91 ? 0.4111 0.3706 0.7868 0.0011  -0.0973 0.0902  232 LEU C N   
1917 C  CA  . LEU C 91 ? 0.4089 0.3773 0.7559 -0.0071 -0.1028 0.1026  232 LEU C CA  
1918 C  C   . LEU C 91 ? 0.4036 0.3691 0.7652 -0.0099 -0.1164 0.1249  232 LEU C C   
1919 O  O   . LEU C 91 ? 0.4451 0.4078 0.8355 -0.0046 -0.1233 0.1330  232 LEU C O   
1920 C  CB  . LEU C 91 ? 0.4198 0.4075 0.7444 -0.0076 -0.1035 0.1037  232 LEU C CB  
1921 C  CG  . LEU C 91 ? 0.4270 0.4193 0.7393 -0.0046 -0.0919 0.0848  232 LEU C CG  
1922 C  CD1 . LEU C 91 ? 0.4161 0.4260 0.7092 -0.0057 -0.0949 0.0887  232 LEU C CD1 
1923 C  CD2 . LEU C 91 ? 0.4316 0.4181 0.7230 -0.0080 -0.0813 0.0712  232 LEU C CD2 
1924 N  N   . THR C 92 ? 0.2702 0.2374 0.6136 -0.0182 -0.1207 0.1358  233 THR C N   
1925 C  CA  . THR C 92 ? 0.2893 0.2525 0.6474 -0.0219 -0.1334 0.1577  233 THR C CA  
1926 C  C   . THR C 92 ? 0.9124 0.8898 1.2779 -0.0208 -0.1460 0.1767  233 THR C C   
1927 O  O   . THR C 92 ? 0.8784 0.8563 1.2503 -0.0255 -0.1573 0.1974  233 THR C O   
1928 C  CB  . THR C 92 ? 0.3340 0.2984 0.6707 -0.0322 -0.1355 0.1669  233 THR C CB  
1929 O  OG1 . THR C 92 ? 0.3798 0.3639 0.6822 -0.0364 -0.1330 0.1657  233 THR C OG1 
1930 C  CG2 . THR C 92 ? 0.3245 0.2710 0.6640 -0.0344 -0.1269 0.1534  233 THR C CG2 
1931 N  N   . THR C 93 ? 0.9717 0.9611 1.3363 -0.0155 -0.1445 0.1704  234 THR C N   
1932 C  CA  . THR C 93 ? 1.0002 1.0031 1.3748 -0.0145 -0.1568 0.1874  234 THR C CA  
1933 C  C   . THR C 93 ? 1.0406 1.0355 1.4559 -0.0051 -0.1605 0.1884  234 THR C C   
1934 O  O   . THR C 93 ? 1.0329 1.0408 1.4585 -0.0022 -0.1682 0.1969  234 THR C O   
1935 C  CB  . THR C 93 ? 0.9334 0.9573 1.2829 -0.0157 -0.1555 0.1829  234 THR C CB  
1936 O  OG1 . THR C 93 ? 0.9286 0.9494 1.2768 -0.0099 -0.1430 0.1606  234 THR C OG1 
1937 C  CG2 . THR C 93 ? 0.9155 0.9504 1.2281 -0.0247 -0.1551 0.1867  234 THR C CG2 
1938 N  N   . HIS C 94 ? 1.0679 1.0420 1.5067 -0.0005 -0.1548 0.1795  235 HIS C N   
1939 C  CA  . HIS C 94 ? 1.0851 1.0505 1.5642 0.0097  -0.1560 0.1770  235 HIS C CA  
1940 C  C   . HIS C 94 ? 1.0871 1.0278 1.5935 0.0118  -0.1561 0.1778  235 HIS C C   
1941 O  O   . HIS C 94 ? 1.0859 1.0199 1.5972 0.0068  -0.1662 0.1967  235 HIS C O   
1942 C  CB  . HIS C 94 ? 1.1009 1.0694 1.5817 0.0165  -0.1429 0.1532  235 HIS C CB  
1943 C  CG  . HIS C 94 ? 1.1069 1.0926 1.5514 0.0120  -0.1376 0.1454  235 HIS C CG  
1944 N  ND1 . HIS C 94 ? 1.1032 1.0859 1.5230 0.0095  -0.1245 0.1269  235 HIS C ND1 
1945 C  CD2 . HIS C 94 ? 1.1036 1.1095 1.5330 0.0095  -0.1438 0.1535  235 HIS C CD2 
1946 C  CE1 . HIS C 94 ? 1.0938 1.0926 1.4861 0.0063  -0.1229 0.1244  235 HIS C CE1 
1947 N  NE2 . HIS C 94 ? 1.0999 1.1126 1.4970 0.0061  -0.1342 0.1395  235 HIS C NE2 
1948 N  N   . HIS D 10 ? 0.6906 0.6305 0.7062 -0.0380 -0.0625 0.0409  151 HIS D N   
1949 C  CA  . HIS D 10 ? 0.7081 0.6586 0.7178 -0.0396 -0.0580 0.0369  151 HIS D CA  
1950 C  C   . HIS D 10 ? 0.6335 0.5792 0.6465 -0.0456 -0.0605 0.0350  151 HIS D C   
1951 O  O   . HIS D 10 ? 0.4716 0.4217 0.4803 -0.0453 -0.0580 0.0281  151 HIS D O   
1952 C  CB  . HIS D 10 ? 0.8035 0.7704 0.8080 -0.0407 -0.0543 0.0446  151 HIS D CB  
1953 C  CG  . HIS D 10 ? 0.9031 0.8806 0.9006 -0.0371 -0.0487 0.0378  151 HIS D CG  
1954 N  ND1 . HIS D 10 ? 0.9144 0.8973 0.9085 -0.0313 -0.0458 0.0348  151 HIS D ND1 
1955 C  CD2 . HIS D 10 ? 0.9250 0.9082 0.9195 -0.0384 -0.0457 0.0336  151 HIS D CD2 
1956 C  CE1 . HIS D 10 ? 0.8742 0.8647 0.8640 -0.0294 -0.0412 0.0293  151 HIS D CE1 
1957 N  NE2 . HIS D 10 ? 0.9032 0.8940 0.8927 -0.0334 -0.0409 0.0288  151 HIS D NE2 
1958 N  N   . MSE D 11 ? 0.6654 0.6025 0.6866 -0.0509 -0.0658 0.0414  152 MSE D N   
1959 C  CA  . MSE D 11 ? 0.6824 0.6125 0.7091 -0.0565 -0.0698 0.0380  152 MSE D CA  
1960 C  C   . MSE D 11 ? 0.6314 0.5500 0.6570 -0.0519 -0.0713 0.0243  152 MSE D C   
1961 O  O   . MSE D 11 ? 0.5494 0.4693 0.5721 -0.0526 -0.0712 0.0163  152 MSE D O   
1962 C  CB  . MSE D 11 ? 0.7326 0.6526 0.7706 -0.0627 -0.0757 0.0472  152 MSE D CB  
1963 C  CG  . MSE D 11 ? 0.7856 0.6976 0.8312 -0.0690 -0.0808 0.0429  152 MSE D CG  
1964 SE SE  . MSE D 11 ? 1.3304 1.2616 1.3721 -0.0746 -0.0775 0.0435  152 MSE D SE  
1965 C  CE  . MSE D 11 ? 0.9888 0.9099 1.0475 -0.0860 -0.0863 0.0468  152 MSE D CE  
1966 N  N   . GLN D 12 ? 0.6294 0.5378 0.6574 -0.0467 -0.0726 0.0217  153 GLN D N   
1967 C  CA  . GLN D 12 ? 0.6306 0.5288 0.6579 -0.0411 -0.0734 0.0088  153 GLN D CA  
1968 C  C   . GLN D 12 ? 0.5996 0.5078 0.6171 -0.0348 -0.0665 0.0014  153 GLN D C   
1969 O  O   . GLN D 12 ? 0.6584 0.5657 0.6715 -0.0326 -0.0653 -0.0085 153 GLN D O   
1970 C  CB  . GLN D 12 ? 0.6815 0.5659 0.7162 -0.0372 -0.0771 0.0089  153 GLN D CB  
1971 N  N   . LYS D 13 ? 0.4797 0.3976 0.4940 -0.0319 -0.0622 0.0063  154 LYS D N   
1972 C  CA  . LYS D 13 ? 0.4187 0.3449 0.4262 -0.0262 -0.0559 -0.0003 154 LYS D CA  
1973 C  C   . LYS D 13 ? 0.3639 0.3056 0.3657 -0.0274 -0.0510 0.0047  154 LYS D C   
1974 O  O   . LYS D 13 ? 0.3907 0.3388 0.3924 -0.0256 -0.0494 0.0097  154 LYS D O   
1975 C  CB  . LYS D 13 ? 0.4587 0.3806 0.4692 -0.0194 -0.0549 -0.0036 154 LYS D CB  
1976 C  CG  . LYS D 13 ? 0.5087 0.4165 0.5240 -0.0160 -0.0581 -0.0117 154 LYS D CG  
1977 C  CD  . LYS D 13 ? 0.5515 0.4543 0.5733 -0.0106 -0.0594 -0.0112 154 LYS D CD  
1978 C  CE  . LYS D 13 ? 0.5876 0.4749 0.6159 -0.0074 -0.0636 -0.0182 154 LYS D CE  
1979 N  NZ  . LYS D 13 ? 0.5678 0.4533 0.5920 -0.0036 -0.0606 -0.0306 154 LYS D NZ  
1980 N  N   . PRO D 14 ? 0.3864 0.3344 0.3835 -0.0299 -0.0491 0.0029  155 PRO D N   
1981 C  CA  . PRO D 14 ? 0.3726 0.3350 0.3649 -0.0303 -0.0444 0.0069  155 PRO D CA  
1982 C  C   . PRO D 14 ? 0.3060 0.2729 0.2949 -0.0241 -0.0387 0.0014  155 PRO D C   
1983 O  O   . PRO D 14 ? 0.2977 0.2609 0.2846 -0.0207 -0.0366 -0.0062 155 PRO D O   
1984 C  CB  . PRO D 14 ? 0.3653 0.3320 0.3547 -0.0341 -0.0445 0.0057  155 PRO D CB  
1985 C  CG  . PRO D 14 ? 0.4228 0.3788 0.4121 -0.0327 -0.0470 -0.0031 155 PRO D CG  
1986 C  CD  . PRO D 14 ? 0.3981 0.3413 0.3939 -0.0320 -0.0513 -0.0033 155 PRO D CD  
1987 N  N   . ILE D 15 ? 0.2793 0.2547 0.2677 -0.0226 -0.0361 0.0054  156 ILE D N   
1988 C  CA  . ILE D 15 ? 0.2477 0.2277 0.2350 -0.0174 -0.0310 0.0008  156 ILE D CA  
1989 C  C   . ILE D 15 ? 0.2522 0.2447 0.2366 -0.0177 -0.0276 0.0040  156 ILE D C   
1990 O  O   . ILE D 15 ? 0.2474 0.2457 0.2303 -0.0213 -0.0290 0.0101  156 ILE D O   
1991 C  CB  . ILE D 15 ? 0.3161 0.2920 0.3086 -0.0135 -0.0323 -0.0004 156 ILE D CB  
1992 C  CG1 . ILE D 15 ? 0.3488 0.3270 0.3426 -0.0154 -0.0363 0.0074  156 ILE D CG1 
1993 C  CG2 . ILE D 15 ? 0.2651 0.2289 0.2613 -0.0116 -0.0349 -0.0050 156 ILE D CG2 
1994 C  CD1 . ILE D 15 ? 0.3270 0.3156 0.3199 -0.0129 -0.0343 0.0087  156 ILE D CD1 
1995 N  N   . VAL D 16 ? 0.2024 0.1989 0.1868 -0.0138 -0.0230 -0.0001 157 VAL D N   
1996 C  CA  . VAL D 16 ? 0.1700 0.1768 0.1528 -0.0132 -0.0199 0.0014  157 VAL D CA  
1997 C  C   . VAL D 16 ? 0.2014 0.2091 0.1887 -0.0090 -0.0185 -0.0020 157 VAL D C   
1998 O  O   . VAL D 16 ? 0.1897 0.1924 0.1809 -0.0062 -0.0168 -0.0068 157 VAL D O   
1999 C  CB  . VAL D 16 ? 0.2783 0.2888 0.2582 -0.0126 -0.0154 -0.0007 157 VAL D CB  
2000 C  CG1 . VAL D 16 ? 0.2363 0.2559 0.2164 -0.0109 -0.0120 -0.0003 157 VAL D CG1 
2001 C  CG2 . VAL D 16 ? 0.3320 0.3431 0.3083 -0.0168 -0.0176 0.0023  157 VAL D CG2 
2002 N  N   . ARG D 17 ? 0.1809 0.1958 0.1679 -0.0086 -0.0196 0.0003  158 ARG D N   
2003 C  CA  . ARG D 17 ? 0.1873 0.2047 0.1789 -0.0050 -0.0192 -0.0034 158 ARG D CA  
2004 C  C   . ARG D 17 ? 0.2506 0.2732 0.2437 -0.0032 -0.0143 -0.0072 158 ARG D C   
2005 O  O   . ARG D 17 ? 0.2567 0.2855 0.2459 -0.0042 -0.0127 -0.0053 158 ARG D O   
2006 C  CB  . ARG D 17 ? 0.2724 0.2963 0.2616 -0.0050 -0.0231 0.0006  158 ARG D CB  
2007 C  CG  . ARG D 17 ? 0.3207 0.3392 0.3095 -0.0065 -0.0283 0.0058  158 ARG D CG  
2008 C  CD  . ARG D 17 ? 0.4179 0.4449 0.4022 -0.0068 -0.0313 0.0117  158 ARG D CD  
2009 N  NE  . ARG D 17 ? 0.5732 0.6072 0.5521 -0.0099 -0.0291 0.0161  158 ARG D NE  
2010 C  CZ  . ARG D 17 ? 0.7166 0.7598 0.6904 -0.0108 -0.0302 0.0224  158 ARG D CZ  
2011 N  NH1 . ARG D 17 ? 0.7368 0.7834 0.7089 -0.0088 -0.0337 0.0255  158 ARG D NH1 
2012 N  NH2 . ARG D 17 ? 0.7836 0.8338 0.7540 -0.0135 -0.0275 0.0259  158 ARG D NH2 
2013 N  N   . VAL D 18 ? 0.2564 0.2767 0.2564 -0.0005 -0.0118 -0.0122 159 VAL D N   
2014 C  CA  . VAL D 18 ? 0.1994 0.2227 0.2029 0.0010  -0.0069 -0.0152 159 VAL D CA  
2015 C  C   . VAL D 18 ? 0.1924 0.2187 0.2041 0.0035  -0.0073 -0.0198 159 VAL D C   
2016 O  O   . VAL D 18 ? 0.2563 0.2796 0.2752 0.0049  -0.0077 -0.0226 159 VAL D O   
2017 C  CB  . VAL D 18 ? 0.1995 0.2174 0.2048 0.0016  -0.0021 -0.0164 159 VAL D CB  
2018 C  CG1 . VAL D 18 ? 0.2396 0.2605 0.2494 0.0031  0.0033  -0.0179 159 VAL D CG1 
2019 C  CG2 . VAL D 18 ? 0.2289 0.2438 0.2259 -0.0006 -0.0027 -0.0132 159 VAL D CG2 
2020 N  N   . PHE D 19 ? 0.2444 0.2770 0.2559 0.0042  -0.0071 -0.0212 160 PHE D N   
2021 C  CA  . PHE D 19 ? 0.2362 0.2715 0.2566 0.0064  -0.0076 -0.0269 160 PHE D CA  
2022 C  C   . PHE D 19 ? 0.2752 0.3079 0.3046 0.0071  -0.0021 -0.0295 160 PHE D C   
2023 O  O   . PHE D 19 ? 0.3128 0.3456 0.3397 0.0068  0.0017  -0.0276 160 PHE D O   
2024 C  CB  . PHE D 19 ? 0.2562 0.2995 0.2725 0.0075  -0.0105 -0.0285 160 PHE D CB  
2025 C  CG  . PHE D 19 ? 0.2594 0.3064 0.2685 0.0074  -0.0157 -0.0256 160 PHE D CG  
2026 C  CD1 . PHE D 19 ? 0.2159 0.2641 0.2153 0.0051  -0.0161 -0.0188 160 PHE D CD1 
2027 C  CD2 . PHE D 19 ? 0.3310 0.3798 0.3439 0.0092  -0.0205 -0.0287 160 PHE D CD2 
2028 C  CE1 . PHE D 19 ? 0.3255 0.3768 0.3189 0.0047  -0.0207 -0.0145 160 PHE D CE1 
2029 C  CE2 . PHE D 19 ? 0.3495 0.4016 0.3551 0.0093  -0.0255 -0.0244 160 PHE D CE2 
2030 C  CZ  . PHE D 19 ? 0.3391 0.3922 0.3351 0.0070  -0.0253 -0.0170 160 PHE D CZ  
2031 N  N   . LEU D 20 ? 0.2925 0.3233 0.3332 0.0080  -0.0017 -0.0331 161 LEU D N   
2032 C  CA  . LEU D 20 ? 0.2870 0.3152 0.3381 0.0083  0.0041  -0.0343 161 LEU D CA  
2033 C  C   . LEU D 20 ? 0.3286 0.3597 0.3914 0.0092  0.0030  -0.0401 161 LEU D C   
2034 O  O   . LEU D 20 ? 0.2275 0.2629 0.2907 0.0101  -0.0027 -0.0444 161 LEU D O   
2035 C  CB  . LEU D 20 ? 0.2281 0.2527 0.2856 0.0085  0.0066  -0.0339 161 LEU D CB  
2036 C  CG  . LEU D 20 ? 0.2938 0.3147 0.3396 0.0080  0.0072  -0.0295 161 LEU D CG  
2037 C  CD1 . LEU D 20 ? 0.1717 0.1893 0.2221 0.0091  0.0090  -0.0300 161 LEU D CD1 
2038 C  CD2 . LEU D 20 ? 0.2597 0.2798 0.2985 0.0074  0.0119  -0.0257 161 LEU D CD2 
2039 N  N   . PRO D 21 ? 0.3493 0.3781 0.4220 0.0091  0.0084  -0.0402 162 PRO D N   
2040 C  CA  . PRO D 21 ? 0.4103 0.4402 0.4980 0.0094  0.0077  -0.0460 162 PRO D CA  
