data_3O33
# 
_entry.id   3O33 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3O33         
RCSB  RCSB060603   
WWPDB D_1000060603 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3O34 . unspecified 
PDB 3O35 . unspecified 
PDB 3O36 . unspecified 
PDB 3O37 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3O33 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, Z.'    1 
'Patel, D.J.' 2 
# 
_citation.id                        primary 
_citation.title                     'TRIM24 links a non-canonical histone signature to breast cancer.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            468 
_citation.page_first                927 
_citation.page_last                 932 
_citation.year                      2010 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21164480 
_citation.pdbx_database_id_DOI      10.1038/nature09542 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tsai, W.W.'    1  
primary 'Wang, Z.'      2  
primary 'Yiu, T.T.'     3  
primary 'Akdemir, K.C.' 4  
primary 'Xia, W.'       5  
primary 'Winter, S.'    6  
primary 'Tsai, C.Y.'    7  
primary 'Shi, X.'       8  
primary 'Schwarzer, D.' 9  
primary 'Plunkett, W.'  10 
primary 'Aronow, B.'    11 
primary 'Gozani, O.'    12 
primary 'Fischle, W.'   13 
primary 'Hung, M.C.'    14 
primary 'Patel, D.J.'   15 
primary 'Barton, M.C.'  16 
# 
_cell.entry_id           3O33 
_cell.length_a           36.482 
_cell.length_b           48.498 
_cell.length_c           122.729 
_cell.angle_alpha        86.45 
_cell.angle_beta         81.46 
_cell.angle_gamma        67.84 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3O33 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcription intermediary factor 1-alpha' 21318.395 4   ? ? 'UNP residues 824-1006' ? 
2 non-polymer syn 'ZINC ION'                                  65.409    8   ? ? ?                       ? 
3 water       nat water                                       18.015    242 ? ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TIF1-alpha, Tripartite motif-containing protein 24, RING finger protein 82' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTP
IDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEP
DSEVANAGIKLENYFEELLKNLYP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTP
IDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEP
DSEVANAGIKLENYFEELLKNLYP
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   PRO n 
1 3   ASN n 
1 4   GLU n 
1 5   ASP n 
1 6   TRP n 
1 7   CYS n 
1 8   ALA n 
1 9   VAL n 
1 10  CYS n 
1 11  GLN n 
1 12  ASN n 
1 13  GLY n 
1 14  GLY n 
1 15  GLU n 
1 16  LEU n 
1 17  LEU n 
1 18  CYS n 
1 19  CYS n 
1 20  GLU n 
1 21  LYS n 
1 22  CYS n 
1 23  PRO n 
1 24  LYS n 
1 25  VAL n 
1 26  PHE n 
1 27  HIS n 
1 28  LEU n 
1 29  SER n 
1 30  CYS n 
1 31  HIS n 
1 32  VAL n 
1 33  PRO n 
1 34  THR n 
1 35  LEU n 
1 36  THR n 
1 37  ASN n 
1 38  PHE n 
1 39  PRO n 
1 40  SER n 
1 41  GLY n 
1 42  GLU n 
1 43  TRP n 
1 44  ILE n 
1 45  CYS n 
1 46  THR n 
1 47  PHE n 
1 48  CYS n 
1 49  ARG n 
1 50  ASP n 
1 51  LEU n 
1 52  SER n 
1 53  LYS n 
1 54  PRO n 
1 55  GLU n 
1 56  VAL n 
1 57  GLU n 
1 58  TYR n 
1 59  ASP n 
1 60  CYS n 
1 61  ASP n 
1 62  ALA n 
1 63  PRO n 
1 64  SER n 
1 65  HIS n 
1 66  ASN n 
1 67  SER n 
1 68  GLU n 
1 69  LYS n 
1 70  LYS n 
1 71  LYS n 
1 72  THR n 
1 73  GLU n 
1 74  GLY n 
1 75  LEU n 
1 76  VAL n 
1 77  LYS n 
1 78  LEU n 
1 79  THR n 
1 80  PRO n 
1 81  ILE n 
1 82  ASP n 
1 83  LYS n 
1 84  ARG n 
1 85  LYS n 
1 86  CYS n 
1 87  GLU n 
1 88  ARG n 
1 89  LEU n 
1 90  LEU n 
1 91  LEU n 
1 92  PHE n 
1 93  LEU n 
1 94  TYR n 
1 95  CYS n 
1 96  HIS n 
1 97  GLU n 
1 98  MET n 
1 99  SER n 
1 100 LEU n 
1 101 ALA n 
1 102 PHE n 
1 103 GLN n 
1 104 ASP n 
1 105 PRO n 
1 106 VAL n 
1 107 PRO n 
1 108 LEU n 
1 109 THR n 
1 110 VAL n 
1 111 PRO n 
1 112 ASP n 
1 113 TYR n 
1 114 TYR n 
1 115 LYS n 
1 116 ILE n 
1 117 ILE n 
1 118 LYS n 
1 119 ASN n 
1 120 PRO n 
1 121 MET n 
1 122 ASP n 
1 123 LEU n 
1 124 SER n 
1 125 THR n 
1 126 ILE n 
1 127 LYS n 
1 128 LYS n 
1 129 ARG n 
1 130 LEU n 
1 131 GLN n 
1 132 GLU n 
1 133 ASP n 
1 134 TYR n 
1 135 SER n 
1 136 MET n 
1 137 TYR n 
1 138 SER n 
1 139 LYS n 
1 140 PRO n 
1 141 GLU n 
1 142 ASP n 
1 143 PHE n 
1 144 VAL n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 ARG n 
1 149 LEU n 
1 150 ILE n 
1 151 PHE n 
1 152 GLN n 
1 153 ASN n 
1 154 CYS n 
1 155 ALA n 
1 156 GLU n 
1 157 PHE n 
1 158 ASN n 
1 159 GLU n 
1 160 PRO n 
1 161 ASP n 
1 162 SER n 
1 163 GLU n 
1 164 VAL n 
1 165 ALA n 
1 166 ASN n 
1 167 ALA n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 LEU n 
1 172 GLU n 
1 173 ASN n 
1 174 TYR n 
1 175 PHE n 
1 176 GLU n 
1 177 GLU n 
1 178 LEU n 
1 179 LEU n 
1 180 LYS n 
1 181 ASN n 
1 182 LEU n 
1 183 TYR n 
1 184 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TRIM24, RNF82, TIF1, TIF1A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pRSFDuet-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TIF1A_HUMAN 
_struct_ref.pdbx_db_accession          O15164 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPI
DKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPD
SEVANAGIKLENYFEELLKNLYP
;
_struct_ref.pdbx_align_begin           824 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3O33 A 2 ? 184 ? O15164 824 ? 1006 ? 824 1006 
2 1 3O33 B 2 ? 184 ? O15164 824 ? 1006 ? 824 1006 
3 1 3O33 C 2 ? 184 ? O15164 824 ? 1006 ? 824 1006 
4 1 3O33 D 2 ? 184 ? O15164 824 ? 1006 ? 824 1006 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3O33 SER A 1 ? UNP O15164 ? ? 'EXPRESSION TAG' 823 1 
2 3O33 SER B 1 ? UNP O15164 ? ? 'EXPRESSION TAG' 823 2 
3 3O33 SER C 1 ? UNP O15164 ? ? 'EXPRESSION TAG' 823 3 
4 3O33 SER D 1 ? UNP O15164 ? ? 'EXPRESSION TAG' 823 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3O33 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.26 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'100 mM Hepes (pH 7.5), 2.0 M ammonium sulfate and 2% Polyethylene glycol 400, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           197 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-04-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3O33 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   50497 
_reflns.number_all                   52087 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rsym_value              0.107 
_reflns.pdbx_netI_over_sigmaI        26.2 
_reflns.B_iso_Wilson_estimate        26.6 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   96.8 
_reflns_shell.Rmerge_I_obs           0.51 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5031 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3O33 
_refine.ls_number_reflns_obs                     50135 
_refine.ls_number_reflns_all                     52087 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.69 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2207 
_refine.ls_R_factor_R_free                       0.2442 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2487 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entries 2PUY, 2YYN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3O33 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5739 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             242 
_refine_hist.number_atoms_total               5989 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        19.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.27  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.85  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.07 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2578 
_refine_ls_shell.percent_reflns_obs               93.8 
_refine_ls_shell.R_factor_R_free                  0.2989 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             235 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                4869 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3O33 
_struct.title                     'Crystal structure of TRIM24 PHD-Bromo in the free state' 
_struct.pdbx_descriptor           'Transcription intermediary factor 1-alpha' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3O33 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'PHD finger, Bromodomain, TRIM24, breast cancer, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 79  ? HIS A 96  ? THR A 901 HIS A 918  1 ? 18 
HELX_P HELX_P2  2  GLU A 97  ? GLN A 103 ? GLU A 919 GLN A 925  5 ? 7  
HELX_P HELX_P3  3  ASP A 112 ? ILE A 117 ? ASP A 934 ILE A 939  1 ? 6  
HELX_P HELX_P4  4  ASP A 122 ? GLU A 132 ? ASP A 944 GLU A 954  1 ? 11 
HELX_P HELX_P5  5  LYS A 139 ? ASN A 158 ? LYS A 961 ASN A 980  1 ? 20 
HELX_P HELX_P6  6  SER A 162 ? TYR A 183 ? SER A 984 TYR A 1005 1 ? 22 
HELX_P HELX_P7  7  TYR B 58  ? ALA B 62  ? TYR B 880 ALA B 884  5 ? 5  
HELX_P HELX_P8  8  THR B 79  ? HIS B 96  ? THR B 901 HIS B 918  1 ? 18 
HELX_P HELX_P9  9  SER B 99  ? GLN B 103 ? SER B 921 GLN B 925  5 ? 5  
HELX_P HELX_P10 10 ASP B 112 ? ILE B 117 ? ASP B 934 ILE B 939  1 ? 6  
HELX_P HELX_P11 11 ASP B 122 ? GLU B 132 ? ASP B 944 GLU B 954  1 ? 11 
HELX_P HELX_P12 12 LYS B 139 ? ASN B 158 ? LYS B 961 ASN B 980  1 ? 20 
HELX_P HELX_P13 13 SER B 162 ? TYR B 183 ? SER B 984 TYR B 1005 1 ? 22 
HELX_P HELX_P14 14 TYR C 58  ? ALA C 62  ? TYR C 880 ALA C 884  5 ? 5  
HELX_P HELX_P15 15 THR C 79  ? HIS C 96  ? THR C 901 HIS C 918  1 ? 18 
HELX_P HELX_P16 16 SER C 99  ? ASP C 104 ? SER C 921 ASP C 926  1 ? 6  
HELX_P HELX_P17 17 ASP C 112 ? ILE C 117 ? ASP C 934 ILE C 939  1 ? 6  
HELX_P HELX_P18 18 ASP C 122 ? GLU C 132 ? ASP C 944 GLU C 954  1 ? 11 
HELX_P HELX_P19 19 LYS C 139 ? ASN C 158 ? LYS C 961 ASN C 980  1 ? 20 
HELX_P HELX_P20 20 SER C 162 ? TYR C 183 ? SER C 984 TYR C 1005 1 ? 22 
HELX_P HELX_P21 21 THR D 79  ? HIS D 96  ? THR D 901 HIS D 918  1 ? 18 
HELX_P HELX_P22 22 GLU D 97  ? GLN D 103 ? GLU D 919 GLN D 925  5 ? 7  
HELX_P HELX_P23 23 ASP D 112 ? ILE D 117 ? ASP D 934 ILE D 939  1 ? 6  
HELX_P HELX_P24 24 ASP D 122 ? GLU D 132 ? ASP D 944 GLU D 954  1 ? 11 
HELX_P HELX_P25 25 LYS D 139 ? ASN D 158 ? LYS D 961 ASN D 980  1 ? 20 
HELX_P HELX_P26 26 SER D 162 ? TYR D 183 ? SER D 984 TYR D 1005 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D HIS 27 ND1 ? ? ? 1_555 K ZN . ZN ? ? D HIS 849 D ZN 1 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc2  metalc ? ? C HIS 27 ND1 ? ? ? 1_555 J ZN . ZN ? ? C HIS 849 C ZN 2 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc3  metalc ? ? A CYS 48 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 870 A ZN 2 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc4  metalc ? ? D CYS 48 SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 870 D ZN 2 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc5  metalc ? ? B CYS 48 SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 870 B ZN 2 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc6  metalc ? ? D CYS 19 SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 841 D ZN 2 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc7  metalc ? ? B HIS 27 ND1 ? ? ? 1_555 G ZN . ZN ? ? B HIS 849 B ZN 1 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc8  metalc ? ? A HIS 27 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 849 A ZN 1 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc9  metalc ? ? D CYS 10 SG  ? ? ? 1_555 K ZN . ZN ? ? D CYS 832 D ZN 1 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc10 metalc ? ? C CYS 48 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 870 C ZN 1 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc11 metalc ? ? A CYS 19 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 841 A ZN 2 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc12 metalc ? ? B CYS 7  SG  ? ? ? 1_555 G ZN . ZN ? ? B CYS 829 B ZN 1 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc13 metalc ? ? C CYS 7  SG  ? ? ? 1_555 J ZN . ZN ? ? C CYS 829 C ZN 2 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc14 metalc ? ? A CYS 10 SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 832 A ZN 1 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc15 metalc ? ? B CYS 19 SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 841 B ZN 2 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc16 metalc ? ? A CYS 30 SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 852 A ZN 1 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc17 metalc ? ? B CYS 30 SG  ? ? ? 1_555 G ZN . ZN ? ? B CYS 852 B ZN 1 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc18 metalc ? ? C CYS 19 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 841 C ZN 1 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc19 metalc ? ? A CYS 7  SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 829 A ZN 1 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc20 metalc ? ? D CYS 30 SG  ? ? ? 1_555 K ZN . ZN ? ? D CYS 852 D ZN 1 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc21 metalc ? ? B CYS 22 SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 844 B ZN 2 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc22 metalc ? ? C CYS 30 SG  ? ? ? 1_555 J ZN . ZN ? ? C CYS 852 C ZN 2 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc23 metalc ? ? C CYS 10 SG  ? ? ? 1_555 J ZN . ZN ? ? C CYS 832 C ZN 2 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc24 metalc ? ? D CYS 7  SG  ? ? ? 1_555 K ZN . ZN ? ? D CYS 829 D ZN 1 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc25 metalc ? ? D CYS 22 SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 844 D ZN 2 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc26 metalc ? ? C CYS 22 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 844 C ZN 1 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc27 metalc ? ? B CYS 10 SG  ? ? ? 1_555 G ZN . ZN ? ? B CYS 832 B ZN 1 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc28 metalc ? ? C CYS 45 SG  ? ? ? 1_555 I ZN . ZN ? ? C CYS 867 C ZN 1 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc29 metalc ? ? B CYS 45 SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 867 B ZN 2 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc30 metalc ? ? A CYS 22 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 844 A ZN 2 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc31 metalc ? ? D CYS 45 SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 867 D ZN 2 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc32 metalc ? ? A CYS 45 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 867 A ZN 2 1_555 ? ? ? ? ? ? ? 2.524 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 32 A . ? VAL 854 A PRO 33 A ? PRO 855 A 1 0.13  
2 VAL 32 B . ? VAL 854 B PRO 33 B ? PRO 855 B 1 0.14  
3 VAL 32 C . ? VAL 854 C PRO 33 C ? PRO 855 C 1 -0.01 
4 VAL 32 D . ? VAL 854 D PRO 33 D ? PRO 855 D 1 -0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 17 ? CYS A 18 ? LEU A 839 CYS A 840 
A 2 VAL A 25 ? PHE A 26 ? VAL A 847 PHE A 848 
B 1 LEU B 17 ? CYS B 18 ? LEU B 839 CYS B 840 
B 2 VAL B 25 ? PHE B 26 ? VAL B 847 PHE B 848 
C 1 LEU C 17 ? CYS C 18 ? LEU C 839 CYS C 840 
C 2 VAL C 25 ? PHE C 26 ? VAL C 847 PHE C 848 
D 1 LEU D 17 ? CYS D 18 ? LEU D 839 CYS D 840 
D 2 VAL D 25 ? PHE D 26 ? VAL D 847 PHE D 848 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 17 ? N LEU A 839 O PHE A 26 ? O PHE A 848 
B 1 2 N LEU B 17 ? N LEU B 839 O PHE B 26 ? O PHE B 848 
C 1 2 N LEU C 17 ? N LEU C 839 O PHE C 26 ? O PHE C 848 
D 1 2 N LEU D 17 ? N LEU D 839 O PHE D 26 ? O PHE D 848 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 2' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 2' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 1' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 7  ? CYS A 829 . ? 1_555 ? 
2  AC1 4 CYS A 10 ? CYS A 832 . ? 1_555 ? 
3  AC1 4 HIS A 27 ? HIS A 849 . ? 1_555 ? 
4  AC1 4 CYS A 30 ? CYS A 852 . ? 1_555 ? 
5  AC2 4 CYS A 19 ? CYS A 841 . ? 1_555 ? 
6  AC2 4 CYS A 22 ? CYS A 844 . ? 1_555 ? 
7  AC2 4 CYS A 45 ? CYS A 867 . ? 1_555 ? 
8  AC2 4 CYS A 48 ? CYS A 870 . ? 1_555 ? 
9  AC3 4 CYS B 7  ? CYS B 829 . ? 1_555 ? 
10 AC3 4 CYS B 10 ? CYS B 832 . ? 1_555 ? 
11 AC3 4 HIS B 27 ? HIS B 849 . ? 1_555 ? 
12 AC3 4 CYS B 30 ? CYS B 852 . ? 1_555 ? 
13 AC4 4 CYS B 19 ? CYS B 841 . ? 1_555 ? 
14 AC4 4 CYS B 22 ? CYS B 844 . ? 1_555 ? 
15 AC4 4 CYS B 45 ? CYS B 867 . ? 1_555 ? 
16 AC4 4 CYS B 48 ? CYS B 870 . ? 1_555 ? 
17 AC5 4 CYS C 19 ? CYS C 841 . ? 1_555 ? 
18 AC5 4 CYS C 22 ? CYS C 844 . ? 1_555 ? 
19 AC5 4 CYS C 45 ? CYS C 867 . ? 1_555 ? 
20 AC5 4 CYS C 48 ? CYS C 870 . ? 1_555 ? 
21 AC6 4 CYS C 7  ? CYS C 829 . ? 1_555 ? 
22 AC6 4 CYS C 10 ? CYS C 832 . ? 1_555 ? 
23 AC6 4 HIS C 27 ? HIS C 849 . ? 1_555 ? 
24 AC6 4 CYS C 30 ? CYS C 852 . ? 1_555 ? 
25 AC7 4 CYS D 7  ? CYS D 829 . ? 1_555 ? 
26 AC7 4 CYS D 10 ? CYS D 832 . ? 1_555 ? 
27 AC7 4 HIS D 27 ? HIS D 849 . ? 1_555 ? 
28 AC7 4 CYS D 30 ? CYS D 852 . ? 1_555 ? 
29 AC8 4 CYS D 19 ? CYS D 841 . ? 1_555 ? 
30 AC8 4 CYS D 22 ? CYS D 844 . ? 1_555 ? 
31 AC8 4 CYS D 45 ? CYS D 867 . ? 1_555 ? 
32 AC8 4 CYS D 48 ? CYS D 870 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3O33 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3O33 
_atom_sites.fract_transf_matrix[1][1]   0.027411 
_atom_sites.fract_transf_matrix[1][2]   -0.011164 
_atom_sites.fract_transf_matrix[1][3]   -0.004044 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022264 
_atom_sites.fract_transf_matrix[2][3]   -0.000144 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008240 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 33.351  57.621  5.247    1.00 81.03  ? 825  ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 34.703  57.902  4.686    1.00 81.03  ? 825  ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 34.879  57.198  3.338    1.00 81.03  ? 825  ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 35.597  57.683  2.461    1.00 81.03  ? 825  ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 35.782  57.433  5.664    1.00 90.20  ? 825  ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 36.926  58.422  5.788    1.00 90.20  ? 825  ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 36.729  59.564  6.207    1.00 90.20  ? 825  ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 38.128  57.989  5.423    1.00 90.20  ? 825  ASN A ND2 1 
ATOM   9    N  N   . GLU A 1 4   ? 34.223  56.051  3.185    1.00 63.47  ? 826  GLU A N   1 
ATOM   10   C  CA  . GLU A 1 4   ? 34.286  55.281  1.945    1.00 63.47  ? 826  GLU A CA  1 
ATOM   11   C  C   . GLU A 1 4   ? 33.594  56.118  0.866    1.00 63.47  ? 826  GLU A C   1 
ATOM   12   O  O   . GLU A 1 4   ? 32.664  56.870  1.162    1.00 63.47  ? 826  GLU A O   1 
ATOM   13   C  CB  . GLU A 1 4   ? 33.551  53.945  2.119    1.00 85.16  ? 826  GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 4   ? 33.595  53.400  3.545    1.00 85.16  ? 826  GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 4   ? 34.490  52.187  3.708    1.00 85.16  ? 826  GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 4   ? 33.991  51.051  3.559    1.00 85.16  ? 826  GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 4   ? 35.694  52.371  3.982    1.00 85.16  ? 826  GLU A OE2 1 
ATOM   18   N  N   . ASP A 1 5   ? 34.038  55.997  -0.380   1.00 55.28  ? 827  ASP A N   1 
ATOM   19   C  CA  . ASP A 1 5   ? 33.423  56.772  -1.451   1.00 55.83  ? 827  ASP A CA  1 
ATOM   20   C  C   . ASP A 1 5   ? 32.332  56.002  -2.180   1.00 54.19  ? 827  ASP A C   1 
ATOM   21   O  O   . ASP A 1 5   ? 31.553  56.585  -2.936   1.00 54.39  ? 827  ASP A O   1 
ATOM   22   C  CB  . ASP A 1 5   ? 34.482  57.225  -2.460   1.00 83.85  ? 827  ASP A CB  1 
ATOM   23   C  CG  . ASP A 1 5   ? 35.520  58.140  -1.843   1.00 86.89  ? 827  ASP A CG  1 
ATOM   24   O  OD1 . ASP A 1 5   ? 35.130  59.142  -1.204   1.00 89.88  ? 827  ASP A OD1 1 
ATOM   25   O  OD2 . ASP A 1 5   ? 36.727  57.860  -2.002   1.00 88.62  ? 827  ASP A OD2 1 
ATOM   26   N  N   . TRP A 1 6   ? 32.261  54.696  -1.943   1.00 38.89  ? 828  TRP A N   1 
ATOM   27   C  CA  . TRP A 1 6   ? 31.263  53.881  -2.618   1.00 38.12  ? 828  TRP A CA  1 
ATOM   28   C  C   . TRP A 1 6   ? 30.304  53.160  -1.675   1.00 35.04  ? 828  TRP A C   1 
ATOM   29   O  O   . TRP A 1 6   ? 30.654  52.829  -0.542   1.00 33.01  ? 828  TRP A O   1 
ATOM   30   C  CB  . TRP A 1 6   ? 31.978  52.891  -3.535   1.00 83.66  ? 828  TRP A CB  1 
ATOM   31   C  CG  . TRP A 1 6   ? 32.828  53.596  -4.555   1.00 91.21  ? 828  TRP A CG  1 
ATOM   32   C  CD1 . TRP A 1 6   ? 32.396  54.222  -5.690   1.00 92.19  ? 828  TRP A CD1 1 
ATOM   33   C  CD2 . TRP A 1 6   ? 34.245  53.808  -4.497   1.00 97.11  ? 828  TRP A CD2 1 
ATOM   34   N  NE1 . TRP A 1 6   ? 33.453  54.810  -6.340   1.00 98.46  ? 828  TRP A NE1 1 
ATOM   35   C  CE2 . TRP A 1 6   ? 34.600  54.572  -5.630   1.00 99.16  ? 828  TRP A CE2 1 
ATOM   36   C  CE3 . TRP A 1 6   ? 35.248  53.427  -3.595   1.00 98.85  ? 828  TRP A CE3 1 
ATOM   37   C  CZ2 . TRP A 1 6   ? 35.919  54.964  -5.887   1.00 99.34  ? 828  TRP A CZ2 1 
ATOM   38   C  CZ3 . TRP A 1 6   ? 36.561  53.817  -3.850   1.00 101.56 ? 828  TRP A CZ3 1 
ATOM   39   C  CH2 . TRP A 1 6   ? 36.883  54.578  -4.989   1.00 101.44 ? 828  TRP A CH2 1 
ATOM   40   N  N   . CYS A 1 7   ? 29.085  52.934  -2.159   1.00 35.94  ? 829  CYS A N   1 
ATOM   41   C  CA  . CYS A 1 7   ? 28.040  52.263  -1.389   1.00 33.89  ? 829  CYS A CA  1 
ATOM   42   C  C   . CYS A 1 7   ? 28.497  50.891  -0.907   1.00 33.19  ? 829  CYS A C   1 
ATOM   43   O  O   . CYS A 1 7   ? 28.966  50.069  -1.696   1.00 32.22  ? 829  CYS A O   1 
ATOM   44   C  CB  . CYS A 1 7   ? 26.778  52.121  -2.246   1.00 30.26  ? 829  CYS A CB  1 
ATOM   45   S  SG  . CYS A 1 7   ? 25.414  51.198  -1.486   1.00 28.42  ? 829  CYS A SG  1 
ATOM   46   N  N   . ALA A 1 8   ? 28.352  50.648  0.391    1.00 31.27  ? 830  ALA A N   1 
ATOM   47   C  CA  . ALA A 1 8   ? 28.757  49.378  0.983    1.00 30.41  ? 830  ALA A CA  1 
ATOM   48   C  C   . ALA A 1 8   ? 28.029  48.178  0.373    1.00 29.56  ? 830  ALA A C   1 
ATOM   49   O  O   . ALA A 1 8   ? 28.496  47.042  0.478    1.00 28.55  ? 830  ALA A O   1 
ATOM   50   C  CB  . ALA A 1 8   ? 28.529  49.411  2.488    1.00 27.62  ? 830  ALA A CB  1 
ATOM   51   N  N   . VAL A 1 9   ? 26.894  48.423  -0.273   1.00 32.70  ? 831  VAL A N   1 
ATOM   52   C  CA  . VAL A 1 9   ? 26.133  47.333  -0.868   1.00 32.75  ? 831  VAL A CA  1 
ATOM   53   C  C   . VAL A 1 9   ? 26.393  47.101  -2.356   1.00 33.26  ? 831  VAL A C   1 
ATOM   54   O  O   . VAL A 1 9   ? 26.861  46.029  -2.740   1.00 32.04  ? 831  VAL A O   1 
ATOM   55   C  CB  . VAL A 1 9   ? 24.616  47.532  -0.662   1.00 34.28  ? 831  VAL A CB  1 
ATOM   56   C  CG1 . VAL A 1 9   ? 23.843  46.427  -1.372   1.00 33.56  ? 831  VAL A CG1 1 
ATOM   57   C  CG2 . VAL A 1 9   ? 24.291  47.535  0.826    1.00 33.84  ? 831  VAL A CG2 1 
ATOM   58   N  N   . CYS A 1 10  ? 26.097  48.101  -3.186   1.00 31.45  ? 832  CYS A N   1 
ATOM   59   C  CA  . CYS A 1 10  ? 26.267  47.974  -4.633   1.00 32.51  ? 832  CYS A CA  1 
ATOM   60   C  C   . CYS A 1 10  ? 27.613  48.433  -5.174   1.00 33.54  ? 832  CYS A C   1 
ATOM   61   O  O   . CYS A 1 10  ? 27.961  48.118  -6.310   1.00 35.69  ? 832  CYS A O   1 
ATOM   62   C  CB  . CYS A 1 10  ? 25.164  48.741  -5.358   1.00 31.89  ? 832  CYS A CB  1 
ATOM   63   S  SG  . CYS A 1 10  ? 25.249  50.530  -5.126   1.00 34.18  ? 832  CYS A SG  1 
ATOM   64   N  N   . GLN A 1 11  ? 28.356  49.188  -4.371   1.00 31.60  ? 833  GLN A N   1 
ATOM   65   C  CA  . GLN A 1 11  ? 29.667  49.692  -4.769   1.00 32.37  ? 833  GLN A CA  1 
ATOM   66   C  C   . GLN A 1 11  ? 29.626  50.804  -5.820   1.00 31.19  ? 833  GLN A C   1 
ATOM   67   O  O   . GLN A 1 11  ? 30.601  51.018  -6.540   1.00 30.80  ? 833  GLN A O   1 
ATOM   68   C  CB  . GLN A 1 11  ? 30.543  48.542  -5.277   1.00 44.25  ? 833  GLN A CB  1 
ATOM   69   C  CG  . GLN A 1 11  ? 30.976  47.557  -4.201   1.00 47.77  ? 833  GLN A CG  1 
ATOM   70   C  CD  . GLN A 1 11  ? 31.883  48.191  -3.163   1.00 53.72  ? 833  GLN A CD  1 
ATOM   71   O  OE1 . GLN A 1 11  ? 31.428  48.924  -2.285   1.00 58.04  ? 833  GLN A OE1 1 
ATOM   72   N  NE2 . GLN A 1 11  ? 33.179  47.921  -3.269   1.00 57.51  ? 833  GLN A NE2 1 
ATOM   73   N  N   . ASN A 1 12  ? 28.501  51.504  -5.918   1.00 32.84  ? 834  ASN A N   1 
ATOM   74   C  CA  . ASN A 1 12  ? 28.387  52.602  -6.875   1.00 34.37  ? 834  ASN A CA  1 
ATOM   75   C  C   . ASN A 1 12  ? 28.447  53.943  -6.145   1.00 35.29  ? 834  ASN A C   1 
ATOM   76   O  O   . ASN A 1 12  ? 28.187  54.024  -4.942   1.00 34.74  ? 834  ASN A O   1 
ATOM   77   C  CB  . ASN A 1 12  ? 27.075  52.515  -7.666   1.00 38.08  ? 834  ASN A CB  1 
ATOM   78   C  CG  . ASN A 1 12  ? 27.025  51.314  -8.589   1.00 37.62  ? 834  ASN A CG  1 
ATOM   79   O  OD1 . ASN A 1 12  ? 27.984  51.028  -9.304   1.00 37.26  ? 834  ASN A OD1 1 
ATOM   80   N  ND2 . ASN A 1 12  ? 25.895  50.614  -8.592   1.00 38.48  ? 834  ASN A ND2 1 
ATOM   81   N  N   . GLY A 1 13  ? 28.800  54.993  -6.879   1.00 37.08  ? 835  GLY A N   1 
ATOM   82   C  CA  . GLY A 1 13  ? 28.868  56.317  -6.289   1.00 38.21  ? 835  GLY A CA  1 
ATOM   83   C  C   . GLY A 1 13  ? 27.500  56.958  -6.373   1.00 38.78  ? 835  GLY A C   1 
ATOM   84   O  O   . GLY A 1 13  ? 26.497  56.252  -6.478   1.00 37.88  ? 835  GLY A O   1 
ATOM   85   N  N   . GLY A 1 14  ? 27.451  58.287  -6.338   1.00 40.64  ? 836  GLY A N   1 
ATOM   86   C  CA  . GLY A 1 14  ? 26.179  58.982  -6.421   1.00 41.37  ? 836  GLY A CA  1 
ATOM   87   C  C   . GLY A 1 14  ? 25.761  59.621  -5.111   1.00 42.72  ? 836  GLY A C   1 
ATOM   88   O  O   . GLY A 1 14  ? 26.607  60.004  -4.297   1.00 43.40  ? 836  GLY A O   1 
ATOM   89   N  N   . GLU A 1 15  ? 24.451  59.735  -4.906   1.00 41.68  ? 837  GLU A N   1 
ATOM   90   C  CA  . GLU A 1 15  ? 23.905  60.330  -3.688   1.00 43.77  ? 837  GLU A CA  1 
ATOM   91   C  C   . GLU A 1 15  ? 23.957  59.279  -2.589   1.00 44.32  ? 837  GLU A C   1 
ATOM   92   O  O   . GLU A 1 15  ? 23.250  58.274  -2.644   1.00 43.12  ? 837  GLU A O   1 
ATOM   93   C  CB  . GLU A 1 15  ? 22.461  60.779  -3.926   1.00 70.34  ? 837  GLU A CB  1 
ATOM   94   C  CG  . GLU A 1 15  ? 22.301  61.683  -5.136   1.00 72.99  ? 837  GLU A CG  1 
ATOM   95   C  CD  . GLU A 1 15  ? 20.888  62.202  -5.296   1.00 77.84  ? 837  GLU A CD  1 
ATOM   96   O  OE1 . GLU A 1 15  ? 20.435  62.971  -4.422   1.00 77.90  ? 837  GLU A OE1 1 
ATOM   97   O  OE2 . GLU A 1 15  ? 20.230  61.838  -6.296   1.00 79.44  ? 837  GLU A OE2 1 
ATOM   98   N  N   . LEU A 1 16  ? 24.791  59.526  -1.586   1.00 48.66  ? 838  LEU A N   1 
ATOM   99   C  CA  . LEU A 1 16  ? 24.974  58.573  -0.505   1.00 49.84  ? 838  LEU A CA  1 
ATOM   100  C  C   . LEU A 1 16  ? 24.707  59.109  0.895    1.00 50.03  ? 838  LEU A C   1 
ATOM   101  O  O   . LEU A 1 16  ? 24.840  60.304  1.157    1.00 50.31  ? 838  LEU A O   1 
ATOM   102  C  CB  . LEU A 1 16  ? 26.402  58.033  -0.566   1.00 42.61  ? 838  LEU A CB  1 
ATOM   103  C  CG  . LEU A 1 16  ? 26.789  57.355  -1.883   1.00 44.58  ? 838  LEU A CG  1 
ATOM   104  C  CD1 . LEU A 1 16  ? 28.300  57.229  -1.979   1.00 42.52  ? 838  LEU A CD1 1 
ATOM   105  C  CD2 . LEU A 1 16  ? 26.114  55.990  -1.966   1.00 42.78  ? 838  LEU A CD2 1 
ATOM   106  N  N   . LEU A 1 17  ? 24.322  58.199  1.784    1.00 45.32  ? 839  LEU A N   1 
ATOM   107  C  CA  . LEU A 1 17  ? 24.065  58.513  3.184    1.00 45.56  ? 839  LEU A CA  1 
ATOM   108  C  C   . LEU A 1 17  ? 25.373  58.164  3.873    1.00 46.09  ? 839  LEU A C   1 
ATOM   109  O  O   . LEU A 1 17  ? 25.943  57.102  3.619    1.00 45.30  ? 839  LEU A O   1 
ATOM   110  C  CB  . LEU A 1 17  ? 22.956  57.624  3.758    1.00 56.76  ? 839  LEU A CB  1 
ATOM   111  C  CG  . LEU A 1 17  ? 21.516  57.754  3.261    1.00 57.14  ? 839  LEU A CG  1 
ATOM   112  C  CD1 . LEU A 1 17  ? 20.686  56.614  3.829    1.00 56.84  ? 839  LEU A CD1 1 
ATOM   113  C  CD2 . LEU A 1 17  ? 20.943  59.098  3.679    1.00 58.34  ? 839  LEU A CD2 1 
ATOM   114  N  N   . CYS A 1 18  ? 25.853  59.046  4.739    1.00 43.35  ? 840  CYS A N   1 
ATOM   115  C  CA  . CYS A 1 18  ? 27.103  58.789  5.436    1.00 44.85  ? 840  CYS A CA  1 
ATOM   116  C  C   . CYS A 1 18  ? 26.884  58.509  6.914    1.00 44.40  ? 840  CYS A C   1 
ATOM   117  O  O   . CYS A 1 18  ? 26.308  59.327  7.632    1.00 44.52  ? 840  CYS A O   1 
ATOM   118  C  CB  . CYS A 1 18  ? 28.049  59.980  5.270    1.00 79.11  ? 840  CYS A CB  1 
ATOM   119  S  SG  . CYS A 1 18  ? 28.527  60.308  3.560    1.00 87.37  ? 840  CYS A SG  1 
ATOM   120  N  N   . CYS A 1 19  ? 27.336  57.344  7.364    1.00 46.37  ? 841  CYS A N   1 
ATOM   121  C  CA  . CYS A 1 19  ? 27.209  56.980  8.768    1.00 45.99  ? 841  CYS A CA  1 
ATOM   122  C  C   . CYS A 1 19  ? 28.230  57.816  9.520    1.00 46.57  ? 841  CYS A C   1 
ATOM   123  O  O   . CYS A 1 19  ? 29.349  58.009  9.047    1.00 45.33  ? 841  CYS A O   1 
ATOM   124  C  CB  . CYS A 1 19  ? 27.509  55.494  8.976    1.00 43.52  ? 841  CYS A CB  1 
ATOM   125  S  SG  . CYS A 1 19  ? 27.327  54.937  10.692   1.00 37.96  ? 841  CYS A SG  1 
ATOM   126  N  N   . GLU A 1 20  ? 27.850  58.316  10.688   1.00 55.73  ? 842  GLU A N   1 
ATOM   127  C  CA  . GLU A 1 20  ? 28.761  59.138  11.461   1.00 57.55  ? 842  GLU A CA  1 
ATOM   128  C  C   . GLU A 1 20  ? 29.552  58.304  12.464   1.00 57.38  ? 842  GLU A C   1 
ATOM   129  O  O   . GLU A 1 20  ? 30.506  58.792  13.066   1.00 57.57  ? 842  GLU A O   1 
ATOM   130  C  CB  . GLU A 1 20  ? 27.980  60.241  12.182   1.00 103.09 ? 842  GLU A CB  1 
ATOM   131  C  CG  . GLU A 1 20  ? 27.197  59.769  13.388   1.00 108.03 ? 842  GLU A CG  1 
ATOM   132  C  CD  . GLU A 1 20  ? 28.051  59.699  14.641   1.00 113.56 ? 842  GLU A CD  1 
ATOM   133  O  OE1 . GLU A 1 20  ? 27.672  58.976  15.588   1.00 115.19 ? 842  GLU A OE1 1 
ATOM   134  O  OE2 . GLU A 1 20  ? 29.098  60.379  14.681   1.00 115.34 ? 842  GLU A OE2 1 
ATOM   135  N  N   . LYS A 1 21  ? 29.169  57.042  12.634   1.00 58.59  ? 843  LYS A N   1 
ATOM   136  C  CA  . LYS A 1 21  ? 29.860  56.178  13.582   1.00 58.48  ? 843  LYS A CA  1 
ATOM   137  C  C   . LYS A 1 21  ? 30.850  55.225  12.919   1.00 57.96  ? 843  LYS A C   1 
ATOM   138  O  O   . LYS A 1 21  ? 31.804  54.773  13.552   1.00 58.43  ? 843  LYS A O   1 
ATOM   139  C  CB  . LYS A 1 21  ? 28.851  55.381  14.409   1.00 67.21  ? 843  LYS A CB  1 
ATOM   140  C  CG  . LYS A 1 21  ? 29.394  54.977  15.763   1.00 72.16  ? 843  LYS A CG  1 
ATOM   141  C  CD  . LYS A 1 21  ? 29.743  56.218  16.577   1.00 75.37  ? 843  LYS A CD  1 
ATOM   142  C  CE  . LYS A 1 21  ? 31.147  56.138  17.153   1.00 78.35  ? 843  LYS A CE  1 
ATOM   143  N  NZ  . LYS A 1 21  ? 32.182  55.940  16.097   1.00 77.57  ? 843  LYS A NZ  1 
ATOM   144  N  N   . CYS A 1 22  ? 30.614  54.912  11.649   1.00 51.67  ? 844  CYS A N   1 
ATOM   145  C  CA  . CYS A 1 22  ? 31.504  54.026  10.906   1.00 50.13  ? 844  CYS A CA  1 
ATOM   146  C  C   . CYS A 1 22  ? 31.790  54.684  9.556    1.00 49.59  ? 844  CYS A C   1 
ATOM   147  O  O   . CYS A 1 22  ? 31.193  55.709  9.220    1.00 49.88  ? 844  CYS A O   1 
ATOM   148  C  CB  . CYS A 1 22  ? 30.865  52.642  10.709   1.00 39.60  ? 844  CYS A CB  1 
ATOM   149  S  SG  . CYS A 1 22  ? 29.708  52.529  9.326    1.00 40.18  ? 844  CYS A SG  1 
ATOM   150  N  N   . PRO A 1 23  ? 32.706  54.107  8.762    1.00 49.74  ? 845  PRO A N   1 
ATOM   151  C  CA  . PRO A 1 23  ? 33.034  54.692  7.458    1.00 49.22  ? 845  PRO A CA  1 
ATOM   152  C  C   . PRO A 1 23  ? 32.087  54.385  6.295    1.00 48.44  ? 845  PRO A C   1 
ATOM   153  O  O   . PRO A 1 23  ? 32.094  55.094  5.289    1.00 48.83  ? 845  PRO A O   1 
ATOM   154  C  CB  . PRO A 1 23  ? 34.443  54.170  7.205    1.00 45.42  ? 845  PRO A CB  1 
ATOM   155  C  CG  . PRO A 1 23  ? 34.379  52.801  7.790    1.00 44.54  ? 845  PRO A CG  1 
ATOM   156  C  CD  . PRO A 1 23  ? 33.646  53.022  9.101    1.00 45.42  ? 845  PRO A CD  1 
ATOM   157  N  N   . LYS A 1 24  ? 31.274  53.342  6.431    1.00 44.54  ? 846  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 24  ? 30.351  52.951  5.370    1.00 42.25  ? 846  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 24  ? 29.361  54.035  4.954    1.00 41.30  ? 846  LYS A C   1 
ATOM   160  O  O   . LYS A 1 24  ? 28.956  54.872  5.763    1.00 41.60  ? 846  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 24  ? 29.580  51.695  5.786    1.00 42.88  ? 846  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 24  ? 30.472  50.516  6.134    1.00 41.77  ? 846  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 24  ? 29.656  49.305  6.559    1.00 40.04  ? 846  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 24  ? 30.568  48.157  6.954    1.00 42.01  ? 846  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 24  ? 31.542  47.851  5.874    1.00 45.67  ? 846  LYS A NZ  1 
ATOM   166  N  N   . VAL A 1 25  ? 28.987  54.005  3.676    1.00 32.62  ? 847  VAL A N   1 
ATOM   167  C  CA  . VAL A 1 25  ? 28.027  54.939  3.091    1.00 31.62  ? 847  VAL A CA  1 
ATOM   168  C  C   . VAL A 1 25  ? 26.991  54.089  2.355    1.00 29.86  ? 847  VAL A C   1 
ATOM   169  O  O   . VAL A 1 25  ? 27.285  52.957  1.970    1.00 29.28  ? 847  VAL A O   1 
ATOM   170  C  CB  . VAL A 1 25  ? 28.701  55.898  2.083    1.00 45.66  ? 847  VAL A CB  1 
ATOM   171  C  CG1 . VAL A 1 25  ? 29.746  56.742  2.791    1.00 49.50  ? 847  VAL A CG1 1 
ATOM   172  C  CG2 . VAL A 1 25  ? 29.331  55.107  0.946    1.00 46.99  ? 847  VAL A CG2 1 
ATOM   173  N  N   . PHE A 1 26  ? 25.793  54.627  2.145    1.00 33.52  ? 848  PHE A N   1 
ATOM   174  C  CA  . PHE A 1 26  ? 24.738  53.861  1.486    1.00 33.78  ? 848  PHE A CA  1 
ATOM   175  C  C   . PHE A 1 26  ? 23.805  54.679  0.600    1.00 34.12  ? 848  PHE A C   1 
ATOM   176  O  O   . PHE A 1 26  ? 23.597  55.870  0.831    1.00 34.76  ? 848  PHE A O   1 
ATOM   177  C  CB  . PHE A 1 26  ? 23.851  53.179  2.534    1.00 31.04  ? 848  PHE A CB  1 
ATOM   178  C  CG  . PHE A 1 26  ? 24.596  52.395  3.566    1.00 30.09  ? 848  PHE A CG  1 
ATOM   179  C  CD1 . PHE A 1 26  ? 24.783  51.023  3.415    1.00 29.12  ? 848  PHE A CD1 1 
ATOM   180  C  CD2 . PHE A 1 26  ? 25.077  53.019  4.715    1.00 28.14  ? 848  PHE A CD2 1 
ATOM   181  C  CE1 . PHE A 1 26  ? 25.436  50.279  4.396    1.00 28.94  ? 848  PHE A CE1 1 
ATOM   182  C  CE2 . PHE A 1 26  ? 25.732  52.288  5.702    1.00 27.21  ? 848  PHE A CE2 1 
ATOM   183  C  CZ  . PHE A 1 26  ? 25.913  50.914  5.545    1.00 32.42  ? 848  PHE A CZ  1 
ATOM   184  N  N   . HIS A 1 27  ? 23.236  54.024  -0.410   1.00 29.86  ? 849  HIS A N   1 
ATOM   185  C  CA  . HIS A 1 27  ? 22.251  54.665  -1.269   1.00 30.09  ? 849  HIS A CA  1 
ATOM   186  C  C   . HIS A 1 27  ? 20.990  54.573  -0.411   1.00 30.09  ? 849  HIS A C   1 
ATOM   187  O  O   . HIS A 1 27  ? 20.921  53.737  0.493    1.00 28.03  ? 849  HIS A O   1 
ATOM   188  C  CB  . HIS A 1 27  ? 22.053  53.878  -2.567   1.00 31.12  ? 849  HIS A CB  1 
ATOM   189  C  CG  . HIS A 1 27  ? 23.083  54.169  -3.612   1.00 33.42  ? 849  HIS A CG  1 
ATOM   190  N  ND1 . HIS A 1 27  ? 23.932  53.204  -4.110   1.00 34.29  ? 849  HIS A ND1 1 
ATOM   191  C  CD2 . HIS A 1 27  ? 23.398  55.315  -4.258   1.00 31.39  ? 849  HIS A CD2 1 
ATOM   192  C  CE1 . HIS A 1 27  ? 24.724  53.744  -5.017   1.00 32.33  ? 849  HIS A CE1 1 
ATOM   193  N  NE2 . HIS A 1 27  ? 24.420  55.025  -5.125   1.00 31.93  ? 849  HIS A NE2 1 
ATOM   194  N  N   . LEU A 1 28  ? 19.995  55.411  -0.674   1.00 35.24  ? 850  LEU A N   1 
ATOM   195  C  CA  . LEU A 1 28  ? 18.789  55.367  0.137    1.00 37.61  ? 850  LEU A CA  1 
ATOM   196  C  C   . LEU A 1 28  ? 18.105  54.002  0.164    1.00 37.45  ? 850  LEU A C   1 
ATOM   197  O  O   . LEU A 1 28  ? 17.624  53.575  1.215    1.00 37.31  ? 850  LEU A O   1 
ATOM   198  C  CB  . LEU A 1 28  ? 17.790  56.434  -0.320   1.00 45.08  ? 850  LEU A CB  1 
ATOM   199  C  CG  . LEU A 1 28  ? 18.168  57.893  -0.040   1.00 48.60  ? 850  LEU A CG  1 
ATOM   200  C  CD1 . LEU A 1 28  ? 16.986  58.795  -0.366   1.00 47.02  ? 850  LEU A CD1 1 
ATOM   201  C  CD2 . LEU A 1 28  ? 18.560  58.056  1.418    1.00 46.62  ? 850  LEU A CD2 1 
ATOM   202  N  N   . SER A 1 29  ? 18.070  53.312  -0.974   1.00 34.40  ? 851  SER A N   1 
ATOM   203  C  CA  . SER A 1 29  ? 17.408  52.014  -1.030   1.00 34.19  ? 851  SER A CA  1 
ATOM   204  C  C   . SER A 1 29  ? 18.335  50.808  -0.911   1.00 33.17  ? 851  SER A C   1 
ATOM   205  O  O   . SER A 1 29  ? 17.877  49.670  -0.986   1.00 32.38  ? 851  SER A O   1 
ATOM   206  C  CB  . SER A 1 29  ? 16.567  51.890  -2.307   1.00 43.31  ? 851  SER A CB  1 
ATOM   207  O  OG  . SER A 1 29  ? 17.381  51.710  -3.447   1.00 42.05  ? 851  SER A OG  1 
ATOM   208  N  N   . CYS A 1 30  ? 19.633  51.041  -0.746   1.00 27.10  ? 852  CYS A N   1 
ATOM   209  C  CA  . CYS A 1 30  ? 20.553  49.922  -0.572   1.00 26.70  ? 852  CYS A CA  1 
ATOM   210  C  C   . CYS A 1 30  ? 20.581  49.607  0.918    1.00 25.66  ? 852  CYS A C   1 
ATOM   211  O  O   . CYS A 1 30  ? 20.682  48.451  1.325    1.00 24.15  ? 852  CYS A O   1 
ATOM   212  C  CB  . CYS A 1 30  ? 21.958  50.272  -1.072   1.00 32.68  ? 852  CYS A CB  1 
ATOM   213  S  SG  . CYS A 1 30  ? 22.146  50.092  -2.870   1.00 33.51  ? 852  CYS A SG  1 
ATOM   214  N  N   . HIS A 1 31  ? 20.476  50.654  1.731    1.00 31.67  ? 853  HIS A N   1 
ATOM   215  C  CA  . HIS A 1 31  ? 20.470  50.495  3.178    1.00 31.26  ? 853  HIS A CA  1 
ATOM   216  C  C   . HIS A 1 31  ? 19.190  49.760  3.545    1.00 30.88  ? 853  HIS A C   1 
ATOM   217  O  O   . HIS A 1 31  ? 18.226  49.760  2.781    1.00 30.95  ? 853  HIS A O   1 
ATOM   218  C  CB  . HIS A 1 31  ? 20.470  51.869  3.863    1.00 30.04  ? 853  HIS A CB  1 
ATOM   219  C  CG  . HIS A 1 31  ? 20.492  51.806  5.361    1.00 33.90  ? 853  HIS A CG  1 
ATOM   220  N  ND1 . HIS A 1 31  ? 21.650  51.600  6.082    1.00 31.79  ? 853  HIS A ND1 1 
ATOM   221  C  CD2 . HIS A 1 31  ? 19.499  51.927  6.274    1.00 29.35  ? 853  HIS A CD2 1 
ATOM   222  C  CE1 . HIS A 1 31  ? 21.369  51.600  7.373    1.00 31.49  ? 853  HIS A CE1 1 
ATOM   223  N  NE2 . HIS A 1 31  ? 20.071  51.796  7.517    1.00 33.20  ? 853  HIS A NE2 1 
ATOM   224  N  N   . VAL A 1 32  ? 19.193  49.107  4.698    1.00 27.54  ? 854  VAL A N   1 
ATOM   225  C  CA  . VAL A 1 32  ? 17.996  48.431  5.165    1.00 27.54  ? 854  VAL A CA  1 
ATOM   226  C  C   . VAL A 1 32  ? 17.796  48.829  6.623    1.00 27.54  ? 854  VAL A C   1 
ATOM   227  O  O   . VAL A 1 32  ? 18.706  48.707  7.447    1.00 27.54  ? 854  VAL A O   1 
ATOM   228  C  CB  . VAL A 1 32  ? 18.068  46.876  4.994    1.00 30.86  ? 854  VAL A CB  1 
ATOM   229  C  CG1 . VAL A 1 32  ? 19.490  46.427  4.807    1.00 30.86  ? 854  VAL A CG1 1 
ATOM   230  C  CG2 . VAL A 1 32  ? 17.416  46.176  6.187    1.00 30.86  ? 854  VAL A CG2 1 
ATOM   231  N  N   . PRO A 1 33  ? 16.604  49.346  6.948    1.00 28.34  ? 855  PRO A N   1 
ATOM   232  C  CA  . PRO A 1 33  ? 15.516  49.536  5.987    1.00 28.34  ? 855  PRO A CA  1 
ATOM   233  C  C   . PRO A 1 33  ? 15.832  50.654  4.997    1.00 28.34  ? 855  PRO A C   1 
ATOM   234  O  O   . PRO A 1 33  ? 16.724  51.468  5.230    1.00 28.34  ? 855  PRO A O   1 
ATOM   235  C  CB  . PRO A 1 33  ? 14.344  49.899  6.880    1.00 35.83  ? 855  PRO A CB  1 
ATOM   236  C  CG  . PRO A 1 33  ? 15.011  50.780  7.889    1.00 35.83  ? 855  PRO A CG  1 
ATOM   237  C  CD  . PRO A 1 33  ? 16.275  49.991  8.233    1.00 35.83  ? 855  PRO A CD  1 
ATOM   238  N  N   . THR A 1 34  ? 15.091  50.681  3.897    1.00 33.69  ? 856  THR A N   1 
ATOM   239  C  CA  . THR A 1 34  ? 15.256  51.707  2.876    1.00 33.69  ? 856  THR A CA  1 
ATOM   240  C  C   . THR A 1 34  ? 14.758  53.044  3.420    1.00 33.69  ? 856  THR A C   1 
ATOM   241  O  O   . THR A 1 34  ? 13.712  53.093  4.066    1.00 33.69  ? 856  THR A O   1 
ATOM   242  C  CB  . THR A 1 34  ? 14.431  51.359  1.614    1.00 36.12  ? 856  THR A CB  1 
ATOM   243  O  OG1 . THR A 1 34  ? 15.070  50.292  0.903    1.00 36.12  ? 856  THR A OG1 1 
ATOM   244  C  CG2 . THR A 1 34  ? 14.292  52.575  0.702    1.00 36.12  ? 856  THR A CG2 1 
ATOM   245  N  N   . LEU A 1 35  ? 15.514  54.114  3.177    1.00 38.51  ? 857  LEU A N   1 
ATOM   246  C  CA  . LEU A 1 35  ? 15.114  55.454  3.608    1.00 38.51  ? 857  LEU A CA  1 
ATOM   247  C  C   . LEU A 1 35  ? 14.478  56.154  2.415    1.00 38.51  ? 857  LEU A C   1 
ATOM   248  O  O   . LEU A 1 35  ? 14.909  55.961  1.277    1.00 38.51  ? 857  LEU A O   1 
ATOM   249  C  CB  . LEU A 1 35  ? 16.315  56.273  4.093    1.00 36.73  ? 857  LEU A CB  1 
ATOM   250  C  CG  . LEU A 1 35  ? 16.763  56.098  5.544    1.00 36.73  ? 857  LEU A CG  1 
ATOM   251  C  CD1 . LEU A 1 35  ? 17.345  54.715  5.727    1.00 36.73  ? 857  LEU A CD1 1 
ATOM   252  C  CD2 . LEU A 1 35  ? 17.787  57.159  5.904    1.00 36.73  ? 857  LEU A CD2 1 
ATOM   253  N  N   . THR A 1 36  ? 13.456  56.963  2.668    1.00 52.94  ? 858  THR A N   1 
ATOM   254  C  CA  . THR A 1 36  ? 12.777  57.661  1.584    1.00 52.94  ? 858  THR A CA  1 
ATOM   255  C  C   . THR A 1 36  ? 13.433  58.989  1.222    1.00 52.94  ? 858  THR A C   1 
ATOM   256  O  O   . THR A 1 36  ? 13.352  59.434  0.074    1.00 52.94  ? 858  THR A O   1 
ATOM   257  C  CB  . THR A 1 36  ? 11.302  57.915  1.929    1.00 61.90  ? 858  THR A CB  1 
ATOM   258  O  OG1 . THR A 1 36  ? 11.217  58.645  3.158    1.00 61.90  ? 858  THR A OG1 1 
ATOM   259  C  CG2 . THR A 1 36  ? 10.562  56.595  2.073    1.00 61.90  ? 858  THR A CG2 1 
ATOM   260  N  N   . ASN A 1 37  ? 14.084  59.618  2.198    1.00 47.40  ? 859  ASN A N   1 
ATOM   261  C  CA  . ASN A 1 37  ? 14.755  60.895  1.976    1.00 47.40  ? 859  ASN A CA  1 
ATOM   262  C  C   . ASN A 1 37  ? 16.045  60.997  2.776    1.00 47.40  ? 859  ASN A C   1 
ATOM   263  O  O   . ASN A 1 37  ? 16.245  60.271  3.745    1.00 47.40  ? 859  ASN A O   1 
ATOM   264  C  CB  . ASN A 1 37  ? 13.844  62.062  2.376    1.00 81.20  ? 859  ASN A CB  1 
ATOM   265  C  CG  . ASN A 1 37  ? 12.709  62.285  1.400    1.00 81.20  ? 859  ASN A CG  1 
ATOM   266  O  OD1 . ASN A 1 37  ? 11.757  61.507  1.343    1.00 81.20  ? 859  ASN A OD1 1 
ATOM   267  N  ND2 . ASN A 1 37  ? 12.808  63.355  0.618    1.00 81.20  ? 859  ASN A ND2 1 
ATOM   268  N  N   . PHE A 1 38  ? 16.924  61.902  2.364    1.00 57.29  ? 860  PHE A N   1 
ATOM   269  C  CA  . PHE A 1 38  ? 18.166  62.099  3.091    1.00 57.29  ? 860  PHE A CA  1 
ATOM   270  C  C   . PHE A 1 38  ? 17.818  62.886  4.341    1.00 57.29  ? 860  PHE A C   1 
ATOM   271  O  O   . PHE A 1 38  ? 17.026  63.828  4.286    1.00 57.29  ? 860  PHE A O   1 
ATOM   272  C  CB  . PHE A 1 38  ? 19.172  62.899  2.266    1.00 56.06  ? 860  PHE A CB  1 
ATOM   273  C  CG  . PHE A 1 38  ? 19.684  62.170  1.070    1.00 56.06  ? 860  PHE A CG  1 
ATOM   274  C  CD1 . PHE A 1 38  ? 18.921  62.081  -0.087   1.00 56.06  ? 860  PHE A CD1 1 
ATOM   275  C  CD2 . PHE A 1 38  ? 20.925  61.548  1.108    1.00 56.06  ? 860  PHE A CD2 1 
ATOM   276  C  CE1 . PHE A 1 38  ? 19.385  61.380  -1.192   1.00 56.06  ? 860  PHE A CE1 1 
ATOM   277  C  CE2 . PHE A 1 38  ? 21.400  60.844  0.013    1.00 56.06  ? 860  PHE A CE2 1 
ATOM   278  C  CZ  . PHE A 1 38  ? 20.628  60.758  -1.142   1.00 56.06  ? 860  PHE A CZ  1 
ATOM   279  N  N   . PRO A 1 39  ? 18.394  62.505  5.487    1.00 82.30  ? 861  PRO A N   1 
ATOM   280  C  CA  . PRO A 1 39  ? 18.121  63.205  6.747    1.00 82.30  ? 861  PRO A CA  1 
ATOM   281  C  C   . PRO A 1 39  ? 18.800  64.569  6.748    1.00 82.30  ? 861  PRO A C   1 
ATOM   282  O  O   . PRO A 1 39  ? 19.608  64.861  5.868    1.00 82.30  ? 861  PRO A O   1 
ATOM   283  C  CB  . PRO A 1 39  ? 18.726  62.271  7.797    1.00 71.61  ? 861  PRO A CB  1 
ATOM   284  C  CG  . PRO A 1 39  ? 18.719  60.919  7.118    1.00 71.61  ? 861  PRO A CG  1 
ATOM   285  C  CD  . PRO A 1 39  ? 19.160  61.273  5.730    1.00 71.61  ? 861  PRO A CD  1 
ATOM   286  N  N   . SER A 1 40  ? 18.479  65.415  7.719    1.00 83.54  ? 862  SER A N   1 
ATOM   287  C  CA  . SER A 1 40  ? 19.141  66.708  7.763    1.00 83.54  ? 862  SER A CA  1 
ATOM   288  C  C   . SER A 1 40  ? 20.232  66.707  8.826    1.00 83.54  ? 862  SER A C   1 
ATOM   289  O  O   . SER A 1 40  ? 21.224  67.418  8.695    1.00 83.54  ? 862  SER A O   1 
ATOM   290  C  CB  . SER A 1 40  ? 18.150  67.842  8.026    1.00 100.35 ? 862  SER A CB  1 
ATOM   291  O  OG  . SER A 1 40  ? 18.790  69.092  7.816    1.00 100.35 ? 862  SER A OG  1 
ATOM   292  N  N   . GLY A 1 41  ? 20.054  65.908  9.874    1.00 82.40  ? 863  GLY A N   1 
ATOM   293  C  CA  . GLY A 1 41  ? 21.061  65.835  10.921   1.00 82.40  ? 863  GLY A CA  1 
ATOM   294  C  C   . GLY A 1 41  ? 22.026  64.697  10.637   1.00 82.40  ? 863  GLY A C   1 
ATOM   295  O  O   . GLY A 1 41  ? 21.887  64.026  9.616    1.00 82.40  ? 863  GLY A O   1 
ATOM   296  N  N   . GLU A 1 42  ? 23.007  64.474  11.511   1.00 55.33  ? 864  GLU A N   1 
ATOM   297  C  CA  . GLU A 1 42  ? 23.945  63.376  11.296   1.00 55.33  ? 864  GLU A CA  1 
ATOM   298  C  C   . GLU A 1 42  ? 23.158  62.076  11.357   1.00 55.33  ? 864  GLU A C   1 
ATOM   299  O  O   . GLU A 1 42  ? 22.203  61.946  12.123   1.00 55.33  ? 864  GLU A O   1 
ATOM   300  C  CB  . GLU A 1 42  ? 25.070  63.385  12.343   1.00 100.82 ? 864  GLU A CB  1 
ATOM   301  C  CG  . GLU A 1 42  ? 26.363  64.084  11.888   1.00 100.82 ? 864  GLU A CG  1 
ATOM   302  C  CD  . GLU A 1 42  ? 27.319  63.170  11.117   1.00 100.82 ? 864  GLU A CD  1 
ATOM   303  O  OE1 . GLU A 1 42  ? 26.930  62.633  10.057   1.00 100.82 ? 864  GLU A OE1 1 
ATOM   304  O  OE2 . GLU A 1 42  ? 28.469  62.992  11.574   1.00 100.82 ? 864  GLU A OE2 1 
ATOM   305  N  N   . TRP A 1 43  ? 23.571  61.115  10.540   1.00 64.59  ? 865  TRP A N   1 
ATOM   306  C  CA  . TRP A 1 43  ? 22.887  59.835  10.444   1.00 64.47  ? 865  TRP A CA  1 
ATOM   307  C  C   . TRP A 1 43  ? 23.738  58.654  10.908   1.00 63.56  ? 865  TRP A C   1 
ATOM   308  O  O   . TRP A 1 43  ? 24.960  58.652  10.753   1.00 64.71  ? 865  TRP A O   1 
ATOM   309  C  CB  . TRP A 1 43  ? 22.451  59.639  8.992    1.00 48.39  ? 865  TRP A CB  1 
ATOM   310  C  CG  . TRP A 1 43  ? 21.726  58.373  8.700    1.00 48.34  ? 865  TRP A CG  1 
ATOM   311  C  CD1 . TRP A 1 43  ? 20.432  58.072  9.012    1.00 48.23  ? 865  TRP A CD1 1 
ATOM   312  C  CD2 . TRP A 1 43  ? 22.243  57.245  7.990    1.00 45.77  ? 865  TRP A CD2 1 
ATOM   313  N  NE1 . TRP A 1 43  ? 20.108  56.825  8.533    1.00 49.24  ? 865  TRP A NE1 1 
ATOM   314  C  CE2 . TRP A 1 43  ? 21.202  56.293  7.902    1.00 46.60  ? 865  TRP A CE2 1 
ATOM   315  C  CE3 . TRP A 1 43  ? 23.487  56.945  7.416    1.00 42.90  ? 865  TRP A CE3 1 
ATOM   316  C  CZ2 . TRP A 1 43  ? 21.366  55.059  7.263    1.00 44.99  ? 865  TRP A CZ2 1 
ATOM   317  C  CZ3 . TRP A 1 43  ? 23.648  55.717  6.781    1.00 42.19  ? 865  TRP A CZ3 1 
ATOM   318  C  CH2 . TRP A 1 43  ? 22.591  54.791  6.711    1.00 42.43  ? 865  TRP A CH2 1 
ATOM   319  N  N   . ILE A 1 44  ? 23.074  57.654  11.482   1.00 42.58  ? 866  ILE A N   1 
ATOM   320  C  CA  . ILE A 1 44  ? 23.735  56.446  11.970   1.00 39.98  ? 866  ILE A CA  1 
ATOM   321  C  C   . ILE A 1 44  ? 23.149  55.278  11.180   1.00 38.69  ? 866  ILE A C   1 
ATOM   322  O  O   . ILE A 1 44  ? 21.941  55.244  10.943   1.00 37.11  ? 866  ILE A O   1 
ATOM   323  C  CB  . ILE A 1 44  ? 23.443  56.211  13.461   1.00 50.20  ? 866  ILE A CB  1 
ATOM   324  C  CG1 . ILE A 1 44  ? 23.801  57.455  14.277   1.00 51.85  ? 866  ILE A CG1 1 
ATOM   325  C  CG2 . ILE A 1 44  ? 24.241  55.019  13.956   1.00 47.80  ? 866  ILE A CG2 1 
ATOM   326  C  CD1 . ILE A 1 44  ? 25.278  57.612  14.536   1.00 52.48  ? 866  ILE A CD1 1 
ATOM   327  N  N   . CYS A 1 45  ? 23.987  54.319  10.783   1.00 34.90  ? 867  CYS A N   1 
ATOM   328  C  CA  . CYS A 1 45  ? 23.497  53.181  10.005   1.00 32.44  ? 867  CYS A CA  1 
ATOM   329  C  C   . CYS A 1 45  ? 23.004  52.036  10.877   1.00 30.53  ? 867  CYS A C   1 
ATOM   330  O  O   . CYS A 1 45  ? 23.220  52.021  12.083   1.00 29.80  ? 867  CYS A O   1 
ATOM   331  C  CB  . CYS A 1 45  ? 24.580  52.677  9.042    1.00 35.15  ? 867  CYS A CB  1 
ATOM   332  S  SG  . CYS A 1 45  ? 25.792  51.543  9.735    1.00 36.56  ? 867  CYS A SG  1 
ATOM   333  N  N   . THR A 1 46  ? 22.337  51.075  10.247   1.00 30.31  ? 868  THR A N   1 
ATOM   334  C  CA  . THR A 1 46  ? 21.778  49.920  10.933   1.00 29.83  ? 868  THR A CA  1 
ATOM   335  C  C   . THR A 1 46  ? 22.816  49.061  11.642   1.00 29.08  ? 868  THR A C   1 
ATOM   336  O  O   . THR A 1 46  ? 22.487  48.315  12.566   1.00 27.82  ? 868  THR A O   1 
ATOM   337  C  CB  . THR A 1 46  ? 20.963  49.055  9.939    1.00 29.91  ? 868  THR A CB  1 
ATOM   338  O  OG1 . THR A 1 46  ? 19.702  49.690  9.697    1.00 28.43  ? 868  THR A OG1 1 
ATOM   339  C  CG2 . THR A 1 46  ? 20.726  47.651  10.480   1.00 32.11  ? 868  THR A CG2 1 
ATOM   340  N  N   . PHE A 1 47  ? 24.070  49.155  11.214   1.00 29.00  ? 869  PHE A N   1 
ATOM   341  C  CA  . PHE A 1 47  ? 25.127  48.379  11.853   1.00 30.20  ? 869  PHE A CA  1 
ATOM   342  C  C   . PHE A 1 47  ? 25.524  49.048  13.167   1.00 31.14  ? 869  PHE A C   1 
ATOM   343  O  O   . PHE A 1 47  ? 25.773  48.375  14.173   1.00 32.12  ? 869  PHE A O   1 
ATOM   344  C  CB  . PHE A 1 47  ? 26.377  48.315  10.963   1.00 28.33  ? 869  PHE A CB  1 
ATOM   345  C  CG  . PHE A 1 47  ? 26.235  47.433  9.758    1.00 27.09  ? 869  PHE A CG  1 
ATOM   346  C  CD1 . PHE A 1 47  ? 25.901  46.090  9.899    1.00 28.44  ? 869  PHE A CD1 1 
ATOM   347  C  CD2 . PHE A 1 47  ? 26.475  47.936  8.481    1.00 27.60  ? 869  PHE A CD2 1 
ATOM   348  C  CE1 . PHE A 1 47  ? 25.810  45.257  8.783    1.00 28.52  ? 869  PHE A CE1 1 
ATOM   349  C  CE2 . PHE A 1 47  ? 26.387  47.111  7.360    1.00 28.44  ? 869  PHE A CE2 1 
ATOM   350  C  CZ  . PHE A 1 47  ? 26.054  45.767  7.514    1.00 28.69  ? 869  PHE A CZ  1 
ATOM   351  N  N   . CYS A 1 48  ? 25.576  50.378  13.140   1.00 33.12  ? 870  CYS A N   1 
ATOM   352  C  CA  . CYS A 1 48  ? 25.998  51.176  14.286   1.00 35.34  ? 870  CYS A CA  1 
ATOM   353  C  C   . CYS A 1 48  ? 24.905  51.611  15.258   1.00 36.80  ? 870  CYS A C   1 
ATOM   354  O  O   . CYS A 1 48  ? 25.176  51.862  16.435   1.00 37.19  ? 870  CYS A O   1 
ATOM   355  C  CB  . CYS A 1 48  ? 26.739  52.414  13.777   1.00 39.08  ? 870  CYS A CB  1 
ATOM   356  S  SG  . CYS A 1 48  ? 28.120  52.033  12.664   1.00 43.51  ? 870  CYS A SG  1 
ATOM   357  N  N   . ARG A 1 49  ? 23.676  51.706  14.770   1.00 48.82  ? 871  ARG A N   1 
ATOM   358  C  CA  . ARG A 1 49  ? 22.566  52.129  15.610   1.00 50.90  ? 871  ARG A CA  1 
ATOM   359  C  C   . ARG A 1 49  ? 22.256  51.106  16.707   1.00 51.83  ? 871  ARG A C   1 
ATOM   360  O  O   . ARG A 1 49  ? 22.341  49.899  16.488   1.00 51.79  ? 871  ARG A O   1 
ATOM   361  C  CB  . ARG A 1 49  ? 21.341  52.365  14.738   1.00 42.91  ? 871  ARG A CB  1 
ATOM   362  C  CG  . ARG A 1 49  ? 20.121  52.791  15.496   1.00 45.48  ? 871  ARG A CG  1 
ATOM   363  C  CD  . ARG A 1 49  ? 18.921  52.069  14.940   1.00 48.32  ? 871  ARG A CD  1 
ATOM   364  N  NE  . ARG A 1 49  ? 18.013  52.963  14.237   1.00 41.73  ? 871  ARG A NE  1 
ATOM   365  C  CZ  . ARG A 1 49  ? 16.923  52.555  13.601   1.00 44.13  ? 871  ARG A CZ  1 
ATOM   366  N  NH1 . ARG A 1 49  ? 16.617  51.266  13.577   1.00 45.40  ? 871  ARG A NH1 1 
ATOM   367  N  NH2 . ARG A 1 49  ? 16.137  53.438  13.005   1.00 49.35  ? 871  ARG A NH2 1 
ATOM   368  N  N   . ASP A 1 50  ? 21.905  51.598  17.891   1.00 44.72  ? 872  ASP A N   1 
ATOM   369  C  CA  . ASP A 1 50  ? 21.597  50.731  19.027   1.00 45.52  ? 872  ASP A CA  1 
ATOM   370  C  C   . ASP A 1 50  ? 20.307  49.951  18.777   1.00 44.96  ? 872  ASP A C   1 
ATOM   371  O  O   . ASP A 1 50  ? 19.322  50.506  18.294   1.00 44.27  ? 872  ASP A O   1 
ATOM   372  C  CB  . ASP A 1 50  ? 21.456  51.576  20.299   1.00 60.73  ? 872  ASP A CB  1 
ATOM   373  C  CG  . ASP A 1 50  ? 21.476  50.739  21.563   1.00 63.41  ? 872  ASP A CG  1 
ATOM   374  O  OD1 . ASP A 1 50  ? 20.617  49.843  21.710   1.00 70.38  ? 872  ASP A OD1 1 
ATOM   375  O  OD2 . ASP A 1 50  ? 22.356  50.981  22.414   1.00 68.48  ? 872  ASP A OD2 1 
ATOM   376  N  N   . LEU A 1 51  ? 20.318  48.663  19.105   1.00 40.78  ? 873  LEU A N   1 
ATOM   377  C  CA  . LEU A 1 51  ? 19.151  47.808  18.917   1.00 40.55  ? 873  LEU A CA  1 
ATOM   378  C  C   . LEU A 1 51  ? 18.057  48.086  19.949   1.00 42.50  ? 873  LEU A C   1 
ATOM   379  O  O   . LEU A 1 51  ? 16.874  48.143  19.612   1.00 41.47  ? 873  LEU A O   1 
ATOM   380  C  CB  . LEU A 1 51  ? 19.562  46.334  18.998   1.00 32.48  ? 873  LEU A CB  1 
ATOM   381  C  CG  . LEU A 1 51  ? 20.440  45.783  17.873   1.00 30.28  ? 873  LEU A CG  1 
ATOM   382  C  CD1 . LEU A 1 51  ? 20.907  44.376  18.216   1.00 28.16  ? 873  LEU A CD1 1 
ATOM   383  C  CD2 . LEU A 1 51  ? 19.655  45.779  16.576   1.00 26.71  ? 873  LEU A CD2 1 
ATOM   384  N  N   . SER A 1 52  ? 18.460  48.256  21.205   1.00 41.23  ? 874  SER A N   1 
ATOM   385  C  CA  . SER A 1 52  ? 17.518  48.516  22.293   1.00 44.17  ? 874  SER A CA  1 
ATOM   386  C  C   . SER A 1 52  ? 16.757  49.824  22.104   1.00 44.76  ? 874  SER A C   1 
ATOM   387  O  O   . SER A 1 52  ? 15.533  49.831  22.019   1.00 45.45  ? 874  SER A O   1 
ATOM   388  C  CB  . SER A 1 52  ? 18.264  48.546  23.628   1.00 63.46  ? 874  SER A CB  1 
ATOM   389  O  OG  . SER A 1 52  ? 17.730  47.596  24.533   1.00 64.06  ? 874  SER A OG  1 
ATOM   390  N  N   . LYS A 1 53  ? 17.491  50.930  22.049   1.00 49.94  ? 875  LYS A N   1 
ATOM   391  C  CA  . LYS A 1 53  ? 16.898  52.249  21.865   1.00 51.07  ? 875  LYS A CA  1 
ATOM   392  C  C   . LYS A 1 53  ? 17.705  53.048  20.843   1.00 51.47  ? 875  LYS A C   1 
ATOM   393  O  O   . LYS A 1 53  ? 18.709  53.679  21.184   1.00 51.51  ? 875  LYS A O   1 
ATOM   394  C  CB  . LYS A 1 53  ? 16.850  53.005  23.201   1.00 82.07  ? 875  LYS A CB  1 
ATOM   395  C  CG  . LYS A 1 53  ? 17.818  52.482  24.255   1.00 83.26  ? 875  LYS A CG  1 
ATOM   396  C  CD  . LYS A 1 53  ? 17.107  51.599  25.276   1.00 86.52  ? 875  LYS A CD  1 
ATOM   397  C  CE  . LYS A 1 53  ? 16.410  52.432  26.344   1.00 88.21  ? 875  LYS A CE  1 
ATOM   398  N  NZ  . LYS A 1 53  ? 17.392  53.188  27.176   1.00 90.98  ? 875  LYS A NZ  1 
ATOM   399  N  N   . PRO A 1 54  ? 17.270  53.028  19.571   1.00 57.31  ? 876  PRO A N   1 
ATOM   400  C  CA  . PRO A 1 54  ? 17.929  53.738  18.468   1.00 58.05  ? 876  PRO A CA  1 
ATOM   401  C  C   . PRO A 1 54  ? 18.128  55.223  18.750   1.00 58.59  ? 876  PRO A C   1 
ATOM   402  O  O   . PRO A 1 54  ? 17.215  55.904  19.212   1.00 58.33  ? 876  PRO A O   1 
ATOM   403  C  CB  . PRO A 1 54  ? 16.983  53.501  17.294   1.00 49.04  ? 876  PRO A CB  1 
ATOM   404  C  CG  . PRO A 1 54  ? 16.394  52.161  17.608   1.00 48.57  ? 876  PRO A CG  1 
ATOM   405  C  CD  . PRO A 1 54  ? 16.094  52.289  19.082   1.00 48.50  ? 876  PRO A CD  1 
ATOM   406  N  N   . GLU A 1 55  ? 19.325  55.721  18.462   1.00 58.50  ? 877  GLU A N   1 
ATOM   407  C  CA  . GLU A 1 55  ? 19.631  57.126  18.687   1.00 59.10  ? 877  GLU A CA  1 
ATOM   408  C  C   . GLU A 1 55  ? 18.956  57.989  17.627   1.00 59.04  ? 877  GLU A C   1 
ATOM   409  O  O   . GLU A 1 55  ? 18.795  59.198  17.806   1.00 59.36  ? 877  GLU A O   1 
ATOM   410  C  CB  . GLU A 1 55  ? 21.146  57.356  18.656   1.00 64.47  ? 877  GLU A CB  1 
ATOM   411  C  CG  . GLU A 1 55  ? 21.929  56.539  19.680   1.00 64.62  ? 877  GLU A CG  1 
ATOM   412  C  CD  . GLU A 1 55  ? 22.370  55.183  19.152   1.00 63.76  ? 877  GLU A CD  1 
ATOM   413  O  OE1 . GLU A 1 55  ? 21.508  54.389  18.712   1.00 58.47  ? 877  GLU A OE1 1 
ATOM   414  O  OE2 . GLU A 1 55  ? 23.590  54.912  19.181   1.00 65.48  ? 877  GLU A OE2 1 
ATOM   415  N  N   . VAL A 1 56  ? 18.563  57.363  16.522   1.00 54.61  ? 878  VAL A N   1 
ATOM   416  C  CA  . VAL A 1 56  ? 17.904  58.077  15.434   1.00 55.24  ? 878  VAL A CA  1 
ATOM   417  C  C   . VAL A 1 56  ? 16.737  57.276  14.858   1.00 54.84  ? 878  VAL A C   1 
ATOM   418  O  O   . VAL A 1 56  ? 16.713  56.048  14.937   1.00 53.87  ? 878  VAL A O   1 
ATOM   419  C  CB  . VAL A 1 56  ? 18.894  58.384  14.288   1.00 76.72  ? 878  VAL A CB  1 
ATOM   420  C  CG1 . VAL A 1 56  ? 18.243  59.312  13.276   1.00 78.69  ? 878  VAL A CG1 1 
ATOM   421  C  CG2 . VAL A 1 56  ? 20.163  59.007  14.843   1.00 77.61  ? 878  VAL A CG2 1 
ATOM   422  N  N   . GLU A 1 57  ? 15.773  57.988  14.283   1.00 58.54  ? 879  GLU A N   1 
ATOM   423  C  CA  . GLU A 1 57  ? 14.596  57.376  13.671   1.00 59.69  ? 879  GLU A CA  1 
ATOM   424  C  C   . GLU A 1 57  ? 14.710  57.495  12.155   1.00 58.99  ? 879  GLU A C   1 
ATOM   425  O  O   . GLU A 1 57  ? 15.129  58.533  11.643   1.00 59.18  ? 879  GLU A O   1 
ATOM   426  C  CB  . GLU A 1 57  ? 13.322  58.096  14.129   1.00 82.45  ? 879  GLU A CB  1 
ATOM   427  C  CG  . GLU A 1 57  ? 12.834  57.733  15.524   1.00 85.29  ? 879  GLU A CG  1 
ATOM   428  C  CD  . GLU A 1 57  ? 11.852  56.574  15.514   1.00 89.19  ? 879  GLU A CD  1 
ATOM   429  O  OE1 . GLU A 1 57  ? 10.784  56.706  14.877   1.00 91.28  ? 879  GLU A OE1 1 
ATOM   430  O  OE2 . GLU A 1 57  ? 12.145  55.534  16.143   1.00 90.39  ? 879  GLU A OE2 1 
ATOM   431  N  N   . TYR A 1 58  ? 14.354  56.436  11.435   1.00 62.97  ? 880  TYR A N   1 
ATOM   432  C  CA  . TYR A 1 58  ? 14.404  56.484  9.977    1.00 62.97  ? 880  TYR A CA  1 
ATOM   433  C  C   . TYR A 1 58  ? 13.004  56.854  9.493    1.00 62.97  ? 880  TYR A C   1 
ATOM   434  O  O   . TYR A 1 58  ? 12.851  57.716  8.629    1.00 62.97  ? 880  TYR A O   1 
ATOM   435  C  CB  . TYR A 1 58  ? 14.836  55.131  9.385    1.00 38.36  ? 880  TYR A CB  1 
ATOM   436  C  CG  . TYR A 1 58  ? 16.214  54.658  9.816    1.00 38.36  ? 880  TYR A CG  1 
ATOM   437  C  CD1 . TYR A 1 58  ? 17.290  55.548  9.908    1.00 38.36  ? 880  TYR A CD1 1 
ATOM   438  C  CD2 . TYR A 1 58  ? 16.445  53.317  10.132   1.00 38.36  ? 880  TYR A CD2 1 
ATOM   439  C  CE1 . TYR A 1 58  ? 18.556  55.113  10.308   1.00 38.36  ? 880  TYR A CE1 1 
ATOM   440  C  CE2 . TYR A 1 58  ? 17.709  52.873  10.532   1.00 38.36  ? 880  TYR A CE2 1 
ATOM   441  C  CZ  . TYR A 1 58  ? 18.757  53.776  10.621   1.00 38.36  ? 880  TYR A CZ  1 
ATOM   442  O  OH  . TYR A 1 58  ? 19.997  53.340  11.045   1.00 38.36  ? 880  TYR A OH  1 
ATOM   443  N  N   . ASP A 1 59  ? 12.002  56.197  10.082   1.00 95.60  ? 881  ASP A N   1 
ATOM   444  C  CA  . ASP A 1 59  ? 10.572  56.388  9.801    1.00 95.60  ? 881  ASP A CA  1 
ATOM   445  C  C   . ASP A 1 59  ? 9.904   55.053  9.485    1.00 95.60  ? 881  ASP A C   1 
ATOM   446  O  O   . ASP A 1 59  ? 9.407   54.368  10.379   1.00 95.60  ? 881  ASP A O   1 
ATOM   447  C  CB  . ASP A 1 59  ? 10.332  57.354  8.632    1.00 107.82 ? 881  ASP A CB  1 
ATOM   448  C  CG  . ASP A 1 59  ? 10.531  56.698  7.277    1.00 107.82 ? 881  ASP A CG  1 
ATOM   449  O  OD1 . ASP A 1 59  ? 11.664  56.269  6.974    1.00 107.82 ? 881  ASP A OD1 1 
ATOM   450  O  OD2 . ASP A 1 59  ? 9.546   56.612  6.512    1.00 107.82 ? 881  ASP A OD2 1 
ATOM   451  N  N   . LYS A 1 70  ? -4.361  53.302  20.145   1.00 55.52  ? 892  LYS A N   1 
ATOM   452  C  CA  . LYS A 1 70  ? -4.355  52.736  18.806   1.00 55.52  ? 892  LYS A CA  1 
ATOM   453  C  C   . LYS A 1 70  ? -3.774  51.329  18.818   1.00 55.52  ? 892  LYS A C   1 
ATOM   454  O  O   . LYS A 1 70  ? -3.144  50.898  17.852   1.00 55.52  ? 892  LYS A O   1 
ATOM   455  C  CB  . LYS A 1 70  ? -3.545  53.632  17.870   1.00 52.55  ? 892  LYS A CB  1 
ATOM   456  C  CG  . LYS A 1 70  ? -2.125  53.897  18.336   1.00 52.55  ? 892  LYS A CG  1 
ATOM   457  C  CD  . LYS A 1 70  ? -1.650  55.274  17.905   1.00 52.55  ? 892  LYS A CD  1 
ATOM   458  C  CE  . LYS A 1 70  ? -2.354  56.367  18.701   1.00 52.55  ? 892  LYS A CE  1 
ATOM   459  N  NZ  . LYS A 1 70  ? -2.089  56.263  20.167   1.00 52.55  ? 892  LYS A NZ  1 
ATOM   460  N  N   . LYS A 1 71  ? -3.989  50.616  19.920   1.00 52.32  ? 893  LYS A N   1 
ATOM   461  C  CA  . LYS A 1 71  ? -3.495  49.250  20.052   1.00 53.01  ? 893  LYS A CA  1 
ATOM   462  C  C   . LYS A 1 71  ? -4.188  48.339  19.068   1.00 52.53  ? 893  LYS A C   1 
ATOM   463  O  O   . LYS A 1 71  ? -5.404  48.185  19.115   1.00 52.72  ? 893  LYS A O   1 
ATOM   464  C  CB  . LYS A 1 71  ? -3.757  48.705  21.452   1.00 39.14  ? 893  LYS A CB  1 
ATOM   465  C  CG  . LYS A 1 71  ? -2.572  48.732  22.374   1.00 41.19  ? 893  LYS A CG  1 
ATOM   466  C  CD  . LYS A 1 71  ? -2.233  50.135  22.776   1.00 43.55  ? 893  LYS A CD  1 
ATOM   467  C  CE  . LYS A 1 71  ? -1.250  50.126  23.919   1.00 39.79  ? 893  LYS A CE  1 
ATOM   468  N  NZ  . LYS A 1 71  ? -1.046  51.505  24.421   1.00 41.48  ? 893  LYS A NZ  1 
ATOM   469  N  N   . THR A 1 72  ? -3.419  47.724  18.181   1.00 41.26  ? 894  THR A N   1 
ATOM   470  C  CA  . THR A 1 72  ? -4.009  46.811  17.219   1.00 39.28  ? 894  THR A CA  1 
ATOM   471  C  C   . THR A 1 72  ? -4.302  45.503  17.942   1.00 37.91  ? 894  THR A C   1 
ATOM   472  O  O   . THR A 1 72  ? -3.409  44.895  18.537   1.00 36.74  ? 894  THR A O   1 
ATOM   473  C  CB  . THR A 1 72  ? -3.062  46.550  16.043   1.00 38.24  ? 894  THR A CB  1 
ATOM   474  O  OG1 . THR A 1 72  ? -2.730  47.797  15.419   1.00 36.05  ? 894  THR A OG1 1 
ATOM   475  C  CG2 . THR A 1 72  ? -3.724  45.643  15.024   1.00 36.64  ? 894  THR A CG2 1 
ATOM   476  N  N   . GLU A 1 73  ? -5.558  45.074  17.890   1.00 33.51  ? 895  GLU A N   1 
ATOM   477  C  CA  . GLU A 1 73  ? -5.967  43.852  18.561   1.00 32.33  ? 895  GLU A CA  1 
ATOM   478  C  C   . GLU A 1 73  ? -5.836  42.617  17.672   1.00 32.17  ? 895  GLU A C   1 
ATOM   479  O  O   . GLU A 1 73  ? -5.780  42.721  16.445   1.00 31.08  ? 895  GLU A O   1 
ATOM   480  C  CB  . GLU A 1 73  ? -7.415  43.990  19.043   1.00 36.22  ? 895  GLU A CB  1 
ATOM   481  C  CG  . GLU A 1 73  ? -7.743  45.354  19.627   1.00 38.08  ? 895  GLU A CG  1 
ATOM   482  C  CD  . GLU A 1 73  ? -9.195  45.472  20.046   1.00 44.60  ? 895  GLU A CD  1 
ATOM   483  O  OE1 . GLU A 1 73  ? -9.710  46.606  20.088   1.00 50.69  ? 895  GLU A OE1 1 
ATOM   484  O  OE2 . GLU A 1 73  ? -9.821  44.433  20.343   1.00 44.09  ? 895  GLU A OE2 1 
ATOM   485  N  N   . GLY A 1 74  ? -5.790  41.453  18.315   1.00 30.25  ? 896  GLY A N   1 
ATOM   486  C  CA  . GLY A 1 74  ? -5.678  40.192  17.607   1.00 30.72  ? 896  GLY A CA  1 
ATOM   487  C  C   . GLY A 1 74  ? -4.555  40.128  16.588   1.00 30.98  ? 896  GLY A C   1 
ATOM   488  O  O   . GLY A 1 74  ? -4.705  39.501  15.540   1.00 31.61  ? 896  GLY A O   1 
ATOM   489  N  N   . LEU A 1 75  ? -3.426  40.763  16.887   1.00 30.52  ? 897  LEU A N   1 
ATOM   490  C  CA  . LEU A 1 75  ? -2.304  40.749  15.960   1.00 30.78  ? 897  LEU A CA  1 
ATOM   491  C  C   . LEU A 1 75  ? -0.963  40.713  16.676   1.00 30.28  ? 897  LEU A C   1 
ATOM   492  O  O   . LEU A 1 75  ? -0.667  41.576  17.494   1.00 29.48  ? 897  LEU A O   1 
ATOM   493  C  CB  . LEU A 1 75  ? -2.348  41.979  15.050   1.00 37.24  ? 897  LEU A CB  1 
ATOM   494  C  CG  . LEU A 1 75  ? -1.291  41.960  13.944   1.00 38.11  ? 897  LEU A CG  1 
ATOM   495  C  CD1 . LEU A 1 75  ? -1.539  40.763  13.049   1.00 41.24  ? 897  LEU A CD1 1 
ATOM   496  C  CD2 . LEU A 1 75  ? -1.336  43.252  13.140   1.00 41.26  ? 897  LEU A CD2 1 
ATOM   497  N  N   . VAL A 1 76  ? -0.157  39.708  16.356   1.00 28.65  ? 898  VAL A N   1 
ATOM   498  C  CA  . VAL A 1 76  ? 1.163   39.565  16.947   1.00 28.65  ? 898  VAL A CA  1 
ATOM   499  C  C   . VAL A 1 76  ? 2.190   40.094  15.949   1.00 28.06  ? 898  VAL A C   1 
ATOM   500  O  O   . VAL A 1 76  ? 2.269   39.611  14.820   1.00 29.54  ? 898  VAL A O   1 
ATOM   501  C  CB  . VAL A 1 76  ? 1.489   38.087  17.241   1.00 36.05  ? 898  VAL A CB  1 
ATOM   502  C  CG1 . VAL A 1 76  ? 2.834   37.983  17.961   1.00 34.02  ? 898  VAL A CG1 1 
ATOM   503  C  CG2 . VAL A 1 76  ? 0.381   37.465  18.073   1.00 38.47  ? 898  VAL A CG2 1 
ATOM   504  N  N   . LYS A 1 77  ? 2.966   41.092  16.354   1.00 30.02  ? 899  LYS A N   1 
ATOM   505  C  CA  . LYS A 1 77  ? 3.989   41.646  15.476   1.00 28.97  ? 899  LYS A CA  1 
ATOM   506  C  C   . LYS A 1 77  ? 5.366   41.520  16.116   1.00 27.56  ? 899  LYS A C   1 
ATOM   507  O  O   . LYS A 1 77  ? 5.481   41.375  17.327   1.00 25.31  ? 899  LYS A O   1 
ATOM   508  C  CB  . LYS A 1 77  ? 3.690   43.113  15.179   1.00 43.98  ? 899  LYS A CB  1 
ATOM   509  C  CG  . LYS A 1 77  ? 2.304   43.339  14.617   1.00 48.97  ? 899  LYS A CG  1 
ATOM   510  C  CD  . LYS A 1 77  ? 2.341   44.352  13.489   1.00 52.70  ? 899  LYS A CD  1 
ATOM   511  C  CE  . LYS A 1 77  ? 2.833   45.704  13.968   1.00 52.98  ? 899  LYS A CE  1 
ATOM   512  N  NZ  . LYS A 1 77  ? 1.832   46.348  14.857   1.00 52.41  ? 899  LYS A NZ  1 
ATOM   513  N  N   . LEU A 1 78  ? 6.415   41.561  15.300   1.00 31.96  ? 900  LEU A N   1 
ATOM   514  C  CA  . LEU A 1 78  ? 7.768   41.469  15.830   1.00 30.47  ? 900  LEU A CA  1 
ATOM   515  C  C   . LEU A 1 78  ? 7.993   42.632  16.789   1.00 30.77  ? 900  LEU A C   1 
ATOM   516  O  O   . LEU A 1 78  ? 7.489   43.731  16.564   1.00 30.36  ? 900  LEU A O   1 
ATOM   517  C  CB  . LEU A 1 78  ? 8.801   41.566  14.699   1.00 27.11  ? 900  LEU A CB  1 
ATOM   518  C  CG  . LEU A 1 78  ? 8.901   40.473  13.638   1.00 23.69  ? 900  LEU A CG  1 
ATOM   519  C  CD1 . LEU A 1 78  ? 9.889   40.924  12.573   1.00 25.28  ? 900  LEU A CD1 1 
ATOM   520  C  CD2 . LEU A 1 78  ? 9.348   39.159  14.264   1.00 24.96  ? 900  LEU A CD2 1 
ATOM   521  N  N   . THR A 1 79  ? 8.735   42.399  17.866   1.00 25.23  ? 901  THR A N   1 
ATOM   522  C  CA  . THR A 1 79  ? 9.026   43.492  18.780   1.00 25.37  ? 901  THR A CA  1 
ATOM   523  C  C   . THR A 1 79  ? 9.954   44.376  17.956   1.00 25.50  ? 901  THR A C   1 
ATOM   524  O  O   . THR A 1 79  ? 10.530  43.915  16.968   1.00 22.97  ? 901  THR A O   1 
ATOM   525  C  CB  . THR A 1 79  ? 9.792   43.021  20.028   1.00 29.07  ? 901  THR A CB  1 
ATOM   526  O  OG1 . THR A 1 79  ? 11.118  42.627  19.650   1.00 27.40  ? 901  THR A OG1 1 
ATOM   527  C  CG2 . THR A 1 79  ? 9.078   41.842  20.683   1.00 26.04  ? 901  THR A CG2 1 
ATOM   528  N  N   . PRO A 1 80  ? 10.103  45.651  18.335   1.00 30.66  ? 902  PRO A N   1 
ATOM   529  C  CA  . PRO A 1 80  ? 10.984  46.551  17.583   1.00 31.46  ? 902  PRO A CA  1 
ATOM   530  C  C   . PRO A 1 80  ? 12.430  46.062  17.563   1.00 31.39  ? 902  PRO A C   1 
ATOM   531  O  O   . PRO A 1 80  ? 13.140  46.241  16.574   1.00 31.99  ? 902  PRO A O   1 
ATOM   532  C  CB  . PRO A 1 80  ? 10.830  47.875  18.319   1.00 34.68  ? 902  PRO A CB  1 
ATOM   533  C  CG  . PRO A 1 80  ? 9.408   47.819  18.801   1.00 36.54  ? 902  PRO A CG  1 
ATOM   534  C  CD  . PRO A 1 80  ? 9.327   46.400  19.339   1.00 33.54  ? 902  PRO A CD  1 
ATOM   535  N  N   . ILE A 1 81  ? 12.861  45.444  18.656   1.00 23.63  ? 903  ILE A N   1 
ATOM   536  C  CA  . ILE A 1 81  ? 14.222  44.926  18.751   1.00 23.69  ? 903  ILE A CA  1 
ATOM   537  C  C   . ILE A 1 81  ? 14.476  43.834  17.710   1.00 23.07  ? 903  ILE A C   1 
ATOM   538  O  O   . ILE A 1 81  ? 15.522  43.814  17.067   1.00 21.15  ? 903  ILE A O   1 
ATOM   539  C  CB  . ILE A 1 81  ? 14.497  44.339  20.157   1.00 30.39  ? 903  ILE A CB  1 
ATOM   540  C  CG1 . ILE A 1 81  ? 14.779  45.473  21.147   1.00 27.97  ? 903  ILE A CG1 1 
ATOM   541  C  CG2 . ILE A 1 81  ? 15.659  43.346  20.106   1.00 31.51  ? 903  ILE A CG2 1 
ATOM   542  C  CD1 . ILE A 1 81  ? 14.905  44.997  22.590   1.00 30.37  ? 903  ILE A CD1 1 
ATOM   543  N  N   . ASP A 1 82  ? 13.515  42.928  17.551   1.00 24.24  ? 904  ASP A N   1 
ATOM   544  C  CA  . ASP A 1 82  ? 13.660  41.834  16.607   1.00 23.62  ? 904  ASP A CA  1 
ATOM   545  C  C   . ASP A 1 82  ? 13.568  42.286  15.157   1.00 24.11  ? 904  ASP A C   1 
ATOM   546  O  O   . ASP A 1 82  ? 14.174  41.682  14.275   1.00 24.16  ? 904  ASP A O   1 
ATOM   547  C  CB  . ASP A 1 82  ? 12.633  40.747  16.911   1.00 26.75  ? 904  ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 82  ? 12.880  40.090  18.258   1.00 28.35  ? 904  ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 82  ? 14.024  39.642  18.491   1.00 23.80  ? 904  ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 82  ? 11.940  40.020  19.081   1.00 27.39  ? 904  ASP A OD2 1 
ATOM   551  N  N   . LYS A 1 83  ? 12.815  43.350  14.912   1.00 22.55  ? 905  LYS A N   1 
ATOM   552  C  CA  . LYS A 1 83  ? 12.695  43.886  13.567   1.00 22.84  ? 905  LYS A CA  1 
ATOM   553  C  C   . LYS A 1 83  ? 14.062  44.469  13.225   1.00 23.79  ? 905  LYS A C   1 
ATOM   554  O  O   . LYS A 1 83  ? 14.578  44.276  12.122   1.00 22.35  ? 905  LYS A O   1 
ATOM   555  C  CB  . LYS A 1 83  ? 11.628  44.984  13.527   1.00 34.63  ? 905  LYS A CB  1 
ATOM   556  C  CG  . LYS A 1 83  ? 11.447  45.640  12.162   1.00 36.06  ? 905  LYS A CG  1 
ATOM   557  C  CD  . LYS A 1 83  ? 10.254  46.584  12.171   1.00 42.23  ? 905  LYS A CD  1 
ATOM   558  C  CE  . LYS A 1 83  ? 10.078  47.294  10.836   1.00 44.81  ? 905  LYS A CE  1 
ATOM   559  N  NZ  . LYS A 1 83  ? 11.158  48.282  10.584   1.00 51.83  ? 905  LYS A NZ  1 
ATOM   560  N  N   . ARG A 1 84  ? 14.646  45.184  14.185   1.00 26.46  ? 906  ARG A N   1 
ATOM   561  C  CA  . ARG A 1 84  ? 15.962  45.779  13.993   1.00 27.92  ? 906  ARG A CA  1 
ATOM   562  C  C   . ARG A 1 84  ? 17.051  44.711  13.841   1.00 25.55  ? 906  ARG A C   1 
ATOM   563  O  O   . ARG A 1 84  ? 18.039  44.934  13.142   1.00 26.18  ? 906  ARG A O   1 
ATOM   564  C  CB  . ARG A 1 84  ? 16.295  46.742  15.145   1.00 29.61  ? 906  ARG A CB  1 
ATOM   565  C  CG  . ARG A 1 84  ? 15.500  48.055  15.088   1.00 34.22  ? 906  ARG A CG  1 
ATOM   566  C  CD  . ARG A 1 84  ? 16.036  49.108  16.057   1.00 42.17  ? 906  ARG A CD  1 
ATOM   567  N  NE  . ARG A 1 84  ? 15.646  48.878  17.449   1.00 43.17  ? 906  ARG A NE  1 
ATOM   568  C  CZ  . ARG A 1 84  ? 14.494  49.275  17.986   1.00 44.92  ? 906  ARG A CZ  1 
ATOM   569  N  NH1 . ARG A 1 84  ? 13.601  49.927  17.251   1.00 44.73  ? 906  ARG A NH1 1 
ATOM   570  N  NH2 . ARG A 1 84  ? 14.241  49.037  19.268   1.00 43.49  ? 906  ARG A NH2 1 
ATOM   571  N  N   . LYS A 1 85  ? 16.867  43.552  14.470   1.00 21.54  ? 907  LYS A N   1 
ATOM   572  C  CA  . LYS A 1 85  ? 17.847  42.479  14.352   1.00 20.46  ? 907  LYS A CA  1 
ATOM   573  C  C   . LYS A 1 85  ? 17.796  41.876  12.950   1.00 20.07  ? 907  LYS A C   1 
ATOM   574  O  O   . LYS A 1 85  ? 18.829  41.513  12.388   1.00 19.46  ? 907  LYS A O   1 
ATOM   575  C  CB  . LYS A 1 85  ? 17.599  41.380  15.386   1.00 16.91  ? 907  LYS A CB  1 
ATOM   576  C  CG  . LYS A 1 85  ? 18.057  41.731  16.794   1.00 18.95  ? 907  LYS A CG  1 
ATOM   577  C  CD  . LYS A 1 85  ? 17.845  40.567  17.750   1.00 23.55  ? 907  LYS A CD  1 
ATOM   578  C  CE  . LYS A 1 85  ? 18.397  40.887  19.136   1.00 30.71  ? 907  LYS A CE  1 
ATOM   579  N  NZ  . LYS A 1 85  ? 18.231  39.734  20.072   1.00 25.35  ? 907  LYS A NZ  1 
ATOM   580  N  N   . CYS A 1 86  ? 16.589  41.773  12.396   1.00 20.98  ? 908  CYS A N   1 
ATOM   581  C  CA  . CYS A 1 86  ? 16.398  41.231  11.056   1.00 21.63  ? 908  CYS A CA  1 
ATOM   582  C  C   . CYS A 1 86  ? 16.927  42.235  10.037   1.00 21.01  ? 908  CYS A C   1 
ATOM   583  O  O   . CYS A 1 86  ? 17.456  41.852  8.986    1.00 19.57  ? 908  CYS A O   1 
ATOM   584  C  CB  . CYS A 1 86  ? 14.914  40.963  10.783   1.00 22.40  ? 908  CYS A CB  1 
ATOM   585  S  SG  . CYS A 1 86  ? 14.617  40.139  9.185    1.00 28.32  ? 908  CYS A SG  1 
ATOM   586  N  N   . GLU A 1 87  ? 16.777  43.521  10.346   1.00 20.89  ? 909  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 87  ? 17.265  44.564  9.448    1.00 23.74  ? 909  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 87  ? 18.789  44.492  9.388    1.00 23.28  ? 909  GLU A C   1 
ATOM   589  O  O   . GLU A 1 87  ? 19.389  44.687  8.332    1.00 24.36  ? 909  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 87  ? 16.826  45.954  9.929    1.00 26.59  ? 909  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 87  ? 15.314  46.171  9.892    1.00 29.28  ? 909  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 87  ? 14.898  47.564  10.344   1.00 28.77  ? 909  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 87  ? 15.543  48.114  11.264   1.00 27.80  ? 909  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 87  ? 13.910  48.105  9.792    1.00 32.43  ? 909  GLU A OE2 1 
ATOM   595  N  N   . ARG A 1 88  ? 19.408  44.202  10.526   1.00 23.38  ? 910  ARG A N   1 
ATOM   596  C  CA  . ARG A 1 88  ? 20.855  44.101  10.579   1.00 25.18  ? 910  ARG A CA  1 
ATOM   597  C  C   . ARG A 1 88  ? 21.308  42.843  9.842    1.00 24.33  ? 910  ARG A C   1 
ATOM   598  O  O   . ARG A 1 88  ? 22.277  42.884  9.090    1.00 25.00  ? 910  ARG A O   1 
ATOM   599  C  CB  . ARG A 1 88  ? 21.330  44.078  12.035   1.00 29.55  ? 910  ARG A CB  1 
ATOM   600  C  CG  . ARG A 1 88  ? 22.828  44.299  12.198   1.00 35.25  ? 910  ARG A CG  1 
ATOM   601  C  CD  . ARG A 1 88  ? 23.225  44.428  13.659   1.00 35.10  ? 910  ARG A CD  1 
ATOM   602  N  NE  . ARG A 1 88  ? 22.970  45.757  14.207   1.00 39.48  ? 910  ARG A NE  1 
ATOM   603  C  CZ  . ARG A 1 88  ? 23.272  46.108  15.453   1.00 37.57  ? 910  ARG A CZ  1 
ATOM   604  N  NH1 . ARG A 1 88  ? 23.834  45.228  16.267   1.00 36.26  ? 910  ARG A NH1 1 
ATOM   605  N  NH2 . ARG A 1 88  ? 23.017  47.334  15.887   1.00 37.13  ? 910  ARG A NH2 1 
ATOM   606  N  N   . LEU A 1 89  ? 20.602  41.733  10.054   1.00 21.30  ? 911  LEU A N   1 
ATOM   607  C  CA  . LEU A 1 89  ? 20.942  40.475  9.388    1.00 21.72  ? 911  LEU A CA  1 
ATOM   608  C  C   . LEU A 1 89  ? 20.897  40.669  7.874    1.00 20.51  ? 911  LEU A C   1 
ATOM   609  O  O   . LEU A 1 89  ? 21.779  40.199  7.157    1.00 22.91  ? 911  LEU A O   1 
ATOM   610  C  CB  . LEU A 1 89  ? 19.965  39.363  9.789    1.00 23.07  ? 911  LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 89  ? 20.141  38.706  11.163   1.00 24.83  ? 911  LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 89  ? 18.919  37.861  11.495   1.00 26.32  ? 911  LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 89  ? 21.401  37.849  11.159   1.00 27.32  ? 911  LEU A CD2 1 
ATOM   614  N  N   . LEU A 1 90  ? 19.863  41.357  7.399    1.00 21.12  ? 912  LEU A N   1 
ATOM   615  C  CA  . LEU A 1 90  ? 19.714  41.623  5.973    1.00 20.83  ? 912  LEU A CA  1 
ATOM   616  C  C   . LEU A 1 90  ? 20.865  42.456  5.418    1.00 20.62  ? 912  LEU A C   1 
ATOM   617  O  O   . LEU A 1 90  ? 21.431  42.128  4.375    1.00 20.87  ? 912  LEU A O   1 
ATOM   618  C  CB  . LEU A 1 90  ? 18.400  42.355  5.704    1.00 20.18  ? 912  LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 90  ? 17.114  41.530  5.725    1.00 18.55  ? 912  LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 90  ? 15.919  42.467  5.617    1.00 20.17  ? 912  LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 90  ? 17.127  40.532  4.570    1.00 18.39  ? 912  LEU A CD2 1 
ATOM   622  N  N   . LEU A 1 91  ? 21.197  43.540  6.111    1.00 23.87  ? 913  LEU A N   1 
ATOM   623  C  CA  . LEU A 1 91  ? 22.269  44.428  5.680    1.00 22.73  ? 913  LEU A CA  1 
ATOM   624  C  C   . LEU A 1 91  ? 23.613  43.705  5.650    1.00 22.17  ? 913  LEU A C   1 
ATOM   625  O  O   . LEU A 1 91  ? 24.405  43.888  4.718    1.00 22.35  ? 913  LEU A O   1 
ATOM   626  C  CB  . LEU A 1 91  ? 22.335  45.648  6.600    1.00 25.95  ? 913  LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 91  ? 23.200  46.825  6.144    1.00 24.48  ? 913  LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 91  ? 22.761  47.307  4.757    1.00 30.33  ? 913  LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 91  ? 23.059  47.951  7.155    1.00 32.25  ? 913  LEU A CD2 1 
ATOM   630  N  N   . PHE A 1 92  ? 23.876  42.886  6.665    1.00 19.00  ? 914  PHE A N   1 
ATOM   631  C  CA  . PHE A 1 92  ? 25.121  42.123  6.697    1.00 21.86  ? 914  PHE A CA  1 
ATOM   632  C  C   . PHE A 1 92  ? 25.209  41.268  5.434    1.00 22.37  ? 914  PHE A C   1 
ATOM   633  O  O   . PHE A 1 92  ? 26.237  41.259  4.759    1.00 23.38  ? 914  PHE A O   1 
ATOM   634  C  CB  . PHE A 1 92  ? 25.185  41.189  7.914    1.00 26.07  ? 914  PHE A CB  1 
ATOM   635  C  CG  . PHE A 1 92  ? 25.871  41.783  9.115    1.00 28.04  ? 914  PHE A CG  1 
ATOM   636  C  CD1 . PHE A 1 92  ? 25.131  42.209  10.218   1.00 32.71  ? 914  PHE A CD1 1 
ATOM   637  C  CD2 . PHE A 1 92  ? 27.258  41.911  9.149    1.00 28.16  ? 914  PHE A CD2 1 
ATOM   638  C  CE1 . PHE A 1 92  ? 25.766  42.752  11.338   1.00 33.11  ? 914  PHE A CE1 1 
ATOM   639  C  CE2 . PHE A 1 92  ? 27.901  42.454  10.263   1.00 32.29  ? 914  PHE A CE2 1 
ATOM   640  C  CZ  . PHE A 1 92  ? 27.155  42.874  11.358   1.00 33.49  ? 914  PHE A CZ  1 
ATOM   641  N  N   . LEU A 1 93  ? 24.134  40.545  5.117    1.00 25.90  ? 915  LEU A N   1 
ATOM   642  C  CA  . LEU A 1 93  ? 24.145  39.691  3.933    1.00 26.24  ? 915  LEU A CA  1 
ATOM   643  C  C   . LEU A 1 93  ? 24.259  40.515  2.652    1.00 26.25  ? 915  LEU A C   1 
ATOM   644  O  O   . LEU A 1 93  ? 25.028  40.170  1.763    1.00 24.47  ? 915  LEU A O   1 
ATOM   645  C  CB  . LEU A 1 93  ? 22.899  38.798  3.884    1.00 23.25  ? 915  LEU A CB  1 
ATOM   646  C  CG  . LEU A 1 93  ? 22.750  37.779  5.029    1.00 29.09  ? 915  LEU A CG  1 
ATOM   647  C  CD1 . LEU A 1 93  ? 21.619  36.802  4.730    1.00 26.13  ? 915  LEU A CD1 1 
ATOM   648  C  CD2 . LEU A 1 93  ? 24.045  37.017  5.210    1.00 25.89  ? 915  LEU A CD2 1 
ATOM   649  N  N   . TYR A 1 94  ? 23.500  41.601  2.557    1.00 26.31  ? 916  TYR A N   1 
ATOM   650  C  CA  . TYR A 1 94  ? 23.565  42.448  1.372    1.00 27.59  ? 916  TYR A CA  1 
ATOM   651  C  C   . TYR A 1 94  ? 24.995  42.908  1.109    1.00 29.25  ? 916  TYR A C   1 
ATOM   652  O  O   . TYR A 1 94  ? 25.427  42.965  -0.040   1.00 28.03  ? 916  TYR A O   1 
ATOM   653  C  CB  . TYR A 1 94  ? 22.670  43.683  1.525    1.00 23.19  ? 916  TYR A CB  1 
ATOM   654  C  CG  . TYR A 1 94  ? 21.295  43.533  0.913    1.00 23.03  ? 916  TYR A CG  1 
ATOM   655  C  CD1 . TYR A 1 94  ? 20.169  43.379  1.717    1.00 24.88  ? 916  TYR A CD1 1 
ATOM   656  C  CD2 . TYR A 1 94  ? 21.122  43.547  -0.476   1.00 22.19  ? 916  TYR A CD2 1 
ATOM   657  C  CE1 . TYR A 1 94  ? 18.901  43.242  1.163    1.00 23.36  ? 916  TYR A CE1 1 
ATOM   658  C  CE2 . TYR A 1 94  ? 19.862  43.412  -1.043   1.00 25.90  ? 916  TYR A CE2 1 
ATOM   659  C  CZ  . TYR A 1 94  ? 18.755  43.259  -0.214   1.00 26.78  ? 916  TYR A CZ  1 
ATOM   660  O  OH  . TYR A 1 94  ? 17.502  43.129  -0.748   1.00 24.57  ? 916  TYR A OH  1 
ATOM   661  N  N   . CYS A 1 95  ? 25.726  43.227  2.175    1.00 28.55  ? 917  CYS A N   1 
ATOM   662  C  CA  . CYS A 1 95  ? 27.102  43.704  2.044    1.00 28.83  ? 917  CYS A CA  1 
ATOM   663  C  C   . CYS A 1 95  ? 28.144  42.601  1.815    1.00 28.50  ? 917  CYS A C   1 
ATOM   664  O  O   . CYS A 1 95  ? 29.303  42.896  1.514    1.00 30.47  ? 917  CYS A O   1 
ATOM   665  C  CB  . CYS A 1 95  ? 27.489  44.547  3.273    1.00 28.02  ? 917  CYS A CB  1 
ATOM   666  S  SG  . CYS A 1 95  ? 26.617  46.140  3.425    1.00 32.63  ? 917  CYS A SG  1 
ATOM   667  N  N   . HIS A 1 96  ? 27.741  41.337  1.949    1.00 28.91  ? 918  HIS A N   1 
ATOM   668  C  CA  . HIS A 1 96  ? 28.663  40.220  1.743    1.00 28.89  ? 918  HIS A CA  1 
ATOM   669  C  C   . HIS A 1 96  ? 28.718  39.875  0.245    1.00 28.73  ? 918  HIS A C   1 
ATOM   670  O  O   . HIS A 1 96  ? 27.686  39.791  -0.406   1.00 27.40  ? 918  HIS A O   1 
ATOM   671  C  CB  . HIS A 1 96  ? 28.200  39.000  2.548    1.00 24.23  ? 918  HIS A CB  1 
ATOM   672  C  CG  . HIS A 1 96  ? 29.189  37.877  2.561    1.00 28.00  ? 918  HIS A CG  1 
ATOM   673  N  ND1 . HIS A 1 96  ? 29.865  37.492  3.698    1.00 32.22  ? 918  HIS A ND1 1 
ATOM   674  C  CD2 . HIS A 1 96  ? 29.639  37.076  1.566    1.00 24.75  ? 918  HIS A CD2 1 
ATOM   675  C  CE1 . HIS A 1 96  ? 30.689  36.503  3.404    1.00 30.51  ? 918  HIS A CE1 1 
ATOM   676  N  NE2 . HIS A 1 96  ? 30.572  36.232  2.116    1.00 27.04  ? 918  HIS A NE2 1 
ATOM   677  N  N   . GLU A 1 97  ? 29.913  39.660  -0.300   1.00 27.79  ? 919  GLU A N   1 
ATOM   678  C  CA  . GLU A 1 97  ? 30.037  39.366  -1.731   1.00 28.73  ? 919  GLU A CA  1 
ATOM   679  C  C   . GLU A 1 97  ? 29.353  38.096  -2.237   1.00 28.25  ? 919  GLU A C   1 
ATOM   680  O  O   . GLU A 1 97  ? 29.038  37.989  -3.424   1.00 30.56  ? 919  GLU A O   1 
ATOM   681  C  CB  . GLU A 1 97  ? 31.511  39.345  -2.155   1.00 30.60  ? 919  GLU A CB  1 
ATOM   682  C  CG  . GLU A 1 97  ? 32.383  38.338  -1.422   1.00 33.72  ? 919  GLU A CG  1 
ATOM   683  C  CD  . GLU A 1 97  ? 33.732  38.145  -2.103   1.00 43.46  ? 919  GLU A CD  1 
ATOM   684  O  OE1 . GLU A 1 97  ? 34.066  38.957  -2.994   1.00 46.51  ? 919  GLU A OE1 1 
ATOM   685  O  OE2 . GLU A 1 97  ? 34.458  37.189  -1.749   1.00 44.29  ? 919  GLU A OE2 1 
ATOM   686  N  N   . MET A 1 98  ? 29.114  37.135  -1.354   1.00 24.09  ? 920  MET A N   1 
ATOM   687  C  CA  . MET A 1 98  ? 28.463  35.897  -1.766   1.00 23.80  ? 920  MET A CA  1 
ATOM   688  C  C   . MET A 1 98  ? 26.939  35.997  -1.853   1.00 22.37  ? 920  MET A C   1 
ATOM   689  O  O   . MET A 1 98  ? 26.273  35.013  -2.151   1.00 20.16  ? 920  MET A O   1 
ATOM   690  C  CB  . MET A 1 98  ? 28.849  34.755  -0.815   1.00 23.03  ? 920  MET A CB  1 
ATOM   691  C  CG  . MET A 1 98  ? 30.311  34.337  -0.914   1.00 26.79  ? 920  MET A CG  1 
ATOM   692  S  SD  . MET A 1 98  ? 30.801  33.894  -2.600   1.00 34.22  ? 920  MET A SD  1 
ATOM   693  C  CE  . MET A 1 98  ? 31.629  35.382  -3.114   1.00 37.39  ? 920  MET A CE  1 
ATOM   694  N  N   . SER A 1 99  ? 26.392  37.186  -1.615   1.00 25.09  ? 921  SER A N   1 
ATOM   695  C  CA  . SER A 1 99  ? 24.942  37.382  -1.659   1.00 24.75  ? 921  SER A CA  1 
ATOM   696  C  C   . SER A 1 99  ? 24.420  37.841  -3.020   1.00 23.17  ? 921  SER A C   1 
ATOM   697  O  O   . SER A 1 99  ? 23.213  37.906  -3.237   1.00 23.08  ? 921  SER A O   1 
ATOM   698  C  CB  . SER A 1 99  ? 24.530  38.426  -0.623   1.00 26.58  ? 921  SER A CB  1 
ATOM   699  O  OG  . SER A 1 99  ? 24.905  39.722  -1.063   1.00 27.00  ? 921  SER A OG  1 
ATOM   700  N  N   . LEU A 1 100 ? 25.330  38.174  -3.926   1.00 26.41  ? 922  LEU A N   1 
ATOM   701  C  CA  . LEU A 1 100 ? 24.957  38.661  -5.245   1.00 27.24  ? 922  LEU A CA  1 
ATOM   702  C  C   . LEU A 1 100 ? 23.871  37.873  -5.972   1.00 26.33  ? 922  LEU A C   1 
ATOM   703  O  O   . LEU A 1 100 ? 22.959  38.463  -6.544   1.00 25.89  ? 922  LEU A O   1 
ATOM   704  C  CB  . LEU A 1 100 ? 26.211  38.780  -6.116   1.00 28.08  ? 922  LEU A CB  1 
ATOM   705  C  CG  . LEU A 1 100 ? 27.124  39.909  -5.626   1.00 30.32  ? 922  LEU A CG  1 
ATOM   706  C  CD1 . LEU A 1 100 ? 28.417  39.955  -6.433   1.00 32.98  ? 922  LEU A CD1 1 
ATOM   707  C  CD2 . LEU A 1 100 ? 26.374  41.232  -5.744   1.00 36.56  ? 922  LEU A CD2 1 
ATOM   708  N  N   . ALA A 1 101 ? 23.952  36.548  -5.939   1.00 22.34  ? 923  ALA A N   1 
ATOM   709  C  CA  . ALA A 1 101 ? 22.955  35.726  -6.616   1.00 24.52  ? 923  ALA A CA  1 
ATOM   710  C  C   . ALA A 1 101 ? 21.657  35.572  -5.825   1.00 24.73  ? 923  ALA A C   1 
ATOM   711  O  O   . ALA A 1 101 ? 20.694  34.989  -6.326   1.00 26.05  ? 923  ALA A O   1 
ATOM   712  C  CB  . ALA A 1 101 ? 23.541  34.341  -6.910   1.00 25.76  ? 923  ALA A CB  1 
ATOM   713  N  N   . PHE A 1 102 ? 21.613  36.111  -4.608   1.00 24.23  ? 924  PHE A N   1 
ATOM   714  C  CA  . PHE A 1 102 ? 20.431  35.955  -3.766   1.00 22.70  ? 924  PHE A CA  1 
ATOM   715  C  C   . PHE A 1 102 ? 19.731  37.226  -3.311   1.00 23.59  ? 924  PHE A C   1 
ATOM   716  O  O   . PHE A 1 102 ? 18.834  37.165  -2.473   1.00 23.56  ? 924  PHE A O   1 
ATOM   717  C  CB  . PHE A 1 102 ? 20.812  35.128  -2.532   1.00 21.30  ? 924  PHE A CB  1 
ATOM   718  C  CG  . PHE A 1 102 ? 21.711  33.973  -2.845   1.00 19.21  ? 924  PHE A CG  1 
ATOM   719  C  CD1 . PHE A 1 102 ? 21.222  32.856  -3.517   1.00 18.95  ? 924  PHE A CD1 1 
ATOM   720  C  CD2 . PHE A 1 102 ? 23.059  34.017  -2.511   1.00 20.90  ? 924  PHE A CD2 1 
ATOM   721  C  CE1 . PHE A 1 102 ? 22.058  31.804  -3.859   1.00 20.39  ? 924  PHE A CE1 1 
ATOM   722  C  CE2 . PHE A 1 102 ? 23.910  32.960  -2.851   1.00 19.65  ? 924  PHE A CE2 1 
ATOM   723  C  CZ  . PHE A 1 102 ? 23.407  31.856  -3.525   1.00 21.49  ? 924  PHE A CZ  1 
ATOM   724  N  N   . GLN A 1 103 ? 20.116  38.371  -3.866   1.00 21.88  ? 925  GLN A N   1 
ATOM   725  C  CA  . GLN A 1 103 ? 19.513  39.637  -3.468   1.00 23.23  ? 925  GLN A CA  1 
ATOM   726  C  C   . GLN A 1 103 ? 18.163  39.911  -4.104   1.00 23.52  ? 925  GLN A C   1 
ATOM   727  O  O   . GLN A 1 103 ? 17.265  40.450  -3.470   1.00 23.66  ? 925  GLN A O   1 
ATOM   728  C  CB  . GLN A 1 103 ? 20.463  40.789  -3.789   1.00 23.81  ? 925  GLN A CB  1 
ATOM   729  C  CG  . GLN A 1 103 ? 21.765  40.712  -3.026   1.00 25.99  ? 925  GLN A CG  1 
ATOM   730  C  CD  . GLN A 1 103 ? 22.700  41.855  -3.353   1.00 22.63  ? 925  GLN A CD  1 
ATOM   731  O  OE1 . GLN A 1 103 ? 22.314  42.812  -4.018   1.00 24.97  ? 925  GLN A OE1 1 
ATOM   732  N  NE2 . GLN A 1 103 ? 23.933  41.762  -2.881   1.00 22.41  ? 925  GLN A NE2 1 
ATOM   733  N  N   . ASP A 1 104 ? 18.022  39.542  -5.365   1.00 22.74  ? 926  ASP A N   1 
ATOM   734  C  CA  . ASP A 1 104 ? 16.775  39.776  -6.066   1.00 24.88  ? 926  ASP A CA  1 
ATOM   735  C  C   . ASP A 1 104 ? 16.240  38.457  -6.573   1.00 25.20  ? 926  ASP A C   1 
ATOM   736  O  O   . ASP A 1 104 ? 16.981  37.484  -6.681   1.00 23.09  ? 926  ASP A O   1 
ATOM   737  C  CB  . ASP A 1 104 ? 17.016  40.745  -7.223   1.00 33.86  ? 926  ASP A CB  1 
ATOM   738  C  CG  . ASP A 1 104 ? 17.557  42.082  -6.745   1.00 37.67  ? 926  ASP A CG  1 
ATOM   739  O  OD1 . ASP A 1 104 ? 16.853  42.758  -5.965   1.00 35.34  ? 926  ASP A OD1 1 
ATOM   740  O  OD2 . ASP A 1 104 ? 18.687  42.448  -7.138   1.00 39.06  ? 926  ASP A OD2 1 
ATOM   741  N  N   . PRO A 1 105 ? 14.938  38.399  -6.873   1.00 30.82  ? 927  PRO A N   1 
ATOM   742  C  CA  . PRO A 1 105 ? 14.344  37.156  -7.368   1.00 30.33  ? 927  PRO A CA  1 
ATOM   743  C  C   . PRO A 1 105 ? 15.133  36.584  -8.537   1.00 29.66  ? 927  PRO A C   1 
ATOM   744  O  O   . PRO A 1 105 ? 15.700  37.330  -9.332   1.00 26.45  ? 927  PRO A O   1 
ATOM   745  C  CB  . PRO A 1 105 ? 12.939  37.587  -7.773   1.00 33.75  ? 927  PRO A CB  1 
ATOM   746  C  CG  . PRO A 1 105 ? 12.641  38.705  -6.804   1.00 34.60  ? 927  PRO A CG  1 
ATOM   747  C  CD  . PRO A 1 105 ? 13.933  39.475  -6.806   1.00 32.85  ? 927  PRO A CD  1 
ATOM   748  N  N   . VAL A 1 106 ? 15.183  35.259  -8.623   1.00 25.27  ? 928  VAL A N   1 
ATOM   749  C  CA  . VAL A 1 106 ? 15.881  34.590  -9.710   1.00 25.83  ? 928  VAL A CA  1 
ATOM   750  C  C   . VAL A 1 106 ? 15.181  34.985  -11.018  1.00 28.21  ? 928  VAL A C   1 
ATOM   751  O  O   . VAL A 1 106 ? 13.954  34.942  -11.112  1.00 28.63  ? 928  VAL A O   1 
ATOM   752  C  CB  . VAL A 1 106 ? 15.818  33.051  -9.551   1.00 33.64  ? 928  VAL A CB  1 
ATOM   753  C  CG1 . VAL A 1 106 ? 16.535  32.373  -10.705  1.00 33.06  ? 928  VAL A CG1 1 
ATOM   754  C  CG2 . VAL A 1 106 ? 16.442  32.637  -8.230   1.00 30.33  ? 928  VAL A CG2 1 
ATOM   755  N  N   . PRO A 1 107 ? 15.953  35.395  -12.033  1.00 29.00  ? 929  PRO A N   1 
ATOM   756  C  CA  . PRO A 1 107 ? 15.394  35.795  -13.333  1.00 30.47  ? 929  PRO A CA  1 
ATOM   757  C  C   . PRO A 1 107 ? 14.660  34.634  -14.004  1.00 30.75  ? 929  PRO A C   1 
ATOM   758  O  O   . PRO A 1 107 ? 14.881  33.479  -13.654  1.00 30.21  ? 929  PRO A O   1 
ATOM   759  C  CB  . PRO A 1 107 ? 16.631  36.204  -14.127  1.00 39.37  ? 929  PRO A CB  1 
ATOM   760  C  CG  . PRO A 1 107 ? 17.569  36.696  -13.067  1.00 41.71  ? 929  PRO A CG  1 
ATOM   761  C  CD  . PRO A 1 107 ? 17.400  35.665  -11.980  1.00 37.96  ? 929  PRO A CD  1 
ATOM   762  N  N   . LEU A 1 108 ? 13.797  34.943  -14.969  1.00 37.39  ? 930  LEU A N   1 
ATOM   763  C  CA  . LEU A 1 108 ? 13.054  33.913  -15.692  1.00 38.65  ? 930  LEU A CA  1 
ATOM   764  C  C   . LEU A 1 108 ? 13.934  33.228  -16.726  1.00 39.07  ? 930  LEU A C   1 
ATOM   765  O  O   . LEU A 1 108 ? 13.550  32.215  -17.303  1.00 39.28  ? 930  LEU A O   1 
ATOM   766  C  CB  . LEU A 1 108 ? 11.844  34.513  -16.407  1.00 41.02  ? 930  LEU A CB  1 
ATOM   767  C  CG  . LEU A 1 108 ? 10.614  34.864  -15.574  1.00 42.35  ? 930  LEU A CG  1 
ATOM   768  C  CD1 . LEU A 1 108 ? 10.994  35.838  -14.472  1.00 43.28  ? 930  LEU A CD1 1 
ATOM   769  C  CD2 . LEU A 1 108 ? 9.553   35.466  -16.483  1.00 39.20  ? 930  LEU A CD2 1 
ATOM   770  N  N   . THR A 1 109 ? 15.114  33.783  -16.970  1.00 38.24  ? 931  THR A N   1 
ATOM   771  C  CA  . THR A 1 109 ? 16.009  33.193  -17.950  1.00 37.98  ? 931  THR A CA  1 
ATOM   772  C  C   . THR A 1 109 ? 16.811  32.031  -17.383  1.00 37.18  ? 931  THR A C   1 
ATOM   773  O  O   . THR A 1 109 ? 17.553  31.380  -18.112  1.00 35.89  ? 931  THR A O   1 
ATOM   774  C  CB  . THR A 1 109 ? 16.987  34.232  -18.520  1.00 54.03  ? 931  THR A CB  1 
ATOM   775  O  OG1 . THR A 1 109 ? 17.641  34.914  -17.445  1.00 57.51  ? 931  THR A OG1 1 
ATOM   776  C  CG2 . THR A 1 109 ? 16.248  35.238  -19.390  1.00 57.25  ? 931  THR A CG2 1 
ATOM   777  N  N   . VAL A 1 110 ? 16.678  31.769  -16.086  1.00 31.74  ? 932  VAL A N   1 
ATOM   778  C  CA  . VAL A 1 110 ? 17.405  30.652  -15.486  1.00 31.27  ? 932  VAL A CA  1 
ATOM   779  C  C   . VAL A 1 110 ? 16.573  29.406  -15.753  1.00 31.77  ? 932  VAL A C   1 
ATOM   780  O  O   . VAL A 1 110 ? 15.516  29.207  -15.144  1.00 31.47  ? 932  VAL A O   1 
ATOM   781  C  CB  . VAL A 1 110 ? 17.602  30.838  -13.968  1.00 27.95  ? 932  VAL A CB  1 
ATOM   782  C  CG1 . VAL A 1 110 ? 18.257  29.594  -13.379  1.00 29.99  ? 932  VAL A CG1 1 
ATOM   783  C  CG2 . VAL A 1 110 ? 18.468  32.062  -13.705  1.00 28.46  ? 932  VAL A CG2 1 
ATOM   784  N  N   . PRO A 1 111 ? 17.054  28.543  -16.663  1.00 34.71  ? 933  PRO A N   1 
ATOM   785  C  CA  . PRO A 1 111 ? 16.402  27.299  -17.075  1.00 33.79  ? 933  PRO A CA  1 
ATOM   786  C  C   . PRO A 1 111 ? 15.651  26.515  -16.014  1.00 31.71  ? 933  PRO A C   1 
ATOM   787  O  O   . PRO A 1 111 ? 16.261  25.963  -15.109  1.00 32.32  ? 933  PRO A O   1 
ATOM   788  C  CB  . PRO A 1 111 ? 17.552  26.492  -17.671  1.00 47.09  ? 933  PRO A CB  1 
ATOM   789  C  CG  . PRO A 1 111 ? 18.412  27.540  -18.263  1.00 48.93  ? 933  PRO A CG  1 
ATOM   790  C  CD  . PRO A 1 111 ? 18.438  28.586  -17.172  1.00 47.55  ? 933  PRO A CD  1 
ATOM   791  N  N   . ASP A 1 112 ? 14.327  26.472  -16.151  1.00 29.90  ? 934  ASP A N   1 
ATOM   792  C  CA  . ASP A 1 112 ? 13.432  25.718  -15.266  1.00 28.70  ? 934  ASP A CA  1 
ATOM   793  C  C   . ASP A 1 112 ? 13.482  26.018  -13.772  1.00 27.96  ? 934  ASP A C   1 
ATOM   794  O  O   . ASP A 1 112 ? 13.035  25.197  -12.969  1.00 28.03  ? 934  ASP A O   1 
ATOM   795  C  CB  . ASP A 1 112 ? 13.671  24.215  -15.448  1.00 34.75  ? 934  ASP A CB  1 
ATOM   796  C  CG  . ASP A 1 112 ? 13.481  23.754  -16.884  1.00 37.33  ? 934  ASP A CG  1 
ATOM   797  O  OD1 . ASP A 1 112 ? 12.423  24.048  -17.473  1.00 38.20  ? 934  ASP A OD1 1 
ATOM   798  O  OD2 . ASP A 1 112 ? 14.389  23.086  -17.417  1.00 47.82  ? 934  ASP A OD2 1 
ATOM   799  N  N   . TYR A 1 113 ? 14.007  27.175  -13.384  1.00 29.09  ? 935  TYR A N   1 
ATOM   800  C  CA  . TYR A 1 113 ? 14.090  27.489  -11.960  1.00 27.91  ? 935  TYR A CA  1 
ATOM   801  C  C   . TYR A 1 113 ? 12.743  27.433  -11.234  1.00 26.81  ? 935  TYR A C   1 
ATOM   802  O  O   . TYR A 1 113 ? 12.632  26.819  -10.173  1.00 28.12  ? 935  TYR A O   1 
ATOM   803  C  CB  . TYR A 1 113 ? 14.710  28.872  -11.739  1.00 24.86  ? 935  TYR A CB  1 
ATOM   804  C  CG  . TYR A 1 113 ? 15.011  29.142  -10.274  1.00 23.49  ? 935  TYR A CG  1 
ATOM   805  C  CD1 . TYR A 1 113 ? 16.171  28.648  -9.680   1.00 26.24  ? 935  TYR A CD1 1 
ATOM   806  C  CD2 . TYR A 1 113 ? 14.111  29.845  -9.475   1.00 24.68  ? 935  TYR A CD2 1 
ATOM   807  C  CE1 . TYR A 1 113 ? 16.430  28.845  -8.320   1.00 28.58  ? 935  TYR A CE1 1 
ATOM   808  C  CE2 . TYR A 1 113 ? 14.355  30.049  -8.115   1.00 27.10  ? 935  TYR A CE2 1 
ATOM   809  C  CZ  . TYR A 1 113 ? 15.514  29.546  -7.543   1.00 28.43  ? 935  TYR A CZ  1 
ATOM   810  O  OH  . TYR A 1 113 ? 15.748  29.718  -6.196   1.00 27.27  ? 935  TYR A OH  1 
ATOM   811  N  N   . TYR A 1 114 ? 11.720  28.068  -11.797  1.00 21.32  ? 936  TYR A N   1 
ATOM   812  C  CA  . TYR A 1 114 ? 10.408  28.082  -11.155  1.00 21.35  ? 936  TYR A CA  1 
ATOM   813  C  C   . TYR A 1 114 ? 9.560   26.825  -11.342  1.00 20.90  ? 936  TYR A C   1 
ATOM   814  O  O   . TYR A 1 114 ? 8.494   26.695  -10.731  1.00 17.31  ? 936  TYR A O   1 
ATOM   815  C  CB  . TYR A 1 114 ? 9.639   29.331  -11.588  1.00 24.65  ? 936  TYR A CB  1 
ATOM   816  C  CG  . TYR A 1 114 ? 10.271  30.586  -11.026  1.00 27.32  ? 936  TYR A CG  1 
ATOM   817  C  CD1 . TYR A 1 114 ? 10.055  30.963  -9.700   1.00 27.68  ? 936  TYR A CD1 1 
ATOM   818  C  CD2 . TYR A 1 114 ? 11.138  31.363  -11.800  1.00 25.28  ? 936  TYR A CD2 1 
ATOM   819  C  CE1 . TYR A 1 114 ? 10.686  32.081  -9.156   1.00 26.57  ? 936  TYR A CE1 1 
ATOM   820  C  CE2 . TYR A 1 114 ? 11.772  32.481  -11.267  1.00 25.81  ? 936  TYR A CE2 1 
ATOM   821  C  CZ  . TYR A 1 114 ? 11.541  32.833  -9.946   1.00 27.32  ? 936  TYR A CZ  1 
ATOM   822  O  OH  . TYR A 1 114 ? 12.156  33.940  -9.410   1.00 28.40  ? 936  TYR A OH  1 
ATOM   823  N  N   . LYS A 1 115 ? 10.024  25.903  -12.178  1.00 28.34  ? 937  LYS A N   1 
ATOM   824  C  CA  . LYS A 1 115 ? 9.312   24.644  -12.370  1.00 29.65  ? 937  LYS A CA  1 
ATOM   825  C  C   . LYS A 1 115 ? 9.813   23.705  -11.277  1.00 31.02  ? 937  LYS A C   1 
ATOM   826  O  O   . LYS A 1 115 ? 9.094   22.816  -10.816  1.00 30.94  ? 937  LYS A O   1 
ATOM   827  C  CB  . LYS A 1 115 ? 9.617   24.034  -13.745  1.00 26.31  ? 937  LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 115 ? 8.968   24.761  -14.906  1.00 27.97  ? 937  LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 115 ? 9.157   24.016  -16.220  1.00 28.81  ? 937  LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 115 ? 8.389   24.718  -17.351  1.00 31.65  ? 937  LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 115 ? 8.380   23.946  -18.636  1.00 34.49  ? 937  LYS A NZ  1 
ATOM   832  N  N   . ILE A 1 116 ? 11.053  23.934  -10.856  1.00 32.11  ? 938  ILE A N   1 
ATOM   833  C  CA  . ILE A 1 116 ? 11.699  23.115  -9.835   1.00 32.26  ? 938  ILE A CA  1 
ATOM   834  C  C   . ILE A 1 116 ? 11.498  23.641  -8.415   1.00 32.24  ? 938  ILE A C   1 
ATOM   835  O  O   . ILE A 1 116 ? 10.960  22.941  -7.559   1.00 31.55  ? 938  ILE A O   1 
ATOM   836  C  CB  . ILE A 1 116 ? 13.212  23.007  -10.120  1.00 28.32  ? 938  ILE A CB  1 