2041 C  C   . PRO D 21 ? 0.3312 0.3634 0.4295 0.0095  0.0030  -0.0514 162 PRO D C   
2042 O  O   . PRO D 21 ? 0.2610 0.2929 0.3585 0.0095  0.0027  -0.0494 162 PRO D O   
2043 C  CB  . PRO D 21 ? 0.4020 0.4275 0.4995 0.0087  0.0153  -0.0425 162 PRO D CB  
2044 C  CG  . PRO D 21 ? 0.3309 0.3544 0.4150 0.0088  0.0195  -0.0353 162 PRO D CG  
2045 C  CD  . PRO D 21 ? 0.3186 0.3435 0.3893 0.0087  0.0152  -0.0344 162 PRO D CD  
2046 N  N   . ASN D 22 ? 0.3107 0.3458 0.4190 0.0100  -0.0011 -0.0586 163 ASN D N   
2047 C  CA  . ASN D 22 ? 0.3949 0.4337 0.5145 0.0103  -0.0066 -0.0645 163 ASN D CA  
2048 C  C   . ASN D 22 ? 0.3567 0.3999 0.4657 0.0118  -0.0134 -0.0649 163 ASN D C   
2049 O  O   . ASN D 22 ? 0.3189 0.3637 0.4356 0.0121  -0.0160 -0.0662 163 ASN D O   
2050 C  CB  . ASN D 22 ? 0.4569 0.4936 0.5926 0.0088  -0.0018 -0.0628 163 ASN D CB  
2051 C  CG  . ASN D 22 ? 0.5815 0.6150 0.7322 0.0072  0.0038  -0.0630 163 ASN D CG  
2052 O  OD1 . ASN D 22 ? 0.6226 0.6529 0.7782 0.0061  0.0114  -0.0570 163 ASN D OD1 
2053 N  ND2 . ASN D 22 ? 0.5873 0.6214 0.7448 0.0073  0.0001  -0.0696 163 ASN D ND2 
2054 N  N   . LYS D 23 ? 0.3483 0.3937 0.4405 0.0128  -0.0161 -0.0631 164 LYS D N   
2055 C  CA  . LYS D 23 ? 0.3405 0.3901 0.4218 0.0143  -0.0225 -0.0620 164 LYS D CA  
2056 C  C   . LYS D 23 ? 0.2694 0.3149 0.3473 0.0136  -0.0211 -0.0556 164 LYS D C   
2057 O  O   . LYS D 23 ? 0.3110 0.3586 0.3859 0.0149  -0.0264 -0.0548 164 LYS D O   
2058 C  CB  . LYS D 23 ? 0.3741 0.4300 0.4637 0.0161  -0.0300 -0.0696 164 LYS D CB  
2059 C  CG  . LYS D 23 ? 0.5070 0.5672 0.5998 0.0173  -0.0328 -0.0778 164 LYS D CG  
2060 C  CD  . LYS D 23 ? 0.6058 0.6672 0.6833 0.0181  -0.0306 -0.0754 164 LYS D CD  
2061 C  CE  . LYS D 23 ? 0.6925 0.7562 0.7753 0.0196  -0.0317 -0.0842 164 LYS D CE  
2062 N  NZ  . LYS D 23 ? 0.7443 0.8162 0.8285 0.0225  -0.0402 -0.0937 164 LYS D NZ  
2063 N  N   . GLN D 24 ? 0.2031 0.2427 0.2812 0.0121  -0.0142 -0.0512 165 GLN D N   
2064 C  CA  . GLN D 24 ? 0.2305 0.2657 0.3064 0.0120  -0.0127 -0.0467 165 GLN D CA  
2065 C  C   . GLN D 24 ? 0.1395 0.1713 0.1992 0.0109  -0.0115 -0.0404 165 GLN D C   
2066 O  O   . GLN D 24 ? 0.1822 0.2154 0.2336 0.0100  -0.0105 -0.0387 165 GLN D O   
2067 C  CB  . GLN D 24 ? 0.2721 0.3043 0.3605 0.0116  -0.0060 -0.0469 165 GLN D CB  
2068 C  CG  . GLN D 24 ? 0.2744 0.3104 0.3812 0.0122  -0.0078 -0.0524 165 GLN D CG  
2069 C  CD  . GLN D 24 ? 0.2720 0.3066 0.3917 0.0121  -0.0012 -0.0514 165 GLN D CD  
2070 O  OE1 . GLN D 24 ? 0.3137 0.3443 0.4269 0.0124  0.0039  -0.0470 165 GLN D OE1 
2071 N  NE2 . GLN D 24 ? 0.3021 0.3406 0.4407 0.0118  -0.0014 -0.0558 165 GLN D NE2 
2072 N  N   . ARG D 25 ? 0.2209 0.2486 0.2771 0.0111  -0.0122 -0.0372 166 ARG D N   
2073 C  CA  . ARG D 25 ? 0.2610 0.2852 0.3035 0.0095  -0.0123 -0.0317 166 ARG D CA  
2074 C  C   . ARG D 25 ? 0.2539 0.2713 0.2956 0.0096  -0.0100 -0.0299 166 ARG D C   
2075 O  O   . ARG D 25 ? 0.3147 0.3306 0.3657 0.0114  -0.0086 -0.0325 166 ARG D O   
2076 C  CB  . ARG D 25 ? 0.3685 0.3954 0.4028 0.0094  -0.0191 -0.0290 166 ARG D CB  
2077 C  CG  . ARG D 25 ? 0.4451 0.4774 0.4856 0.0117  -0.0245 -0.0327 166 ARG D CG  
2078 C  CD  . ARG D 25 ? 0.4201 0.4546 0.4522 0.0122  -0.0309 -0.0284 166 ARG D CD  
2079 N  NE  . ARG D 25 ? 0.3743 0.4178 0.4020 0.0133  -0.0341 -0.0301 166 ARG D NE  
2080 C  CZ  . ARG D 25 ? 0.4165 0.4653 0.4395 0.0151  -0.0404 -0.0282 166 ARG D CZ  
2081 N  NH1 . ARG D 25 ? 0.4207 0.4658 0.4439 0.0159  -0.0443 -0.0239 166 ARG D NH1 
2082 N  NH2 . ARG D 25 ? 0.3738 0.4319 0.3917 0.0166  -0.0429 -0.0308 166 ARG D NH2 
2083 N  N   . THR D 26 ? 0.2990 0.3128 0.3299 0.0078  -0.0097 -0.0259 167 THR D N   
2084 C  CA  . THR D 26 ? 0.2786 0.2857 0.3071 0.0079  -0.0087 -0.0250 167 THR D CA  
2085 C  C   . THR D 26 ? 0.2619 0.2660 0.2792 0.0051  -0.0117 -0.0205 167 THR D C   
2086 O  O   . THR D 26 ? 0.2329 0.2415 0.2444 0.0030  -0.0126 -0.0176 167 THR D O   
2087 C  CB  . THR D 26 ? 0.2580 0.2637 0.2888 0.0089  -0.0014 -0.0267 167 THR D CB  
2088 O  OG1 . THR D 26 ? 0.2971 0.2968 0.3258 0.0102  -0.0008 -0.0276 167 THR D OG1 
2089 C  CG2 . THR D 26 ? 0.2932 0.3009 0.3165 0.0070  0.0019  -0.0242 167 THR D CG2 
2090 N  N   . VAL D 27 ? 0.2677 0.2647 0.2832 0.0052  -0.0134 -0.0202 168 VAL D N   
2091 C  CA  . VAL D 27 ? 0.2892 0.2822 0.2966 0.0020  -0.0164 -0.0164 168 VAL D CA  
2092 C  C   . VAL D 27 ? 0.3593 0.3476 0.3636 0.0024  -0.0128 -0.0191 168 VAL D C   
2093 O  O   . VAL D 27 ? 0.3613 0.3466 0.3700 0.0057  -0.0102 -0.0234 168 VAL D O   
2094 C  CB  . VAL D 27 ? 0.3736 0.3607 0.3823 0.0018  -0.0228 -0.0139 168 VAL D CB  
2095 C  CG1 . VAL D 27 ? 0.4311 0.4117 0.4344 -0.0017 -0.0256 -0.0110 168 VAL D CG1 
2096 C  CG2 . VAL D 27 ? 0.3190 0.3121 0.3278 0.0014  -0.0267 -0.0099 168 VAL D CG2 
2097 N  N   . VAL D 28 ? 0.2839 0.2727 0.2807 -0.0007 -0.0129 -0.0168 169 VAL D N   
2098 C  CA  . VAL D 28 ? 0.2097 0.1953 0.2017 -0.0003 -0.0105 -0.0194 169 VAL D CA  
2099 C  C   . VAL D 28 ? 0.2313 0.2121 0.2185 -0.0041 -0.0157 -0.0174 169 VAL D C   
2100 O  O   . VAL D 28 ? 0.2177 0.2010 0.2042 -0.0077 -0.0191 -0.0124 169 VAL D O   
2101 C  CB  . VAL D 28 ? 0.3752 0.3673 0.3635 0.0001  -0.0047 -0.0189 169 VAL D CB  
2102 C  CG1 . VAL D 28 ? 0.3587 0.3553 0.3540 0.0030  0.0004  -0.0201 169 VAL D CG1 
2103 C  CG2 . VAL D 28 ? 0.2598 0.2571 0.2429 -0.0036 -0.0063 -0.0144 169 VAL D CG2 
2104 N  N   . PRO D 29 ? 0.3201 0.2942 0.3050 -0.0031 -0.0166 -0.0217 170 PRO D N   
2105 C  CA  . PRO D 29 ? 0.3314 0.3001 0.3137 -0.0072 -0.0224 -0.0207 170 PRO D CA  
2106 C  C   . PRO D 29 ? 0.3829 0.3585 0.3592 -0.0105 -0.0215 -0.0178 170 PRO D C   
2107 O  O   . PRO D 29 ? 0.3765 0.3585 0.3491 -0.0084 -0.0164 -0.0186 170 PRO D O   
2108 C  CB  . PRO D 29 ? 0.3235 0.2841 0.3044 -0.0042 -0.0228 -0.0280 170 PRO D CB  
2109 C  CG  . PRO D 29 ? 0.3560 0.3215 0.3353 0.0008  -0.0156 -0.0316 170 PRO D CG  
2110 C  CD  . PRO D 29 ? 0.3270 0.2985 0.3123 0.0017  -0.0126 -0.0279 170 PRO D CD  
2111 N  N   . ALA D 30 ? 0.3237 0.2987 0.3001 -0.0156 -0.0265 -0.0138 171 ALA D N   
2112 C  CA  . ALA D 30 ? 0.3812 0.3644 0.3537 -0.0188 -0.0261 -0.0106 171 ALA D CA  
2113 C  C   . ALA D 30 ? 0.3501 0.3296 0.3192 -0.0210 -0.0298 -0.0142 171 ALA D C   
2114 O  O   . ALA D 30 ? 0.4069 0.3863 0.3781 -0.0262 -0.0345 -0.0110 171 ALA D O   
2115 C  CB  . ALA D 30 ? 0.3842 0.3728 0.3596 -0.0230 -0.0282 -0.0029 171 ALA D CB  
2116 N  N   . ARG D 31 ? 0.4046 0.3822 0.3687 -0.0168 -0.0274 -0.0207 172 ARG D N   
2117 C  CA  . ARG D 31 ? 0.4928 0.4666 0.4527 -0.0176 -0.0313 -0.0262 172 ARG D CA  
2118 C  C   . ARG D 31 ? 0.4124 0.3956 0.3668 -0.0192 -0.0311 -0.0246 172 ARG D C   
2119 O  O   . ARG D 31 ? 0.4165 0.4075 0.3670 -0.0160 -0.0254 -0.0227 172 ARG D O   
2120 C  CB  . ARG D 31 ? 0.6434 0.6124 0.5988 -0.0115 -0.0286 -0.0344 172 ARG D CB  
2121 C  CG  . ARG D 31 ? 0.7993 0.7575 0.7605 -0.0095 -0.0305 -0.0382 172 ARG D CG  
2122 C  CD  . ARG D 31 ? 0.8903 0.8450 0.8467 -0.0031 -0.0278 -0.0472 172 ARG D CD  
2123 N  NE  . ARG D 31 ? 0.9422 0.9063 0.8918 0.0011  -0.0201 -0.0469 172 ARG D NE  
2124 C  CZ  . ARG D 31 ? 0.9913 0.9561 0.9357 0.0073  -0.0156 -0.0528 172 ARG D CZ  
2125 N  NH1 . ARG D 31 ? 0.9814 0.9379 0.9262 0.0104  -0.0180 -0.0608 172 ARG D NH1 
2126 N  NH2 . ARG D 31 ? 1.0047 0.9785 0.9438 0.0105  -0.0084 -0.0505 172 ARG D NH2 
2127 N  N   . CYS D 32 ? 0.3778 0.3601 0.3326 -0.0239 -0.0375 -0.0256 173 CYS D N   
2128 C  CA  . CYS D 32 ? 0.4115 0.4033 0.3614 -0.0251 -0.0383 -0.0248 173 CYS D CA  
2129 C  C   . CYS D 32 ? 0.3870 0.3822 0.3267 -0.0187 -0.0342 -0.0296 173 CYS D C   
2130 O  O   . CYS D 32 ? 0.3667 0.3555 0.3022 -0.0148 -0.0340 -0.0368 173 CYS D O   
2131 C  CB  . CYS D 32 ? 0.4353 0.4246 0.3884 -0.0311 -0.0469 -0.0270 173 CYS D CB  
2132 S  SG  . CYS D 32 ? 0.7530 0.7408 0.7186 -0.0392 -0.0512 -0.0189 173 CYS D SG  
2133 N  N   . GLY D 33 ? 0.3680 0.3740 0.3041 -0.0172 -0.0305 -0.0252 174 GLY D N   
2134 C  CA  . GLY D 33 ? 0.3570 0.3680 0.2832 -0.0119 -0.0273 -0.0278 174 GLY D CA  
2135 C  C   . GLY D 33 ? 0.4415 0.4529 0.3659 -0.0061 -0.0186 -0.0262 174 GLY D C   
2136 O  O   . GLY D 33 ? 0.5025 0.5178 0.4190 -0.0010 -0.0145 -0.0271 174 GLY D O   
2137 N  N   . VAL D 34 ? 0.3639 0.3716 0.2962 -0.0069 -0.0159 -0.0236 175 VAL D N   
2138 C  CA  . VAL D 34 ? 0.3561 0.3635 0.2897 -0.0022 -0.0083 -0.0226 175 VAL D CA  
2139 C  C   . VAL D 34 ? 0.3640 0.3780 0.3026 -0.0028 -0.0046 -0.0156 175 VAL D C   
2140 O  O   . VAL D 34 ? 0.3663 0.3816 0.3103 -0.0068 -0.0075 -0.0124 175 VAL D O   
2141 C  CB  . VAL D 34 ? 0.4199 0.4187 0.3596 -0.0017 -0.0082 -0.0259 175 VAL D CB  
2142 C  CG1 . VAL D 34 ? 0.4420 0.4416 0.3835 0.0033  -0.0005 -0.0258 175 VAL D CG1 
2143 C  CG2 . VAL D 34 ? 0.5178 0.5087 0.4548 -0.0018 -0.0134 -0.0332 175 VAL D CG2 
2144 N  N   . THR D 35 ? 0.2830 0.3013 0.2197 0.0014  0.0019  -0.0132 176 THR D N   
2145 C  CA  . THR D 35 ? 0.2886 0.3118 0.2309 0.0016  0.0055  -0.0077 176 THR D CA  
2146 C  C   . THR D 35 ? 0.2728 0.2922 0.2239 0.0013  0.0075  -0.0081 176 THR D C   
2147 O  O   . THR D 35 ? 0.2874 0.3010 0.2404 0.0022  0.0077  -0.0119 176 THR D O   
2148 C  CB  . THR D 35 ? 0.3534 0.3814 0.2927 0.0062  0.0118  -0.0043 176 THR D CB  
2149 O  OG1 . THR D 35 ? 0.3579 0.3824 0.2981 0.0098  0.0175  -0.0059 176 THR D OG1 
2150 C  CG2 . THR D 35 ? 0.2396 0.2727 0.1689 0.0072  0.0094  -0.0035 176 THR D CG2 
2151 N  N   . VAL D 36 ? 0.2625 0.2860 0.2192 0.0006  0.0087  -0.0046 177 VAL D N   
2152 C  CA  . VAL D 36 ? 0.2231 0.2448 0.1881 0.0008  0.0103  -0.0051 177 VAL D CA  
2153 C  C   . VAL D 36 ? 0.2556 0.2753 0.2242 0.0046  0.0166  -0.0061 177 VAL D C   
2154 O  O   . VAL D 36 ? 0.2139 0.2298 0.1882 0.0053  0.0176  -0.0088 177 VAL D O   
2155 C  CB  . VAL D 36 ? 0.2683 0.2962 0.2371 0.0000  0.0104  -0.0019 177 VAL D CB  
2156 C  CG1 . VAL D 36 ? 0.2405 0.2674 0.2176 0.0009  0.0121  -0.0035 177 VAL D CG1 
2157 C  CG2 . VAL D 36 ? 0.3392 0.3704 0.3055 -0.0040 0.0048  -0.0003 177 VAL D CG2 
2158 N  N   . ARG D 37 ? 0.2954 0.3184 0.2613 0.0071  0.0208  -0.0030 178 ARG D N   
2159 C  CA  . ARG D 37 ? 0.3566 0.3786 0.3252 0.0106  0.0276  -0.0022 178 ARG D CA  
2160 C  C   . ARG D 37 ? 0.3280 0.3459 0.2947 0.0118  0.0280  -0.0066 178 ARG D C   
2161 O  O   . ARG D 37 ? 0.2897 0.3054 0.2647 0.0126  0.0306  -0.0085 178 ARG D O   
2162 C  CB  . ARG D 37 ? 0.4387 0.4650 0.4009 0.0133  0.0310  0.0026  178 ARG D CB  
2163 C  CG  . ARG D 37 ? 0.4942 0.5209 0.4590 0.0170  0.0389  0.0056  178 ARG D CG  
2164 C  CD  . ARG D 37 ? 0.4778 0.5091 0.4328 0.0201  0.0413  0.0106  178 ARG D CD  
2165 N  NE  . ARG D 37 ? 0.4383 0.4728 0.3943 0.0197  0.0396  0.0149  178 ARG D NE  
2166 C  CZ  . ARG D 37 ? 0.4050 0.4401 0.3692 0.0213  0.0442  0.0202  178 ARG D CZ  
2167 N  NH1 . ARG D 37 ? 0.4547 0.4874 0.4268 0.0229  0.0508  0.0225  178 ARG D NH1 
2168 N  NH2 . ARG D 37 ? 0.3450 0.3830 0.3103 0.0215  0.0422  0.0233  178 ARG D NH2 
2169 N  N   . ASP D 38 ? 0.3239 0.3412 0.2806 0.0120  0.0251  -0.0088 179 ASP D N   
2170 C  CA  . ASP D 38 ? 0.3458 0.3591 0.3004 0.0138  0.0254  -0.0139 179 ASP D CA  
2171 C  C   . ASP D 38 ? 0.3117 0.3194 0.2736 0.0120  0.0216  -0.0179 179 ASP D C   
2172 O  O   . ASP D 38 ? 0.3047 0.3099 0.2706 0.0144  0.0242  -0.0212 179 ASP D O   
2173 C  CB  . ASP D 38 ? 0.4775 0.4908 0.4197 0.0147  0.0222  -0.0169 179 ASP D CB  
2174 C  CG  . ASP D 38 ? 0.6416 0.6605 0.5760 0.0189  0.0278  -0.0141 179 ASP D CG  
2175 O  OD1 . ASP D 38 ? 0.6564 0.6774 0.5959 0.0216  0.0353  -0.0105 179 ASP D OD1 
2176 O  OD2 . ASP D 38 ? 0.7454 0.7668 0.6689 0.0196  0.0248  -0.0151 179 ASP D OD2 
2177 N  N   . SER D 39 ? 0.2825 0.2891 0.2466 0.0080  0.0158  -0.0171 180 SER D N   
2178 C  CA  . SER D 39 ? 0.2965 0.2983 0.2671 0.0064  0.0119  -0.0195 180 SER D CA  
2179 C  C   . SER D 39 ? 0.2998 0.3027 0.2812 0.0080  0.0158  -0.0194 180 SER D C   
2180 O  O   . SER D 39 ? 0.2322 0.2315 0.2195 0.0089  0.0144  -0.0224 180 SER D O   
2181 C  CB  . SER D 39 ? 0.2118 0.2141 0.1821 0.0019  0.0058  -0.0171 180 SER D CB  
2182 O  OG  . SER D 39 ? 0.3189 0.3207 0.2816 -0.0002 0.0019  -0.0171 180 SER D OG  
2183 N  N   . LEU D 40 ? 0.3440 0.3516 0.3290 0.0084  0.0199  -0.0162 181 LEU D N   
2184 C  CA  . LEU D 40 ? 0.3383 0.3470 0.3350 0.0091  0.0222  -0.0166 181 LEU D CA  
2185 C  C   . LEU D 40 ? 0.3699 0.3801 0.3730 0.0121  0.0298  -0.0162 181 LEU D C   
2186 O  O   . LEU D 40 ? 0.3134 0.3248 0.3283 0.0124  0.0318  -0.0168 181 LEU D O   
2187 C  CB  . LEU D 40 ? 0.3360 0.3484 0.3355 0.0074  0.0210  -0.0142 181 LEU D CB  
2188 C  CG  . LEU D 40 ? 0.3434 0.3561 0.3405 0.0046  0.0143  -0.0143 181 LEU D CG  
2189 C  CD1 . LEU D 40 ? 0.2891 0.3069 0.2864 0.0037  0.0140  -0.0121 181 LEU D CD1 
2190 C  CD2 . LEU D 40 ? 0.3020 0.3127 0.3063 0.0048  0.0114  -0.0173 181 LEU D CD2 
2191 N  N   . LYS D 41 ? 0.3698 0.3808 0.3656 0.0143  0.0339  -0.0149 182 LYS D N   
2192 C  CA  . LYS D 41 ? 0.3204 0.3343 0.3209 0.0172  0.0421  -0.0126 182 LYS D CA  
2193 C  C   . LYS D 41 ? 0.3188 0.3325 0.3312 0.0187  0.0448  -0.0157 182 LYS D C   
2194 O  O   . LYS D 41 ? 0.2882 0.3047 0.3125 0.0192  0.0502  -0.0135 182 LYS D O   
2195 C  CB  . LYS D 41 ? 0.4549 0.4702 0.4423 0.0199  0.0448  -0.0117 182 LYS D CB  
2196 C  CG  . LYS D 41 ? 0.6275 0.6467 0.6168 0.0237  0.0538  -0.0090 182 LYS D CG  
2197 C  CD  . LYS D 41 ? 0.7102 0.7317 0.6838 0.0269  0.0553  -0.0090 182 LYS D CD  
2198 C  CE  . LYS D 41 ? 0.7222 0.7455 0.6863 0.0259  0.0530  -0.0046 182 LYS D CE  
2199 N  NZ  . LYS D 41 ? 0.7326 0.7594 0.6810 0.0294  0.0539  -0.0047 182 LYS D NZ  
2200 N  N   . LYS D 42 ? 0.3075 0.3179 0.3179 0.0194  0.0408  -0.0206 183 LYS D N   
2201 C  CA  . LYS D 42 ? 0.4136 0.4244 0.4351 0.0214  0.0427  -0.0239 183 LYS D CA  
2202 C  C   . LYS D 42 ? 0.3517 0.3631 0.3872 0.0192  0.0399  -0.0245 183 LYS D C   
2203 O  O   . LYS D 42 ? 0.3124 0.3273 0.3614 0.0200  0.0444  -0.0243 183 LYS D O   
2204 C  CB  . LYS D 42 ? 0.4609 0.4671 0.4768 0.0232  0.0385  -0.0293 183 LYS D CB  
2205 C  CG  . LYS D 42 ? 0.5940 0.6017 0.6213 0.0265  0.0415  -0.0327 183 LYS D CG  
2206 C  CD  . LYS D 42 ? 0.7288 0.7311 0.7513 0.0291  0.0373  -0.0385 183 LYS D CD  
2207 C  CE  . LYS D 42 ? 0.8013 0.7980 0.8278 0.0268  0.0282  -0.0401 183 LYS D CE  
2208 N  NZ  . LYS D 42 ? 0.8217 0.8153 0.8398 0.0221  0.0222  -0.0371 183 LYS D NZ  
2209 N  N   . ALA D 43 ? 0.3159 0.3249 0.3487 0.0164  0.0325  -0.0251 184 ALA D N   
2210 C  CA  . ALA D 43 ? 0.3082 0.3187 0.3519 0.0148  0.0290  -0.0262 184 ALA D CA  
2211 C  C   . ALA D 43 ? 0.3207 0.3349 0.3740 0.0140  0.0339  -0.0239 184 ALA D C   
2212 O  O   . ALA D 43 ? 0.3452 0.3618 0.4128 0.0138  0.0341  -0.0259 184 ALA D O   
2213 C  CB  . ALA D 43 ? 0.3207 0.3293 0.3570 0.0123  0.0212  -0.0261 184 ALA D CB  
2214 N  N   . LEU D 44 ? 0.2782 0.2930 0.3250 0.0137  0.0377  -0.0199 185 LEU D N   
2215 C  CA  . LEU D 44 ? 0.3389 0.3557 0.3955 0.0131  0.0420  -0.0172 185 LEU D CA  
2216 C  C   . LEU D 44 ? 0.3027 0.3219 0.3707 0.0146  0.0499  -0.0153 185 LEU D C   
2217 O  O   . LEU D 44 ? 0.3140 0.3349 0.3980 0.0135  0.0519  -0.0154 185 LEU D O   
2218 C  CB  . LEU D 44 ? 0.3431 0.3599 0.3900 0.0128  0.0433  -0.0127 185 LEU D CB  
2219 C  CG  . LEU D 44 ? 0.3821 0.3985 0.4221 0.0110  0.0366  -0.0139 185 LEU D CG  
2220 C  CD1 . LEU D 44 ? 0.3970 0.4144 0.4290 0.0113  0.0385  -0.0092 185 LEU D CD1 
2221 C  CD2 . LEU D 44 ? 0.3099 0.3272 0.3612 0.0099  0.0333  -0.0175 185 LEU D CD2 
2222 N  N   A MSE D 45 ? 0.3308 0.3508 0.3911 0.0170  0.0543  -0.0138 186 MSE D N   
2223 N  N   B MSE D 45 ? 0.3259 0.3459 0.3860 0.0170  0.0543  -0.0137 186 MSE D N   
2224 C  CA  A MSE D 45 ? 0.3582 0.3820 0.4275 0.0190  0.0630  -0.0110 186 MSE D CA  
2225 C  CA  B MSE D 45 ? 0.3626 0.3865 0.4314 0.0191  0.0629  -0.0112 186 MSE D CA  
2226 C  C   A MSE D 45 ? 0.3625 0.3887 0.4495 0.0188  0.0627  -0.0150 186 MSE D C   
2227 C  C   B MSE D 45 ? 0.3620 0.3881 0.4489 0.0187  0.0625  -0.0150 186 MSE D C   
2228 O  O   A MSE D 45 ? 0.3771 0.4072 0.4789 0.0186  0.0690  -0.0123 186 MSE D O   
2229 O  O   B MSE D 45 ? 0.3792 0.4089 0.4813 0.0183  0.0685  -0.0123 186 MSE D O   
2230 C  CB  A MSE D 45 ? 0.3967 0.4218 0.4522 0.0225  0.0668  -0.0102 186 MSE D CB  
2231 C  CB  B MSE D 45 ? 0.3882 0.4130 0.4435 0.0226  0.0659  -0.0113 186 MSE D CB  
2232 C  CG  A MSE D 45 ? 0.4500 0.4808 0.5112 0.0252  0.0774  -0.0056 186 MSE D CG  
2233 C  CG  B MSE D 45 ? 0.4361 0.4666 0.4987 0.0256  0.0755  -0.0087 186 MSE D CG  
2234 SE SE  A MSE D 45 ? 0.7774 0.8104 0.8383 0.0248  0.0852  0.0055  186 MSE D SE  
2235 SE SE  B MSE D 45 ? 1.5870 1.6199 1.6283 0.0310  0.0801  -0.0087 186 MSE D SE  
2236 C  CE  A MSE D 45 ? 0.4509 0.4832 0.5397 0.0203  0.0852  0.0061  186 MSE D CE  
2237 C  CE  B MSE D 45 ? 0.6336 0.6635 0.6564 0.0295  0.0764  -0.0041 186 MSE D CE  
2238 N  N   . MSE D 46 ? 0.3507 0.3749 0.4368 0.0186  0.0551  -0.0208 187 MSE D N   
2239 C  CA  . MSE D 46 ? 0.3825 0.4094 0.4851 0.0187  0.0533  -0.0248 187 MSE D CA  
2240 C  C   . MSE D 46 ? 0.3709 0.3995 0.4894 0.0157  0.0517  -0.0253 187 MSE D C   
2241 O  O   . MSE D 46 ? 0.3158 0.3484 0.4520 0.0154  0.0526  -0.0273 187 MSE D O   
2242 C  CB  . MSE D 46 ? 0.3552 0.3791 0.4523 0.0195  0.0445  -0.0300 187 MSE D CB  
2243 C  CG  . MSE D 46 ? 0.4459 0.4671 0.5303 0.0226  0.0452  -0.0311 187 MSE D CG  
2244 SE SE  . MSE D 46 ? 1.3375 1.3540 1.4202 0.0238  0.0344  -0.0367 187 MSE D SE  
2245 C  CE  . MSE D 46 ? 0.3400 0.3542 0.4171 0.0193  0.0255  -0.0354 187 MSE D CE  
2246 N  N   . ARG D 47 ? 0.3034 0.3292 0.4163 0.0136  0.0489  -0.0241 188 ARG D N   
2247 C  CA  . ARG D 47 ? 0.3520 0.3785 0.4789 0.0111  0.0462  -0.0263 188 ARG D CA  
2248 C  C   . ARG D 47 ? 0.3983 0.4245 0.5328 0.0099  0.0534  -0.0208 188 ARG D C   
2249 O  O   . ARG D 47 ? 0.4352 0.4602 0.5792 0.0080  0.0513  -0.0222 188 ARG D O   
2250 C  CB  . ARG D 47 ? 0.3572 0.3814 0.4741 0.0102  0.0375  -0.0297 188 ARG D CB  
2251 C  CG  . ARG D 47 ? 0.3987 0.4226 0.5074 0.0114  0.0309  -0.0330 188 ARG D CG  
2252 C  CD  . ARG D 47 ? 0.3744 0.3964 0.4686 0.0108  0.0244  -0.0336 188 ARG D CD  
2253 N  NE  . ARG D 47 ? 0.3511 0.3741 0.4444 0.0113  0.0168  -0.0372 188 ARG D NE  
2254 C  CZ  . ARG D 47 ? 0.3438 0.3644 0.4292 0.0126  0.0146  -0.0366 188 ARG D CZ  
2255 N  NH1 . ARG D 47 ? 0.2469 0.2644 0.3241 0.0134  0.0192  -0.0338 188 ARG D NH1 
2256 N  NH2 . ARG D 47 ? 0.3221 0.3434 0.4076 0.0133  0.0075  -0.0390 188 ARG D NH2 
2257 N  N   . GLY D 48 ? 0.3761 0.4033 0.5059 0.0115  0.0616  -0.0146 189 GLY D N   
2258 C  CA  . GLY D 48 ? 0.4277 0.4547 0.5631 0.0110  0.0694  -0.0073 189 GLY D CA  
2259 C  C   . GLY D 48 ? 0.4366 0.4595 0.5595 0.0110  0.0682  -0.0040 189 GLY D C   
2260 O  O   . GLY D 48 ? 0.4454 0.4667 0.5771 0.0100  0.0718  0.0006  189 GLY D O   
2261 N  N   . LEU D 49 ? 0.3643 0.3857 0.4681 0.0121  0.0632  -0.0059 190 LEU D N   
2262 C  CA  . LEU D 49 ? 0.4160 0.4349 0.5084 0.0121  0.0610  -0.0034 190 LEU D CA  
2263 C  C   . LEU D 49 ? 0.3774 0.3969 0.4503 0.0143  0.0629  0.0007  190 LEU D C   
2264 O  O   . LEU D 49 ? 0.3751 0.3959 0.4402 0.0157  0.0635  -0.0005 190 LEU D O   
2265 C  CB  . LEU D 49 ? 0.4524 0.4701 0.5411 0.0109  0.0519  -0.0100 190 LEU D CB  
2266 C  CG  . LEU D 49 ? 0.4902 0.5080 0.5954 0.0092  0.0480  -0.0159 190 LEU D CG  
2267 C  CD1 . LEU D 49 ? 0.5040 0.5221 0.6010 0.0089  0.0394  -0.0215 190 LEU D CD1 
2268 C  CD2 . LEU D 49 ? 0.5344 0.5503 0.6534 0.0084  0.0515  -0.0136 190 LEU D CD2 
2269 N  N   . ILE D 50 ? 0.4401 0.4587 0.5054 0.0149  0.0632  0.0050  191 ILE D N   
2270 C  CA  . ILE D 50 ? 0.4453 0.4651 0.4922 0.0167  0.0633  0.0082  191 ILE D CA  
2271 C  C   . ILE D 50 ? 0.4225 0.4415 0.4623 0.0160  0.0578  0.0079  191 ILE D C   
2272 O  O   . ILE D 50 ? 0.3160 0.3337 0.3654 0.0152  0.0567  0.0074  191 ILE D O   
2273 C  CB  . ILE D 50 ? 0.5358 0.5577 0.5809 0.0192  0.0715  0.0166  191 ILE D CB  
2274 C  CG1 . ILE D 50 ? 0.5632 0.5832 0.6225 0.0186  0.0751  0.0218  191 ILE D CG1 
2275 C  CG2 . ILE D 50 ? 0.5408 0.5655 0.5894 0.0206  0.0776  0.0172  191 ILE D CG2 
2276 C  CD1 . ILE D 50 ? 0.5973 0.6192 0.6540 0.0212  0.0828  0.0321  191 ILE D CD1 
2277 N  N   . PRO D 51 ? 0.4207 0.4410 0.4445 0.0165  0.0542  0.0076  192 PRO D N   
2278 C  CA  . PRO D 51 ? 0.2691 0.2901 0.2872 0.0154  0.0485  0.0068  192 PRO D CA  
2279 C  C   . PRO D 51 ? 0.4206 0.4421 0.4434 0.0169  0.0512  0.0119  192 PRO D C   
2280 O  O   . PRO D 51 ? 0.3685 0.3902 0.3948 0.0162  0.0477  0.0097  192 PRO D O   
2281 C  CB  . PRO D 51 ? 0.3830 0.4058 0.3851 0.0156  0.0454  0.0069  192 PRO D CB  
2282 C  CG  . PRO D 51 ? 0.4508 0.4723 0.4505 0.0163  0.0472  0.0043  192 PRO D CG  
2283 C  CD  . PRO D 51 ? 0.4612 0.4825 0.4729 0.0177  0.0544  0.0068  192 PRO D CD  
2284 N  N   . GLU D 52 ? 0.4854 0.5072 0.5089 0.0191  0.0576  0.0186  193 GLU D N   
2285 C  CA  . GLU D 52 ? 0.5513 0.5724 0.5811 0.0209  0.0605  0.0244  193 GLU D CA  
2286 C  C   . GLU D 52 ? 0.4887 0.5057 0.5373 0.0199  0.0616  0.0225  193 GLU D C   
2287 O  O   . GLU D 52 ? 0.4794 0.4945 0.5347 0.0214  0.0634  0.0266  193 GLU D O   
2288 C  CB  . GLU D 52 ? 0.6129 0.6356 0.6381 0.0238  0.0670  0.0335  193 GLU D CB  