ATOM   837  C  CG1 . ILE A 1 116 ? 13.430  22.282  -11.452  1.00 28.70  ? 938  ILE A CG1 1 
ATOM   838  C  CG2 . ILE A 1 116 ? 13.918  22.292  -8.975   1.00 27.17  ? 938  ILE A CG2 1 
ATOM   839  C  CD1 . ILE A 1 116 ? 14.882  22.212  -11.882  1.00 35.00  ? 938  ILE A CD1 1 
ATOM   840  N  N   . ILE A 1 117 ? 11.931  24.875  -8.175   1.00 31.03  ? 939  ILE A N   1 
ATOM   841  C  CA  . ILE A 1 117 ? 11.814  25.496  -6.860   1.00 30.91  ? 939  ILE A CA  1 
ATOM   842  C  C   . ILE A 1 117 ? 10.381  25.932  -6.589   1.00 32.52  ? 939  ILE A C   1 
ATOM   843  O  O   . ILE A 1 117 ? 9.887   26.885  -7.199   1.00 32.73  ? 939  ILE A O   1 
ATOM   844  C  CB  . ILE A 1 117 ? 12.739  26.729  -6.740   1.00 23.24  ? 939  ILE A CB  1 
ATOM   845  C  CG1 . ILE A 1 117 ? 14.189  26.321  -7.010   1.00 22.99  ? 939  ILE A CG1 1 
ATOM   846  C  CG2 . ILE A 1 117 ? 12.605  27.347  -5.356   1.00 23.27  ? 939  ILE A CG2 1 
ATOM   847  C  CD1 . ILE A 1 117 ? 14.706  25.239  -6.076   1.00 27.88  ? 939  ILE A CD1 1 
ATOM   848  N  N   . LYS A 1 118 ? 9.727   25.241  -5.658   1.00 33.23  ? 940  LYS A N   1 
ATOM   849  C  CA  . LYS A 1 118 ? 8.340   25.530  -5.314   1.00 35.11  ? 940  LYS A CA  1 
ATOM   850  C  C   . LYS A 1 118 ? 8.089   26.825  -4.540   1.00 32.99  ? 940  LYS A C   1 
ATOM   851  O  O   . LYS A 1 118 ? 7.110   27.526  -4.802   1.00 32.70  ? 940  LYS A O   1 
ATOM   852  C  CB  . LYS A 1 118 ? 7.740   24.358  -4.529   1.00 50.94  ? 940  LYS A CB  1 
ATOM   853  C  CG  . LYS A 1 118 ? 6.324   24.629  -4.031   1.00 55.17  ? 940  LYS A CG  1 
ATOM   854  C  CD  . LYS A 1 118 ? 5.729   23.441  -3.290   1.00 62.68  ? 940  LYS A CD  1 
ATOM   855  C  CE  . LYS A 1 118 ? 4.338   23.774  -2.764   1.00 64.74  ? 940  LYS A CE  1 
ATOM   856  N  NZ  . LYS A 1 118 ? 3.413   24.221  -3.849   1.00 64.05  ? 940  LYS A NZ  1 
ATOM   857  N  N   . ASN A 1 119 ? 8.957   27.133  -3.582   1.00 24.01  ? 941  ASN A N   1 
ATOM   858  C  CA  . ASN A 1 119 ? 8.808   28.338  -2.765   1.00 24.27  ? 941  ASN A CA  1 
ATOM   859  C  C   . ASN A 1 119 ? 10.032  29.236  -2.861   1.00 23.64  ? 941  ASN A C   1 
ATOM   860  O  O   . ASN A 1 119 ? 10.891  29.229  -1.982   1.00 23.02  ? 941  ASN A O   1 
ATOM   861  C  CB  . ASN A 1 119 ? 8.572   27.955  -1.305   1.00 34.75  ? 941  ASN A CB  1 
ATOM   862  C  CG  . ASN A 1 119 ? 7.357   27.075  -1.130   1.00 38.72  ? 941  ASN A CG  1 
ATOM   863  O  OD1 . ASN A 1 119 ? 7.472   25.883  -0.844   1.00 45.42  ? 941  ASN A OD1 1 
ATOM   864  N  ND2 . ASN A 1 119 ? 6.180   27.657  -1.314   1.00 40.24  ? 941  ASN A ND2 1 
ATOM   865  N  N   . PRO A 1 120 ? 10.113  30.038  -3.930   1.00 27.14  ? 942  PRO A N   1 
ATOM   866  C  CA  . PRO A 1 120 ? 11.232  30.957  -4.167   1.00 26.07  ? 942  PRO A CA  1 
ATOM   867  C  C   . PRO A 1 120 ? 11.394  31.945  -3.019   1.00 25.09  ? 942  PRO A C   1 
ATOM   868  O  O   . PRO A 1 120 ? 10.431  32.260  -2.322   1.00 24.14  ? 942  PRO A O   1 
ATOM   869  C  CB  . PRO A 1 120 ? 10.833  31.663  -5.465   1.00 23.06  ? 942  PRO A CB  1 
ATOM   870  C  CG  . PRO A 1 120 ? 9.904   30.688  -6.130   1.00 26.53  ? 942  PRO A CG  1 
ATOM   871  C  CD  . PRO A 1 120 ? 9.093   30.174  -4.984   1.00 25.76  ? 942  PRO A CD  1 
ATOM   872  N  N   . MET A 1 121 ? 12.613  32.435  -2.832   1.00 22.56  ? 943  MET A N   1 
ATOM   873  C  CA  . MET A 1 121 ? 12.879  33.406  -1.781   1.00 23.06  ? 943  MET A CA  1 
ATOM   874  C  C   . MET A 1 121 ? 14.193  34.115  -2.080   1.00 22.08  ? 943  MET A C   1 
ATOM   875  O  O   . MET A 1 121 ? 15.109  33.530  -2.658   1.00 21.39  ? 943  MET A O   1 
ATOM   876  C  CB  . MET A 1 121 ? 12.952  32.713  -0.417   1.00 20.49  ? 943  MET A CB  1 
ATOM   877  C  CG  . MET A 1 121 ? 13.079  33.676  0.777    1.00 23.88  ? 943  MET A CG  1 
ATOM   878  S  SD  . MET A 1 121 ? 11.787  34.949  0.813    1.00 28.60  ? 943  MET A SD  1 
ATOM   879  C  CE  . MET A 1 121 ? 10.307  33.922  1.164    1.00 25.40  ? 943  MET A CE  1 
ATOM   880  N  N   . ASP A 1 122 ? 14.271  35.379  -1.686   1.00 20.54  ? 944  ASP A N   1 
ATOM   881  C  CA  . ASP A 1 122 ? 15.461  36.192  -1.903   1.00 21.42  ? 944  ASP A CA  1 
ATOM   882  C  C   . ASP A 1 122 ? 15.493  37.303  -0.861   1.00 20.21  ? 944  ASP A C   1 
ATOM   883  O  O   . ASP A 1 122 ? 14.481  37.580  -0.211   1.00 21.49  ? 944  ASP A O   1 
ATOM   884  C  CB  . ASP A 1 122 ? 15.437  36.792  -3.307   1.00 38.07  ? 944  ASP A CB  1 
ATOM   885  C  CG  . ASP A 1 122 ? 14.106  37.415  -3.638   1.00 43.07  ? 944  ASP A CG  1 
ATOM   886  O  OD1 . ASP A 1 122 ? 13.173  36.669  -4.001   1.00 51.77  ? 944  ASP A OD1 1 
ATOM   887  O  OD2 . ASP A 1 122 ? 13.988  38.650  -3.518   1.00 48.09  ? 944  ASP A OD2 1 
ATOM   888  N  N   . LEU A 1 123 ? 16.645  37.948  -0.700   1.00 19.90  ? 945  LEU A N   1 
ATOM   889  C  CA  . LEU A 1 123 ? 16.783  39.010  0.298    1.00 18.41  ? 945  LEU A CA  1 
ATOM   890  C  C   . LEU A 1 123 ? 15.800  40.165  0.145    1.00 20.93  ? 945  LEU A C   1 
ATOM   891  O  O   . LEU A 1 123 ? 15.289  40.681  1.142    1.00 19.97  ? 945  LEU A O   1 
ATOM   892  C  CB  . LEU A 1 123 ? 18.211  39.557  0.292    1.00 28.10  ? 945  LEU A CB  1 
ATOM   893  C  CG  . LEU A 1 123 ? 19.293  38.546  0.688    1.00 24.21  ? 945  LEU A CG  1 
ATOM   894  C  CD1 . LEU A 1 123 ? 20.656  39.214  0.613    1.00 23.28  ? 945  LEU A CD1 1 
ATOM   895  C  CD2 . LEU A 1 123 ? 19.033  38.014  2.091    1.00 21.74  ? 945  LEU A CD2 1 
ATOM   896  N  N   . SER A 1 124 ? 15.530  40.576  -1.092   1.00 21.92  ? 946  SER A N   1 
ATOM   897  C  CA  . SER A 1 124 ? 14.614  41.691  -1.323   1.00 23.90  ? 946  SER A CA  1 
ATOM   898  C  C   . SER A 1 124 ? 13.201  41.360  -0.858   1.00 23.41  ? 946  SER A C   1 
ATOM   899  O  O   . SER A 1 124 ? 12.459  42.240  -0.422   1.00 23.44  ? 946  SER A O   1 
ATOM   900  C  CB  . SER A 1 124 ? 14.598  42.085  -2.804   1.00 34.37  ? 946  SER A CB  1 
ATOM   901  O  OG  . SER A 1 124 ? 13.950  41.100  -3.592   1.00 34.78  ? 946  SER A OG  1 
ATOM   902  N  N   . THR A 1 125 ? 12.824  40.091  -0.947   1.00 24.64  ? 947  THR A N   1 
ATOM   903  C  CA  . THR A 1 125 ? 11.497  39.684  -0.518   1.00 24.58  ? 947  THR A CA  1 
ATOM   904  C  C   . THR A 1 125 ? 11.413  39.745  0.999    1.00 24.79  ? 947  THR A C   1 
ATOM   905  O  O   . THR A 1 125 ? 10.409  40.188  1.554    1.00 22.50  ? 947  THR A O   1 
ATOM   906  C  CB  . THR A 1 125 ? 11.162  38.258  -1.007   1.00 27.28  ? 947  THR A CB  1 
ATOM   907  O  OG1 . THR A 1 125 ? 11.152  38.248  -2.437   1.00 26.90  ? 947  THR A OG1 1 
ATOM   908  C  CG2 . THR A 1 125 ? 9.802   37.818  -0.498   1.00 27.81  ? 947  THR A CG2 1 
ATOM   909  N  N   . ILE A 1 126 ? 12.473  39.307  1.671    1.00 26.69  ? 948  ILE A N   1 
ATOM   910  C  CA  . ILE A 1 126 ? 12.498  39.346  3.125    1.00 26.93  ? 948  ILE A CA  1 
ATOM   911  C  C   . ILE A 1 126 ? 12.497  40.816  3.541    1.00 26.53  ? 948  ILE A C   1 
ATOM   912  O  O   . ILE A 1 126 ? 11.762  41.218  4.444    1.00 26.81  ? 948  ILE A O   1 
ATOM   913  C  CB  . ILE A 1 126 ? 13.758  38.650  3.680    1.00 22.36  ? 948  ILE A CB  1 
ATOM   914  C  CG1 . ILE A 1 126 ? 13.783  37.191  3.215    1.00 23.69  ? 948  ILE A CG1 1 
ATOM   915  C  CG2 . ILE A 1 126 ? 13.780  38.745  5.202    1.00 23.54  ? 948  ILE A CG2 1 
ATOM   916  C  CD1 . ILE A 1 126 ? 14.961  36.381  3.741    1.00 22.15  ? 948  ILE A CD1 1 
ATOM   917  N  N   . LYS A 1 127 ? 13.308  41.618  2.859    1.00 25.85  ? 949  LYS A N   1 
ATOM   918  C  CA  . LYS A 1 127 ? 13.397  43.045  3.151    1.00 26.66  ? 949  LYS A CA  1 
ATOM   919  C  C   . LYS A 1 127 ? 12.028  43.703  3.069    1.00 27.62  ? 949  LYS A C   1 
ATOM   920  O  O   . LYS A 1 127 ? 11.664  44.504  3.931    1.00 27.17  ? 949  LYS A O   1 
ATOM   921  C  CB  . LYS A 1 127 ? 14.350  43.739  2.172    1.00 26.17  ? 949  LYS A CB  1 
ATOM   922  C  CG  . LYS A 1 127 ? 14.454  45.246  2.382    1.00 26.10  ? 949  LYS A CG  1 
ATOM   923  C  CD  . LYS A 1 127 ? 15.478  45.867  1.443    1.00 26.53  ? 949  LYS A CD  1 
ATOM   924  C  CE  . LYS A 1 127 ? 15.564  47.370  1.645    1.00 23.31  ? 949  LYS A CE  1 
ATOM   925  N  NZ  . LYS A 1 127 ? 16.603  47.992  0.781    1.00 23.88  ? 949  LYS A NZ  1 
ATOM   926  N  N   . LYS A 1 128 ? 11.274  43.362  2.030    1.00 26.03  ? 950  LYS A N   1 
ATOM   927  C  CA  . LYS A 1 128 ? 9.938   43.922  1.827    1.00 27.90  ? 950  LYS A CA  1 
ATOM   928  C  C   . LYS A 1 128 ? 8.929   43.426  2.861    1.00 26.98  ? 950  LYS A C   1 
ATOM   929  O  O   . LYS A 1 128 ? 8.120   44.204  3.373    1.00 27.72  ? 950  LYS A O   1 
ATOM   930  C  CB  . LYS A 1 128 ? 9.429   43.584  0.419    1.00 39.18  ? 950  LYS A CB  1 
ATOM   931  C  CG  . LYS A 1 128 ? 8.036   44.124  0.127    1.00 43.68  ? 950  LYS A CG  1 
ATOM   932  C  CD  . LYS A 1 128 ? 7.567   43.767  -1.278   1.00 51.08  ? 950  LYS A CD  1 
ATOM   933  C  CE  . LYS A 1 128 ? 6.186   44.359  -1.562   1.00 54.94  ? 950  LYS A CE  1 
ATOM   934  N  NZ  . LYS A 1 128 ? 5.675   44.022  -2.923   1.00 58.80  ? 950  LYS A NZ  1 
ATOM   935  N  N   . ARG A 1 129 ? 8.971   42.130  3.160    1.00 27.61  ? 951  ARG A N   1 
ATOM   936  C  CA  . ARG A 1 129 ? 8.055   41.548  4.132    1.00 28.16  ? 951  ARG A CA  1 
ATOM   937  C  C   . ARG A 1 129 ? 8.259   42.127  5.525    1.00 28.37  ? 951  ARG A C   1 
ATOM   938  O  O   . ARG A 1 129 ? 7.325   42.204  6.326    1.00 27.69  ? 951  ARG A O   1 
ATOM   939  C  CB  . ARG A 1 129 ? 8.228   40.031  4.183    1.00 26.06  ? 951  ARG A CB  1 
ATOM   940  C  CG  . ARG A 1 129 ? 7.744   39.320  2.934    1.00 29.04  ? 951  ARG A CG  1 
ATOM   941  C  CD  . ARG A 1 129 ? 7.726   37.826  3.146    1.00 32.23  ? 951  ARG A CD  1 
ATOM   942  N  NE  . ARG A 1 129 ? 7.140   37.125  2.010    1.00 28.70  ? 951  ARG A NE  1 
ATOM   943  C  CZ  . ARG A 1 129 ? 7.027   35.804  1.929    1.00 35.63  ? 951  ARG A CZ  1 
ATOM   944  N  NH1 . ARG A 1 129 ? 7.465   35.042  2.923    1.00 30.90  ? 951  ARG A NH1 1 
ATOM   945  N  NH2 . ARG A 1 129 ? 6.473   35.245  0.859    1.00 32.93  ? 951  ARG A NH2 1 
ATOM   946  N  N   . LEU A 1 130 ? 9.488   42.536  5.812    1.00 29.16  ? 952  LEU A N   1 
ATOM   947  C  CA  . LEU A 1 130 ? 9.811   43.107  7.112    1.00 30.37  ? 952  LEU A CA  1 
ATOM   948  C  C   . LEU A 1 130 ? 9.273   44.529  7.223    1.00 31.19  ? 952  LEU A C   1 
ATOM   949  O  O   . LEU A 1 130 ? 8.834   44.965  8.285    1.00 34.99  ? 952  LEU A O   1 
ATOM   950  C  CB  . LEU A 1 130 ? 11.328  43.111  7.297    1.00 25.69  ? 952  LEU A CB  1 
ATOM   951  C  CG  . LEU A 1 130 ? 11.883  43.541  8.646    1.00 25.90  ? 952  LEU A CG  1 
ATOM   952  C  CD1 . LEU A 1 130 ? 11.370  42.596  9.740    1.00 22.08  ? 952  LEU A CD1 1 
ATOM   953  C  CD2 . LEU A 1 130 ? 13.420  43.530  8.571    1.00 21.86  ? 952  LEU A CD2 1 
ATOM   954  N  N   . GLN A 1 131 ? 9.299   45.227  6.097    1.00 46.75  ? 953  GLN A N   1 
ATOM   955  C  CA  . GLN A 1 131 ? 8.877   46.617  5.986    1.00 46.75  ? 953  GLN A CA  1 
ATOM   956  C  C   . GLN A 1 131 ? 7.385   46.947  6.119    1.00 46.75  ? 953  GLN A C   1 
ATOM   957  O  O   . GLN A 1 131 ? 7.026   48.056  6.515    1.00 46.75  ? 953  GLN A O   1 
ATOM   958  C  CB  . GLN A 1 131 ? 9.387   47.156  4.654    1.00 104.72 ? 953  GLN A CB  1 
ATOM   959  C  CG  . GLN A 1 131 ? 9.174   48.627  4.450    1.00 104.72 ? 953  GLN A CG  1 
ATOM   960  C  CD  . GLN A 1 131 ? 10.412  49.290  3.901    1.00 104.72 ? 953  GLN A CD  1 
ATOM   961  O  OE1 . GLN A 1 131 ? 10.883  48.950  2.816    1.00 104.72 ? 953  GLN A OE1 1 
ATOM   962  N  NE2 . GLN A 1 131 ? 10.957  50.239  4.655    1.00 104.72 ? 953  GLN A NE2 1 
ATOM   963  N  N   . GLU A 1 132 ? 6.518   46.000  5.792    1.00 62.31  ? 954  GLU A N   1 
ATOM   964  C  CA  . GLU A 1 132 ? 5.078   46.240  5.846    1.00 62.31  ? 954  GLU A CA  1 
ATOM   965  C  C   . GLU A 1 132 ? 4.485   46.412  7.243    1.00 62.31  ? 954  GLU A C   1 
ATOM   966  O  O   . GLU A 1 132 ? 4.813   45.663  8.164    1.00 62.31  ? 954  GLU A O   1 
ATOM   967  C  CB  . GLU A 1 132 ? 4.368   45.116  5.101    1.00 70.91  ? 954  GLU A CB  1 
ATOM   968  C  CG  . GLU A 1 132 ? 4.960   44.913  3.719    1.00 70.91  ? 954  GLU A CG  1 
ATOM   969  C  CD  . GLU A 1 132 ? 4.583   43.589  3.109    1.00 70.91  ? 954  GLU A CD  1 
ATOM   970  O  OE1 . GLU A 1 132 ? 4.245   42.663  3.876    1.00 70.91  ? 954  GLU A OE1 1 
ATOM   971  O  OE2 . GLU A 1 132 ? 4.643   43.470  1.866    1.00 70.91  ? 954  GLU A OE2 1 
ATOM   972  N  N   . ASP A 1 133 ? 3.611   47.412  7.376    1.00 81.64  ? 955  ASP A N   1 
ATOM   973  C  CA  . ASP A 1 133 ? 2.940   47.736  8.638    1.00 81.64  ? 955  ASP A CA  1 
ATOM   974  C  C   . ASP A 1 133 ? 2.380   46.488  9.308    1.00 81.64  ? 955  ASP A C   1 
ATOM   975  O  O   . ASP A 1 133 ? 2.512   46.306  10.520   1.00 81.64  ? 955  ASP A O   1 
ATOM   976  C  CB  . ASP A 1 133 ? 1.810   48.736  8.392    1.00 118.94 ? 955  ASP A CB  1 
ATOM   977  C  CG  . ASP A 1 133 ? 2.318   50.149  8.179    1.00 118.94 ? 955  ASP A CG  1 
ATOM   978  O  OD1 . ASP A 1 133 ? 2.016   51.023  9.022    1.00 118.94 ? 955  ASP A OD1 1 
ATOM   979  O  OD2 . ASP A 1 133 ? 3.027   50.385  7.178    1.00 118.94 ? 955  ASP A OD2 1 
ATOM   980  N  N   . TYR A 1 134 ? 1.726   45.647  8.517    1.00 82.04  ? 956  TYR A N   1 
ATOM   981  C  CA  . TYR A 1 134 ? 1.197   44.396  9.026    1.00 82.04  ? 956  TYR A CA  1 
ATOM   982  C  C   . TYR A 1 134 ? 2.076   43.359  8.346    1.00 82.04  ? 956  TYR A C   1 
ATOM   983  O  O   . TYR A 1 134 ? 1.823   42.947  7.213    1.00 82.04  ? 956  TYR A O   1 
ATOM   984  C  CB  . TYR A 1 134 ? -0.273  44.212  8.634    1.00 106.25 ? 956  TYR A CB  1 
ATOM   985  C  CG  . TYR A 1 134 ? -1.179  45.340  9.085    1.00 106.25 ? 956  TYR A CG  1 
ATOM   986  C  CD1 . TYR A 1 134 ? -1.555  46.348  8.201    1.00 106.25 ? 956  TYR A CD1 1 
ATOM   987  C  CD2 . TYR A 1 134 ? -1.653  45.404  10.397   1.00 106.25 ? 956  TYR A CD2 1 
ATOM   988  C  CE1 . TYR A 1 134 ? -2.380  47.393  8.607    1.00 106.25 ? 956  TYR A CE1 1 
ATOM   989  C  CE2 . TYR A 1 134 ? -2.481  46.446  10.815   1.00 106.25 ? 956  TYR A CE2 1 
ATOM   990  C  CZ  . TYR A 1 134 ? -2.839  47.437  9.913    1.00 106.25 ? 956  TYR A CZ  1 
ATOM   991  O  OH  . TYR A 1 134 ? -3.652  48.473  10.311   1.00 106.25 ? 956  TYR A OH  1 
ATOM   992  N  N   . SER A 1 135 ? 3.130   42.970  9.050    1.00 65.21  ? 957  SER A N   1 
ATOM   993  C  CA  . SER A 1 135 ? 4.082   42.008  8.541    1.00 65.21  ? 957  SER A CA  1 
ATOM   994  C  C   . SER A 1 135 ? 3.598   40.569  8.551    1.00 65.21  ? 957  SER A C   1 
ATOM   995  O  O   . SER A 1 135 ? 2.596   40.222  9.177    1.00 65.21  ? 957  SER A O   1 
ATOM   996  C  CB  . SER A 1 135 ? 5.396   42.116  9.328    1.00 52.97  ? 957  SER A CB  1 
ATOM   997  O  OG  . SER A 1 135 ? 6.379   41.240  8.798    1.00 52.97  ? 957  SER A OG  1 
ATOM   998  N  N   . MET A 1 136 ? 4.351   39.750  7.832    1.00 58.05  ? 958  MET A N   1 
ATOM   999  C  CA  . MET A 1 136 ? 4.118   38.325  7.689    1.00 58.05  ? 958  MET A CA  1 
ATOM   1000 C  C   . MET A 1 136 ? 4.852   37.651  8.844    1.00 58.05  ? 958  MET A C   1 
ATOM   1001 O  O   . MET A 1 136 ? 4.604   36.495  9.182    1.00 58.05  ? 958  MET A O   1 
ATOM   1002 C  CB  . MET A 1 136 ? 4.707   37.888  6.345    1.00 76.72  ? 958  MET A CB  1 
ATOM   1003 C  CG  . MET A 1 136 ? 4.276   36.538  5.833    1.00 76.72  ? 958  MET A CG  1 
ATOM   1004 S  SD  . MET A 1 136 ? 4.479   36.496  4.040    1.00 76.72  ? 958  MET A SD  1 
ATOM   1005 C  CE  . MET A 1 136 ? 3.301   37.771  3.552    1.00 76.72  ? 958  MET A CE  1 
ATOM   1006 N  N   . TYR A 1 137 ? 5.758   38.411  9.446    1.00 35.17  ? 959  TYR A N   1 
ATOM   1007 C  CA  . TYR A 1 137 ? 6.574   37.932  10.551   1.00 32.46  ? 959  TYR A CA  1 
ATOM   1008 C  C   . TYR A 1 137 ? 6.007   38.317  11.911   1.00 32.48  ? 959  TYR A C   1 
ATOM   1009 O  O   . TYR A 1 137 ? 5.845   39.500  12.216   1.00 32.16  ? 959  TYR A O   1 
ATOM   1010 C  CB  . TYR A 1 137 ? 7.991   38.487  10.415   1.00 30.60  ? 959  TYR A CB  1 
ATOM   1011 C  CG  . TYR A 1 137 ? 8.611   38.230  9.063    1.00 29.49  ? 959  TYR A CG  1 
ATOM   1012 C  CD1 . TYR A 1 137 ? 8.540   36.970  8.475    1.00 26.91  ? 959  TYR A CD1 1 
ATOM   1013 C  CD2 . TYR A 1 137 ? 9.305   39.234  8.386    1.00 27.36  ? 959  TYR A CD2 1 
ATOM   1014 C  CE1 . TYR A 1 137 ? 9.146   36.711  7.251    1.00 24.06  ? 959  TYR A CE1 1 
ATOM   1015 C  CE2 . TYR A 1 137 ? 9.919   38.981  7.156    1.00 24.38  ? 959  TYR A CE2 1 
ATOM   1016 C  CZ  . TYR A 1 137 ? 9.835   37.716  6.599    1.00 23.52  ? 959  TYR A CZ  1 
ATOM   1017 O  OH  . TYR A 1 137 ? 10.448  37.440  5.395    1.00 24.19  ? 959  TYR A OH  1 
ATOM   1018 N  N   . SER A 1 138 ? 5.706   37.317  12.731   1.00 29.52  ? 960  SER A N   1 
ATOM   1019 C  CA  . SER A 1 138 ? 5.173   37.588  14.061   1.00 31.35  ? 960  SER A CA  1 
ATOM   1020 C  C   . SER A 1 138 ? 6.279   37.390  15.094   1.00 30.12  ? 960  SER A C   1 
ATOM   1021 O  O   . SER A 1 138 ? 6.255   38.005  16.157   1.00 32.25  ? 960  SER A O   1 
ATOM   1022 C  CB  . SER A 1 138 ? 3.986   36.666  14.367   1.00 36.21  ? 960  SER A CB  1 
ATOM   1023 O  OG  . SER A 1 138 ? 4.379   35.304  14.397   1.00 39.48  ? 960  SER A OG  1 
ATOM   1024 N  N   . LYS A 1 139 ? 7.242   36.529  14.770   1.00 32.22  ? 961  LYS A N   1 
ATOM   1025 C  CA  . LYS A 1 139 ? 8.372   36.260  15.654   1.00 32.28  ? 961  LYS A CA  1 
ATOM   1026 C  C   . LYS A 1 139 ? 9.643   35.928  14.860   1.00 31.92  ? 961  LYS A C   1 
ATOM   1027 O  O   . LYS A 1 139 ? 9.576   35.567  13.685   1.00 30.49  ? 961  LYS A O   1 
ATOM   1028 C  CB  . LYS A 1 139 ? 8.032   35.127  16.617   1.00 39.47  ? 961  LYS A CB  1 
ATOM   1029 C  CG  . LYS A 1 139 ? 7.745   33.809  15.960   1.00 40.25  ? 961  LYS A CG  1 
ATOM   1030 C  CD  . LYS A 1 139 ? 7.153   32.860  16.975   1.00 46.35  ? 961  LYS A CD  1 
ATOM   1031 C  CE  . LYS A 1 139 ? 7.187   31.440  16.469   1.00 46.72  ? 961  LYS A CE  1 
ATOM   1032 N  NZ  . LYS A 1 139 ? 6.453   31.311  15.184   1.00 47.03  ? 961  LYS A NZ  1 
ATOM   1033 N  N   . PRO A 1 140 ? 10.818  36.037  15.504   1.00 28.92  ? 962  PRO A N   1 
ATOM   1034 C  CA  . PRO A 1 140 ? 12.114  35.767  14.878   1.00 28.45  ? 962  PRO A CA  1 
ATOM   1035 C  C   . PRO A 1 140 ? 12.185  34.531  13.995   1.00 28.55  ? 962  PRO A C   1 
ATOM   1036 O  O   . PRO A 1 140 ? 12.688  34.597  12.876   1.00 28.65  ? 962  PRO A O   1 
ATOM   1037 C  CB  . PRO A 1 140 ? 13.060  35.683  16.072   1.00 32.50  ? 962  PRO A CB  1 
ATOM   1038 C  CG  . PRO A 1 140 ? 12.468  36.668  17.019   1.00 32.38  ? 962  PRO A CG  1 
ATOM   1039 C  CD  . PRO A 1 140 ? 10.992  36.340  16.938   1.00 33.70  ? 962  PRO A CD  1 
ATOM   1040 N  N   . GLU A 1 141 ? 11.690  33.404  14.495   1.00 23.14  ? 963  GLU A N   1 
ATOM   1041 C  CA  . GLU A 1 141 ? 11.731  32.172  13.731   1.00 23.69  ? 963  GLU A CA  1 
ATOM   1042 C  C   . GLU A 1 141 ? 11.041  32.293  12.374   1.00 23.22  ? 963  GLU A C   1 
ATOM   1043 O  O   . GLU A 1 141 ? 11.345  31.539  11.450   1.00 22.77  ? 963  GLU A O   1 
ATOM   1044 C  CB  . GLU A 1 141 ? 11.122  31.014  14.539   1.00 37.82  ? 963  GLU A CB  1 
ATOM   1045 C  CG  . GLU A 1 141 ? 11.976  30.575  15.734   1.00 41.77  ? 963  GLU A CG  1 
ATOM   1046 C  CD  . GLU A 1 141 ? 11.527  31.194  17.051   1.00 49.90  ? 963  GLU A CD  1 
ATOM   1047 O  OE1 . GLU A 1 141 ? 11.164  32.391  17.065   1.00 49.03  ? 963  GLU A OE1 1 
ATOM   1048 O  OE2 . GLU A 1 141 ? 11.546  30.477  18.077   1.00 52.50  ? 963  GLU A OE2 1 
ATOM   1049 N  N   . ASP A 1 142 ? 10.114  33.236  12.243   1.00 28.35  ? 964  ASP A N   1 
ATOM   1050 C  CA  . ASP A 1 142 ? 9.436   33.398  10.965   1.00 26.00  ? 964  ASP A CA  1 
ATOM   1051 C  C   . ASP A 1 142 ? 10.386  33.940  9.904    1.00 25.16  ? 964  ASP A C   1 
ATOM   1052 O  O   . ASP A 1 142 ? 10.410  33.419  8.790    1.00 24.70  ? 964  ASP A O   1 
ATOM   1053 C  CB  . ASP A 1 142 ? 8.214   34.311  11.089   1.00 27.67  ? 964  ASP A CB  1 
ATOM   1054 C  CG  . ASP A 1 142 ? 7.107   33.692  11.930   1.00 30.40  ? 964  ASP A CG  1 
ATOM   1055 O  OD1 . ASP A 1 142 ? 6.982   32.449  11.938   1.00 34.19  ? 964  ASP A OD1 1 
ATOM   1056 O  OD2 . ASP A 1 142 ? 6.352   34.449  12.568   1.00 31.72  ? 964  ASP A OD2 1 
ATOM   1057 N  N   . PHE A 1 143 ? 11.171  34.970  10.223   1.00 20.92  ? 965  PHE A N   1 
ATOM   1058 C  CA  . PHE A 1 143 ? 12.079  35.474  9.199    1.00 21.25  ? 965  PHE A CA  1 
ATOM   1059 C  C   . PHE A 1 143 ? 13.301  34.589  9.037    1.00 20.89  ? 965  PHE A C   1 
ATOM   1060 O  O   . PHE A 1 143 ? 13.843  34.484  7.942    1.00 21.92  ? 965  PHE A O   1 
ATOM   1061 C  CB  . PHE A 1 143 ? 12.469  36.957  9.418    1.00 21.32  ? 965  PHE A CB  1 
ATOM   1062 C  CG  . PHE A 1 143 ? 13.165  37.256  10.721   1.00 24.59  ? 965  PHE A CG  1 
ATOM   1063 C  CD1 . PHE A 1 143 ? 14.433  36.753  10.993   1.00 25.34  ? 965  PHE A CD1 1 
ATOM   1064 C  CD2 . PHE A 1 143 ? 12.577  38.123  11.645   1.00 21.95  ? 965  PHE A CD2 1 
ATOM   1065 C  CE1 . PHE A 1 143 ? 15.109  37.111  12.162   1.00 29.76  ? 965  PHE A CE1 1 
ATOM   1066 C  CE2 . PHE A 1 143 ? 13.240  38.483  12.809   1.00 25.76  ? 965  PHE A CE2 1 
ATOM   1067 C  CZ  . PHE A 1 143 ? 14.514  37.975  13.066   1.00 25.71  ? 965  PHE A CZ  1 
ATOM   1068 N  N   . VAL A 1 144 ? 13.724  33.932  10.114   1.00 23.79  ? 966  VAL A N   1 
ATOM   1069 C  CA  . VAL A 1 144 ? 14.869  33.033  10.028   1.00 24.74  ? 966  VAL A CA  1 
ATOM   1070 C  C   . VAL A 1 144 ? 14.528  31.941  9.016    1.00 24.06  ? 966  VAL A C   1 
ATOM   1071 O  O   . VAL A 1 144 ? 15.377  31.516  8.235    1.00 24.73  ? 966  VAL A O   1 
ATOM   1072 C  CB  . VAL A 1 144 ? 15.192  32.372  11.398   1.00 22.35  ? 966  VAL A CB  1 
ATOM   1073 C  CG1 . VAL A 1 144 ? 16.195  31.237  11.208   1.00 26.27  ? 966  VAL A CG1 1 
ATOM   1074 C  CG2 . VAL A 1 144 ? 15.759  33.407  12.351   1.00 23.83  ? 966  VAL A CG2 1 
ATOM   1075 N  N   . ALA A 1 145 ? 13.277  31.493  9.034    1.00 21.55  ? 967  ALA A N   1 
ATOM   1076 C  CA  . ALA A 1 145 ? 12.827  30.458  8.107    1.00 22.55  ? 967  ALA A CA  1 
ATOM   1077 C  C   . ALA A 1 145 ? 12.980  30.917  6.655    1.00 22.85  ? 967  ALA A C   1 
ATOM   1078 O  O   . ALA A 1 145 ? 13.335  30.120  5.789    1.00 22.10  ? 967  ALA A O   1 
ATOM   1079 C  CB  . ALA A 1 145 ? 11.365  30.088  8.393    1.00 25.70  ? 967  ALA A CB  1 
ATOM   1080 N  N   . ASP A 1 146 ? 12.704  32.193  6.383    1.00 22.44  ? 968  ASP A N   1 
ATOM   1081 C  CA  . ASP A 1 146 ? 12.839  32.692  5.022    1.00 23.59  ? 968  ASP A CA  1 
ATOM   1082 C  C   . ASP A 1 146 ? 14.304  32.767  4.612    1.00 22.95  ? 968  ASP A C   1 
ATOM   1083 O  O   . ASP A 1 146 ? 14.636  32.502  3.462    1.00 21.36  ? 968  ASP A O   1 
ATOM   1084 C  CB  . ASP A 1 146 ? 12.169  34.061  4.860    1.00 23.10  ? 968  ASP A CB  1 
ATOM   1085 C  CG  . ASP A 1 146 ? 10.682  33.945  4.538    1.00 29.47  ? 968  ASP A CG  1 
ATOM   1086 O  OD1 . ASP A 1 146 ? 10.267  32.856  4.081    1.00 33.48  ? 968  ASP A OD1 1 
ATOM   1087 O  OD2 . ASP A 1 146 ? 9.935   34.934  4.716    1.00 28.89  ? 968  ASP A OD2 1 
ATOM   1088 N  N   . PHE A 1 147 ? 15.184  33.121  5.546    1.00 19.56  ? 969  PHE A N   1 
ATOM   1089 C  CA  . PHE A 1 147 ? 16.606  33.180  5.223    1.00 20.94  ? 969  PHE A CA  1 
ATOM   1090 C  C   . PHE A 1 147 ? 17.083  31.786  4.854    1.00 21.01  ? 969  PHE A C   1 
ATOM   1091 O  O   . PHE A 1 147 ? 17.783  31.600  3.863    1.00 19.88  ? 969  PHE A O   1 
ATOM   1092 C  CB  . PHE A 1 147 ? 17.418  33.680  6.420    1.00 21.66  ? 969  PHE A CB  1 
ATOM   1093 C  CG  . PHE A 1 147 ? 17.435  35.173  6.564    1.00 18.84  ? 969  PHE A CG  1 
ATOM   1094 C  CD1 . PHE A 1 147 ? 18.252  35.952  5.756    1.00 20.89  ? 969  PHE A CD1 1 
ATOM   1095 C  CD2 . PHE A 1 147 ? 16.641  35.796  7.512    1.00 20.44  ? 969  PHE A CD2 1 
ATOM   1096 C  CE1 . PHE A 1 147 ? 18.276  37.335  5.893    1.00 25.86  ? 969  PHE A CE1 1 
ATOM   1097 C  CE2 . PHE A 1 147 ? 16.655  37.177  7.658    1.00 21.96  ? 969  PHE A CE2 1 
ATOM   1098 C  CZ  . PHE A 1 147 ? 17.475  37.949  6.848    1.00 27.40  ? 969  PHE A CZ  1 
ATOM   1099 N  N   . ARG A 1 148 ? 16.700  30.799  5.657    1.00 23.65  ? 970  ARG A N   1 
ATOM   1100 C  CA  . ARG A 1 148 ? 17.119  29.430  5.399    1.00 23.61  ? 970  ARG A CA  1 
ATOM   1101 C  C   . ARG A 1 148 ? 16.537  28.871  4.107    1.00 22.50  ? 970  ARG A C   1 
ATOM   1102 O  O   . ARG A 1 148 ? 17.156  28.038  3.454    1.00 23.23  ? 970  ARG A O   1 
ATOM   1103 C  CB  . ARG A 1 148 ? 16.774  28.546  6.600    1.00 24.25  ? 970  ARG A CB  1 
ATOM   1104 C  CG  . ARG A 1 148 ? 17.750  28.771  7.751    1.00 25.85  ? 970  ARG A CG  1 
ATOM   1105 C  CD  . ARG A 1 148 ? 17.334  28.075  9.028    1.00 29.34  ? 970  ARG A CD  1 
ATOM   1106 N  NE  . ARG A 1 148 ? 18.280  28.366  10.100   1.00 34.02  ? 970  ARG A NE  1 
ATOM   1107 C  CZ  . ARG A 1 148 ? 18.052  28.128  11.387   1.00 40.35  ? 970  ARG A CZ  1 
ATOM   1108 N  NH1 . ARG A 1 148 ? 16.901  27.593  11.772   1.00 37.49  ? 970  ARG A NH1 1 
ATOM   1109 N  NH2 . ARG A 1 148 ? 18.977  28.430  12.291   1.00 38.96  ? 970  ARG A NH2 1 
ATOM   1110 N  N   . LEU A 1 149 ? 15.360  29.358  3.726    1.00 23.93  ? 971  LEU A N   1 
ATOM   1111 C  CA  . LEU A 1 149 ? 14.712  28.918  2.498    1.00 23.38  ? 971  LEU A CA  1 
ATOM   1112 C  C   . LEU A 1 149 ? 15.581  29.317  1.308    1.00 23.49  ? 971  LEU A C   1 
ATOM   1113 O  O   . LEU A 1 149 ? 15.634  28.604  0.298    1.00 22.32  ? 971  LEU A O   1 
ATOM   1114 C  CB  . LEU A 1 149 ? 13.327  29.557  2.383    1.00 26.61  ? 971  LEU A CB  1 
ATOM   1115 C  CG  . LEU A 1 149 ? 12.466  29.229  1.160    1.00 28.00  ? 971  LEU A CG  1 
ATOM   1116 C  CD1 . LEU A 1 149 ? 12.306  27.717  1.015    1.00 30.50  ? 971  LEU A CD1 1 
ATOM   1117 C  CD2 . LEU A 1 149 ? 11.107  29.906  1.317    1.00 25.72  ? 971  LEU A CD2 1 
ATOM   1118 N  N   . ILE A 1 150 ? 16.257  30.459  1.426    1.00 22.85  ? 972  ILE A N   1 
ATOM   1119 C  CA  . ILE A 1 150 ? 17.147  30.922  0.362    1.00 23.30  ? 972  ILE A CA  1 
ATOM   1120 C  C   . ILE A 1 150 ? 18.272  29.903  0.147    1.00 23.10  ? 972  ILE A C   1 
ATOM   1121 O  O   . ILE A 1 150 ? 18.573  29.539  -0.986   1.00 21.20  ? 972  ILE A O   1 
ATOM   1122 C  CB  . ILE A 1 150 ? 17.769  32.301  0.694    1.00 20.04  ? 972  ILE A CB  1 
ATOM   1123 C  CG1 . ILE A 1 150 ? 16.688  33.391  0.661    1.00 18.78  ? 972  ILE A CG1 1 
ATOM   1124 C  CG2 . ILE A 1 150 ? 18.881  32.634  -0.303   1.00 21.95  ? 972  ILE A CG2 1 
ATOM   1125 C  CD1 . ILE A 1 150 ? 17.157  34.744  1.196    1.00 20.56  ? 972  ILE A CD1 1 
ATOM   1126 N  N   . PHE A 1 151 ? 18.885  29.435  1.234    1.00 23.94  ? 973  PHE A N   1 
ATOM   1127 C  CA  . PHE A 1 151 ? 19.967  28.454  1.132    1.00 27.08  ? 973  PHE A CA  1 
ATOM   1128 C  C   . PHE A 1 151 ? 19.441  27.089  0.700    1.00 26.95  ? 973  PHE A C   1 
ATOM   1129 O  O   . PHE A 1 151 ? 20.130  26.337  0.008    1.00 27.12  ? 973  PHE A O   1 
ATOM   1130 C  CB  . PHE A 1 151 ? 20.693  28.321  2.472    1.00 23.44  ? 973  PHE A CB  1 
ATOM   1131 C  CG  . PHE A 1 151 ? 21.039  29.635  3.089    1.00 28.57  ? 973  PHE A CG  1 
ATOM   1132 C  CD1 . PHE A 1 151 ? 21.746  30.587  2.364    1.00 29.77  ? 973  PHE A CD1 1 
ATOM   1133 C  CD2 . PHE A 1 151 ? 20.626  29.944  4.378    1.00 27.79  ? 973  PHE A CD2 1 
ATOM   1134 C  CE1 . PHE A 1 151 ? 22.032  31.829  2.910    1.00 28.81  ? 973  PHE A CE1 1 
ATOM   1135 C  CE2 . PHE A 1 151 ? 20.909  31.184  4.931    1.00 31.17  ? 973  PHE A CE2 1 
ATOM   1136 C  CZ  . PHE A 1 151 ? 21.614  32.131  4.192    1.00 26.52  ? 973  PHE A CZ  1 
ATOM   1137 N  N   . GLN A 1 152 ? 18.223  26.766  1.119    1.00 25.64  ? 974  GLN A N   1 
ATOM   1138 C  CA  . GLN A 1 152 ? 17.619  25.491  0.745    1.00 28.48  ? 974  GLN A CA  1 
ATOM   1139 C  C   . GLN A 1 152 ? 17.436  25.429  -0.767   1.00 27.89  ? 974  GLN A C   1 
ATOM   1140 O  O   . GLN A 1 152 ? 17.839  24.461  -1.420   1.00 26.43  ? 974  GLN A O   1 
ATOM   1141 C  CB  . GLN A 1 152 ? 16.253  25.325  1.408    1.00 39.21  ? 974  GLN A CB  1 
ATOM   1142 C  CG  . GLN A 1 152 ? 16.293  24.871  2.843    1.00 45.58  ? 974  GLN A CG  1 
ATOM   1143 C  CD  . GLN A 1 152 ? 14.901  24.753  3.428    1.00 52.43  ? 974  GLN A CD  1 
ATOM   1144 O  OE1 . GLN A 1 152 ? 14.025  24.104  2.849    1.00 53.25  ? 974  GLN A OE1 1 
ATOM   1145 N  NE2 . GLN A 1 152 ? 14.688  25.381  4.578    1.00 50.93  ? 974  GLN A NE2 1 
ATOM   1146 N  N   . ASN A 1 153 ? 16.816  26.466  -1.320   1.00 30.44  ? 975  ASN A N   1 
ATOM   1147 C  CA  . ASN A 1 153 ? 16.577  26.519  -2.751   1.00 28.85  ? 975  ASN A CA  1 
ATOM   1148 C  C   . ASN A 1 153 ? 17.875  26.521  -3.544   1.00 29.26  ? 975  ASN A C   1 
ATOM   1149 O  O   . ASN A 1 153 ? 17.944  25.938  -4.633   1.00 27.33  ? 975  ASN A O   1 
ATOM   1150 C  CB  . ASN A 1 153 ? 15.741  27.751  -3.111   1.00 24.85  ? 975  ASN A CB  1 
ATOM   1151 C  CG  . ASN A 1 153 ? 14.371  27.723  -2.477   1.00 23.21  ? 975  ASN A CG  1 
ATOM   1152 O  OD1 . ASN A 1 153 ? 13.851  26.654  -2.152   1.00 24.73  ? 975  ASN A OD1 1 
ATOM   1153 N  ND2 . ASN A 1 153 ? 13.767  28.895  -2.309   1.00 25.88  ? 975  ASN A ND2 1 
ATOM   1154 N  N   . CYS A 1 154 ? 18.900  27.182  -3.011   1.00 25.55  ? 976  CYS A N   1 
ATOM   1155 C  CA  . CYS A 1 154 ? 20.192  27.239  -3.686   1.00 26.25  ? 976  CYS A CA  1 
ATOM   1156 C  C   . CYS A 1 154 ? 20.776  25.837  -3.793   1.00 26.29  ? 976  CYS A C   1 
ATOM   1157 O  O   . CYS A 1 154 ? 21.248  25.428  -4.860   1.00 28.47  ? 976  CYS A O   1 
ATOM   1158 C  CB  . CYS A 1 154 ? 21.171  28.136  -2.921   1.00 25.20  ? 976  CYS A CB  1 
ATOM   1159 S  SG  . CYS A 1 154 ? 22.859  28.150  -3.600   1.00 25.62  ? 976  CYS A SG  1 
ATOM   1160 N  N   . ALA A 1 155 ? 20.739  25.106  -2.684   1.00 28.40  ? 977  ALA A N   1 
ATOM   1161 C  CA  . ALA A 1 155 ? 21.262  23.742  -2.641   1.00 31.70  ? 977  ALA A CA  1 
ATOM   1162 C  C   . ALA A 1 155 ? 20.467  22.768  -3.517   1.00 31.91  ? 977  ALA A C   1 
ATOM   1163 O  O   . ALA A 1 155 ? 21.042  21.872  -4.135   1.00 33.85  ? 977  ALA A O   1 
ATOM   1164 C  CB  . ALA A 1 155 ? 21.284  23.245  -1.203   1.00 34.25  ? 977  ALA A CB  1 
ATOM   1165 N  N   . GLU A 1 156 ? 19.151  22.936  -3.576   1.00 39.13  ? 978  GLU A N   1 
ATOM   1166 C  CA  . GLU A 1 156 ? 18.324  22.044  -4.384   1.00 39.23  ? 978  GLU A CA  1 
ATOM   1167 C  C   . GLU A 1 156 ? 18.459  22.265  -5.889   1.00 39.84  ? 978  GLU A C   1 
ATOM   1168 O  O   . GLU A 1 156 ? 18.495  21.307  -6.661   1.00 38.62  ? 978  GLU A O   1 
ATOM   1169 C  CB  . GLU A 1 156 ? 16.846  22.173  -3.999   1.00 44.34  ? 978  GLU A CB  1 
ATOM   1170 C  CG  . GLU A 1 156 ? 15.911  21.662  -5.097   1.00 50.61  ? 978  GLU A CG  1 
ATOM   1171 C  CD  . GLU A 1 156 ? 14.456  21.578  -4.679   1.00 54.90  ? 978  GLU A CD  1 
ATOM   1172 O  OE1 . GLU A 1 156 ? 13.994  22.450  -3.911   1.00 55.01  ? 978  GLU A OE1 1 
ATOM   1173 O  OE2 . GLU A 1 156 ? 13.768  20.640  -5.142   1.00 57.68  ? 978  GLU A OE2 1 
ATOM   1174 N  N   . PHE A 1 157 ? 18.532  23.524  -6.302   1.00 32.56  ? 979  PHE A N   1 
ATOM   1175 C  CA  . PHE A 1 157 ? 18.620  23.847  -7.717   1.00 33.82  ? 979  PHE A CA  1 
ATOM   1176 C  C   . PHE A 1 157 ? 19.993  23.763  -8.376   1.00 34.62  ? 979  PHE A C   1 
ATOM   1177 O  O   . PHE A 1 157 ? 20.133  23.192  -9.459   1.00 35.07  ? 979  PHE A O   1 
ATOM   1178 C  CB  . PHE A 1 157 ? 18.071  25.248  -7.974   1.00 26.38  ? 979  PHE A CB  1 
ATOM   1179 C  CG  . PHE A 1 157 ? 18.092  25.632  -9.412   1.00 27.88  ? 979  PHE A CG  1 
ATOM   1180 C  CD1 . PHE A 1 157 ? 17.149  25.116  -10.291  1.00 26.64  ? 979  PHE A CD1 1 
ATOM   1181 C  CD2 . PHE A 1 157 ? 19.090  26.463  -9.907   1.00 26.43  ? 979  PHE A CD2 1 
ATOM   1182 C  CE1 . PHE A 1 157 ? 17.199  25.420  -11.646  1.00 28.08  ? 979  PHE A CE1 1 
ATOM   1183 C  CE2 . PHE A 1 157 ? 19.147  26.771  -11.260  1.00 30.89  ? 979  PHE A CE2 1 
ATOM   1184 C  CZ  . PHE A 1 157 ? 18.195  26.245  -12.131  1.00 29.62  ? 979  PHE A CZ  1 
ATOM   1185 N  N   . ASN A 1 158 ? 20.998  24.339  -7.729   1.00 28.03  ? 980  ASN A N   1 
ATOM   1186 C  CA  . ASN A 1 158 ? 22.347  24.382  -8.287   1.00 29.82  ? 980  ASN A CA  1 
ATOM   1187 C  C   . ASN A 1 158 ? 23.210  23.145  -8.105   1.00 31.60  ? 980  ASN A C   1 
ATOM   1188 O  O   . ASN A 1 158 ? 23.169  22.495  -7.067   1.00 31.50  ? 980  ASN A O   1 
ATOM   1189 C  CB  . ASN A 1 158 ? 23.080  25.590  -7.718   1.00 32.65  ? 980  ASN A CB  1 
ATOM   1190 C  CG  . ASN A 1 158 ? 22.383  26.880  -8.042   1.00 31.97  ? 980  ASN A CG  1 
ATOM   1191 O  OD1 . ASN A 1 158 ? 22.397  27.330  -9.183   1.00 31.27  ? 980  ASN A OD1 1 
ATOM   1192 N  ND2 . ASN A 1 158 ? 21.748  27.476  -7.043   1.00 26.66  ? 980  ASN A ND2 1 
ATOM   1193 N  N   . GLU A 1 159 ? 24.010  22.849  -9.127   1.00 35.07  ? 981  GLU A N   1 
ATOM   1194 C  CA  . GLU A 1 159 ? 24.908  21.700  -9.104   1.00 37.65  ? 981  GLU A CA  1 
ATOM   1195 C  C   . GLU A 1 159 ? 25.900  21.821  -7.962   1.00 37.48  ? 981  GLU A C   1 
ATOM   1196 O  O   . GLU A 1 159 ? 26.489  22.878  -7.748   1.00 36.35  ? 981  GLU A O   1 
ATOM   1197 C  CB  . GLU A 1 159 ? 25.678  21.588  -10.423  1.00 72.10  ? 981  GLU A CB  1 
ATOM   1198 C  CG  . GLU A 1 159 ? 24.865  21.045  -11.584  1.00 74.59  ? 981  GLU A CG  1 
ATOM   1199 C  CD  . GLU A 1 159 ? 24.340  19.644  -11.321  1.00 81.12  ? 981  GLU A CD  1 
ATOM   1200 O  OE1 . GLU A 1 159 ? 25.148  18.762  -10.955  1.00 82.27  ? 981  GLU A OE1 1 
ATOM   1201 O  OE2 . GLU A 1 159 ? 23.121  19.422  -11.485  1.00 80.45  ? 981  GLU A OE2 1 
ATOM   1202 N  N   . PRO A 1 160 ? 26.101  20.732  -7.211   1.00 48.76  ? 982  PRO A N   1 
ATOM   1203 C  CA  . PRO A 1 160 ? 27.055  20.820  -6.105   1.00 48.78  ? 982  PRO A CA  1 
ATOM   1204 C  C   . PRO A 1 160 ? 28.431  21.219  -6.627   1.00 48.27  ? 982  PRO A C   1 
ATOM   1205 O  O   . PRO A 1 160 ? 28.863  20.756  -7.683   1.00 47.85  ? 982  PRO A O   1 
ATOM   1206 C  CB  . PRO A 1 160 ? 27.023  19.413  -5.509   1.00 47.52  ? 982  PRO A CB  1 
ATOM   1207 C  CG  . PRO A 1 160 ? 26.693  18.550  -6.702   1.00 47.82  ? 982  PRO A CG  1 
ATOM   1208 C  CD  . PRO A 1 160 ? 25.613  19.354  -7.386   1.00 47.63  ? 982  PRO A CD  1 
ATOM   1209 N  N   . ASP A 1 161 ? 29.092  22.106  -5.890   1.00 42.94  ? 983  ASP A N   1 
ATOM   1210 C  CA  . ASP A 1 161 ? 30.422  22.598  -6.235   1.00 43.23  ? 983  ASP A CA  1 
ATOM   1211 C  C   . ASP A 1 161 ? 30.444  23.664  -7.333   1.00 40.99  ? 983  ASP A C   1 
ATOM   1212 O  O   . ASP A 1 161 ? 31.516  24.103  -7.753   1.00 40.61  ? 983  ASP A O   1 
ATOM   1213 C  CB  . ASP A 1 161 ? 31.343  21.437  -6.621   1.00 88.32  ? 983  ASP A CB  1 
ATOM   1214 C  CG  . ASP A 1 161 ? 32.807  21.827  -6.595   1.00 94.28  ? 983  ASP A CG  1 
ATOM   1215 O  OD1 . ASP A 1 161 ? 33.279  22.287  -5.531   1.00 101.84 ? 983  ASP A OD1 1 
ATOM   1216 O  OD2 . ASP A 1 161 ? 33.487  21.675  -7.632   1.00 98.64  ? 983  ASP A OD2 1 
ATOM   1217 N  N   . SER A 1 162 ? 29.271  24.076  -7.807   1.00 37.17  ? 984  SER A N   1 
ATOM   1218 C  CA  . SER A 1 162 ? 29.201  25.129  -8.820   1.00 34.29  ? 984  SER A CA  1 
ATOM   1219 C  C   . SER A 1 162 ? 29.454  26.445  -8.080   1.00 32.51  ? 984  SER A C   1 
ATOM   1220 O  O   . SER A 1 162 ? 29.468  26.464  -6.851   1.00 29.16  ? 984  SER A O   1 
ATOM   1221 C  CB  . SER A 1 162 ? 27.822  25.154  -9.478   1.00 36.40  ? 984  SER A CB  1 
ATOM   1222 O  OG  . SER A 1 162 ? 26.801  25.401  -8.526   1.00 38.99  ? 984  SER A OG  1 
ATOM   1223 N  N   . GLU A 1 163 ? 29.656  27.537  -8.814   1.00 30.57  ? 985  GLU A N   1 
ATOM   1224 C  CA  . GLU A 1 163 ? 29.921  28.833  -8.188   1.00 29.70  ? 985  GLU A CA  1 
ATOM   1225 C  C   . GLU A 1 163 ? 28.813  29.243  -7.224   1.00 28.46  ? 985  GLU A C   1 
ATOM   1226 O  O   . GLU A 1 163 ? 29.070  29.562  -6.065   1.00 27.38  ? 985  GLU A O   1 
ATOM   1227 C  CB  . GLU A 1 163 ? 30.073  29.931  -9.249   1.00 31.81  ? 985  GLU A CB  1 
ATOM   1228 C  CG  . GLU A 1 163 ? 30.539  31.275  -8.685   1.00 37.67  ? 985  GLU A CG  1 
ATOM   1229 C  CD  . GLU A 1 163 ? 30.165  32.466  -9.565   1.00 39.23  ? 985  GLU A CD  1 
ATOM   1230 O  OE1 . GLU A 1 163 ? 29.996  32.287  -10.788  1.00 38.62  ? 985  GLU A OE1 1 
ATOM   1231 O  OE2 . GLU A 1 163 ? 30.053  33.591  -9.032   1.00 39.56  ? 985  GLU A OE2 1 
ATOM   1232 N  N   . VAL A 1 164 ? 27.579  29.244  -7.717   1.00 27.40  ? 986  VAL A N   1 
ATOM   1233 C  CA  . VAL A 1 164 ? 26.436  29.637  -6.905   1.00 28.52  ? 986  VAL A CA  1 
ATOM   1234 C  C   . VAL A 1 164 ? 26.212  28.705  -5.712   1.00 26.80  ? 986  VAL A C   1 
ATOM   1235 O  O   . VAL A 1 164 ? 25.894  29.163  -4.614   1.00 25.42  ? 986  VAL A O   1 
ATOM   1236 C  CB  . VAL A 1 164 ? 25.152  29.709  -7.766   1.00 30.28  ? 986  VAL A CB  1 
ATOM   1237 C  CG1 . VAL A 1 164 ? 23.970  30.123  -6.910   1.00 30.58  ? 986  VAL A CG1 1 
ATOM   1238 C  CG2 . VAL A 1 164 ? 25.352  30.706  -8.899   1.00 31.62  ? 986  VAL A CG2 1 
ATOM   1239 N  N   . ALA A 1 165 ? 26.383  27.403  -5.925   1.00 25.60  ? 987  ALA A N   1 
ATOM   1240 C  CA  . ALA A 1 165 ? 26.198  26.445  -4.841   1.00 25.57  ? 987  ALA A CA  1 
ATOM   1241 C  C   . ALA A 1 165 ? 27.148  26.772  -3.690   1.00 25.33  ? 987  ALA A C   1 
ATOM   1242 O  O   . ALA A 1 165 ? 26.722  26.838  -2.538   1.00 24.59  ? 987  ALA A O   1 
ATOM   1243 C  CB  . ALA A 1 165 ? 26.445  25.018  -5.339   1.00 30.60  ? 987  ALA A CB  1 
ATOM   1244 N  N   . ASN A 1 166 ? 28.426  26.984  -4.007   1.00 25.62  ? 988  ASN A N   1 
ATOM   1245 C  CA  . ASN A 1 166 ? 29.432  27.302  -2.989   1.00 27.04  ? 988  ASN A CA  1 
ATOM   1246 C  C   . ASN A 1 166 ? 29.157  28.649  -2.325   1.00 26.21  ? 988  ASN A C   1 
ATOM   1247 O  O   . ASN A 1 166 ? 29.424  28.830  -1.137   1.00 24.11  ? 988  ASN A O   1 
ATOM   1248 C  CB  . ASN A 1 166 ? 30.847  27.326  -3.590   1.00 36.15  ? 988  ASN A CB  1 
ATOM   1249 C  CG  . ASN A 1 166 ? 31.308  25.962  -4.080   1.00 42.22  ? 988  ASN A CG  1 
ATOM   1250 O  OD1 . ASN A 1 166 ? 31.115  24.946  -3.411   1.00 43.65  ? 988  ASN A OD1 1 
ATOM   1251 N  ND2 . ASN A 1 166 ? 31.941  25.939  -5.249   1.00 45.03  ? 988  ASN A ND2 1 
ATOM   1252 N  N   . ALA A 1 167 ? 28.641  29.596  -3.101   1.00 23.34  ? 989  ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 167 ? 28.314  30.914  -2.569   1.00 23.99  ? 989  ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 167 ? 27.198  30.760  -1.533   1.00 24.61  ? 989  ALA A C   1 
ATOM   1255 O  O   . ALA A 1 167 ? 27.250  31.350  -0.449   1.00 24.44  ? 989  ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 167 ? 27.864  31.839  -3.704   1.00 20.18  ? 989  ALA A CB  1 
ATOM   1257 N  N   . GLY A 1 168 ? 26.194  29.955  -1.874   1.00 26.71  ? 990  GLY A N   1 
ATOM   1258 C  CA  . GLY A 1 168 ? 25.088  29.715  -0.968   1.00 26.68  ? 990  GLY A CA  1 
ATOM   1259 C  C   . GLY A 1 168 ? 25.578  29.151  0.354    1.00 28.30  ? 990  GLY A C   1 
ATOM   1260 O  O   . GLY A 1 168 ? 25.195  29.628  1.424    1.00 27.35  ? 990  GLY A O   1 
ATOM   1261 N  N   . ILE A 1 169 ? 26.432  28.134  0.284    1.00 28.27  ? 991  ILE A N   1 
ATOM   1262 C  CA  . ILE A 1 169 ? 26.975  27.521  1.485    1.00 30.21  ? 991  ILE A CA  1 
ATOM   1263 C  C   . ILE A 1 169 ? 27.778  28.524  2.317    1.00 29.87  ? 991  ILE A C   1 
ATOM   1264 O  O   . ILE A 1 169 ? 27.642  28.577  3.545    1.00 30.20  ? 991  ILE A O   1 
ATOM   1265 C  CB  . ILE A 1 169 ? 27.856  26.315  1.122    1.00 37.23  ? 991  ILE A CB  1 
ATOM   1266 C  CG1 . ILE A 1 169 ? 26.989  25.243  0.458    1.00 38.04  ? 991  ILE A CG1 1 
ATOM   1267 C  CG2 . ILE A 1 169 ? 28.532  25.765  2.364    1.00 39.25  ? 991  ILE A CG2 1 
ATOM   1268 C  CD1 . ILE A 1 169 ? 27.721  23.981  0.103    1.00 44.52  ? 991  ILE A CD1 1 
ATOM   1269 N  N   . LYS A 1 170 ? 28.598  29.331  1.653    1.00 31.21  ? 992  LYS A N   1 
ATOM   1270 C  CA  . LYS A 1 170 ? 29.402  30.324  2.351    1.00 31.62  ? 992  LYS A CA  1 
ATOM   1271 C  C   . LYS A 1 170 ? 28.522  31.397  2.983    1.00 32.26  ? 992  LYS A C   1 
ATOM   1272 O  O   . LYS A 1 170 ? 28.801  31.869  4.086    1.00 32.13  ? 992  LYS A O   1 
ATOM   1273 C  CB  . LYS A 1 170 ? 30.397  30.978  1.391    1.00 41.87  ? 992  LYS A CB  1 
ATOM   1274 C  CG  . LYS A 1 170 ? 31.526  30.062  0.934    1.00 43.68  ? 992  LYS A CG  1 
ATOM   1275 C  CD  . LYS A 1 170 ? 32.299  30.687  -0.220   1.00 45.05  ? 992  LYS A CD  1 
ATOM   1276 C  CE  . LYS A 1 170 ? 33.479  29.824  -0.654   1.00 50.03  ? 992  LYS A CE  1 
ATOM   1277 N  NZ  . LYS A 1 170 ? 34.572  29.817  0.360    1.00 52.49  ? 992  LYS A NZ  1 
ATOM   1278 N  N   . LEU A 1 171 ? 27.463  31.786  2.281    1.00 29.13  ? 993  LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 171 ? 26.562  32.802  2.795    1.00 28.18  ? 993  LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 171 ? 25.776  32.221  3.960    1.00 27.07  ? 993  LEU A C   1 
ATOM   1281 O  O   . LEU A 1 171 ? 25.526  32.903  4.955    1.00 25.81  ? 993  LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 171 ? 25.600  33.276  1.702    1.00 26.09  ? 993  LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 171 ? 24.823  34.552  2.040    1.00 26.89  ? 993  LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 171 ? 25.802  35.712  2.187    1.00 23.65  ? 993  LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 171 ? 23.804  34.851  0.945    1.00 24.27  ? 993  LEU A CD2 1 
ATOM   1286 N  N   . GLU A 1 172 ? 25.392  30.955  3.834    1.00 28.53  ? 994  GLU A N   1 
ATOM   1287 C  CA  . GLU A 1 172 ? 24.637  30.289  4.887    1.00 29.88  ? 994  GLU A CA  1 
ATOM   1288 C  C   . GLU A 1 172 ? 25.445  30.214  6.178    1.00 29.81  ? 994  GLU A C   1 
ATOM   1289 O  O   . GLU A 1 172 ? 24.920  30.463  7.262    1.00 28.58  ? 994  GLU A O   1 
ATOM   1290 C  CB  . GLU A 1 172 ? 24.241  28.881  4.455    1.00 31.44  ? 994  GLU A CB  1 
ATOM   1291 C  CG  . GLU A 1 172 ? 23.583  28.080  5.557    1.00 32.57  ? 994  GLU A CG  1 
ATOM   1292 C  CD  . GLU A 1 172 ? 23.200  26.692  5.111    1.00 36.51  ? 994  GLU A CD  1 
ATOM   1293 O  OE1 . GLU A 1 172 ? 24.027  26.025  4.451    1.00 36.00  ? 994  GLU A OE1 1 
ATOM   1294 O  OE2 . GLU A 1 172 ? 22.073  26.262  5.425    1.00 38.90  ? 994  GLU A OE2 1 
ATOM   1295 N  N   . ASN A 1 173 ? 26.724  29.872  6.064    1.00 34.11  ? 995  ASN A N   1 
ATOM   1296 C  CA  . ASN A 1 173 ? 27.567  29.781  7.248    1.00 33.67  ? 995  ASN A CA  1 
ATOM   1297 C  C   . ASN A 1 173 ? 27.734  31.156  7.874    1.00 31.56  ? 995  ASN A C   1 
ATOM   1298 O  O   . ASN A 1 173 ? 27.719  31.301  9.095    1.00 32.82  ? 995  ASN A O   1 
ATOM   1299 C  CB  . ASN A 1 173 ? 28.933  29.191  6.895    1.00 40.09  ? 995  ASN A CB  1 
ATOM   1300 C  CG  . ASN A 1 173 ? 28.836  27.754  6.425    1.00 44.82  ? 995  ASN A CG  1 
ATOM   1301 O  OD1 . ASN A 1 173 ? 27.930  27.021  6.823    1.00 47.96  ? 995  ASN A OD1 1 
ATOM   1302 N  ND2 . ASN A 1 173 ? 29.778  27.338  5.588    1.00 47.88  ? 995  ASN A ND2 1 
ATOM   1303 N  N   . TYR A 1 174 ? 27.888  32.169  7.031    1.00 24.01  ? 996  TYR A N   1 
ATOM   1304 C  CA  . TYR A 1 174 ? 28.040  33.532  7.512    1.00 22.93  ? 996  TYR A CA  1 
ATOM   1305 C  C   . TYR A 1 174 ? 26.770  33.908  8.268    1.00 22.84  ? 996  TYR A C   1 
ATOM   1306 O  O   . TYR A 1 174 ? 26.822  34.491  9.363    1.00 20.15  ? 996  TYR A O   1 
ATOM   1307 C  CB  . TYR A 1 174 ? 28.257  34.472  6.323    1.00 25.00  ? 996  TYR A CB  1 
ATOM   1308 C  CG  . TYR A 1 174 ? 28.485  35.920  6.680    1.00 26.18  ? 996  TYR A CG  1 
ATOM   1309 C  CD1 . TYR A 1 174 ? 29.622  36.321  7.386    1.00 30.51  ? 996  TYR A CD1 1 
ATOM   1310 C  CD2 . TYR A 1 174 ? 27.580  36.904  6.278    1.00 26.05  ? 996  TYR A CD2 1 
ATOM   1311 C  CE1 . TYR A 1 174 ? 29.849  37.666  7.676    1.00 27.40  ? 996  TYR A CE1 1 
ATOM   1312 C  CE2 . TYR A 1 174 ? 27.799  38.241  6.557    1.00 28.46  ? 996  TYR A CE2 1 
ATOM   1313 C  CZ  . TYR A 1 174 ? 28.932  38.617  7.253    1.00 28.72  ? 996  TYR A CZ  1 
ATOM   1314 O  OH  . TYR A 1 174 ? 29.147  39.948  7.500    1.00 28.74  ? 996  TYR A OH  1 
ATOM   1315 N  N   . PHE A 1 175 ? 25.627  33.550  7.687    1.00 23.37  ? 997  PHE A N   1 
ATOM   1316 C  CA  . PHE A 1 175 ? 24.334  33.846  8.292    1.00 24.45  ? 997  PHE A CA  1 
ATOM   1317 C  C   . PHE A 1 175 ? 24.179  33.195  9.660    1.00 24.56  ? 997  PHE A C   1 
ATOM   1318 O  O   . PHE A 1 175 ? 23.781  33.849  10.619   1.00 24.22  ? 997  PHE A O   1 
ATOM   1319 C  CB  . PHE A 1 175 ? 23.193  33.368  7.388    1.00 19.70  ? 997  PHE A CB  1 
ATOM   1320 C  CG  . PHE A 1 175 ? 21.836  33.447  8.036    1.00 17.58  ? 997  PHE A CG  1 
ATOM   1321 C  CD1 . PHE A 1 175 ? 21.215  34.672  8.239    1.00 21.87  ? 997  PHE A CD1 1 
ATOM   1322 C  CD2 . PHE A 1 175 ? 21.197  32.294  8.473    1.00 18.43  ? 997  PHE A CD2 1 
ATOM   1323 C  CE1 . PHE A 1 175 ? 19.973  34.752  8.872    1.00 23.73  ? 997  PHE A CE1 1 
ATOM   1324 C  CE2 . PHE A 1 175 ? 19.954  32.361  9.109    1.00 21.05  ? 997  PHE A CE2 1 
ATOM   1325 C  CZ  . PHE A 1 175 ? 19.342  33.594  9.309    1.00 17.73  ? 997  PHE A CZ  1 
ATOM   1326 N  N   . GLU A 1 176 ? 24.476  31.905  9.738    1.00 30.23  ? 998  GLU A N   1 
ATOM   1327 C  CA  . GLU A 1 176 ? 24.351  31.179  10.991   1.00 33.43  ? 998  GLU A CA  1 
ATOM   1328 C  C   . GLU A 1 176 ? 25.231  31.790  12.080   1.00 33.08  ? 998  GLU A C   1 
ATOM   1329 O  O   . GLU A 1 176 ? 24.849  31.820  13.253   1.00 34.93  ? 998  GLU A O   1 
ATOM   1330 C  CB  . GLU A 1 176 ? 24.687  29.704  10.781   1.00 35.47  ? 998  GLU A CB  1 
ATOM   1331 C  CG  . GLU A 1 176 ? 23.676  28.968  9.909    1.00 40.92  ? 998  GLU A CG  1 
ATOM   1332 C  CD  . GLU A 1 176 ? 22.255  29.053  10.452   1.00 43.00  ? 998  GLU A CD  1 
ATOM   1333 O  OE1 . GLU A 1 176 ? 22.068  28.860  11.670   1.00 46.79  ? 998  GLU A OE1 1 
ATOM   1334 O  OE2 . GLU A 1 176 ? 21.323  29.304  9.660    1.00 44.18  ? 998  GLU A OE2 1 
ATOM   1335 N  N   . GLU A 1 177 ? 26.401  32.285  11.697   1.00 30.04  ? 999  GLU A N   1 
ATOM   1336 C  CA  . GLU A 1 177 ? 27.289  32.916  12.665   1.00 29.27  ? 999  GLU A CA  1 
ATOM   1337 C  C   . GLU A 1 177 ? 26.670  34.200  13.196   1.00 28.10  ? 999  GLU A C   1 
ATOM   1338 O  O   . GLU A 1 177 ? 26.704  34.462  14.401   1.00 26.91  ? 999  GLU A O   1 
ATOM   1339 C  CB  . GLU A 1 177 ? 28.651  33.225  12.041   1.00 43.71  ? 999  GLU A CB  1 
ATOM   1340 C  CG  . GLU A 1 177 ? 29.558  32.017  11.953   1.00 49.27  ? 999  GLU A CG  1 
ATOM   1341 C  CD  . GLU A 1 177 ? 29.641  31.269  13.274   1.00 57.10  ? 999  GLU A CD  1 
ATOM   1342 O  OE1 . GLU A 1 177 ? 29.914  31.915  14.310   1.00 62.21  ? 999  GLU A OE1 1 
ATOM   1343 O  OE2 . GLU A 1 177 ? 29.433  30.036  13.277   1.00 57.47  ? 999  GLU A OE2 1 
ATOM   1344 N  N   . LEU A 1 178 ? 26.099  35.001  12.300   1.00 24.24  ? 1000 LEU A N   1 
ATOM   1345 C  CA  . LEU A 1 178 ? 25.479  36.253  12.709   1.00 23.22  ? 1000 LEU A CA  1 
ATOM   1346 C  C   . LEU A 1 178 ? 24.301  35.953  13.624   1.00 23.23  ? 1000 LEU A C   1 
ATOM   1347 O  O   . LEU A 1 178 ? 24.070  36.651  14.614   1.00 20.69  ? 1000 LEU A O   1 
ATOM   1348 C  CB  . LEU A 1 178 ? 24.996  37.040  11.484   1.00 29.89  ? 1000 LEU A CB  1 
ATOM   1349 C  CG  . LEU A 1 178 ? 26.065  37.580  10.529   1.00 29.51  ? 1000 LEU A CG  1 
ATOM   1350 C  CD1 . LEU A 1 178 ? 25.392  38.118  9.277    1.00 38.07  ? 1000 LEU A CD1 1 