2289 C  CG  . GLU D 52 ? 0.7480 0.7752 0.7548 0.0256  0.0646  0.0354  193 GLU D CG  
2290 C  CD  . GLU D 52 ? 0.8900 0.9202 0.8907 0.0294  0.0704  0.0448  193 GLU D CD  
2291 O  OE1 . GLU D 52 ? 0.9364 0.9645 0.9481 0.0305  0.0769  0.0515  193 GLU D OE1 
2292 O  OE2 . GLU D 52 ? 0.9244 0.9591 0.9092 0.0311  0.0684  0.0458  193 GLU D OE2 
2293 N  N   . CYS D 53 ? 0.4250 0.4404 0.4827 0.0176  0.0601  0.0162  194 CYS D N   
2294 C  CA  . CYS D 53 ? 0.3571 0.3690 0.4326 0.0164  0.0596  0.0126  194 CYS D CA  
2295 C  C   . CYS D 53 ? 0.2870 0.2999 0.3618 0.0152  0.0521  0.0036  194 CYS D C   
2296 O  O   . CYS D 53 ? 0.3189 0.3297 0.4069 0.0144  0.0501  -0.0017 194 CYS D O   
2297 C  CB  . CYS D 53 ? 0.4140 0.4243 0.5053 0.0149  0.0643  0.0130  194 CYS D CB  
2298 S  SG  . CYS D 53 ? 0.6276 0.6403 0.7200 0.0129  0.0617  0.0060  194 CYS D SG  
2299 N  N   . CYS D 54 ? 0.2647 0.2810 0.3240 0.0152  0.0478  0.0022  195 CYS D N   
2300 C  CA  . CYS D 54 ? 0.2838 0.3024 0.3403 0.0140  0.0411  -0.0050 195 CYS D CA  
2301 C  C   . CYS D 54 ? 0.2585 0.2809 0.3030 0.0149  0.0380  -0.0038 195 CYS D C   
2302 O  O   . CYS D 54 ? 0.2756 0.2992 0.3124 0.0161  0.0401  0.0019  195 CYS D O   
2303 C  CB  . CYS D 54 ? 0.2803 0.2997 0.3313 0.0122  0.0384  -0.0079 195 CYS D CB  
2304 S  SG  . CYS D 54 ? 0.3225 0.3396 0.3881 0.0113  0.0410  -0.0104 195 CYS D SG  
2305 N  N   . ALA D 55 ? 0.2558 0.2812 0.2989 0.0146  0.0329  -0.0092 196 ALA D N   
2306 C  CA  . ALA D 55 ? 0.2806 0.3115 0.3121 0.0147  0.0298  -0.0080 196 ALA D CA  
2307 C  C   . ALA D 55 ? 0.1971 0.2307 0.2205 0.0122  0.0250  -0.0104 196 ALA D C   
2308 O  O   . ALA D 55 ? 0.1850 0.2171 0.2127 0.0112  0.0229  -0.0147 196 ALA D O   
2309 C  CB  . ALA D 55 ? 0.2756 0.3096 0.3112 0.0171  0.0287  -0.0107 196 ALA D CB  
2310 N  N   . VAL D 56 ? 0.2129 0.2505 0.2256 0.0111  0.0229  -0.0074 197 VAL D N   
2311 C  CA  . VAL D 56 ? 0.1707 0.2104 0.1768 0.0085  0.0184  -0.0085 197 VAL D CA  
2312 C  C   . VAL D 56 ? 0.2534 0.3008 0.2542 0.0082  0.0156  -0.0077 197 VAL D C   
2313 O  O   . VAL D 56 ? 0.2196 0.2710 0.2185 0.0094  0.0170  -0.0048 197 VAL D O   
2314 C  CB  . VAL D 56 ? 0.2436 0.2797 0.2429 0.0065  0.0181  -0.0058 197 VAL D CB  
2315 C  CG1 . VAL D 56 ? 0.2511 0.2892 0.2442 0.0068  0.0196  -0.0013 197 VAL D CG1 
2316 C  CG2 . VAL D 56 ? 0.2996 0.3365 0.2938 0.0036  0.0130  -0.0065 197 VAL D CG2 
2317 N  N   . TYR D 57 ? 0.2536 0.3040 0.2524 0.0070  0.0118  -0.0099 198 TYR D N   
2318 C  CA  . TYR D 57 ? 0.2856 0.3450 0.2793 0.0067  0.0096  -0.0086 198 TYR D CA  
2319 C  C   . TYR D 57 ? 0.3741 0.4350 0.3618 0.0032  0.0057  -0.0060 198 TYR D C   
2320 O  O   . TYR D 57 ? 0.2804 0.3355 0.2687 0.0019  0.0038  -0.0071 198 TYR D O   
2321 C  CB  . TYR D 57 ? 0.2797 0.3436 0.2772 0.0098  0.0093  -0.0137 198 TYR D CB  
2322 C  CG  . TYR D 57 ? 0.3408 0.4010 0.3472 0.0131  0.0125  -0.0174 198 TYR D CG  
2323 C  CD1 . TYR D 57 ? 0.4345 0.4989 0.4426 0.0161  0.0147  -0.0172 198 TYR D CD1 
2324 C  CD2 . TYR D 57 ? 0.3035 0.3560 0.3179 0.0133  0.0133  -0.0207 198 TYR D CD2 
2325 C  CE1 . TYR D 57 ? 0.4694 0.5290 0.4870 0.0192  0.0175  -0.0201 198 TYR D CE1 
2326 C  CE2 . TYR D 57 ? 0.3926 0.4410 0.4170 0.0157  0.0163  -0.0232 198 TYR D CE2 
2327 C  CZ  . TYR D 57 ? 0.4426 0.4939 0.4686 0.0187  0.0182  -0.0229 198 TYR D CZ  
2328 O  OH  . TYR D 57 ? 0.4833 0.5291 0.5207 0.0210  0.0210  -0.0250 198 TYR D OH  
2329 N  N   . ARG D 58 ? 0.3244 0.3932 0.3071 0.0016  0.0046  -0.0020 199 ARG D N   
2330 C  CA  . ARG D 58 ? 0.3469 0.4181 0.3251 -0.0017 0.0010  0.0014  199 ARG D CA  
2331 C  C   . ARG D 58 ? 0.4631 0.5435 0.4401 0.0006  0.0006  -0.0001 199 ARG D C   
2332 O  O   . ARG D 58 ? 0.5774 0.6620 0.5569 0.0045  0.0030  -0.0039 199 ARG D O   
2333 C  CB  . ARG D 58 ? 0.3693 0.4440 0.3442 -0.0056 0.0000  0.0074  199 ARG D CB  
2334 C  CG  . ARG D 58 ? 0.5330 0.6186 0.5077 -0.0042 0.0022  0.0093  199 ARG D CG  
2335 C  CD  . ARG D 58 ? 0.6705 0.7603 0.6438 -0.0085 0.0008  0.0151  199 ARG D CD  
2336 N  NE  . ARG D 58 ? 0.7551 0.8446 0.7267 -0.0134 -0.0027 0.0195  199 ARG D NE  
2337 C  CZ  . ARG D 58 ? 0.8521 0.9461 0.8242 -0.0181 -0.0047 0.0249  199 ARG D CZ  
2338 N  NH1 . ARG D 58 ? 0.8766 0.9765 0.8501 -0.0181 -0.0037 0.0260  199 ARG D NH1 
2339 N  NH2 . ARG D 58 ? 0.8817 0.9743 0.8537 -0.0228 -0.0079 0.0294  199 ARG D NH2 
2340 N  N   . ILE D 59 ? 0.4950 0.5784 0.4682 -0.0012 -0.0024 0.0027  200 ILE D N   
2341 C  CA  . ILE D 59 ? 0.5696 0.6643 0.5393 0.0012  -0.0027 0.0025  200 ILE D CA  
2342 C  C   . ILE D 59 ? 0.5887 0.6927 0.5542 -0.0022 -0.0027 0.0106  200 ILE D C   
2343 O  O   . ILE D 59 ? 0.5986 0.6981 0.5637 -0.0069 -0.0049 0.0163  200 ILE D O   
2344 C  CB  . ILE D 59 ? 0.5907 0.6842 0.5589 0.0024  -0.0061 0.0001  200 ILE D CB  
2345 C  CG1 . ILE D 59 ? 0.5309 0.6150 0.5056 0.0048  -0.0064 -0.0075 200 ILE D CG1 
2346 C  CG2 . ILE D 59 ? 0.4616 0.5685 0.4243 0.0058  -0.0063 -0.0007 200 ILE D CG2 
2347 C  CD1 . ILE D 59 ? 0.4506 0.5372 0.4298 0.0091  -0.0038 -0.0148 200 ILE D CD1 
2348 N  N   . LYS D 64 ? 0.5154 0.6221 0.4992 0.0208  0.0052  -0.0247 205 LYS D N   
2349 C  CA  . LYS D 64 ? 0.5255 0.6210 0.5131 0.0170  0.0060  -0.0205 205 LYS D CA  
2350 C  C   . LYS D 64 ? 0.4852 0.5821 0.4742 0.0171  0.0094  -0.0163 205 LYS D C   
2351 O  O   . LYS D 64 ? 0.4827 0.5819 0.4759 0.0212  0.0116  -0.0196 205 LYS D O   
2352 C  CB  . LYS D 64 ? 0.5577 0.6423 0.5541 0.0180  0.0059  -0.0265 205 LYS D CB  
2353 C  CG  . LYS D 64 ? 0.6036 0.6839 0.6001 0.0163  0.0023  -0.0284 205 LYS D CG  
2354 C  CD  . LYS D 64 ? 0.6535 0.7232 0.6605 0.0163  0.0032  -0.0323 205 LYS D CD  
2355 C  CE  . LYS D 64 ? 0.7151 0.7839 0.7309 0.0201  0.0048  -0.0391 205 LYS D CE  
2356 N  NZ  . LYS D 64 ? 0.7632 0.8324 0.7846 0.0221  0.0011  -0.0479 205 LYS D NZ  
2357 N  N   . LYS D 65 ? 0.4110 0.5062 0.3968 0.0128  0.0092  -0.0093 206 LYS D N   
2358 C  CA  . LYS D 65 ? 0.4006 0.4980 0.3872 0.0128  0.0114  -0.0051 206 LYS D CA  
2359 C  C   . LYS D 65 ? 0.3546 0.4410 0.3434 0.0110  0.0121  -0.0033 206 LYS D C   
2360 O  O   . LYS D 65 ? 0.3208 0.4017 0.3068 0.0072  0.0101  -0.0015 206 LYS D O   
2361 C  CB  . LYS D 65 ? 0.4213 0.5289 0.4028 0.0095  0.0104  0.0015  206 LYS D CB  
2362 C  CG  . LYS D 65 ? 0.4927 0.6143 0.4718 0.0117  0.0111  0.0012  206 LYS D CG  
2363 C  CD  . LYS D 65 ? 0.5646 0.6890 0.5381 0.0094  0.0085  0.0024  206 LYS D CD  
2364 C  CE  . LYS D 65 ? 1.0822 1.2120 1.0525 0.0035  0.0070  0.0114  206 LYS D CE  
2365 N  NZ  . LYS D 65 ? 1.0610 1.1933 1.0264 0.0011  0.0046  0.0147  206 LYS D NZ  
2366 N  N   . PRO D 66 ? 0.2317 0.3151 0.2252 0.0140  0.0149  -0.0036 207 PRO D N   
2367 C  CA  . PRO D 66 ? 0.2738 0.3474 0.2689 0.0131  0.0163  -0.0019 207 PRO D CA  
2368 C  C   . PRO D 66 ? 0.2374 0.3117 0.2265 0.0097  0.0151  0.0036  207 PRO D C   
2369 O  O   . PRO D 66 ? 0.2125 0.2948 0.1992 0.0094  0.0143  0.0070  207 PRO D O   
2370 C  CB  . PRO D 66 ? 0.2585 0.3305 0.2603 0.0176  0.0197  -0.0023 207 PRO D CB  
2371 C  CG  . PRO D 66 ? 0.1973 0.2804 0.1987 0.0202  0.0197  -0.0022 207 PRO D CG  
2372 C  CD  . PRO D 66 ? 0.2370 0.3263 0.2348 0.0188  0.0172  -0.0052 207 PRO D CD  
2373 N  N   . ILE D 67 ? 0.2501 0.3162 0.2373 0.0077  0.0148  0.0040  208 ILE D N   
2374 C  CA  . ILE D 67 ? 0.2747 0.3409 0.2561 0.0050  0.0131  0.0078  208 ILE D CA  
2375 C  C   . ILE D 67 ? 0.2247 0.2844 0.2059 0.0069  0.0160  0.0087  208 ILE D C   
2376 O  O   . ILE D 67 ? 0.2363 0.2899 0.2224 0.0089  0.0190  0.0066  208 ILE D O   
2377 C  CB  . ILE D 67 ? 0.3900 0.4537 0.3673 0.0005  0.0093  0.0076  208 ILE D CB  
2378 C  CG1 . ILE D 67 ? 0.2828 0.3372 0.2620 0.0007  0.0099  0.0040  208 ILE D CG1 
2379 C  CG2 . ILE D 67 ? 0.3983 0.4700 0.3751 -0.0017 0.0067  0.0087  208 ILE D CG2 
2380 C  CD1 . ILE D 67 ? 0.2490 0.2989 0.2242 -0.0033 0.0059  0.0041  208 ILE D CD1 
2381 N  N   . GLY D 68 ? 0.2173 0.2792 0.1932 0.0065  0.0151  0.0120  209 GLY D N   
2382 C  CA  . GLY D 68 ? 0.2299 0.2871 0.2039 0.0089  0.0181  0.0135  209 GLY D CA  
2383 C  C   . GLY D 68 ? 0.3252 0.3749 0.2965 0.0072  0.0180  0.0108  209 GLY D C   
2384 O  O   . GLY D 68 ? 0.2641 0.3126 0.2324 0.0036  0.0139  0.0086  209 GLY D O   
2385 N  N   . TRP D 69 ? 0.3813 0.4262 0.3548 0.0099  0.0226  0.0112  210 TRP D N   
2386 C  CA  . TRP D 69 ? 0.3792 0.4182 0.3506 0.0096  0.0238  0.0090  210 TRP D CA  
2387 C  C   . TRP D 69 ? 0.3468 0.3863 0.3080 0.0083  0.0205  0.0085  210 TRP D C   
2388 O  O   . TRP D 69 ? 0.2928 0.3276 0.2518 0.0074  0.0196  0.0051  210 TRP D O   
2389 C  CB  . TRP D 69 ? 0.3469 0.3828 0.3230 0.0130  0.0304  0.0112  210 TRP D CB  
2390 C  CG  . TRP D 69 ? 0.3564 0.3891 0.3443 0.0131  0.0326  0.0090  210 TRP D CG  
2391 C  CD1 . TRP D 69 ? 0.3852 0.4177 0.3823 0.0150  0.0356  0.0105  210 TRP D CD1 
2392 C  CD2 . TRP D 69 ? 0.3210 0.3502 0.3134 0.0112  0.0310  0.0041  210 TRP D CD2 
2393 N  NE1 . TRP D 69 ? 0.3613 0.3906 0.3684 0.0142  0.0358  0.0063  210 TRP D NE1 
2394 C  CE2 . TRP D 69 ? 0.3095 0.3373 0.3138 0.0120  0.0331  0.0026  210 TRP D CE2 
2395 C  CE3 . TRP D 69 ? 0.2864 0.3133 0.2747 0.0093  0.0279  0.0007  210 TRP D CE3 
2396 C  CZ2 . TRP D 69 ? 0.2968 0.3221 0.3082 0.0108  0.0317  -0.0022 210 TRP D CZ2 
2397 C  CZ3 . TRP D 69 ? 0.2989 0.3228 0.2944 0.0084  0.0268  -0.0033 210 TRP D CZ3 
2398 C  CH2 . TRP D 69 ? 0.3034 0.3272 0.3102 0.0092  0.0287  -0.0047 210 TRP D CH2 
2399 N  N   . ASP D 70 ? 0.2702 0.3155 0.2258 0.0086  0.0183  0.0113  211 ASP D N   
2400 C  CA  . ASP D 70 ? 0.3085 0.3548 0.2548 0.0075  0.0144  0.0100  211 ASP D CA  
2401 C  C   . ASP D 70 ? 0.3394 0.3870 0.2852 0.0025  0.0076  0.0078  211 ASP D C   
2402 O  O   . ASP D 70 ? 0.3202 0.3690 0.2599 0.0009  0.0032  0.0063  211 ASP D O   
2403 C  CB  . ASP D 70 ? 0.4387 0.4913 0.3789 0.0104  0.0146  0.0141  211 ASP D CB  
2404 C  CG  . ASP D 70 ? 0.5245 0.5761 0.4644 0.0153  0.0214  0.0179  211 ASP D CG  
2405 O  OD1 . ASP D 70 ? 0.5247 0.5726 0.4605 0.0169  0.0242  0.0163  211 ASP D OD1 
2406 O  OD2 . ASP D 70 ? 0.6792 0.7340 0.6237 0.0178  0.0241  0.0229  211 ASP D OD2 
2407 N  N   . THR D 71 ? 0.3357 0.3836 0.2882 0.0001  0.0067  0.0078  212 THR D N   
2408 C  CA  . THR D 71 ? 0.2971 0.3468 0.2506 -0.0049 0.0011  0.0075  212 THR D CA  
2409 C  C   . THR D 71 ? 0.2223 0.2643 0.1729 -0.0073 -0.0024 0.0034  212 THR D C   
2410 O  O   . THR D 71 ? 0.2253 0.2601 0.1762 -0.0054 0.0000  0.0003  212 THR D O   
2411 C  CB  . THR D 71 ? 0.2277 0.2790 0.1879 -0.0061 0.0017  0.0082  212 THR D CB  
2412 O  OG1 . THR D 71 ? 0.2969 0.3553 0.2601 -0.0035 0.0046  0.0109  212 THR D OG1 
2413 C  CG2 . THR D 71 ? 0.2675 0.3209 0.2287 -0.0113 -0.0033 0.0093  212 THR D CG2 
2414 N  N   . ASP D 72 ? 0.2534 0.2968 0.2024 -0.0113 -0.0081 0.0031  213 ASP D N   
2415 C  CA  . ASP D 72 ? 0.3148 0.3498 0.2623 -0.0137 -0.0122 -0.0012 213 ASP D CA  
2416 C  C   . ASP D 72 ? 0.2613 0.2918 0.2150 -0.0162 -0.0130 -0.0006 213 ASP D C   
2417 O  O   . ASP D 72 ? 0.2873 0.3222 0.2448 -0.0199 -0.0153 0.0031  213 ASP D O   
2418 C  CB  . ASP D 72 ? 0.3376 0.3750 0.2837 -0.0180 -0.0188 -0.0018 213 ASP D CB  
2419 C  CG  . ASP D 72 ? 0.3893 0.4168 0.3349 -0.0204 -0.0237 -0.0071 213 ASP D CG  
2420 O  OD1 . ASP D 72 ? 0.3947 0.4145 0.3438 -0.0208 -0.0233 -0.0083 213 ASP D OD1 
2421 O  OD2 . ASP D 72 ? 0.4608 0.4885 0.4030 -0.0219 -0.0286 -0.0105 213 ASP D OD2 
2422 N  N   . ILE D 73 ? 0.2296 0.2521 0.1839 -0.0140 -0.0113 -0.0041 214 ILE D N   
2423 C  CA  . ILE D 73 ? 0.2573 0.2762 0.2172 -0.0151 -0.0118 -0.0032 214 ILE D CA  
2424 C  C   . ILE D 73 ? 0.2342 0.2510 0.1971 -0.0205 -0.0178 -0.0010 214 ILE D C   
2425 O  O   . ILE D 73 ? 0.2056 0.2234 0.1723 -0.0218 -0.0183 0.0023  214 ILE D O   
2426 C  CB  . ILE D 73 ? 0.2755 0.2866 0.2367 -0.0115 -0.0094 -0.0076 214 ILE D CB  
2427 C  CG1 . ILE D 73 ? 0.3008 0.3100 0.2679 -0.0121 -0.0102 -0.0063 214 ILE D CG1 
2428 C  CG2 . ILE D 73 ? 0.2747 0.2777 0.2331 -0.0119 -0.0129 -0.0123 214 ILE D CG2 
2429 C  CD1 . ILE D 73 ? 0.2255 0.2370 0.1963 -0.0084 -0.0053 -0.0070 214 ILE D CD1 
2430 N  N   . SER D 74 ? 0.2437 0.2572 0.2049 -0.0234 -0.0224 -0.0027 215 SER D N   
2431 C  CA  . SER D 74 ? 0.3100 0.3203 0.2758 -0.0292 -0.0283 -0.0001 215 SER D CA  
2432 C  C   . SER D 74 ? 0.3423 0.3630 0.3113 -0.0330 -0.0287 0.0072  215 SER D C   
2433 O  O   . SER D 74 ? 0.2759 0.2958 0.2498 -0.0373 -0.0317 0.0118  215 SER D O   
2434 C  CB  . SER D 74 ? 0.2566 0.2612 0.2214 -0.0319 -0.0339 -0.0044 215 SER D CB  
2435 O  OG  . SER D 74 ? 0.3188 0.3326 0.2812 -0.0332 -0.0346 -0.0034 215 SER D OG  
2436 N  N   . TRP D 75 ? 0.2386 0.2696 0.2054 -0.0313 -0.0254 0.0087  216 TRP D N   
2437 C  CA  . TRP D 75 ? 0.2799 0.3221 0.2502 -0.0339 -0.0247 0.0152  216 TRP D CA  
2438 C  C   . TRP D 75 ? 0.2924 0.3360 0.2643 -0.0324 -0.0221 0.0181  216 TRP D C   
2439 O  O   . TRP D 75 ? 0.3321 0.3838 0.3066 -0.0351 -0.0223 0.0240  216 TRP D O   
2440 C  CB  . TRP D 75 ? 0.3365 0.3898 0.3049 -0.0317 -0.0218 0.0161  216 TRP D CB  
2441 C  CG  . TRP D 75 ? 0.3583 0.4131 0.3254 -0.0337 -0.0256 0.0144  216 TRP D CG  
2442 C  CD1 . TRP D 75 ? 0.4202 0.4725 0.3814 -0.0299 -0.0250 0.0097  216 TRP D CD1 
2443 C  CD2 . TRP D 75 ? 0.3241 0.3840 0.2959 -0.0398 -0.0308 0.0172  216 TRP D CD2 
2444 N  NE1 . TRP D 75 ? 0.3652 0.4208 0.3262 -0.0329 -0.0301 0.0088  216 TRP D NE1 
2445 C  CE2 . TRP D 75 ? 0.3851 0.4451 0.3534 -0.0393 -0.0339 0.0130  216 TRP D CE2 
2446 C  CE3 . TRP D 75 ? 0.2260 0.2911 0.2051 -0.0457 -0.0331 0.0232  216 TRP D CE3 
2447 C  CZ2 . TRP D 75 ? 0.3411 0.4062 0.3139 -0.0446 -0.0398 0.0138  216 TRP D CZ2 
2448 C  CZ3 . TRP D 75 ? 0.2509 0.3208 0.2355 -0.0514 -0.0382 0.0249  216 TRP D CZ3 
2449 C  CH2 . TRP D 75 ? 0.3078 0.3776 0.2897 -0.0510 -0.0419 0.0197  216 TRP D CH2 
2450 N  N   . LEU D 76 ? 0.2248 0.2617 0.1951 -0.0281 -0.0198 0.0141  217 LEU D N   
2451 C  CA  . LEU D 76 ? 0.2714 0.3105 0.2429 -0.0257 -0.0176 0.0153  217 LEU D CA  
2452 C  C   . LEU D 76 ? 0.2869 0.3183 0.2604 -0.0270 -0.0208 0.0164  217 LEU D C   
2453 O  O   . LEU D 76 ? 0.2731 0.3054 0.2471 -0.0244 -0.0197 0.0163  217 LEU D O   
2454 C  CB  . LEU D 76 ? 0.2772 0.3162 0.2478 -0.0201 -0.0127 0.0107  217 LEU D CB  
2455 C  CG  . LEU D 76 ? 0.3537 0.3998 0.3228 -0.0180 -0.0093 0.0106  217 LEU D CG  
2456 C  CD1 . LEU D 76 ? 0.3436 0.3869 0.3133 -0.0130 -0.0049 0.0066  217 LEU D CD1 
2457 C  CD2 . LEU D 76 ? 0.3451 0.4034 0.3152 -0.0186 -0.0084 0.0147  217 LEU D CD2 
2458 N  N   . THR D 77 ? 0.2874 0.3114 0.2627 -0.0310 -0.0253 0.0173  218 THR D N   
2459 C  CA  . THR D 77 ? 0.4080 0.4233 0.3863 -0.0320 -0.0289 0.0188  218 THR D CA  
2460 C  C   . THR D 77 ? 0.4217 0.4441 0.4005 -0.0326 -0.0288 0.0254  218 THR D C   
2461 O  O   . THR D 77 ? 0.4383 0.4704 0.4172 -0.0356 -0.0284 0.0313  218 THR D O   
2462 C  CB  . THR D 77 ? 0.4111 0.4182 0.3929 -0.0371 -0.0343 0.0200  218 THR D CB  
2463 O  OG1 . THR D 77 ? 0.4516 0.4502 0.4317 -0.0352 -0.0349 0.0121  218 THR D OG1 
2464 C  CG2 . THR D 77 ? 0.4004 0.3998 0.3865 -0.0387 -0.0382 0.0243  218 THR D CG2 
2465 N  N   . GLY D 78 ? 0.4441 0.4631 0.4233 -0.0291 -0.0290 0.0243  219 GLY D N   
2466 C  CA  . GLY D 78 ? 0.4676 0.4937 0.4459 -0.0287 -0.0294 0.0302  219 GLY D CA  
2467 C  C   . GLY D 78 ? 0.4314 0.4692 0.4062 -0.0248 -0.0253 0.0283  219 GLY D C   
2468 O  O   . GLY D 78 ? 0.4235 0.4674 0.3965 -0.0230 -0.0257 0.0310  219 GLY D O   
2469 N  N   . GLU D 79 ? 0.4279 0.4686 0.4019 -0.0231 -0.0216 0.0234  220 GLU D N   
2470 C  CA  . GLU D 79 ? 0.4322 0.4822 0.4044 -0.0190 -0.0179 0.0205  220 GLU D CA  
2471 C  C   . GLU D 79 ? 0.3637 0.4093 0.3380 -0.0143 -0.0170 0.0136  220 GLU D C   
2472 O  O   . GLU D 79 ? 0.3686 0.4043 0.3457 -0.0136 -0.0182 0.0106  220 GLU D O   
2473 C  CB  . GLU D 79 ? 0.5293 0.5842 0.5010 -0.0190 -0.0145 0.0190  220 GLU D CB  
2474 C  CG  . GLU D 79 ? 0.6739 0.7342 0.6454 -0.0238 -0.0155 0.0250  220 GLU D CG  
2475 C  CD  . GLU D 79 ? 0.7791 0.8535 0.7491 -0.0241 -0.0140 0.0301  220 GLU D CD  
2476 O  OE1 . GLU D 79 ? 0.7975 0.8775 0.7655 -0.0198 -0.0121 0.0278  220 GLU D OE1 
2477 O  OE2 . GLU D 79 ? 0.7975 0.8780 0.7689 -0.0284 -0.0147 0.0361  220 GLU D OE2 
2478 N  N   . GLU D 80 ? 0.3094 0.3627 0.2831 -0.0108 -0.0152 0.0110  221 GLU D N   
2479 C  CA  . GLU D 80 ? 0.3658 0.4159 0.3435 -0.0067 -0.0141 0.0039  221 GLU D CA  
2480 C  C   . GLU D 80 ? 0.2904 0.3416 0.2702 -0.0050 -0.0095 0.0001  221 GLU D C   
2481 O  O   . GLU D 80 ? 0.3466 0.4058 0.3240 -0.0047 -0.0076 0.0013  221 GLU D O   
2482 C  CB  . GLU D 80 ? 0.4797 0.5374 0.4563 -0.0037 -0.0156 0.0021  221 GLU D CB  
2483 C  CG  . GLU D 80 ? 0.5540 0.6119 0.5284 -0.0043 -0.0203 0.0063  221 GLU D CG  
2484 C  CD  . GLU D 80 ? 0.6450 0.7118 0.6170 -0.0005 -0.0222 0.0036  221 GLU D CD  
2485 O  OE1 . GLU D 80 ? 0.6270 0.7010 0.5985 0.0021  -0.0197 -0.0011 221 GLU D OE1 
2486 O  OE2 . GLU D 80 ? 0.7276 0.7942 0.6986 0.0003  -0.0264 0.0058  221 GLU D OE2 
2487 N  N   . LEU D 81 ? 0.2176 0.2615 0.2021 -0.0037 -0.0074 -0.0040 222 LEU D N   
2488 C  CA  . LEU D 81 ? 0.2362 0.2806 0.2237 -0.0016 -0.0028 -0.0069 222 LEU D CA  
2489 C  C   . LEU D 81 ? 0.2284 0.2723 0.2230 0.0016  -0.0020 -0.0126 222 LEU D C   
2490 O  O   . LEU D 81 ? 0.2469 0.2879 0.2449 0.0020  -0.0044 -0.0147 222 LEU D O   
2491 C  CB  . LEU D 81 ? 0.2088 0.2460 0.1966 -0.0023 -0.0004 -0.0065 222 LEU D CB  
2492 C  CG  . LEU D 81 ? 0.2925 0.3292 0.2742 -0.0055 -0.0018 -0.0024 222 LEU D CG  
2493 C  CD1 . LEU D 81 ? 0.2575 0.2882 0.2381 -0.0052 0.0003  -0.0033 222 LEU D CD1 
2494 C  CD2 . LEU D 81 ? 0.3093 0.3547 0.2882 -0.0061 -0.0012 0.0007  222 LEU D CD2 
2495 N  N   . HIS D 82 ? 0.2387 0.2849 0.2372 0.0038  0.0013  -0.0152 223 HIS D N   
2496 C  CA  . HIS D 82 ? 0.2408 0.2855 0.2487 0.0062  0.0022  -0.0211 223 HIS D CA  
2497 C  C   . HIS D 82 ? 0.2315 0.2712 0.2456 0.0070  0.0074  -0.0210 223 HIS D C   
2498 O  O   . HIS D 82 ? 0.2660 0.3067 0.2764 0.0070  0.0101  -0.0176 223 HIS D O   
2499 C  CB  . HIS D 82 ? 0.2819 0.3337 0.2904 0.0087  0.0008  -0.0251 223 HIS D CB  
2500 C  CG  . HIS D 82 ? 0.3328 0.3901 0.3367 0.0089  -0.0042 -0.0261 223 HIS D CG  
2501 N  ND1 . HIS D 82 ? 0.4402 0.5019 0.4345 0.0071  -0.0063 -0.0204 223 HIS D ND1 
2502 C  CD2 . HIS D 82 ? 0.3590 0.4186 0.3665 0.0109  -0.0077 -0.0317 223 HIS D CD2 
2503 C  CE1 . HIS D 82 ? 0.4314 0.4978 0.4229 0.0082  -0.0105 -0.0216 223 HIS D CE1 
2504 N  NE2 . HIS D 82 ? 0.4071 0.4727 0.4061 0.0107  -0.0117 -0.0289 223 HIS D NE2 
2505 N  N   . VAL D 83 ? 0.2150 0.2500 0.2384 0.0076  0.0090  -0.0239 224 VAL D N   
2506 C  CA  . VAL D 83 ? 0.2829 0.3138 0.3128 0.0083  0.0146  -0.0225 224 VAL D CA  
2507 C  C   . VAL D 83 ? 0.3205 0.3510 0.3634 0.0098  0.0154  -0.0275 224 VAL D C   
2508 O  O   . VAL D 83 ? 0.2775 0.3084 0.3269 0.0098  0.0123  -0.0322 224 VAL D O   
2509 C  CB  . VAL D 83 ? 0.2619 0.2880 0.2930 0.0076  0.0170  -0.0208 224 VAL D CB  
2510 C  CG1 . VAL D 83 ? 0.2232 0.2466 0.2610 0.0087  0.0233  -0.0186 224 VAL D CG1 
2511 C  CG2 . VAL D 83 ? 0.2250 0.2504 0.2436 0.0062  0.0154  -0.0170 224 VAL D CG2 
2512 N  N   . GLU D 84 ? 0.2971 0.3267 0.3445 0.0111  0.0190  -0.0264 225 GLU D N   
2513 C  CA  . GLU D 84 ? 0.3004 0.3285 0.3618 0.0123  0.0196  -0.0314 225 GLU D CA  
2514 C  C   . GLU D 84 ? 0.3330 0.3560 0.4039 0.0125  0.0259  -0.0273 225 GLU D C   
2515 O  O   . GLU D 84 ? 0.2675 0.2895 0.3320 0.0128  0.0298  -0.0207 225 GLU D O   
2516 C  CB  . GLU D 84 ? 0.2742 0.3060 0.3339 0.0145  0.0177  -0.0347 225 GLU D CB  
2517 C  CG  . GLU D 84 ? 0.3898 0.4270 0.4472 0.0153  0.0117  -0.0415 225 GLU D CG  
2518 C  CD  . GLU D 84 ? 0.5803 0.6233 0.6316 0.0180  0.0106  -0.0435 225 GLU D CD  
2519 O  OE1 . GLU D 84 ? 0.5308 0.5718 0.5866 0.0198  0.0138  -0.0427 225 GLU D OE1 
2520 O  OE2 . GLU D 84 ? 0.6933 0.7433 0.7354 0.0185  0.0066  -0.0454 225 GLU D OE2 
2521 N  N   . VAL D 85 ? 0.2888 0.3089 0.3757 0.0122  0.0268  -0.0309 226 VAL D N   
2522 C  CA  . VAL D 85 ? 0.2675 0.2829 0.3646 0.0122  0.0333  -0.0258 226 VAL D CA  
2523 C  C   . VAL D 85 ? 0.2775 0.2911 0.3769 0.0144  0.0344  -0.0249 226 VAL D C   
2524 O  O   . VAL D 85 ? 0.2841 0.2991 0.3864 0.0156  0.0301  -0.0319 226 VAL D O   
2525 C  CB  . VAL D 85 ? 0.2924 0.3055 0.4084 0.0105  0.0339  -0.0295 226 VAL D CB  
2526 C  CG1 . VAL D 85 ? 0.2816 0.2899 0.4103 0.0102  0.0413  -0.0229 226 VAL D CG1 
2527 C  CG2 . VAL D 85 ? 0.3367 0.3523 0.4503 0.0091  0.0325  -0.0305 226 VAL D CG2 
2528 N  N   . LEU D 86 ? 0.2529 0.2643 0.3505 0.0154  0.0398  -0.0167 227 LEU D N   
2529 C  CA  . LEU D 86 ? 0.2458 0.2547 0.3478 0.0180  0.0412  -0.0151 227 LEU D CA  
2530 C  C   . LEU D 86 ? 0.2673 0.2705 0.3904 0.0178  0.0415  -0.0197 227 LEU D C   
2531 O  O   . LEU D 86 ? 0.2320 0.2329 0.3674 0.0153  0.0427  -0.0209 227 LEU D O   
2532 C  CB  . LEU D 86 ? 0.3228 0.3301 0.4209 0.0193  0.0472  -0.0042 227 LEU D CB  
2533 C  CG  . LEU D 86 ? 0.3392 0.3518 0.4175 0.0199  0.0466  0.0005  227 LEU D CG  
2534 C  CD1 . LEU D 86 ? 0.3528 0.3645 0.4274 0.0218  0.0521  0.0109  227 LEU D CD1 
2535 C  CD2 . LEU D 86 ? 0.2707 0.2885 0.3402 0.0212  0.0414  -0.0039 227 LEU D CD2 
2536 N  N   . GLU D 87 ? 0.2489 0.2498 0.3774 0.0206  0.0402  -0.0227 228 GLU D N   
2537 C  CA  . GLU D 87 ? 0.2970 0.2910 0.4470 0.0204  0.0404  -0.0270 228 GLU D CA  