ATOM   1351 C  CD2 . LEU A 1 178 ? 26.885  38.668  11.208   1.00 27.92  ? 1000 LEU A CD2 1 
ATOM   1352 N  N   . LEU A 1 179 ? 23.559  34.902  13.296   1.00 29.70  ? 1001 LEU A N   1 
ATOM   1353 C  CA  . LEU A 1 179 ? 22.402  34.527  14.095   1.00 31.74  ? 1001 LEU A CA  1 
ATOM   1354 C  C   . LEU A 1 179 ? 22.841  34.174  15.521   1.00 33.17  ? 1001 LEU A C   1 
ATOM   1355 O  O   . LEU A 1 179 ? 22.133  34.464  16.486   1.00 33.72  ? 1001 LEU A O   1 
ATOM   1356 C  CB  . LEU A 1 179 ? 21.669  33.348  13.436   1.00 30.66  ? 1001 LEU A CB  1 
ATOM   1357 C  CG  . LEU A 1 179 ? 20.177  33.173  13.744   1.00 31.81  ? 1001 LEU A CG  1 
ATOM   1358 C  CD1 . LEU A 1 179 ? 19.425  34.441  13.365   1.00 27.31  ? 1001 LEU A CD1 1 
ATOM   1359 C  CD2 . LEU A 1 179 ? 19.623  31.980  12.977   1.00 24.59  ? 1001 LEU A CD2 1 
ATOM   1360 N  N   . LYS A 1 180 ? 24.013  33.561  15.660   1.00 34.59  ? 1002 LYS A N   1 
ATOM   1361 C  CA  . LYS A 1 180 ? 24.503  33.210  16.989   1.00 35.49  ? 1002 LYS A CA  1 
ATOM   1362 C  C   . LYS A 1 180 ? 24.882  34.462  17.762   1.00 34.27  ? 1002 LYS A C   1 
ATOM   1363 O  O   . LYS A 1 180 ? 24.845  34.477  18.986   1.00 35.13  ? 1002 LYS A O   1 
ATOM   1364 C  CB  . LYS A 1 180 ? 25.714  32.278  16.908   1.00 40.07  ? 1002 LYS A CB  1 
ATOM   1365 C  CG  . LYS A 1 180 ? 25.438  30.947  16.243   1.00 43.02  ? 1002 LYS A CG  1 
ATOM   1366 C  CD  . LYS A 1 180 ? 26.268  29.853  16.884   1.00 49.04  ? 1002 LYS A CD  1 
ATOM   1367 C  CE  . LYS A 1 180 ? 26.691  28.801  15.878   1.00 51.61  ? 1002 LYS A CE  1 
ATOM   1368 N  NZ  . LYS A 1 180 ? 28.103  29.006  15.448   1.00 51.80  ? 1002 LYS A NZ  1 
ATOM   1369 N  N   . ASN A 1 181 ? 25.249  35.514  17.041   1.00 29.54  ? 1003 ASN A N   1 
ATOM   1370 C  CA  . ASN A 1 181 ? 25.622  36.766  17.679   1.00 28.74  ? 1003 ASN A CA  1 
ATOM   1371 C  C   . ASN A 1 181 ? 24.430  37.623  18.089   1.00 28.15  ? 1003 ASN A C   1 
ATOM   1372 O  O   . ASN A 1 181 ? 24.498  38.353  19.078   1.00 25.86  ? 1003 ASN A O   1 
ATOM   1373 C  CB  . ASN A 1 181 ? 26.523  37.596  16.761   1.00 39.94  ? 1003 ASN A CB  1 
ATOM   1374 C  CG  . ASN A 1 181 ? 27.840  36.918  16.469   1.00 45.23  ? 1003 ASN A CG  1 
ATOM   1375 O  OD1 . ASN A 1 181 ? 28.357  36.166  17.290   1.00 46.34  ? 1003 ASN A OD1 1 
ATOM   1376 N  ND2 . ASN A 1 181 ? 28.400  37.194  15.300   1.00 47.52  ? 1003 ASN A ND2 1 
ATOM   1377 N  N   . LEU A 1 182 ? 23.344  37.544  17.326   1.00 27.32  ? 1004 LEU A N   1 
ATOM   1378 C  CA  . LEU A 1 182 ? 22.158  38.342  17.617   1.00 25.98  ? 1004 LEU A CA  1 
ATOM   1379 C  C   . LEU A 1 182 ? 21.151  37.630  18.521   1.00 27.30  ? 1004 LEU A C   1 
ATOM   1380 O  O   . LEU A 1 182 ? 20.381  38.276  19.230   1.00 26.66  ? 1004 LEU A O   1 
ATOM   1381 C  CB  . LEU A 1 182 ? 21.481  38.771  16.308   1.00 29.79  ? 1004 LEU A CB  1 
ATOM   1382 C  CG  . LEU A 1 182 ? 22.281  39.762  15.452   1.00 31.24  ? 1004 LEU A CG  1 
ATOM   1383 C  CD1 . LEU A 1 182 ? 21.534  40.052  14.161   1.00 29.84  ? 1004 LEU A CD1 1 
ATOM   1384 C  CD2 . LEU A 1 182 ? 22.498  41.053  16.223   1.00 33.04  ? 1004 LEU A CD2 1 
ATOM   1385 N  N   . TYR A 1 183 ? 21.159  36.303  18.497   1.00 27.37  ? 1005 TYR A N   1 
ATOM   1386 C  CA  . TYR A 1 183 ? 20.252  35.535  19.334   1.00 27.37  ? 1005 TYR A CA  1 
ATOM   1387 C  C   . TYR A 1 183 ? 20.989  34.481  20.151   1.00 27.37  ? 1005 TYR A C   1 
ATOM   1388 O  O   . TYR A 1 183 ? 20.806  33.288  19.949   1.00 27.37  ? 1005 TYR A O   1 
ATOM   1389 C  CB  . TYR A 1 183 ? 19.164  34.863  18.486   1.00 28.05  ? 1005 TYR A CB  1 
ATOM   1390 C  CG  . TYR A 1 183 ? 18.146  35.832  17.919   1.00 28.05  ? 1005 TYR A CG  1 
ATOM   1391 C  CD1 . TYR A 1 183 ? 18.240  36.287  16.607   1.00 28.05  ? 1005 TYR A CD1 1 
ATOM   1392 C  CD2 . TYR A 1 183 ? 17.101  36.314  18.709   1.00 28.05  ? 1005 TYR A CD2 1 
ATOM   1393 C  CE1 . TYR A 1 183 ? 17.318  37.200  16.093   1.00 28.05  ? 1005 TYR A CE1 1 
ATOM   1394 C  CE2 . TYR A 1 183 ? 16.174  37.225  18.206   1.00 28.05  ? 1005 TYR A CE2 1 
ATOM   1395 C  CZ  . TYR A 1 183 ? 16.290  37.665  16.899   1.00 28.05  ? 1005 TYR A CZ  1 
ATOM   1396 O  OH  . TYR A 1 183 ? 15.396  38.591  16.401   1.00 28.05  ? 1005 TYR A OH  1 
ATOM   1397 N  N   . PRO A 1 184 ? 21.839  34.916  21.091   1.00 50.80  ? 1006 PRO A N   1 
ATOM   1398 C  CA  . PRO A 1 184 ? 22.585  33.974  21.924   1.00 50.80  ? 1006 PRO A CA  1 
ATOM   1399 C  C   . PRO A 1 184 ? 21.725  33.439  23.073   1.00 50.80  ? 1006 PRO A C   1 
ATOM   1400 O  O   . PRO A 1 184 ? 21.839  32.234  23.389   1.00 50.80  ? 1006 PRO A O   1 
ATOM   1401 C  CB  . PRO A 1 184 ? 23.764  34.811  22.401   1.00 38.14  ? 1006 PRO A CB  1 
ATOM   1402 C  CG  . PRO A 1 184 ? 23.153  36.151  22.575   1.00 38.14  ? 1006 PRO A CG  1 
ATOM   1403 C  CD  . PRO A 1 184 ? 22.282  36.300  21.341   1.00 38.14  ? 1006 PRO A CD  1 
ATOM   1404 O  OXT . PRO A 1 184 ? 20.951  34.235  23.647   1.00 45.47  ? 1006 PRO A OXT 1 
ATOM   1405 N  N   . PRO B 1 2   ? 54.388  4.812   -19.413  1.00 68.17  ? 824  PRO B N   1 
ATOM   1406 C  CA  . PRO B 1 2   ? 54.650  5.580   -20.651  1.00 68.17  ? 824  PRO B CA  1 
ATOM   1407 C  C   . PRO B 1 2   ? 53.742  6.805   -20.780  1.00 68.17  ? 824  PRO B C   1 
ATOM   1408 O  O   . PRO B 1 2   ? 54.162  7.843   -21.292  1.00 68.17  ? 824  PRO B O   1 
ATOM   1409 C  CB  . PRO B 1 2   ? 54.435  4.622   -21.811  1.00 62.06  ? 824  PRO B CB  1 
ATOM   1410 C  CG  . PRO B 1 2   ? 53.413  3.664   -21.215  1.00 62.06  ? 824  PRO B CG  1 
ATOM   1411 C  CD  . PRO B 1 2   ? 53.865  3.477   -19.757  1.00 62.06  ? 824  PRO B CD  1 
ATOM   1412 N  N   . ASN B 1 3   ? 52.499  6.677   -20.318  1.00 58.64  ? 825  ASN B N   1 
ATOM   1413 C  CA  . ASN B 1 3   ? 51.536  7.778   -20.378  1.00 58.64  ? 825  ASN B CA  1 
ATOM   1414 C  C   . ASN B 1 3   ? 51.816  8.789   -19.260  1.00 58.64  ? 825  ASN B C   1 
ATOM   1415 O  O   . ASN B 1 3   ? 52.382  8.433   -18.230  1.00 58.64  ? 825  ASN B O   1 
ATOM   1416 C  CB  . ASN B 1 3   ? 50.097  7.243   -20.255  1.00 104.98 ? 825  ASN B CB  1 
ATOM   1417 C  CG  . ASN B 1 3   ? 49.832  6.004   -21.121  1.00 104.98 ? 825  ASN B CG  1 
ATOM   1418 O  OD1 . ASN B 1 3   ? 50.480  5.778   -22.148  1.00 104.98 ? 825  ASN B OD1 1 
ATOM   1419 N  ND2 . ASN B 1 3   ? 48.849  5.211   -20.711  1.00 104.98 ? 825  ASN B ND2 1 
ATOM   1420 N  N   . GLU B 1 4   ? 51.427  10.046  -19.464  1.00 41.44  ? 826  GLU B N   1 
ATOM   1421 C  CA  . GLU B 1 4   ? 51.646  11.090  -18.457  1.00 41.44  ? 826  GLU B CA  1 
ATOM   1422 C  C   . GLU B 1 4   ? 50.960  10.751  -17.134  1.00 41.44  ? 826  GLU B C   1 
ATOM   1423 O  O   . GLU B 1 4   ? 50.107  9.872   -17.094  1.00 41.44  ? 826  GLU B O   1 
ATOM   1424 C  CB  . GLU B 1 4   ? 51.151  12.438  -18.981  1.00 83.43  ? 826  GLU B CB  1 
ATOM   1425 C  CG  . GLU B 1 4   ? 51.648  12.754  -20.377  1.00 83.43  ? 826  GLU B CG  1 
ATOM   1426 C  CD  . GLU B 1 4   ? 51.864  14.237  -20.608  1.00 83.43  ? 826  GLU B CD  1 
ATOM   1427 O  OE1 . GLU B 1 4   ? 52.273  14.612  -21.725  1.00 83.43  ? 826  GLU B OE1 1 
ATOM   1428 O  OE2 . GLU B 1 4   ? 51.649  15.026  -19.667  1.00 83.43  ? 826  GLU B OE2 1 
ATOM   1429 N  N   . ASP B 1 5   ? 51.322  11.453  -16.060  1.00 42.14  ? 827  ASP B N   1 
ATOM   1430 C  CA  . ASP B 1 5   ? 50.755  11.175  -14.738  1.00 43.79  ? 827  ASP B CA  1 
ATOM   1431 C  C   . ASP B 1 5   ? 49.630  12.093  -14.269  1.00 41.64  ? 827  ASP B C   1 
ATOM   1432 O  O   . ASP B 1 5   ? 48.913  11.763  -13.321  1.00 42.75  ? 827  ASP B O   1 
ATOM   1433 C  CB  . ASP B 1 5   ? 51.857  11.203  -13.674  1.00 44.56  ? 827  ASP B CB  1 
ATOM   1434 C  CG  . ASP B 1 5   ? 53.065  10.390  -14.067  1.00 47.78  ? 827  ASP B CG  1 
ATOM   1435 O  OD1 . ASP B 1 5   ? 52.884  9.280   -14.608  1.00 53.01  ? 827  ASP B OD1 1 
ATOM   1436 O  OD2 . ASP B 1 5   ? 54.198  10.857  -13.831  1.00 47.43  ? 827  ASP B OD2 1 
ATOM   1437 N  N   . TRP B 1 6   ? 49.484  13.245  -14.914  1.00 31.69  ? 828  TRP B N   1 
ATOM   1438 C  CA  . TRP B 1 6   ? 48.450  14.200  -14.529  1.00 28.67  ? 828  TRP B CA  1 
ATOM   1439 C  C   . TRP B 1 6   ? 47.501  14.500  -15.687  1.00 24.91  ? 828  TRP B C   1 
ATOM   1440 O  O   . TRP B 1 6   ? 47.905  14.486  -16.845  1.00 22.93  ? 828  TRP B O   1 
ATOM   1441 C  CB  . TRP B 1 6   ? 49.102  15.500  -14.049  1.00 39.55  ? 828  TRP B CB  1 
ATOM   1442 C  CG  . TRP B 1 6   ? 50.034  15.308  -12.887  1.00 47.30  ? 828  TRP B CG  1 
ATOM   1443 C  CD1 . TRP B 1 6   ? 49.695  15.215  -11.566  1.00 49.76  ? 828  TRP B CD1 1 
ATOM   1444 C  CD2 . TRP B 1 6   ? 51.456  15.138  -12.949  1.00 55.40  ? 828  TRP B CD2 1 
ATOM   1445 N  NE1 . TRP B 1 6   ? 50.815  14.997  -10.803  1.00 54.84  ? 828  TRP B NE1 1 
ATOM   1446 C  CE2 . TRP B 1 6   ? 51.911  14.945  -11.624  1.00 56.79  ? 828  TRP B CE2 1 
ATOM   1447 C  CE3 . TRP B 1 6   ? 52.391  15.127  -13.995  1.00 58.48  ? 828  TRP B CE3 1 
ATOM   1448 C  CZ2 . TRP B 1 6   ? 53.265  14.743  -11.316  1.00 61.53  ? 828  TRP B CZ2 1 
ATOM   1449 C  CZ3 . TRP B 1 6   ? 53.737  14.926  -13.689  1.00 61.64  ? 828  TRP B CZ3 1 
ATOM   1450 C  CH2 . TRP B 1 6   ? 54.159  14.737  -12.358  1.00 62.00  ? 828  TRP B CH2 1 
ATOM   1451 N  N   . CYS B 1 7   ? 46.241  14.760  -15.355  1.00 21.33  ? 829  CYS B N   1 
ATOM   1452 C  CA  . CYS B 1 7   ? 45.216  15.090  -16.342  1.00 22.95  ? 829  CYS B CA  1 
ATOM   1453 C  C   . CYS B 1 7   ? 45.743  16.186  -17.282  1.00 23.35  ? 829  CYS B C   1 
ATOM   1454 O  O   . CYS B 1 7   ? 46.313  17.174  -16.828  1.00 24.05  ? 829  CYS B O   1 
ATOM   1455 C  CB  . CYS B 1 7   ? 43.958  15.566  -15.608  1.00 22.51  ? 829  CYS B CB  1 
ATOM   1456 S  SG  . CYS B 1 7   ? 42.545  16.019  -16.646  1.00 22.90  ? 829  CYS B SG  1 
ATOM   1457 N  N   . ALA B 1 8   ? 45.563  15.997  -18.588  1.00 24.38  ? 830  ALA B N   1 
ATOM   1458 C  CA  . ALA B 1 8   ? 46.026  16.959  -19.589  1.00 26.32  ? 830  ALA B CA  1 
ATOM   1459 C  C   . ALA B 1 8   ? 45.262  18.278  -19.511  1.00 25.59  ? 830  ALA B C   1 
ATOM   1460 O  O   . ALA B 1 8   ? 45.729  19.308  -19.992  1.00 26.64  ? 830  ALA B O   1 
ATOM   1461 C  CB  . ALA B 1 8   ? 45.875  16.363  -20.988  1.00 18.23  ? 830  ALA B CB  1 
ATOM   1462 N  N   . VAL B 1 9   ? 44.083  18.237  -18.903  1.00 29.03  ? 831  VAL B N   1 
ATOM   1463 C  CA  . VAL B 1 9   ? 43.258  19.423  -18.781  1.00 28.96  ? 831  VAL B CA  1 
ATOM   1464 C  C   . VAL B 1 9   ? 43.507  20.225  -17.508  1.00 31.07  ? 831  VAL B C   1 
ATOM   1465 O  O   . VAL B 1 9   ? 43.879  21.399  -17.579  1.00 33.37  ? 831  VAL B O   1 
ATOM   1466 C  CB  . VAL B 1 9   ? 41.757  19.060  -18.847  1.00 25.04  ? 831  VAL B CB  1 
ATOM   1467 C  CG1 . VAL B 1 9   ? 40.904  20.274  -18.471  1.00 23.98  ? 831  VAL B CG1 1 
ATOM   1468 C  CG2 . VAL B 1 9   ? 41.403  18.594  -20.251  1.00 20.61  ? 831  VAL B CG2 1 
ATOM   1469 N  N   . CYS B 1 10  ? 43.311  19.596  -16.349  1.00 27.41  ? 832  CYS B N   1 
ATOM   1470 C  CA  . CYS B 1 10  ? 43.475  20.293  -15.071  1.00 27.49  ? 832  CYS B CA  1 
ATOM   1471 C  C   . CYS B 1 10  ? 44.833  20.148  -14.375  1.00 26.67  ? 832  CYS B C   1 
ATOM   1472 O  O   . CYS B 1 10  ? 45.070  20.784  -13.344  1.00 28.42  ? 832  CYS B O   1 
ATOM   1473 C  CB  . CYS B 1 10  ? 42.368  19.859  -14.098  1.00 27.33  ? 832  CYS B CB  1 
ATOM   1474 S  SG  . CYS B 1 10  ? 42.541  18.167  -13.446  1.00 26.02  ? 832  CYS B SG  1 
ATOM   1475 N  N   . GLN B 1 11  ? 45.710  19.316  -14.932  1.00 26.73  ? 833  GLN B N   1 
ATOM   1476 C  CA  . GLN B 1 11  ? 47.045  19.075  -14.381  1.00 28.19  ? 833  GLN B CA  1 
ATOM   1477 C  C   . GLN B 1 11  ? 47.064  18.467  -12.974  1.00 29.32  ? 833  GLN B C   1 
ATOM   1478 O  O   . GLN B 1 11  ? 48.023  18.650  -12.225  1.00 29.81  ? 833  GLN B O   1 
ATOM   1479 C  CB  . GLN B 1 11  ? 47.875  20.368  -14.388  1.00 31.10  ? 833  GLN B CB  1 
ATOM   1480 C  CG  . GLN B 1 11  ? 48.087  20.986  -15.773  1.00 31.30  ? 833  GLN B CG  1 
ATOM   1481 C  CD  . GLN B 1 11  ? 48.627  19.996  -16.796  1.00 34.99  ? 833  GLN B CD  1 
ATOM   1482 O  OE1 . GLN B 1 11  ? 49.583  19.266  -16.536  1.00 35.33  ? 833  GLN B OE1 1 
ATOM   1483 N  NE2 . GLN B 1 11  ? 48.017  19.978  -17.974  1.00 34.47  ? 833  GLN B NE2 1 
ATOM   1484 N  N   . ASN B 1 12  ? 46.006  17.745  -12.616  1.00 27.57  ? 834  ASN B N   1 
ATOM   1485 C  CA  . ASN B 1 12  ? 45.935  17.097  -11.307  1.00 28.55  ? 834  ASN B CA  1 
ATOM   1486 C  C   . ASN B 1 12  ? 45.804  15.586  -11.464  1.00 29.39  ? 834  ASN B C   1 
ATOM   1487 O  O   . ASN B 1 12  ? 45.429  15.098  -12.535  1.00 26.08  ? 834  ASN B O   1 
ATOM   1488 C  CB  . ASN B 1 12  ? 44.753  17.634  -10.497  1.00 34.15  ? 834  ASN B CB  1 
ATOM   1489 C  CG  . ASN B 1 12  ? 45.055  18.968  -9.846   1.00 38.71  ? 834  ASN B CG  1 
ATOM   1490 O  OD1 . ASN B 1 12  ? 45.149  20.000  -10.515  1.00 40.06  ? 834  ASN B OD1 1 
ATOM   1491 N  ND2 . ASN B 1 12  ? 45.223  18.952  -8.529   1.00 42.28  ? 834  ASN B ND2 1 
ATOM   1492 N  N   . GLY B 1 13  ? 46.115  14.850  -10.398  1.00 36.86  ? 835  GLY B N   1 
ATOM   1493 C  CA  . GLY B 1 13  ? 46.035  13.400  -10.448  1.00 37.02  ? 835  GLY B CA  1 
ATOM   1494 C  C   . GLY B 1 13  ? 44.706  12.835  -9.977   1.00 36.69  ? 835  GLY B C   1 
ATOM   1495 O  O   . GLY B 1 13  ? 43.742  13.577  -9.789   1.00 35.09  ? 835  GLY B O   1 
ATOM   1496 N  N   . GLY B 1 14  ? 44.661  11.516  -9.781   1.00 28.69  ? 836  GLY B N   1 
ATOM   1497 C  CA  . GLY B 1 14  ? 43.445  10.855  -9.336   1.00 29.63  ? 836  GLY B CA  1 
ATOM   1498 C  C   . GLY B 1 14  ? 43.079  9.711   -10.267  1.00 30.38  ? 836  GLY B C   1 
ATOM   1499 O  O   . GLY B 1 14  ? 43.962  9.071   -10.839  1.00 29.61  ? 836  GLY B O   1 
ATOM   1500 N  N   . GLU B 1 15  ? 41.782  9.449   -10.414  1.00 38.95  ? 837  GLU B N   1 
ATOM   1501 C  CA  . GLU B 1 15  ? 41.305  8.397   -11.307  1.00 40.46  ? 837  GLU B CA  1 
ATOM   1502 C  C   . GLU B 1 15  ? 41.402  8.958   -12.726  1.00 39.72  ? 837  GLU B C   1 
ATOM   1503 O  O   . GLU B 1 15  ? 40.641  9.845   -13.114  1.00 39.35  ? 837  GLU B O   1 
ATOM   1504 C  CB  . GLU B 1 15  ? 39.857  8.013   -10.971  1.00 65.30  ? 837  GLU B CB  1 
ATOM   1505 C  CG  . GLU B 1 15  ? 38.811  9.110   -11.183  1.00 71.43  ? 837  GLU B CG  1 
ATOM   1506 C  CD  . GLU B 1 15  ? 38.896  10.242  -10.166  1.00 81.76  ? 837  GLU B CD  1 
ATOM   1507 O  OE1 . GLU B 1 15  ? 38.953  9.963   -8.950   1.00 83.97  ? 837  GLU B OE1 1 
ATOM   1508 O  OE2 . GLU B 1 15  ? 38.913  11.419  -10.588  1.00 84.05  ? 837  GLU B OE2 1 
ATOM   1509 N  N   . LEU B 1 16  ? 42.349  8.441   -13.498  1.00 38.69  ? 838  LEU B N   1 
ATOM   1510 C  CA  . LEU B 1 16  ? 42.569  8.936   -14.847  1.00 38.19  ? 838  LEU B CA  1 
ATOM   1511 C  C   . LEU B 1 16  ? 42.406  7.896   -15.945  1.00 38.58  ? 838  LEU B C   1 
ATOM   1512 O  O   . LEU B 1 16  ? 42.788  6.733   -15.788  1.00 39.65  ? 838  LEU B O   1 
ATOM   1513 C  CB  . LEU B 1 16  ? 43.969  9.547   -14.936  1.00 34.05  ? 838  LEU B CB  1 
ATOM   1514 C  CG  . LEU B 1 16  ? 44.293  10.635  -13.906  1.00 34.89  ? 838  LEU B CG  1 
ATOM   1515 C  CD1 . LEU B 1 16  ? 45.784  10.923  -13.911  1.00 36.55  ? 838  LEU B CD1 1 
ATOM   1516 C  CD2 . LEU B 1 16  ? 43.497  11.898  -14.220  1.00 37.66  ? 838  LEU B CD2 1 
ATOM   1517 N  N   . LEU B 1 17  ? 41.837  8.336   -17.061  1.00 32.02  ? 839  LEU B N   1 
ATOM   1518 C  CA  . LEU B 1 17  ? 41.630  7.486   -18.223  1.00 32.08  ? 839  LEU B CA  1 
ATOM   1519 C  C   . LEU B 1 17  ? 42.825  7.676   -19.164  1.00 32.12  ? 839  LEU B C   1 
ATOM   1520 O  O   . LEU B 1 17  ? 43.178  8.805   -19.519  1.00 29.31  ? 839  LEU B O   1 
ATOM   1521 C  CB  . LEU B 1 17  ? 40.320  7.874   -18.916  1.00 30.73  ? 839  LEU B CB  1 
ATOM   1522 C  CG  . LEU B 1 17  ? 39.865  7.085   -20.144  1.00 33.15  ? 839  LEU B CG  1 
ATOM   1523 C  CD1 . LEU B 1 17  ? 40.184  5.590   -19.993  1.00 34.44  ? 839  LEU B CD1 1 
ATOM   1524 C  CD2 . LEU B 1 17  ? 38.365  7.315   -20.328  1.00 28.69  ? 839  LEU B CD2 1 
ATOM   1525 N  N   . CYS B 1 18  ? 43.449  6.568   -19.555  1.00 29.63  ? 840  CYS B N   1 
ATOM   1526 C  CA  . CYS B 1 18  ? 44.621  6.601   -20.429  1.00 31.16  ? 840  CYS B CA  1 
ATOM   1527 C  C   . CYS B 1 18  ? 44.302  6.395   -21.903  1.00 29.36  ? 840  CYS B C   1 
ATOM   1528 O  O   . CYS B 1 18  ? 43.548  5.497   -22.266  1.00 29.37  ? 840  CYS B O   1 
ATOM   1529 C  CB  . CYS B 1 18  ? 45.629  5.532   -19.992  1.00 54.57  ? 840  CYS B CB  1 
ATOM   1530 S  SG  . CYS B 1 18  ? 46.153  5.653   -18.270  1.00 63.96  ? 840  CYS B SG  1 
ATOM   1531 N  N   . CYS B 1 19  ? 44.897  7.224   -22.753  1.00 34.90  ? 841  CYS B N   1 
ATOM   1532 C  CA  . CYS B 1 19  ? 44.677  7.108   -24.186  1.00 34.16  ? 841  CYS B CA  1 
ATOM   1533 C  C   . CYS B 1 19  ? 45.627  6.078   -24.779  1.00 34.81  ? 841  CYS B C   1 
ATOM   1534 O  O   . CYS B 1 19  ? 46.806  6.039   -24.436  1.00 30.98  ? 841  CYS B O   1 
ATOM   1535 C  CB  . CYS B 1 19  ? 44.899  8.446   -24.874  1.00 25.67  ? 841  CYS B CB  1 
ATOM   1536 S  SG  . CYS B 1 19  ? 44.722  8.358   -26.658  1.00 26.72  ? 841  CYS B SG  1 
ATOM   1537 N  N   . GLU B 1 20  ? 45.102  5.257   -25.678  1.00 36.01  ? 842  GLU B N   1 
ATOM   1538 C  CA  . GLU B 1 20  ? 45.877  4.206   -26.324  1.00 37.56  ? 842  GLU B CA  1 
ATOM   1539 C  C   . GLU B 1 20  ? 46.868  4.699   -27.361  1.00 38.06  ? 842  GLU B C   1 
ATOM   1540 O  O   . GLU B 1 20  ? 47.871  4.034   -27.620  1.00 37.48  ? 842  GLU B O   1 
ATOM   1541 C  CB  . GLU B 1 20  ? 44.935  3.205   -27.001  1.00 54.55  ? 842  GLU B CB  1 
ATOM   1542 C  CG  . GLU B 1 20  ? 44.328  2.186   -26.066  1.00 59.15  ? 842  GLU B CG  1 
ATOM   1543 C  CD  . GLU B 1 20  ? 45.364  1.228   -25.532  1.00 66.66  ? 842  GLU B CD  1 
ATOM   1544 O  OE1 . GLU B 1 20  ? 45.975  0.508   -26.350  1.00 66.04  ? 842  GLU B OE1 1 
ATOM   1545 O  OE2 . GLU B 1 20  ? 45.571  1.201   -24.301  1.00 69.34  ? 842  GLU B OE2 1 
ATOM   1546 N  N   . LYS B 1 21  ? 46.595  5.860   -27.950  1.00 31.25  ? 843  LYS B N   1 
ATOM   1547 C  CA  . LYS B 1 21  ? 47.448  6.385   -29.002  1.00 32.71  ? 843  LYS B CA  1 
ATOM   1548 C  C   . LYS B 1 21  ? 48.353  7.576   -28.687  1.00 33.02  ? 843  LYS B C   1 
ATOM   1549 O  O   . LYS B 1 21  ? 49.208  7.925   -29.500  1.00 32.81  ? 843  LYS B O   1 
ATOM   1550 C  CB  . LYS B 1 21  ? 46.581  6.675   -30.229  1.00 35.06  ? 843  LYS B CB  1 
ATOM   1551 C  CG  . LYS B 1 21  ? 45.820  5.434   -30.685  1.00 38.14  ? 843  LYS B CG  1 
ATOM   1552 C  CD  . LYS B 1 21  ? 45.179  5.618   -32.039  1.00 44.94  ? 843  LYS B CD  1 
ATOM   1553 C  CE  . LYS B 1 21  ? 44.630  4.294   -32.552  1.00 50.92  ? 843  LYS B CE  1 
ATOM   1554 N  NZ  . LYS B 1 21  ? 44.007  4.422   -33.902  1.00 53.96  ? 843  LYS B NZ  1 
ATOM   1555 N  N   . CYS B 1 22  ? 48.175  8.193   -27.519  1.00 34.69  ? 844  CYS B N   1 
ATOM   1556 C  CA  . CYS B 1 22  ? 49.020  9.317   -27.113  1.00 33.32  ? 844  CYS B CA  1 
ATOM   1557 C  C   . CYS B 1 22  ? 49.264  9.238   -25.597  1.00 32.19  ? 844  CYS B C   1 
ATOM   1558 O  O   . CYS B 1 22  ? 48.582  8.497   -24.890  1.00 31.66  ? 844  CYS B O   1 
ATOM   1559 C  CB  . CYS B 1 22  ? 48.367  10.652  -27.488  1.00 31.67  ? 844  CYS B CB  1 
ATOM   1560 S  SG  . CYS B 1 22  ? 47.063  11.154  -26.370  1.00 30.43  ? 844  CYS B SG  1 
ATOM   1561 N  N   . PRO B 1 23  ? 50.240  10.002  -25.077  1.00 30.00  ? 845  PRO B N   1 
ATOM   1562 C  CA  . PRO B 1 23  ? 50.556  9.990   -23.641  1.00 28.68  ? 845  PRO B CA  1 
ATOM   1563 C  C   . PRO B 1 23  ? 49.505  10.587  -22.705  1.00 27.10  ? 845  PRO B C   1 
ATOM   1564 O  O   . PRO B 1 23  ? 49.525  10.331  -21.503  1.00 26.94  ? 845  PRO B O   1 
ATOM   1565 C  CB  . PRO B 1 23  ? 51.873  10.775  -23.567  1.00 32.14  ? 845  PRO B CB  1 
ATOM   1566 C  CG  . PRO B 1 23  ? 52.451  10.628  -24.938  1.00 33.83  ? 845  PRO B CG  1 
ATOM   1567 C  CD  . PRO B 1 23  ? 51.240  10.790  -25.813  1.00 32.09  ? 845  PRO B CD  1 
ATOM   1568 N  N   . LYS B 1 24  ? 48.586  11.373  -23.253  1.00 29.47  ? 846  LYS B N   1 
ATOM   1569 C  CA  . LYS B 1 24  ? 47.574  12.031  -22.439  1.00 28.59  ? 846  LYS B CA  1 
ATOM   1570 C  C   . LYS B 1 24  ? 46.668  11.153  -21.585  1.00 29.71  ? 846  LYS B C   1 
ATOM   1571 O  O   . LYS B 1 24  ? 46.304  10.041  -21.967  1.00 31.63  ? 846  LYS B O   1 
ATOM   1572 C  CB  . LYS B 1 24  ? 46.712  12.931  -23.323  1.00 22.71  ? 846  LYS B CB  1 
ATOM   1573 C  CG  . LYS B 1 24  ? 47.524  13.995  -24.055  1.00 23.19  ? 846  LYS B CG  1 
ATOM   1574 C  CD  . LYS B 1 24  ? 46.644  15.130  -24.536  1.00 27.88  ? 846  LYS B CD  1 
ATOM   1575 C  CE  . LYS B 1 24  ? 47.485  16.245  -25.131  1.00 32.69  ? 846  LYS B CE  1 
ATOM   1576 N  NZ  . LYS B 1 24  ? 46.694  17.495  -25.205  1.00 39.90  ? 846  LYS B NZ  1 
ATOM   1577 N  N   . VAL B 1 25  ? 46.323  11.676  -20.412  1.00 24.78  ? 847  VAL B N   1 
ATOM   1578 C  CA  . VAL B 1 25  ? 45.417  11.010  -19.484  1.00 26.25  ? 847  VAL B CA  1 
ATOM   1579 C  C   . VAL B 1 25  ? 44.397  12.084  -19.110  1.00 24.43  ? 847  VAL B C   1 
ATOM   1580 O  O   . VAL B 1 25  ? 44.726  13.273  -19.107  1.00 23.80  ? 847  VAL B O   1 
ATOM   1581 C  CB  . VAL B 1 25  ? 46.142  10.494  -18.201  1.00 34.34  ? 847  VAL B CB  1 
ATOM   1582 C  CG1 . VAL B 1 25  ? 47.214  9.475   -18.583  1.00 36.96  ? 847  VAL B CG1 1 
ATOM   1583 C  CG2 . VAL B 1 25  ? 46.750  11.647  -17.431  1.00 35.19  ? 847  VAL B CG2 1 
ATOM   1584 N  N   . PHE B 1 26  ? 43.169  11.675  -18.807  1.00 22.54  ? 848  PHE B N   1 
ATOM   1585 C  CA  . PHE B 1 26  ? 42.110  12.625  -18.472  1.00 23.52  ? 848  PHE B CA  1 
ATOM   1586 C  C   . PHE B 1 26  ? 41.165  12.130  -17.383  1.00 24.87  ? 848  PHE B C   1 
ATOM   1587 O  O   . PHE B 1 26  ? 40.941  10.927  -17.243  1.00 25.87  ? 848  PHE B O   1 
ATOM   1588 C  CB  . PHE B 1 26  ? 41.216  12.884  -19.683  1.00 21.06  ? 848  PHE B CB  1 
ATOM   1589 C  CG  . PHE B 1 26  ? 41.940  13.273  -20.924  1.00 22.45  ? 848  PHE B CG  1 
ATOM   1590 C  CD1 . PHE B 1 26  ? 42.054  14.616  -21.282  1.00 20.10  ? 848  PHE B CD1 1 
ATOM   1591 C  CD2 . PHE B 1 26  ? 42.448  12.302  -21.779  1.00 17.36  ? 848  PHE B CD2 1 
ATOM   1592 C  CE1 . PHE B 1 26  ? 42.655  14.979  -22.475  1.00 17.80  ? 848  PHE B CE1 1 
ATOM   1593 C  CE2 . PHE B 1 26  ? 43.050  12.655  -22.968  1.00 18.96  ? 848  PHE B CE2 1 
ATOM   1594 C  CZ  . PHE B 1 26  ? 43.154  13.999  -23.322  1.00 20.84  ? 848  PHE B CZ  1 
ATOM   1595 N  N   . HIS B 1 27  ? 40.600  13.069  -16.626  1.00 27.33  ? 849  HIS B N   1 
ATOM   1596 C  CA  . HIS B 1 27  ? 39.589  12.723  -15.639  1.00 26.13  ? 849  HIS B CA  1 
ATOM   1597 C  C   . HIS B 1 27  ? 38.373  12.521  -16.540  1.00 25.76  ? 849  HIS B C   1 
ATOM   1598 O  O   . HIS B 1 27  ? 38.339  13.049  -17.653  1.00 25.30  ? 849  HIS B O   1 
ATOM   1599 C  CB  . HIS B 1 27  ? 39.317  13.883  -14.681  1.00 30.10  ? 849  HIS B CB  1 
ATOM   1600 C  CG  . HIS B 1 27  ? 40.356  14.051  -13.617  1.00 30.86  ? 849  HIS B CG  1 
ATOM   1601 N  ND1 . HIS B 1 27  ? 41.336  15.017  -13.677  1.00 35.18  ? 849  HIS B ND1 1 
ATOM   1602 C  CD2 . HIS B 1 27  ? 40.561  13.378  -12.460  1.00 37.56  ? 849  HIS B CD2 1 
ATOM   1603 C  CE1 . HIS B 1 27  ? 42.099  14.935  -12.602  1.00 27.43  ? 849  HIS B CE1 1 
ATOM   1604 N  NE2 . HIS B 1 27  ? 41.651  13.947  -11.848  1.00 32.14  ? 849  HIS B NE2 1 
ATOM   1605 N  N   . LEU B 1 28  ? 37.375  11.776  -16.079  1.00 29.06  ? 850  LEU B N   1 
ATOM   1606 C  CA  . LEU B 1 28  ? 36.197  11.536  -16.901  1.00 28.73  ? 850  LEU B CA  1 
ATOM   1607 C  C   . LEU B 1 28  ? 35.498  12.821  -17.341  1.00 27.18  ? 850  LEU B C   1 
ATOM   1608 O  O   . LEU B 1 28  ? 35.123  12.960  -18.502  1.00 27.85  ? 850  LEU B O   1 
ATOM   1609 C  CB  . LEU B 1 28  ? 35.197  10.647  -16.160  1.00 25.75  ? 850  LEU B CB  1 
ATOM   1610 C  CG  . LEU B 1 28  ? 35.649  9.214   -15.854  1.00 28.11  ? 850  LEU B CG  1 
ATOM   1611 C  CD1 . LEU B 1 28  ? 34.465  8.443   -15.279  1.00 33.43  ? 850  LEU B CD1 1 
ATOM   1612 C  CD2 . LEU B 1 28  ? 36.160  8.529   -17.110  1.00 29.21  ? 850  LEU B CD2 1 
ATOM   1613 N  N   . SER B 1 29  ? 35.325  13.758  -16.416  1.00 24.57  ? 851  SER B N   1 
ATOM   1614 C  CA  . SER B 1 29  ? 34.649  15.002  -16.749  1.00 24.85  ? 851  SER B CA  1 
ATOM   1615 C  C   . SER B 1 29  ? 35.573  16.089  -17.320  1.00 23.91  ? 851  SER B C   1 
ATOM   1616 O  O   . SER B 1 29  ? 35.106  17.140  -17.743  1.00 23.50  ? 851  SER B O   1 
ATOM   1617 C  CB  . SER B 1 29  ? 33.882  15.527  -15.528  1.00 28.57  ? 851  SER B CB  1 
ATOM   1618 O  OG  . SER B 1 29  ? 34.744  15.735  -14.429  1.00 33.54  ? 851  SER B OG  1 
ATOM   1619 N  N   . CYS B 1 30  ? 36.878  15.840  -17.349  1.00 22.91  ? 852  CYS B N   1 
ATOM   1620 C  CA  . CYS B 1 30  ? 37.799  16.828  -17.917  1.00 22.18  ? 852  CYS B CA  1 
ATOM   1621 C  C   . CYS B 1 30  ? 37.899  16.629  -19.428  1.00 22.25  ? 852  CYS B C   1 
ATOM   1622 O  O   . CYS B 1 30  ? 38.187  17.566  -20.183  1.00 23.03  ? 852  CYS B O   1 
ATOM   1623 C  CB  . CYS B 1 30  ? 39.185  16.701  -17.281  1.00 23.37  ? 852  CYS B CB  1 
ATOM   1624 S  SG  . CYS B 1 30  ? 39.303  17.501  -15.661  1.00 25.46  ? 852  CYS B SG  1 
ATOM   1625 N  N   . HIS B 1 31  ? 37.672  15.393  -19.861  1.00 23.24  ? 853  HIS B N   1 
ATOM   1626 C  CA  . HIS B 1 31  ? 37.715  15.054  -21.275  1.00 21.53  ? 853  HIS B CA  1 
ATOM   1627 C  C   . HIS B 1 31  ? 36.509  15.696  -21.962  1.00 21.78  ? 853  HIS B C   1 
ATOM   1628 O  O   . HIS B 1 31  ? 35.528  16.054  -21.308  1.00 20.78  ? 853  HIS B O   1 
ATOM   1629 C  CB  . HIS B 1 31  ? 37.646  13.531  -21.453  1.00 15.61  ? 853  HIS B CB  1 
ATOM   1630 C  CG  . HIS B 1 31  ? 37.720  13.081  -22.880  1.00 17.88  ? 853  HIS B CG  1 
ATOM   1631 N  ND1 . HIS B 1 31  ? 38.900  13.057  -23.593  1.00 19.32  ? 853  HIS B ND1 1 
ATOM   1632 C  CD2 . HIS B 1 31  ? 36.757  12.654  -23.732  1.00 11.58  ? 853  HIS B CD2 1 
ATOM   1633 C  CE1 . HIS B 1 31  ? 38.660  12.636  -24.825  1.00 10.91  ? 853  HIS B CE1 1 
ATOM   1634 N  NE2 . HIS B 1 31  ? 37.366  12.387  -24.934  1.00 19.32  ? 853  HIS B NE2 1 
ATOM   1635 N  N   . VAL B 1 32  ? 36.601  15.867  -23.277  1.00 22.09  ? 854  VAL B N   1 
ATOM   1636 C  CA  . VAL B 1 32  ? 35.497  16.413  -24.051  1.00 22.09  ? 854  VAL B CA  1 
ATOM   1637 C  C   . VAL B 1 32  ? 35.265  15.428  -25.202  1.00 22.09  ? 854  VAL B C   1 
ATOM   1638 O  O   . VAL B 1 32  ? 36.131  15.236  -26.056  1.00 22.09  ? 854  VAL B O   1 
ATOM   1639 C  CB  . VAL B 1 32  ? 35.814  17.821  -24.635  1.00 18.86  ? 854  VAL B CB  1 
ATOM   1640 C  CG1 . VAL B 1 32  ? 34.594  18.358  -25.372  1.00 18.86  ? 854  VAL B CG1 1 
ATOM   1641 C  CG2 . VAL B 1 32  ? 36.211  18.782  -23.520  1.00 18.86  ? 854  VAL B CG2 1 
ATOM   1642 N  N   . PRO B 1 33  ? 34.094  14.780  -25.227  1.00 18.95  ? 855  PRO B N   1 
ATOM   1643 C  CA  . PRO B 1 33  ? 33.035  14.961  -24.229  1.00 18.95  ? 855  PRO B CA  1 
ATOM   1644 C  C   . PRO B 1 33  ? 33.287  14.230  -22.912  1.00 18.95  ? 855  PRO B C   1 
ATOM   1645 O  O   . PRO B 1 33  ? 34.179  13.392  -22.796  1.00 18.95  ? 855  PRO B O   1 
ATOM   1646 C  CB  . PRO B 1 33  ? 31.804  14.423  -24.941  1.00 21.50  ? 855  PRO B CB  1 
ATOM   1647 C  CG  . PRO B 1 33  ? 32.375  13.263  -25.708  1.00 21.50  ? 855  PRO B CG  1 
ATOM   1648 C  CD  . PRO B 1 33  ? 33.660  13.851  -26.289  1.00 21.50  ? 855  PRO B CD  1 
ATOM   1649 N  N   . THR B 1 34  ? 32.473  14.559  -21.924  1.00 21.71  ? 856  THR B N   1 
ATOM   1650 C  CA  . THR B 1 34  ? 32.562  13.941  -20.615  1.00 22.64  ? 856  THR B CA  1 
ATOM   1651 C  C   . THR B 1 34  ? 32.076  12.498  -20.699  1.00 23.38  ? 856  THR B C   1 
ATOM   1652 O  O   . THR B 1 34  ? 31.038  12.227  -21.294  1.00 22.41  ? 856  THR B O   1 
ATOM   1653 C  CB  . THR B 1 34  ? 31.693  14.728  -19.609  1.00 25.10  ? 856  THR B CB  1 
ATOM   1654 O  OG1 . THR B 1 34  ? 32.316  15.991  -19.353  1.00 22.77  ? 856  THR B OG1 1 
ATOM   1655 C  CG2 . THR B 1 34  ? 31.514  13.956  -18.296  1.00 23.62  ? 856  THR B CG2 1 
ATOM   1656 N  N   . LEU B 1 35  ? 32.848  11.567  -20.153  1.00 23.81  ? 857  LEU B N   1 
ATOM   1657 C  CA  . LEU B 1 35  ? 32.424  10.171  -20.144  1.00 25.24  ? 857  LEU B CA  1 
ATOM   1658 C  C   . LEU B 1 35  ? 31.745  9.937   -18.803  1.00 25.98  ? 857  LEU B C   1 
ATOM   1659 O  O   . LEU B 1 35  ? 32.144  10.518  -17.790  1.00 23.95  ? 857  LEU B O   1 
ATOM   1660 C  CB  . LEU B 1 35  ? 33.613  9.216   -20.315  1.00 27.33  ? 857  LEU B CB  1 
ATOM   1661 C  CG  . LEU B 1 35  ? 33.992  8.868   -21.762  1.00 27.53  ? 857  LEU B CG  1 
ATOM   1662 C  CD1 . LEU B 1 35  ? 34.665  10.059  -22.431  1.00 30.83  ? 857  LEU B CD1 1 
ATOM   1663 C  CD2 . LEU B 1 35  ? 34.925  7.654   -21.766  1.00 30.99  ? 857  LEU B CD2 1 
ATOM   1664 N  N   . THR B 1 36  ? 30.709  9.108   -18.802  1.00 27.57  ? 858  THR B N   1 
ATOM   1665 C  CA  . THR B 1 36  ? 29.957  8.811   -17.586  1.00 30.20  ? 858  THR B CA  1 
ATOM   1666 C  C   . THR B 1 36  ? 30.691  7.807   -16.707  1.00 29.61  ? 858  THR B C   1 
ATOM   1667 O  O   . THR B 1 36  ? 30.849  8.014   -15.507  1.00 31.17  ? 858  THR B O   1 
ATOM   1668 C  CB  . THR B 1 36  ? 28.565  8.231   -17.926  1.00 35.91  ? 858  THR B CB  1 
ATOM   1669 O  OG1 . THR B 1 36  ? 27.840  9.173   -18.721  1.00 37.87  ? 858  THR B OG1 1 
ATOM   1670 C  CG2 . THR B 1 36  ? 27.777  7.928   -16.653  1.00 36.77  ? 858  THR B CG2 1 
ATOM   1671 N  N   . ASN B 1 37  ? 31.145  6.722   -17.318  1.00 32.53  ? 859  ASN B N   1 
ATOM   1672 C  CA  . ASN B 1 37  ? 31.856  5.679   -16.595  1.00 33.66  ? 859  ASN B CA  1 
ATOM   1673 C  C   . ASN B 1 37  ? 33.188  5.404   -17.262  1.00 33.82  ? 859  ASN B C   1 
ATOM   1674 O  O   . ASN B 1 37  ? 33.418  5.814   -18.400  1.00 32.97  ? 859  ASN B O   1 
ATOM   1675 C  CB  . ASN B 1 37  ? 31.024  4.392   -16.585  1.00 31.32  ? 859  ASN B CB  1 
ATOM   1676 C  CG  . ASN B 1 37  ? 29.672  4.582   -15.940  1.00 32.13  ? 859  ASN B CG  1 
ATOM   1677 O  OD1 . ASN B 1 37  ? 29.582  4.879   -14.752  1.00 36.31  ? 859  ASN B OD1 1 
ATOM   1678 N  ND2 . ASN B 1 37  ? 28.611  4.417   -16.720  1.00 32.25  ? 859  ASN B ND2 1 
ATOM   1679 N  N   . PHE B 1 38  ? 34.069  4.714   -16.547  1.00 32.49  ? 860  PHE B N   1 
ATOM   1680 C  CA  . PHE B 1 38  ? 35.364  4.355   -17.096  1.00 33.61  ? 860  PHE B CA  1 
ATOM   1681 C  C   . PHE B 1 38  ? 35.122  3.248   -18.119  1.00 33.71  ? 860  PHE B C   1 
ATOM   1682 O  O   . PHE B 1 38  ? 34.289  2.367   -17.902  1.00 32.44  ? 860  PHE B O   1 
ATOM   1683 C  CB  . PHE B 1 38  ? 36.298  3.866   -15.986  1.00 43.78  ? 860  PHE B CB  1 
ATOM   1684 C  CG  . PHE B 1 38  ? 37.008  4.975   -15.264  1.00 46.76  ? 860  PHE B CG  1 
ATOM   1685 C  CD1 . PHE B 1 38  ? 38.158  5.545   -15.802  1.00 46.00  ? 860  PHE B CD1 1 
ATOM   1686 C  CD2 . PHE B 1 38  ? 36.512  5.476   -14.064  1.00 46.92  ? 860  PHE B CD2 1 
ATOM   1687 C  CE1 . PHE B 1 38  ? 38.801  6.596   -15.158  1.00 46.41  ? 860  PHE B CE1 1 
ATOM   1688 C  CE2 . PHE B 1 38  ? 37.150  6.530   -13.412  1.00 44.46  ? 860  PHE B CE2 1 
ATOM   1689 C  CZ  . PHE B 1 38  ? 38.294  7.090   -13.959  1.00 44.92  ? 860  PHE B CZ  1 
ATOM   1690 N  N   . PRO B 1 39  ? 35.827  3.302   -19.259  1.00 31.34  ? 861  PRO B N   1 
ATOM   1691 C  CA  . PRO B 1 39  ? 35.741  2.338   -20.363  1.00 30.79  ? 861  PRO B CA  1 
ATOM   1692 C  C   . PRO B 1 39  ? 36.198  0.941   -19.961  1.00 30.65  ? 861  PRO B C   1 
ATOM   1693 O  O   . PRO B 1 39  ? 37.229  0.780   -19.304  1.00 29.31  ? 861  PRO B O   1 
ATOM   1694 C  CB  . PRO B 1 39  ? 36.658  2.946   -21.423  1.00 37.99  ? 861  PRO B CB  1 
ATOM   1695 C  CG  . PRO B 1 39  ? 36.557  4.416   -21.151  1.00 38.29  ? 861  PRO B CG  1 
ATOM   1696 C  CD  . PRO B 1 39  ? 36.647  4.462   -19.651  1.00 38.65  ? 861  PRO B CD  1 
ATOM   1697 N  N   . SER B 1 40  ? 35.435  -0.066  -20.371  1.00 41.69  ? 862  SER B N   1 
ATOM   1698 C  CA  . SER B 1 40  ? 35.763  -1.448  -20.055  1.00 42.81  ? 862  SER B CA  1 
ATOM   1699 C  C   . SER B 1 40  ? 37.021  -1.912  -20.786  1.00 42.50  ? 862  SER B C   1 
ATOM   1700 O  O   . SER B 1 40  ? 37.806  -2.690  -20.247  1.00 43.98  ? 862  SER B O   1 
ATOM   1701 C  CB  . SER B 1 40  ? 34.589  -2.360  -20.422  1.00 37.00  ? 862  SER B CB  1 
ATOM   1702 O  OG  . SER B 1 40  ? 34.271  -2.254  -21.798  1.00 37.07  ? 862  SER B OG  1 
ATOM   1703 N  N   . GLY B 1 41  ? 37.215  -1.428  -22.008  1.00 34.08  ? 863  GLY B N   1 
ATOM   1704 C  CA  . GLY B 1 41  ? 38.375  -1.831  -22.780  1.00 34.38  ? 863  GLY B CA  1 
ATOM   1705 C  C   . GLY B 1 41  ? 39.245  -0.685  -23.265  1.00 33.81  ? 863  GLY B C   1 
ATOM   1706 O  O   . GLY B 1 41  ? 39.400  0.323   -22.579  1.00 33.21  ? 863  GLY B O   1 
ATOM   1707 N  N   . GLU B 1 42  ? 39.815  -0.851  -24.453  1.00 35.42  ? 864  GLU B N   1 
ATOM   1708 C  CA  . GLU B 1 42  ? 40.685  0.158   -25.051  1.00 35.77  ? 864  GLU B CA  1 
ATOM   1709 C  C   . GLU B 1 42  ? 39.950  1.473   -25.292  1.00 34.38  ? 864  GLU B C   1 
ATOM   1710 O  O   . GLU B 1 42  ? 38.812  1.487   -25.751  1.00 34.47  ? 864  GLU B O   1 
ATOM   1711 C  CB  . GLU B 1 42  ? 41.246  -0.354  -26.376  1.00 43.27  ? 864  GLU B CB  1 
ATOM   1712 C  CG  . GLU B 1 42  ? 42.166  -1.550  -26.257  1.00 45.14  ? 864  GLU B CG  1 
ATOM   1713 C  CD  . GLU B 1 42  ? 42.575  -2.090  -27.614  1.00 54.79  ? 864  GLU B CD  1 
ATOM   1714 O  OE1 . GLU B 1 42  ? 41.695  -2.601  -28.344  1.00 62.30  ? 864  GLU B OE1 1 
ATOM   1715 O  OE2 . GLU B 1 42  ? 43.774  -1.997  -27.957  1.00 58.51  ? 864  GLU B OE2 1 
ATOM   1716 N  N   . TRP B 1 43  ? 40.613  2.581   -24.989  1.00 30.15  ? 865  TRP B N   1 
ATOM   1717 C  CA  . TRP B 1 43  ? 39.998  3.888   -25.177  1.00 28.01  ? 865  TRP B CA  1 
ATOM   1718 C  C   . TRP B 1 43  ? 40.942  4.817   -25.921  1.00 28.19  ? 865  TRP B C   1 
ATOM   1719 O  O   . TRP B 1 43  ? 42.159  4.753   -25.743  1.00 28.00  ? 865  TRP B O   1 
ATOM   1720 C  CB  . TRP B 1 43  ? 39.641  4.486   -23.821  1.00 27.47  ? 865  TRP B CB  1 
ATOM   1721 C  CG  . TRP B 1 43  ? 39.023  5.839   -23.906  1.00 27.74  ? 865  TRP B CG  1 
ATOM   1722 C  CD1 . TRP B 1 43  ? 37.729  6.131   -24.218  1.00 24.24  ? 865  TRP B CD1 1 
ATOM   1723 C  CD2 . TRP B 1 43  ? 39.670  7.089   -23.653  1.00 25.06  ? 865  TRP B CD2 1 
ATOM   1724 N  NE1 . TRP B 1 43  ? 37.525  7.489   -24.167  1.00 25.70  ? 865  TRP B NE1 1 
ATOM   1725 C  CE2 . TRP B 1 43  ? 38.702  8.101   -23.822  1.00 26.37  ? 865  TRP B CE2 1 
ATOM   1726 C  CE3 . TRP B 1 43  ? 40.977  7.452   -23.295  1.00 24.13  ? 865  TRP B CE3 1 
ATOM   1727 C  CZ2 . TRP B 1 43  ? 38.995  9.455   -23.645  1.00 26.98  ? 865  TRP B CZ2 1 
ATOM   1728 C  CZ3 . TRP B 1 43  ? 41.269  8.795   -23.116  1.00 26.68  ? 865  TRP B CZ3 1 
ATOM   1729 C  CH2 . TRP B 1 43  ? 40.278  9.784   -23.292  1.00 26.37  ? 865  TRP B CH2 1 
ATOM   1730 N  N   . ILE B 1 44  ? 40.370  5.672   -26.764  1.00 29.49  ? 866  ILE B N   1 
ATOM   1731 C  CA  . ILE B 1 44  ? 41.139  6.633   -27.547  1.00 29.44  ? 866  ILE B CA  1 
ATOM   1732 C  C   . ILE B 1 44  ? 40.554  8.037   -27.324  1.00 29.01  ? 866  ILE B C   1 
ATOM   1733 O  O   . ILE B 1 44  ? 39.368  8.258   -27.552  1.00 31.00  ? 866  ILE B O   1 
ATOM   1734 C  CB  . ILE B 1 44  ? 41.078  6.275   -29.045  1.00 25.39  ? 866  ILE B CB  1 
ATOM   1735 C  CG1 . ILE B 1 44  ? 41.472  4.807   -29.234  1.00 28.43  ? 866  ILE B CG1 1 
ATOM   1736 C  CG2 . ILE B 1 44  ? 42.020  7.176   -29.844  1.00 22.60  ? 866  ILE B CG2 1 
ATOM   1737 C  CD1 . ILE B 1 44  ? 41.347  4.313   -30.664  1.00 33.12  ? 866  ILE B CD1 1 
ATOM   1738 N  N   . CYS B 1 45  ? 41.386  8.978   -26.878  1.00 24.25  ? 867  CYS B N   1 
ATOM   1739 C  CA  . CYS B 1 45  ? 40.920  10.340  -26.606  1.00 21.37  ? 867  CYS B CA  1 
ATOM   1740 C  C   . CYS B 1 45  ? 40.442  11.070  -27.860  1.00 18.52  ? 867  CYS B C   1 
ATOM   1741 O  O   . CYS B 1 45  ? 40.661  10.618  -28.983  1.00 19.18  ? 867  CYS B O   1 
ATOM   1742 C  CB  . CYS B 1 45  ? 42.019  11.162  -25.918  1.00 20.61  ? 867  CYS B CB  1 
ATOM   1743 S  SG  . CYS B 1 45  ? 43.241  11.918  -27.030  1.00 20.95  ? 867  CYS B SG  1 
ATOM   1744 N  N   . THR B 1 46  ? 39.792  12.206  -27.647  1.00 20.63  ? 868  THR B N   1 
ATOM   1745 C  CA  . THR B 1 46  ? 39.251  13.025  -28.723  1.00 20.21  ? 868  THR B CA  1 
ATOM   1746 C  C   . THR B 1 46  ? 40.320  13.562  -29.671  1.00 20.30  ? 868  THR B C   1 
ATOM   1747 O  O   . THR B 1 46  ? 40.040  13.860  -30.829  1.00 21.12  ? 868  THR B O   1 
ATOM   1748 C  CB  . THR B 1 46  ? 38.419  14.193  -28.131  1.00 20.14  ? 868  THR B CB  1 
ATOM   1749 O  OG1 . THR B 1 46  ? 37.119  13.704  -27.774  1.00 23.16  ? 868  THR B OG1 1 
ATOM   1750 C  CG2 . THR B 1 46  ? 38.273  15.345  -29.126  1.00 18.08  ? 868  THR B CG2 1 
ATOM   1751 N  N   . PHE B 1 47  ? 41.546  13.689  -29.181  1.00 22.65  ? 869  PHE B N   1 
ATOM   1752 C  CA  . PHE B 1 47  ? 42.628  14.176  -30.021  1.00 24.34  ? 869  PHE B CA  1 
ATOM   1753 C  C   . PHE B 1 47  ? 43.020  13.138  -31.066  1.00 24.86  ? 869  PHE B C   1 
ATOM   1754 O  O   . PHE B 1 47  ? 43.220  13.461  -32.229  1.00 25.13  ? 869  PHE B O   1 
ATOM   1755 C  CB  . PHE B 1 47  ? 43.864  14.495  -29.176  1.00 20.18  ? 869  PHE B CB  1 
ATOM   1756 C  CG  . PHE B 1 47  ? 43.714  15.706  -28.309  1.00 19.73  ? 869  PHE B CG  1 
ATOM   1757 C  CD1 . PHE B 1 47  ? 43.240  16.900  -28.837  1.00 20.28  ? 869  PHE B CD1 1 
ATOM   1758 C  CD2 . PHE B 1 47  ? 44.097  15.668  -26.974  1.00 22.37  ? 869  PHE B CD2 1 
ATOM   1759 C  CE1 . PHE B 1 47  ? 43.153  18.042  -28.046  1.00 22.97  ? 869  PHE B CE1 1 
ATOM   1760 C  CE2 . PHE B 1 47  ? 44.016  16.807  -26.178  1.00 26.04  ? 869  PHE B CE2 1 
ATOM   1761 C  CZ  . PHE B 1 47  ? 43.544  17.994  -26.717  1.00 24.09  ? 869  PHE B CZ  1 
ATOM   1762 N  N   . CYS B 1 48  ? 43.106  11.889  -30.626  1.00 20.70  ? 870  CYS B N   1 
ATOM   1763 C  CA  . CYS B 1 48  ? 43.540  10.770  -31.462  1.00 24.94  ? 870  CYS B CA  1 
ATOM   1764 C  C   . CYS B 1 48  ? 42.485  10.063  -32.286  1.00 25.52  ? 870  CYS B C   1 
ATOM   1765 O  O   . CYS B 1 48  ? 42.782  9.520   -33.343  1.00 28.38  ? 870  CYS B O   1 
ATOM   1766 C  CB  . CYS B 1 48  ? 44.224  9.724   -30.581  1.00 19.09  ? 870  CYS B CB  1 
ATOM   1767 S  SG  . CYS B 1 48  ? 45.529  10.381  -29.531  1.00 28.37  ? 870  CYS B SG  1 
ATOM   1768 N  N   . ARG B 1 49  ? 41.259  10.052  -31.789  1.00 25.88  ? 871  ARG B N   1 
ATOM   1769 C  CA  . ARG B 1 49  ? 40.172  9.365   -32.463  1.00 27.10  ? 871  ARG B CA  1 
ATOM   1770 C  C   . ARG B 1 49  ? 39.881  9.914   -33.857  1.00 26.69  ? 871  ARG B C   1 
ATOM   1771 O  O   . ARG B 1 49  ? 39.828  11.125  -34.056  1.00 27.79  ? 871  ARG B O   1 
ATOM   1772 C  CB  . ARG B 1 49  ? 38.933  9.445   -31.583  1.00 27.88  ? 871  ARG B CB  1 
ATOM   1773 C  CG  . ARG B 1 49  ? 37.727  8.793   -32.139  1.00 32.68  ? 871  ARG B CG  1 
ATOM   1774 C  CD  . ARG B 1 49  ? 36.531  9.600   -31.700  1.00 36.47  ? 871  ARG B CD  1 
ATOM   1775 N  NE  . ARG B 1 49  ? 35.596  8.810   -30.927  1.00 39.36  ? 871  ARG B NE  1 
ATOM   1776 C  CZ  . ARG B 1 49  ? 34.449  9.283   -30.467  1.00 38.68  ? 871  ARG B CZ  1 
ATOM   1777 N  NH1 . ARG B 1 49  ? 34.113  10.544  -30.704  1.00 30.84  ? 871  ARG B NH1 1 
ATOM   1778 N  NH2 . ARG B 1 49  ? 33.638  8.491   -29.786  1.00 41.49  ? 871  ARG B NH2 1 
ATOM   1779 N  N   . ASP B 1 50  ? 39.694  9.014   -34.821  1.00 25.19  ? 872  ASP B N   1 
ATOM   1780 C  CA  . ASP B 1 50  ? 39.410  9.416   -36.192  1.00 25.30  ? 872  ASP B CA  1 
ATOM   1781 C  C   . ASP B 1 50  ? 38.109  10.217  -36.240  1.00 25.11  ? 872  ASP B C   1 
ATOM   1782 O  O   . ASP B 1 50  ? 37.116  9.817   -35.639  1.00 22.79  ? 872  ASP B O   1 
ATOM   1783 C  CB  . ASP B 1 50  ? 39.278  8.188   -37.087  1.00 34.27  ? 872  ASP B CB  1 
ATOM   1784 C  CG  . ASP B 1 50  ? 39.254  8.547   -38.555  1.00 38.03  ? 872  ASP B CG  1 
ATOM   1785 O  OD1 . ASP B 1 50  ? 40.320  8.921   -39.085  1.00 39.19  ? 872  ASP B OD1 1 
ATOM   1786 O  OD2 . ASP B 1 50  ? 38.171  8.470   -39.173  1.00 43.04  ? 872  ASP B OD2 1 
ATOM   1787 N  N   . LEU B 1 51  ? 38.112  11.339  -36.956  1.00 27.43  ? 873  LEU B N   1 
ATOM   1788 C  CA  . LEU B 1 51  ? 36.921  12.180  -37.052  1.00 28.06  ? 873  LEU B CA  1 
ATOM   1789 C  C   . LEU B 1 51  ? 35.827  11.593  -37.924  1.00 29.28  ? 873  LEU B C   1 
ATOM   1790 O  O   . LEU B 1 51  ? 34.642  11.758  -37.624  1.00 27.76  ? 873  LEU B O   1 
ATOM   1791 C  CB  . LEU B 1 51  ? 37.281  13.561  -37.600  1.00 22.75  ? 873  LEU B CB  1 
ATOM   1792 C  CG  . LEU B 1 51  ? 38.085  14.505  -36.709  1.00 23.63  ? 873  LEU B CG  1 
ATOM   1793 C  CD1 . LEU B 1 51  ? 38.622  15.647  -37.556  1.00 21.28  ? 873  LEU B CD1 1 
ATOM   1794 C  CD2 . LEU B 1 51  ? 37.215  15.019  -35.577  1.00 22.87  ? 873  LEU B CD2 1 
ATOM   1795 N  N   . SER B 1 52  ? 36.225  10.918  -39.003  1.00 27.74  ? 874  SER B N   1 
ATOM   1796 C  CA  . SER B 1 52  ? 35.276  10.326  -39.949  1.00 30.86  ? 874  SER B CA  1 
ATOM   1797 C  C   . SER B 1 52  ? 34.591  9.082   -39.418  1.00 31.90  ? 874  SER B C   1 
ATOM   1798 O  O   . SER B 1 52  ? 33.367  8.985   -39.415  1.00 32.40  ? 874  SER B O   1 
ATOM   1799 C  CB  . SER B 1 52  ? 35.984  9.961   -41.257  1.00 40.42  ? 874  SER B CB  1 
ATOM   1800 O  OG  . SER B 1 52  ? 36.581  11.094  -41.857  1.00 46.76  ? 874  SER B OG  1 
ATOM   1801 N  N   . LYS B 1 53  ? 35.397  8.118   -38.997  1.00 33.41  ? 875  LYS B N   1 
ATOM   1802 C  CA  . LYS B 1 53  ? 34.882  6.866   -38.469  1.00 36.25  ? 875  LYS B CA  1 
ATOM   1803 C  C   . LYS B 1 53  ? 35.587  6.564   -37.154  1.00 33.89  ? 875  LYS B C   1 
ATOM   1804 O  O   . LYS B 1 53  ? 36.631  5.914   -37.135  1.00 33.60  ? 875  LYS B O   1 
ATOM   1805 C  CB  . LYS B 1 53  ? 35.120  5.735   -39.478  1.00 54.67  ? 875  LYS B CB  1 
ATOM   1806 C  CG  . LYS B 1 53  ? 34.208  5.761   -40.709  1.00 62.73  ? 875  LYS B CG  1 
ATOM   1807 C  CD  . LYS B 1 53  ? 32.880  5.035   -40.457  1.00 69.39  ? 875  LYS B CD  1 
ATOM   1808 C  CE  . LYS B 1 53  ? 32.054  4.884   -41.738  1.00 73.31  ? 875  LYS B CE  1 
ATOM   1809 N  NZ  . LYS B 1 53  ? 30.859  4.002   -41.560  1.00 73.68  ? 875  LYS B NZ  1 
ATOM   1810 N  N   . PRO B 1 54  ? 35.028  7.051   -36.036  1.00 33.33  ? 876  PRO B N   1 
ATOM   1811 C  CA  . PRO B 1 54  ? 35.614  6.828   -34.709  1.00 34.13  ? 876  PRO B CA  1 
ATOM   1812 C  C   . PRO B 1 54  ? 35.865  5.340   -34.465  1.00 34.20  ? 876  PRO B C   1 
ATOM   1813 O  O   . PRO B 1 54  ? 34.991  4.518   -34.738  1.00 35.16  ? 876  PRO B O   1 
ATOM   1814 C  CB  . PRO B 1 54  ? 34.551  7.389   -33.769  1.00 33.56  ? 876  PRO B CB  1 
ATOM   1815 C  CG  . PRO B 1 54  ? 33.926  8.477   -34.584  1.00 35.59  ? 876  PRO B CG  1 
ATOM   1816 C  CD  . PRO B 1 54  ? 33.785  7.836   -35.936  1.00 33.22  ? 876  PRO B CD  1 
ATOM   1817 N  N   . GLU B 1 55  ? 37.048  4.997   -33.957  1.00 31.92  ? 877  GLU B N   1 
ATOM   1818 C  CA  . GLU B 1 55  ? 37.384  3.596   -33.687  1.00 32.37  ? 877  GLU B CA  1 
ATOM   1819 C  C   . GLU B 1 55  ? 36.566  3.059   -32.515  1.00 32.45  ? 877  GLU B C   1 
ATOM   1820 O  O   . GLU B 1 55  ? 36.306  1.861   -32.420  1.00 33.24  ? 877  GLU B O   1 
ATOM   1821 C  CB  . GLU B 1 55  ? 38.880  3.435   -33.386  1.00 41.68  ? 877  GLU B CB  1 
ATOM   1822 C  CG  . GLU B 1 55  ? 39.796  3.747   -34.567  1.00 42.93  ? 877  GLU B CG  1 
ATOM   1823 C  CD  . GLU B 1 55  ? 40.158  5.219   -34.666  1.00 46.49  ? 877  GLU B CD  1 
ATOM   1824 O  OE1 . GLU B 1 55  ? 39.272  6.071   -34.446  1.00 40.10  ? 877  GLU B OE1 1 
ATOM   1825 O  OE2 . GLU B 1 55  ? 41.333  5.523   -34.972  1.00 42.73  ? 877  GLU B OE2 1 
ATOM   1826 N  N   . VAL B 1 56  ? 36.162  3.957   -31.624  1.00 30.45  ? 878  VAL B N   1 
ATOM   1827 C  CA  . VAL B 1 56  ? 35.363  3.587   -30.462  1.00 29.58  ? 878  VAL B CA  1 
ATOM   1828 C  C   . VAL B 1 56  ? 34.270  4.629   -30.276  1.00 30.21  ? 878  VAL B C   1 
ATOM   1829 O  O   . VAL B 1 56  ? 34.355  5.734   -30.812  1.00 28.94  ? 878  VAL B O   1 
ATOM   1830 C  CB  . VAL B 1 56  ? 36.221  3.547   -29.176  1.00 37.46  ? 878  VAL B CB  1 
ATOM   1831 C  CG1 . VAL B 1 56  ? 37.343  2.540   -29.329  1.00 38.87  ? 878  VAL B CG1 1 
ATOM   1832 C  CG2 . VAL B 1 56  ? 36.797  4.936   -28.885  1.00 36.63  ? 878  VAL B CG2 1 
ATOM   1833 N  N   . GLU B 1 57  ? 33.235  4.271   -29.527  1.00 32.70  ? 879  GLU B N   1 
ATOM   1834 C  CA  . GLU B 1 57  ? 32.148  5.195   -29.251  1.00 34.43  ? 879  GLU B CA  1 
ATOM   1835 C  C   . GLU B 1 57  ? 32.181  5.475   -27.755  1.00 32.85  ? 879  GLU B C   1 
ATOM   1836 O  O   . GLU B 1 57  ? 32.353  4.556   -26.958  1.00 32.72  ? 879  GLU B O   1 
ATOM   1837 C  CB  . GLU B 1 57  ? 30.804  4.571   -29.630  1.00 51.67  ? 879  GLU B CB  1 
ATOM   1838 C  CG  . GLU B 1 57  ? 29.619  5.492   -29.386  1.00 59.39  ? 879  GLU B CG  1 
ATOM   1839 C  CD  . GLU B 1 57  ? 28.286  4.815   -29.642  1.00 65.55  ? 879  GLU B CD  1 
ATOM   1840 O  OE1 . GLU B 1 57  ? 27.947  3.863   -28.906  1.00 64.37  ? 879  GLU B OE1 1 
ATOM   1841 O  OE2 . GLU B 1 57  ? 27.579  5.237   -30.582  1.00 68.31  ? 879  GLU B OE2 1 
ATOM   1842 N  N   . TYR B 1 58  ? 32.040  6.739   -27.369  1.00 34.46  ? 880  TYR B N   1 
ATOM   1843 C  CA  . TYR B 1 58  ? 32.049  7.083   -25.951  1.00 33.72  ? 880  TYR B CA  1 
ATOM   1844 C  C   . TYR B 1 58  ? 30.654  6.811   -25.396  1.00 34.04  ? 880  TYR B C   1 
ATOM   1845 O  O   . TYR B 1 58  ? 29.652  7.037   -26.079  1.00 34.51  ? 880  TYR B O   1 
ATOM   1846 C  CB  . TYR B 1 58  ? 32.435  8.553   -25.748  1.00 30.00  ? 880  TYR B CB  1 
ATOM   1847 C  CG  . TYR B 1 58  ? 33.780  8.937   -26.351  1.00 27.89  ? 880  TYR B CG  1 
ATOM   1848 C  CD1 . TYR B 1 58  ? 34.893  8.100   -26.235  1.00 26.67  ? 880  TYR B CD1 1 
ATOM   1849 C  CD2 . TYR B 1 58  ? 33.940  10.146  -27.024  1.00 24.36  ? 880  TYR B CD2 1 
ATOM   1850 C  CE1 . TYR B 1 58  ? 36.135  8.463   -26.782  1.00 26.43  ? 880  TYR B CE1 1 
ATOM   1851 C  CE2 . TYR B 1 58  ? 35.176  10.521  -27.573  1.00 20.51  ? 880  TYR B CE2 1 
ATOM   1852 C  CZ  . TYR B 1 58  ? 36.262  9.682   -27.452  1.00 21.76  ? 880  TYR B CZ  1 
ATOM   1853 O  OH  . TYR B 1 58  ? 37.467  10.061  -28.004  1.00 22.22  ? 880  TYR B OH  1 
ATOM   1854 N  N   . ASP B 1 59  ? 30.588  6.317   -24.165  1.00 39.34  ? 881  ASP B N   1 
ATOM   1855 C  CA  . ASP B 1 59  ? 29.307  5.991   -23.549  1.00 40.66  ? 881  ASP B CA  1 
ATOM   1856 C  C   . ASP B 1 59  ? 28.293  7.133   -23.581  1.00 41.48  ? 881  ASP B C   1 
ATOM   1857 O  O   . ASP B 1 59  ? 27.088  6.901   -23.712  1.00 42.03  ? 881  ASP B O   1 
ATOM   1858 C  CB  . ASP B 1 59  ? 29.519  5.511   -22.103  1.00 39.51  ? 881  ASP B CB  1 
ATOM   1859 C  CG  . ASP B 1 59  ? 30.150  6.571   -21.205  1.00 40.63  ? 881  ASP B CG  1 
ATOM   1860 O  OD1 . ASP B 1 59  ? 30.304  7.731   -21.642  1.00 43.63  ? 881  ASP B OD1 1 
ATOM   1861 O  OD2 . ASP B 1 59  ? 30.486  6.239   -20.046  1.00 36.68  ? 881  ASP B OD2 1 
ATOM   1862 N  N   . CYS B 1 60  ? 28.779  8.364   -23.474  1.00 35.86  ? 882  CYS B N   1 
ATOM   1863 C  CA  . CYS B 1 60  ? 27.899  9.527   -23.483  1.00 34.56  ? 882  CYS B CA  1 
ATOM   1864 C  C   . CYS B 1 60  ? 27.205  9.753   -24.829  1.00 34.57  ? 882  CYS B C   1 
ATOM   1865 O  O   . CYS B 1 60  ? 26.194  10.454  -24.894  1.00 33.59  ? 882  CYS B O   1 