2538 C  C   . GLU D 87 ? 0.3121 0.3000 0.4754 0.0185  0.0472  -0.0178 228 GLU D C   
2539 O  O   . GLU D 87 ? 0.2879 0.2756 0.4442 0.0194  0.0525  -0.0068 228 GLU D O   
2540 C  CB  . GLU D 87 ? 0.3638 0.3555 0.5171 0.0245  0.0386  -0.0309 228 GLU D CB  
2541 C  CG  . GLU D 87 ? 0.4288 0.4276 0.5715 0.0266  0.0322  -0.0411 228 GLU D CG  
2542 C  CD  . GLU D 87 ? 0.5076 0.5066 0.6598 0.0250  0.0268  -0.0529 228 GLU D CD  
2543 O  OE1 . GLU D 87 ? 0.5440 0.5392 0.7090 0.0270  0.0240  -0.0616 228 GLU D OE1 
2544 O  OE2 . GLU D 87 ? 0.4173 0.4204 0.5645 0.0220  0.0250  -0.0537 228 GLU D OE2 
2545 N  N   . ASN D 88 ? 0.2516 0.2352 0.4349 0.0158  0.0468  -0.0222 229 ASN D N   
2546 C  CA  . ASN D 88 ? 0.2223 0.2003 0.4218 0.0136  0.0534  -0.0135 229 ASN D CA  
2547 C  C   . ASN D 88 ? 0.2740 0.2437 0.4854 0.0161  0.0557  -0.0096 229 ASN D C   
2548 O  O   . ASN D 88 ? 0.2648 0.2284 0.4949 0.0156  0.0527  -0.0170 229 ASN D O   
2549 C  CB  . ASN D 88 ? 0.3118 0.2891 0.5303 0.0095  0.0517  -0.0199 229 ASN D CB  
2550 C  CG  . ASN D 88 ? 0.4216 0.3959 0.6563 0.0065  0.0597  -0.0096 229 ASN D CG  
2551 O  OD1 . ASN D 88 ? 0.4491 0.4213 0.6803 0.0078  0.0665  0.0027  229 ASN D OD1 
2552 N  ND2 . ASN D 88 ? 0.4247 0.3998 0.6772 0.0025  0.0589  -0.0139 229 ASN D ND2 
2553 N  N   . VAL D 89 ? 0.2774 0.2473 0.4773 0.0190  0.0601  0.0013  230 VAL D N   
2554 C  CA  . VAL D 89 ? 0.3211 0.2836 0.5302 0.0221  0.0627  0.0072  230 VAL D CA  
2555 C  C   . VAL D 89 ? 0.3763 0.3385 0.5825 0.0222  0.0709  0.0235  230 VAL D C   
2556 O  O   . VAL D 89 ? 0.3787 0.3482 0.5651 0.0228  0.0727  0.0288  230 VAL D O   
2557 C  CB  . VAL D 89 ? 0.3162 0.2814 0.5110 0.0272  0.0589  0.0041  230 VAL D CB  
2558 C  CG1 . VAL D 89 ? 0.2796 0.2361 0.4867 0.0311  0.0614  0.0104  230 VAL D CG1 
2559 C  CG2 . VAL D 89 ? 0.2313 0.2002 0.4232 0.0278  0.0510  -0.0118 230 VAL D CG2 
2560 N  N   . PRO D 90 ? 0.2921 0.2459 0.5181 0.0217  0.0758  0.0316  231 PRO D N   
2561 C  CA  . PRO D 90 ? 0.4057 0.3598 0.6310 0.0214  0.0846  0.0481  231 PRO D CA  
2562 C  C   . PRO D 90 ? 0.4546 0.4134 0.6584 0.0262  0.0870  0.0586  231 PRO D C   
2563 O  O   . PRO D 90 ? 0.3074 0.2675 0.5004 0.0302  0.0825  0.0550  231 PRO D O   
2564 C  CB  . PRO D 90 ? 0.3861 0.3289 0.6389 0.0204  0.0880  0.0538  231 PRO D CB  
2565 C  CG  . PRO D 90 ? 0.3999 0.3375 0.6700 0.0180  0.0812  0.0384  231 PRO D CG  
2566 C  CD  . PRO D 90 ? 0.3251 0.2684 0.5762 0.0210  0.0735  0.0257  231 PRO D CD  
2567 N  N   . LEU D 91 ? 0.6552 0.6172 0.8546 0.0259  0.0946  0.0719  232 LEU D N   
2568 C  CA  . LEU D 91 ? 0.7244 0.6920 0.9043 0.0301  0.0982  0.0839  232 LEU D CA  
2569 C  C   . LEU D 91 ? 0.8168 0.7938 0.9712 0.0314  0.0931  0.0771  232 LEU D C   
2570 O  O   . LEU D 91 ? 0.8139 0.7981 0.9542 0.0306  0.0954  0.0791  232 LEU D O   
2571 C  CB  . LEU D 91 ? 0.7109 0.6724 0.8961 0.0348  0.0990  0.0927  232 LEU D CB  
2572 C  CG  . LEU D 91 ? 0.7665 0.7335 0.9348 0.0393  0.1035  0.1078  232 LEU D CG  
2573 C  CD1 . LEU D 91 ? 0.8033 0.7681 0.9820 0.0386  0.1131  0.1237  232 LEU D CD1 
2574 C  CD2 . LEU D 91 ? 0.8158 0.7808 0.9802 0.0452  0.1000  0.1108  232 LEU D CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MSE 1  142 ?   ?   ?   A . n 
A 1 2  GLY 2  143 ?   ?   ?   A . n 
A 1 3  HIS 3  144 ?   ?   ?   A . n 
A 1 4  HIS 4  145 ?   ?   ?   A . n 
A 1 5  HIS 5  146 ?   ?   ?   A . n 
A 1 6  HIS 6  147 ?   ?   ?   A . n 
A 1 7  HIS 7  148 ?   ?   ?   A . n 
A 1 8  HIS 8  149 ?   ?   ?   A . n 
A 1 9  SER 9  150 ?   ?   ?   A . n 
A 1 10 HIS 10 151 151 HIS ALA A . n 
A 1 11 MSE 11 152 152 MSE MSE A . n 
A 1 12 GLN 12 153 153 GLN GLN A . n 
A 1 13 LYS 13 154 154 LYS LYS A . n 
A 1 14 PRO 14 155 155 PRO PRO A . n 
A 1 15 ILE 15 156 156 ILE ILE A . n 
A 1 16 VAL 16 157 157 VAL VAL A . n 
A 1 17 ARG 17 158 158 ARG ARG A . n 
A 1 18 VAL 18 159 159 VAL VAL A . n 
A 1 19 PHE 19 160 160 PHE PHE A . n 
A 1 20 LEU 20 161 161 LEU LEU A . n 
A 1 21 PRO 21 162 162 PRO PRO A . n 
A 1 22 ASN 22 163 163 ASN ASN A . n 
A 1 23 LYS 23 164 164 LYS LYS A . n 
A 1 24 GLN 24 165 165 GLN GLN A . n 
A 1 25 ARG 25 166 166 ARG ARG A . n 
A 1 26 THR 26 167 167 THR THR A . n 
A 1 27 VAL 27 168 168 VAL VAL A . n 
A 1 28 VAL 28 169 169 VAL VAL A . n 
A 1 29 PRO 29 170 170 PRO PRO A . n 
A 1 30 ALA 30 171 171 ALA ALA A . n 
A 1 31 ARG 31 172 172 ARG ARG A . n 
A 1 32 CYS 32 173 173 CYS CYS A . n 
A 1 33 GLY 33 174 174 GLY GLY A . n 
A 1 34 VAL 34 175 175 VAL VAL A . n 
A 1 35 THR 35 176 176 THR THR A . n 
A 1 36 VAL 36 177 177 VAL VAL A . n 
A 1 37 ARG 37 178 178 ARG ARG A . n 
A 1 38 ASP 38 179 179 ASP ASP A . n 
A 1 39 SER 39 180 180 SER SER A . n 
A 1 40 LEU 40 181 181 LEU LEU A . n 
A 1 41 LYS 41 182 182 LYS LYS A . n 
A 1 42 LYS 42 183 183 LYS LYS A . n 
A 1 43 ALA 43 184 184 ALA ALA A . n 
A 1 44 LEU 44 185 185 LEU LEU A . n 
A 1 45 MSE 45 186 186 MSE MSE A . n 
A 1 46 MSE 46 187 187 MSE MSE A . n 
A 1 47 ARG 47 188 188 ARG ARG A . n 
A 1 48 GLY 48 189 189 GLY GLY A . n 
A 1 49 LEU 49 190 190 LEU LEU A . n 
A 1 50 ILE 50 191 191 ILE ILE A . n 
A 1 51 PRO 51 192 192 PRO PRO A . n 
A 1 52 GLU 52 193 193 GLU GLU A . n 
A 1 53 CYS 53 194 194 CYS CYS A . n 
A 1 54 CYS 54 195 195 CYS CYS A . n 
A 1 55 ALA 55 196 196 ALA ALA A . n 
A 1 56 VAL 56 197 197 VAL VAL A . n 
A 1 57 TYR 57 198 198 TYR TYR A . n 
A 1 58 ARG 58 199 199 ARG ARG A . n 
A 1 59 ILE 59 200 200 ILE ILE A . n 
A 1 60 GLN 60 201 201 GLN GLN A . n 
A 1 61 ASP 61 202 ?   ?   ?   A . n 
A 1 62 GLY 62 203 ?   ?   ?   A . n 
A 1 63 GLU 63 204 ?   ?   ?   A . n 
A 1 64 LYS 64 205 205 LYS ALA A . n 
A 1 65 LYS 65 206 206 LYS LYS A . n 
A 1 66 PRO 66 207 207 PRO PRO A . n 
A 1 67 ILE 67 208 208 ILE ILE A . n 
A 1 68 GLY 68 209 209 GLY GLY A . n 
A 1 69 TRP 69 210 210 TRP TRP A . n 
A 1 70 ASP 70 211 211 ASP ASP A . n 
A 1 71 THR 71 212 212 THR THR A . n 
A 1 72 ASP 72 213 213 ASP ASP A . n 
A 1 73 ILE 73 214 214 ILE ILE A . n 
A 1 74 SER 74 215 215 SER SER A . n 
A 1 75 TRP 75 216 216 TRP TRP A . n 
A 1 76 LEU 76 217 217 LEU LEU A . n 
A 1 77 THR 77 218 218 THR THR A . n 
A 1 78 GLY 78 219 219 GLY GLY A . n 
A 1 79 GLU 79 220 220 GLU GLU A . n 
A 1 80 GLU 80 221 221 GLU GLU A . n 
A 1 81 LEU 81 222 222 LEU LEU A . n 
A 1 82 HIS 82 223 223 HIS HIS A . n 
A 1 83 VAL 83 224 224 VAL VAL A . n 
A 1 84 GLU 84 225 225 GLU GLU A . n 
A 1 85 VAL 85 226 226 VAL VAL A . n 
A 1 86 LEU 86 227 227 LEU LEU A . n 
A 1 87 GLU 87 228 228 GLU GLU A . n 
A 1 88 ASN 88 229 229 ASN ASN A . n 
A 1 89 VAL 89 230 230 VAL VAL A . n 
A 1 90 PRO 90 231 231 PRO PRO A . n 
A 1 91 LEU 91 232 232 LEU LEU A . n 
A 1 92 THR 92 233 233 THR THR A . n 
A 1 93 THR 93 234 ?   ?   ?   A . n 
A 1 94 HIS 94 235 ?   ?   ?   A . n 
A 1 95 ASN 95 236 ?   ?   ?   A . n 
A 1 96 PHE 96 237 ?   ?   ?   A . n 
B 1 1  MSE 1  142 ?   ?   ?   B . n 
B 1 2  GLY 2  143 ?   ?   ?   B . n 
B 1 3  HIS 3  144 ?   ?   ?   B . n 
B 1 4  HIS 4  145 ?   ?   ?   B . n 
B 1 5  HIS 5  146 ?   ?   ?   B . n 
B 1 6  HIS 6  147 ?   ?   ?   B . n 
B 1 7  HIS 7  148 ?   ?   ?   B . n 
B 1 8  HIS 8  149 ?   ?   ?   B . n 
B 1 9  SER 9  150 150 SER SER B . n 
B 1 10 HIS 10 151 151 HIS HIS B . n 
B 1 11 MSE 11 152 152 MSE MSE B . n 
B 1 12 GLN 12 153 153 GLN GLN B . n 
B 1 13 LYS 13 154 154 LYS LYS B . n 
B 1 14 PRO 14 155 155 PRO PRO B . n 
B 1 15 ILE 15 156 156 ILE ILE B . n 
B 1 16 VAL 16 157 157 VAL VAL B . n 
B 1 17 ARG 17 158 158 ARG ARG B . n 
B 1 18 VAL 18 159 159 VAL VAL B . n 
B 1 19 PHE 19 160 160 PHE PHE B . n 
B 1 20 LEU 20 161 161 LEU LEU B . n 
B 1 21 PRO 21 162 162 PRO PRO B . n 
B 1 22 ASN 22 163 163 ASN ASN B . n 
B 1 23 LYS 23 164 164 LYS LYS B . n 
B 1 24 GLN 24 165 165 GLN GLN B . n 
B 1 25 ARG 25 166 166 ARG ARG B . n 
B 1 26 THR 26 167 167 THR THR B . n 
B 1 27 VAL 27 168 168 VAL VAL B . n 
B 1 28 VAL 28 169 169 VAL VAL B . n 
B 1 29 PRO 29 170 170 PRO PRO B . n 
B 1 30 ALA 30 171 171 ALA ALA B . n 
B 1 31 ARG 31 172 172 ARG ARG B . n 
B 1 32 CYS 32 173 173 CYS CYS B . n 
B 1 33 GLY 33 174 174 GLY GLY B . n 
B 1 34 VAL 34 175 175 VAL VAL B . n 
B 1 35 THR 35 176 176 THR THR B . n 
B 1 36 VAL 36 177 177 VAL VAL B . n 
B 1 37 ARG 37 178 178 ARG ARG B . n 
B 1 38 ASP 38 179 179 ASP ASP B . n 
B 1 39 SER 39 180 180 SER SER B . n 
B 1 40 LEU 40 181 181 LEU LEU B . n 
B 1 41 LYS 41 182 182 LYS LYS B . n 
B 1 42 LYS 42 183 183 LYS LYS B . n 
B 1 43 ALA 43 184 184 ALA ALA B . n 
B 1 44 LEU 44 185 185 LEU LEU B . n 
B 1 45 MSE 45 186 186 MSE MSE B . n 
B 1 46 MSE 46 187 187 MSE MSE B . n 
B 1 47 ARG 47 188 188 ARG ARG B . n 
B 1 48 GLY 48 189 189 GLY GLY B . n 
B 1 49 LEU 49 190 190 LEU LEU B . n 
B 1 50 ILE 50 191 191 ILE ILE B . n 
B 1 51 PRO 51 192 192 PRO PRO B . n 
B 1 52 GLU 52 193 193 GLU GLU B . n 
B 1 53 CYS 53 194 194 CYS CYS B . n 
B 1 54 CYS 54 195 195 CYS CYS B . n 
B 1 55 ALA 55 196 196 ALA ALA B . n 
B 1 56 VAL 56 197 197 VAL VAL B . n 
B 1 57 TYR 57 198 198 TYR TYR B . n 
B 1 58 ARG 58 199 199 ARG ARG B . n 
B 1 59 ILE 59 200 200 ILE ILE B . n 
B 1 60 GLN 60 201 201 GLN GLN B . n 
B 1 61 ASP 61 202 ?   ?   ?   B . n 
B 1 62 GLY 62 203 ?   ?   ?   B . n 
B 1 63 GLU 63 204 204 GLU ALA B . n 
B 1 64 LYS 64 205 205 LYS ALA B . n 
B 1 65 LYS 65 206 206 LYS LYS B . n 
B 1 66 PRO 66 207 207 PRO PRO B . n 
B 1 67 ILE 67 208 208 ILE ILE B . n 
B 1 68 GLY 68 209 209 GLY GLY B . n 
B 1 69 TRP 69 210 210 TRP TRP B . n 
B 1 70 ASP 70 211 211 ASP ASP B . n 
B 1 71 THR 71 212 212 THR THR B . n 
B 1 72 ASP 72 213 213 ASP ASP B . n 
B 1 73 ILE 73 214 214 ILE ILE B . n 
B 1 74 SER 74 215 215 SER SER B . n 
B 1 75 TRP 75 216 216 TRP TRP B . n 
B 1 76 LEU 76 217 217 LEU LEU B . n 
B 1 77 THR 77 218 218 THR THR B . n 
B 1 78 GLY 78 219 219 GLY GLY B . n 
B 1 79 GLU 79 220 220 GLU GLU B . n 
B 1 80 GLU 80 221 221 GLU GLU B . n 
B 1 81 LEU 81 222 222 LEU LEU B . n 
B 1 82 HIS 82 223 223 HIS HIS B . n 
B 1 83 VAL 83 224 224 VAL VAL B . n 
B 1 84 GLU 84 225 225 GLU GLU B . n 
B 1 85 VAL 85 226 226 VAL VAL B . n 
B 1 86 LEU 86 227 227 LEU LEU B . n 
B 1 87 GLU 87 228 228 GLU GLU B . n 
B 1 88 ASN 88 229 229 ASN ASN B . n 
B 1 89 VAL 89 230 230 VAL VAL B . n 
B 1 90 PRO 90 231 231 PRO PRO B . n 
B 1 91 LEU 91 232 232 LEU LEU B . n 
B 1 92 THR 92 233 233 THR THR B . n 
B 1 93 THR 93 234 234 THR THR B . n 
B 1 94 HIS 94 235 235 HIS HIS B . n 
B 1 95 ASN 95 236 ?   ?   ?   B . n 
B 1 96 PHE 96 237 ?   ?   ?   B . n 
C 1 1  MSE 1  142 ?   ?   ?   C . n 
C 1 2  GLY 2  143 ?   ?   ?   C . n 
C 1 3  HIS 3  144 ?   ?   ?   C . n 
C 1 4  HIS 4  145 ?   ?   ?   C . n 
C 1 5  HIS 5  146 ?   ?   ?   C . n 
C 1 6  HIS 6  147 ?   ?   ?   C . n 
C 1 7  HIS 7  148 ?   ?   ?   C . n 