ATOM   1866 C  CB  . CYS B 1 60  ? 28.688  10.787  -23.093  1.00 39.41  ? 882  CYS B CB  1 
ATOM   1867 S  SG  . CYS B 1 60  ? 30.116  11.134  -24.144  1.00 42.88  ? 882  CYS B SG  1 
ATOM   1868 N  N   . ASP B 1 61  ? 27.730  9.162   -25.900  1.00 32.29  ? 883  ASP B N   1 
ATOM   1869 C  CA  . ASP B 1 61  ? 27.140  9.343   -27.226  1.00 33.35  ? 883  ASP B CA  1 
ATOM   1870 C  C   . ASP B 1 61  ? 26.288  8.159   -27.647  1.00 32.79  ? 883  ASP B C   1 
ATOM   1871 O  O   . ASP B 1 61  ? 25.569  8.239   -28.644  1.00 33.39  ? 883  ASP B O   1 
ATOM   1872 C  CB  . ASP B 1 61  ? 28.236  9.609   -28.276  1.00 43.14  ? 883  ASP B CB  1 
ATOM   1873 C  CG  . ASP B 1 61  ? 28.990  10.907  -28.015  1.00 43.98  ? 883  ASP B CG  1 
ATOM   1874 O  OD1 . ASP B 1 61  ? 28.343  11.957  -27.800  1.00 40.26  ? 883  ASP B OD1 1 
ATOM   1875 O  OD2 . ASP B 1 61  ? 30.236  10.876  -28.029  1.00 44.31  ? 883  ASP B OD2 1 
ATOM   1876 N  N   . ALA B 1 62  ? 26.366  7.065   -26.893  1.00 52.99  ? 884  ALA B N   1 
ATOM   1877 C  CA  . ALA B 1 62  ? 25.568  5.900   -27.222  1.00 52.99  ? 884  ALA B CA  1 
ATOM   1878 C  C   . ALA B 1 62  ? 24.135  6.380   -27.418  1.00 52.99  ? 884  ALA B C   1 
ATOM   1879 O  O   . ALA B 1 62  ? 23.669  7.264   -26.683  1.00 52.99  ? 884  ALA B O   1 
ATOM   1880 C  CB  . ALA B 1 62  ? 25.624  4.865   -26.089  1.00 46.80  ? 884  ALA B CB  1 
ATOM   1881 N  N   . PRO B 1 63  ? 23.418  5.818   -28.419  1.00 73.01  ? 885  PRO B N   1 
ATOM   1882 C  CA  . PRO B 1 63  ? 22.024  6.210   -28.677  1.00 73.01  ? 885  PRO B CA  1 
ATOM   1883 C  C   . PRO B 1 63  ? 21.115  5.962   -27.472  1.00 73.01  ? 885  PRO B C   1 
ATOM   1884 O  O   . PRO B 1 63  ? 21.178  4.889   -26.848  1.00 73.01  ? 885  PRO B O   1 
ATOM   1885 C  CB  . PRO B 1 63  ? 21.605  5.297   -29.831  1.00 79.28  ? 885  PRO B CB  1 
ATOM   1886 C  CG  . PRO B 1 63  ? 22.878  5.165   -30.638  1.00 79.28  ? 885  PRO B CG  1 
ATOM   1887 C  CD  . PRO B 1 63  ? 23.921  4.964   -29.515  1.00 79.28  ? 885  PRO B CD  1 
ATOM   1888 N  N   . SER B 1 64  ? 20.240  6.912   -27.159  1.00 68.00  ? 886  SER B N   1 
ATOM   1889 C  CA  . SER B 1 64  ? 19.307  6.722   -26.032  1.00 68.00  ? 886  SER B CA  1 
ATOM   1890 C  C   . SER B 1 64  ? 18.632  5.337   -26.022  1.00 68.00  ? 886  SER B C   1 
ATOM   1891 O  O   . SER B 1 64  ? 18.809  4.585   -25.047  1.00 68.00  ? 886  SER B O   1 
ATOM   1892 C  CB  . SER B 1 64  ? 18.233  7.790   -26.076  1.00 56.05  ? 886  SER B CB  1 
ATOM   1893 O  OG  . SER B 1 64  ? 17.337  7.525   -27.156  1.00 56.05  ? 886  SER B OG  1 
ATOM   1894 N  N   . HIS B 1 65  ? 17.829  5.036   -27.064  1.00 70.00  ? 887  HIS B N   1 
ATOM   1895 C  CA  . HIS B 1 65  ? 17.162  3.708   -27.268  1.00 70.00  ? 887  HIS B CA  1 
ATOM   1896 C  C   . HIS B 1 65  ? 18.027  2.856   -28.175  1.00 70.00  ? 887  HIS B C   1 
ATOM   1897 O  O   . HIS B 1 65  ? 18.864  3.374   -28.927  1.00 70.00  ? 887  HIS B O   1 
ATOM   1898 C  CB  . HIS B 1 65  ? 15.792  3.785   -27.993  1.00 85.48  ? 887  HIS B CB  1 
ATOM   1899 C  CG  . HIS B 1 65  ? 14.746  4.555   -27.246  1.00 85.48  ? 887  HIS B CG  1 
ATOM   1900 N  ND1 . HIS B 1 65  ? 14.488  5.884   -27.500  1.00 85.48  ? 887  HIS B ND1 1 
ATOM   1901 C  CD2 . HIS B 1 65  ? 13.933  4.208   -26.218  1.00 85.48  ? 887  HIS B CD2 1 
ATOM   1902 C  CE1 . HIS B 1 65  ? 13.569  6.326   -26.660  1.00 85.48  ? 887  HIS B CE1 1 
ATOM   1903 N  NE2 . HIS B 1 65  ? 13.214  5.330   -25.870  1.00 85.48  ? 887  HIS B NE2 1 
ATOM   1904 N  N   . ASN B 1 66  ? 17.747  1.556   -28.164  1.00 65.32  ? 888  ASN B N   1 
ATOM   1905 C  CA  . ASN B 1 66  ? 18.455  0.563   -28.973  1.00 65.32  ? 888  ASN B CA  1 
ATOM   1906 C  C   . ASN B 1 66  ? 17.812  0.520   -30.336  1.00 65.32  ? 888  ASN B C   1 
ATOM   1907 O  O   . ASN B 1 66  ? 18.488  0.735   -31.352  1.00 65.32  ? 888  ASN B O   1 
ATOM   1908 C  CB  . ASN B 1 66  ? 18.363  -0.834  -28.296  1.00 59.44  ? 888  ASN B CB  1 
ATOM   1909 C  CG  . ASN B 1 66  ? 19.137  -1.914  -29.026  1.00 59.44  ? 888  ASN B CG  1 
ATOM   1910 O  OD1 . ASN B 1 66  ? 18.584  -2.959  -29.440  1.00 59.44  ? 888  ASN B OD1 1 
ATOM   1911 N  ND2 . ASN B 1 66  ? 20.432  -1.683  -29.169  1.00 59.44  ? 888  ASN B ND2 1 
ATOM   1912 N  N   . SER B 1 67  ? 16.504  0.278   -30.381  1.00 62.42  ? 889  SER B N   1 
ATOM   1913 C  CA  . SER B 1 67  ? 15.829  0.187   -31.678  1.00 62.42  ? 889  SER B CA  1 
ATOM   1914 C  C   . SER B 1 67  ? 16.179  1.402   -32.540  1.00 62.42  ? 889  SER B C   1 
ATOM   1915 O  O   . SER B 1 67  ? 16.445  2.503   -32.024  1.00 62.42  ? 889  SER B O   1 
ATOM   1916 C  CB  . SER B 1 67  ? 14.306  0.092   -31.518  1.00 61.95  ? 889  SER B CB  1 
ATOM   1917 O  OG  . SER B 1 67  ? 13.698  -0.495  -32.678  1.00 61.95  ? 889  SER B OG  1 
ATOM   1918 N  N   . GLU B 1 68  ? 16.196  1.181   -33.855  1.00 84.07  ? 890  GLU B N   1 
ATOM   1919 C  CA  . GLU B 1 68  ? 16.511  2.207   -34.857  1.00 84.07  ? 890  GLU B CA  1 
ATOM   1920 C  C   . GLU B 1 68  ? 15.669  3.451   -34.605  1.00 84.07  ? 890  GLU B C   1 
ATOM   1921 O  O   . GLU B 1 68  ? 14.432  3.432   -34.689  1.00 84.07  ? 890  GLU B O   1 
ATOM   1922 C  CB  . GLU B 1 68  ? 16.243  1.663   -36.273  1.00 100.71 ? 890  GLU B CB  1 
ATOM   1923 C  CG  . GLU B 1 68  ? 17.405  0.780   -36.788  1.00 100.71 ? 890  GLU B CG  1 
ATOM   1924 C  CD  . GLU B 1 68  ? 16.927  -0.237  -37.782  1.00 100.71 ? 890  GLU B CD  1 
ATOM   1925 O  OE1 . GLU B 1 68  ? 15.871  -0.860  -37.498  1.00 100.71 ? 890  GLU B OE1 1 
ATOM   1926 O  OE2 . GLU B 1 68  ? 17.587  -0.403  -38.840  1.00 100.71 ? 890  GLU B OE2 1 
ATOM   1927 N  N   . LYS B 1 69  ? 16.365  4.528   -34.265  1.00 65.84  ? 891  LYS B N   1 
ATOM   1928 C  CA  . LYS B 1 69  ? 15.746  5.819   -33.970  1.00 65.84  ? 891  LYS B CA  1 
ATOM   1929 C  C   . LYS B 1 69  ? 14.882  6.396   -35.084  1.00 65.84  ? 891  LYS B C   1 
ATOM   1930 O  O   . LYS B 1 69  ? 15.185  6.298   -36.276  1.00 65.84  ? 891  LYS B O   1 
ATOM   1931 C  CB  . LYS B 1 69  ? 16.816  6.848   -33.619  1.00 79.31  ? 891  LYS B CB  1 
ATOM   1932 C  CG  . LYS B 1 69  ? 17.818  6.342   -32.602  1.00 79.31  ? 891  LYS B CG  1 
ATOM   1933 C  CD  . LYS B 1 69  ? 18.506  7.506   -31.874  1.00 79.31  ? 891  LYS B CD  1 
ATOM   1934 C  CE  . LYS B 1 69  ? 17.694  7.965   -30.692  1.00 79.31  ? 891  LYS B CE  1 
ATOM   1935 N  NZ  . LYS B 1 69  ? 18.620  8.442   -29.645  1.00 79.31  ? 891  LYS B NZ  1 
ATOM   1936 N  N   . LYS B 1 70  ? 13.816  7.049   -34.650  1.00 43.20  ? 892  LYS B N   1 
ATOM   1937 C  CA  . LYS B 1 70  ? 12.870  7.704   -35.535  1.00 43.20  ? 892  LYS B CA  1 
ATOM   1938 C  C   . LYS B 1 70  ? 13.613  8.960   -35.982  1.00 43.20  ? 892  LYS B C   1 
ATOM   1939 O  O   . LYS B 1 70  ? 14.203  9.647   -35.153  1.00 43.20  ? 892  LYS B O   1 
ATOM   1940 C  CB  . LYS B 1 70  ? 11.603  8.063   -34.737  1.00 57.45  ? 892  LYS B CB  1 
ATOM   1941 C  CG  . LYS B 1 70  ? 10.434  8.667   -35.507  1.00 57.45  ? 892  LYS B CG  1 
ATOM   1942 C  CD  . LYS B 1 70  ? 10.610  10.156  -35.774  1.00 57.45  ? 892  LYS B CD  1 
ATOM   1943 C  CE  . LYS B 1 70  ? 9.271   10.876  -35.760  1.00 57.45  ? 892  LYS B CE  1 
ATOM   1944 N  NZ  . LYS B 1 70  ? 8.256   10.196  -36.619  1.00 57.45  ? 892  LYS B NZ  1 
ATOM   1945 N  N   . LYS B 1 71  ? 13.616  9.266   -37.275  1.00 31.27  ? 893  LYS B N   1 
ATOM   1946 C  CA  . LYS B 1 71  ? 14.331  10.465  -37.710  1.00 32.97  ? 893  LYS B CA  1 
ATOM   1947 C  C   . LYS B 1 71  ? 13.645  11.721  -37.190  1.00 31.17  ? 893  LYS B C   1 
ATOM   1948 O  O   . LYS B 1 71  ? 12.459  11.943  -37.425  1.00 28.68  ? 893  LYS B O   1 
ATOM   1949 C  CB  . LYS B 1 71  ? 14.467  10.478  -39.238  1.00 30.14  ? 893  LYS B CB  1 
ATOM   1950 C  CG  . LYS B 1 71  ? 15.524  9.479   -39.695  1.00 33.74  ? 893  LYS B CG  1 
ATOM   1951 C  CD  . LYS B 1 71  ? 15.472  9.154   -41.164  1.00 37.15  ? 893  LYS B CD  1 
ATOM   1952 C  CE  . LYS B 1 71  ? 16.557  8.143   -41.497  1.00 34.58  ? 893  LYS B CE  1 
ATOM   1953 N  NZ  . LYS B 1 71  ? 16.495  6.959   -40.593  1.00 33.03  ? 893  LYS B NZ  1 
ATOM   1954 N  N   . THR B 1 72  ? 14.402  12.518  -36.443  1.00 27.25  ? 894  THR B N   1 
ATOM   1955 C  CA  . THR B 1 72  ? 13.892  13.747  -35.854  1.00 27.73  ? 894  THR B CA  1 
ATOM   1956 C  C   . THR B 1 72  ? 13.519  14.732  -36.945  1.00 26.48  ? 894  THR B C   1 
ATOM   1957 O  O   . THR B 1 72  ? 14.369  15.150  -37.726  1.00 24.71  ? 894  THR B O   1 
ATOM   1958 C  CB  . THR B 1 72  ? 14.939  14.381  -34.929  1.00 40.15  ? 894  THR B CB  1 
ATOM   1959 O  OG1 . THR B 1 72  ? 15.302  13.437  -33.915  1.00 42.47  ? 894  THR B OG1 1 
ATOM   1960 C  CG2 . THR B 1 72  ? 14.378  15.631  -34.263  1.00 42.48  ? 894  THR B CG2 1 
ATOM   1961 N  N   . GLU B 1 73  ? 12.242  15.100  -36.985  1.00 25.78  ? 895  GLU B N   1 
ATOM   1962 C  CA  . GLU B 1 73  ? 11.728  16.025  -37.991  1.00 26.89  ? 895  GLU B CA  1 
ATOM   1963 C  C   . GLU B 1 73  ? 11.892  17.489  -37.594  1.00 26.41  ? 895  GLU B C   1 
ATOM   1964 O  O   . GLU B 1 73  ? 12.036  17.814  -36.413  1.00 27.21  ? 895  GLU B O   1 
ATOM   1965 C  CB  . GLU B 1 73  ? 10.245  15.734  -38.246  1.00 33.69  ? 895  GLU B CB  1 
ATOM   1966 C  CG  . GLU B 1 73  ? 9.938   14.277  -38.555  1.00 36.25  ? 895  GLU B CG  1 
ATOM   1967 C  CD  . GLU B 1 73  ? 8.449   13.980  -38.542  1.00 45.41  ? 895  GLU B CD  1 
ATOM   1968 O  OE1 . GLU B 1 73  ? 7.798   14.228  -37.504  1.00 48.64  ? 895  GLU B OE1 1 
ATOM   1969 O  OE2 . GLU B 1 73  ? 7.927   13.497  -39.568  1.00 50.32  ? 895  GLU B OE2 1 
ATOM   1970 N  N   . GLY B 1 74  ? 11.872  18.358  -38.602  1.00 27.76  ? 896  GLY B N   1 
ATOM   1971 C  CA  . GLY B 1 74  ? 11.994  19.791  -38.397  1.00 27.81  ? 896  GLY B CA  1 
ATOM   1972 C  C   . GLY B 1 74  ? 13.133  20.248  -37.508  1.00 27.20  ? 896  GLY B C   1 
ATOM   1973 O  O   . GLY B 1 74  ? 12.992  21.222  -36.770  1.00 27.49  ? 896  GLY B O   1 
ATOM   1974 N  N   . LEU B 1 75  ? 14.273  19.571  -37.588  1.00 23.69  ? 897  LEU B N   1 
ATOM   1975 C  CA  . LEU B 1 75  ? 15.407  19.938  -36.748  1.00 23.59  ? 897  LEU B CA  1 
ATOM   1976 C  C   . LEU B 1 75  ? 16.746  19.745  -37.443  1.00 22.00  ? 897  LEU B C   1 
ATOM   1977 O  O   . LEU B 1 75  ? 17.039  18.663  -37.956  1.00 23.50  ? 897  LEU B O   1 
ATOM   1978 C  CB  . LEU B 1 75  ? 15.382  19.109  -35.463  1.00 27.20  ? 897  LEU B CB  1 
ATOM   1979 C  CG  . LEU B 1 75  ? 16.509  19.345  -34.453  1.00 32.52  ? 897  LEU B CG  1 
ATOM   1980 C  CD1 . LEU B 1 75  ? 16.474  20.786  -33.978  1.00 38.82  ? 897  LEU B CD1 1 
ATOM   1981 C  CD2 . LEU B 1 75  ? 16.351  18.390  -33.275  1.00 37.46  ? 897  LEU B CD2 1 
ATOM   1982 N  N   . VAL B 1 76  ? 17.562  20.793  -37.458  1.00 20.03  ? 898  VAL B N   1 
ATOM   1983 C  CA  . VAL B 1 76  ? 18.879  20.699  -38.077  1.00 20.30  ? 898  VAL B CA  1 
ATOM   1984 C  C   . VAL B 1 76  ? 19.912  20.505  -36.977  1.00 20.28  ? 898  VAL B C   1 
ATOM   1985 O  O   . VAL B 1 76  ? 20.061  21.349  -36.099  1.00 20.94  ? 898  VAL B O   1 
ATOM   1986 C  CB  . VAL B 1 76  ? 19.235  21.965  -38.869  1.00 22.52  ? 898  VAL B CB  1 
ATOM   1987 C  CG1 . VAL B 1 76  ? 20.611  21.803  -39.505  1.00 21.05  ? 898  VAL B CG1 1 
ATOM   1988 C  CG2 . VAL B 1 76  ? 18.189  22.218  -39.945  1.00 26.13  ? 898  VAL B CG2 1 
ATOM   1989 N  N   . LYS B 1 77  ? 20.612  19.379  -37.008  1.00 23.27  ? 899  LYS B N   1 
ATOM   1990 C  CA  . LYS B 1 77  ? 21.633  19.114  -36.006  1.00 23.97  ? 899  LYS B CA  1 
ATOM   1991 C  C   . LYS B 1 77  ? 23.001  19.092  -36.662  1.00 23.19  ? 899  LYS B C   1 
ATOM   1992 O  O   . LYS B 1 77  ? 23.112  18.919  -37.874  1.00 21.55  ? 899  LYS B O   1 
ATOM   1993 C  CB  . LYS B 1 77  ? 21.392  17.763  -35.337  1.00 29.27  ? 899  LYS B CB  1 
ATOM   1994 C  CG  . LYS B 1 77  ? 20.106  17.668  -34.546  1.00 34.87  ? 899  LYS B CG  1 
ATOM   1995 C  CD  . LYS B 1 77  ? 19.993  16.308  -33.867  1.00 42.58  ? 899  LYS B CD  1 
ATOM   1996 C  CE  . LYS B 1 77  ? 21.176  16.042  -32.939  1.00 47.64  ? 899  LYS B CE  1 
ATOM   1997 N  NZ  . LYS B 1 77  ? 21.089  14.711  -32.269  1.00 51.79  ? 899  LYS B NZ  1 
ATOM   1998 N  N   . LEU B 1 78  ? 24.042  19.266  -35.859  1.00 20.15  ? 900  LEU B N   1 
ATOM   1999 C  CA  . LEU B 1 78  ? 25.398  19.208  -36.388  1.00 20.31  ? 900  LEU B CA  1 
ATOM   2000 C  C   . LEU B 1 78  ? 25.612  17.800  -36.914  1.00 19.29  ? 900  LEU B C   1 
ATOM   2001 O  O   . LEU B 1 78  ? 25.059  16.838  -36.372  1.00 17.91  ? 900  LEU B O   1 
ATOM   2002 C  CB  . LEU B 1 78  ? 26.429  19.455  -35.285  1.00 20.47  ? 900  LEU B CB  1 
ATOM   2003 C  CG  . LEU B 1 78  ? 26.618  20.843  -34.685  1.00 22.04  ? 900  LEU B CG  1 
ATOM   2004 C  CD1 . LEU B 1 78  ? 27.647  20.756  -33.569  1.00 22.03  ? 900  LEU B CD1 1 
ATOM   2005 C  CD2 . LEU B 1 78  ? 27.073  21.824  -35.760  1.00 19.39  ? 900  LEU B CD2 1 
ATOM   2006 N  N   . THR B 1 79  ? 26.398  17.662  -37.972  1.00 18.01  ? 901  THR B N   1 
ATOM   2007 C  CA  . THR B 1 79  ? 26.685  16.324  -38.465  1.00 16.47  ? 901  THR B CA  1 
ATOM   2008 C  C   . THR B 1 79  ? 27.599  15.763  -37.380  1.00 16.65  ? 901  THR B C   1 
ATOM   2009 O  O   . THR B 1 79  ? 28.168  16.523  -36.594  1.00 15.65  ? 901  THR B O   1 
ATOM   2010 C  CB  . THR B 1 79  ? 27.475  16.338  -39.783  1.00 19.25  ? 901  THR B CB  1 
ATOM   2011 O  OG1 . THR B 1 79  ? 28.769  16.915  -39.554  1.00 17.50  ? 901  THR B OG1 1 
ATOM   2012 C  CG2 . THR B 1 79  ? 26.735  17.147  -40.846  1.00 20.47  ? 901  THR B CG2 1 
ATOM   2013 N  N   . PRO B 1 80  ? 27.735  14.429  -37.302  1.00 18.87  ? 902  PRO B N   1 
ATOM   2014 C  CA  . PRO B 1 80  ? 28.604  13.844  -36.278  1.00 17.72  ? 902  PRO B CA  1 
ATOM   2015 C  C   . PRO B 1 80  ? 30.056  14.318  -36.436  1.00 18.10  ? 902  PRO B C   1 
ATOM   2016 O  O   . PRO B 1 80  ? 30.754  14.554  -35.451  1.00 18.61  ? 902  PRO B O   1 
ATOM   2017 C  CB  . PRO B 1 80  ? 28.449  12.344  -36.516  1.00 24.20  ? 902  PRO B CB  1 
ATOM   2018 C  CG  . PRO B 1 80  ? 27.018  12.238  -37.027  1.00 23.16  ? 902  PRO B CG  1 
ATOM   2019 C  CD  . PRO B 1 80  ? 26.986  13.386  -38.021  1.00 22.60  ? 902  PRO B CD  1 
ATOM   2020 N  N   . ILE B 1 81  ? 30.509  14.459  -37.676  1.00 16.74  ? 903  ILE B N   1 
ATOM   2021 C  CA  . ILE B 1 81  ? 31.874  14.907  -37.917  1.00 16.83  ? 903  ILE B CA  1 
ATOM   2022 C  C   . ILE B 1 81  ? 32.088  16.291  -37.305  1.00 17.08  ? 903  ILE B C   1 
ATOM   2023 O  O   . ILE B 1 81  ? 33.099  16.543  -36.645  1.00 16.39  ? 903  ILE B O   1 
ATOM   2024 C  CB  . ILE B 1 81  ? 32.181  14.947  -39.428  1.00 18.95  ? 903  ILE B CB  1 
ATOM   2025 C  CG1 . ILE B 1 81  ? 32.450  13.526  -39.928  1.00 19.75  ? 903  ILE B CG1 1 
ATOM   2026 C  CG2 . ILE B 1 81  ? 33.383  15.858  -39.712  1.00 19.80  ? 903  ILE B CG2 1 
ATOM   2027 C  CD1 . ILE B 1 81  ? 32.637  13.433  -41.443  1.00 22.66  ? 903  ILE B CD1 1 
ATOM   2028 N  N   . ASP B 1 82  ? 31.124  17.182  -37.500  1.00 18.37  ? 904  ASP B N   1 
ATOM   2029 C  CA  . ASP B 1 82  ? 31.253  18.526  -36.965  1.00 19.28  ? 904  ASP B CA  1 
ATOM   2030 C  C   . ASP B 1 82  ? 31.141  18.588  -35.450  1.00 20.15  ? 904  ASP B C   1 
ATOM   2031 O  O   . ASP B 1 82  ? 31.770  19.435  -34.814  1.00 17.26  ? 904  ASP B O   1 
ATOM   2032 C  CB  . ASP B 1 82  ? 30.243  19.450  -37.641  1.00 17.44  ? 904  ASP B CB  1 
ATOM   2033 C  CG  . ASP B 1 82  ? 30.574  19.660  -39.102  1.00 20.40  ? 904  ASP B CG  1 
ATOM   2034 O  OD1 . ASP B 1 82  ? 31.725  20.074  -39.383  1.00 18.12  ? 904  ASP B OD1 1 
ATOM   2035 O  OD2 . ASP B 1 82  ? 29.703  19.402  -39.961  1.00 19.07  ? 904  ASP B OD2 1 
ATOM   2036 N  N   . LYS B 1 83  ? 30.348  17.698  -34.865  1.00 15.84  ? 905  LYS B N   1 
ATOM   2037 C  CA  . LYS B 1 83  ? 30.228  17.672  -33.414  1.00 16.44  ? 905  LYS B CA  1 
ATOM   2038 C  C   . LYS B 1 83  ? 31.583  17.237  -32.866  1.00 15.86  ? 905  LYS B C   1 
ATOM   2039 O  O   . LYS B 1 83  ? 32.059  17.754  -31.858  1.00 17.31  ? 905  LYS B O   1 
ATOM   2040 C  CB  . LYS B 1 83  ? 29.153  16.675  -32.975  1.00 18.23  ? 905  LYS B CB  1 
ATOM   2041 C  CG  . LYS B 1 83  ? 29.076  16.459  -31.460  1.00 20.84  ? 905  LYS B CG  1 
ATOM   2042 C  CD  . LYS B 1 83  ? 27.826  15.655  -31.086  1.00 23.47  ? 905  LYS B CD  1 
ATOM   2043 C  CE  . LYS B 1 83  ? 27.832  15.251  -29.615  1.00 25.78  ? 905  LYS B CE  1 
ATOM   2044 N  NZ  . LYS B 1 83  ? 28.833  14.171  -29.349  1.00 29.08  ? 905  LYS B NZ  1 
ATOM   2045 N  N   . ARG B 1 84  ? 32.200  16.277  -33.541  1.00 16.89  ? 906  ARG B N   1 
ATOM   2046 C  CA  . ARG B 1 84  ? 33.500  15.780  -33.118  1.00 18.19  ? 906  ARG B CA  1 
ATOM   2047 C  C   . ARG B 1 84  ? 34.574  16.839  -33.306  1.00 17.02  ? 906  ARG B C   1 
ATOM   2048 O  O   . ARG B 1 84  ? 35.528  16.906  -32.535  1.00 18.06  ? 906  ARG B O   1 
ATOM   2049 C  CB  . ARG B 1 84  ? 33.857  14.495  -33.876  1.00 12.46  ? 906  ARG B CB  1 
ATOM   2050 C  CG  . ARG B 1 84  ? 33.033  13.275  -33.402  1.00 16.11  ? 906  ARG B CG  1 
ATOM   2051 C  CD  . ARG B 1 84  ? 33.629  11.960  -33.890  1.00 23.44  ? 906  ARG B CD  1 
ATOM   2052 N  NE  . ARG B 1 84  ? 33.341  11.683  -35.294  1.00 34.38  ? 906  ARG B NE  1 
ATOM   2053 C  CZ  . ARG B 1 84  ? 32.192  11.189  -35.740  1.00 30.37  ? 906  ARG B CZ  1 
ATOM   2054 N  NH1 . ARG B 1 84  ? 31.212  10.915  -34.890  1.00 31.46  ? 906  ARG B NH1 1 
ATOM   2055 N  NH2 . ARG B 1 84  ? 32.026  10.957  -37.036  1.00 33.18  ? 906  ARG B NH2 1 
ATOM   2056 N  N   . LYS B 1 85  ? 34.423  17.675  -34.327  1.00 16.74  ? 907  LYS B N   1 
ATOM   2057 C  CA  . LYS B 1 85  ? 35.395  18.738  -34.544  1.00 15.90  ? 907  LYS B CA  1 
ATOM   2058 C  C   . LYS B 1 85  ? 35.307  19.739  -33.390  1.00 15.63  ? 907  LYS B C   1 
ATOM   2059 O  O   . LYS B 1 85  ? 36.326  20.178  -32.867  1.00 16.07  ? 907  LYS B O   1 
ATOM   2060 C  CB  . LYS B 1 85  ? 35.133  19.441  -35.871  1.00 13.21  ? 907  LYS B CB  1 
ATOM   2061 C  CG  . LYS B 1 85  ? 35.756  18.721  -37.069  1.00 14.27  ? 907  LYS B CG  1 
ATOM   2062 C  CD  . LYS B 1 85  ? 35.406  19.396  -38.373  1.00 15.23  ? 907  LYS B CD  1 
ATOM   2063 C  CE  . LYS B 1 85  ? 35.988  18.622  -39.549  1.00 24.32  ? 907  LYS B CE  1 
ATOM   2064 N  NZ  . LYS B 1 85  ? 35.728  19.311  -40.838  1.00 19.45  ? 907  LYS B NZ  1 
ATOM   2065 N  N   . CYS B 1 86  ? 34.084  20.095  -32.995  1.00 17.45  ? 908  CYS B N   1 
ATOM   2066 C  CA  . CYS B 1 86  ? 33.902  21.040  -31.896  1.00 18.04  ? 908  CYS B CA  1 
ATOM   2067 C  C   . CYS B 1 86  ? 34.432  20.443  -30.591  1.00 16.51  ? 908  CYS B C   1 
ATOM   2068 O  O   . CYS B 1 86  ? 34.965  21.158  -29.743  1.00 18.47  ? 908  CYS B O   1 
ATOM   2069 C  CB  . CYS B 1 86  ? 32.425  21.416  -31.736  1.00 15.73  ? 908  CYS B CB  1 
ATOM   2070 S  SG  . CYS B 1 86  ? 32.159  22.759  -30.537  1.00 20.28  ? 908  CYS B SG  1 
ATOM   2071 N  N   . GLU B 1 87  ? 34.282  19.132  -30.427  1.00 15.14  ? 909  GLU B N   1 
ATOM   2072 C  CA  . GLU B 1 87  ? 34.788  18.477  -29.225  1.00 15.68  ? 909  GLU B CA  1 
ATOM   2073 C  C   . GLU B 1 87  ? 36.313  18.583  -29.198  1.00 17.09  ? 909  GLU B C   1 
ATOM   2074 O  O   . GLU B 1 87  ? 36.910  18.770  -28.143  1.00 17.10  ? 909  GLU B O   1 
ATOM   2075 C  CB  . GLU B 1 87  ? 34.362  17.003  -29.195  1.00 14.99  ? 909  GLU B CB  1 
ATOM   2076 C  CG  . GLU B 1 87  ? 32.853  16.847  -29.014  1.00 15.95  ? 909  GLU B CG  1 
ATOM   2077 C  CD  . GLU B 1 87  ? 32.370  15.415  -29.135  1.00 23.24  ? 909  GLU B CD  1 
ATOM   2078 O  OE1 . GLU B 1 87  ? 32.977  14.631  -29.894  1.00 20.32  ? 909  GLU B OE1 1 
ATOM   2079 O  OE2 . GLU B 1 87  ? 31.361  15.082  -28.481  1.00 24.97  ? 909  GLU B OE2 1 
ATOM   2080 N  N   . ARG B 1 88  ? 36.935  18.453  -30.363  1.00 16.22  ? 910  ARG B N   1 
ATOM   2081 C  CA  . ARG B 1 88  ? 38.387  18.557  -30.446  1.00 17.66  ? 910  ARG B CA  1 
ATOM   2082 C  C   . ARG B 1 88  ? 38.813  20.003  -30.144  1.00 17.13  ? 910  ARG B C   1 
ATOM   2083 O  O   . ARG B 1 88  ? 39.722  20.233  -29.343  1.00 17.97  ? 910  ARG B O   1 
ATOM   2084 C  CB  . ARG B 1 88  ? 38.869  18.110  -31.834  1.00 21.63  ? 910  ARG B CB  1 
ATOM   2085 C  CG  . ARG B 1 88  ? 40.371  17.902  -31.931  1.00 27.12  ? 910  ARG B CG  1 
ATOM   2086 C  CD  . ARG B 1 88  ? 40.765  17.175  -33.219  1.00 30.72  ? 910  ARG B CD  1 
ATOM   2087 N  NE  . ARG B 1 88  ? 40.455  15.747  -33.180  1.00 35.04  ? 910  ARG B NE  1 
ATOM   2088 C  CZ  . ARG B 1 88  ? 40.809  14.876  -34.122  1.00 33.83  ? 910  ARG B CZ  1 
ATOM   2089 N  NH1 . ARG B 1 88  ? 41.485  15.277  -35.188  1.00 27.70  ? 910  ARG B NH1 1 
ATOM   2090 N  NH2 . ARG B 1 88  ? 40.500  13.596  -33.989  1.00 34.42  ? 910  ARG B NH2 1 
ATOM   2091 N  N   . LEU B 1 89  ? 38.141  20.972  -30.766  1.00 19.77  ? 911  LEU B N   1 
ATOM   2092 C  CA  . LEU B 1 89  ? 38.439  22.380  -30.524  1.00 20.48  ? 911  LEU B CA  1 
ATOM   2093 C  C   . LEU B 1 89  ? 38.355  22.692  -29.034  1.00 20.31  ? 911  LEU B C   1 
ATOM   2094 O  O   . LEU B 1 89  ? 39.233  23.365  -28.479  1.00 21.44  ? 911  LEU B O   1 
ATOM   2095 C  CB  . LEU B 1 89  ? 37.456  23.284  -31.269  1.00 16.00  ? 911  LEU B CB  1 
ATOM   2096 C  CG  . LEU B 1 89  ? 37.679  23.439  -32.772  1.00 18.15  ? 911  LEU B CG  1 
ATOM   2097 C  CD1 . LEU B 1 89  ? 36.519  24.246  -33.363  1.00 15.50  ? 911  LEU B CD1 1 
ATOM   2098 C  CD2 . LEU B 1 89  ? 39.016  24.138  -33.032  1.00 16.67  ? 911  LEU B CD2 1 
ATOM   2099 N  N   . LEU B 1 90  ? 37.295  22.207  -28.388  1.00 15.89  ? 912  LEU B N   1 
ATOM   2100 C  CA  . LEU B 1 90  ? 37.118  22.434  -26.963  1.00 16.85  ? 912  LEU B CA  1 
ATOM   2101 C  C   . LEU B 1 90  ? 38.246  21.801  -26.152  1.00 16.52  ? 912  LEU B C   1 
ATOM   2102 O  O   . LEU B 1 90  ? 38.806  22.448  -25.277  1.00 15.45  ? 912  LEU B O   1 
ATOM   2103 C  CB  . LEU B 1 90  ? 35.775  21.871  -26.486  1.00 17.78  ? 912  LEU B CB  1 
ATOM   2104 C  CG  . LEU B 1 90  ? 34.527  22.711  -26.735  1.00 19.80  ? 912  LEU B CG  1 
ATOM   2105 C  CD1 . LEU B 1 90  ? 33.278  21.903  -26.382  1.00 21.16  ? 912  LEU B CD1 1 
ATOM   2106 C  CD2 . LEU B 1 90  ? 34.611  23.972  -25.889  1.00 21.26  ? 912  LEU B CD2 1 
ATOM   2107 N  N   . LEU B 1 91  ? 38.578  20.543  -26.438  1.00 16.30  ? 913  LEU B N   1 
ATOM   2108 C  CA  . LEU B 1 91  ? 39.643  19.866  -25.691  1.00 16.46  ? 913  LEU B CA  1 
ATOM   2109 C  C   . LEU B 1 91  ? 40.990  20.569  -25.872  1.00 16.99  ? 913  LEU B C   1 
ATOM   2110 O  O   . LEU B 1 91  ? 41.772  20.685  -24.917  1.00 15.20  ? 913  LEU B O   1 
ATOM   2111 C  CB  . LEU B 1 91  ? 39.750  18.385  -26.107  1.00 17.41  ? 913  LEU B CB  1 
ATOM   2112 C  CG  . LEU B 1 91  ? 40.589  17.482  -25.192  1.00 16.12  ? 913  LEU B CG  1 
ATOM   2113 C  CD1 . LEU B 1 91  ? 40.128  17.630  -23.751  1.00 20.53  ? 913  LEU B CD1 1 
ATOM   2114 C  CD2 . LEU B 1 91  ? 40.454  16.019  -25.636  1.00 15.48  ? 913  LEU B CD2 1 
ATOM   2115 N  N   . PHE B 1 92  ? 41.262  21.034  -27.087  1.00 19.71  ? 914  PHE B N   1 
ATOM   2116 C  CA  . PHE B 1 92  ? 42.502  21.754  -27.345  1.00 20.94  ? 914  PHE B CA  1 
ATOM   2117 C  C   . PHE B 1 92  ? 42.581  22.983  -26.447  1.00 20.45  ? 914  PHE B C   1 
ATOM   2118 O  O   . PHE B 1 92  ? 43.607  23.217  -25.801  1.00 19.25  ? 914  PHE B O   1 
ATOM   2119 C  CB  . PHE B 1 92  ? 42.599  22.207  -28.805  1.00 17.60  ? 914  PHE B CB  1 
ATOM   2120 C  CG  . PHE B 1 92  ? 43.348  21.251  -29.693  1.00 21.33  ? 914  PHE B CG  1 
ATOM   2121 C  CD1 . PHE B 1 92  ? 42.696  20.578  -30.721  1.00 22.99  ? 914  PHE B CD1 1 
ATOM   2122 C  CD2 . PHE B 1 92  ? 44.703  21.014  -29.492  1.00 22.60  ? 914  PHE B CD2 1 
ATOM   2123 C  CE1 . PHE B 1 92  ? 43.385  19.677  -31.539  1.00 27.99  ? 914  PHE B CE1 1 
ATOM   2124 C  CE2 . PHE B 1 92  ? 45.402  20.117  -30.301  1.00 25.32  ? 914  PHE B CE2 1 
ATOM   2125 C  CZ  . PHE B 1 92  ? 44.739  19.446  -31.327  1.00 25.72  ? 914  PHE B CZ  1 
ATOM   2126 N  N   . LEU B 1 93  ? 41.503  23.764  -26.396  1.00 15.63  ? 915  LEU B N   1 
ATOM   2127 C  CA  . LEU B 1 93  ? 41.518  24.964  -25.571  1.00 17.43  ? 915  LEU B CA  1 
ATOM   2128 C  C   . LEU B 1 93  ? 41.587  24.641  -24.093  1.00 16.77  ? 915  LEU B C   1 
ATOM   2129 O  O   . LEU B 1 93  ? 42.316  25.301  -23.359  1.00 18.67  ? 915  LEU B O   1 
ATOM   2130 C  CB  . LEU B 1 93  ? 40.313  25.858  -25.872  1.00 19.57  ? 915  LEU B CB  1 
ATOM   2131 C  CG  . LEU B 1 93  ? 40.278  26.416  -27.301  1.00 24.42  ? 915  LEU B CG  1 
ATOM   2132 C  CD1 . LEU B 1 93  ? 39.135  27.409  -27.424  1.00 25.23  ? 915  LEU B CD1 1 
ATOM   2133 C  CD2 . LEU B 1 93  ? 41.596  27.086  -27.643  1.00 26.85  ? 915  LEU B CD2 1 
ATOM   2134 N  N   . TYR B 1 94  ? 40.850  23.622  -23.654  1.00 19.59  ? 916  TYR B N   1 
ATOM   2135 C  CA  . TYR B 1 94  ? 40.880  23.226  -22.249  1.00 20.13  ? 916  TYR B CA  1 
ATOM   2136 C  C   . TYR B 1 94  ? 42.305  22.836  -21.820  1.00 18.09  ? 916  TYR B C   1 
ATOM   2137 O  O   . TYR B 1 94  ? 42.733  23.142  -20.710  1.00 17.66  ? 916  TYR B O   1 
ATOM   2138 C  CB  . TYR B 1 94  ? 39.935  22.043  -21.999  1.00 19.08  ? 916  TYR B CB  1 
ATOM   2139 C  CG  . TYR B 1 94  ? 38.554  22.422  -21.485  1.00 20.69  ? 916  TYR B CG  1 
ATOM   2140 C  CD1 . TYR B 1 94  ? 37.430  22.322  -22.304  1.00 23.19  ? 916  TYR B CD1 1 
ATOM   2141 C  CD2 . TYR B 1 94  ? 38.370  22.837  -20.162  1.00 24.55  ? 916  TYR B CD2 1 
ATOM   2142 C  CE1 . TYR B 1 94  ? 36.159  22.617  -21.821  1.00 21.26  ? 916  TYR B CE1 1 
ATOM   2143 C  CE2 . TYR B 1 94  ? 37.104  23.134  -19.667  1.00 23.93  ? 916  TYR B CE2 1 
ATOM   2144 C  CZ  . TYR B 1 94  ? 36.002  23.019  -20.500  1.00 25.08  ? 916  TYR B CZ  1 
ATOM   2145 O  OH  . TYR B 1 94  ? 34.742  23.280  -20.009  1.00 25.40  ? 916  TYR B OH  1 
ATOM   2146 N  N   . CYS B 1 95  ? 43.039  22.174  -22.706  1.00 16.64  ? 917  CYS B N   1 
ATOM   2147 C  CA  . CYS B 1 95  ? 44.403  21.754  -22.403  1.00 18.92  ? 917  CYS B CA  1 
ATOM   2148 C  C   . CYS B 1 95  ? 45.450  22.875  -22.503  1.00 21.39  ? 917  CYS B C   1 
ATOM   2149 O  O   . CYS B 1 95  ? 46.557  22.739  -21.989  1.00 21.09  ? 917  CYS B O   1 
ATOM   2150 C  CB  . CYS B 1 95  ? 44.808  20.591  -23.312  1.00 18.90  ? 917  CYS B CB  1 
ATOM   2151 S  SG  . CYS B 1 95  ? 43.891  19.056  -22.981  1.00 24.96  ? 917  CYS B SG  1 
ATOM   2152 N  N   . HIS B 1 96  ? 45.104  23.974  -23.163  1.00 16.93  ? 918  HIS B N   1 
ATOM   2153 C  CA  . HIS B 1 96  ? 46.032  25.096  -23.295  1.00 17.82  ? 918  HIS B CA  1 
ATOM   2154 C  C   . HIS B 1 96  ? 46.333  25.650  -21.904  1.00 20.31  ? 918  HIS B C   1 
ATOM   2155 O  O   . HIS B 1 96  ? 45.446  25.735  -21.062  1.00 20.72  ? 918  HIS B O   1 
ATOM   2156 C  CB  . HIS B 1 96  ? 45.421  26.178  -24.183  1.00 26.15  ? 918  HIS B CB  1 
ATOM   2157 C  CG  . HIS B 1 96  ? 46.417  27.169  -24.694  1.00 25.58  ? 918  HIS B CG  1 
ATOM   2158 N  ND1 . HIS B 1 96  ? 46.929  28.181  -23.910  1.00 26.04  ? 918  HIS B ND1 1 
ATOM   2159 C  CD2 . HIS B 1 96  ? 47.024  27.280  -25.899  1.00 26.85  ? 918  HIS B CD2 1 
ATOM   2160 C  CE1 . HIS B 1 96  ? 47.809  28.873  -24.612  1.00 24.32  ? 918  HIS B CE1 1 
ATOM   2161 N  NE2 . HIS B 1 96  ? 47.885  28.346  -25.822  1.00 31.21  ? 918  HIS B NE2 1 
ATOM   2162 N  N   . GLU B 1 97  ? 47.588  26.024  -21.668  1.00 22.60  ? 919  GLU B N   1 
ATOM   2163 C  CA  . GLU B 1 97  ? 48.011  26.541  -20.368  1.00 26.23  ? 919  GLU B CA  1 
ATOM   2164 C  C   . GLU B 1 97  ? 47.296  27.804  -19.898  1.00 25.69  ? 919  GLU B C   1 
ATOM   2165 O  O   . GLU B 1 97  ? 47.193  28.040  -18.701  1.00 27.72  ? 919  GLU B O   1 
ATOM   2166 C  CB  . GLU B 1 97  ? 49.523  26.793  -20.378  1.00 30.77  ? 919  GLU B CB  1 
ATOM   2167 C  CG  . GLU B 1 97  ? 50.341  25.543  -20.626  1.00 37.40  ? 919  GLU B CG  1 
ATOM   2168 C  CD  . GLU B 1 97  ? 51.824  25.825  -20.798  1.00 43.07  ? 919  GLU B CD  1 
ATOM   2169 O  OE1 . GLU B 1 97  ? 52.194  27.004  -20.991  1.00 46.84  ? 919  GLU B OE1 1 
ATOM   2170 O  OE2 . GLU B 1 97  ? 52.616  24.860  -20.753  1.00 44.87  ? 919  GLU B OE2 1 
ATOM   2171 N  N   . MET B 1 98  ? 46.795  28.598  -20.841  1.00 30.12  ? 920  MET B N   1 
ATOM   2172 C  CA  . MET B 1 98  ? 46.114  29.858  -20.538  1.00 30.06  ? 920  MET B CA  1 
ATOM   2173 C  C   . MET B 1 98  ? 44.588  29.769  -20.488  1.00 30.08  ? 920  MET B C   1 
ATOM   2174 O  O   . MET B 1 98  ? 43.924  30.796  -20.428  1.00 29.98  ? 920  MET B O   1 
ATOM   2175 C  CB  . MET B 1 98  ? 46.472  30.916  -21.598  1.00 30.40  ? 920  MET B CB  1 
ATOM   2176 C  CG  . MET B 1 98  ? 47.958  31.147  -21.851  1.00 34.74  ? 920  MET B CG  1 
ATOM   2177 S  SD  . MET B 1 98  ? 48.777  31.996  -20.495  1.00 44.99  ? 920  MET B SD  1 
ATOM   2178 C  CE  . MET B 1 98  ? 49.380  30.626  -19.574  1.00 40.05  ? 920  MET B CE  1 
ATOM   2179 N  N   . SER B 1 99  ? 44.024  28.566  -20.496  1.00 23.19  ? 921  SER B N   1 
ATOM   2180 C  CA  . SER B 1 99  ? 42.564  28.443  -20.527  1.00 24.00  ? 921  SER B CA  1 
ATOM   2181 C  C   . SER B 1 99  ? 41.781  28.571  -19.231  1.00 23.80  ? 921  SER B C   1 
ATOM   2182 O  O   . SER B 1 99  ? 40.571  28.787  -19.271  1.00 21.81  ? 921  SER B O   1 
ATOM   2183 C  CB  . SER B 1 99  ? 42.168  27.114  -21.178  1.00 22.65  ? 921  SER B CB  1 
ATOM   2184 O  OG  . SER B 1 99  ? 42.385  26.034  -20.283  1.00 23.33  ? 921  SER B OG  1 
ATOM   2185 N  N   . LEU B 1 100 ? 42.446  28.448  -18.088  1.00 23.60  ? 922  LEU B N   1 
ATOM   2186 C  CA  . LEU B 1 100 ? 41.734  28.492  -16.820  1.00 25.90  ? 922  LEU B CA  1 
ATOM   2187 C  C   . LEU B 1 100 ? 40.739  29.640  -16.653  1.00 24.07  ? 922  LEU B C   1 
ATOM   2188 O  O   . LEU B 1 100 ? 39.611  29.417  -16.234  1.00 24.21  ? 922  LEU B O   1 
ATOM   2189 C  CB  . LEU B 1 100 ? 42.729  28.479  -15.657  1.00 33.64  ? 922  LEU B CB  1 
ATOM   2190 C  CG  . LEU B 1 100 ? 42.145  28.132  -14.286  1.00 37.14  ? 922  LEU B CG  1 
ATOM   2191 C  CD1 . LEU B 1 100 ? 41.334  26.844  -14.359  1.00 42.65  ? 922  LEU B CD1 1 
ATOM   2192 C  CD2 . LEU B 1 100 ? 43.282  27.982  -13.294  1.00 42.87  ? 922  LEU B CD2 1 
ATOM   2193 N  N   . ALA B 1 101 ? 41.139  30.859  -16.991  1.00 30.90  ? 923  ALA B N   1 
ATOM   2194 C  CA  . ALA B 1 101 ? 40.254  32.015  -16.844  1.00 30.20  ? 923  ALA B CA  1 
ATOM   2195 C  C   . ALA B 1 101 ? 39.025  32.012  -17.757  1.00 29.99  ? 923  ALA B C   1 
ATOM   2196 O  O   . ALA B 1 101 ? 38.108  32.813  -17.570  1.00 30.57  ? 923  ALA B O   1 
ATOM   2197 C  CB  . ALA B 1 101 ? 41.049  33.300  -17.064  1.00 29.14  ? 923  ALA B CB  1 
ATOM   2198 N  N   . PHE B 1 102 ? 38.995  31.106  -18.729  1.00 21.12  ? 924  PHE B N   1 
ATOM   2199 C  CA  . PHE B 1 102 ? 37.889  31.035  -19.681  1.00 19.41  ? 924  PHE B CA  1 
ATOM   2200 C  C   . PHE B 1 102 ? 37.109  29.718  -19.660  1.00 19.31  ? 924  PHE B C   1 
ATOM   2201 O  O   . PHE B 1 102 ? 36.277  29.478  -20.531  1.00 18.37  ? 924  PHE B O   1 
ATOM   2202 C  CB  . PHE B 1 102 ? 38.437  31.277  -21.086  1.00 23.79  ? 924  PHE B CB  1 
ATOM   2203 C  CG  . PHE B 1 102 ? 39.316  32.492  -21.178  1.00 26.98  ? 924  PHE B CG  1 
ATOM   2204 C  CD1 . PHE B 1 102 ? 38.763  33.768  -21.157  1.00 26.46  ? 924  PHE B CD1 1 
ATOM   2205 C  CD2 . PHE B 1 102 ? 40.701  32.362  -21.223  1.00 25.06  ? 924  PHE B CD2 1 
ATOM   2206 C  CE1 . PHE B 1 102 ? 39.576  34.902  -21.176  1.00 26.55  ? 924  PHE B CE1 1 
ATOM   2207 C  CE2 . PHE B 1 102 ? 41.523  33.489  -21.243  1.00 26.32  ? 924  PHE B CE2 1 
ATOM   2208 C  CZ  . PHE B 1 102 ? 40.956  34.762  -21.219  1.00 22.24  ? 924  PHE B CZ  1 
ATOM   2209 N  N   . GLN B 1 103 ? 37.367  28.877  -18.663  1.00 21.54  ? 925  GLN B N   1 
ATOM   2210 C  CA  . GLN B 1 103 ? 36.695  27.581  -18.559  1.00 24.14  ? 925  GLN B CA  1 
ATOM   2211 C  C   . GLN B 1 103 ? 35.296  27.636  -17.965  1.00 24.98  ? 925  GLN B C   1 
ATOM   2212 O  O   . GLN B 1 103 ? 34.375  27.021  -18.489  1.00 26.22  ? 925  GLN B O   1 
ATOM   2213 C  CB  . GLN B 1 103 ? 37.546  26.606  -17.741  1.00 21.26  ? 925  GLN B CB  1 
ATOM   2214 C  CG  . GLN B 1 103 ? 38.794  26.135  -18.451  1.00 22.50  ? 925  GLN B CG  1 
ATOM   2215 C  CD  . GLN B 1 103 ? 39.562  25.121  -17.636  1.00 23.77  ? 925  GLN B CD  1 
ATOM   2216 O  OE1 . GLN B 1 103 ? 38.996  24.459  -16.763  1.00 27.00  ? 925  GLN B OE1 1 
ATOM   2217 N  NE2 . GLN B 1 103 ? 40.847  24.977  -17.925  1.00 26.58  ? 925  GLN B NE2 1 
ATOM   2218 N  N   . ASP B 1 104 ? 35.134  28.367  -16.869  1.00 26.88  ? 926  ASP B N   1 
ATOM   2219 C  CA  . ASP B 1 104 ? 33.827  28.469  -16.228  1.00 28.63  ? 926  ASP B CA  1 
ATOM   2220 C  C   . ASP B 1 104 ? 33.340  29.901  -16.308  1.00 27.75  ? 926  ASP B C   1 
ATOM   2221 O  O   . ASP B 1 104 ? 34.111  30.804  -16.616  1.00 28.13  ? 926  ASP B O   1 
ATOM   2222 C  CB  . ASP B 1 104 ? 33.918  28.023  -14.771  1.00 30.81  ? 926  ASP B CB  1 
ATOM   2223 C  CG  . ASP B 1 104 ? 34.499  26.627  -14.631  1.00 37.73  ? 926  ASP B CG  1 
ATOM   2224 O  OD1 . ASP B 1 104 ? 33.890  25.672  -15.159  1.00 41.87  ? 926  ASP B OD1 1 
ATOM   2225 O  OD2 . ASP B 1 104 ? 35.572  26.490  -14.004  1.00 42.33  ? 926  ASP B OD2 1 
ATOM   2226 N  N   . PRO B 1 105 ? 32.048  30.129  -16.036  1.00 26.13  ? 927  PRO B N   1 
ATOM   2227 C  CA  . PRO B 1 105 ? 31.533  31.495  -16.104  1.00 26.24  ? 927  PRO B CA  1 
ATOM   2228 C  C   . PRO B 1 105 ? 32.351  32.426  -15.219  1.00 25.70  ? 927  PRO B C   1 
ATOM   2229 O  O   . PRO B 1 105 ? 32.894  32.002  -14.193  1.00 24.71  ? 927  PRO B O   1 
ATOM   2230 C  CB  . PRO B 1 105 ? 30.096  31.344  -15.620  1.00 32.13  ? 927  PRO B CB  1 
ATOM   2231 C  CG  . PRO B 1 105 ? 29.740  29.955  -16.049  1.00 32.53  ? 927  PRO B CG  1 
ATOM   2232 C  CD  . PRO B 1 105 ? 30.981  29.183  -15.666  1.00 31.88  ? 927  PRO B CD  1 
ATOM   2233 N  N   . VAL B 1 106 ? 32.465  33.684  -15.632  1.00 21.55  ? 928  VAL B N   1 
ATOM   2234 C  CA  . VAL B 1 106 ? 33.207  34.658  -14.844  1.00 24.08  ? 928  VAL B CA  1 
ATOM   2235 C  C   . VAL B 1 106 ? 32.424  34.844  -13.548  1.00 23.40  ? 928  VAL B C   1 
ATOM   2236 O  O   . VAL B 1 106 ? 31.201  34.981  -13.571  1.00 21.67  ? 928  VAL B O   1 
ATOM   2237 C  CB  . VAL B 1 106 ? 33.304  36.007  -15.570  1.00 29.38  ? 928  VAL B CB  1 
ATOM   2238 C  CG1 . VAL B 1 106 ? 34.015  37.021  -14.688  1.00 30.64  ? 928  VAL B CG1 1 
ATOM   2239 C  CG2 . VAL B 1 106 ? 34.035  35.826  -16.894  1.00 35.02  ? 928  VAL B CG2 1 
ATOM   2240 N  N   . PRO B 1 107 ? 33.117  34.835  -12.400  1.00 25.86  ? 929  PRO B N   1 
ATOM   2241 C  CA  . PRO B 1 107 ? 32.435  35.005  -11.113  1.00 26.17  ? 929  PRO B CA  1 
ATOM   2242 C  C   . PRO B 1 107 ? 31.604  36.280  -11.029  1.00 26.14  ? 929  PRO B C   1 
ATOM   2243 O  O   . PRO B 1 107 ? 31.969  37.316  -11.590  1.00 24.57  ? 929  PRO B O   1 
ATOM   2244 C  CB  . PRO B 1 107 ? 33.586  35.001  -10.108  1.00 33.50  ? 929  PRO B CB  1 
ATOM   2245 C  CG  . PRO B 1 107 ? 34.603  34.112  -10.769  1.00 35.38  ? 929  PRO B CG  1 
ATOM   2246 C  CD  . PRO B 1 107 ? 34.556  34.589  -12.203  1.00 32.30  ? 929  PRO B CD  1 
ATOM   2247 N  N   . LEU B 1 108 ? 30.478  36.190  -10.328  1.00 30.38  ? 930  LEU B N   1 
ATOM   2248 C  CA  . LEU B 1 108 ? 29.597  37.332  -10.141  1.00 32.15  ? 930  LEU B CA  1 
ATOM   2249 C  C   . LEU B 1 108 ? 30.333  38.415  -9.356   1.00 32.18  ? 930  LEU B C   1 
ATOM   2250 O  O   . LEU B 1 108 ? 30.007  39.598  -9.456   1.00 33.18  ? 930  LEU B O   1 
ATOM   2251 C  CB  . LEU B 1 108 ? 28.347  36.908  -9.363   1.00 36.48  ? 930  LEU B CB  1 
ATOM   2252 C  CG  . LEU B 1 108 ? 27.338  35.999  -10.065  1.00 37.27  ? 930  LEU B CG  1 
ATOM   2253 C  CD1 . LEU B 1 108 ? 26.285  35.534  -9.074   1.00 40.96  ? 930  LEU B CD1 1 
ATOM   2254 C  CD2 . LEU B 1 108 ? 26.690  36.761  -11.208  1.00 39.94  ? 930  LEU B CD2 1 
ATOM   2255 N  N   . THR B 1 109 ? 31.330  37.993  -8.583   1.00 31.24  ? 931  THR B N   1 
ATOM   2256 C  CA  . THR B 1 109 ? 32.119  38.897  -7.752   1.00 32.79  ? 931  THR B CA  1 
ATOM   2257 C  C   . THR B 1 109 ? 33.044  39.845  -8.510   1.00 33.93  ? 931  THR B C   1 
ATOM   2258 O  O   . THR B 1 109 ? 33.541  40.811  -7.934   1.00 34.59  ? 931  THR B O   1 
ATOM   2259 C  CB  . THR B 1 109 ? 32.964  38.113  -6.732   1.00 32.54  ? 931  THR B CB  1 
ATOM   2260 O  OG1 . THR B 1 109 ? 33.654  37.051  -7.399   1.00 33.73  ? 931  THR B OG1 1 
ATOM   2261 C  CG2 . THR B 1 109 ? 32.074  37.525  -5.642   1.00 32.35  ? 931  THR B CG2 1 
ATOM   2262 N  N   . VAL B 1 110 ? 33.293  39.576  -9.788   1.00 30.98  ? 932  VAL B N   1 
ATOM   2263 C  CA  . VAL B 1 110 ? 34.147  40.465  -10.567  1.00 30.61  ? 932  VAL B CA  1 
ATOM   2264 C  C   . VAL B 1 110 ? 33.351  41.751  -10.774  1.00 31.49  ? 932  VAL B C   1 
ATOM   2265 O  O   . VAL B 1 110 ? 32.325  41.756  -11.458  1.00 31.84  ? 932  VAL B O   1 
ATOM   2266 C  CB  . VAL B 1 110 ? 34.515  39.842  -11.925  1.00 27.65  ? 932  VAL B CB  1 
ATOM   2267 C  CG1 . VAL B 1 110 ? 35.301  40.845  -12.769  1.00 27.43  ? 932  VAL B CG1 1 
ATOM   2268 C  CG2 . VAL B 1 110 ? 35.340  38.573  -11.695  1.00 26.09  ? 932  VAL B CG2 1 
ATOM   2269 N  N   . PRO B 1 111 ? 33.813  42.860  -10.174  1.00 32.62  ? 933  PRO B N   1 
ATOM   2270 C  CA  . PRO B 1 111 ? 33.151  44.165  -10.272  1.00 33.02  ? 933  PRO B CA  1 
ATOM   2271 C  C   . PRO B 1 111 ? 32.741  44.609  -11.667  1.00 34.11  ? 933  PRO B C   1 
ATOM   2272 O  O   . PRO B 1 111 ? 33.561  44.650  -12.583  1.00 34.99  ? 933  PRO B O   1 
ATOM   2273 C  CB  . PRO B 1 111 ? 34.171  45.119  -9.650   1.00 35.96  ? 933  PRO B CB  1 
ATOM   2274 C  CG  . PRO B 1 111 ? 34.841  44.264  -8.627   1.00 34.13  ? 933  PRO B CG  1 
ATOM   2275 C  CD  . PRO B 1 111 ? 35.059  42.971  -9.390   1.00 34.77  ? 933  PRO B CD  1 
ATOM   2276 N  N   . ASP B 1 112 ? 31.460  44.936  -11.809  1.00 34.34  ? 934  ASP B N   1 
ATOM   2277 C  CA  . ASP B 1 112 ? 30.892  45.423  -13.062  1.00 35.82  ? 934  ASP B CA  1 
ATOM   2278 C  C   . ASP B 1 112 ? 30.900  44.465  -14.243  1.00 34.73  ? 934  ASP B C   1 
ATOM   2279 O  O   . ASP B 1 112 ? 30.373  44.801  -15.303  1.00 34.67  ? 934  ASP B O   1 
ATOM   2280 C  CB  . ASP B 1 112 ? 31.600  46.707  -13.509  1.00 51.05  ? 934  ASP B CB  1 
ATOM   2281 C  CG  . ASP B 1 112 ? 31.433  47.846  -12.524  1.00 55.38  ? 934  ASP B CG  1 
ATOM   2282 O  OD1 . ASP B 1 112 ? 30.370  47.922  -11.873  1.00 54.01  ? 934  ASP B OD1 1 
ATOM   2283 O  OD2 . ASP B 1 112 ? 32.363  48.674  -12.416  1.00 58.79  ? 934  ASP B OD2 1 
ATOM   2284 N  N   . TYR B 1 113 ? 31.474  43.279  -14.083  1.00 31.93  ? 935  TYR B N   1 
ATOM   2285 C  CA  . TYR B 1 113 ? 31.533  42.368  -15.215  1.00 29.82  ? 935  TYR B CA  1 
ATOM   2286 C  C   . TYR B 1 113 ? 30.210  42.195  -15.945  1.00 30.31  ? 935  TYR B C   1 
ATOM   2287 O  O   . TYR B 1 113 ? 30.127  42.431  -17.152  1.00 28.60  ? 935  TYR B O   1 
ATOM   2288 C  CB  . TYR B 1 113 ? 32.042  40.988  -14.811  1.00 29.39  ? 935  TYR B CB  1 
ATOM   2289 C  CG  . TYR B 1 113 ? 32.382  40.166  -16.034  1.00 27.33  ? 935  TYR B CG  1 
ATOM   2290 C  CD1 . TYR B 1 113 ? 33.570  40.390  -16.730  1.00 29.06  ? 935  TYR B CD1 1 
ATOM   2291 C  CD2 . TYR B 1 113 ? 31.487  39.228  -16.546  1.00 26.33  ? 935  TYR B CD2 1 
ATOM   2292 C  CE1 . TYR B 1 113 ? 33.861  39.706  -17.907  1.00 29.51  ? 935  TYR B CE1 1 
ATOM   2293 C  CE2 . TYR B 1 113 ? 31.768  38.535  -17.732  1.00 26.65  ? 935  TYR B CE2 1 
ATOM   2294 C  CZ  . TYR B 1 113 ? 32.959  38.784  -18.404  1.00 24.80  ? 935  TYR B CZ  1 
ATOM   2295 O  OH  . TYR B 1 113 ? 33.250  38.125  -19.581  1.00 28.09  ? 935  TYR B OH  1 
ATOM   2296 N  N   . TYR B 1 114 ? 29.177  41.780  -15.222  1.00 32.41  ? 936  TYR B N   1 
ATOM   2297 C  CA  . TYR B 1 114 ? 27.880  41.558  -15.841  1.00 34.07  ? 936  TYR B CA  1 
ATOM   2298 C  C   . TYR B 1 114 ? 27.103  42.821  -16.161  1.00 36.09  ? 936  TYR B C   1 
ATOM   2299 O  O   . TYR B 1 114 ? 26.020  42.760  -16.744  1.00 35.59  ? 936  TYR B O   1 
ATOM   2300 C  CB  . TYR B 1 114 ? 27.066  40.598  -14.981  1.00 33.07  ? 936  TYR B CB  1 
ATOM   2301 C  CG  . TYR B 1 114 ? 27.656  39.214  -15.053  1.00 32.64  ? 936  TYR B CG  1 
ATOM   2302 C  CD1 . TYR B 1 114 ? 27.460  38.416  -16.180  1.00 35.43  ? 936  TYR B CD1 1 
ATOM   2303 C  CD2 . TYR B 1 114 ? 28.495  38.739  -14.047  1.00 31.58  ? 936  TYR B CD2 1 
ATOM   2304 C  CE1 . TYR B 1 114 ? 28.087  37.182  -16.307  1.00 31.32  ? 936  TYR B CE1 1 
ATOM   2305 C  CE2 . TYR B 1 114 ? 29.128  37.509  -14.165  1.00 29.72  ? 936  TYR B CE2 1 
ATOM   2306 C  CZ  . TYR B 1 114 ? 28.920  36.736  -15.298  1.00 29.29  ? 936  TYR B CZ  1 
ATOM   2307 O  OH  . TYR B 1 114 ? 29.554  35.521  -15.423  1.00 28.75  ? 936  TYR B OH  1 
ATOM   2308 N  N   . LYS B 1 115 ? 27.676  43.962  -15.793  1.00 47.75  ? 937  LYS B N   1 
ATOM   2309 C  CA  . LYS B 1 115 ? 27.074  45.255  -16.078  1.00 49.80  ? 937  LYS B CA  1 
ATOM   2310 C  C   . LYS B 1 115 ? 27.572  45.626  -17.469  1.00 49.57  ? 937  LYS B C   1 
ATOM   2311 O  O   . LYS B 1 115 ? 26.888  46.300  -18.239  1.00 51.17  ? 937  LYS B O   1 
ATOM   2312 C  CB  . LYS B 1 115 ? 27.549  46.310  -15.073  1.00 73.84  ? 937  LYS B CB  1 
ATOM   2313 C  CG  . LYS B 1 115 ? 26.532  46.701  -14.011  1.00 77.31  ? 937  LYS B CG  1 
ATOM   2314 C  CD  . LYS B 1 115 ? 26.234  45.562  -13.050  1.00 84.96  ? 937  LYS B CD  1 
ATOM   2315 C  CE  . LYS B 1 115 ? 25.270  46.011  -11.962  1.00 87.49  ? 937  LYS B CE  1 
ATOM   2316 N  NZ  . LYS B 1 115 ? 24.975  44.924  -10.992  1.00 89.99  ? 937  LYS B NZ  1 
ATOM   2317 N  N   . ILE B 1 116 ? 28.777  45.160  -17.780  1.00 44.00  ? 938  ILE B N   1 
ATOM   2318 C  CA  . ILE B 1 116 ? 29.403  45.428  -19.066  1.00 42.35  ? 938  ILE B CA  1 
ATOM   2319 C  C   . ILE B 1 116 ? 29.098  44.320  -20.080  1.00 40.78  ? 938  ILE B C   1 
ATOM   2320 O  O   . ILE B 1 116 ? 28.578  44.586  -21.162  1.00 37.69  ? 938  ILE B O   1 
ATOM   2321 C  CB  . ILE B 1 116 ? 30.940  45.552  -18.913  1.00 42.58  ? 938  ILE B CB  1 
ATOM   2322 C  CG1 . ILE B 1 116 ? 31.281  46.563  -17.815  1.00 44.35  ? 938  ILE B CG1 1 
ATOM   2323 C  CG2 . ILE B 1 116 ? 31.568  45.984  -20.233  1.00 43.76  ? 938  ILE B CG2 1 
ATOM   2324 C  CD1 . ILE B 1 116 ? 30.760  47.962  -18.074  1.00 50.31  ? 938  ILE B CD1 1 
ATOM   2325 N  N   . ILE B 1 117 ? 29.406  43.078  -19.718  1.00 26.82  ? 939  ILE B N   1 
ATOM   2326 C  CA  . ILE B 1 117 ? 29.185  41.945  -20.614  1.00 25.15  ? 939  ILE B CA  1 
ATOM   2327 C  C   . ILE B 1 117 ? 27.763  41.385  -20.543  1.00 25.10  ? 939  ILE B C   1 
ATOM   2328 O  O   . ILE B 1 117 ? 27.395  40.721  -19.573  1.00 24.39  ? 939  ILE B O   1 
ATOM   2329 C  CB  . ILE B 1 117 ? 30.191  40.807  -20.312  1.00 29.65  ? 939  ILE B CB  1 
ATOM   2330 C  CG1 . ILE B 1 117 ? 31.624  41.352  -20.358  1.00 27.71  ? 939  ILE B CG1 1 
ATOM   2331 C  CG2 . ILE B 1 117 ? 30.021  39.670  -21.319  1.00 28.12  ? 939  ILE B CG2 1 
ATOM   2332 C  CD1 . ILE B 1 117 ? 32.028  41.937  -21.707  1.00 33.52  ? 939  ILE B CD1 1 
ATOM   2333 N  N   . LYS B 1 118 ? 26.984  41.647  -21.589  1.00 31.38  ? 940  LYS B N   1 
ATOM   2334 C  CA  . LYS B 1 118 ? 25.597  41.196  -21.684  1.00 33.40  ? 940  LYS B CA  1 
ATOM   2335 C  C   . LYS B 1 118 ? 25.447  39.740  -22.131  1.00 34.02  ? 940  LYS B C   1 
ATOM   2336 O  O   . LYS B 1 118 ? 24.523  39.047  -21.705  1.00 33.99  ? 940  LYS B O   1 
ATOM   2337 C  CB  . LYS B 1 118 ? 24.829  42.085  -22.659  1.00 40.12  ? 940  LYS B CB  1 
ATOM   2338 C  CG  . LYS B 1 118 ? 24.811  43.556  -22.303  1.00 43.14  ? 940  LYS B CG  1 
ATOM   2339 C  CD  . LYS B 1 118 ? 23.836  43.870  -21.176  1.00 49.90  ? 940  LYS B CD  1 
ATOM   2340 C  CE  . LYS B 1 118 ? 24.452  43.650  -19.814  1.00 54.68  ? 940  LYS B CE  1 
ATOM   2341 N  NZ  . LYS B 1 118 ? 24.006  44.716  -18.874  1.00 57.59  ? 940  LYS B NZ  1 
ATOM   2342 N  N   . ASN B 1 119 ? 26.343  39.285  -23.004  1.00 29.89  ? 941  ASN B N   1 
ATOM   2343 C  CA  . ASN B 1 119 ? 26.298  37.910  -23.497  1.00 30.71  ? 941  ASN B CA  1 
ATOM   2344 C  C   . ASN B 1 119 ? 27.542  37.130  -23.093  1.00 28.17  ? 941  ASN B C   1 
ATOM   2345 O  O   . ASN B 1 119 ? 28.415  36.869  -23.911  1.00 26.82  ? 941  ASN B O   1 
ATOM   2346 C  CB  . ASN B 1 119 ? 26.163  37.893  -25.020  1.00 36.83  ? 941  ASN B CB  1 
ATOM   2347 C  CG  . ASN B 1 119 ? 24.787  38.325  -25.489  1.00 45.65  ? 941  ASN B CG  1 
ATOM   2348 O  OD1 . ASN B 1 119 ? 24.659  39.175  -26.370  1.00 48.97  ? 941  ASN B OD1 1 
ATOM   2349 N  ND2 . ASN B 1 119 ? 23.749  37.733  -24.907  1.00 47.13  ? 941  ASN B ND2 1 
ATOM   2350 N  N   . PRO B 1 120 ? 27.638  36.754  -21.815  1.00 27.18  ? 942  PRO B N   1 
ATOM   2351 C  CA  . PRO B 1 120 ? 28.801  35.998  -21.345  1.00 27.19  ? 942  PRO B CA  1 
ATOM   2352 C  C   . PRO B 1 120 ? 28.922  34.643  -22.034  1.00 26.31  ? 942  PRO B C   1 
ATOM   2353 O  O   . PRO B 1 120 ? 27.937  34.094  -22.521  1.00 24.01  ? 942  PRO B O   1 
ATOM   2354 C  CB  . PRO B 1 120 ? 28.546  35.869  -19.846  1.00 27.66  ? 942  PRO B CB  1 
ATOM   2355 C  CG  . PRO B 1 120 ? 27.043  35.875  -19.760  1.00 30.93  ? 942  PRO B CG  1 
ATOM   2356 C  CD  . PRO B 1 120 ? 26.666  36.962  -20.728  1.00 30.12  ? 942  PRO B CD  1 
ATOM   2357 N  N   . MET B 1 121 ? 30.141  34.117  -22.079  1.00 25.18  ? 943  MET B N   1 
ATOM   2358 C  CA  . MET B 1 121 ? 30.387  32.819  -22.695  1.00 22.85  ? 943  MET B CA  1 
ATOM   2359 C  C   . MET B 1 121 ? 31.672  32.244  -22.114  1.00 23.09  ? 943  MET B C   1 
ATOM   2360 O  O   . MET B 1 121 ? 32.587  32.982  -21.754  1.00 23.68  ? 943  MET B O   1 
ATOM   2361 C  CB  . MET B 1 121 ? 30.504  32.962  -24.222  1.00 20.19  ? 943  MET B CB  1 
ATOM   2362 C  CG  . MET B 1 121 ? 30.575  31.634  -25.001  1.00 22.53  ? 943  MET B CG  1 
ATOM   2363 S  SD  . MET B 1 121 ? 29.235  30.469  -24.582  1.00 22.02  ? 943  MET B SD  1 
ATOM   2364 C  CE  . MET B 1 121 ? 27.786  31.419  -25.026  1.00 27.80  ? 943  MET B CE  1 
ATOM   2365 N  N   . ASP B 1 122 ? 31.722  30.923  -22.004  1.00 19.91  ? 944  ASP B N   1 
ATOM   2366 C  CA  . ASP B 1 122 ? 32.891  30.237  -21.482  1.00 20.26  ? 944  ASP B CA  1 
ATOM   2367 C  C   . ASP B 1 122 ? 32.940  28.854  -22.107  1.00 17.21  ? 944  ASP B C   1 
ATOM   2368 O  O   . ASP B 1 122 ? 31.979  28.419  -22.744  1.00 15.68  ? 944  ASP B O   1 
ATOM   2369 C  CB  . ASP B 1 122 ? 32.819  30.119  -19.962  1.00 27.76  ? 944  ASP B CB  1 
ATOM   2370 C  CG  . ASP B 1 122 ? 31.479  29.602  -19.486  1.00 34.27  ? 944  ASP B CG  1 
ATOM   2371 O  OD1 . ASP B 1 122 ? 30.708  30.401  -18.922  1.00 45.64  ? 944  ASP B OD1 1 
ATOM   2372 O  OD2 . ASP B 1 122 ? 31.193  28.402  -19.684  1.00 39.59  ? 944  ASP B OD2 1 
ATOM   2373 N  N   . LEU B 1 123 ? 34.057  28.163  -21.924  1.00 19.17  ? 945  LEU B N   1 
ATOM   2374 C  CA  . LEU B 1 123 ? 34.226  26.837  -22.499  1.00 19.25  ? 945  LEU B CA  1 
ATOM   2375 C  C   . LEU B 1 123 ? 33.231  25.802  -21.964  1.00 20.54  ? 945  LEU B C   1 
ATOM   2376 O  O   . LEU B 1 123 ? 32.743  24.951  -22.717  1.00 17.79  ? 945  LEU B O   1 
ATOM   2377 C  CB  . LEU B 1 123 ? 35.665  26.349  -22.269  1.00 16.98  ? 945  LEU B CB  1 
ATOM   2378 C  CG  . LEU B 1 123 ? 36.814  27.145  -22.919  1.00 16.28  ? 945  LEU B CG  1 
ATOM   2379 C  CD1 . LEU B 1 123 ? 38.166  26.576  -22.486  1.00 16.58  ? 945  LEU B CD1 1 
ATOM   2380 C  CD2 . LEU B 1 123 ? 36.706  27.073  -24.432  1.00 13.27  ? 945  LEU B CD2 1 
ATOM   2381 N  N   . SER B 1 124 ? 32.923  25.864  -20.673  1.00 21.83  ? 946  SER B N   1 
ATOM   2382 C  CA  . SER B 1 124 ? 31.994  24.891  -20.110  1.00 22.28  ? 946  SER B CA  1 
ATOM   2383 C  C   . SER B 1 124 ? 30.583  25.071  -20.669  1.00 21.18  ? 946  SER B C   1 
ATOM   2384 O  O   . SER B 1 124 ? 29.838  24.109  -20.777  1.00 20.64  ? 946  SER B O   1 
ATOM   2385 C  CB  . SER B 1 124 ? 31.984  24.958  -18.575  1.00 18.12  ? 946  SER B CB  1 
ATOM   2386 O  OG  . SER B 1 124 ? 31.396  26.154  -18.111  1.00 22.67  ? 946  SER B OG  1 
ATOM   2387 N  N   . THR B 1 125 ? 30.215  26.292  -21.046  1.00 19.98  ? 947  THR B N   1 
ATOM   2388 C  CA  . THR B 1 125 ? 28.888  26.510  -21.613  1.00 20.08  ? 947  THR B CA  1 
ATOM   2389 C  C   . THR B 1 125 ? 28.825  25.920  -23.023  1.00 19.35  ? 947  THR B C   1 
ATOM   2390 O  O   . THR B 1 125 ? 27.810  25.337  -23.423  1.00 18.51  ? 947  THR B O   1 
ATOM   2391 C  CB  . THR B 1 125 ? 28.541  28.003  -21.674  1.00 17.69  ? 947  THR B CB  1 
ATOM   2392 O  OG1 . THR B 1 125 ? 28.522  28.536  -20.347  1.00 18.20  ? 947  THR B OG1 1 
ATOM   2393 C  CG2 . THR B 1 125 ? 27.185  28.210  -22.314  1.00 21.82  ? 947  THR B CG2 1 
ATOM   2394 N  N   . ILE B 1 126 ? 29.906  26.067  -23.781  1.00 14.78  ? 948  ILE B N   1 
ATOM   2395 C  CA  . ILE B 1 126 ? 29.939  25.509  -25.134  1.00 15.72  ? 948  ILE B CA  1 
ATOM   2396 C  C   . ILE B 1 126 ? 29.919  23.984  -25.029  1.00 14.76  ? 948  ILE B C   1 
ATOM   2397 O  O   . ILE B 1 126 ? 29.226  23.303  -25.787  1.00 15.63  ? 948  ILE B O   1 
ATOM   2398 C  CB  . ILE B 1 126 ? 31.208  25.949  -25.909  1.00 14.08  ? 948  ILE B CB  1 
ATOM   2399 C  CG1 . ILE B 1 126 ? 31.218  27.474  -26.067  1.00 15.55  ? 948  ILE B CG1 1 
ATOM   2400 C  CG2 . ILE B 1 126 ? 31.240  25.278  -27.309  1.00 14.37  ? 948  ILE B CG2 1 
ATOM   2401 C  CD1 . ILE B 1 126 ? 32.463  28.014  -26.749  1.00 16.86  ? 948  ILE B CD1 1 
ATOM   2402 N  N   . LYS B 1 127 ? 30.673  23.452  -24.076  1.00 15.17  ? 949  LYS B N   1 
ATOM   2403 C  CA  . LYS B 1 127 ? 30.734  22.007  -23.879  1.00 17.23  ? 949  LYS B CA  1 
ATOM   2404 C  C   . LYS B 1 127 ? 29.319  21.460  -23.605  1.00 19.30  ? 949  LYS B C   1 
ATOM   2405 O  O   . LYS B 1 127 ? 28.872  20.514  -24.255  1.00 17.88  ? 949  LYS B O   1 
ATOM   2406 C  CB  . LYS B 1 127 ? 31.672  21.678  -22.712  1.00 19.77  ? 949  LYS B CB  1 
ATOM   2407 C  CG  . LYS B 1 127 ? 31.873  20.184  -22.463  1.00 19.37  ? 949  LYS B CG  1 
ATOM   2408 C  CD  . LYS B 1 127 ? 32.845  19.942  -21.322  1.00 25.53  ? 949  LYS B CD  1 
ATOM   2409 C  CE  . LYS B 1 127 ? 33.076  18.455  -21.108  1.00 20.62  ? 949  LYS B CE  1 
ATOM   2410 N  NZ  . LYS B 1 127 ? 33.996  18.197  -19.967  1.00 23.49  ? 949  LYS B NZ  1 
ATOM   2411 N  N   . LYS B 1 128 ? 28.614  22.065  -22.656  1.00 19.84  ? 950  LYS B N   1 
ATOM   2412 C  CA  . LYS B 1 128 ? 27.260  21.622  -22.316  1.00 21.96  ? 950  LYS B CA  1 
ATOM   2413 C  C   . LYS B 1 128 ? 26.303  21.748  -23.491  1.00 21.65  ? 950  LYS B C   1 
ATOM   2414 O  O   . LYS B 1 128 ? 25.552  20.821  -23.785  1.00 20.79  ? 950  LYS B O   1 
ATOM   2415 C  CB  . LYS B 1 128 ? 26.722  22.416  -21.122  1.00 44.73  ? 950  LYS B CB  1 
ATOM   2416 C  CG  . LYS B 1 128 ? 27.253  21.963  -19.759  1.00 54.64  ? 950  LYS B CG  1 
ATOM   2417 C  CD  . LYS B 1 128 ? 28.779  21.899  -19.719  1.00 63.25  ? 950  LYS B CD  1 
ATOM   2418 C  CE  . LYS B 1 128 ? 29.310  21.745  -18.302  1.00 65.70  ? 950  LYS B CE  1 
ATOM   2419 N  NZ  . LYS B 1 128 ? 30.799  21.799  -18.264  1.00 70.67  ? 950  LYS B NZ  1 
ATOM   2420 N  N   . ARG B 1 129 ? 26.324  22.890  -24.169  1.00 19.95  ? 951  ARG B N   1 
ATOM   2421 C  CA  . ARG B 1 129 ? 25.440  23.091  -25.312  1.00 21.56  ? 951  ARG B CA  1 
ATOM   2422 C  C   . ARG B 1 129 ? 25.672  22.074  -26.423  1.00 21.55  ? 951  ARG B C   1 
ATOM   2423 O  O   . ARG B 1 129 ? 24.736  21.680  -27.115  1.00 23.51  ? 951  ARG B O   1 
ATOM   2424 C  CB  . ARG B 1 129 ? 25.611  24.496  -25.887  1.00 20.46  ? 951  ARG B CB  1 
ATOM   2425 C  CG  . ARG B 1 129 ? 25.113  25.593  -24.982  1.00 24.45  ? 951  ARG B CG  1 
ATOM   2426 C  CD  . ARG B 1 129 ? 25.196  26.924  -25.693  1.00 29.03  ? 951  ARG B CD  1 
ATOM   2427 N  NE  . ARG B 1 129 ? 24.555  27.981  -24.927  1.00 28.18  ? 951  ARG B NE  1 
ATOM   2428 C  CZ  . ARG B 1 129 ? 24.458  29.239  -25.338  1.00 32.27  ? 951  ARG B CZ  1 
ATOM   2429 N  NH1 . ARG B 1 129 ? 24.965  29.596  -26.515  1.00 24.36  ? 951  ARG B NH1 1 
ATOM   2430 N  NH2 . ARG B 1 129 ? 23.850  30.135  -24.572  1.00 28.03  ? 951  ARG B NH2 1 
ATOM   2431 N  N   . LEU B 1 130 ? 26.921  21.653  -26.591  1.00 23.35  ? 952  LEU B N   1 
ATOM   2432 C  CA  . LEU B 1 130 ? 27.272  20.690  -27.624  1.00 23.72  ? 952  LEU B CA  1 
ATOM   2433 C  C   . LEU B 1 130 ? 26.713  19.301  -27.322  1.00 23.76  ? 952  LEU B C   1 
ATOM   2434 O  O   . LEU B 1 130 ? 26.197  18.624  -28.209  1.00 24.40  ? 952  LEU B O   1 
ATOM   2435 C  CB  . LEU B 1 130 ? 28.795  20.609  -27.765  1.00 18.35  ? 952  LEU B CB  1 
ATOM   2436 C  CG  . LEU B 1 130 ? 29.352  19.716  -28.874  1.00 23.31  ? 952  LEU B CG  1 
ATOM   2437 C  CD1 . LEU B 1 130 ? 28.858  20.239  -30.213  1.00 17.79  ? 952  LEU B CD1 1 
ATOM   2438 C  CD2 . LEU B 1 130 ? 30.887  19.709  -28.831  1.00 19.06  ? 952  LEU B CD2 1 
ATOM   2439 N  N   . GLN B 1 131 ? 26.806  18.898  -26.063  1.00 34.77  ? 953  GLN B N   1 
ATOM   2440 C  CA  . GLN B 1 131 ? 26.351  17.586  -25.627  1.00 34.77  ? 953  GLN B CA  1 
ATOM   2441 C  C   . GLN B 1 131 ? 24.839  17.447  -25.437  1.00 34.77  ? 953  GLN B C   1 
ATOM   2442 O  O   . GLN B 1 131 ? 24.318  16.335  -25.375  1.00 34.77  ? 953  GLN B O   1 
ATOM   2443 C  CB  . GLN B 1 131 ? 27.070  17.214  -24.325  1.00 71.30  ? 953  GLN B CB  1 
ATOM   2444 C  CG  . GLN B 1 131 ? 26.946  15.759  -23.924  1.00 71.30  ? 953  GLN B CG  1 
ATOM   2445 C  CD  . GLN B 1 131 ? 27.721  15.441  -22.655  1.00 71.30  ? 953  GLN B CD  1 
ATOM   2446 O  OE1 . GLN B 1 131 ? 27.454  16.010  -21.594  1.00 71.30  ? 953  GLN B OE1 1 
ATOM   2447 N  NE2 . GLN B 1 131 ? 28.688  14.529  -22.758  1.00 71.30  ? 953  GLN B NE2 1 
ATOM   2448 N  N   . GLU B 1 132 ? 24.136  18.569  -25.354  1.00 47.67  ? 954  GLU B N   1 
ATOM   2449 C  CA  . GLU B 1 132 ? 22.691  18.543  -25.146  1.00 47.67  ? 954  GLU B CA  1 
ATOM   2450 C  C   . GLU B 1 132 ? 21.859  17.963  -26.281  1.00 47.67  ? 954  GLU B C   1 
ATOM   2451 O  O   . GLU B 1 132 ? 22.156  18.178  -27.457  1.00 47.67  ? 954  GLU B O   1 
ATOM   2452 C  CB  . GLU B 1 132 ? 22.182  19.953  -24.837  1.00 71.84  ? 954  GLU B CB  1 
ATOM   2453 C  CG  . GLU B 1 132 ? 22.190  20.306  -23.363  1.00 71.84  ? 954  GLU B CG  1 
ATOM   2454 C  CD  . GLU B 1 132 ? 21.887  21.771  -23.117  1.00 71.84  ? 954  GLU B CD  1 
ATOM   2455 O  OE1 . GLU B 1 132 ? 21.107  22.358  -23.898  1.00 71.84  ? 954  GLU B OE1 1 
ATOM   2456 O  OE2 . GLU B 1 132 ? 22.421  22.333  -22.137  1.00 71.84  ? 954  GLU B OE2 1 
ATOM   2457 N  N   . ASP B 1 133 ? 20.819  17.216  -25.915  1.00 79.15  ? 955  ASP B N   1 
ATOM   2458 C  CA  . ASP B 1 133 ? 19.909  16.646  -26.901  1.00 79.15  ? 955  ASP B CA  1 
ATOM   2459 C  C   . ASP B 1 133 ? 19.174  17.851  -27.461  1.00 79.15  ? 955  ASP B C   1 
ATOM   2460 O  O   . ASP B 1 133 ? 18.775  18.738  -26.704  1.00 79.15  ? 955  ASP B O   1 
ATOM   2461 C  CB  . ASP B 1 133 ? 18.897  15.704  -26.243  1.00 82.19  ? 955  ASP B CB  1 
ATOM   2462 C  CG  . ASP B 1 133 ? 19.112  14.253  -26.623  1.00 82.19  ? 955  ASP B CG  1 
ATOM   2463 O  OD1 . ASP B 1 133 ? 19.476  13.988  -27.787  1.00 82.19  ? 955  ASP B OD1 1 
ATOM   2464 O  OD2 . ASP B 1 133 ? 18.897  13.376  -25.761  1.00 82.19  ? 955  ASP B OD2 1 
ATOM   2465 N  N   . TYR B 1 134 ? 18.990  17.885  -28.776  1.00 62.72  ? 956  TYR B N   1 
ATOM   2466 C  CA  . TYR B 1 134 ? 18.314  19.008  -29.411  1.00 62.72  ? 956  TYR B CA  1 
ATOM   2467 C  C   . TYR B 1 134 ? 19.134  20.257  -29.103  1.00 62.72  ? 956  TYR B C   1 
ATOM   2468 O  O   . TYR B 1 134 ? 18.628  21.243  -28.571  1.00 62.72  ? 956  TYR B O   1 
ATOM   2469 C  CB  . TYR B 1 134 ? 16.890  19.149  -28.865  1.00 73.38  ? 956  TYR B CB  1 
ATOM   2470 C  CG  . TYR B 1 134 ? 16.140  17.835  -28.791  1.00 73.38  ? 956  TYR B CG  1 
ATOM   2471 C  CD1 . TYR B 1 134 ? 15.687  17.342  -27.567  1.00 73.38  ? 956  TYR B CD1 1 
ATOM   2472 C  CD2 . TYR B 1 134 ? 15.900  17.074  -29.938  1.00 73.38  ? 956  TYR B CD2 1 
ATOM   2473 C  CE1 . TYR B 1 134 ? 15.016  16.124  -27.483  1.00 73.38  ? 956  TYR B CE1 1 
ATOM   2474 C  CE2 . TYR B 1 134 ? 15.229  15.852  -29.864  1.00 73.38  ? 956  TYR B CE2 1 
ATOM   2475 C  CZ  . TYR B 1 134 ? 14.790  15.385  -28.632  1.00 73.38  ? 956  TYR B CZ  1 
ATOM   2476 O  OH  . TYR B 1 134 ? 14.127  14.182  -28.540  1.00 73.38  ? 956  TYR B OH  1 
ATOM   2477 N  N   . SER B 1 135 ? 20.419  20.178  -29.433  1.00 44.76  ? 957  SER B N   1 
ATOM   2478 C  CA  . SER B 1 135 ? 21.366  21.265  -29.218  1.00 44.76  ? 957  SER B CA  1 
ATOM   2479 C  C   . SER B 1 135 ? 20.997  22.508  -30.018  1.00 44.76  ? 957  SER B C   1 
ATOM   2480 O  O   . SER B 1 135 ? 20.234  22.439  -30.980  1.00 44.76  ? 957  SER B O   1 
ATOM   2481 C  CB  . SER B 1 135 ? 22.774  20.799  -29.614  1.00 38.43  ? 957  SER B CB  1 
ATOM   2482 O  OG  . SER B 1 135 ? 23.674  21.888  -29.729  1.00 38.43  ? 957  SER B OG  1 
ATOM   2483 N  N   . MET B 1 136 ? 21.546  23.648  -29.615  1.00 44.62  ? 958  MET B N   1 
ATOM   2484 C  CA  . MET B 1 136 ? 21.283  24.896  -30.314  1.00 44.62  ? 958  MET B CA  1 
ATOM   2485 C  C   . MET B 1 136 ? 22.288  25.102  -31.443  1.00 44.62  ? 958  MET B C   1 
ATOM   2486 O  O   . MET B 1 136 ? 22.189  26.059  -32.212  1.00 44.62  ? 958  MET B O   1 
ATOM   2487 C  CB  . MET B 1 136 ? 21.332  26.073  -29.344  1.00 85.33  ? 958  MET B CB  1 
ATOM   2488 C  CG  . MET B 1 136 ? 22.642  26.237  -28.616  1.00 85.33  ? 958  MET B CG  1 
ATOM   2489 S  SD  . MET B 1 136 ? 22.558  27.692  -27.576  1.00 85.33  ? 958  MET B SD  1 
ATOM   2490 C  CE  . MET B 1 136 ? 23.063  28.947  -28.741  1.00 85.33  ? 958  MET B CE  1 
ATOM   2491 N  N   . TYR B 1 137 ? 23.271  24.214  -31.531  1.00 30.70  ? 959  TYR B N   1 
ATOM   2492 C  CA  . TYR B 1 137 ? 24.239  24.313  -32.610  1.00 27.34  ? 959  TYR B CA  1 
ATOM   2493 C  C   . TYR B 1 137 ? 23.714  23.443  -33.753  1.00 27.23  ? 959  TYR B C   1 
ATOM   2494 O  O   . TYR B 1 137 ? 23.555  22.235  -33.599  1.00 27.42  ? 959  TYR B O   1 
ATOM   2495 C  CB  . TYR B 1 137 ? 25.617  23.819  -32.164  1.00 21.77  ? 959  TYR B CB  1 
ATOM   2496 C  CG  . TYR B 1 137 ? 26.224  24.575  -30.995  1.00 19.81  ? 959  TYR B CG  1 
ATOM   2497 C  CD1 . TYR B 1 137 ? 26.123  25.966  -30.900  1.00 20.01  ? 959  TYR B CD1 1 
ATOM   2498 C  CD2 . TYR B 1 137 ? 26.939  23.901  -30.011  1.00 22.17  ? 959  TYR B CD2 1 
ATOM   2499 C  CE1 . TYR B 1 137 ? 26.724  26.664  -29.857  1.00 23.08  ? 959  TYR B CE1 1 
ATOM   2500 C  CE2 . TYR B 1 137 ? 27.543  24.586  -28.965  1.00 20.86  ? 959  TYR B CE2 1 
ATOM   2501 C  CZ  . TYR B 1 137 ? 27.434  25.965  -28.892  1.00 22.76  ? 959  TYR B CZ  1 
ATOM   2502 O  OH  . TYR B 1 137 ? 28.041  26.628  -27.852  1.00 20.08  ? 959  TYR B OH  1 
ATOM   2503 N  N   . SER B 1 138 ? 23.432  24.057  -34.894  1.00 22.11  ? 960  SER B N   1 
ATOM   2504 C  CA  . SER B 1 138 ? 22.918  23.316  -36.045  1.00 22.14  ? 960  SER B CA  1 
ATOM   2505 C  C   . SER B 1 138 ? 23.928  23.278  -37.189  1.00 22.03  ? 960  SER B C   1 
ATOM   2506 O  O   . SER B 1 138 ? 23.803  22.484  -38.132  1.00 22.18  ? 960  SER B O   1 
ATOM   2507 C  CB  . SER B 1 138 ? 21.609  23.947  -36.523  1.00 26.48  ? 960  SER B CB  1 
ATOM   2508 O  OG  . SER B 1 138 ? 21.819  25.296  -36.886  1.00 33.77  ? 960  SER B OG  1 
ATOM   2509 N  N   . LYS B 1 139 ? 24.921  24.158  -37.108  1.00 19.02  ? 961  LYS B N   1 
ATOM   2510 C  CA  . LYS B 1 139 ? 25.981  24.230  -38.100  1.00 19.40  ? 961  LYS B CA  1 
ATOM   2511 C  C   . LYS B 1 139 ? 27.239  24.731  -37.394  1.00 18.91  ? 961  LYS B C   1 
ATOM   2512 O  O   . LYS B 1 139 ? 27.156  25.364  -36.336  1.00 17.93  ? 961  LYS B O   1 
ATOM   2513 C  CB  . LYS B 1 139 ? 25.587  25.170  -39.243  1.00 30.94  ? 961  LYS B CB  1 
ATOM   2514 C  CG  . LYS B 1 139 ? 25.340  26.601  -38.834  1.00 32.22  ? 961  LYS B CG  1 
ATOM   2515 C  CD  . LYS B 1 139 ? 24.859  27.419  -40.033  1.00 38.78  ? 961  LYS B CD  1 
ATOM   2516 C  CE  . LYS B 1 139 ? 24.650  28.879  -39.672  1.00 38.39  ? 961  LYS B CE  1 
ATOM   2517 N  NZ  . LYS B 1 139 ? 23.664  29.056  -38.570  1.00 41.63  ? 961  LYS B NZ  1 
ATOM   2518 N  N   . PRO B 1 140 ? 28.420  24.462  -37.975  1.00 20.49  ? 962  PRO B N   1 
ATOM   2519 C  CA  . PRO B 1 140 ? 29.703  24.874  -37.401  1.00 21.75  ? 962  PRO B CA  1 
ATOM   2520 C  C   . PRO B 1 140 ? 29.798  26.345  -37.012  1.00 19.88  ? 962  PRO B C   1 
ATOM   2521 O  O   . PRO B 1 140 ? 30.329  26.667  -35.956  1.00 19.68  ? 962  PRO B O   1 
ATOM   2522 C  CB  . PRO B 1 140 ? 30.708  24.507  -38.494  1.00 24.67  ? 962  PRO B CB  1 
ATOM   2523 C  CG  . PRO B 1 140 ? 30.058  23.343  -39.173  1.00 24.54  ? 962  PRO B CG  1 
ATOM   2524 C  CD  . PRO B 1 140 ? 28.621  23.796  -39.275  1.00 23.96  ? 962  PRO B CD  1 
ATOM   2525 N  N   . GLU B 1 141 ? 29.298  27.238  -37.863  1.00 23.38  ? 963  GLU B N   1 
ATOM   2526 C  CA  . GLU B 1 141 ? 29.376  28.661  -37.564  1.00 23.18  ? 963  GLU B CA  1 
ATOM   2527 C  C   . GLU B 1 141 ? 28.710  28.995  -36.227  1.00 23.54  ? 963  GLU B C   1 
ATOM   2528 O  O   . GLU B 1 141 ? 29.032  30.010  -35.602  1.00 21.28  ? 963  GLU B O   1 
ATOM   2529 C  CB  . GLU B 1 141 ? 28.731  29.491  -38.687  1.00 24.82  ? 963  GLU B CB  1 
ATOM   2530 C  CG  . GLU B 1 141 ? 29.544  29.592  -39.989  1.00 23.48  ? 963  GLU B CG  1 
ATOM   2531 C  CD  . GLU B 1 141 ? 29.478  28.335  -40.862  1.00 31.57  ? 963  GLU B CD  1 
ATOM   2532 O  OE1 . GLU B 1 141 ? 28.747  27.378  -40.510  1.00 24.85  ? 963  GLU B OE1 1 
ATOM   2533 O  OE2 . GLU B 1 141 ? 30.158  28.313  -41.915  1.00 33.57  ? 963  GLU B OE2 1 
ATOM   2534 N  N   . ASP B 1 142 ? 27.784  28.143  -35.789  1.00 19.46  ? 964  ASP B N   1 
ATOM   2535 C  CA  . ASP B 1 142 ? 27.087  28.379  -34.528  1.00 19.64  ? 964  ASP B CA  1 
ATOM   2536 C  C   . ASP B 1 142 ? 28.020  28.253  -33.332  1.00 18.86  ? 964  ASP B C   1 
ATOM   2537 O  O   . ASP B 1 142 ? 28.020  29.121  -32.457  1.00 18.43  ? 964  ASP B O   1 
ATOM   2538 C  CB  . ASP B 1 142 ? 25.902  27.417  -34.353  1.00 28.48  ? 964  ASP B CB  1 
ATOM   2539 C  CG  . ASP B 1 142 ? 24.776  27.674  -35.354  1.00 32.84  ? 964  ASP B CG  1 
ATOM   2540 O  OD1 . ASP B 1 142 ? 24.713  28.790  -35.914  1.00 31.03  ? 964  ASP B OD1 1 
ATOM   2541 O  OD2 . ASP B 1 142 ? 23.945  26.761  -35.568  1.00 33.00  ? 964  ASP B OD2 1 
ATOM   2542 N  N   . PHE B 1 143 ? 28.810  27.180  -33.268  1.00 19.57  ? 965  PHE B N   1 
ATOM   2543 C  CA  . PHE B 1 143 ? 29.709  27.066  -32.130  1.00 18.93  ? 965  PHE B CA  1 
ATOM   2544 C  C   . PHE B 1 143 ? 30.945  27.943  -32.313  1.00 18.25  ? 965  PHE B C   1 
ATOM   2545 O  O   . PHE B 1 143 ? 31.523  28.410  -31.341  1.00 15.98  ? 965  PHE B O   1 
ATOM   2546 C  CB  . PHE B 1 143 ? 30.073  25.592  -31.824  1.00 16.65  ? 965  PHE B CB  1 
ATOM   2547 C  CG  . PHE B 1 143 ? 30.728  24.844  -32.962  1.00 16.53  ? 965  PHE B CG  1 
ATOM   2548 C  CD1 . PHE B 1 143 ? 32.050  25.092  -33.317  1.00 16.84  ? 965  PHE B CD1 1 
ATOM   2549 C  CD2 . PHE B 1 143 ? 30.038  23.835  -33.626  1.00 16.05  ? 965  PHE B CD2 1 
ATOM   2550 C  CE1 . PHE B 1 143 ? 32.678  24.339  -34.314  1.00 20.59  ? 965  PHE B CE1 1 
ATOM   2551 C  CE2 . PHE B 1 143 ? 30.658  23.078  -34.623  1.00 15.89  ? 965  PHE B CE2 1 
ATOM   2552 C  CZ  . PHE B 1 143 ? 31.981  23.332  -34.965  1.00 19.10  ? 965  PHE B CZ  1 
ATOM   2553 N  N   . VAL B 1 144 ? 31.332  28.208  -33.554  1.00 17.73  ? 966  VAL B N   1 
ATOM   2554 C  CA  . VAL B 1 144 ? 32.493  29.067  -33.766  1.00 19.81  ? 966  VAL B CA  1 
ATOM   2555 C  C   . VAL B 1 144 ? 32.198  30.459  -33.189  1.00 19.46  ? 966  VAL B C   1 
ATOM   2556 O  O   . VAL B 1 144 ? 33.071  31.087  -32.588  1.00 18.98  ? 966  VAL B O   1 
ATOM   2557 C  CB  . VAL B 1 144 ? 32.855  29.178  -35.266  1.00 21.62  ? 966  VAL B CB  1 
ATOM   2558 C  CG1 . VAL B 1 144 ? 33.949  30.235  -35.468  1.00 24.33  ? 966  VAL B CG1 1 
ATOM   2559 C  CG2 . VAL B 1 144 ? 33.342  27.820  -35.783  1.00 21.25  ? 966  VAL B CG2 1 
ATOM   2560 N  N   . ALA B 1 145 ? 30.959  30.920  -33.351  1.00 17.90  ? 967  ALA B N   1 
ATOM   2561 C  CA  . ALA B 1 145 ? 30.556  32.230  -32.840  1.00 18.93  ? 967  ALA B CA  1 
ATOM   2562 C  C   . ALA B 1 145 ? 30.646  32.284  -31.314  1.00 19.44  ? 967  ALA B C   1 
ATOM   2563 O  O   . ALA B 1 145 ? 31.007  33.315  -30.736  1.00 18.41  ? 967  ALA B O   1 
ATOM   2564 C  CB  . ALA B 1 145 ? 29.138  32.552  -33.292  1.00 27.38  ? 967  ALA B CB  1 
ATOM   2565 N  N   . ASP B 1 146 ? 30.316  31.173  -30.659  1.00 17.51  ? 968  ASP B N   1 
ATOM   2566 C  CA  . ASP B 1 146 ? 30.381  31.114  -29.204  1.00 17.69  ? 968  ASP B CA  1 
ATOM   2567 C  C   . ASP B 1 146 ? 31.832  31.168  -28.730  1.00 16.95  ? 968  ASP B C   1 
ATOM   2568 O  O   . ASP B 1 146 ? 32.134  31.843  -27.749  1.00 17.12  ? 968  ASP B O   1 
ATOM   2569 C  CB  . ASP B 1 146 ? 29.675  29.852  -28.673  1.00 18.89  ? 968  ASP B CB  1 
ATOM   2570 C  CG  . ASP B 1 146 ? 28.187  30.083  -28.405  1.00 21.20  ? 968  ASP B CG  1 
ATOM   2571 O  OD1 . ASP B 1 146 ? 27.714  31.218  -28.624  1.00 24.69  ? 968  ASP B OD1 1 
ATOM   2572 O  OD2 . ASP B 1 146 ? 27.489  29.140  -27.963  1.00 26.52  ? 968  ASP B OD2 1 
ATOM   2573 N  N   . PHE B 1 147 ? 32.724  30.460  -29.424  1.00 18.42  ? 969  PHE B N   1 
ATOM   2574 C  CA  . PHE B 1 147 ? 34.147  30.475  -29.077  1.00 20.31  ? 969  PHE B CA  1 
ATOM   2575 C  C   . PHE B 1 147 ? 34.676  31.904  -29.164  1.00 20.95  ? 969  PHE B C   1 
ATOM   2576 O  O   . PHE B 1 147 ? 35.369  32.391  -28.266  1.00 19.04  ? 969  PHE B O   1 
ATOM   2577 C  CB  . PHE B 1 147 ? 34.959  29.608  -30.051  1.00 19.00  ? 969  PHE B CB  1 
ATOM   2578 C  CG  . PHE B 1 147 ? 35.047  28.159  -29.657  1.00 16.33  ? 969  PHE B CG  1 
ATOM   2579 C  CD1 . PHE B 1 147 ? 35.822  27.764  -28.571  1.00 18.72  ? 969  PHE B CD1 1 
ATOM   2580 C  CD2 . PHE B 1 147 ? 34.362  27.193  -30.378  1.00 15.95  ? 969  PHE B CD2 1 
ATOM   2581 C  CE1 . PHE B 1 147 ? 35.917  26.418  -28.210  1.00 20.09  ? 969  PHE B CE1 1 
ATOM   2582 C  CE2 . PHE B 1 147 ? 34.445  25.840  -30.029  1.00 18.93  ? 969  PHE B CE2 1 
ATOM   2583 C  CZ  . PHE B 1 147 ? 35.224  25.453  -28.944  1.00 18.73  ? 969  PHE B CZ  1 
ATOM   2584 N  N   . ARG B 1 148 ? 34.351  32.572  -30.266  1.00 20.29  ? 970  ARG B N   1 
ATOM   2585 C  CA  . ARG B 1 148 ? 34.827  33.929  -30.475  1.00 21.99  ? 970  ARG B CA  1 
ATOM   2586 C  C   . ARG B 1 148 ? 34.215  34.934  -29.504  1.00 22.03  ? 970  ARG B C   1 
ATOM   2587 O  O   . ARG B 1 148 ? 34.824  35.963  -29.190  1.00 21.26  ? 970  ARG B O   1 
ATOM   2588 C  CB  . ARG B 1 148 ? 34.624  34.317  -31.946  1.00 16.83  ? 970  ARG B CB  1 
ATOM   2589 C  CG  . ARG B 1 148 ? 35.505  33.446  -32.870  1.00 20.13  ? 970  ARG B CG  1 
ATOM   2590 C  CD  . ARG B 1 148 ? 36.001  34.135  -34.137  1.00 27.95  ? 970  ARG B CD  1 
ATOM   2591 N  NE  . ARG B 1 148 ? 35.150  33.878  -35.290  1.00 31.42  ? 970  ARG B NE  1 
ATOM   2592 C  CZ  . ARG B 1 148 ? 35.545  33.282  -36.413  1.00 36.06  ? 970  ARG B CZ  1 
ATOM   2593 N  NH1 . ARG B 1 148 ? 36.792  32.862  -36.563  1.00 43.53  ? 970  ARG B NH1 1 
ATOM   2594 N  NH2 . ARG B 1 148 ? 34.680  33.117  -37.399  1.00 27.72  ? 970  ARG B NH2 1 
ATOM   2595 N  N   . LEU B 1 149 ? 33.025  34.616  -29.002  1.00 20.10  ? 971  LEU B N   1 
ATOM   2596 C  CA  . LEU B 1 149 ? 32.360  35.474  -28.037  1.00 19.50  ? 971  LEU B CA  1 
ATOM   2597 C  C   . LEU B 1 149 ? 33.183  35.478  -26.747  1.00 20.06  ? 971  LEU B C   1 
ATOM   2598 O  O   . LEU B 1 149 ? 33.250  36.484  -26.039  1.00 18.38  ? 971  LEU B O   1 
ATOM   2599 C  CB  . LEU B 1 149 ? 30.944  34.958  -27.770  1.00 23.70  ? 971  LEU B CB  1 
ATOM   2600 C  CG  . LEU B 1 149 ? 30.082  35.718  -26.767  1.00 24.86  ? 971  LEU B CG  1 
ATOM   2601 C  CD1 . LEU B 1 149 ? 30.080  37.214  -27.093  1.00 27.66  ? 971  LEU B CD1 1 
ATOM   2602 C  CD2 . LEU B 1 149 ? 28.665  35.147  -26.802  1.00 27.74  ? 971  LEU B CD2 1 
ATOM   2603 N  N   . ILE B 1 150 ? 33.823  34.353  -26.447  1.00 22.11  ? 972  ILE B N   1 
ATOM   2604 C  CA  . ILE B 1 150 ? 34.659  34.254  -25.250  1.00 22.06  ? 972  ILE B CA  1 
ATOM   2605 C  C   . ILE B 1 150 ? 35.816  35.253  -25.343  1.00 22.73  ? 972  ILE B C   1 
ATOM   2606 O  O   . ILE B 1 150 ? 36.138  35.948  -24.377  1.00 20.45  ? 972  ILE B O   1 
ATOM   2607 C  CB  . ILE B 1 150 ? 35.276  32.843  -25.098  1.00 18.68  ? 972  ILE B CB  1 
ATOM   2608 C  CG1 . ILE B 1 150 ? 34.177  31.797  -24.889  1.00 17.67  ? 972  ILE B CG1 1 
ATOM   2609 C  CG2 . ILE B 1 150 ? 36.258  32.832  -23.936  1.00 22.04  ? 972  ILE B CG2 1 
ATOM   2610 C  CD1 . ILE B 1 150 ? 34.715  30.386  -24.867  1.00 16.69  ? 972  ILE B CD1 1 
ATOM   2611 N  N   . PHE B 1 151 ? 36.452  35.306  -26.507  1.00 19.37  ? 973  PHE B N   1 
ATOM   2612 C  CA  . PHE B 1 151 ? 37.573  36.214  -26.707  1.00 19.65  ? 973  PHE B CA  1 
ATOM   2613 C  C   . PHE B 1 151 ? 37.124  37.663  -26.810  1.00 21.32  ? 973  PHE B C   1 
ATOM   2614 O  O   . PHE B 1 151 ? 37.839  38.562  -26.372  1.00 21.46  ? 973  PHE B O   1 
ATOM   2615 C  CB  . PHE B 1 151 ? 38.357  35.809  -27.953  1.00 20.54  ? 973  PHE B CB  1 
ATOM   2616 C  CG  . PHE B 1 151 ? 38.749  34.364  -27.952  1.00 24.53  ? 973  PHE B CG  1 
ATOM   2617 C  CD1 . PHE B 1 151 ? 39.402  33.820  -26.849  1.00 23.55  ? 973  PHE B CD1 1 
ATOM   2618 C  CD2 . PHE B 1 151 ? 38.398  33.529  -29.007  1.00 26.38  ? 973  PHE B CD2 1 
ATOM   2619 C  CE1 . PHE B 1 151 ? 39.695  32.456  -26.789  1.00 27.06  ? 973  PHE B CE1 1 
ATOM   2620 C  CE2 . PHE B 1 151 ? 38.687  32.162  -28.961  1.00 27.17  ? 973  PHE B CE2 1 
ATOM   2621 C  CZ  . PHE B 1 151 ? 39.336  31.626  -27.845  1.00 27.38  ? 973  PHE B CZ  1 
ATOM   2622 N  N   . GLN B 1 152 ? 35.951  37.892  -27.392  1.00 25.49  ? 974  GLN B N   1 
ATOM   2623 C  CA  . GLN B 1 152 ? 35.437  39.254  -27.518  1.00 28.63  ? 974  GLN B CA  1 
ATOM   2624 C  C   . GLN B 1 152 ? 35.116  39.831  -26.150  1.00 27.35  ? 974  GLN B C   1 
ATOM   2625 O  O   . GLN B 1 152 ? 35.378  41.005  -25.883  1.00 28.83  ? 974  GLN B O   1 
ATOM   2626 C  CB  . GLN B 1 152 ? 34.170  39.285  -28.364  1.00 37.80  ? 974  GLN B CB  1 
ATOM   2627 C  CG  . GLN B 1 152 ? 34.366  38.906  -29.806  1.00 46.20  ? 974  GLN B CG  1 
ATOM   2628 C  CD  . GLN B 1 152 ? 33.064  38.953  -30.569  1.00 55.60  ? 974  GLN B CD  1 
ATOM   2629 O  OE1 . GLN B 1 152 ? 32.470  40.022  -30.741  1.00 58.96  ? 974  GLN B OE1 1 
ATOM   2630 N  NE2 . GLN B 1 152 ? 32.601  37.793  -31.018  1.00 48.69  ? 974  GLN B NE2 1 
ATOM   2631 N  N   . ASN B 1 153 ? 34.526  39.011  -25.287  1.00 21.39  ? 975  ASN B N   1 
ATOM   2632 C  CA  . ASN B 1 153 ? 34.184  39.474  -23.953  1.00 20.46  ? 975  ASN B CA  1 
ATOM   2633 C  C   . ASN B 1 153 ? 35.450  39.808  -23.170  1.00 21.88  ? 975  ASN B C   1 
ATOM   2634 O  O   . ASN B 1 153 ? 35.494  40.804  -22.440  1.00 19.72  ? 975  ASN B O   1 
ATOM   2635 C  CB  . ASN B 1 153 ? 33.361  38.418  -23.204  1.00 22.80  ? 975  ASN B CB  1 
ATOM   2636 C  CG  . ASN B 1 153 ? 31.938  38.296  -23.738  1.00 21.76  ? 975  ASN B CG  1 
ATOM   2637 O  OD1 . ASN B 1 153 ? 31.412  39.223  -24.358  1.00 22.86  ? 975  ASN B OD1 1 
ATOM   2638 N  ND2 . ASN B 1 153 ? 31.303  37.160  -23.479  1.00 20.72  ? 975  ASN B ND2 1 
ATOM   2639 N  N   . CYS B 1 154 ? 36.477  38.976  -23.330  1.00 19.32  ? 976  CYS B N   1 
ATOM   2640 C  CA  . CYS B 1 154 ? 37.750  39.176  -22.642  1.00 20.82  ? 976  CYS B CA  1 
ATOM   2641 C  C   . CYS B 1 154 ? 38.367  40.517  -23.037  1.00 20.57  ? 976  CYS B C   1 
ATOM   2642 O  O   . CYS B 1 154 ? 38.750  41.316  -22.183  1.00 20.47  ? 976  CYS B O   1 
ATOM   2643 C  CB  . CYS B 1 154 ? 38.713  38.030  -22.992  1.00 20.94  ? 976  CYS B CB  1 
ATOM   2644 S  SG  . CYS B 1 154 ? 40.378  38.129  -22.249  1.00 23.22  ? 976  CYS B SG  1 
ATOM   2645 N  N   . ALA B 1 155 ? 38.453  40.761  -24.339  1.00 25.22  ? 977  ALA B N   1 
ATOM   2646 C  CA  . ALA B 1 155 ? 39.036  41.998  -24.845  1.00 26.91  ? 977  ALA B CA  1 
ATOM   2647 C  C   . ALA B 1 155 ? 38.184  43.211  -24.477  1.00 27.69  ? 977  ALA B C   1 
ATOM   2648 O  O   . ALA B 1 155 ? 38.699  44.302  -24.243  1.00 26.14  ? 977  ALA B O   1 
ATOM   2649 C  CB  . ALA B 1 155 ? 39.197  41.910  -26.353  1.00 30.61  ? 977  ALA B CB  1 
ATOM   2650 N  N   . GLU B 1 156 ? 36.876  43.013  -24.419  1.00 29.38  ? 978  GLU B N   1 
ATOM   2651 C  CA  . GLU B 1 156 ? 35.970  44.095  -24.083  1.00 31.97  ? 978  GLU B CA  1 
ATOM   2652 C  C   . GLU B 1 156 ? 36.060  44.527  -22.622  1.00 31.38  ? 978  GLU B C   1 
ATOM   2653 O  O   . GLU B 1 156 ? 36.124  45.724  -22.322  1.00 32.49  ? 978  GLU B O   1 
ATOM   2654 C  CB  . GLU B 1 156 ? 34.531  43.691  -24.403  1.00 47.90  ? 978  GLU B CB  1 
ATOM   2655 C  CG  . GLU B 1 156 ? 33.522  44.770  -24.084  1.00 57.28  ? 978  GLU B CG  1 
ATOM   2656 C  CD  . GLU B 1 156 ? 32.734  45.207  -25.299  1.00 63.52  ? 978  GLU B CD  1 
ATOM   2657 O  OE1 . GLU B 1 156 ? 32.164  46.318  -25.261  1.00 62.66  ? 978  GLU B OE1 1 
ATOM   2658 O  OE2 . GLU B 1 156 ? 32.679  44.439  -26.286  1.00 64.21  ? 978  GLU B OE2 1 
ATOM   2659 N  N   . PHE B 1 157 ? 36.081  43.556  -21.715  1.00 27.40  ? 979  PHE B N   1 
ATOM   2660 C  CA  . PHE B 1 157 ? 36.111  43.851  -20.282  1.00 26.84  ? 979  PHE B CA  1 
ATOM   2661 C  C   . PHE B 1 157 ? 37.460  44.144  -19.646  1.00 26.85  ? 979  PHE B C   1 
ATOM   2662 O  O   . PHE B 1 157 ? 37.576  45.039  -18.808  1.00 25.83  ? 979  PHE B O   1 
ATOM   2663 C  CB  . PHE B 1 157 ? 35.472  42.706  -19.497  1.00 27.63  ? 979  PHE B CB  1 
ATOM   2664 C  CG  . PHE B 1 157 ? 35.497  42.914  -18.013  1.00 25.94  ? 979  PHE B CG  1 
ATOM   2665 C  CD1 . PHE B 1 157 ? 34.566  43.748  -17.403  1.00 24.70  ? 979  PHE B CD1 1 
ATOM   2666 C  CD2 . PHE B 1 157 ? 36.469  42.302  -17.228  1.00 23.73  ? 979  PHE B CD2 1 
ATOM   2667 C  CE1 . PHE B 1 157 ? 34.602  43.970  -16.034  1.00 20.30  ? 979  PHE B CE1 1 
ATOM   2668 C  CE2 . PHE B 1 157 ? 36.514  42.520  -15.855  1.00 25.81  ? 979  PHE B CE2 1 
ATOM   2669 C  CZ  . PHE B 1 157 ? 35.580  43.355  -15.257  1.00 21.85  ? 979  PHE B CZ  1 
ATOM   2670 N  N   . ASN B 1 158 ? 38.475  43.380  -20.026  1.00 26.34  ? 980  ASN B N   1 
ATOM   2671 C  CA  . ASN B 1 158 ? 39.791  43.544  -19.432  1.00 24.89  ? 980  ASN B CA  1 
ATOM   2672 C  C   . ASN B 1 158 ? 40.649  44.656  -20.011  1.00 26.28  ? 980  ASN B C   1 
ATOM   2673 O  O   . ASN B 1 158 ? 40.618  44.938  -21.209  1.00 26.18  ? 980  ASN B O   1 
ATOM   2674 C  CB  . ASN B 1 158 ? 40.547  42.213  -19.479  1.00 26.01  ? 980  ASN B CB  1 
ATOM   2675 C  CG  . ASN B 1 158 ? 39.805  41.103  -18.756  1.00 24.36  ? 980  ASN B CG  1 
ATOM   2676 O  OD1 . ASN B 1 158 ? 39.212  40.219  -19.382  1.00 27.39  ? 980  ASN B OD1 1 
ATOM   2677 N  ND2 . ASN B 1 158 ? 39.823  41.152  -17.431  1.00 18.89  ? 980  ASN B ND2 1 
ATOM   2678 N  N   . GLU B 1 159 ? 41.419  45.285  -19.134  1.00 25.72  ? 981  GLU B N   1 
ATOM   2679 C  CA  . GLU B 1 159 ? 42.300  46.374  -19.530  1.00 28.26  ? 981  GLU B CA  1 
ATOM   2680 C  C   . GLU B 1 159 ? 43.290  45.946  -20.601  1.00 27.16  ? 981  GLU B C   1 
ATOM   2681 O  O   . GLU B 1 159 ? 43.804  44.820  -20.586  1.00 25.51  ? 981  GLU B O   1 
ATOM   2682 C  CB  . GLU B 1 159 ? 43.084  46.898  -18.318  1.00 39.97  ? 981  GLU B CB  1 
ATOM   2683 C  CG  . GLU B 1 159 ? 42.224  47.505  -17.227  1.00 46.05  ? 981  GLU B CG  1 
ATOM   2684 C  CD  . GLU B 1 159 ? 41.268  48.558  -17.759  1.00 55.78  ? 981  GLU B CD  1 
ATOM   2685 O  OE1 . GLU B 1 159 ? 41.738  49.537  -18.379  1.00 60.85  ? 981  GLU B OE1 1 
ATOM   2686 O  OE2 . GLU B 1 159 ? 40.043  48.406  -17.559  1.00 58.06  ? 981  GLU B OE2 1 
ATOM   2687 N  N   . PRO B 1 160 ? 43.580  46.849  -21.548  1.00 32.60  ? 982  PRO B N   1 
ATOM   2688 C  CA  . PRO B 1 160 ? 44.526  46.554  -22.625  1.00 31.84  ? 982  PRO B CA  1 
ATOM   2689 C  C   . PRO B 1 160 ? 45.874  46.140  -22.024  1.00 31.02  ? 982  PRO B C   1 
ATOM   2690 O  O   . PRO B 1 160 ? 46.335  46.734  -21.055  1.00 30.14  ? 982  PRO B O   1 
ATOM   2691 C  CB  . PRO B 1 160 ? 44.605  47.882  -23.377  1.00 41.91  ? 982  PRO B CB  1 
ATOM   2692 C  CG  . PRO B 1 160 ? 43.224  48.446  -23.187  1.00 40.38  ? 982  PRO B CG  1 
ATOM   2693 C  CD  . PRO B 1 160 ? 42.981  48.184  -21.724  1.00 41.04  ? 982  PRO B CD  1 
ATOM   2694 N  N   . ASP B 1 161 ? 46.480  45.106  -22.594  1.00 23.97  ? 983  ASP B N   1 
ATOM   2695 C  CA  . ASP B 1 161 ? 47.764  44.582  -22.141  1.00 25.74  ? 983  ASP B CA  1 
ATOM   2696 C  C   . ASP B 1 161 ? 47.790  44.033  -20.716  1.00 24.35  ? 983  ASP B C   1 
ATOM   2697 O  O   . ASP B 1 161 ? 48.865  43.843  -20.148  1.00 25.10  ? 983  ASP B O   1 
ATOM   2698 C  CB  . ASP B 1 161 ? 48.867  45.636  -22.289  1.00 31.47  ? 983  ASP B CB  1 
ATOM   2699 C  CG  . ASP B 1 161 ? 50.257  45.039  -22.137  1.00 33.75  ? 983  ASP B CG  1 
ATOM   2700 O  OD1 . ASP B 1 161 ? 50.604  44.133  -22.929  1.00 32.12  ? 983  ASP B OD1 1 
ATOM   2701 O  OD2 . ASP B 1 161 ? 50.998  45.465  -21.225  1.00 32.82  ? 983  ASP B OD2 1 
ATOM   2702 N  N   . SER B 1 162 ? 46.616  43.789  -20.136  1.00 26.94  ? 984  SER B N   1 
ATOM   2703 C  CA  . SER B 1 162 ? 46.539  43.218  -18.791  1.00 26.90  ? 984  SER B CA  1 
ATOM   2704 C  C   . SER B 1 162 ? 46.824  41.717  -18.905  1.00 26.28  ? 984  SER B C   1 
ATOM   2705 O  O   . SER B 1 162 ? 46.733  41.143  -19.997  1.00 24.70  ? 984  SER B O   1 
ATOM   2706 C  CB  . SER B 1 162 ? 45.141  43.429  -18.200  1.00 26.19  ? 984  SER B CB  1 
ATOM   2707 O  OG  . SER B 1 162 ? 44.149  42.803  -19.001  1.00 25.94  ? 984  SER B OG  1 
ATOM   2708 N  N   . GLU B 1 163 ? 47.159  41.077  -17.789  1.00 23.98  ? 985  GLU B N   1 
ATOM   2709 C  CA  . GLU B 1 163 ? 47.456  39.644  -17.800  1.00 24.91  ? 985  GLU B CA  1 
ATOM   2710 C  C   . GLU B 1 163 ? 46.347  38.809  -18.432  1.00 24.06  ? 985  GLU B C   1 
ATOM   2711 O  O   . GLU B 1 163 ? 46.612  37.949  -19.277  1.00 23.35  ? 985  GLU B O   1 
ATOM   2712 C  CB  . GLU B 1 163 ? 47.705  39.126  -16.380  1.00 27.68  ? 985  GLU B CB  1 
ATOM   2713 C  CG  . GLU B 1 163 ? 49.018  39.566  -15.775  1.00 36.22  ? 985  GLU B CG  1 
ATOM   2714 C  CD  . GLU B 1 163 ? 49.624  38.491  -14.894  1.00 43.45  ? 985  GLU B CD  1 
ATOM   2715 O  OE1 . GLU B 1 163 ? 50.115  37.480  -15.440  1.00 44.32  ? 985  GLU B OE1 1 
ATOM   2716 O  OE2 . GLU B 1 163 ? 49.602  38.650  -13.658  1.00 49.03  ? 985  GLU B OE2 1 
ATOM   2717 N  N   . VAL B 1 164 ? 45.108  39.054  -18.017  1.00 21.53  ? 986  VAL B N   1 
ATOM   2718 C  CA  . VAL B 1 164 ? 43.973  38.307  -18.548  1.00 22.27  ? 986  VAL B CA  1 
ATOM   2719 C  C   . VAL B 1 164 ? 43.752  38.621  -20.022  1.00 21.55  ? 986  VAL B C   1 
ATOM   2720 O  O   . VAL B 1 164 ? 43.513  37.723  -20.821  1.00 22.52  ? 986  VAL B O   1 
ATOM   2721 C  CB  . VAL B 1 164 ? 42.680  38.611  -17.755  1.00 21.89  ? 986  VAL B CB  1 
ATOM   2722 C  CG1 . VAL B 1 164 ? 41.489  37.927  -18.413  1.00 20.74  ? 986  VAL B CG1 1 
ATOM   2723 C  CG2 . VAL B 1 164 ? 42.831  38.132  -16.325  1.00 24.32  ? 986  VAL B CG2 1 
ATOM   2724 N  N   . ALA B 1 165 ? 43.840  39.895  -20.386  1.00 21.67  ? 987  ALA B N   1 
ATOM   2725 C  CA  . ALA B 1 165 ? 43.660  40.285  -21.783  1.00 21.72  ? 987  ALA B CA  1 
ATOM   2726 C  C   . ALA B 1 165 ? 44.692  39.590  -22.681  1.00 22.31  ? 987  ALA B C   1 
ATOM   2727 O  O   . ALA B 1 165 ? 44.363  39.116  -23.767  1.00 19.88  ? 987  ALA B O   1 
ATOM   2728 C  CB  . ALA B 1 165 ? 43.773  41.798  -21.925  1.00 17.10  ? 987  ALA B CB  1 
ATOM   2729 N  N   . ASN B 1 166 ? 45.939  39.528  -22.231  1.00 23.39  ? 988  ASN B N   1 
ATOM   2730 C  CA  . ASN B 1 166 ? 46.973  38.880  -23.026  1.00 25.18  ? 988  ASN B CA  1 
ATOM   2731 C  C   . ASN B 1 166 ? 46.721  37.381  -23.115  1.00 24.83  ? 988  ASN B C   1 
ATOM   2732 O  O   . ASN B 1 166 ? 46.983  36.770  -24.145  1.00 24.45  ? 988  ASN B O   1 
ATOM   2733 C  CB  . ASN B 1 166 ? 48.362  39.160  -22.450  1.00 25.32  ? 988  ASN B CB  1 
ATOM   2734 C  CG  . ASN B 1 166 ? 48.780  40.608  -22.633  1.00 28.89  ? 988  ASN B CG  1 
ATOM   2735 O  OD1 . ASN B 1 166 ? 48.465  41.222  -23.646  1.00 28.01  ? 988  ASN B OD1 1 
ATOM   2736 N  ND2 . ASN B 1 166 ? 49.496  41.154  -21.658  1.00 28.99  ? 988  ASN B ND2 1 
ATOM   2737 N  N   . ALA B 1 167 ? 46.195  36.792  -22.043  1.00 21.87  ? 989  ALA B N   1 
ATOM   2738 C  CA  . ALA B 1 167 ? 45.890  35.366  -22.055  1.00 23.46  ? 989  ALA B CA  1 
ATOM   2739 C  C   . ALA B 1 167 ? 44.803  35.142  -23.102  1.00 23.39  ? 989  ALA B C   1 
ATOM   2740 O  O   . ALA B 1 167 ? 44.841  34.168  -23.850  1.00 23.57  ? 989  ALA B O   1 
ATOM   2741 C  CB  . ALA B 1 167 ? 45.407  34.914  -20.689  1.00 17.09  ? 989  ALA B CB  1 
ATOM   2742 N  N   . GLY B 1 168 ? 43.844  36.064  -23.159  1.00 26.54  ? 990  GLY B N   1 
ATOM   2743 C  CA  . GLY B 1 168 ? 42.766  35.950  -24.124  1.00 26.47  ? 990  GLY B CA  1 
ATOM   2744 C  C   . GLY B 1 168 ? 43.248  35.981  -25.565  1.00 26.03  ? 990  GLY B C   1 
ATOM   2745 O  O   . GLY B 1 168 ? 42.778  35.216  -26.405  1.00 24.28  ? 990  GLY B O   1 
ATOM   2746 N  N   . ILE B 1 169 ? 44.182  36.878  -25.858  1.00 22.43  ? 991  ILE B N   1 
ATOM   2747 C  CA  . ILE B 1 169 ? 44.724  36.998  -27.205  1.00 22.30  ? 991  ILE B CA  1 
ATOM   2748 C  C   . ILE B 1 169 ? 45.520  35.745  -27.575  1.00 20.66  ? 991  ILE B C   1 
ATOM   2749 O  O   . ILE B 1 169 ? 45.463  35.264  -28.706  1.00 20.05  ? 991  ILE B O   1 
ATOM   2750 C  CB  . ILE B 1 169 ? 45.615  38.251  -27.311  1.00 27.15  ? 991  ILE B CB  1 
ATOM   2751 C  CG1 . ILE B 1 169 ? 44.727  39.506  -27.271  1.00 27.15  ? 991  ILE B CG1 1 
ATOM   2752 C  CG2 . ILE B 1 169 ? 46.452  38.200  -28.587  1.00 29.01  ? 991  ILE B CG2 1 
ATOM   2753 C  CD1 . ILE B 1 169 ? 45.496  40.806  -27.116  1.00 36.59  ? 991  ILE B CD1 1 
ATOM   2754 N  N   . LYS B 1 170 ? 46.253  35.211  -26.606  1.00 22.91  ? 992  LYS B N   1 
ATOM   2755 C  CA  . LYS B 1 170 ? 47.044  34.009  -26.825  1.00 24.27  ? 992  LYS B CA  1 
ATOM   2756 C  C   . LYS B 1 170 ? 46.110  32.844  -27.191  1.00 23.05  ? 992  LYS B C   1 
ATOM   2757 O  O   . LYS B 1 170 ? 46.331  32.141  -28.181  1.00 21.46  ? 992  LYS B O   1 
ATOM   2758 C  CB  . LYS B 1 170 ? 47.830  33.677  -25.555  1.00 37.13  ? 992  LYS B CB  1 
ATOM   2759 C  CG  . LYS B 1 170 ? 49.300  33.373  -25.786  1.00 45.44  ? 992  LYS B CG  1 
ATOM   2760 C  CD  . LYS B 1 170 ? 50.018  33.133  -24.464  1.00 50.47  ? 992  LYS B CD  1 
ATOM   2761 C  CE  . LYS B 1 170 ? 51.496  32.854  -24.680  1.00 57.49  ? 992  LYS B CE  1 
ATOM   2762 N  NZ  . LYS B 1 170 ? 51.712  31.681  -25.569  1.00 60.14  ? 992  LYS B NZ  1 
ATOM   2763 N  N   . LEU B 1 171 ? 45.064  32.656  -26.390  1.00 21.30  ? 993  LEU B N   1 
ATOM   2764 C  CA  . LEU B 1 171 ? 44.093  31.589  -26.612  1.00 20.47  ? 993  LEU B CA  1 
ATOM   2765 C  C   . LEU B 1 171 ? 43.355  31.749  -27.936  1.00 20.09  ? 993  LEU B C   1 
ATOM   2766 O  O   . LEU B 1 171 ? 43.077  30.766  -28.623  1.00 19.40  ? 993  LEU B O   1 
ATOM   2767 C  CB  . LEU B 1 171 ? 43.067  31.552  -25.477  1.00 23.67  ? 993  LEU B CB  1 
ATOM   2768 C  CG  . LEU B 1 171 ? 43.087  30.367  -24.509  1.00 29.89  ? 993  LEU B CG  1 
ATOM   2769 C  CD1 . LEU B 1 171 ? 41.724  30.284  -23.821  1.00 28.52  ? 993  LEU B CD1 1 
ATOM   2770 C  CD2 . LEU B 1 171 ? 43.364  29.064  -25.250  1.00 29.43  ? 993  LEU B CD2 1 
ATOM   2771 N  N   . GLU B 1 172 ? 43.036  32.993  -28.287  1.00 23.06  ? 994  GLU B N   1 
ATOM   2772 C  CA  . GLU B 1 172 ? 42.322  33.272  -29.529  1.00 23.58  ? 994  GLU B CA  1 
ATOM   2773 C  C   . GLU B 1 172 ? 43.155  32.944  -30.761  1.00 23.35  ? 994  GLU B C   1 
ATOM   2774 O  O   . GLU B 1 172 ? 42.640  32.394  -31.745  1.00 20.07  ? 994  GLU B O   1 
ATOM   2775 C  CB  . GLU B 1 172 ? 41.896  34.739  -29.575  1.00 24.51  ? 994  GLU B CB  1 
ATOM   2776 C  CG  . GLU B 1 172 ? 41.324  35.163  -30.916  1.00 29.26  ? 994  GLU B CG  1 
ATOM   2777 C  CD  . GLU B 1 172 ? 40.872  36.603  -30.922  1.00 35.82  ? 994  GLU B CD  1 
ATOM   2778 O  OE1 . GLU B 1 172 ? 41.570  37.447  -30.327  1.00 39.00  ? 994  GLU B OE1 1 
ATOM   2779 O  OE2 . GLU B 1 172 ? 39.824  36.897  -31.529  1.00 40.02  ? 994  GLU B OE2 1 
ATOM   2780 N  N   . ASN B 1 173 ? 44.439  33.294  -30.712  1.00 23.65  ? 995  ASN B N   1 
ATOM   2781 C  CA  . ASN B 1 173 ? 45.336  33.024  -31.827  1.00 25.43  ? 995  ASN B CA  1 
ATOM   2782 C  C   . ASN B 1 173 ? 45.461  31.522  -31.994  1.00 25.87  ? 995  ASN B C   1 
ATOM   2783 O  O   . ASN B 1 173 ? 45.518  31.006  -33.111  1.00 27.42  ? 995  ASN B O   1 
ATOM   2784 C  CB  . ASN B 1 173 ? 46.720  33.635  -31.576  1.00 26.85  ? 995  ASN B CB  1 
ATOM   2785 C  CG  . ASN B 1 173 ? 46.707  35.153  -31.643  1.00 31.21  ? 995  ASN B CG  1 
ATOM   2786 O  OD1 . ASN B 1 173 ? 45.838  35.745  -32.279  1.00 33.07  ? 995  ASN B OD1 1 
ATOM   2787 N  ND2 . ASN B 1 173 ? 47.679  35.789  -30.997  1.00 34.67  ? 995  ASN B ND2 1 
ATOM   2788 N  N   . TYR B 1 174 ? 45.499  30.828  -30.865  1.00 24.38  ? 996  TYR B N   1 
ATOM   2789 C  CA  . TYR B 1 174 ? 45.601  29.382  -30.857  1.00 24.62  ? 996  TYR B CA  1 
ATOM   2790 C  C   . TYR B 1 174 ? 44.347  28.805  -31.516  1.00 23.56  ? 996  TYR B C   1 
ATOM   2791 O  O   . TYR B 1 174 ? 44.434  27.960  -32.408  1.00 21.93  ? 996  TYR B O   1 
ATOM   2792 C  CB  . TYR B 1 174 ? 45.726  28.907  -29.411  1.00 20.72  ? 996  TYR B CB  1 
ATOM   2793 C  CG  . TYR B 1 174 ? 45.998  27.438  -29.245  1.00 23.53  ? 996  TYR B CG  1 
ATOM   2794 C  CD1 . TYR B 1 174 ? 47.175  26.864  -29.722  1.00 28.87  ? 996  TYR B CD1 1 
ATOM   2795 C  CD2 . TYR B 1 174 ? 45.091  26.622  -28.571  1.00 21.73  ? 996  TYR B CD2 1 
ATOM   2796 C  CE1 . TYR B 1 174 ? 47.443  25.509  -29.525  1.00 30.42  ? 996  TYR B CE1 1 
ATOM   2797 C  CE2 . TYR B 1 174 ? 45.345  25.282  -28.372  1.00 20.78  ? 996  TYR B CE2 1 
ATOM   2798 C  CZ  . TYR B 1 174 ? 46.518  24.729  -28.847  1.00 26.20  ? 996  TYR B CZ  1 
ATOM   2799 O  OH  . TYR B 1 174 ? 46.762  23.398  -28.625  1.00 28.29  ? 996  TYR B OH  1 
ATOM   2800 N  N   . PHE B 1 175 ? 43.182  29.282  -31.080  1.00 19.69  ? 997  PHE B N   1 
ATOM   2801 C  CA  . PHE B 1 175 ? 41.902  28.830  -31.620  1.00 18.96  ? 997  PHE B CA  1 
ATOM   2802 C  C   . PHE B 1 175 ? 41.785  29.047  -33.131  1.00 19.01  ? 997  PHE B C   1 
ATOM   2803 O  O   . PHE B 1 175 ? 41.375  28.147  -33.874  1.00 16.48  ? 997  PHE B O   1 
ATOM   2804 C  CB  . PHE B 1 175 ? 40.739  29.562  -30.931  1.00 22.69  ? 997  PHE B CB  1 
ATOM   2805 C  CG  . PHE B 1 175 ? 39.396  29.253  -31.535  1.00 20.39  ? 997  PHE B CG  1 
ATOM   2806 C  CD1 . PHE B 1 175 ? 38.767  28.037  -31.286  1.00 23.02  ? 997  PHE B CD1 1 
ATOM   2807 C  CD2 . PHE B 1 175 ? 38.784  30.156  -32.400  1.00 20.66  ? 997  PHE B CD2 1 
ATOM   2808 C  CE1 . PHE B 1 175 ? 37.550  27.724  -31.892  1.00 21.89  ? 997  PHE B CE1 1 
ATOM   2809 C  CE2 . PHE B 1 175 ? 37.574  29.855  -33.009  1.00 21.66  ? 997  PHE B CE2 1 
ATOM   2810 C  CZ  . PHE B 1 175 ? 36.953  28.639  -32.759  1.00 18.52  ? 997  PHE B CZ  1 
ATOM   2811 N  N   . GLU B 1 176 ? 42.127  30.246  -33.587  1.00 20.52  ? 998  GLU B N   1 
ATOM   2812 C  CA  . GLU B 1 176 ? 42.028  30.546  -35.007  1.00 21.99  ? 998  GLU B CA  1 
ATOM   2813 C  C   . GLU B 1 176 ? 42.922  29.617  -35.824  1.00 21.48  ? 998  GLU B C   1 
ATOM   2814 O  O   . GLU B 1 176 ? 42.548  29.181  -36.917  1.00 21.32  ? 998  GLU B O   1 
ATOM   2815 C  CB  . GLU B 1 176 ? 42.382  32.011  -35.265  1.00 26.43  ? 998  GLU B CB  1 
ATOM   2816 C  CG  . GLU B 1 176 ? 41.397  33.007  -34.632  1.00 29.13  ? 998  GLU B CG  1 
ATOM   2817 C  CD  . GLU B 1 176 ? 39.949  32.772  -35.054  1.00 31.02  ? 998  GLU B CD  1 
ATOM   2818 O  OE1 . GLU B 1 176 ? 39.717  32.219  -36.152  1.00 34.63  ? 998  GLU B OE1 1 
ATOM   2819 O  OE2 . GLU B 1 176 ? 39.038  33.159  -34.293  1.00 29.19  ? 998  GLU B OE2 1 
ATOM   2820 N  N   . GLU B 1 177 ? 44.096  29.299  -35.292  1.00 22.71  ? 999  GLU B N   1 
ATOM   2821 C  CA  . GLU B 1 177 ? 45.010  28.402  -35.990  1.00 25.43  ? 999  GLU B CA  1 
ATOM   2822 C  C   . GLU B 1 177 ? 44.405  27.002  -36.054  1.00 23.38  ? 999  GLU B C   1 
ATOM   2823 O  O   . GLU B 1 177 ? 44.498  26.321  -37.073  1.00 20.99  ? 999  GLU B O   1 
ATOM   2824 C  CB  . GLU B 1 177 ? 46.363  28.362  -35.277  1.00 52.60  ? 999  GLU B CB  1 
ATOM   2825 C  CG  . GLU B 1 177 ? 47.233  29.578  -35.550  1.00 60.61  ? 999  GLU B CG  1 
ATOM   2826 C  CD  . GLU B 1 177 ? 48.494  29.595  -34.709  1.00 70.65  ? 999  GLU B CD  1 
ATOM   2827 O  OE1 . GLU B 1 177 ? 49.163  28.543  -34.616  1.00 75.12  ? 999  GLU B OE1 1 
ATOM   2828 O  OE2 . GLU B 1 177 ? 48.821  30.663  -34.147  1.00 76.88  ? 999  GLU B OE2 1 
ATOM   2829 N  N   . LEU B 1 178 ? 43.786  26.575  -34.959  1.00 22.38  ? 1000 LEU B N   1 
ATOM   2830 C  CA  . LEU B 1 178 ? 43.151  25.262  -34.909  1.00 22.06  ? 1000 LEU B CA  1 
ATOM   2831 C  C   . LEU B 1 178 ? 41.986  25.204  -35.904  1.00 19.83  ? 1000 LEU B C   1 
ATOM   2832 O  O   . LEU B 1 178 ? 41.791  24.203  -36.596  1.00 18.80  ? 1000 LEU B O   1 
ATOM   2833 C  CB  . LEU B 1 178 ? 42.645  24.979  -33.489  1.00 23.23  ? 1000 LEU B CB  1 
ATOM   2834 C  CG  . LEU B 1 178 ? 43.737  24.833  -32.421  1.00 26.38  ? 1000 LEU B CG  1 
ATOM   2835 C  CD1 . LEU B 1 178 ? 43.102  24.744  -31.048  1.00 25.78  ? 1000 LEU B CD1 1 
ATOM   2836 C  CD2 . LEU B 1 178 ? 44.575  23.600  -32.709  1.00 29.43  ? 1000 LEU B CD2 1 
ATOM   2837 N  N   . LEU B 1 179 ? 41.225  26.290  -35.984  1.00 24.53  ? 1001 LEU B N   1 
ATOM   2838 C  CA  . LEU B 1 179 ? 40.085  26.365  -36.891  1.00 25.40  ? 1001 LEU B CA  1 
ATOM   2839 C  C   . LEU B 1 179 ? 40.520  26.259  -38.358  1.00 26.64  ? 1001 LEU B C   1 
ATOM   2840 O  O   . LEU B 1 179 ? 39.767  25.774  -39.205  1.00 26.59  ? 1001 LEU B O   1 
ATOM   2841 C  CB  . LEU B 1 179 ? 39.326  27.680  -36.663  1.00 26.16  ? 1001 LEU B CB  1 
ATOM   2842 C  CG  . LEU B 1 179 ? 37.840  27.695  -37.024  1.00 26.96  ? 1001 LEU B CG  1 
ATOM   2843 C  CD1 . LEU B 1 179 ? 37.102  26.620  -36.222  1.00 28.49  ? 1001 LEU B CD1 1 
ATOM   2844 C  CD2 . LEU B 1 179 ? 37.256  29.059  -36.734  1.00 26.45  ? 1001 LEU B CD2 1 
ATOM   2845 N  N   . LYS B 1 180 ? 41.731  26.719  -38.660  1.00 24.35  ? 1002 LYS B N   1 
ATOM   2846 C  CA  . LYS B 1 180 ? 42.236  26.647  -40.029  1.00 26.27  ? 1002 LYS B CA  1 
ATOM   2847 C  C   . LYS B 1 180 ? 42.594  25.201  -40.352  1.00 24.06  ? 1002 LYS B C   1 
ATOM   2848 O  O   . LYS B 1 180 ? 42.508  24.769  -41.500  1.00 26.43  ? 1002 LYS B O   1 
ATOM   2849 C  CB  . LYS B 1 180 ? 43.467  27.542  -40.200  1.00 31.35  ? 1002 LYS B CB  1 
ATOM   2850 C  CG  . LYS B 1 180 ? 43.173  29.022  -40.068  1.00 38.14  ? 1002 LYS B CG  1 
ATOM   2851 C  CD  . LYS B 1 180 ? 44.424  29.866  -40.287  1.00 40.76  ? 1002 LYS B CD  1 
ATOM   2852 C  CE  . LYS B 1 180 ? 44.105  31.359  -40.238  1.00 48.05  ? 1002 LYS B CE  1 
ATOM   2853 N  NZ  . LYS B 1 180 ? 43.196  31.782  -41.347  1.00 46.53  ? 1002 LYS B NZ  1 
ATOM   2854 N  N   . ASN B 1 181 ? 42.996  24.455  -39.326  1.00 23.35  ? 1003 ASN B N   1 
ATOM   2855 C  CA  . ASN B 1 181 ? 43.351  23.049  -39.497  1.00 21.53  ? 1003 ASN B CA  1 
ATOM   2856 C  C   . ASN B 1 181 ? 42.124  22.150  -39.648  1.00 22.13  ? 1003 ASN B C   1 
ATOM   2857 O  O   . ASN B 1 181 ? 42.121  21.241  -40.472  1.00 20.56  ? 1003 ASN B O   1 
ATOM   2858 C  CB  . ASN B 1 181 ? 44.183  22.557  -38.312  1.00 28.45  ? 1003 ASN B CB  1 
ATOM   2859 C  CG  . ASN B 1 181 ? 45.587  23.134  -38.301  1.00 32.83  ? 1003 ASN B CG  1 
ATOM   2860 O  OD1 . ASN B 1 181 ? 46.018  23.767  -39.261  1.00 37.13  ? 1003 ASN B OD1 1 
ATOM   2861 N  ND2 . ASN B 1 181 ? 46.309  22.905  -37.211  1.00 37.95  ? 1003 ASN B ND2 1 
ATOM   2862 N  N   . LEU B 1 182 ? 41.085  22.403  -38.857  1.00 22.16  ? 1004 LEU B N   1 
ATOM   2863 C  CA  . LEU B 1 182 ? 39.869  21.585  -38.905  1.00 23.48  ? 1004 LEU B CA  1 
ATOM   2864 C  C   . LEU B 1 182 ? 38.859  21.972  -39.978  1.00 22.63  ? 1004 LEU B C   1 
ATOM   2865 O  O   . LEU B 1 182 ? 38.028  21.157  -40.379  1.00 23.21  ? 1004 LEU B O   1 
ATOM   2866 C  CB  . LEU B 1 182 ? 39.179  21.593  -37.543  1.00 23.59  ? 1004 LEU B CB  1 
ATOM   2867 C  CG  . LEU B 1 182 ? 39.963  20.894  -36.433  1.00 26.87  ? 1004 LEU B CG  1 
ATOM   2868 C  CD1 . LEU B 1 182 ? 39.249  21.096  -35.103  1.00 26.73  ? 1004 LEU B CD1 1 
ATOM   2869 C  CD2 . LEU B 1 182 ? 40.105  19.412  -36.765  1.00 27.48  ? 1004 LEU B CD2 1 
ATOM   2870 N  N   . TYR B 1 183 ? 38.928  23.216  -40.436  1.00 19.11  ? 1005 TYR B N   1 
ATOM   2871 C  CA  . TYR B 1 183 ? 38.027  23.697  -41.468  1.00 19.90  ? 1005 TYR B CA  1 
ATOM   2872 C  C   . TYR B 1 183 ? 38.807  24.400  -42.575  1.00 20.96  ? 1005 TYR B C   1 
ATOM   2873 O  O   . TYR B 1 183 ? 38.634  25.595  -42.808  1.00 20.42  ? 1005 TYR B O   1 
ATOM   2874 C  CB  . TYR B 1 183 ? 36.988  24.642  -40.850  1.00 20.81  ? 1005 TYR B CB  1 
ATOM   2875 C  CG  . TYR B 1 183 ? 35.930  23.911  -40.048  1.00 22.53  ? 1005 TYR B CG  1 
ATOM   2876 C  CD1 . TYR B 1 183 ? 34.966  23.122  -40.687  1.00 22.28  ? 1005 TYR B CD1 1 
ATOM   2877 C  CD2 . TYR B 1 183 ? 35.921  23.961  -38.658  1.00 20.96  ? 1005 TYR B CD2 1 
ATOM   2878 C  CE1 . TYR B 1 183 ? 34.023  22.394  -39.957  1.00 18.42  ? 1005 TYR B CE1 1 
ATOM   2879 C  CE2 . TYR B 1 183 ? 34.983  23.238  -37.916  1.00 21.38  ? 1005 TYR B CE2 1 
ATOM   2880 C  CZ  . TYR B 1 183 ? 34.040  22.454  -38.572  1.00 19.36  ? 1005 TYR B CZ  1 
ATOM   2881 O  OH  . TYR B 1 183 ? 33.145  21.701  -37.838  1.00 17.16  ? 1005 TYR B OH  1 
ATOM   2882 N  N   . PRO B 1 184 ? 39.687  23.658  -43.270  1.00 49.41  ? 1006 PRO B N   1 
ATOM   2883 C  CA  . PRO B 1 184 ? 40.504  24.194  -44.362  1.00 49.41  ? 1006 PRO B CA  1 
ATOM   2884 C  C   . PRO B 1 184 ? 39.666  24.366  -45.627  1.00 49.41  ? 1006 PRO B C   1 
ATOM   2885 O  O   . PRO B 1 184 ? 40.055  25.184  -46.484  1.00 49.41  ? 1006 PRO B O   1 
ATOM   2886 C  CB  . PRO B 1 184 ? 41.586  23.134  -44.523  1.00 31.99  ? 1006 PRO B CB  1 
ATOM   2887 C  CG  . PRO B 1 184 ? 40.820  21.880  -44.270  1.00 31.99  ? 1006 PRO B CG  1 
ATOM   2888 C  CD  . PRO B 1 184 ? 39.996  22.234  -43.049  1.00 31.99  ? 1006 PRO B CD  1 
ATOM   2889 O  OXT . PRO B 1 184 ? 38.636  23.665  -45.750  1.00 39.32  ? 1006 PRO B OXT 1 
ATOM   2890 N  N   . PRO C 1 2   ? 36.033  31.619  -61.464  1.00 76.10  ? 824  PRO C N   1 
ATOM   2891 C  CA  . PRO C 1 2   ? 36.432  30.699  -60.375  1.00 76.10  ? 824  PRO C CA  1 
ATOM   2892 C  C   . PRO C 1 2   ? 35.508  29.485  -60.323  1.00 76.10  ? 824  PRO C C   1 
ATOM   2893 O  O   . PRO C 1 2   ? 35.877  28.431  -59.802  1.00 76.10  ? 824  PRO C O   1 
ATOM   2894 C  CB  . PRO C 1 2   ? 36.349  31.492  -59.081  1.00 57.56  ? 824  PRO C CB  1 
ATOM   2895 C  CG  . PRO C 1 2   ? 35.255  32.500  -59.426  1.00 57.56  ? 824  PRO C CG  1 
ATOM   2896 C  CD  . PRO C 1 2   ? 35.534  32.883  -60.891  1.00 57.56  ? 824  PRO C CD  1 