C 1 8  HIS 8  149 ?   ?   ?   C . n 
C 1 9  SER 9  150 ?   ?   ?   C . n 
C 1 10 HIS 10 151 ?   ?   ?   C . n 
C 1 11 MSE 11 152 152 MSE MSE C . n 
C 1 12 GLN 12 153 153 GLN GLN C . n 
C 1 13 LYS 13 154 154 LYS LYS C . n 
C 1 14 PRO 14 155 155 PRO PRO C . n 
C 1 15 ILE 15 156 156 ILE ILE C . n 
C 1 16 VAL 16 157 157 VAL VAL C . n 
C 1 17 ARG 17 158 158 ARG ARG C . n 
C 1 18 VAL 18 159 159 VAL VAL C . n 
C 1 19 PHE 19 160 160 PHE PHE C . n 
C 1 20 LEU 20 161 161 LEU LEU C . n 
C 1 21 PRO 21 162 162 PRO PRO C . n 
C 1 22 ASN 22 163 163 ASN ASN C . n 
C 1 23 LYS 23 164 164 LYS LYS C . n 
C 1 24 GLN 24 165 165 GLN GLN C . n 
C 1 25 ARG 25 166 166 ARG ARG C . n 
C 1 26 THR 26 167 167 THR THR C . n 
C 1 27 VAL 27 168 168 VAL VAL C . n 
C 1 28 VAL 28 169 169 VAL VAL C . n 
C 1 29 PRO 29 170 170 PRO PRO C . n 
C 1 30 ALA 30 171 171 ALA ALA C . n 
C 1 31 ARG 31 172 172 ARG ARG C . n 
C 1 32 CYS 32 173 173 CYS CYS C . n 
C 1 33 GLY 33 174 174 GLY GLY C . n 
C 1 34 VAL 34 175 175 VAL VAL C . n 
C 1 35 THR 35 176 176 THR THR C . n 
C 1 36 VAL 36 177 177 VAL VAL C . n 
C 1 37 ARG 37 178 178 ARG ARG C . n 
C 1 38 ASP 38 179 179 ASP ASP C . n 
C 1 39 SER 39 180 180 SER SER C . n 
C 1 40 LEU 40 181 181 LEU LEU C . n 
C 1 41 LYS 41 182 182 LYS LYS C . n 
C 1 42 LYS 42 183 183 LYS LYS C . n 
C 1 43 ALA 43 184 184 ALA ALA C . n 
C 1 44 LEU 44 185 185 LEU LEU C . n 
C 1 45 MSE 45 186 186 MSE MSE C . n 
C 1 46 MSE 46 187 187 MSE MSE C . n 
C 1 47 ARG 47 188 188 ARG ARG C . n 
C 1 48 GLY 48 189 189 GLY GLY C . n 
C 1 49 LEU 49 190 190 LEU LEU C . n 
C 1 50 ILE 50 191 191 ILE ILE C . n 
C 1 51 PRO 51 192 192 PRO PRO C . n 
C 1 52 GLU 52 193 193 GLU GLU C . n 
C 1 53 CYS 53 194 194 CYS CYS C . n 
C 1 54 CYS 54 195 195 CYS CYS C . n 
C 1 55 ALA 55 196 196 ALA ALA C . n 
C 1 56 VAL 56 197 197 VAL VAL C . n 
C 1 57 TYR 57 198 198 TYR TYR C . n 
C 1 58 ARG 58 199 199 ARG ARG C . n 
C 1 59 ILE 59 200 200 ILE ILE C . n 
C 1 60 GLN 60 201 201 GLN GLN C . n 
C 1 61 ASP 61 202 ?   ?   ?   C . n 
C 1 62 GLY 62 203 ?   ?   ?   C . n 
C 1 63 GLU 63 204 ?   ?   ?   C . n 
C 1 64 LYS 64 205 205 LYS ALA C . n 
C 1 65 LYS 65 206 206 LYS LYS C . n 
C 1 66 PRO 66 207 207 PRO PRO C . n 
C 1 67 ILE 67 208 208 ILE ILE C . n 
C 1 68 GLY 68 209 209 GLY GLY C . n 
C 1 69 TRP 69 210 210 TRP TRP C . n 
C 1 70 ASP 70 211 211 ASP ASP C . n 
C 1 71 THR 71 212 212 THR THR C . n 
C 1 72 ASP 72 213 213 ASP ASP C . n 
C 1 73 ILE 73 214 214 ILE ILE C . n 
C 1 74 SER 74 215 215 SER SER C . n 
C 1 75 TRP 75 216 216 TRP TRP C . n 
C 1 76 LEU 76 217 217 LEU LEU C . n 
C 1 77 THR 77 218 218 THR THR C . n 
C 1 78 GLY 78 219 219 GLY GLY C . n 
C 1 79 GLU 79 220 220 GLU GLU C . n 
C 1 80 GLU 80 221 221 GLU GLU C . n 
C 1 81 LEU 81 222 222 LEU LEU C . n 
C 1 82 HIS 82 223 223 HIS HIS C . n 
C 1 83 VAL 83 224 224 VAL VAL C . n 
C 1 84 GLU 84 225 225 GLU GLU C . n 
C 1 85 VAL 85 226 226 VAL VAL C . n 
C 1 86 LEU 86 227 227 LEU LEU C . n 
C 1 87 GLU 87 228 228 GLU GLU C . n 
C 1 88 ASN 88 229 229 ASN ASN C . n 
C 1 89 VAL 89 230 230 VAL VAL C . n 
C 1 90 PRO 90 231 231 PRO PRO C . n 
C 1 91 LEU 91 232 232 LEU LEU C . n 
C 1 92 THR 92 233 233 THR THR C . n 
C 1 93 THR 93 234 234 THR THR C . n 
C 1 94 HIS 94 235 235 HIS HIS C . n 
C 1 95 ASN 95 236 ?   ?   ?   C . n 
C 1 96 PHE 96 237 ?   ?   ?   C . n 
D 1 1  MSE 1  142 ?   ?   ?   D . n 
D 1 2  GLY 2  143 ?   ?   ?   D . n 
D 1 3  HIS 3  144 ?   ?   ?   D . n 
D 1 4  HIS 4  145 ?   ?   ?   D . n 
D 1 5  HIS 5  146 ?   ?   ?   D . n 
D 1 6  HIS 6  147 ?   ?   ?   D . n 
D 1 7  HIS 7  148 ?   ?   ?   D . n 
D 1 8  HIS 8  149 ?   ?   ?   D . n 
D 1 9  SER 9  150 ?   ?   ?   D . n 
D 1 10 HIS 10 151 151 HIS HIS D . n 
D 1 11 MSE 11 152 152 MSE MSE D . n 
D 1 12 GLN 12 153 153 GLN ALA D . n 
D 1 13 LYS 13 154 154 LYS LYS D . n 
D 1 14 PRO 14 155 155 PRO PRO D . n 
D 1 15 ILE 15 156 156 ILE ILE D . n 
D 1 16 VAL 16 157 157 VAL VAL D . n 
D 1 17 ARG 17 158 158 ARG ARG D . n 
D 1 18 VAL 18 159 159 VAL VAL D . n 
D 1 19 PHE 19 160 160 PHE PHE D . n 
D 1 20 LEU 20 161 161 LEU LEU D . n 
D 1 21 PRO 21 162 162 PRO PRO D . n 
D 1 22 ASN 22 163 163 ASN ASN D . n 
D 1 23 LYS 23 164 164 LYS LYS D . n 
D 1 24 GLN 24 165 165 GLN GLN D . n 
D 1 25 ARG 25 166 166 ARG ARG D . n 
D 1 26 THR 26 167 167 THR THR D . n 
D 1 27 VAL 27 168 168 VAL VAL D . n 
D 1 28 VAL 28 169 169 VAL VAL D . n 
D 1 29 PRO 29 170 170 PRO PRO D . n 
D 1 30 ALA 30 171 171 ALA ALA D . n 
D 1 31 ARG 31 172 172 ARG ARG D . n 
D 1 32 CYS 32 173 173 CYS CYS D . n 
D 1 33 GLY 33 174 174 GLY GLY D . n 
D 1 34 VAL 34 175 175 VAL VAL D . n 
D 1 35 THR 35 176 176 THR THR D . n 
D 1 36 VAL 36 177 177 VAL VAL D . n 
D 1 37 ARG 37 178 178 ARG ARG D . n 
D 1 38 ASP 38 179 179 ASP ASP D . n 
D 1 39 SER 39 180 180 SER SER D . n 
D 1 40 LEU 40 181 181 LEU LEU D . n 
D 1 41 LYS 41 182 182 LYS LYS D . n 
D 1 42 LYS 42 183 183 LYS LYS D . n 
D 1 43 ALA 43 184 184 ALA ALA D . n 
D 1 44 LEU 44 185 185 LEU LEU D . n 
D 1 45 MSE 45 186 186 MSE MSE D . n 
D 1 46 MSE 46 187 187 MSE MSE D . n 
D 1 47 ARG 47 188 188 ARG ARG D . n 
D 1 48 GLY 48 189 189 GLY GLY D . n 
D 1 49 LEU 49 190 190 LEU LEU D . n 
D 1 50 ILE 50 191 191 ILE ILE D . n 
D 1 51 PRO 51 192 192 PRO PRO D . n 
D 1 52 GLU 52 193 193 GLU GLU D . n 
D 1 53 CYS 53 194 194 CYS CYS D . n 
D 1 54 CYS 54 195 195 CYS CYS D . n 
D 1 55 ALA 55 196 196 ALA ALA D . n 
D 1 56 VAL 56 197 197 VAL VAL D . n 
D 1 57 TYR 57 198 198 TYR TYR D . n 
D 1 58 ARG 58 199 199 ARG ARG D . n 
D 1 59 ILE 59 200 200 ILE ILE D . n 
D 1 60 GLN 60 201 ?   ?   ?   D . n 
D 1 61 ASP 61 202 ?   ?   ?   D . n 
D 1 62 GLY 62 203 ?   ?   ?   D . n 
D 1 63 GLU 63 204 ?   ?   ?   D . n 
D 1 64 LYS 64 205 205 LYS LYS D . n 
D 1 65 LYS 65 206 206 LYS LYS D . n 
D 1 66 PRO 66 207 207 PRO PRO D . n 
D 1 67 ILE 67 208 208 ILE ILE D . n 
D 1 68 GLY 68 209 209 GLY GLY D . n 
D 1 69 TRP 69 210 210 TRP TRP D . n 
D 1 70 ASP 70 211 211 ASP ASP D . n 
D 1 71 THR 71 212 212 THR THR D . n 
D 1 72 ASP 72 213 213 ASP ASP D . n 
D 1 73 ILE 73 214 214 ILE ILE D . n 
D 1 74 SER 74 215 215 SER SER D . n 
D 1 75 TRP 75 216 216 TRP TRP D . n 
D 1 76 LEU 76 217 217 LEU LEU D . n 
D 1 77 THR 77 218 218 THR THR D . n 
D 1 78 GLY 78 219 219 GLY GLY D . n 
D 1 79 GLU 79 220 220 GLU GLU D . n 
D 1 80 GLU 80 221 221 GLU GLU D . n 
D 1 81 LEU 81 222 222 LEU LEU D . n 
D 1 82 HIS 82 223 223 HIS HIS D . n 
D 1 83 VAL 83 224 224 VAL VAL D . n 
D 1 84 GLU 84 225 225 GLU GLU D . n 
D 1 85 VAL 85 226 226 VAL VAL D . n 
D 1 86 LEU 86 227 227 LEU LEU D . n 
D 1 87 GLU 87 228 228 GLU GLU D . n 
D 1 88 ASN 88 229 229 ASN ASN D . n 
D 1 89 VAL 89 230 230 VAL VAL D . n 
D 1 90 PRO 90 231 231 PRO PRO D . n 
D 1 91 LEU 91 232 232 LEU LEU D . n 
D 1 92 THR 92 233 ?   ?   ?   D . n 
D 1 93 THR 93 234 ?   ?   ?   D . n 
D 1 94 HIS 94 235 ?   ?   ?   D . n 
D 1 95 ASN 95 236 ?   ?   ?   D . n 
D 1 96 PHE 96 237 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     NESG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1  303 303 HOH WAT A . 
E 2 HOH 2  309 309 HOH WAT A . 
E 2 HOH 3  310 310 HOH WAT A . 
E 2 HOH 4  312 312 HOH WAT A . 
E 2 HOH 5  314 314 HOH WAT A . 
E 2 HOH 6  315 315 HOH WAT A . 
E 2 HOH 7  317 317 HOH WAT A . 
E 2 HOH 8  318 318 HOH WAT A . 
E 2 HOH 9  319 319 HOH WAT A . 
E 2 HOH 10 323 323 HOH WAT A . 
E 2 HOH 11 325 325 HOH WAT A . 
E 2 HOH 12 326 326 HOH WAT A . 
E 2 HOH 13 328 328 HOH WAT A . 
E 2 HOH 14 330 330 HOH WAT A . 
E 2 HOH 15 334 334 HOH WAT A . 
E 2 HOH 16 335 335 HOH WAT A . 
E 2 HOH 17 337 337 HOH WAT A . 
E 2 HOH 18 340 340 HOH WAT A . 
E 2 HOH 19 341 341 HOH WAT A . 
E 2 HOH 20 343 343 HOH WAT A . 
E 2 HOH 21 350 350 HOH WAT A . 
E 2 HOH 22 352 352 HOH WAT A . 
E 2 HOH 23 354 354 HOH WAT A . 
E 2 HOH 24 355 355 HOH WAT A . 
E 2 HOH 25 359 359 HOH WAT A . 
E 2 HOH 26 363 363 HOH WAT A . 
E 2 HOH 27 373 373 HOH WAT A . 
E 2 HOH 28 375 375 HOH WAT A . 
E 2 HOH 29 376 376 HOH WAT A . 
E 2 HOH 30 377 377 HOH WAT A . 
E 2 HOH 31 381 381 HOH WAT A . 
E 2 HOH 32 383 383 HOH WAT A . 
E 2 HOH 33 389 389 HOH WAT A . 
E 2 HOH 34 390 390 HOH WAT A . 
E 2 HOH 35 394 394 HOH WAT A . 
E 2 HOH 36 396 396 HOH WAT A . 
E 2 HOH 37 397 397 HOH WAT A . 
E 2 HOH 38 402 402 HOH WAT A . 
E 2 HOH 39 407 407 HOH WAT A . 
E 2 HOH 40 409 409 HOH WAT A . 
E 2 HOH 41 424 424 HOH WAT A . 
E 2 HOH 42 425 425 HOH WAT A . 
E 2 HOH 43 426 426 HOH WAT A . 
E 2 HOH 44 427 427 HOH WAT A . 
E 2 HOH 45 428 428 HOH WAT A . 
E 2 HOH 46 430 430 HOH WAT A . 
E 2 HOH 47 433 433 HOH WAT A . 
E 2 HOH 48 434 434 HOH WAT A . 
E 2 HOH 49 440 440 HOH WAT A . 
E 2 HOH 50 465 465 HOH WAT A . 
E 2 HOH 51 467 467 HOH WAT A . 
E 2 HOH 52 468 468 HOH WAT A . 
E 2 HOH 53 471 471 HOH WAT A . 
E 2 HOH 54 478 478 HOH WAT A . 
E 2 HOH 55 480 480 HOH WAT A . 
E 2 HOH 56 482 482 HOH WAT A . 
E 2 HOH 57 492 492 HOH WAT A . 
E 2 HOH 58 494 494 HOH WAT A . 
E 2 HOH 59 497 497 HOH WAT A . 
E 2 HOH 60 498 498 HOH WAT A . 
E 2 HOH 61 500 500 HOH WAT A . 
E 2 HOH 62 501 501 HOH WAT A . 
E 2 HOH 63 503 503 HOH WAT A . 
E 2 HOH 64 512 512 HOH WAT A . 
E 2 HOH 65 519 519 HOH WAT A . 
E 2 HOH 66 523 523 HOH WAT A . 
E 2 HOH 67 528 528 HOH WAT A . 
E 2 HOH 68 529 529 HOH WAT A . 
E 2 HOH 69 540 540 HOH WAT A . 
E 2 HOH 70 548 548 HOH WAT A . 
E 2 HOH 71 550 550 HOH WAT A . 
E 2 HOH 72 553 553 HOH WAT A . 
E 2 HOH 73 560 560 HOH WAT A . 
E 2 HOH 74 568 568 HOH WAT A . 
E 2 HOH 75 573 573 HOH WAT A . 
E 2 HOH 76 582 582 HOH WAT A . 
E 2 HOH 77 585 585 HOH WAT A . 
E 2 HOH 78 590 590 HOH WAT A . 
E 2 HOH 79 591 591 HOH WAT A . 
E 2 HOH 80 596 596 HOH WAT A . 
E 2 HOH 81 602 602 HOH WAT A . 
E 2 HOH 82 610 610 HOH WAT A . 
F 2 HOH 1  304 304 HOH WAT B . 
F 2 HOH 2  308 308 HOH WAT B . 
F 2 HOH 3  313 313 HOH WAT B . 
F 2 HOH 4  320 320 HOH WAT B . 
F 2 HOH 5  324 324 HOH WAT B . 
F 2 HOH 6  336 336 HOH WAT B . 
F 2 HOH 7  339 339 HOH WAT B . 
F 2 HOH 8  342 342 HOH WAT B . 
F 2 HOH 9  344 344 HOH WAT B . 
F 2 HOH 10 349 349 HOH WAT B . 
F 2 HOH 11 353 353 HOH WAT B . 
F 2 HOH 12 361 361 HOH WAT B . 
F 2 HOH 13 366 366 HOH WAT B . 
F 2 HOH 14 368 368 HOH WAT B . 
F 2 HOH 15 369 369 HOH WAT B . 
F 2 HOH 16 370 370 HOH WAT B . 
F 2 HOH 17 372 372 HOH WAT B . 
F 2 HOH 18 388 388 HOH WAT B . 
F 2 HOH 19 392 392 HOH WAT B . 
F 2 HOH 20 398 398 HOH WAT B . 
F 2 HOH 21 399 399 HOH WAT B . 
F 2 HOH 22 403 403 HOH WAT B . 
F 2 HOH 23 410 410 HOH WAT B . 
F 2 HOH 24 412 412 HOH WAT B . 
F 2 HOH 25 415 415 HOH WAT B . 
F 2 HOH 26 422 422 HOH WAT B . 
F 2 HOH 27 429 429 HOH WAT B . 
F 2 HOH 28 438 438 HOH WAT B . 
F 2 HOH 29 439 439 HOH WAT B . 
F 2 HOH 30 447 447 HOH WAT B . 
F 2 HOH 31 449 449 HOH WAT B . 
F 2 HOH 32 451 451 HOH WAT B . 