ATOM   2897 N  N   . ASN C 1 3   ? 34.305  29.639  -60.867  1.00 57.04  ? 825  ASN C N   1 
ATOM   2898 C  CA  . ASN C 1 3   ? 33.335  28.551  -60.879  1.00 57.04  ? 825  ASN C CA  1 
ATOM   2899 C  C   . ASN C 1 3   ? 33.633  27.553  -61.997  1.00 57.04  ? 825  ASN C C   1 
ATOM   2900 O  O   . ASN C 1 3   ? 34.276  27.887  -62.993  1.00 57.04  ? 825  ASN C O   1 
ATOM   2901 C  CB  . ASN C 1 3   ? 31.915  29.108  -61.028  1.00 100.40 ? 825  ASN C CB  1 
ATOM   2902 C  CG  . ASN C 1 3   ? 31.597  30.176  -59.992  1.00 100.40 ? 825  ASN C CG  1 
ATOM   2903 O  OD1 . ASN C 1 3   ? 32.222  30.238  -58.931  1.00 100.40 ? 825  ASN C OD1 1 
ATOM   2904 N  ND2 . ASN C 1 3   ? 30.609  31.011  -60.289  1.00 100.40 ? 825  ASN C ND2 1 
ATOM   2905 N  N   . GLU C 1 4   ? 33.163  26.325  -61.819  1.00 39.14  ? 826  GLU C N   1 
ATOM   2906 C  CA  . GLU C 1 4   ? 33.382  25.260  -62.792  1.00 39.14  ? 826  GLU C CA  1 
ATOM   2907 C  C   . GLU C 1 4   ? 32.729  25.569  -64.136  1.00 39.14  ? 826  GLU C C   1 
ATOM   2908 O  O   . GLU C 1 4   ? 31.859  26.432  -64.231  1.00 39.14  ? 826  GLU C O   1 
ATOM   2909 C  CB  . GLU C 1 4   ? 32.848  23.941  -62.234  1.00 54.88  ? 826  GLU C CB  1 
ATOM   2910 C  CG  . GLU C 1 4   ? 33.189  23.740  -60.764  1.00 54.88  ? 826  GLU C CG  1 
ATOM   2911 C  CD  . GLU C 1 4   ? 33.070  22.298  -60.318  1.00 54.88  ? 826  GLU C CD  1 
ATOM   2912 O  OE1 . GLU C 1 4   ? 32.010  21.680  -60.551  1.00 54.88  ? 826  GLU C OE1 1 
ATOM   2913 O  OE2 . GLU C 1 4   ? 34.042  21.786  -59.726  1.00 54.88  ? 826  GLU C OE2 1 
ATOM   2914 N  N   . ASP C 1 5   ? 33.154  24.857  -65.174  1.00 38.00  ? 827  ASP C N   1 
ATOM   2915 C  CA  . ASP C 1 5   ? 32.630  25.075  -66.515  1.00 38.94  ? 827  ASP C CA  1 
ATOM   2916 C  C   . ASP C 1 5   ? 31.455  24.187  -66.893  1.00 37.21  ? 827  ASP C C   1 
ATOM   2917 O  O   . ASP C 1 5   ? 30.689  24.523  -67.799  1.00 37.62  ? 827  ASP C O   1 
ATOM   2918 C  CB  . ASP C 1 5   ? 33.742  24.876  -67.546  1.00 47.75  ? 827  ASP C CB  1 
ATOM   2919 C  CG  . ASP C 1 5   ? 34.842  25.899  -67.420  1.00 51.04  ? 827  ASP C CG  1 
ATOM   2920 O  OD1 . ASP C 1 5   ? 34.551  27.101  -67.586  1.00 57.72  ? 827  ASP C OD1 1 
ATOM   2921 O  OD2 . ASP C 1 5   ? 35.995  25.502  -67.158  1.00 54.72  ? 827  ASP C OD2 1 
ATOM   2922 N  N   . TRP C 1 6   ? 31.316  23.051  -66.219  1.00 29.37  ? 828  TRP C N   1 
ATOM   2923 C  CA  . TRP C 1 6   ? 30.227  22.134  -66.543  1.00 27.08  ? 828  TRP C CA  1 
ATOM   2924 C  C   . TRP C 1 6   ? 29.279  21.867  -65.384  1.00 23.97  ? 828  TRP C C   1 
ATOM   2925 O  O   . TRP C 1 6   ? 29.678  21.878  -64.218  1.00 21.07  ? 828  TRP C O   1 
ATOM   2926 C  CB  . TRP C 1 6   ? 30.772  20.784  -67.019  1.00 44.71  ? 828  TRP C CB  1 
ATOM   2927 C  CG  . TRP C 1 6   ? 31.570  20.810  -68.291  1.00 52.39  ? 828  TRP C CG  1 
ATOM   2928 C  CD1 . TRP C 1 6   ? 31.589  21.796  -69.240  1.00 55.35  ? 828  TRP C CD1 1 
ATOM   2929 C  CD2 . TRP C 1 6   ? 32.411  19.763  -68.785  1.00 60.26  ? 828  TRP C CD2 1 
ATOM   2930 N  NE1 . TRP C 1 6   ? 32.388  21.423  -70.295  1.00 61.12  ? 828  TRP C NE1 1 
ATOM   2931 C  CE2 . TRP C 1 6   ? 32.904  20.179  -70.042  1.00 61.59  ? 828  TRP C CE2 1 
ATOM   2932 C  CE3 . TRP C 1 6   ? 32.793  18.508  -68.289  1.00 62.01  ? 828  TRP C CE3 1 
ATOM   2933 C  CZ2 . TRP C 1 6   ? 33.762  19.385  -70.811  1.00 63.86  ? 828  TRP C CZ2 1 
ATOM   2934 C  CZ3 . TRP C 1 6   ? 33.645  17.717  -69.053  1.00 64.17  ? 828  TRP C CZ3 1 
ATOM   2935 C  CH2 . TRP C 1 6   ? 34.120  18.160  -70.302  1.00 64.86  ? 828  TRP C CH2 1 
ATOM   2936 N  N   . CYS C 1 7   ? 28.023  21.619  -65.729  1.00 20.75  ? 829  CYS C N   1 
ATOM   2937 C  CA  . CYS C 1 7   ? 26.995  21.302  -64.751  1.00 23.61  ? 829  CYS C CA  1 
ATOM   2938 C  C   . CYS C 1 7   ? 27.542  20.211  -63.818  1.00 23.15  ? 829  CYS C C   1 
ATOM   2939 O  O   . CYS C 1 7   ? 28.124  19.228  -64.276  1.00 23.01  ? 829  CYS C O   1 
ATOM   2940 C  CB  . CYS C 1 7   ? 25.750  20.808  -65.491  1.00 20.89  ? 829  CYS C CB  1 
ATOM   2941 S  SG  . CYS C 1 7   ? 24.334  20.395  -64.460  1.00 21.65  ? 829  CYS C SG  1 
ATOM   2942 N  N   . ALA C 1 8   ? 27.372  20.397  -62.512  1.00 24.03  ? 830  ALA C N   1 
ATOM   2943 C  CA  . ALA C 1 8   ? 27.858  19.433  -61.530  1.00 25.48  ? 830  ALA C CA  1 
ATOM   2944 C  C   . ALA C 1 8   ? 27.082  18.120  -61.591  1.00 24.52  ? 830  ALA C C   1 
ATOM   2945 O  O   . ALA C 1 8   ? 27.539  17.097  -61.089  1.00 25.82  ? 830  ALA C O   1 
ATOM   2946 C  CB  . ALA C 1 8   ? 27.759  20.022  -60.123  1.00 23.59  ? 830  ALA C CB  1 
ATOM   2947 N  N   . VAL C 1 9   ? 25.905  18.155  -62.202  1.00 21.39  ? 831  VAL C N   1 
ATOM   2948 C  CA  . VAL C 1 9   ? 25.077  16.966  -62.305  1.00 22.70  ? 831  VAL C CA  1 
ATOM   2949 C  C   . VAL C 1 9   ? 25.305  16.168  -63.591  1.00 23.96  ? 831  VAL C C   1 
ATOM   2950 O  O   . VAL C 1 9   ? 25.673  14.995  -63.531  1.00 26.62  ? 831  VAL C O   1 
ATOM   2951 C  CB  . VAL C 1 9   ? 23.575  17.329  -62.203  1.00 23.85  ? 831  VAL C CB  1 
ATOM   2952 C  CG1 . VAL C 1 9   ? 22.714  16.119  -62.532  1.00 25.84  ? 831  VAL C CG1 1 
ATOM   2953 C  CG2 . VAL C 1 9   ? 23.263  17.827  -60.798  1.00 17.66  ? 831  VAL C CG2 1 
ATOM   2954 N  N   . CYS C 1 10  ? 25.100  16.804  -64.744  1.00 23.73  ? 832  CYS C N   1 
ATOM   2955 C  CA  . CYS C 1 10  ? 25.241  16.116  -66.029  1.00 23.66  ? 832  CYS C CA  1 
ATOM   2956 C  C   . CYS C 1 10  ? 26.596  16.248  -66.720  1.00 23.57  ? 832  CYS C C   1 
ATOM   2957 O  O   . CYS C 1 10  ? 26.836  15.599  -67.740  1.00 23.69  ? 832  CYS C O   1 
ATOM   2958 C  CB  . CYS C 1 10  ? 24.146  16.581  -66.996  1.00 25.10  ? 832  CYS C CB  1 
ATOM   2959 S  SG  . CYS C 1 10  ? 24.357  18.285  -67.606  1.00 26.13  ? 832  CYS C SG  1 
ATOM   2960 N  N   . GLN C 1 11  ? 27.468  17.090  -66.175  1.00 28.42  ? 833  GLN C N   1 
ATOM   2961 C  CA  . GLN C 1 11  ? 28.802  17.300  -66.732  1.00 30.37  ? 833  GLN C CA  1 
ATOM   2962 C  C   . GLN C 1 11  ? 28.817  17.892  -68.142  1.00 31.36  ? 833  GLN C C   1 
ATOM   2963 O  O   . GLN C 1 11  ? 29.764  17.675  -68.899  1.00 31.23  ? 833  GLN C O   1 
ATOM   2964 C  CB  . GLN C 1 11  ? 29.593  15.985  -66.723  1.00 30.56  ? 833  GLN C CB  1 
ATOM   2965 C  CG  . GLN C 1 11  ? 29.821  15.402  -65.336  1.00 32.33  ? 833  GLN C CG  1 
ATOM   2966 C  CD  . GLN C 1 11  ? 30.380  16.421  -64.357  1.00 34.90  ? 833  GLN C CD  1 
ATOM   2967 O  OE1 . GLN C 1 11  ? 31.306  17.169  -64.677  1.00 34.59  ? 833  GLN C OE1 1 
ATOM   2968 N  NE2 . GLN C 1 11  ? 29.823  16.448  -63.153  1.00 35.82  ? 833  GLN C NE2 1 
ATOM   2969 N  N   . ASN C 1 12  ? 27.773  18.635  -68.494  1.00 29.99  ? 834  ASN C N   1 
ATOM   2970 C  CA  . ASN C 1 12  ? 27.693  19.274  -69.812  1.00 31.34  ? 834  ASN C CA  1 
ATOM   2971 C  C   . ASN C 1 12  ? 27.534  20.782  -69.644  1.00 31.35  ? 834  ASN C C   1 
ATOM   2972 O  O   . ASN C 1 12  ? 27.104  21.243  -68.587  1.00 27.97  ? 834  ASN C O   1 
ATOM   2973 C  CB  . ASN C 1 12  ? 26.510  18.721  -70.614  1.00 33.83  ? 834  ASN C CB  1 
ATOM   2974 C  CG  . ASN C 1 12  ? 26.790  17.350  -71.198  1.00 39.24  ? 834  ASN C CG  1 
ATOM   2975 O  OD1 . ASN C 1 12  ? 26.667  17.144  -72.404  1.00 45.55  ? 834  ASN C OD1 1 
ATOM   2976 N  ND2 . ASN C 1 12  ? 27.167  16.407  -70.347  1.00 38.59  ? 834  ASN C ND2 1 
ATOM   2977 N  N   . GLY C 1 13  ? 27.874  21.543  -70.684  1.00 33.48  ? 835  GLY C N   1 
ATOM   2978 C  CA  . GLY C 1 13  ? 27.769  22.994  -70.615  1.00 33.71  ? 835  GLY C CA  1 
ATOM   2979 C  C   . GLY C 1 13  ? 26.441  23.586  -71.066  1.00 33.62  ? 835  GLY C C   1 
ATOM   2980 O  O   . GLY C 1 13  ? 25.443  22.876  -71.185  1.00 31.59  ? 835  GLY C O   1 
ATOM   2981 N  N   . GLY C 1 14  ? 26.437  24.893  -71.325  1.00 29.83  ? 836  GLY C N   1 
ATOM   2982 C  CA  . GLY C 1 14  ? 25.224  25.575  -71.754  1.00 30.64  ? 836  GLY C CA  1 
ATOM   2983 C  C   . GLY C 1 14  ? 24.915  26.731  -70.817  1.00 31.47  ? 836  GLY C C   1 
ATOM   2984 O  O   . GLY C 1 14  ? 25.833  27.317  -70.244  1.00 31.18  ? 836  GLY C O   1 
ATOM   2985 N  N   . GLU C 1 15  ? 23.637  27.073  -70.668  1.00 36.73  ? 837  GLU C N   1 
ATOM   2986 C  CA  . GLU C 1 15  ? 23.244  28.147  -69.760  1.00 38.83  ? 837  GLU C CA  1 
ATOM   2987 C  C   . GLU C 1 15  ? 23.248  27.547  -68.360  1.00 38.77  ? 837  GLU C C   1 
ATOM   2988 O  O   . GLU C 1 15  ? 22.382  26.741  -68.009  1.00 39.06  ? 837  GLU C O   1 
ATOM   2989 C  CB  . GLU C 1 15  ? 21.851  28.678  -70.106  1.00 71.04  ? 837  GLU C CB  1 
ATOM   2990 C  CG  . GLU C 1 15  ? 21.824  29.661  -71.272  1.00 77.01  ? 837  GLU C CG  1 
ATOM   2991 C  CD  . GLU C 1 15  ? 22.773  30.837  -71.076  1.00 82.34  ? 837  GLU C CD  1 
ATOM   2992 O  OE1 . GLU C 1 15  ? 22.858  31.358  -69.943  1.00 80.98  ? 837  GLU C OE1 1 
ATOM   2993 O  OE2 . GLU C 1 15  ? 23.425  31.248  -72.060  1.00 83.16  ? 837  GLU C OE2 1 
ATOM   2994 N  N   . LEU C 1 16  ? 24.230  27.951  -67.562  1.00 44.18  ? 838  LEU C N   1 
ATOM   2995 C  CA  . LEU C 1 16  ? 24.396  27.412  -66.222  1.00 44.75  ? 838  LEU C CA  1 
ATOM   2996 C  C   . LEU C 1 16  ? 24.278  28.435  -65.103  1.00 45.34  ? 838  LEU C C   1 
ATOM   2997 O  O   . LEU C 1 16  ? 24.821  29.537  -65.190  1.00 46.74  ? 838  LEU C O   1 
ATOM   2998 C  CB  . LEU C 1 16  ? 25.759  26.726  -66.130  1.00 37.13  ? 838  LEU C CB  1 
ATOM   2999 C  CG  . LEU C 1 16  ? 26.041  25.676  -67.210  1.00 37.37  ? 838  LEU C CG  1 
ATOM   3000 C  CD1 . LEU C 1 16  ? 27.511  25.283  -67.188  1.00 39.80  ? 838  LEU C CD1 1 
ATOM   3001 C  CD2 . LEU C 1 16  ? 25.147  24.461  -66.980  1.00 37.21  ? 838  LEU C CD2 1 
ATOM   3002 N  N   . LEU C 1 17  ? 23.568  28.051  -64.049  1.00 30.44  ? 839  LEU C N   1 
ATOM   3003 C  CA  . LEU C 1 17  ? 23.386  28.903  -62.884  1.00 31.42  ? 839  LEU C CA  1 
ATOM   3004 C  C   . LEU C 1 17  ? 24.614  28.712  -61.987  1.00 30.05  ? 839  LEU C C   1 
ATOM   3005 O  O   . LEU C 1 17  ? 25.018  27.580  -61.710  1.00 27.25  ? 839  LEU C O   1 
ATOM   3006 C  CB  . LEU C 1 17  ? 22.124  28.489  -62.125  1.00 35.63  ? 839  LEU C CB  1 
ATOM   3007 C  CG  . LEU C 1 17  ? 21.139  29.590  -61.733  1.00 39.13  ? 839  LEU C CG  1 
ATOM   3008 C  CD1 . LEU C 1 17  ? 20.043  28.988  -60.873  1.00 43.91  ? 839  LEU C CD1 1 
ATOM   3009 C  CD2 . LEU C 1 17  ? 21.864  30.708  -60.984  1.00 41.20  ? 839  LEU C CD2 1 
ATOM   3010 N  N   . CYS C 1 18  ? 25.197  29.817  -61.533  1.00 28.89  ? 840  CYS C N   1 
ATOM   3011 C  CA  . CYS C 1 18  ? 26.385  29.774  -60.682  1.00 29.33  ? 840  CYS C CA  1 
ATOM   3012 C  C   . CYS C 1 18  ? 26.067  30.001  -59.213  1.00 27.55  ? 840  CYS C C   1 
ATOM   3013 O  O   . CYS C 1 18  ? 25.361  30.943  -58.867  1.00 27.35  ? 840  CYS C O   1 
ATOM   3014 C  CB  . CYS C 1 18  ? 27.392  30.839  -61.128  1.00 59.24  ? 840  CYS C CB  1 
ATOM   3015 S  SG  . CYS C 1 18  ? 27.943  30.705  -62.843  1.00 67.84  ? 840  CYS C SG  1 
ATOM   3016 N  N   . CYS C 1 19  ? 26.605  29.144  -58.349  1.00 32.50  ? 841  CYS C N   1 
ATOM   3017 C  CA  . CYS C 1 19  ? 26.381  29.278  -56.914  1.00 32.29  ? 841  CYS C CA  1 
ATOM   3018 C  C   . CYS C 1 19  ? 27.322  30.330  -56.352  1.00 32.06  ? 841  CYS C C   1 
ATOM   3019 O  O   . CYS C 1 19  ? 28.494  30.388  -56.720  1.00 30.83  ? 841  CYS C O   1 
ATOM   3020 C  CB  . CYS C 1 19  ? 26.631  27.958  -56.199  1.00 24.56  ? 841  CYS C CB  1 
ATOM   3021 S  SG  . CYS C 1 19  ? 26.479  28.072  -54.413  1.00 27.36  ? 841  CYS C SG  1 
ATOM   3022 N  N   . GLU C 1 20  ? 26.799  31.153  -55.455  1.00 32.55  ? 842  GLU C N   1 
ATOM   3023 C  CA  . GLU C 1 20  ? 27.571  32.221  -54.835  1.00 34.98  ? 842  GLU C CA  1 
ATOM   3024 C  C   . GLU C 1 20  ? 28.562  31.747  -53.785  1.00 34.57  ? 842  GLU C C   1 
ATOM   3025 O  O   . GLU C 1 20  ? 29.557  32.422  -53.525  1.00 34.73  ? 842  GLU C O   1 
ATOM   3026 C  CB  . GLU C 1 20  ? 26.623  33.233  -54.185  1.00 44.18  ? 842  GLU C CB  1 
ATOM   3027 C  CG  . GLU C 1 20  ? 26.147  34.330  -55.107  1.00 47.32  ? 842  GLU C CG  1 
ATOM   3028 C  CD  . GLU C 1 20  ? 27.265  35.270  -55.481  1.00 49.62  ? 842  GLU C CD  1 
ATOM   3029 O  OE1 . GLU C 1 20  ? 27.804  35.934  -54.569  1.00 53.64  ? 842  GLU C OE1 1 
ATOM   3030 O  OE2 . GLU C 1 20  ? 27.609  35.339  -56.679  1.00 53.75  ? 842  GLU C OE2 1 
ATOM   3031 N  N   . LYS C 1 21  ? 28.300  30.591  -53.184  1.00 32.72  ? 843  LYS C N   1 
ATOM   3032 C  CA  . LYS C 1 21  ? 29.161  30.089  -52.121  1.00 32.87  ? 843  LYS C CA  1 
ATOM   3033 C  C   . LYS C 1 21  ? 30.114  28.949  -52.483  1.00 33.31  ? 843  LYS C C   1 
ATOM   3034 O  O   . LYS C 1 21  ? 31.044  28.654  -51.730  1.00 32.74  ? 843  LYS C O   1 
ATOM   3035 C  CB  . LYS C 1 21  ? 28.291  29.699  -50.922  1.00 37.71  ? 843  LYS C CB  1 
ATOM   3036 C  CG  . LYS C 1 21  ? 27.436  30.863  -50.412  1.00 41.89  ? 843  LYS C CG  1 
ATOM   3037 C  CD  . LYS C 1 21  ? 26.604  30.488  -49.197  1.00 45.38  ? 843  LYS C CD  1 
ATOM   3038 C  CE  . LYS C 1 21  ? 27.473  30.187  -47.983  1.00 54.64  ? 843  LYS C CE  1 
ATOM   3039 N  NZ  . LYS C 1 21  ? 26.664  29.868  -46.765  1.00 56.36  ? 843  LYS C NZ  1 
ATOM   3040 N  N   . CYS C 1 22  ? 29.897  28.314  -53.629  1.00 33.42  ? 844  CYS C N   1 
ATOM   3041 C  CA  . CYS C 1 22  ? 30.773  27.227  -54.052  1.00 32.44  ? 844  CYS C CA  1 
ATOM   3042 C  C   . CYS C 1 22  ? 31.033  27.330  -55.556  1.00 31.18  ? 844  CYS C C   1 
ATOM   3043 O  O   . CYS C 1 22  ? 30.420  28.147  -56.246  1.00 31.35  ? 844  CYS C O   1 
ATOM   3044 C  CB  . CYS C 1 22  ? 30.149  25.867  -53.706  1.00 29.20  ? 844  CYS C CB  1 
ATOM   3045 S  SG  . CYS C 1 22  ? 28.869  25.324  -54.857  1.00 29.68  ? 844  CYS C SG  1 
ATOM   3046 N  N   . PRO C 1 23  ? 31.960  26.512  -56.082  1.00 33.64  ? 845  PRO C N   1 
ATOM   3047 C  CA  . PRO C 1 23  ? 32.300  26.519  -57.511  1.00 33.47  ? 845  PRO C CA  1 
ATOM   3048 C  C   . PRO C 1 23  ? 31.300  25.835  -58.454  1.00 31.74  ? 845  PRO C C   1 
ATOM   3049 O  O   . PRO C 1 23  ? 31.348  26.052  -59.664  1.00 32.33  ? 845  PRO C O   1 
ATOM   3050 C  CB  . PRO C 1 23  ? 33.669  25.824  -57.549  1.00 31.28  ? 845  PRO C CB  1 
ATOM   3051 C  CG  . PRO C 1 23  ? 34.207  26.022  -56.168  1.00 34.38  ? 845  PRO C CG  1 
ATOM   3052 C  CD  . PRO C 1 23  ? 32.991  25.795  -55.318  1.00 32.35  ? 845  PRO C CD  1 
ATOM   3053 N  N   . LYS C 1 24  ? 30.397  25.018  -57.911  1.00 26.99  ? 846  LYS C N   1 
ATOM   3054 C  CA  . LYS C 1 24  ? 29.434  24.302  -58.751  1.00 26.80  ? 846  LYS C CA  1 
ATOM   3055 C  C   . LYS C 1 24  ? 28.512  25.184  -59.587  1.00 27.43  ? 846  LYS C C   1 
ATOM   3056 O  O   . LYS C 1 24  ? 28.183  26.309  -59.203  1.00 29.48  ? 846  LYS C O   1 
ATOM   3057 C  CB  . LYS C 1 24  ? 28.565  23.366  -57.904  1.00 26.16  ? 846  LYS C CB  1 
ATOM   3058 C  CG  . LYS C 1 24  ? 29.332  22.313  -57.104  1.00 26.78  ? 846  LYS C CG  1 
ATOM   3059 C  CD  . LYS C 1 24  ? 28.393  21.203  -56.638  1.00 32.55  ? 846  LYS C CD  1 
ATOM   3060 C  CE  . LYS C 1 24  ? 29.032  20.307  -55.584  1.00 38.46  ? 846  LYS C CE  1 
ATOM   3061 N  NZ  . LYS C 1 24  ? 30.266  19.642  -56.050  1.00 42.32  ? 846  LYS C NZ  1 
ATOM   3062 N  N   . VAL C 1 25  ? 28.095  24.650  -60.734  1.00 25.17  ? 847  VAL C N   1 
ATOM   3063 C  CA  . VAL C 1 25  ? 27.175  25.338  -61.633  1.00 25.98  ? 847  VAL C CA  1 
ATOM   3064 C  C   . VAL C 1 25  ? 26.149  24.287  -62.024  1.00 24.53  ? 847  VAL C C   1 
ATOM   3065 O  O   . VAL C 1 25  ? 26.462  23.096  -62.036  1.00 22.99  ? 847  VAL C O   1 
ATOM   3066 C  CB  . VAL C 1 25  ? 27.889  25.902  -62.900  1.00 30.78  ? 847  VAL C CB  1 
ATOM   3067 C  CG1 . VAL C 1 25  ? 28.970  26.894  -62.481  1.00 33.01  ? 847  VAL C CG1 1 
ATOM   3068 C  CG2 . VAL C 1 25  ? 28.488  24.776  -63.732  1.00 30.64  ? 847  VAL C CG2 1 
ATOM   3069 N  N   . PHE C 1 26  ? 24.932  24.717  -62.334  1.00 22.02  ? 848  PHE C N   1 
ATOM   3070 C  CA  . PHE C 1 26  ? 23.864  23.782  -62.674  1.00 24.02  ? 848  PHE C CA  1 
ATOM   3071 C  C   . PHE C 1 26  ? 22.946  24.256  -63.782  1.00 25.29  ? 848  PHE C C   1 
ATOM   3072 O  O   . PHE C 1 26  ? 22.725  25.459  -63.949  1.00 27.55  ? 848  PHE C O   1 
ATOM   3073 C  CB  . PHE C 1 26  ? 22.952  23.560  -61.468  1.00 21.41  ? 848  PHE C CB  1 
ATOM   3074 C  CG  . PHE C 1 26  ? 23.657  23.121  -60.233  1.00 21.62  ? 848  PHE C CG  1 
ATOM   3075 C  CD1 . PHE C 1 26  ? 23.738  21.773  -59.910  1.00 19.07  ? 848  PHE C CD1 1 
ATOM   3076 C  CD2 . PHE C 1 26  ? 24.210  24.058  -59.367  1.00 17.66  ? 848  PHE C CD2 1 
ATOM   3077 C  CE1 . PHE C 1 26  ? 24.357  21.366  -58.738  1.00 18.61  ? 848  PHE C CE1 1 
ATOM   3078 C  CE2 . PHE C 1 26  ? 24.826  23.665  -58.200  1.00 19.68  ? 848  PHE C CE2 1 
ATOM   3079 C  CZ  . PHE C 1 26  ? 24.902  22.314  -57.877  1.00 20.28  ? 848  PHE C CZ  1 
ATOM   3080 N  N   . HIS C 1 27  ? 22.395  23.300  -64.527  1.00 27.19  ? 849  HIS C N   1 
ATOM   3081 C  CA  . HIS C 1 27  ? 21.399  23.639  -65.524  1.00 27.45  ? 849  HIS C CA  1 
ATOM   3082 C  C   . HIS C 1 27  ? 20.192  23.846  -64.619  1.00 26.33  ? 849  HIS C C   1 
ATOM   3083 O  O   . HIS C 1 27  ? 20.171  23.344  -63.490  1.00 26.85  ? 849  HIS C O   1 
ATOM   3084 C  CB  . HIS C 1 27  ? 21.132  22.477  -66.479  1.00 25.14  ? 849  HIS C CB  1 
ATOM   3085 C  CG  . HIS C 1 27  ? 22.197  22.290  -67.512  1.00 28.31  ? 849  HIS C CG  1 
ATOM   3086 N  ND1 . HIS C 1 27  ? 23.198  21.352  -67.391  1.00 37.00  ? 849  HIS C ND1 1 
ATOM   3087 C  CD2 . HIS C 1 27  ? 22.428  22.939  -68.679  1.00 36.31  ? 849  HIS C CD2 1 
ATOM   3088 C  CE1 . HIS C 1 27  ? 23.999  21.427  -68.438  1.00 26.89  ? 849  HIS C CE1 1 
ATOM   3089 N  NE2 . HIS C 1 27  ? 23.555  22.383  -69.234  1.00 33.80  ? 849  HIS C NE2 1 
ATOM   3090 N  N   . LEU C 1 28  ? 19.189  24.573  -65.093  1.00 27.05  ? 850  LEU C N   1 
ATOM   3091 C  CA  . LEU C 1 28  ? 18.017  24.834  -64.274  1.00 27.31  ? 850  LEU C CA  1 
ATOM   3092 C  C   . LEU C 1 28  ? 17.296  23.576  -63.827  1.00 25.40  ? 850  LEU C C   1 
ATOM   3093 O  O   . LEU C 1 28  ? 16.830  23.494  -62.694  1.00 24.61  ? 850  LEU C O   1 
ATOM   3094 C  CB  . LEU C 1 28  ? 17.028  25.729  -65.019  1.00 23.17  ? 850  LEU C CB  1 
ATOM   3095 C  CG  . LEU C 1 28  ? 17.435  27.177  -65.305  1.00 26.00  ? 850  LEU C CG  1 
ATOM   3096 C  CD1 . LEU C 1 28  ? 16.207  27.916  -65.825  1.00 29.53  ? 850  LEU C CD1 1 
ATOM   3097 C  CD2 . LEU C 1 28  ? 17.960  27.861  -64.048  1.00 28.28  ? 850  LEU C CD2 1 
ATOM   3098 N  N   . SER C 1 29  ? 17.201  22.595  -64.715  1.00 27.30  ? 851  SER C N   1 
ATOM   3099 C  CA  . SER C 1 29  ? 16.499  21.372  -64.371  1.00 28.35  ? 851  SER C CA  1 
ATOM   3100 C  C   . SER C 1 29  ? 17.393  20.253  -63.836  1.00 26.80  ? 851  SER C C   1 
ATOM   3101 O  O   . SER C 1 29  ? 16.907  19.171  -63.538  1.00 25.19  ? 851  SER C O   1 
ATOM   3102 C  CB  . SER C 1 29  ? 15.687  20.878  -65.570  1.00 34.76  ? 851  SER C CB  1 
ATOM   3103 O  OG  . SER C 1 29  ? 16.515  20.691  -66.697  1.00 36.57  ? 851  SER C OG  1 
ATOM   3104 N  N   . CYS C 1 30  ? 18.691  20.509  -63.707  1.00 23.04  ? 852  CYS C N   1 
ATOM   3105 C  CA  . CYS C 1 30  ? 19.591  19.494  -63.159  1.00 22.13  ? 852  CYS C CA  1 
ATOM   3106 C  C   . CYS C 1 30  ? 19.682  19.714  -61.654  1.00 21.90  ? 852  CYS C C   1 
ATOM   3107 O  O   . CYS C 1 30  ? 19.925  18.784  -60.872  1.00 21.65  ? 852  CYS C O   1 
ATOM   3108 C  CB  . CYS C 1 30  ? 20.977  19.594  -63.800  1.00 22.04  ? 852  CYS C CB  1 
ATOM   3109 S  SG  . CYS C 1 30  ? 21.060  18.857  -65.460  1.00 24.81  ? 852  CYS C SG  1 
ATOM   3110 N  N   . HIS C 1 31  ? 19.477  20.962  -61.248  1.00 21.57  ? 853  HIS C N   1 
ATOM   3111 C  CA  . HIS C 1 31  ? 19.517  21.314  -59.843  1.00 21.57  ? 853  HIS C CA  1 
ATOM   3112 C  C   . HIS C 1 31  ? 18.311  20.686  -59.146  1.00 21.57  ? 853  HIS C C   1 
ATOM   3113 O  O   . HIS C 1 31  ? 17.325  20.327  -59.792  1.00 21.57  ? 853  HIS C O   1 
ATOM   3114 C  CB  . HIS C 1 31  ? 19.456  22.835  -59.672  1.00 15.81  ? 853  HIS C CB  1 
ATOM   3115 C  CG  . HIS C 1 31  ? 19.567  23.289  -58.248  1.00 15.81  ? 853  HIS C CG  1 
ATOM   3116 N  ND1 . HIS C 1 31  ? 20.763  23.309  -57.562  1.00 15.81  ? 853  HIS C ND1 1 
ATOM   3117 C  CD2 . HIS C 1 31  ? 18.627  23.725  -57.378  1.00 15.81  ? 853  HIS C CD2 1 
ATOM   3118 C  CE1 . HIS C 1 31  ? 20.554  23.739  -56.329  1.00 15.81  ? 853  HIS C CE1 1 
ATOM   3119 N  NE2 . HIS C 1 31  ? 19.266  23.997  -56.192  1.00 15.81  ? 853  HIS C NE2 1 
ATOM   3120 N  N   . VAL C 1 32  ? 18.414  20.526  -57.831  1.00 22.48  ? 854  VAL C N   1 
ATOM   3121 C  CA  . VAL C 1 32  ? 17.310  20.003  -57.040  1.00 22.48  ? 854  VAL C CA  1 
ATOM   3122 C  C   . VAL C 1 32  ? 17.098  21.002  -55.902  1.00 22.48  ? 854  VAL C C   1 
ATOM   3123 O  O   . VAL C 1 32  ? 17.973  21.186  -55.054  1.00 22.48  ? 854  VAL C O   1 
ATOM   3124 C  CB  . VAL C 1 32  ? 17.609  18.602  -56.436  1.00 20.60  ? 854  VAL C CB  1 
ATOM   3125 C  CG1 . VAL C 1 32  ? 16.370  18.090  -55.688  1.00 20.60  ? 854  VAL C CG1 1 
ATOM   3126 C  CG2 . VAL C 1 32  ? 17.989  17.620  -57.540  1.00 20.60  ? 854  VAL C CG2 1 
ATOM   3127 N  N   . PRO C 1 33  ? 15.932  21.668  -55.879  1.00 18.83  ? 855  PRO C N   1 
ATOM   3128 C  CA  . PRO C 1 33  ? 14.879  21.477  -56.882  1.00 18.83  ? 855  PRO C CA  1 
ATOM   3129 C  C   . PRO C 1 33  ? 15.101  22.202  -58.207  1.00 18.83  ? 855  PRO C C   1 
ATOM   3130 O  O   . PRO C 1 33  ? 15.979  23.057  -58.339  1.00 18.83  ? 855  PRO C O   1 
ATOM   3131 C  CB  . PRO C 1 33  ? 13.638  21.977  -56.167  1.00 18.51  ? 855  PRO C CB  1 
ATOM   3132 C  CG  . PRO C 1 33  ? 14.178  23.139  -55.382  1.00 18.51  ? 855  PRO C CG  1 
ATOM   3133 C  CD  . PRO C 1 33  ? 15.474  22.570  -54.804  1.00 18.51  ? 855  PRO C CD  1 
ATOM   3134 N  N   . THR C 1 34  ? 14.292  21.843  -59.193  1.00 16.03  ? 856  THR C N   1 
ATOM   3135 C  CA  . THR C 1 34  ? 14.368  22.463  -60.505  1.00 17.41  ? 856  THR C CA  1 
ATOM   3136 C  C   . THR C 1 34  ? 13.879  23.899  -60.399  1.00 17.74  ? 856  THR C C   1 
ATOM   3137 O  O   . THR C 1 34  ? 12.865  24.168  -59.763  1.00 17.65  ? 856  THR C O   1 
ATOM   3138 C  CB  . THR C 1 34  ? 13.483  21.700  -61.516  1.00 23.90  ? 856  THR C CB  1 
ATOM   3139 O  OG1 . THR C 1 34  ? 14.072  20.421  -61.783  1.00 22.32  ? 856  THR C OG1 1 
ATOM   3140 C  CG2 . THR C 1 34  ? 13.332  22.490  -62.827  1.00 21.32  ? 856  THR C CG2 1 
ATOM   3141 N  N   . LEU C 1 35  ? 14.629  24.824  -60.979  1.00 23.18  ? 857  LEU C N   1 
ATOM   3142 C  CA  . LEU C 1 35  ? 14.216  26.220  -60.974  1.00 24.50  ? 857  LEU C CA  1 
ATOM   3143 C  C   . LEU C 1 35  ? 13.498  26.458  -62.284  1.00 26.06  ? 857  LEU C C   1 
ATOM   3144 O  O   . LEU C 1 35  ? 13.858  25.871  -63.301  1.00 24.09  ? 857  LEU C O   1 
ATOM   3145 C  CB  . LEU C 1 35  ? 15.418  27.155  -60.861  1.00 25.12  ? 857  LEU C CB  1 
ATOM   3146 C  CG  . LEU C 1 35  ? 15.816  27.499  -59.426  1.00 27.74  ? 857  LEU C CG  1 
ATOM   3147 C  CD1 . LEU C 1 35  ? 16.474  26.302  -58.765  1.00 29.79  ? 857  LEU C CD1 1 
ATOM   3148 C  CD2 . LEU C 1 35  ? 16.757  28.695  -59.444  1.00 31.28  ? 857  LEU C CD2 1 
ATOM   3149 N  N   . THR C 1 36  ? 12.478  27.305  -62.254  1.00 26.90  ? 858  THR C N   1 
ATOM   3150 C  CA  . THR C 1 36  ? 11.708  27.603  -63.452  1.00 29.34  ? 858  THR C CA  1 
ATOM   3151 C  C   . THR C 1 36  ? 12.438  28.613  -64.329  1.00 28.64  ? 858  THR C C   1 
ATOM   3152 O  O   . THR C 1 36  ? 12.498  28.460  -65.545  1.00 28.05  ? 858  THR C O   1 
ATOM   3153 C  CB  . THR C 1 36  ? 10.329  28.177  -63.089  1.00 38.63  ? 858  THR C CB  1 
ATOM   3154 O  OG1 . THR C 1 36  ? 9.626   27.234  -62.273  1.00 42.26  ? 858  THR C OG1 1 
ATOM   3155 C  CG2 . THR C 1 36  ? 9.521   28.472  -64.349  1.00 38.32  ? 858  THR C CG2 1 
ATOM   3156 N  N   . ASN C 1 37  ? 12.992  29.644  -63.702  1.00 33.09  ? 859  ASN C N   1 
ATOM   3157 C  CA  . ASN C 1 37  ? 13.717  30.677  -64.433  1.00 33.75  ? 859  ASN C CA  1 
ATOM   3158 C  C   . ASN C 1 37  ? 15.059  30.943  -63.778  1.00 33.48  ? 859  ASN C C   1 
ATOM   3159 O  O   . ASN C 1 37  ? 15.285  30.558  -62.633  1.00 32.86  ? 859  ASN C O   1 
ATOM   3160 C  CB  . ASN C 1 37  ? 12.913  31.983  -64.458  1.00 33.50  ? 859  ASN C CB  1 
ATOM   3161 C  CG  . ASN C 1 37  ? 11.584  31.839  -65.170  1.00 34.78  ? 859  ASN C CG  1 
ATOM   3162 O  OD1 . ASN C 1 37  ? 10.526  31.814  -64.539  1.00 39.37  ? 859  ASN C OD1 1 
ATOM   3163 N  ND2 . ASN C 1 37  ? 11.633  31.739  -66.495  1.00 35.29  ? 859  ASN C ND2 1 
ATOM   3164 N  N   . PHE C 1 38  ? 15.951  31.596  -64.513  1.00 29.87  ? 860  PHE C N   1 
ATOM   3165 C  CA  . PHE C 1 38  ? 17.253  31.947  -63.974  1.00 30.97  ? 860  PHE C CA  1 
ATOM   3166 C  C   . PHE C 1 38  ? 17.008  33.055  -62.950  1.00 31.15  ? 860  PHE C C   1 
ATOM   3167 O  O   . PHE C 1 38  ? 16.201  33.950  -63.184  1.00 30.81  ? 860  PHE C O   1 
ATOM   3168 C  CB  . PHE C 1 38  ? 18.177  32.449  -65.088  1.00 44.10  ? 860  PHE C CB  1 
ATOM   3169 C  CG  . PHE C 1 38  ? 18.808  31.348  -65.890  1.00 48.16  ? 860  PHE C CG  1 
ATOM   3170 C  CD1 . PHE C 1 38  ? 19.974  30.730  -65.448  1.00 50.69  ? 860  PHE C CD1 1 
ATOM   3171 C  CD2 . PHE C 1 38  ? 18.219  30.900  -67.068  1.00 48.85  ? 860  PHE C CD2 1 
ATOM   3172 C  CE1 . PHE C 1 38  ? 20.544  29.680  -66.168  1.00 50.11  ? 860  PHE C CE1 1 
ATOM   3173 C  CE2 . PHE C 1 38  ? 18.781  29.847  -67.798  1.00 50.10  ? 860  PHE C CE2 1 
ATOM   3174 C  CZ  . PHE C 1 38  ? 19.944  29.237  -67.347  1.00 48.15  ? 860  PHE C CZ  1 
ATOM   3175 N  N   . PRO C 1 39  ? 17.688  32.991  -61.795  1.00 33.63  ? 861  PRO C N   1 
ATOM   3176 C  CA  . PRO C 1 39  ? 17.571  33.969  -60.709  1.00 33.02  ? 861  PRO C CA  1 
ATOM   3177 C  C   . PRO C 1 39  ? 17.950  35.374  -61.154  1.00 33.02  ? 861  PRO C C   1 
ATOM   3178 O  O   . PRO C 1 39  ? 18.875  35.553  -61.950  1.00 31.02  ? 861  PRO C O   1 
ATOM   3179 C  CB  . PRO C 1 39  ? 18.534  33.430  -59.656  1.00 32.54  ? 861  PRO C CB  1 
ATOM   3180 C  CG  . PRO C 1 39  ? 18.499  31.959  -59.896  1.00 34.00  ? 861  PRO C CG  1 
ATOM   3181 C  CD  . PRO C 1 39  ? 18.555  31.872  -61.392  1.00 33.19  ? 861  PRO C CD  1 
ATOM   3182 N  N   . SER C 1 40  ? 17.242  36.369  -60.634  1.00 38.54  ? 862  SER C N   1 
ATOM   3183 C  CA  . SER C 1 40  ? 17.520  37.752  -60.992  1.00 39.19  ? 862  SER C CA  1 
ATOM   3184 C  C   . SER C 1 40  ? 18.788  38.269  -60.315  1.00 38.47  ? 862  SER C C   1 
ATOM   3185 O  O   . SER C 1 40  ? 19.517  39.078  -60.886  1.00 39.36  ? 862  SER C O   1 
ATOM   3186 C  CB  . SER C 1 40  ? 16.332  38.642  -60.615  1.00 37.14  ? 862  SER C CB  1 
ATOM   3187 O  OG  . SER C 1 40  ? 16.066  38.576  -59.227  1.00 35.09  ? 862  SER C OG  1 
ATOM   3188 N  N   . GLY C 1 41  ? 19.052  37.793  -59.102  1.00 31.37  ? 863  GLY C N   1 
ATOM   3189 C  CA  . GLY C 1 41  ? 20.225  38.242  -58.371  1.00 31.90  ? 863  GLY C CA  1 
ATOM   3190 C  C   . GLY C 1 41  ? 21.110  37.119  -57.863  1.00 31.22  ? 863  GLY C C   1 
ATOM   3191 O  O   . GLY C 1 41  ? 21.340  36.139  -58.565  1.00 30.26  ? 863  GLY C O   1 
ATOM   3192 N  N   . GLU C 1 42  ? 21.612  37.266  -56.641  1.00 39.01  ? 864  GLU C N   1 
ATOM   3193 C  CA  . GLU C 1 42  ? 22.480  36.257  -56.037  1.00 39.86  ? 864  GLU C CA  1 
ATOM   3194 C  C   . GLU C 1 42  ? 21.740  34.942  -55.802  1.00 38.80  ? 864  GLU C C   1 
ATOM   3195 O  O   . GLU C 1 42  ? 20.609  34.925  -55.321  1.00 39.27  ? 864  GLU C O   1 
ATOM   3196 C  CB  . GLU C 1 42  ? 23.041  36.771  -54.710  1.00 44.15  ? 864  GLU C CB  1 
ATOM   3197 C  CG  . GLU C 1 42  ? 24.076  37.870  -54.854  1.00 47.33  ? 864  GLU C CG  1 
ATOM   3198 C  CD  . GLU C 1 42  ? 24.529  38.409  -53.512  1.00 58.07  ? 864  GLU C CD  1 
ATOM   3199 O  OE1 . GLU C 1 42  ? 23.735  39.117  -52.854  1.00 61.73  ? 864  GLU C OE1 1 
ATOM   3200 O  OE2 . GLU C 1 42  ? 25.675  38.117  -53.109  1.00 61.14  ? 864  GLU C OE2 1 
ATOM   3201 N  N   . TRP C 1 43  ? 22.389  33.837  -56.144  1.00 32.10  ? 865  TRP C N   1 
ATOM   3202 C  CA  . TRP C 1 43  ? 21.782  32.527  -55.977  1.00 30.21  ? 865  TRP C CA  1 
ATOM   3203 C  C   . TRP C 1 43  ? 22.727  31.609  -55.216  1.00 30.11  ? 865  TRP C C   1 
ATOM   3204 O  O   . TRP C 1 43  ? 23.948  31.690  -55.366  1.00 29.79  ? 865  TRP C O   1 
ATOM   3205 C  CB  . TRP C 1 43  ? 21.460  31.922  -57.347  1.00 25.86  ? 865  TRP C CB  1 
ATOM   3206 C  CG  . TRP C 1 43  ? 20.808  30.576  -57.280  1.00 26.48  ? 865  TRP C CG  1 
ATOM   3207 C  CD1 . TRP C 1 43  ? 19.514  30.307  -56.948  1.00 23.12  ? 865  TRP C CD1 1 
ATOM   3208 C  CD2 . TRP C 1 43  ? 21.430  29.309  -57.542  1.00 24.24  ? 865  TRP C CD2 1 
ATOM   3209 N  NE1 . TRP C 1 43  ? 19.288  28.950  -56.989  1.00 24.76  ? 865  TRP C NE1 1 
ATOM   3210 C  CE2 . TRP C 1 43  ? 20.446  28.316  -57.351  1.00 27.06  ? 865  TRP C CE2 1 
ATOM   3211 C  CE3 . TRP C 1 43  ? 22.722  28.920  -57.920  1.00 23.24  ? 865  TRP C CE3 1 
ATOM   3212 C  CZ2 . TRP C 1 43  ? 20.712  26.952  -57.526  1.00 27.49  ? 865  TRP C CZ2 1 
ATOM   3213 C  CZ3 . TRP C 1 43  ? 22.989  27.569  -58.094  1.00 27.67  ? 865  TRP C CZ3 1 
ATOM   3214 C  CH2 . TRP C 1 43  ? 21.984  26.598  -57.896  1.00 28.27  ? 865  TRP C CH2 1 
ATOM   3215 N  N   . ILE C 1 44  ? 22.150  30.744  -54.389  1.00 28.03  ? 866  ILE C N   1 
ATOM   3216 C  CA  . ILE C 1 44  ? 22.925  29.794  -53.601  1.00 26.98  ? 866  ILE C CA  1 
ATOM   3217 C  C   . ILE C 1 44  ? 22.321  28.399  -53.810  1.00 27.38  ? 866  ILE C C   1 
ATOM   3218 O  O   . ILE C 1 44  ? 21.124  28.205  -53.610  1.00 28.23  ? 866  ILE C O   1 
ATOM   3219 C  CB  . ILE C 1 44  ? 22.886  30.172  -52.110  1.00 25.72  ? 866  ILE C CB  1 
ATOM   3220 C  CG1 . ILE C 1 44  ? 23.303  31.637  -51.947  1.00 24.98  ? 866  ILE C CG1 1 
ATOM   3221 C  CG2 . ILE C 1 44  ? 23.839  29.284  -51.318  1.00 21.73  ? 866  ILE C CG2 1 
ATOM   3222 C  CD1 . ILE C 1 44  ? 23.190  32.163  -50.514  1.00 31.20  ? 866  ILE C CD1 1 
ATOM   3223 N  N   . CYS C 1 45  ? 23.153  27.437  -54.215  1.00 23.50  ? 867  CYS C N   1 
ATOM   3224 C  CA  . CYS C 1 45  ? 22.684  26.080  -54.484  1.00 21.43  ? 867  CYS C CA  1 
ATOM   3225 C  C   . CYS C 1 45  ? 22.221  25.329  -53.244  1.00 18.32  ? 867  CYS C C   1 
ATOM   3226 O  O   . CYS C 1 45  ? 22.465  25.750  -52.114  1.00 17.75  ? 867  CYS C O   1 
ATOM   3227 C  CB  . CYS C 1 45  ? 23.769  25.264  -55.203  1.00 21.96  ? 867  CYS C CB  1 
ATOM   3228 S  SG  . CYS C 1 45  ? 25.031  24.538  -54.124  1.00 22.58  ? 867  CYS C SG  1 
ATOM   3229 N  N   . THR C 1 46  ? 21.554  24.205  -53.479  1.00 18.96  ? 868  THR C N   1 
ATOM   3230 C  CA  . THR C 1 46  ? 21.015  23.363  -52.423  1.00 19.11  ? 868  THR C CA  1 
ATOM   3231 C  C   . THR C 1 46  ? 22.076  22.821  -51.461  1.00 20.13  ? 868  THR C C   1 
ATOM   3232 O  O   . THR C 1 46  ? 21.782  22.550  -50.303  1.00 20.77  ? 868  THR C O   1 
ATOM   3233 C  CB  . THR C 1 46  ? 20.185  22.203  -53.046  1.00 19.93  ? 868  THR C CB  1 
ATOM   3234 O  OG1 . THR C 1 46  ? 18.847  22.660  -53.283  1.00 21.38  ? 868  THR C OG1 1 
ATOM   3235 C  CG2 . THR C 1 46  ? 20.159  20.971  -52.140  1.00 18.18  ? 868  THR C CG2 1 
ATOM   3236 N  N   . PHE C 1 47  ? 23.305  22.669  -51.937  1.00 20.45  ? 869  PHE C N   1 
ATOM   3237 C  CA  . PHE C 1 47  ? 24.373  22.175  -51.080  1.00 22.13  ? 869  PHE C CA  1 
ATOM   3238 C  C   . PHE C 1 47  ? 24.765  23.233  -50.046  1.00 22.09  ? 869  PHE C C   1 
ATOM   3239 O  O   . PHE C 1 47  ? 24.967  22.922  -48.877  1.00 22.77  ? 869  PHE C O   1 
ATOM   3240 C  CB  . PHE C 1 47  ? 25.620  21.832  -51.904  1.00 20.62  ? 869  PHE C CB  1 
ATOM   3241 C  CG  . PHE C 1 47  ? 25.459  20.645  -52.807  1.00 21.08  ? 869  PHE C CG  1 
ATOM   3242 C  CD1 . PHE C 1 47  ? 25.002  19.431  -52.310  1.00 20.99  ? 869  PHE C CD1 1 
ATOM   3243 C  CD2 . PHE C 1 47  ? 25.832  20.723  -54.144  1.00 21.13  ? 869  PHE C CD2 1 
ATOM   3244 C  CE1 . PHE C 1 47  ? 24.925  18.308  -53.136  1.00 22.47  ? 869  PHE C CE1 1 
ATOM   3245 C  CE2 . PHE C 1 47  ? 25.758  19.603  -54.974  1.00 25.41  ? 869  PHE C CE2 1 
ATOM   3246 C  CZ  . PHE C 1 47  ? 25.306  18.398  -54.466  1.00 24.16  ? 869  PHE C CZ  1 
ATOM   3247 N  N   . CYS C 1 48  ? 24.858  24.481  -50.501  1.00 18.49  ? 870  CYS C N   1 
ATOM   3248 C  CA  . CYS C 1 48  ? 25.282  25.611  -49.673  1.00 22.45  ? 870  CYS C CA  1 
ATOM   3249 C  C   . CYS C 1 48  ? 24.229  26.339  -48.851  1.00 22.15  ? 870  CYS C C   1 
ATOM   3250 O  O   . CYS C 1 48  ? 24.545  26.884  -47.792  1.00 23.14  ? 870  CYS C O   1 
ATOM   3251 C  CB  . CYS C 1 48  ? 25.982  26.650  -50.554  1.00 17.73  ? 870  CYS C CB  1 
ATOM   3252 S  SG  . CYS C 1 48  ? 27.325  25.983  -51.548  1.00 27.92  ? 870  CYS C SG  1 
ATOM   3253 N  N   . ARG C 1 49  ? 22.994  26.370  -49.345  1.00 27.94  ? 871  ARG C N   1 
ATOM   3254 C  CA  . ARG C 1 49  ? 21.919  27.074  -48.658  1.00 29.06  ? 871  ARG C CA  1 
ATOM   3255 C  C   . ARG C 1 49  ? 21.671  26.501  -47.269  1.00 28.91  ? 871  ARG C C   1 
ATOM   3256 O  O   . ARG C 1 49  ? 21.705  25.289  -47.065  1.00 29.06  ? 871  ARG C O   1 
ATOM   3257 C  CB  . ARG C 1 49  ? 20.634  27.018  -49.497  1.00 22.31  ? 871  ARG C CB  1 
ATOM   3258 C  CG  . ARG C 1 49  ? 19.625  28.092  -49.141  1.00 27.03  ? 871  ARG C CG  1 
ATOM   3259 C  CD  . ARG C 1 49  ? 18.440  28.085  -50.089  1.00 24.93  ? 871  ARG C CD  1 
ATOM   3260 N  NE  . ARG C 1 49  ? 17.724  26.815  -50.044  1.00 29.15  ? 871  ARG C NE  1 
ATOM   3261 C  CZ  . ARG C 1 49  ? 16.457  26.671  -50.412  1.00 29.01  ? 871  ARG C CZ  1 
ATOM   3262 N  NH1 . ARG C 1 49  ? 15.777  27.723  -50.848  1.00 25.38  ? 871  ARG C NH1 1 
ATOM   3263 N  NH2 . ARG C 1 49  ? 15.871  25.484  -50.343  1.00 24.85  ? 871  ARG C NH2 1 
ATOM   3264 N  N   . ASP C 1 50  ? 21.425  27.386  -46.312  1.00 25.23  ? 872  ASP C N   1 
ATOM   3265 C  CA  . ASP C 1 50  ? 21.176  26.977  -44.939  1.00 25.42  ? 872  ASP C CA  1 
ATOM   3266 C  C   . ASP C 1 50  ? 19.882  26.167  -44.874  1.00 25.63  ? 872  ASP C C   1 
ATOM   3267 O  O   . ASP C 1 50  ? 18.878  26.544  -45.477  1.00 25.13  ? 872  ASP C O   1 
ATOM   3268 C  CB  . ASP C 1 50  ? 21.066  28.214  -44.044  1.00 34.21  ? 872  ASP C CB  1 
ATOM   3269 C  CG  . ASP C 1 50  ? 21.172  27.881  -42.575  1.00 36.73  ? 872  ASP C CG  1 
ATOM   3270 O  OD1 . ASP C 1 50  ? 22.284  27.542  -42.126  1.00 40.42  ? 872  ASP C OD1 1 
ATOM   3271 O  OD2 . ASP C 1 50  ? 20.143  27.951  -41.873  1.00 40.49  ? 872  ASP C OD2 1 
ATOM   3272 N  N   . LEU C 1 51  ? 19.908  25.054  -44.145  1.00 23.02  ? 873  LEU C N   1 
ATOM   3273 C  CA  . LEU C 1 51  ? 18.732  24.203  -44.020  1.00 23.77  ? 873  LEU C CA  1 
ATOM   3274 C  C   . LEU C 1 51  ? 17.625  24.829  -43.185  1.00 25.51  ? 873  LEU C C   1 
ATOM   3275 O  O   . LEU C 1 51  ? 16.447  24.715  -43.527  1.00 23.88  ? 873  LEU C O   1 
ATOM   3276 C  CB  . LEU C 1 51  ? 19.114  22.860  -43.399  1.00 23.10  ? 873  LEU C CB  1 
ATOM   3277 C  CG  . LEU C 1 51  ? 19.869  21.867  -44.277  1.00 22.78  ? 873  LEU C CG  1 
ATOM   3278 C  CD1 . LEU C 1 51  ? 20.349  20.698  -43.417  1.00 21.40  ? 873  LEU C CD1 1 
ATOM   3279 C  CD2 . LEU C 1 51  ? 18.955  21.381  -45.402  1.00 24.31  ? 873  LEU C CD2 1 
ATOM   3280 N  N   . SER C 1 52  ? 18.009  25.482  -42.088  1.00 28.65  ? 874  SER C N   1 
ATOM   3281 C  CA  . SER C 1 52  ? 17.051  26.102  -41.171  1.00 33.28  ? 874  SER C CA  1 
ATOM   3282 C  C   . SER C 1 52  ? 16.459  27.416  -41.672  1.00 33.12  ? 874  SER C C   1 
ATOM   3283 O  O   . SER C 1 52  ? 15.246  27.618  -41.633  1.00 33.67  ? 874  SER C O   1 
ATOM   3284 C  CB  . SER C 1 52  ? 17.716  26.349  -39.815  1.00 42.02  ? 874  SER C CB  1 
ATOM   3285 O  OG  . SER C 1 52  ? 18.204  25.142  -39.260  1.00 50.30  ? 874  SER C OG  1 
ATOM   3286 N  N   . LYS C 1 53  ? 17.328  28.315  -42.114  1.00 29.39  ? 875  LYS C N   1 
ATOM   3287 C  CA  . LYS C 1 53  ? 16.901  29.616  -42.612  1.00 31.08  ? 875  LYS C CA  1 
ATOM   3288 C  C   . LYS C 1 53  ? 17.527  29.852  -43.973  1.00 29.37  ? 875  LYS C C   1 
ATOM   3289 O  O   . LYS C 1 53  ? 18.565  30.505  -44.085  1.00 29.34  ? 875  LYS C O   1 
ATOM   3290 C  CB  . LYS C 1 53  ? 17.336  30.722  -41.647  1.00 51.01  ? 875  LYS C CB  1 
ATOM   3291 C  CG  . LYS C 1 53  ? 16.752  30.576  -40.261  1.00 56.57  ? 875  LYS C CG  1 
ATOM   3292 C  CD  . LYS C 1 53  ? 15.953  31.804  -39.867  1.00 65.10  ? 875  LYS C CD  1 
ATOM   3293 C  CE  . LYS C 1 53  ? 14.794  31.416  -38.966  1.00 67.55  ? 875  LYS C CE  1 
ATOM   3294 N  NZ  . LYS C 1 53  ? 14.706  32.281  -37.762  1.00 70.18  ? 875  LYS C NZ  1 
ATOM   3295 N  N   . PRO C 1 54  ? 16.915  29.303  -45.030  1.00 29.28  ? 876  PRO C N   1 
ATOM   3296 C  CA  . PRO C 1 54  ? 17.465  29.493  -46.374  1.00 29.42  ? 876  PRO C CA  1 
ATOM   3297 C  C   . PRO C 1 54  ? 17.643  30.975  -46.701  1.00 29.93  ? 876  PRO C C   1 
ATOM   3298 O  O   . PRO C 1 54  ? 16.712  31.764  -46.541  1.00 29.31  ? 876  PRO C O   1 
ATOM   3299 C  CB  . PRO C 1 54  ? 16.447  28.784  -47.274  1.00 34.40  ? 876  PRO C CB  1 
ATOM   3300 C  CG  . PRO C 1 54  ? 15.191  28.719  -46.433  1.00 36.65  ? 876  PRO C CG  1 
ATOM   3301 C  CD  . PRO C 1 54  ? 15.723  28.440  -45.063  1.00 34.21  ? 876  PRO C CD  1 
ATOM   3302 N  N   . GLU C 1 55  ? 18.847  31.337  -47.144  1.00 35.67  ? 877  GLU C N   1 
ATOM   3303 C  CA  . GLU C 1 55  ? 19.185  32.722  -47.478  1.00 36.24  ? 877  GLU C CA  1 
ATOM   3304 C  C   . GLU C 1 55  ? 18.378  33.252  -48.654  1.00 36.67  ? 877  GLU C C   1 
ATOM   3305 O  O   . GLU C 1 55  ? 18.129  34.452  -48.757  1.00 37.11  ? 877  GLU C O   1 
ATOM   3306 C  CB  . GLU C 1 55  ? 20.683  32.854  -47.790  1.00 37.29  ? 877  GLU C CB  1 
ATOM   3307 C  CG  . GLU C 1 55  ? 21.606  32.547  -46.607  1.00 39.45  ? 877  GLU C CG  1 
ATOM   3308 C  CD  . GLU C 1 55  ? 21.912  31.064  -46.456  1.00 43.34  ? 877  GLU C CD  1 
ATOM   3309 O  OE1 . GLU C 1 55  ? 21.076  30.233  -46.864  1.00 39.89  ? 877  GLU C OE1 1 
ATOM   3310 O  OE2 . GLU C 1 55  ? 22.990  30.730  -45.916  1.00 41.88  ? 877  GLU C OE2 1 
ATOM   3311 N  N   . VAL C 1 56  ? 17.973  32.349  -49.538  1.00 36.65  ? 878  VAL C N   1 
ATOM   3312 C  CA  . VAL C 1 56  ? 17.190  32.719  -50.709  1.00 36.14  ? 878  VAL C CA  1 
ATOM   3313 C  C   . VAL C 1 56  ? 16.056  31.718  -50.907  1.00 36.72  ? 878  VAL C C   1 
ATOM   3314 O  O   . VAL C 1 56  ? 16.114  30.593  -50.416  1.00 34.95  ? 878  VAL C O   1 
ATOM   3315 C  CB  . VAL C 1 56  ? 18.061  32.717  -51.989  1.00 33.12  ? 878  VAL C CB  1 
ATOM   3316 C  CG1 . VAL C 1 56  ? 19.202  33.716  -51.857  1.00 34.15  ? 878  VAL C CG1 1 
ATOM   3317 C  CG2 . VAL C 1 56  ? 18.618  31.315  -52.229  1.00 35.11  ? 878  VAL C CG2 1 
ATOM   3318 N  N   . GLU C 1 57  ? 15.016  32.141  -51.614  1.00 35.09  ? 879  GLU C N   1 
ATOM   3319 C  CA  . GLU C 1 57  ? 13.895  31.261  -51.910  1.00 36.32  ? 879  GLU C CA  1 
ATOM   3320 C  C   . GLU C 1 57  ? 14.008  30.945  -53.396  1.00 34.38  ? 879  GLU C C   1 
ATOM   3321 O  O   . GLU C 1 57  ? 14.324  31.830  -54.191  1.00 33.92  ? 879  GLU C O   1 
ATOM   3322 C  CB  . GLU C 1 57  ? 12.561  31.960  -51.633  1.00 52.44  ? 879  GLU C CB  1 
ATOM   3323 C  CG  . GLU C 1 57  ? 11.345  31.148  -52.073  1.00 58.87  ? 879  GLU C CG  1 
ATOM   3324 C  CD  . GLU C 1 57  ? 10.040  31.920  -51.962  1.00 64.63  ? 879  GLU C CD  1 
ATOM   3325 O  OE1 . GLU C 1 57  ? 9.924   32.997  -52.585  1.00 65.59  ? 879  GLU C OE1 1 
ATOM   3326 O  OE2 . GLU C 1 57  ? 9.127   31.445  -51.256  1.00 65.38  ? 879  GLU C OE2 1 
ATOM   3327 N  N   . TYR C 1 58  ? 13.782  29.691  -53.775  1.00 26.82  ? 880  TYR C N   1 
ATOM   3328 C  CA  . TYR C 1 58  ? 13.849  29.310  -55.185  1.00 27.50  ? 880  TYR C CA  1 
ATOM   3329 C  C   . TYR C 1 58  ? 12.474  29.594  -55.782  1.00 28.06  ? 880  TYR C C   1 
ATOM   3330 O  O   . TYR C 1 58  ? 11.459  29.369  -55.126  1.00 28.95  ? 880  TYR C O   1 
ATOM   3331 C  CB  . TYR C 1 58  ? 14.207  27.825  -55.329  1.00 30.49  ? 880  TYR C CB  1 
ATOM   3332 C  CG  . TYR C 1 58  ? 15.544  27.444  -54.709  1.00 27.31  ? 880  TYR C CG  1 
ATOM   3333 C  CD1 . TYR C 1 58  ? 16.635  28.312  -54.760  1.00 24.31  ? 880  TYR C CD1 1 
ATOM   3334 C  CD2 . TYR C 1 58  ? 15.724  26.202  -54.097  1.00 23.44  ? 880  TYR C CD2 1 
ATOM   3335 C  CE1 . TYR C 1 58  ? 17.872  27.951  -54.215  1.00 23.51  ? 880  TYR C CE1 1 
ATOM   3336 C  CE2 . TYR C 1 58  ? 16.958  25.833  -53.549  1.00 21.42  ? 880  TYR C CE2 1 
ATOM   3337 C  CZ  . TYR C 1 58  ? 18.021  26.707  -53.611  1.00 23.31  ? 880  TYR C CZ  1 
ATOM   3338 O  OH  . TYR C 1 58  ? 19.231  26.340  -53.073  1.00 23.54  ? 880  TYR C OH  1 
ATOM   3339 N  N   . ASP C 1 59  ? 12.426  30.094  -57.011  1.00 40.47  ? 881  ASP C N   1 
ATOM   3340 C  CA  . ASP C 1 59  ? 11.138  30.418  -57.617  1.00 41.34  ? 881  ASP C CA  1 
ATOM   3341 C  C   . ASP C 1 59  ? 10.131  29.265  -57.586  1.00 41.81  ? 881  ASP C C   1 
ATOM   3342 O  O   . ASP C 1 59  ? 8.924   29.492  -57.476  1.00 41.71  ? 881  ASP C O   1 
ATOM   3343 C  CB  . ASP C 1 59  ? 11.327  30.925  -59.057  1.00 38.31  ? 881  ASP C CB  1 
ATOM   3344 C  CG  . ASP C 1 59  ? 12.063  29.934  -59.950  1.00 41.28  ? 881  ASP C CG  1 
ATOM   3345 O  OD1 . ASP C 1 59  ? 12.310  28.788  -59.518  1.00 40.89  ? 881  ASP C OD1 1 
ATOM   3346 O  OD2 . ASP C 1 59  ? 12.388  30.306  -61.100  1.00 38.13  ? 881  ASP C OD2 1 
ATOM   3347 N  N   . CYS C 1 60  ? 10.623  28.032  -57.663  1.00 30.91  ? 882  CYS C N   1 
ATOM   3348 C  CA  . CYS C 1 60  ? 9.747   26.864  -57.649  1.00 30.85  ? 882  CYS C CA  1 
ATOM   3349 C  C   . CYS C 1 60  ? 9.034   26.649  -56.319  1.00 30.19  ? 882  CYS C C   1 
ATOM   3350 O  O   . CYS C 1 60  ? 7.996   25.993  -56.270  1.00 30.19  ? 882  CYS C O   1 
ATOM   3351 C  CB  . CYS C 1 60  ? 10.542  25.601  -58.003  1.00 37.72  ? 882  CYS C CB  1 
ATOM   3352 S  SG  . CYS C 1 60  ? 11.942  25.265  -56.908  1.00 42.61  ? 882  CYS C SG  1 
ATOM   3353 N  N   . ASP C 1 61  ? 9.584   27.201  -55.242  1.00 33.94  ? 883  ASP C N   1 
ATOM   3354 C  CA  . ASP C 1 61  ? 8.987   27.031  -53.922  1.00 34.32  ? 883  ASP C CA  1 
ATOM   3355 C  C   . ASP C 1 61  ? 8.113   28.192  -53.468  1.00 34.57  ? 883  ASP C C   1 
ATOM   3356 O  O   . ASP C 1 61  ? 7.451   28.103  -52.434  1.00 34.39  ? 883  ASP C O   1 
ATOM   3357 C  CB  . ASP C 1 61  ? 10.083  26.788  -52.880  1.00 43.82  ? 883  ASP C CB  1 
ATOM   3358 C  CG  . ASP C 1 61  ? 10.862  25.511  -53.142  1.00 43.93  ? 883  ASP C CG  1 
ATOM   3359 O  OD1 . ASP C 1 61  ? 10.223  24.443  -53.274  1.00 43.41  ? 883  ASP C OD1 1 
ATOM   3360 O  OD2 . ASP C 1 61  ? 12.109  25.573  -53.213  1.00 45.08  ? 883  ASP C OD2 1 
ATOM   3361 N  N   . ALA C 1 62  ? 8.112   29.278  -54.235  1.00 50.69  ? 884  ALA C N   1 
ATOM   3362 C  CA  . ALA C 1 62  ? 7.312   30.448  -53.886  1.00 50.69  ? 884  ALA C CA  1 
ATOM   3363 C  C   . ALA C 1 62  ? 5.855   30.056  -53.655  1.00 50.69  ? 884  ALA C C   1 
ATOM   3364 O  O   . ALA C 1 62  ? 5.316   29.198  -54.353  1.00 50.69  ? 884  ALA C O   1 
ATOM   3365 C  CB  . ALA C 1 62  ? 7.406   31.488  -54.988  1.00 58.95  ? 884  ALA C CB  1 
ATOM   3366 N  N   . PRO C 1 63  ? 5.197   30.685  -52.668  1.00 56.05  ? 885  PRO C N   1 
ATOM   3367 C  CA  . PRO C 1 63  ? 3.794   30.390  -52.354  1.00 56.05  ? 885  PRO C CA  1 
ATOM   3368 C  C   . PRO C 1 63  ? 2.847   30.664  -53.521  1.00 56.05  ? 885  PRO C C   1 
ATOM   3369 O  O   . PRO C 1 63  ? 2.083   29.790  -53.929  1.00 56.05  ? 885  PRO C O   1 
ATOM   3370 C  CB  . PRO C 1 63  ? 3.515   31.293  -51.157  1.00 80.34  ? 885  PRO C CB  1 
ATOM   3371 C  CG  . PRO C 1 63  ? 4.407   32.474  -51.424  1.00 80.34  ? 885  PRO C CG  1 
ATOM   3372 C  CD  . PRO C 1 63  ? 5.690   31.806  -51.849  1.00 80.34  ? 885  PRO C CD  1 
ATOM   3373 N  N   . LYS C 1 69  ? -2.510  30.612  -47.829  1.00 73.59  ? 891  LYS C N   1 
ATOM   3374 C  CA  . LYS C 1 69  ? -2.400  31.065  -46.449  1.00 73.59  ? 891  LYS C CA  1 
ATOM   3375 C  C   . LYS C 1 69  ? -3.414  30.330  -45.584  1.00 73.59  ? 891  LYS C C   1 
ATOM   3376 O  O   . LYS C 1 69  ? -3.493  30.550  -44.374  1.00 73.59  ? 891  LYS C O   1 
ATOM   3377 C  CB  . LYS C 1 69  ? -2.618  32.578  -46.371  1.00 73.03  ? 891  LYS C CB  1 
ATOM   3378 C  CG  . LYS C 1 69  ? -2.113  33.207  -45.082  1.00 73.03  ? 891  LYS C CG  1 
ATOM   3379 C  CD  . LYS C 1 69  ? -1.791  34.692  -45.256  1.00 73.03  ? 891  LYS C CD  1 
ATOM   3380 C  CE  . LYS C 1 69  ? -0.573  34.918  -46.169  1.00 73.03  ? 891  LYS C CE  1 
ATOM   3381 N  NZ  . LYS C 1 69  ? -0.819  34.529  -47.592  1.00 73.03  ? 891  LYS C NZ  1 
ATOM   3382 N  N   . LYS C 1 70  ? -4.199  29.465  -46.217  1.00 42.21  ? 892  LYS C N   1 
ATOM   3383 C  CA  . LYS C 1 70  ? -5.171  28.671  -45.488  1.00 42.21  ? 892  LYS C CA  1 
ATOM   3384 C  C   . LYS C 1 70  ? -4.444  27.401  -45.087  1.00 42.21  ? 892  LYS C C   1 
ATOM   3385 O  O   . LYS C 1 70  ? -3.842  26.730  -45.925  1.00 42.21  ? 892  LYS C O   1 
ATOM   3386 C  CB  . LYS C 1 70  ? -6.368  28.303  -46.359  1.00 54.84  ? 892  LYS C CB  1 
ATOM   3387 C  CG  . LYS C 1 70  ? -7.310  27.333  -45.664  1.00 54.84  ? 892  LYS C CG  1 
ATOM   3388 C  CD  . LYS C 1 70  ? -8.329  26.758  -46.619  1.00 54.84  ? 892  LYS C CD  1 
ATOM   3389 C  CE  . LYS C 1 70  ? -9.231  25.771  -45.905  1.00 54.84  ? 892  LYS C CE  1 
ATOM   3390 N  NZ  . LYS C 1 70  ? -9.930  26.412  -44.757  1.00 54.84  ? 892  LYS C NZ  1 
ATOM   3391 N  N   . LYS C 1 71  ? -4.485  27.080  -43.802  1.00 30.22  ? 893  LYS C N   1 
ATOM   3392 C  CA  . LYS C 1 71  ? -3.819  25.879  -43.326  1.00 30.30  ? 893  LYS C CA  1 
ATOM   3393 C  C   . LYS C 1 71  ? -4.550  24.658  -43.862  1.00 29.21  ? 893  LYS C C   1 
ATOM   3394 O  O   . LYS C 1 71  ? -5.743  24.484  -43.631  1.00 28.78  ? 893  LYS C O   1 
ATOM   3395 C  CB  . LYS C 1 71  ? -3.754  25.904  -41.796  1.00 27.16  ? 893  LYS C CB  1 
ATOM   3396 C  CG  . LYS C 1 71  ? -2.679  26.874  -41.325  1.00 29.76  ? 893  LYS C CG  1 
ATOM   3397 C  CD  . LYS C 1 71  ? -2.700  27.168  -39.847  1.00 33.20  ? 893  LYS C CD  1 
ATOM   3398 C  CE  . LYS C 1 71  ? -1.587  28.154  -39.508  1.00 33.06  ? 893  LYS C CE  1 
ATOM   3399 N  NZ  . LYS C 1 71  ? -1.658  29.371  -40.368  1.00 34.13  ? 893  LYS C NZ  1 
ATOM   3400 N  N   . THR C 1 72  ? -3.828  23.842  -44.624  1.00 26.45  ? 894  THR C N   1 
ATOM   3401 C  CA  . THR C 1 72  ? -4.399  22.637  -45.219  1.00 26.60  ? 894  THR C CA  1 
ATOM   3402 C  C   . THR C 1 72  ? -4.754  21.641  -44.125  1.00 24.27  ? 894  THR C C   1 
ATOM   3403 O  O   . THR C 1 72  ? -3.896  21.238  -43.346  1.00 25.13  ? 894  THR C O   1 
ATOM   3404 C  CB  . THR C 1 72  ? -3.409  21.993  -46.207  1.00 36.43  ? 894  THR C CB  1 
ATOM   3405 O  OG1 . THR C 1 72  ? -3.000  22.975  -47.168  1.00 40.76  ? 894  THR C OG1 1 
ATOM   3406 C  CG2 . THR C 1 72  ? -4.065  20.831  -46.942  1.00 38.93  ? 894  THR C CG2 1 
ATOM   3407 N  N   . GLU C 1 73  ? -6.026  21.253  -44.080  1.00 22.13  ? 895  GLU C N   1 
ATOM   3408 C  CA  . GLU C 1 73  ? -6.524  20.324  -43.068  1.00 24.14  ? 895  GLU C CA  1 
ATOM   3409 C  C   . GLU C 1 73  ? -6.370  18.849  -43.438  1.00 23.57  ? 895  GLU C C   1 
ATOM   3410 O  O   . GLU C 1 73  ? -6.288  18.488  -44.613  1.00 24.19  ? 895  GLU C O   1 
ATOM   3411 C  CB  . GLU C 1 73  ? -8.000  20.623  -42.782  1.00 31.21  ? 895  GLU C CB  1 