F 2 HOH 33 460 460 HOH WAT B . 
F 2 HOH 34 461 461 HOH WAT B . 
F 2 HOH 35 462 462 HOH WAT B . 
F 2 HOH 36 463 463 HOH WAT B . 
F 2 HOH 37 466 466 HOH WAT B . 
F 2 HOH 38 476 476 HOH WAT B . 
F 2 HOH 39 479 479 HOH WAT B . 
F 2 HOH 40 493 493 HOH WAT B . 
F 2 HOH 41 499 499 HOH WAT B . 
F 2 HOH 42 504 504 HOH WAT B . 
F 2 HOH 43 513 513 HOH WAT B . 
F 2 HOH 44 515 515 HOH WAT B . 
F 2 HOH 45 518 518 HOH WAT B . 
F 2 HOH 46 525 525 HOH WAT B . 
F 2 HOH 47 532 532 HOH WAT B . 
F 2 HOH 48 535 535 HOH WAT B . 
F 2 HOH 49 538 538 HOH WAT B . 
F 2 HOH 50 551 551 HOH WAT B . 
F 2 HOH 51 555 555 HOH WAT B . 
F 2 HOH 52 558 558 HOH WAT B . 
F 2 HOH 53 565 565 HOH WAT B . 
F 2 HOH 54 566 566 HOH WAT B . 
F 2 HOH 55 575 575 HOH WAT B . 
F 2 HOH 56 579 579 HOH WAT B . 
F 2 HOH 57 595 595 HOH WAT B . 
F 2 HOH 58 613 613 HOH WAT B . 
G 2 HOH 1  305 305 HOH WAT C . 
G 2 HOH 2  311 311 HOH WAT C . 
G 2 HOH 3  321 321 HOH WAT C . 
G 2 HOH 4  332 332 HOH WAT C . 
G 2 HOH 5  345 345 HOH WAT C . 
G 2 HOH 6  346 346 HOH WAT C . 
G 2 HOH 7  348 348 HOH WAT C . 
G 2 HOH 8  380 380 HOH WAT C . 
G 2 HOH 9  384 384 HOH WAT C . 
G 2 HOH 10 385 385 HOH WAT C . 
G 2 HOH 11 386 386 HOH WAT C . 
G 2 HOH 12 393 393 HOH WAT C . 
G 2 HOH 13 395 395 HOH WAT C . 
G 2 HOH 14 405 405 HOH WAT C . 
G 2 HOH 15 406 406 HOH WAT C . 
G 2 HOH 16 408 408 HOH WAT C . 
G 2 HOH 17 418 418 HOH WAT C . 
G 2 HOH 18 419 419 HOH WAT C . 
G 2 HOH 19 432 432 HOH WAT C . 
G 2 HOH 20 435 435 HOH WAT C . 
G 2 HOH 21 441 441 HOH WAT C . 
G 2 HOH 22 445 445 HOH WAT C . 
G 2 HOH 23 446 446 HOH WAT C . 
G 2 HOH 24 448 448 HOH WAT C . 
G 2 HOH 25 450 450 HOH WAT C . 
G 2 HOH 26 453 453 HOH WAT C . 
G 2 HOH 27 454 454 HOH WAT C . 
G 2 HOH 28 456 456 HOH WAT C . 
G 2 HOH 29 457 457 HOH WAT C . 
G 2 HOH 30 473 473 HOH WAT C . 
G 2 HOH 31 474 474 HOH WAT C . 
G 2 HOH 32 481 481 HOH WAT C . 
G 2 HOH 33 483 483 HOH WAT C . 
G 2 HOH 34 496 496 HOH WAT C . 
G 2 HOH 35 511 511 HOH WAT C . 
G 2 HOH 36 527 527 HOH WAT C . 
G 2 HOH 37 530 530 HOH WAT C . 
G 2 HOH 38 542 542 HOH WAT C . 
G 2 HOH 39 552 552 HOH WAT C . 
G 2 HOH 40 554 554 HOH WAT C . 
G 2 HOH 41 563 563 HOH WAT C . 
G 2 HOH 42 564 564 HOH WAT C . 
G 2 HOH 43 569 569 HOH WAT C . 
G 2 HOH 44 584 584 HOH WAT C . 
G 2 HOH 45 599 599 HOH WAT C . 
G 2 HOH 46 600 600 HOH WAT C . 
G 2 HOH 47 607 607 HOH WAT C . 
G 2 HOH 48 617 617 HOH WAT C . 
H 2 HOH 1  302 302 HOH WAT D . 
H 2 HOH 2  306 306 HOH WAT D . 
H 2 HOH 3  307 307 HOH WAT D . 
H 2 HOH 4  329 329 HOH WAT D . 
H 2 HOH 5  331 331 HOH WAT D . 
H 2 HOH 6  333 333 HOH WAT D . 
H 2 HOH 7  338 338 HOH WAT D . 
H 2 HOH 8  351 351 HOH WAT D . 
H 2 HOH 9  357 357 HOH WAT D . 
H 2 HOH 10 358 358 HOH WAT D . 
H 2 HOH 11 360 360 HOH WAT D . 
H 2 HOH 12 362 362 HOH WAT D . 
H 2 HOH 13 364 364 HOH WAT D . 
H 2 HOH 14 367 367 HOH WAT D . 
H 2 HOH 15 371 371 HOH WAT D . 
H 2 HOH 16 378 378 HOH WAT D . 
H 2 HOH 17 379 379 HOH WAT D . 
H 2 HOH 18 387 387 HOH WAT D . 
H 2 HOH 19 391 391 HOH WAT D . 
H 2 HOH 20 400 400 HOH WAT D . 
H 2 HOH 21 404 404 HOH WAT D . 
H 2 HOH 22 413 413 HOH WAT D . 
H 2 HOH 23 414 414 HOH WAT D . 
H 2 HOH 24 421 421 HOH WAT D . 
H 2 HOH 25 423 423 HOH WAT D . 
H 2 HOH 26 437 437 HOH WAT D . 
H 2 HOH 27 442 442 HOH WAT D . 
H 2 HOH 28 443 443 HOH WAT D . 
H 2 HOH 29 444 444 HOH WAT D . 
H 2 HOH 30 452 452 HOH WAT D . 
H 2 HOH 31 469 469 HOH WAT D . 
H 2 HOH 32 475 475 HOH WAT D . 
H 2 HOH 33 477 477 HOH WAT D . 
H 2 HOH 34 484 484 HOH WAT D . 
H 2 HOH 35 488 488 HOH WAT D . 
H 2 HOH 36 491 491 HOH WAT D . 
H 2 HOH 37 495 495 HOH WAT D . 
H 2 HOH 38 502 502 HOH WAT D . 
H 2 HOH 39 505 505 HOH WAT D . 
H 2 HOH 40 506 506 HOH WAT D . 
H 2 HOH 41 507 507 HOH WAT D . 
H 2 HOH 42 508 508 HOH WAT D . 
H 2 HOH 43 509 509 HOH WAT D . 
H 2 HOH 44 510 510 HOH WAT D . 
H 2 HOH 45 517 517 HOH WAT D . 
H 2 HOH 46 522 522 HOH WAT D . 
H 2 HOH 47 524 524 HOH WAT D . 
H 2 HOH 48 531 531 HOH WAT D . 
H 2 HOH 49 534 534 HOH WAT D . 
H 2 HOH 50 537 537 HOH WAT D . 
H 2 HOH 51 539 539 HOH WAT D . 
H 2 HOH 52 543 543 HOH WAT D . 
H 2 HOH 53 549 549 HOH WAT D . 
H 2 HOH 54 571 571 HOH WAT D . 
H 2 HOH 55 572 572 HOH WAT D . 
H 2 HOH 56 577 577 HOH WAT D . 
H 2 HOH 57 580 580 HOH WAT D . 
H 2 HOH 58 589 589 HOH WAT D . 
H 2 HOH 59 601 601 HOH WAT D . 
H 2 HOH 60 606 606 HOH WAT D . 
H 2 HOH 61 609 609 HOH WAT D . 
H 2 HOH 62 612 612 HOH WAT D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 11 A MSE 152 ? MET SELENOMETHIONINE 
2  A MSE 45 A MSE 186 ? MET SELENOMETHIONINE 
3  A MSE 46 A MSE 187 ? MET SELENOMETHIONINE 
4  B MSE 11 B MSE 152 ? MET SELENOMETHIONINE 
5  B MSE 45 B MSE 186 ? MET SELENOMETHIONINE 
6  B MSE 46 B MSE 187 ? MET SELENOMETHIONINE 
7  C MSE 11 C MSE 152 ? MET SELENOMETHIONINE 
8  C MSE 45 C MSE 186 ? MET SELENOMETHIONINE 
9  C MSE 46 C MSE 187 ? MET SELENOMETHIONINE 
10 D MSE 11 D MSE 152 ? MET SELENOMETHIONINE 
11 D MSE 45 D MSE 186 ? MET SELENOMETHIONINE 
12 D MSE 46 D MSE 187 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_defined_assembly              ?    dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,G     
2 2 D,H     
3 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1830 ? 
1 MORE         -13  ? 
1 'SSA (A^2)'  9950 ? 
2 'ABSA (A^2)' 1760 ? 
2 MORE         -13  ? 
2 'SSA (A^2)'  9620 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_656 -x+1,y+1/2,-z+3/2 -1.0000000000 0.0000000000 0.0000000000 39.8050000000 0.0000000000 
1.0000000000 0.0000000000 34.7090000000 0.0000000000 0.0000000000 -1.0000000000 171.9105000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-02-22 
4 'Structure model' 1 3 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance'  
2 3 'Structure model' 'Structure summary'          
3 4 'Structure model' 'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_struct_assembly_auth_evidence 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 2.5554  44.4969 60.2131 0.0771 0.0482 0.0355 0.0003  0.0127  0.0024  1.4972 0.9762 0.6417 -0.1765 
0.2385  -0.1284 -0.0036 0.0002  0.0014  -0.0000 0.0470  0.0856  0.0005 -0.0805 0.0268  
'X-RAY DIFFRACTION' 2 ? refined 14.9142 25.1889 60.1907 0.0584 0.0574 0.0619 -0.0113 -0.0214 -0.0031 0.9312 0.8724 0.6226 -0.4140 
-0.0397 0.1676  0.0064  0.0019  -0.0182 -0.0007 -0.1125 -0.0718 0.0183 0.0352  -0.0401 
'X-RAY DIFFRACTION' 3 ? refined 4.3816  63.6584 82.4547 0.0562 0.0874 0.1225 -0.0104 -0.0101 -0.0153 1.7595 0.8146 1.0578 0.4928  
0.0826  -0.0808 -0.0167 -0.0389 0.0463  0.0718  0.2071  0.3286  0.0064 0.0525  -0.0226 
'X-RAY DIFFRACTION' 4 ? refined 23.8530 48.1416 88.5362 0.0870 0.1081 0.0840 0.0029  0.0121  -0.0113 1.4777 0.8160 0.6911 -0.3333 
0.1604  -0.0492 -0.0680 -0.0299 0.0784  -0.0073 -0.0460 0.1502  0.0594 -0.0602 0.0727  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 151 A 233 'chain A' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 150 B 235 'chain B' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 152 C 235 'chain C' ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 151 D 232 'chain D' ? ? ? ? ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 PHENIX      1.6_289 ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        
http://www.phenix-online.org/             C++ ? 
2 PDB_EXTRACT 3.100   'Jan. 22, 2010' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
3 ADSC        Quantum ?               ?       ?               ?                     'data collection' ? ?   ? 
4 DENZO       .       ?               ?       ?               ?                     'data reduction'  ? ?   ? 
5 SCALEPACK   .       ?               ?       ?               ?                     'data scaling'    ? ?   ? 
6 SHELXDE     .       ?               ?       ?               ?                     phasing           ? ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 162 ? ? -49.60  151.32 
2 1 GLN C 153 ? ? 67.55   -17.19 
3 1 THR C 233 ? ? -62.02  11.86  
4 1 ALA D 171 ? ? -105.00 67.90  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 151 ? CG  ? A HIS 10 CG  
2  1 Y 1 A HIS 151 ? ND1 ? A HIS 10 ND1 
3  1 Y 1 A HIS 151 ? CD2 ? A HIS 10 CD2 
4  1 Y 1 A HIS 151 ? CE1 ? A HIS 10 CE1 
5  1 Y 1 A HIS 151 ? NE2 ? A HIS 10 NE2 
6  1 Y 1 A GLN 201 ? CG  ? A GLN 60 CG  
7  1 Y 1 A GLN 201 ? CD  ? A GLN 60 CD  
8  1 Y 1 A GLN 201 ? OE1 ? A GLN 60 OE1 
9  1 Y 1 A GLN 201 ? NE2 ? A GLN 60 NE2 
10 1 Y 1 A LYS 205 ? CG  ? A LYS 64 CG  
11 1 Y 1 A LYS 205 ? CD  ? A LYS 64 CD  
12 1 Y 1 A LYS 205 ? CE  ? A LYS 64 CE  
13 1 Y 1 A LYS 205 ? NZ  ? A LYS 64 NZ  
14 1 Y 1 B GLU 204 ? CG  ? B GLU 63 CG  
15 1 Y 1 B GLU 204 ? CD  ? B GLU 63 CD  
16 1 Y 1 B GLU 204 ? OE1 ? B GLU 63 OE1 
17 1 Y 1 B GLU 204 ? OE2 ? B GLU 63 OE2 
18 1 Y 1 B LYS 205 ? CG  ? B LYS 64 CG  
19 1 Y 1 B LYS 205 ? CD  ? B LYS 64 CD  
20 1 Y 1 B LYS 205 ? CE  ? B LYS 64 CE  
21 1 Y 1 B LYS 205 ? NZ  ? B LYS 64 NZ  
22 1 Y 1 C LYS 205 ? CG  ? C LYS 64 CG  
23 1 Y 1 C LYS 205 ? CD  ? C LYS 64 CD  
24 1 Y 1 C LYS 205 ? CE  ? C LYS 64 CE  
25 1 Y 1 C LYS 205 ? NZ  ? C LYS 64 NZ  
26 1 Y 1 D GLN 153 ? CG  ? D GLN 12 CG  
27 1 Y 1 D GLN 153 ? CD  ? D GLN 12 CD  
28 1 Y 1 D GLN 153 ? OE1 ? D GLN 12 OE1 
29 1 Y 1 D GLN 153 ? NE2 ? D GLN 12 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 142 ? A MSE 1  
2  1 Y 1 A GLY 143 ? A GLY 2  
3  1 Y 1 A HIS 144 ? A HIS 3  
4  1 Y 1 A HIS 145 ? A HIS 4  
5  1 Y 1 A HIS 146 ? A HIS 5  
6  1 Y 1 A HIS 147 ? A HIS 6  
7  1 Y 1 A HIS 148 ? A HIS 7  
8  1 Y 1 A HIS 149 ? A HIS 8  
9  1 Y 1 A SER 150 ? A SER 9  
10 1 Y 1 A ASP 202 ? A ASP 61 
11 1 Y 1 A GLY 203 ? A GLY 62 
12 1 Y 1 A GLU 204 ? A GLU 63 
13 1 Y 1 A THR 234 ? A THR 93 
14 1 Y 1 A HIS 235 ? A HIS 94 
15 1 Y 1 A ASN 236 ? A ASN 95 
16 1 Y 1 A PHE 237 ? A PHE 96 
17 1 Y 1 B MSE 142 ? B MSE 1  
18 1 Y 1 B GLY 143 ? B GLY 2  
19 1 Y 1 B HIS 144 ? B HIS 3  
20 1 Y 1 B HIS 145 ? B HIS 4  
21 1 Y 1 B HIS 146 ? B HIS 5  
22 1 Y 1 B HIS 147 ? B HIS 6  
23 1 Y 1 B HIS 148 ? B HIS 7  
24 1 Y 1 B HIS 149 ? B HIS 8  
25 1 Y 1 B ASP 202 ? B ASP 61 
26 1 Y 1 B GLY 203 ? B GLY 62 
27 1 Y 1 B ASN 236 ? B ASN 95 
28 1 Y 1 B PHE 237 ? B PHE 96 
29 1 Y 1 C MSE 142 ? C MSE 1  
30 1 Y 1 C GLY 143 ? C GLY 2  
31 1 Y 1 C HIS 144 ? C HIS 3  
32 1 Y 1 C HIS 145 ? C HIS 4  
33 1 Y 1 C HIS 146 ? C HIS 5  
34 1 Y 1 C HIS 147 ? C HIS 6  
35 1 Y 1 C HIS 148 ? C HIS 7  
36 1 Y 1 C HIS 149 ? C HIS 8  
37 1 Y 1 C SER 150 ? C SER 9  
38 1 Y 1 C HIS 151 ? C HIS 10 
39 1 Y 1 C ASP 202 ? C ASP 61 
40 1 Y 1 C GLY 203 ? C GLY 62 
41 1 Y 1 C GLU 204 ? C GLU 63 
42 1 Y 1 C ASN 236 ? C ASN 95 
43 1 Y 1 C PHE 237 ? C PHE 96 
44 1 Y 1 D MSE 142 ? D MSE 1  
45 1 Y 1 D GLY 143 ? D GLY 2  
46 1 Y 1 D HIS 144 ? D HIS 3  
47 1 Y 1 D HIS 145 ? D HIS 4  
48 1 Y 1 D HIS 146 ? D HIS 5  
49 1 Y 1 D HIS 147 ? D HIS 6  
50 1 Y 1 D HIS 148 ? D HIS 7  
51 1 Y 1 D HIS 149 ? D HIS 8  
52 1 Y 1 D SER 150 ? D SER 9  
53 1 Y 1 D GLN 201 ? D GLN 60 
54 1 Y 1 D ASP 202 ? D ASP 61 
55 1 Y 1 D GLY 203 ? D GLY 62 
56 1 Y 1 D GLU 204 ? D GLU 63 
57 1 Y 1 D THR 233 ? D THR 92 
58 1 Y 1 D THR 234 ? D THR 93 
59 1 Y 1 D HIS 235 ? D HIS 94 
60 1 Y 1 D ASN 236 ? D ASN 95 
61 1 Y 1 D PHE 237 ? D PHE 96 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'assay for oligomerization' ? 
2 2 'assay for oligomerization' ? 
3 3 'assay for oligomerization' ? 
#