ATOM   3412 C  CG  . GLU C 1 73  ? -8.323  22.105  -42.689  1.00 34.61  ? 895  GLU C CG  1 
ATOM   3413 C  CD  . GLU C 1 73  ? -9.818  22.376  -42.667  1.00 43.25  ? 895  GLU C CD  1 
ATOM   3414 O  OE1 . GLU C 1 73  ? -10.557 21.717  -43.429  1.00 47.13  ? 895  GLU C OE1 1 
ATOM   3415 O  OE2 . GLU C 1 73  ? -10.255 23.257  -41.902  1.00 47.81  ? 895  GLU C OE2 1 
ATOM   3416 N  N   . GLY C 1 74  ? -6.329  18.010  -42.410  1.00 25.57  ? 896  GLY C N   1 
ATOM   3417 C  CA  . GLY C 1 74  ? -6.203  16.576  -42.589  1.00 26.58  ? 896  GLY C CA  1 
ATOM   3418 C  C   . GLY C 1 74  ? -5.096  16.129  -43.516  1.00 27.41  ? 896  GLY C C   1 
ATOM   3419 O  O   . GLY C 1 74  ? -5.266  15.159  -44.249  1.00 28.94  ? 896  GLY C O   1 
ATOM   3420 N  N   . LEU C 1 75  ? -3.957  16.815  -43.480  1.00 23.22  ? 897  LEU C N   1 
ATOM   3421 C  CA  . LEU C 1 75  ? -2.839  16.460  -44.353  1.00 23.60  ? 897  LEU C CA  1 
ATOM   3422 C  C   . LEU C 1 75  ? -1.492  16.684  -43.685  1.00 22.12  ? 897  LEU C C   1 
ATOM   3423 O  O   . LEU C 1 75  ? -1.182  17.795  -43.240  1.00 23.06  ? 897  LEU C O   1 
ATOM   3424 C  CB  . LEU C 1 75  ? -2.902  17.282  -45.641  1.00 27.55  ? 897  LEU C CB  1 
ATOM   3425 C  CG  . LEU C 1 75  ? -1.755  17.123  -46.644  1.00 32.07  ? 897  LEU C CG  1 
ATOM   3426 C  CD1 . LEU C 1 75  ? -1.700  15.692  -47.139  1.00 36.36  ? 897  LEU C CD1 1 
ATOM   3427 C  CD2 . LEU C 1 75  ? -1.957  18.077  -47.810  1.00 37.99  ? 897  LEU C CD2 1 
ATOM   3428 N  N   . VAL C 1 76  ? -0.693  15.624  -43.615  1.00 19.50  ? 898  VAL C N   1 
ATOM   3429 C  CA  . VAL C 1 76  ? 0.635   15.718  -43.023  1.00 19.26  ? 898  VAL C CA  1 
ATOM   3430 C  C   . VAL C 1 76  ? 1.658   15.873  -44.143  1.00 18.96  ? 898  VAL C C   1 
ATOM   3431 O  O   . VAL C 1 76  ? 1.745   15.036  -45.040  1.00 20.21  ? 898  VAL C O   1 
ATOM   3432 C  CB  . VAL C 1 76  ? 0.977   14.466  -42.196  1.00 25.94  ? 898  VAL C CB  1 
ATOM   3433 C  CG1 . VAL C 1 76  ? 2.376   14.598  -41.598  1.00 21.24  ? 898  VAL C CG1 1 
ATOM   3434 C  CG2 . VAL C 1 76  ? -0.050  14.286  -41.085  1.00 25.28  ? 898  VAL C CG2 1 
ATOM   3435 N  N   . LYS C 1 77  ? 2.412   16.961  -44.103  1.00 20.51  ? 899  LYS C N   1 
ATOM   3436 C  CA  . LYS C 1 77  ? 3.434   17.205  -45.108  1.00 23.01  ? 899  LYS C CA  1 
ATOM   3437 C  C   . LYS C 1 77  ? 4.791   17.230  -44.414  1.00 22.27  ? 899  LYS C C   1 
ATOM   3438 O  O   . LYS C 1 77  ? 4.865   17.370  -43.194  1.00 21.00  ? 899  LYS C O   1 
ATOM   3439 C  CB  . LYS C 1 77  ? 3.208   18.560  -45.779  1.00 30.57  ? 899  LYS C CB  1 
ATOM   3440 C  CG  . LYS C 1 77  ? 1.809   18.779  -46.304  1.00 38.05  ? 899  LYS C CG  1 
ATOM   3441 C  CD  . LYS C 1 77  ? 1.689   20.153  -46.948  1.00 46.20  ? 899  LYS C CD  1 
ATOM   3442 C  CE  . LYS C 1 77  ? 2.661   20.303  -48.112  1.00 52.01  ? 899  LYS C CE  1 
ATOM   3443 N  NZ  . LYS C 1 77  ? 2.533   21.626  -48.786  1.00 53.57  ? 899  LYS C NZ  1 
ATOM   3444 N  N   . LEU C 1 78  ? 5.858   17.089  -45.195  1.00 20.81  ? 900  LEU C N   1 
ATOM   3445 C  CA  . LEU C 1 78  ? 7.206   17.156  -44.644  1.00 20.39  ? 900  LEU C CA  1 
ATOM   3446 C  C   . LEU C 1 78  ? 7.405   18.572  -44.137  1.00 19.14  ? 900  LEU C C   1 
ATOM   3447 O  O   . LEU C 1 78  ? 6.854   19.524  -44.692  1.00 18.11  ? 900  LEU C O   1 
ATOM   3448 C  CB  . LEU C 1 78  ? 8.256   16.918  -45.728  1.00 17.82  ? 900  LEU C CB  1 
ATOM   3449 C  CG  . LEU C 1 78  ? 8.375   15.571  -46.431  1.00 18.94  ? 900  LEU C CG  1 
ATOM   3450 C  CD1 . LEU C 1 78  ? 9.385   15.692  -47.567  1.00 20.08  ? 900  LEU C CD1 1 
ATOM   3451 C  CD2 . LEU C 1 78  ? 8.814   14.516  -45.428  1.00 18.97  ? 900  LEU C CD2 1 
ATOM   3452 N  N   . THR C 1 79  ? 8.195   18.719  -43.086  1.00 15.60  ? 901  THR C N   1 
ATOM   3453 C  CA  . THR C 1 79  ? 8.487   20.046  -42.585  1.00 16.33  ? 901  THR C CA  1 
ATOM   3454 C  C   . THR C 1 79  ? 9.375   20.618  -43.693  1.00 14.74  ? 901  THR C C   1 
ATOM   3455 O  O   . THR C 1 79  ? 9.922   19.869  -44.502  1.00 14.88  ? 901  THR C O   1 
ATOM   3456 C  CB  . THR C 1 79  ? 9.295   19.985  -41.279  1.00 16.23  ? 901  THR C CB  1 
ATOM   3457 O  OG1 . THR C 1 79  ? 10.530  19.298  -41.524  1.00 18.33  ? 901  THR C OG1 1 
ATOM   3458 C  CG2 . THR C 1 79  ? 8.514   19.235  -40.196  1.00 19.57  ? 901  THR C CG2 1 
ATOM   3459 N  N   . PRO C 1 80  ? 9.517   21.946  -43.761  1.00 18.43  ? 902  PRO C N   1 
ATOM   3460 C  CA  . PRO C 1 80  ? 10.369  22.502  -44.819  1.00 17.72  ? 902  PRO C CA  1 
ATOM   3461 C  C   . PRO C 1 80  ? 11.830  22.051  -44.669  1.00 18.19  ? 902  PRO C C   1 
ATOM   3462 O  O   . PRO C 1 80  ? 12.536  21.833  -45.656  1.00 17.77  ? 902  PRO C O   1 
ATOM   3463 C  CB  . PRO C 1 80  ? 10.197  24.004  -44.638  1.00 23.67  ? 902  PRO C CB  1 
ATOM   3464 C  CG  . PRO C 1 80  ? 8.787   24.119  -44.100  1.00 22.71  ? 902  PRO C CG  1 
ATOM   3465 C  CD  . PRO C 1 80  ? 8.768   23.008  -43.069  1.00 22.93  ? 902  PRO C CD  1 
ATOM   3466 N  N   . ILE C 1 81  ? 12.290  21.916  -43.431  1.00 16.26  ? 903  ILE C N   1 
ATOM   3467 C  CA  . ILE C 1 81  ? 13.656  21.478  -43.208  1.00 16.93  ? 903  ILE C CA  1 
ATOM   3468 C  C   . ILE C 1 81  ? 13.872  20.093  -43.823  1.00 16.95  ? 903  ILE C C   1 
ATOM   3469 O  O   . ILE C 1 81  ? 14.873  19.862  -44.504  1.00 17.29  ? 903  ILE C O   1 
ATOM   3470 C  CB  . ILE C 1 81  ? 13.990  21.459  -41.699  1.00 17.99  ? 903  ILE C CB  1 
ATOM   3471 C  CG1 . ILE C 1 81  ? 14.292  22.887  -41.238  1.00 17.74  ? 903  ILE C CG1 1 
ATOM   3472 C  CG2 . ILE C 1 81  ? 15.173  20.542  -41.422  1.00 19.48  ? 903  ILE C CG2 1 
ATOM   3473 C  CD1 . ILE C 1 81  ? 14.346  23.052  -39.726  1.00 20.15  ? 903  ILE C CD1 1 
ATOM   3474 N  N   . ASP C 1 82  ? 12.922  19.186  -43.610  1.00 18.80  ? 904  ASP C N   1 
ATOM   3475 C  CA  . ASP C 1 82  ? 13.042  17.835  -44.149  1.00 18.51  ? 904  ASP C CA  1 
ATOM   3476 C  C   . ASP C 1 82  ? 12.919  17.787  -45.663  1.00 19.55  ? 904  ASP C C   1 
ATOM   3477 O  O   . ASP C 1 82  ? 13.545  16.955  -46.322  1.00 17.11  ? 904  ASP C O   1 
ATOM   3478 C  CB  . ASP C 1 82  ? 12.022  16.920  -43.477  1.00 19.78  ? 904  ASP C CB  1 
ATOM   3479 C  CG  . ASP C 1 82  ? 12.334  16.725  -42.011  1.00 22.25  ? 904  ASP C CG  1 
ATOM   3480 O  OD1 . ASP C 1 82  ? 13.493  16.364  -41.713  1.00 21.56  ? 904  ASP C OD1 1 
ATOM   3481 O  OD2 . ASP C 1 82  ? 11.442  16.944  -41.166  1.00 17.94  ? 904  ASP C OD2 1 
ATOM   3482 N  N   . LYS C 1 83  ? 12.117  18.677  -46.229  1.00 15.87  ? 905  LYS C N   1 
ATOM   3483 C  CA  . LYS C 1 83  ? 12.007  18.715  -47.679  1.00 17.02  ? 905  LYS C CA  1 
ATOM   3484 C  C   . LYS C 1 83  ? 13.377  19.138  -48.217  1.00 15.72  ? 905  LYS C C   1 
ATOM   3485 O  O   . LYS C 1 83  ? 13.849  18.623  -49.226  1.00 15.99  ? 905  LYS C O   1 
ATOM   3486 C  CB  . LYS C 1 83  ? 10.945  19.725  -48.117  1.00 18.81  ? 905  LYS C CB  1 
ATOM   3487 C  CG  . LYS C 1 83  ? 10.888  19.937  -49.633  1.00 18.48  ? 905  LYS C CG  1 
ATOM   3488 C  CD  . LYS C 1 83  ? 9.655   20.749  -50.030  1.00 24.82  ? 905  LYS C CD  1 
ATOM   3489 C  CE  . LYS C 1 83  ? 9.677   21.125  -51.506  1.00 24.40  ? 905  LYS C CE  1 
ATOM   3490 N  NZ  . LYS C 1 83  ? 10.672  22.206  -51.778  1.00 29.18  ? 905  LYS C NZ  1 
ATOM   3491 N  N   . ARG C 1 84  ? 14.015  20.075  -47.527  1.00 16.33  ? 906  ARG C N   1 
ATOM   3492 C  CA  . ARG C 1 84  ? 15.332  20.556  -47.945  1.00 17.40  ? 906  ARG C CA  1 
ATOM   3493 C  C   . ARG C 1 84  ? 16.395  19.491  -47.766  1.00 16.04  ? 906  ARG C C   1 
ATOM   3494 O  O   . ARG C 1 84  ? 17.341  19.414  -48.552  1.00 18.20  ? 906  ARG C O   1 
ATOM   3495 C  CB  . ARG C 1 84  ? 15.723  21.815  -47.172  1.00 22.36  ? 906  ARG C CB  1 
ATOM   3496 C  CG  . ARG C 1 84  ? 14.843  23.004  -47.509  1.00 27.89  ? 906  ARG C CG  1 
ATOM   3497 C  CD  . ARG C 1 84  ? 15.348  24.293  -46.885  1.00 31.35  ? 906  ARG C CD  1 
ATOM   3498 N  NE  . ARG C 1 84  ? 14.300  25.302  -46.932  1.00 40.95  ? 906  ARG C NE  1 
ATOM   3499 C  CZ  . ARG C 1 84  ? 13.556  25.658  -45.893  1.00 35.96  ? 906  ARG C CZ  1 
ATOM   3500 N  NH1 . ARG C 1 84  ? 13.747  25.099  -44.705  1.00 36.15  ? 906  ARG C NH1 1 
ATOM   3501 N  NH2 . ARG C 1 84  ? 12.602  26.561  -46.053  1.00 38.37  ? 906  ARG C NH2 1 
ATOM   3502 N  N   . LYS C 1 85  ? 16.253  18.671  -46.730  1.00 16.94  ? 907  LYS C N   1 
ATOM   3503 C  CA  . LYS C 1 85  ? 17.218  17.599  -46.522  1.00 15.75  ? 907  LYS C CA  1 
ATOM   3504 C  C   . LYS C 1 85  ? 17.103  16.602  -47.670  1.00 16.17  ? 907  LYS C C   1 
ATOM   3505 O  O   . LYS C 1 85  ? 18.108  16.152  -48.198  1.00 14.99  ? 907  LYS C O   1 
ATOM   3506 C  CB  . LYS C 1 85  ? 16.978  16.899  -45.187  1.00 16.77  ? 907  LYS C CB  1 
ATOM   3507 C  CG  . LYS C 1 85  ? 17.514  17.689  -43.997  1.00 16.19  ? 907  LYS C CG  1 
ATOM   3508 C  CD  . LYS C 1 85  ? 17.235  16.981  -42.691  1.00 17.10  ? 907  LYS C CD  1 
ATOM   3509 C  CE  . LYS C 1 85  ? 17.736  17.810  -41.503  1.00 14.94  ? 907  LYS C CE  1 
ATOM   3510 N  NZ  . LYS C 1 85  ? 17.556  17.067  -40.238  1.00 16.62  ? 907  LYS C NZ  1 
ATOM   3511 N  N   . CYS C 1 86  ? 15.877  16.259  -48.060  1.00 18.60  ? 908  CYS C N   1 
ATOM   3512 C  CA  . CYS C 1 86  ? 15.685  15.320  -49.156  1.00 19.12  ? 908  CYS C CA  1 
ATOM   3513 C  C   . CYS C 1 86  ? 16.211  15.929  -50.461  1.00 17.99  ? 908  CYS C C   1 
ATOM   3514 O  O   . CYS C 1 86  ? 16.731  15.221  -51.318  1.00 19.47  ? 908  CYS C O   1 
ATOM   3515 C  CB  . CYS C 1 86  ? 14.206  14.952  -49.311  1.00 19.25  ? 908  CYS C CB  1 
ATOM   3516 S  SG  . CYS C 1 86  ? 13.929  13.609  -50.515  1.00 21.50  ? 908  CYS C SG  1 
ATOM   3517 N  N   . GLU C 1 87  ? 16.061  17.242  -50.610  1.00 15.41  ? 909  GLU C N   1 
ATOM   3518 C  CA  . GLU C 1 87  ? 16.556  17.922  -51.804  1.00 16.73  ? 909  GLU C CA  1 
ATOM   3519 C  C   . GLU C 1 87  ? 18.074  17.806  -51.869  1.00 16.84  ? 909  GLU C C   1 
ATOM   3520 O  O   . GLU C 1 87  ? 18.648  17.614  -52.938  1.00 17.44  ? 909  GLU C O   1 
ATOM   3521 C  CB  . GLU C 1 87  ? 16.134  19.402  -51.802  1.00 16.32  ? 909  GLU C CB  1 
ATOM   3522 C  CG  . GLU C 1 87  ? 14.623  19.566  -51.965  1.00 16.71  ? 909  GLU C CG  1 
ATOM   3523 C  CD  . GLU C 1 87  ? 14.138  21.003  -51.922  1.00 21.60  ? 909  GLU C CD  1 
ATOM   3524 O  OE1 . GLU C 1 87  ? 14.770  21.845  -51.247  1.00 19.43  ? 909  GLU C OE1 1 
ATOM   3525 O  OE2 . GLU C 1 87  ? 13.095  21.277  -52.555  1.00 25.58  ? 909  GLU C OE2 1 
ATOM   3526 N  N   . ARG C 1 88  ? 18.722  17.922  -50.718  1.00 15.75  ? 910  ARG C N   1 
ATOM   3527 C  CA  . ARG C 1 88  ? 20.177  17.812  -50.675  1.00 17.34  ? 910  ARG C CA  1 
ATOM   3528 C  C   . ARG C 1 88  ? 20.596  16.368  -50.987  1.00 16.46  ? 910  ARG C C   1 
ATOM   3529 O  O   . ARG C 1 88  ? 21.504  16.136  -51.791  1.00 15.92  ? 910  ARG C O   1 
ATOM   3530 C  CB  . ARG C 1 88  ? 20.692  18.247  -49.297  1.00 21.91  ? 910  ARG C CB  1 
ATOM   3531 C  CG  . ARG C 1 88  ? 22.185  18.500  -49.252  1.00 28.46  ? 910  ARG C CG  1 
ATOM   3532 C  CD  . ARG C 1 88  ? 22.605  19.187  -47.957  1.00 30.31  ? 910  ARG C CD  1 
ATOM   3533 N  NE  . ARG C 1 88  ? 22.227  20.601  -47.907  1.00 32.50  ? 910  ARG C NE  1 
ATOM   3534 C  CZ  . ARG C 1 88  ? 22.561  21.429  -46.918  1.00 35.71  ? 910  ARG C CZ  1 
ATOM   3535 N  NH1 . ARG C 1 88  ? 23.277  20.989  -45.894  1.00 29.81  ? 910  ARG C NH1 1 
ATOM   3536 N  NH2 . ARG C 1 88  ? 22.193  22.702  -46.957  1.00 33.57  ? 910  ARG C NH2 1 
ATOM   3537 N  N   . LEU C 1 89  ? 19.922  15.404  -50.360  1.00 17.65  ? 911  LEU C N   1 
ATOM   3538 C  CA  . LEU C 1 89  ? 20.210  13.991  -50.585  1.00 18.93  ? 911  LEU C CA  1 
ATOM   3539 C  C   . LEU C 1 89  ? 20.123  13.673  -52.072  1.00 18.49  ? 911  LEU C C   1 
ATOM   3540 O  O   . LEU C 1 89  ? 20.993  12.998  -52.629  1.00 19.84  ? 911  LEU C O   1 
ATOM   3541 C  CB  . LEU C 1 89  ? 19.213  13.120  -49.819  1.00 14.87  ? 911  LEU C CB  1 
ATOM   3542 C  CG  . LEU C 1 89  ? 19.436  13.031  -48.314  1.00 15.58  ? 911  LEU C CG  1 
ATOM   3543 C  CD1 . LEU C 1 89  ? 18.257  12.317  -47.661  1.00 13.40  ? 911  LEU C CD1 1 
ATOM   3544 C  CD2 . LEU C 1 89  ? 20.751  12.294  -48.037  1.00 19.31  ? 911  LEU C CD2 1 
ATOM   3545 N  N   . LEU C 1 90  ? 19.060  14.154  -52.711  1.00 16.79  ? 912  LEU C N   1 
ATOM   3546 C  CA  . LEU C 1 90  ? 18.880  13.940  -54.137  1.00 17.73  ? 912  LEU C CA  1 
ATOM   3547 C  C   . LEU C 1 90  ? 20.005  14.580  -54.938  1.00 17.42  ? 912  LEU C C   1 
ATOM   3548 O  O   . LEU C 1 90  ? 20.554  13.947  -55.834  1.00 16.74  ? 912  LEU C O   1 
ATOM   3549 C  CB  . LEU C 1 90  ? 17.545  14.519  -54.618  1.00 20.30  ? 912  LEU C CB  1 
ATOM   3550 C  CG  . LEU C 1 90  ? 16.287  13.679  -54.395  1.00 20.05  ? 912  LEU C CG  1 
ATOM   3551 C  CD1 . LEU C 1 90  ? 15.045  14.526  -54.671  1.00 21.17  ? 912  LEU C CD1 1 
ATOM   3552 C  CD2 . LEU C 1 90  ? 16.328  12.461  -55.302  1.00 23.25  ? 912  LEU C CD2 1 
ATOM   3553 N  N   . LEU C 1 91  ? 20.343  15.831  -54.631  1.00 17.20  ? 913  LEU C N   1 
ATOM   3554 C  CA  . LEU C 1 91  ? 21.399  16.506  -55.384  1.00 15.78  ? 913  LEU C CA  1 
ATOM   3555 C  C   . LEU C 1 91  ? 22.750  15.802  -55.222  1.00 15.42  ? 913  LEU C C   1 
ATOM   3556 O  O   . LEU C 1 91  ? 23.516  15.683  -56.186  1.00 14.60  ? 913  LEU C O   1 
ATOM   3557 C  CB  . LEU C 1 91  ? 21.509  17.979  -54.966  1.00 18.61  ? 913  LEU C CB  1 
ATOM   3558 C  CG  . LEU C 1 91  ? 22.306  18.888  -55.911  1.00 18.15  ? 913  LEU C CG  1 
ATOM   3559 C  CD1 . LEU C 1 91  ? 21.792  18.754  -57.339  1.00 20.11  ? 913  LEU C CD1 1 
ATOM   3560 C  CD2 . LEU C 1 91  ? 22.177  20.340  -55.439  1.00 17.48  ? 913  LEU C CD2 1 
ATOM   3561 N  N   . PHE C 1 92  ? 23.038  15.334  -54.010  1.00 19.56  ? 914  PHE C N   1 
ATOM   3562 C  CA  . PHE C 1 92  ? 24.280  14.621  -53.757  1.00 21.02  ? 914  PHE C CA  1 
ATOM   3563 C  C   . PHE C 1 92  ? 24.362  13.382  -54.649  1.00 20.00  ? 914  PHE C C   1 
ATOM   3564 O  O   . PHE C 1 92  ? 25.404  13.122  -55.266  1.00 18.71  ? 914  PHE C O   1 
ATOM   3565 C  CB  . PHE C 1 92  ? 24.385  14.185  -52.295  1.00 17.95  ? 914  PHE C CB  1 
ATOM   3566 C  CG  . PHE C 1 92  ? 25.126  15.159  -51.414  1.00 20.31  ? 914  PHE C CG  1 
ATOM   3567 C  CD1 . PHE C 1 92  ? 24.452  15.892  -50.445  1.00 24.77  ? 914  PHE C CD1 1 
ATOM   3568 C  CD2 . PHE C 1 92  ? 26.497  15.341  -51.556  1.00 25.45  ? 914  PHE C CD2 1 
ATOM   3569 C  CE1 . PHE C 1 92  ? 25.130  16.797  -49.628  1.00 27.20  ? 914  PHE C CE1 1 
ATOM   3570 C  CE2 . PHE C 1 92  ? 27.188  16.245  -50.741  1.00 22.68  ? 914  PHE C CE2 1 
ATOM   3571 C  CZ  . PHE C 1 92  ? 26.499  16.973  -49.776  1.00 24.42  ? 914  PHE C CZ  1 
ATOM   3572 N  N   . LEU C 1 93  ? 23.270  12.618  -54.722  1.00 13.71  ? 915  LEU C N   1 
ATOM   3573 C  CA  . LEU C 1 93  ? 23.282  11.412  -55.549  1.00 15.23  ? 915  LEU C CA  1 
ATOM   3574 C  C   . LEU C 1 93  ? 23.355  11.746  -57.032  1.00 14.82  ? 915  LEU C C   1 
ATOM   3575 O  O   . LEU C 1 93  ? 24.093  11.100  -57.773  1.00 16.46  ? 915  LEU C O   1 
ATOM   3576 C  CB  . LEU C 1 93  ? 22.067  10.523  -55.255  1.00 16.82  ? 915  LEU C CB  1 
ATOM   3577 C  CG  . LEU C 1 93  ? 22.022  9.940   -53.836  1.00 22.36  ? 915  LEU C CG  1 
ATOM   3578 C  CD1 . LEU C 1 93  ? 20.876  8.934   -53.725  1.00 21.76  ? 915  LEU C CD1 1 
ATOM   3579 C  CD2 . LEU C 1 93  ? 23.335  9.271   -53.507  1.00 25.91  ? 915  LEU C CD2 1 
ATOM   3580 N  N   . TYR C 1 94  ? 22.605  12.755  -57.470  1.00 16.17  ? 916  TYR C N   1 
ATOM   3581 C  CA  . TYR C 1 94  ? 22.649  13.156  -58.875  1.00 17.53  ? 916  TYR C CA  1 
ATOM   3582 C  C   . TYR C 1 94  ? 24.077  13.552  -59.288  1.00 16.50  ? 916  TYR C C   1 
ATOM   3583 O  O   . TYR C 1 94  ? 24.511  13.256  -60.400  1.00 14.35  ? 916  TYR C O   1 
ATOM   3584 C  CB  . TYR C 1 94  ? 21.712  14.346  -59.137  1.00 17.32  ? 916  TYR C CB  1 
ATOM   3585 C  CG  . TYR C 1 94  ? 20.331  13.975  -59.637  1.00 20.30  ? 916  TYR C CG  1 
ATOM   3586 C  CD1 . TYR C 1 94  ? 19.228  14.007  -58.783  1.00 22.42  ? 916  TYR C CD1 1 
ATOM   3587 C  CD2 . TYR C 1 94  ? 20.119  13.628  -60.975  1.00 22.19  ? 916  TYR C CD2 1 
ATOM   3588 C  CE1 . TYR C 1 94  ? 17.951  13.713  -59.246  1.00 19.91  ? 916  TYR C CE1 1 
ATOM   3589 C  CE2 . TYR C 1 94  ? 18.844  13.331  -61.451  1.00 23.20  ? 916  TYR C CE2 1 
ATOM   3590 C  CZ  . TYR C 1 94  ? 17.764  13.379  -60.580  1.00 22.45  ? 916  TYR C CZ  1 
ATOM   3591 O  OH  . TYR C 1 94  ? 16.495  13.127  -61.045  1.00 23.82  ? 916  TYR C OH  1 
ATOM   3592 N  N   . CYS C 1 95  ? 24.803  14.221  -58.397  1.00 17.23  ? 917  CYS C N   1 
ATOM   3593 C  CA  . CYS C 1 95  ? 26.168  14.643  -58.701  1.00 19.80  ? 917  CYS C CA  1 
ATOM   3594 C  C   . CYS C 1 95  ? 27.225  13.534  -58.595  1.00 21.51  ? 917  CYS C C   1 
ATOM   3595 O  O   . CYS C 1 95  ? 28.322  13.679  -59.122  1.00 20.15  ? 917  CYS C O   1 
ATOM   3596 C  CB  . CYS C 1 95  ? 26.575  15.822  -57.812  1.00 22.65  ? 917  CYS C CB  1 
ATOM   3597 S  SG  . CYS C 1 95  ? 25.655  17.341  -58.178  1.00 25.02  ? 917  CYS C SG  1 
ATOM   3598 N  N   . HIS C 1 96  ? 26.895  12.439  -57.916  1.00 15.38  ? 918  HIS C N   1 
ATOM   3599 C  CA  . HIS C 1 96  ? 27.825  11.322  -57.767  1.00 16.89  ? 918  HIS C CA  1 
ATOM   3600 C  C   . HIS C 1 96  ? 28.103  10.747  -59.159  1.00 18.78  ? 918  HIS C C   1 
ATOM   3601 O  O   . HIS C 1 96  ? 27.198  10.627  -59.984  1.00 18.41  ? 918  HIS C O   1 
ATOM   3602 C  CB  . HIS C 1 96  ? 27.211  10.261  -56.848  1.00 25.60  ? 918  HIS C CB  1 
ATOM   3603 C  CG  . HIS C 1 96  ? 28.191  9.242   -56.358  1.00 27.08  ? 918  HIS C CG  1 
ATOM   3604 N  ND1 . HIS C 1 96  ? 28.723  8.267   -57.174  1.00 27.00  ? 918  HIS C ND1 1 
ATOM   3605 C  CD2 . HIS C 1 96  ? 28.749  9.060   -55.137  1.00 27.11  ? 918  HIS C CD2 1 
ATOM   3606 C  CE1 . HIS C 1 96  ? 29.568  7.528   -56.476  1.00 25.74  ? 918  HIS C CE1 1 
ATOM   3607 N  NE2 . HIS C 1 96  ? 29.601  7.988   -55.238  1.00 30.14  ? 918  HIS C NE2 1 
ATOM   3608 N  N   . GLU C 1 97  ? 29.357  10.399  -59.422  1.00 21.85  ? 919  GLU C N   1 
ATOM   3609 C  CA  . GLU C 1 97  ? 29.747  9.880   -60.730  1.00 25.42  ? 919  GLU C CA  1 
ATOM   3610 C  C   . GLU C 1 97  ? 29.057  8.591   -61.188  1.00 25.42  ? 919  GLU C C   1 
ATOM   3611 O  O   . GLU C 1 97  ? 29.005  8.317   -62.379  1.00 27.06  ? 919  GLU C O   1 
ATOM   3612 C  CB  . GLU C 1 97  ? 31.268  9.694   -60.763  1.00 38.99  ? 919  GLU C CB  1 
ATOM   3613 C  CG  . GLU C 1 97  ? 32.025  10.912  -60.251  1.00 43.67  ? 919  GLU C CG  1 
ATOM   3614 C  CD  . GLU C 1 97  ? 33.530  10.711  -60.217  1.00 47.26  ? 919  GLU C CD  1 
ATOM   3615 O  OE1 . GLU C 1 97  ? 33.975  9.588   -59.901  1.00 50.42  ? 919  GLU C OE1 1 
ATOM   3616 O  OE2 . GLU C 1 97  ? 34.265  11.684  -60.492  1.00 50.80  ? 919  GLU C OE2 1 
ATOM   3617 N  N   . MET C 1 98  ? 28.520  7.817   -60.249  1.00 26.28  ? 920  MET C N   1 
ATOM   3618 C  CA  . MET C 1 98  ? 27.861  6.542   -60.561  1.00 26.38  ? 920  MET C CA  1 
ATOM   3619 C  C   . MET C 1 98  ? 26.335  6.621   -60.691  1.00 25.79  ? 920  MET C C   1 
ATOM   3620 O  O   . MET C 1 98  ? 25.686  5.600   -60.908  1.00 26.95  ? 920  MET C O   1 
ATOM   3621 C  CB  . MET C 1 98  ? 28.164  5.516   -59.459  1.00 31.22  ? 920  MET C CB  1 
ATOM   3622 C  CG  . MET C 1 98  ? 29.627  5.314   -59.126  1.00 35.86  ? 920  MET C CG  1 
ATOM   3623 S  SD  . MET C 1 98  ? 30.468  4.280   -60.327  1.00 46.11  ? 920  MET C SD  1 
ATOM   3624 C  CE  . MET C 1 98  ? 31.040  5.500   -61.465  1.00 36.84  ? 920  MET C CE  1 
ATOM   3625 N  N   . SER C 1 99  ? 25.765  7.817   -60.573  1.00 23.85  ? 921  SER C N   1 
ATOM   3626 C  CA  . SER C 1 99  ? 24.305  7.975   -60.596  1.00 24.03  ? 921  SER C CA  1 
ATOM   3627 C  C   . SER C 1 99  ? 23.530  7.833   -61.900  1.00 24.40  ? 921  SER C C   1 
ATOM   3628 O  O   . SER C 1 99  ? 22.322  7.600   -61.867  1.00 23.71  ? 921  SER C O   1 
ATOM   3629 C  CB  . SER C 1 99  ? 23.924  9.327   -59.982  1.00 21.90  ? 921  SER C CB  1 
ATOM   3630 O  OG  . SER C 1 99  ? 24.094  10.372  -60.932  1.00 21.99  ? 921  SER C OG  1 
ATOM   3631 N  N   . LEU C 1 100 ? 24.197  7.971   -63.042  1.00 23.86  ? 922  LEU C N   1 
ATOM   3632 C  CA  . LEU C 1 100 ? 23.500  7.911   -64.321  1.00 24.82  ? 922  LEU C CA  1 
ATOM   3633 C  C   . LEU C 1 100 ? 22.475  6.794   -64.491  1.00 24.65  ? 922  LEU C C   1 
ATOM   3634 O  O   . LEU C 1 100 ? 21.366  7.047   -64.944  1.00 22.25  ? 922  LEU C O   1 
ATOM   3635 C  CB  . LEU C 1 100 ? 24.502  7.860   -65.480  1.00 35.68  ? 922  LEU C CB  1 
ATOM   3636 C  CG  . LEU C 1 100 ? 23.870  8.015   -66.868  1.00 36.84  ? 922  LEU C CG  1 
ATOM   3637 C  CD1 . LEU C 1 100 ? 23.054  9.293   -66.926  1.00 41.80  ? 922  LEU C CD1 1 
ATOM   3638 C  CD2 . LEU C 1 100 ? 24.956  8.032   -67.930  1.00 44.79  ? 922  LEU C CD2 1 
ATOM   3639 N  N   . ALA C 1 101 ? 22.844  5.570   -64.124  1.00 28.85  ? 923  ALA C N   1 
ATOM   3640 C  CA  . ALA C 1 101 ? 21.956  4.418   -64.263  1.00 29.44  ? 923  ALA C CA  1 
ATOM   3641 C  C   . ALA C 1 101 ? 20.733  4.427   -63.355  1.00 29.84  ? 923  ALA C C   1 
ATOM   3642 O  O   . ALA C 1 101 ? 19.776  3.694   -63.596  1.00 30.85  ? 923  ALA C O   1 
ATOM   3643 C  CB  . ALA C 1 101 ? 22.746  3.135   -64.036  1.00 38.45  ? 923  ALA C CB  1 
ATOM   3644 N  N   . PHE C 1 102 ? 20.751  5.259   -62.321  1.00 21.30  ? 924  PHE C N   1 
ATOM   3645 C  CA  . PHE C 1 102 ? 19.638  5.314   -61.381  1.00 19.92  ? 924  PHE C CA  1 
ATOM   3646 C  C   . PHE C 1 102 ? 18.848  6.624   -61.423  1.00 18.99  ? 924  PHE C C   1 
ATOM   3647 O  O   . PHE C 1 102 ? 17.951  6.836   -60.607  1.00 16.82  ? 924  PHE C O   1 
ATOM   3648 C  CB  . PHE C 1 102 ? 20.184  5.074   -59.976  1.00 22.15  ? 924  PHE C CB  1 
ATOM   3649 C  CG  . PHE C 1 102 ? 21.089  3.882   -59.894  1.00 25.91  ? 924  PHE C CG  1 
ATOM   3650 C  CD1 . PHE C 1 102 ? 20.564  2.595   -59.878  1.00 22.71  ? 924  PHE C CD1 1 
ATOM   3651 C  CD2 . PHE C 1 102 ? 22.471  4.043   -59.919  1.00 27.94  ? 924  PHE C CD2 1 
ATOM   3652 C  CE1 . PHE C 1 102 ? 21.402  1.485   -59.894  1.00 26.83  ? 924  PHE C CE1 1 
ATOM   3653 C  CE2 . PHE C 1 102 ? 23.317  2.937   -59.936  1.00 29.31  ? 924  PHE C CE2 1 
ATOM   3654 C  CZ  . PHE C 1 102 ? 22.783  1.656   -59.925  1.00 19.75  ? 924  PHE C CZ  1 
ATOM   3655 N  N   . GLN C 1 103 ? 19.165  7.487   -62.381  1.00 21.46  ? 925  GLN C N   1 
ATOM   3656 C  CA  . GLN C 1 103 ? 18.490  8.784   -62.509  1.00 23.08  ? 925  GLN C CA  1 
ATOM   3657 C  C   . GLN C 1 103 ? 17.104  8.743   -63.134  1.00 23.46  ? 925  GLN C C   1 
ATOM   3658 O  O   . GLN C 1 103 ? 16.177  9.371   -62.638  1.00 22.70  ? 925  GLN C O   1 
ATOM   3659 C  CB  . GLN C 1 103 ? 19.349  9.751   -63.320  1.00 24.22  ? 925  GLN C CB  1 
ATOM   3660 C  CG  . GLN C 1 103 ? 20.639  10.145  -62.644  1.00 23.49  ? 925  GLN C CG  1 
ATOM   3661 C  CD  . GLN C 1 103 ? 21.410  11.162  -63.451  1.00 22.61  ? 925  GLN C CD  1 
ATOM   3662 O  OE1 . GLN C 1 103 ? 20.887  11.737  -64.413  1.00 25.77  ? 925  GLN C OE1 1 
ATOM   3663 N  NE2 . GLN C 1 103 ? 22.649  11.397  -63.065  1.00 24.97  ? 925  GLN C NE2 1 
ATOM   3664 N  N   . ASP C 1 104 ? 16.961  8.029   -64.240  1.00 28.02  ? 926  ASP C N   1 
ATOM   3665 C  CA  . ASP C 1 104 ? 15.665  7.948   -64.895  1.00 29.38  ? 926  ASP C CA  1 
ATOM   3666 C  C   . ASP C 1 104 ? 15.163  6.517   -64.809  1.00 27.85  ? 926  ASP C C   1 
ATOM   3667 O  O   . ASP C 1 104 ? 15.912  5.617   -64.450  1.00 27.81  ? 926  ASP C O   1 
ATOM   3668 C  CB  . ASP C 1 104 ? 15.782  8.391   -66.357  1.00 28.46  ? 926  ASP C CB  1 
ATOM   3669 C  CG  . ASP C 1 104 ? 16.305  9.818   -66.494  1.00 34.33  ? 926  ASP C CG  1 
ATOM   3670 O  OD1 . ASP C 1 104 ? 15.635  10.754  -66.001  1.00 36.63  ? 926  ASP C OD1 1 
ATOM   3671 O  OD2 . ASP C 1 104 ? 17.390  10.005  -67.088  1.00 38.12  ? 926  ASP C OD2 1 
ATOM   3672 N  N   . PRO C 1 105 ? 13.879  6.292   -65.114  1.00 26.80  ? 927  PRO C N   1 
ATOM   3673 C  CA  . PRO C 1 105 ? 13.320  4.940   -65.058  1.00 26.30  ? 927  PRO C CA  1 
ATOM   3674 C  C   . PRO C 1 105 ? 14.100  3.960   -65.933  1.00 25.54  ? 927  PRO C C   1 
ATOM   3675 O  O   . PRO C 1 105 ? 14.587  4.328   -66.999  1.00 23.17  ? 927  PRO C O   1 
ATOM   3676 C  CB  . PRO C 1 105 ? 11.895  5.144   -65.555  1.00 36.35  ? 927  PRO C CB  1 
ATOM   3677 C  CG  . PRO C 1 105 ? 11.574  6.517   -65.057  1.00 37.00  ? 927  PRO C CG  1 
ATOM   3678 C  CD  . PRO C 1 105 ? 12.827  7.279   -65.413  1.00 36.46  ? 927  PRO C CD  1 
ATOM   3679 N  N   . VAL C 1 106 ? 14.241  2.722   -65.469  1.00 23.68  ? 928  VAL C N   1 
ATOM   3680 C  CA  . VAL C 1 106 ? 14.947  1.711   -66.245  1.00 25.50  ? 928  VAL C CA  1 
ATOM   3681 C  C   . VAL C 1 106 ? 14.161  1.516   -67.543  1.00 25.34  ? 928  VAL C C   1 
ATOM   3682 O  O   . VAL C 1 106 ? 12.946  1.335   -67.512  1.00 24.13  ? 928  VAL C O   1 
ATOM   3683 C  CB  . VAL C 1 106 ? 15.003  0.363   -65.493  1.00 32.18  ? 928  VAL C CB  1 
ATOM   3684 C  CG1 . VAL C 1 106 ? 15.646  -0.698  -66.371  1.00 30.48  ? 928  VAL C CG1 1 
ATOM   3685 C  CG2 . VAL C 1 106 ? 15.779  0.525   -64.194  1.00 34.25  ? 928  VAL C CG2 1 
ATOM   3686 N  N   . PRO C 1 107 ? 14.846  1.556   -68.696  1.00 23.93  ? 929  PRO C N   1 
ATOM   3687 C  CA  . PRO C 1 107 ? 14.219  1.388   -70.014  1.00 24.93  ? 929  PRO C CA  1 
ATOM   3688 C  C   . PRO C 1 107 ? 13.378  0.117   -70.132  1.00 26.32  ? 929  PRO C C   1 
ATOM   3689 O  O   . PRO C 1 107 ? 13.737  -0.933  -69.592  1.00 25.11  ? 929  PRO C O   1 
ATOM   3690 C  CB  . PRO C 1 107 ? 15.414  1.366   -70.967  1.00 28.75  ? 929  PRO C CB  1 
ATOM   3691 C  CG  . PRO C 1 107 ? 16.429  2.206   -70.261  1.00 29.08  ? 929  PRO C CG  1 
ATOM   3692 C  CD  . PRO C 1 107 ? 16.300  1.743   -68.830  1.00 26.34  ? 929  PRO C CD  1 
ATOM   3693 N  N   . LEU C 1 108 ? 12.256  0.215   -70.839  1.00 32.01  ? 930  LEU C N   1 
ATOM   3694 C  CA  . LEU C 1 108 ? 11.380  -0.936  -71.032  1.00 33.50  ? 930  LEU C CA  1 
ATOM   3695 C  C   . LEU C 1 108 ? 12.103  -2.021  -71.826  1.00 33.33  ? 930  LEU C C   1 
ATOM   3696 O  O   . LEU C 1 108 ? 11.752  -3.199  -71.755  1.00 33.95  ? 930  LEU C O   1 
ATOM   3697 C  CB  . LEU C 1 108 ? 10.110  -0.520  -71.785  1.00 39.18  ? 930  LEU C CB  1 
ATOM   3698 C  CG  . LEU C 1 108 ? 9.008   0.207   -71.011  1.00 40.60  ? 930  LEU C CG  1 
ATOM   3699 C  CD1 . LEU C 1 108 ? 7.926   0.679   -71.969  1.00 43.81  ? 930  LEU C CD1 1 
ATOM   3700 C  CD2 . LEU C 1 108 ? 8.422   -0.739  -69.976  1.00 45.28  ? 930  LEU C CD2 1 
ATOM   3701 N  N   . THR C 1 109 ? 13.119  -1.609  -72.573  1.00 31.65  ? 931  THR C N   1 
ATOM   3702 C  CA  . THR C 1 109 ? 13.896  -2.516  -73.409  1.00 33.06  ? 931  THR C CA  1 
ATOM   3703 C  C   . THR C 1 109 ? 14.841  -3.437  -72.640  1.00 33.60  ? 931  THR C C   1 
ATOM   3704 O  O   . THR C 1 109 ? 15.443  -4.335  -73.224  1.00 33.56  ? 931  THR C O   1 
ATOM   3705 C  CB  . THR C 1 109 ? 14.706  -1.723  -74.450  1.00 35.76  ? 931  THR C CB  1 
ATOM   3706 O  OG1 . THR C 1 109 ? 15.444  -0.688  -73.790  1.00 36.26  ? 931  THR C OG1 1 
ATOM   3707 C  CG2 . THR C 1 109 ? 13.775  -1.089  -75.482  1.00 34.77  ? 931  THR C CG2 1 
ATOM   3708 N  N   . VAL C 1 110 ? 14.991  -3.218  -71.338  1.00 35.19  ? 932  VAL C N   1 
ATOM   3709 C  CA  . VAL C 1 110 ? 15.856  -4.088  -70.552  1.00 34.81  ? 932  VAL C CA  1 
ATOM   3710 C  C   . VAL C 1 110 ? 15.073  -5.378  -70.330  1.00 35.74  ? 932  VAL C C   1 
ATOM   3711 O  O   . VAL C 1 110 ? 14.063  -5.395  -69.626  1.00 35.37  ? 932  VAL C O   1 
ATOM   3712 C  CB  . VAL C 1 110 ? 16.223  -3.453  -69.201  1.00 28.19  ? 932  VAL C CB  1 
ATOM   3713 C  CG1 . VAL C 1 110 ? 17.076  -4.413  -68.387  1.00 27.58  ? 932  VAL C CG1 1 
ATOM   3714 C  CG2 . VAL C 1 110 ? 16.978  -2.154  -69.439  1.00 28.28  ? 932  VAL C CG2 1 
ATOM   3715 N  N   . PRO C 1 111 ? 15.528  -6.481  -70.945  1.00 34.20  ? 933  PRO C N   1 
ATOM   3716 C  CA  . PRO C 1 111 ? 14.866  -7.781  -70.826  1.00 34.60  ? 933  PRO C CA  1 
ATOM   3717 C  C   . PRO C 1 111 ? 14.432  -8.190  -69.425  1.00 35.18  ? 933  PRO C C   1 
ATOM   3718 O  O   . PRO C 1 111 ? 15.235  -8.217  -68.490  1.00 36.04  ? 933  PRO C O   1 
ATOM   3719 C  CB  . PRO C 1 111 ? 15.894  -8.745  -71.416  1.00 37.38  ? 933  PRO C CB  1 
ATOM   3720 C  CG  . PRO C 1 111 ? 16.540  -7.916  -72.474  1.00 38.22  ? 933  PRO C CG  1 
ATOM   3721 C  CD  . PRO C 1 111 ? 16.756  -6.596  -71.753  1.00 36.67  ? 933  PRO C CD  1 
ATOM   3722 N  N   . ASP C 1 112 ? 13.145  -8.497  -69.306  1.00 36.66  ? 934  ASP C N   1 
ATOM   3723 C  CA  . ASP C 1 112 ? 12.525  -8.953  -68.066  1.00 38.38  ? 934  ASP C CA  1 
ATOM   3724 C  C   . ASP C 1 112 ? 12.587  -8.026  -66.858  1.00 37.40  ? 934  ASP C C   1 
ATOM   3725 O  O   . ASP C 1 112 ? 12.125  -8.398  -65.781  1.00 38.16  ? 934  ASP C O   1 
ATOM   3726 C  CB  . ASP C 1 112 ? 13.115  -10.306 -67.657  1.00 45.17  ? 934  ASP C CB  1 
ATOM   3727 C  CG  . ASP C 1 112 ? 13.096  -11.319 -68.787  1.00 48.92  ? 934  ASP C CG  1 
ATOM   3728 O  OD1 . ASP C 1 112 ? 12.036  -11.476 -69.428  1.00 46.28  ? 934  ASP C OD1 1 
ATOM   3729 O  OD2 . ASP C 1 112 ? 14.143  -11.961 -69.026  1.00 55.73  ? 934  ASP C OD2 1 
ATOM   3730 N  N   . TYR C 1 113 ? 13.127  -6.825  -67.014  1.00 32.41  ? 935  TYR C N   1 
ATOM   3731 C  CA  . TYR C 1 113 ? 13.221  -5.947  -65.857  1.00 30.68  ? 935  TYR C CA  1 
ATOM   3732 C  C   . TYR C 1 113 ? 11.914  -5.769  -65.110  1.00 31.18  ? 935  TYR C C   1 
ATOM   3733 O  O   . TYR C 1 113 ? 11.842  -5.988  -63.902  1.00 29.91  ? 935  TYR C O   1 
ATOM   3734 C  CB  . TYR C 1 113 ? 13.735  -4.561  -66.228  1.00 28.45  ? 935  TYR C CB  1 
ATOM   3735 C  CG  . TYR C 1 113 ? 14.096  -3.768  -64.990  1.00 27.44  ? 935  TYR C CG  1 
ATOM   3736 C  CD1 . TYR C 1 113 ? 15.297  -4.002  -64.323  1.00 29.17  ? 935  TYR C CD1 1 
ATOM   3737 C  CD2 . TYR C 1 113 ? 13.220  -2.821  -64.456  1.00 27.95  ? 935  TYR C CD2 1 
ATOM   3738 C  CE1 . TYR C 1 113 ? 15.622  -3.316  -63.159  1.00 27.57  ? 935  TYR C CE1 1 
ATOM   3739 C  CE2 . TYR C 1 113 ? 13.535  -2.128  -63.284  1.00 25.82  ? 935  TYR C CE2 1 
ATOM   3740 C  CZ  . TYR C 1 113 ? 14.740  -2.382  -62.645  1.00 25.66  ? 935  TYR C CZ  1 
ATOM   3741 O  OH  . TYR C 1 113 ? 15.073  -1.709  -61.489  1.00 27.77  ? 935  TYR C OH  1 
ATOM   3742 N  N   . TYR C 1 114 ? 10.877  -5.362  -65.826  1.00 33.64  ? 936  TYR C N   1 
ATOM   3743 C  CA  . TYR C 1 114 ? 9.599   -5.127  -65.188  1.00 35.34  ? 936  TYR C CA  1 
ATOM   3744 C  C   . TYR C 1 114 ? 8.794   -6.373  -64.853  1.00 36.53  ? 936  TYR C C   1 
ATOM   3745 O  O   . TYR C 1 114 ? 7.677   -6.278  -64.352  1.00 36.89  ? 936  TYR C O   1 
ATOM   3746 C  CB  . TYR C 1 114 ? 8.801   -4.130  -66.025  1.00 34.65  ? 936  TYR C CB  1 
ATOM   3747 C  CG  . TYR C 1 114 ? 9.423   -2.752  -65.953  1.00 34.33  ? 936  TYR C CG  1 
ATOM   3748 C  CD1 . TYR C 1 114 ? 9.226   -1.940  -64.837  1.00 33.78  ? 936  TYR C CD1 1 
ATOM   3749 C  CD2 . TYR C 1 114 ? 10.269  -2.289  -66.962  1.00 32.75  ? 936  TYR C CD2 1 
ATOM   3750 C  CE1 . TYR C 1 114 ? 9.856   -0.702  -64.721  1.00 33.29  ? 936  TYR C CE1 1 
ATOM   3751 C  CE2 . TYR C 1 114 ? 10.909  -1.049  -66.854  1.00 33.37  ? 936  TYR C CE2 1 
ATOM   3752 C  CZ  . TYR C 1 114 ? 10.694  -0.264  -65.730  1.00 31.91  ? 936  TYR C CZ  1 
ATOM   3753 O  OH  . TYR C 1 114 ? 11.312  0.960   -65.614  1.00 30.43  ? 936  TYR C OH  1 
ATOM   3754 N  N   . LYS C 1 115 ? 9.374   -7.541  -65.115  1.00 49.27  ? 937  LYS C N   1 
ATOM   3755 C  CA  . LYS C 1 115 ? 8.727   -8.802  -64.779  1.00 50.17  ? 937  LYS C CA  1 
ATOM   3756 C  C   . LYS C 1 115 ? 9.292   -9.220  -63.427  1.00 49.91  ? 937  LYS C C   1 
ATOM   3757 O  O   . LYS C 1 115 ? 8.641   -9.924  -62.653  1.00 50.60  ? 937  LYS C O   1 
ATOM   3758 C  CB  . LYS C 1 115 ? 9.028   -9.883  -65.824  1.00 61.24  ? 937  LYS C CB  1 
ATOM   3759 C  CG  . LYS C 1 115 ? 7.903   -10.118 -66.827  1.00 65.49  ? 937  LYS C CG  1 
ATOM   3760 C  CD  . LYS C 1 115 ? 8.203   -11.301 -67.744  1.00 73.84  ? 937  LYS C CD  1 
ATOM   3761 C  CE  . LYS C 1 115 ? 8.080   -12.639 -67.022  1.00 76.52  ? 937  LYS C CE  1 
ATOM   3762 N  NZ  . LYS C 1 115 ? 6.664   -12.976 -66.696  1.00 80.20  ? 937  LYS C NZ  1 
ATOM   3763 N  N   . ILE C 1 116 ? 10.512  -8.766  -63.149  1.00 38.20  ? 938  ILE C N   1 
ATOM   3764 C  CA  . ILE C 1 116 ? 11.187  -9.072  -61.893  1.00 37.11  ? 938  ILE C CA  1 
ATOM   3765 C  C   . ILE C 1 116 ? 10.924  -7.952  -60.881  1.00 35.41  ? 938  ILE C C   1 
ATOM   3766 O  O   . ILE C 1 116 ? 10.496  -8.203  -59.752  1.00 33.05  ? 938  ILE C O   1 
ATOM   3767 C  CB  . ILE C 1 116 ? 12.718  -9.190  -62.095  1.00 37.69  ? 938  ILE C CB  1 
ATOM   3768 C  CG1 . ILE C 1 116 ? 13.028  -10.160 -63.236  1.00 40.81  ? 938  ILE C CG1 1 
ATOM   3769 C  CG2 . ILE C 1 116 ? 13.385  -9.647  -60.807  1.00 38.10  ? 938  ILE C CG2 1 
ATOM   3770 C  CD1 . ILE C 1 116 ? 12.479  -11.552 -63.030  1.00 42.20  ? 938  ILE C CD1 1 
ATOM   3771 N  N   . ILE C 1 117 ? 11.177  -6.717  -61.304  1.00 27.68  ? 939  ILE C N   1 
ATOM   3772 C  CA  . ILE C 1 117 ? 10.993  -5.549  -60.447  1.00 25.91  ? 939  ILE C CA  1 
ATOM   3773 C  C   . ILE C 1 117 ? 9.571   -5.007  -60.514  1.00 26.00  ? 939  ILE C C   1 
ATOM   3774 O  O   . ILE C 1 117 ? 9.185   -4.376  -61.500  1.00 25.66  ? 939  ILE C O   1 
ATOM   3775 C  CB  . ILE C 1 117 ? 11.972  -4.426  -60.844  1.00 25.47  ? 939  ILE C CB  1 
ATOM   3776 C  CG1 . ILE C 1 117 ? 13.410  -4.948  -60.788  1.00 22.11  ? 939  ILE C CG1 1 
ATOM   3777 C  CG2 . ILE C 1 117 ? 11.791  -3.220  -59.931  1.00 23.28  ? 939  ILE C CG2 1 
ATOM   3778 C  CD1 . ILE C 1 117 ? 13.826  -5.475  -59.417  1.00 23.54  ? 939  ILE C CD1 1 
ATOM   3779 N  N   . LYS C 1 118 ? 8.806   -5.245  -59.453  1.00 29.69  ? 940  LYS C N   1 
ATOM   3780 C  CA  . LYS C 1 118 ? 7.424   -4.796  -59.384  1.00 31.82  ? 940  LYS C CA  1 
ATOM   3781 C  C   . LYS C 1 118 ? 7.225   -3.358  -58.893  1.00 31.66  ? 940  LYS C C   1 
ATOM   3782 O  O   . LYS C 1 118 ? 6.252   -2.704  -59.273  1.00 32.39  ? 940  LYS C O   1 
ATOM   3783 C  CB  . LYS C 1 118 ? 6.610   -5.772  -58.530  1.00 36.96  ? 940  LYS C CB  1 
ATOM   3784 C  CG  . LYS C 1 118 ? 6.523   -7.159  -59.142  1.00 38.67  ? 940  LYS C CG  1 
ATOM   3785 C  CD  . LYS C 1 118 ? 5.947   -7.091  -60.555  1.00 42.80  ? 940  LYS C CD  1 
ATOM   3786 C  CE  . LYS C 1 118 ? 5.950   -8.450  -61.244  1.00 46.29  ? 940  LYS C CE  1 
ATOM   3787 N  NZ  . LYS C 1 118 ? 5.632   -8.336  -62.698  1.00 49.89  ? 940  LYS C NZ  1 
ATOM   3788 N  N   . ASN C 1 119 ? 8.135   -2.870  -58.052  1.00 27.80  ? 941  ASN C N   1 
ATOM   3789 C  CA  . ASN C 1 119 ? 8.052   -1.497  -57.544  1.00 28.83  ? 941  ASN C CA  1 
ATOM   3790 C  C   . ASN C 1 119 ? 9.291   -0.704  -57.942  1.00 26.65  ? 941  ASN C C   1 
ATOM   3791 O  O   . ASN C 1 119 ? 10.157  -0.423  -57.116  1.00 25.87  ? 941  ASN C O   1 
ATOM   3792 C  CB  . ASN C 1 119 ? 7.917   -1.477  -56.021  1.00 35.25  ? 941  ASN C CB  1 
ATOM   3793 C  CG  . ASN C 1 119 ? 6.565   -1.964  -55.550  1.00 43.36  ? 941  ASN C CG  1 
ATOM   3794 O  OD1 . ASN C 1 119 ? 5.529   -1.432  -55.948  1.00 45.27  ? 941  ASN C OD1 1 
ATOM   3795 N  ND2 . ASN C 1 119 ? 6.569   -2.980  -54.693  1.00 41.92  ? 941  ASN C ND2 1 
ATOM   3796 N  N   . PRO C 1 120 ? 9.391   -0.338  -59.223  1.00 23.96  ? 942  PRO C N   1 
ATOM   3797 C  CA  . PRO C 1 120 ? 10.544  0.425   -59.705  1.00 23.81  ? 942  PRO C CA  1 
ATOM   3798 C  C   . PRO C 1 120 ? 10.646  1.789   -59.034  1.00 23.36  ? 942  PRO C C   1 
ATOM   3799 O  O   . PRO C 1 120 ? 9.664   2.307   -58.503  1.00 21.04  ? 942  PRO C O   1 
ATOM   3800 C  CB  . PRO C 1 120 ? 10.299  0.510   -61.211  1.00 26.01  ? 942  PRO C CB  1 
ATOM   3801 C  CG  . PRO C 1 120 ? 8.791   0.492   -61.306  1.00 30.07  ? 942  PRO C CG  1 
ATOM   3802 C  CD  . PRO C 1 120 ? 8.406   -0.557  -60.296  1.00 29.60  ? 942  PRO C CD  1 
ATOM   3803 N  N   . MET C 1 121 ? 11.848  2.356   -59.051  1.00 24.20  ? 943  MET C N   1 
ATOM   3804 C  CA  . MET C 1 121 ? 12.082  3.653   -58.439  1.00 22.44  ? 943  MET C CA  1 
ATOM   3805 C  C   . MET C 1 121 ? 13.388  4.198   -58.992  1.00 22.86  ? 943  MET C C   1 
ATOM   3806 O  O   . MET C 1 121 ? 14.304  3.436   -59.301  1.00 22.23  ? 943  MET C O   1 
ATOM   3807 C  CB  . MET C 1 121 ? 12.155  3.502   -56.913  1.00 19.92  ? 943  MET C CB  1 
ATOM   3808 C  CG  . MET C 1 121 ? 12.269  4.803   -56.128  1.00 21.53  ? 943  MET C CG  1 
ATOM   3809 S  SD  . MET C 1 121 ? 10.982  5.976   -56.554  1.00 22.25  ? 943  MET C SD  1 
ATOM   3810 C  CE  . MET C 1 121 ? 9.503   5.074   -56.095  1.00 24.43  ? 943  MET C CE  1 
ATOM   3811 N  N   . ASP C 1 122 ? 13.458  5.516   -59.128  1.00 19.67  ? 944  ASP C N   1 
ATOM   3812 C  CA  . ASP C 1 122 ? 14.646  6.179   -59.647  1.00 20.00  ? 944  ASP C CA  1 
ATOM   3813 C  C   . ASP C 1 122 ? 14.724  7.570   -59.026  1.00 18.90  ? 944  ASP C C   1 
ATOM   3814 O  O   . ASP C 1 122 ? 13.773  8.030   -58.403  1.00 17.01  ? 944  ASP C O   1 
ATOM   3815 C  CB  . ASP C 1 122 ? 14.566  6.287   -61.167  1.00 32.19  ? 944  ASP C CB  1 
ATOM   3816 C  CG  . ASP C 1 122 ? 13.269  6.920   -61.635  1.00 36.08  ? 944  ASP C CG  1 
ATOM   3817 O  OD1 . ASP C 1 122 ? 12.355  6.179   -62.046  1.00 45.61  ? 944  ASP C OD1 1 
ATOM   3818 O  OD2 . ASP C 1 122 ? 13.161  8.162   -61.582  1.00 43.47  ? 944  ASP C OD2 1 
ATOM   3819 N  N   . LEU C 1 123 ? 15.848  8.249   -59.210  1.00 19.78  ? 945  LEU C N   1 
ATOM   3820 C  CA  . LEU C 1 123 ? 16.017  9.566   -58.621  1.00 19.79  ? 945  LEU C CA  1 
ATOM   3821 C  C   . LEU C 1 123 ? 15.017  10.599  -59.136  1.00 20.21  ? 945  LEU C C   1 
ATOM   3822 O  O   . LEU C 1 123 ? 14.527  11.426  -58.364  1.00 18.17  ? 945  LEU C O   1 
ATOM   3823 C  CB  . LEU C 1 123 ? 17.451  10.067  -58.843  1.00 16.45  ? 945  LEU C CB  1 
ATOM   3824 C  CG  . LEU C 1 123 ? 18.585  9.236   -58.221  1.00 17.02  ? 945  LEU C CG  1 
ATOM   3825 C  CD1 . LEU C 1 123 ? 19.928  9.852   -58.596  1.00 18.91  ? 945  LEU C CD1 1 
ATOM   3826 C  CD2 . LEU C 1 123 ? 18.429  9.183   -56.707  1.00 16.68  ? 945  LEU C CD2 1 
ATOM   3827 N  N   . SER C 1 124 ? 14.704  10.553  -60.427  1.00 21.43  ? 946  SER C N   1 
ATOM   3828 C  CA  . SER C 1 124 ? 13.768  11.525  -60.996  1.00 22.89  ? 946  SER C CA  1 
ATOM   3829 C  C   . SER C 1 124 ? 12.361  11.365  -60.410  1.00 21.90  ? 946  SER C C   1 
ATOM   3830 O  O   . SER C 1 124 ? 11.635  12.346  -60.245  1.00 20.69  ? 946  SER C O   1 
ATOM   3831 C  CB  . SER C 1 124 ? 13.728  11.413  -62.533  1.00 19.06  ? 946  SER C CB  1 
ATOM   3832 O  OG  . SER C 1 124 ? 13.035  10.257  -62.960  1.00 22.80  ? 946  SER C OG  1 
ATOM   3833 N  N   . THR C 1 125 ? 11.987  10.133  -60.072  1.00 19.98  ? 947  THR C N   1 
ATOM   3834 C  CA  . THR C 1 125 ? 10.674  9.873   -59.492  1.00 20.01  ? 947  THR C CA  1 
ATOM   3835 C  C   . THR C 1 125 ? 10.588  10.464  -58.085  1.00 19.20  ? 947  THR C C   1 
ATOM   3836 O  O   . THR C 1 125 ? 9.573   11.060  -57.708  1.00 17.79  ? 947  THR C O   1 
ATOM   3837 C  CB  . THR C 1 125 ? 10.386  8.364   -59.441  1.00 22.81  ? 947  THR C CB  1 
ATOM   3838 O  OG1 . THR C 1 125 ? 10.283  7.857   -60.778  1.00 22.97  ? 947  THR C OG1 1 
ATOM   3839 C  CG2 . THR C 1 125 ? 9.091   8.091   -58.701  1.00 23.47  ? 947  THR C CG2 1 
ATOM   3840 N  N   . ILE C 1 126 ? 11.658  10.311  -57.311  1.00 15.44  ? 948  ILE C N   1 
ATOM   3841 C  CA  . ILE C 1 126 ? 11.689  10.857  -55.955  1.00 15.09  ? 948  ILE C CA  1 
ATOM   3842 C  C   . ILE C 1 126 ? 11.659  12.382  -56.058  1.00 15.08  ? 948  ILE C C   1 
ATOM   3843 O  O   . ILE C 1 126 ? 10.962  13.052  -55.302  1.00 15.28  ? 948  ILE C O   1 
ATOM   3844 C  CB  . ILE C 1 126 ? 12.973  10.420  -55.196  1.00 13.66  ? 948  ILE C CB  1 
ATOM   3845 C  CG1 . ILE C 1 126 ? 12.973  8.896   -55.000  1.00 15.01  ? 948  ILE C CG1 1 
ATOM   3846 C  CG2 . ILE C 1 126 ? 13.050  11.131  -53.836  1.00 14.37  ? 948  ILE C CG2 1 
ATOM   3847 C  CD1 . ILE C 1 126 ? 14.253  8.366   -54.366  1.00 14.54  ? 948  ILE C CD1 1 
ATOM   3848 N  N   . LYS C 1 127 ? 12.418  12.922  -57.003  1.00 16.11  ? 949  LYS C N   1 
ATOM   3849 C  CA  . LYS C 1 127 ? 12.481  14.372  -57.206  1.00 18.57  ? 949  LYS C CA  1 
ATOM   3850 C  C   . LYS C 1 127 ? 11.076  14.943  -57.464  1.00 19.65  ? 949  LYS C C   1 
ATOM   3851 O  O   . LYS C 1 127 ? 10.666  15.929  -56.850  1.00 18.73  ? 949  LYS C O   1 
ATOM   3852 C  CB  . LYS C 1 127 ? 13.408  14.691  -58.386  1.00 19.77  ? 949  LYS C CB  1 
ATOM   3853 C  CG  . LYS C 1 127 ? 13.606  16.177  -58.658  1.00 20.74  ? 949  LYS C CG  1 
ATOM   3854 C  CD  . LYS C 1 127 ? 14.602  16.407  -59.784  1.00 25.45  ? 949  LYS C CD  1 
ATOM   3855 C  CE  . LYS C 1 127 ? 14.789  17.890  -60.061  1.00 22.74  ? 949  LYS C CE  1 
ATOM   3856 N  NZ  . LYS C 1 127 ? 15.769  18.136  -61.152  1.00 21.12  ? 949  LYS C NZ  1 
ATOM   3857 N  N   . LYS C 1 128 ? 10.346  14.314  -58.377  1.00 22.63  ? 950  LYS C N   1 
ATOM   3858 C  CA  . LYS C 1 128 ? 8.995   14.748  -58.714  1.00 25.17  ? 950  LYS C CA  1 
ATOM   3859 C  C   . LYS C 1 128 ? 8.040   14.639  -57.522  1.00 24.64  ? 950  LYS C C   1 
ATOM   3860 O  O   . LYS C 1 128 ? 7.306   15.581  -57.213  1.00 22.65  ? 950  LYS C O   1 
ATOM   3861 C  CB  . LYS C 1 128 ? 8.474   13.911  -59.882  1.00 36.43  ? 950  LYS C CB  1 
ATOM   3862 C  CG  . LYS C 1 128 ? 7.037   14.190  -60.275  1.00 42.99  ? 950  LYS C CG  1 
ATOM   3863 C  CD  . LYS C 1 128 ? 6.609   13.273  -61.410  1.00 48.53  ? 950  LYS C CD  1 
ATOM   3864 C  CE  . LYS C 1 128 ? 5.237   12.675  -61.143  1.00 56.22  ? 950  LYS C CE  1 
ATOM   3865 N  NZ  . LYS C 1 128 ? 5.232   11.854  -59.896  1.00 54.43  ? 950  LYS C NZ  1 
ATOM   3866 N  N   . ARG C 1 129 ? 8.047   13.492  -56.850  1.00 17.07  ? 951  ARG C N   1 
ATOM   3867 C  CA  . ARG C 1 129 ? 7.167   13.295  -55.707  1.00 18.64  ? 951  ARG C CA  1 
ATOM   3868 C  C   . ARG C 1 129 ? 7.430   14.314  -54.627  1.00 18.55  ? 951  ARG C C   1 
ATOM   3869 O  O   . ARG C 1 129 ? 6.509   14.768  -53.955  1.00 19.74  ? 951  ARG C O   1 
ATOM   3870 C  CB  . ARG C 1 129 ? 7.344   11.897  -55.123  1.00 23.76  ? 951  ARG C CB  1 
ATOM   3871 C  CG  . ARG C 1 129 ? 6.785   10.809  -56.002  1.00 27.66  ? 951  ARG C CG  1 
ATOM   3872 C  CD  . ARG C 1 129 ? 6.947   9.468   -55.340  1.00 30.31  ? 951  ARG C CD  1 
ATOM   3873 N  NE  . ARG C 1 129 ? 6.334   8.414   -56.132  1.00 31.63  ? 951  ARG C NE  1 
ATOM   3874 C  CZ  . ARG C 1 129 ? 6.247   7.152   -55.739  1.00 33.93  ? 951  ARG C CZ  1 
ATOM   3875 N  NH1 . ARG C 1 129 ? 6.740   6.793   -54.561  1.00 28.97  ? 951  ARG C NH1 1 
ATOM   3876 N  NH2 . ARG C 1 129 ? 5.661   6.257   -56.519  1.00 32.33  ? 951  ARG C NH2 1 
ATOM   3877 N  N   . LEU C 1 130 ? 8.694   14.679  -54.463  1.00 22.58  ? 952  LEU C N   1 
ATOM   3878 C  CA  . LEU C 1 130 ? 9.067   15.639  -53.439  1.00 21.77  ? 952  LEU C CA  1 
ATOM   3879 C  C   . LEU C 1 130 ? 8.506   17.026  -53.726  1.00 23.51  ? 952  LEU C C   1 
ATOM   3880 O  O   . LEU C 1 130 ? 8.023   17.695  -52.818  1.00 22.22  ? 952  LEU C O   1 
ATOM   3881 C  CB  . LEU C 1 130 ? 10.591  15.722  -53.323  1.00 19.36  ? 952  LEU C CB  1 
ATOM   3882 C  CG  . LEU C 1 130 ? 11.165  16.618  -52.224  1.00 22.71  ? 952  LEU C CG  1 
ATOM   3883 C  CD1 . LEU C 1 130 ? 10.658  16.136  -50.876  1.00 16.82  ? 952  LEU C CD1 1 
ATOM   3884 C  CD2 . LEU C 1 130 ? 12.693  16.589  -52.255  1.00 16.53  ? 952  LEU C CD2 1 
ATOM   3885 N  N   . GLN C 1 131 ? 8.556   17.448  -54.984  1.00 33.55  ? 953  GLN C N   1 
ATOM   3886 C  CA  . GLN C 1 131 ? 8.087   18.778  -55.353  1.00 33.55  ? 953  GLN C CA  1 
ATOM   3887 C  C   . GLN C 1 131 ? 6.579   18.926  -55.560  1.00 33.55  ? 953  GLN C C   1 
ATOM   3888 O  O   . GLN C 1 131 ? 6.074   20.042  -55.693  1.00 33.55  ? 953  GLN C O   1 
ATOM   3889 C  CB  . GLN C 1 131 ? 8.829   19.253  -56.603  1.00 43.88  ? 953  GLN C CB  1 
ATOM   3890 C  CG  . GLN C 1 131 ? 8.649   20.733  -56.916  1.00 43.88  ? 953  GLN C CG  1 
ATOM   3891 C  CD  . GLN C 1 131 ? 8.931   21.636  -55.716  1.00 43.88  ? 953  GLN C CD  1 
ATOM   3892 O  OE1 . GLN C 1 131 ? 8.007   22.147  -55.075  1.00 43.88  ? 953  GLN C OE1 1 
ATOM   3893 N  NE2 . GLN C 1 131 ? 10.206  21.830  -55.406  1.00 43.88  ? 953  GLN C NE2 1 
ATOM   3894 N  N   . GLU C 1 132 ? 5.854   17.815  -55.583  1.00 50.55  ? 954  GLU C N   1 
ATOM   3895 C  CA  . GLU C 1 132 ? 4.411   17.882  -55.771  1.00 50.55  ? 954  GLU C CA  1 
ATOM   3896 C  C   . GLU C 1 132 ? 3.707   18.379  -54.519  1.00 50.55  ? 954  GLU C C   1 
ATOM   3897 O  O   . GLU C 1 132 ? 3.920   17.841  -53.432  1.00 50.55  ? 954  GLU C O   1 
ATOM   3898 C  CB  . GLU C 1 132 ? 3.849   16.506  -56.120  1.00 62.20  ? 954  GLU C CB  1 
ATOM   3899 C  CG  . GLU C 1 132 ? 4.245   15.986  -57.480  1.00 62.20  ? 954  GLU C CG  1 
ATOM   3900 C  CD  . GLU C 1 132 ? 3.690   14.603  -57.740  1.00 62.20  ? 954  GLU C CD  1 
ATOM   3901 O  OE1 . GLU C 1 132 ? 3.870   14.094  -58.864  1.00 62.20  ? 954  GLU C OE1 1 
ATOM   3902 O  OE2 . GLU C 1 132 ? 3.078   14.023  -56.817  1.00 62.20  ? 954  GLU C OE2 1 
ATOM   3903 N  N   . ASP C 1 133 ? 2.877   19.408  -54.653  1.00 99.25  ? 955  ASP C N   1 
ATOM   3904 C  CA  . ASP C 1 133 ? 2.142   19.875  -53.489  1.00 99.25  ? 955  ASP C CA  1 
ATOM   3905 C  C   . ASP C 1 133 ? 1.181   18.732  -53.188  1.00 99.25  ? 955  ASP C C   1 
ATOM   3906 O  O   . ASP C 1 133 ? 0.786   17.996  -54.097  1.00 99.25  ? 955  ASP C O   1 
ATOM   3907 C  CB  . ASP C 1 133 ? 1.380   21.172  -53.780  1.00 97.99  ? 955  ASP C CB  1 
ATOM   3908 C  CG  . ASP C 1 133 ? 0.668   21.147  -55.110  1.00 97.99  ? 955  ASP C CG  1 
ATOM   3909 O  OD1 . ASP C 1 133 ? 0.148   20.079  -55.493  1.00 97.99  ? 955  ASP C OD1 1 
ATOM   3910 O  OD2 . ASP C 1 133 ? 0.618   22.206  -55.769  1.00 97.99  ? 955  ASP C OD2 1 
ATOM   3911 N  N   . TYR C 1 134 ? 0.808   18.582  -51.921  1.00 65.68  ? 956  TYR C N   1 
ATOM   3912 C  CA  . TYR C 1 134 ? -0.068  17.489  -51.510  1.00 65.68  ? 956  TYR C CA  1 
ATOM   3913 C  C   . TYR C 1 134 ? 0.722   16.222  -51.826  1.00 65.68  ? 956  TYR C C   1 
ATOM   3914 O  O   . TYR C 1 134 ? 0.186   15.211  -52.284  1.00 65.68  ? 956  TYR C O   1 
ATOM   3915 C  CB  . TYR C 1 134 ? -1.392  17.528  -52.283  1.00 74.61  ? 956  TYR C CB  1 
ATOM   3916 C  CG  . TYR C 1 134 ? -2.115  18.861  -52.198  1.00 74.61  ? 956  TYR C CG  1 
ATOM   3917 C  CD1 . TYR C 1 134 ? -2.330  19.490  -50.969  1.00 74.61  ? 956  TYR C CD1 1 
ATOM   3918 C  CD2 . TYR C 1 134 ? -2.586  19.491  -53.350  1.00 74.61  ? 956  TYR C CD2 1 
ATOM   3919 C  CE1 . TYR C 1 134 ? -2.997  20.716  -50.892  1.00 74.61  ? 956  TYR C CE1 1 
ATOM   3920 C  CE2 . TYR C 1 134 ? -3.253  20.713  -53.285  1.00 74.61  ? 956  TYR C CE2 1 
ATOM   3921 C  CZ  . TYR C 1 134 ? -3.456  21.319  -52.055  1.00 74.61  ? 956  TYR C CZ  1 
ATOM   3922 O  OH  . TYR C 1 134 ? -4.121  22.523  -51.998  1.00 74.61  ? 956  TYR C OH  1 
ATOM   3923 N  N   . SER C 1 135 ? 2.022   16.324  -51.566  1.00 45.83  ? 957  SER C N   1 
ATOM   3924 C  CA  . SER C 1 135 ? 2.995   15.268  -51.794  1.00 45.83  ? 957  SER C CA  1 
ATOM   3925 C  C   . SER C 1 135 ? 2.691   13.944  -51.110  1.00 45.83  ? 957  SER C C   1 
ATOM   3926 O  O   . SER C 1 135 ? 1.871   13.856  -50.196  1.00 45.83  ? 957  SER C O   1 
ATOM   3927 C  CB  . SER C 1 135 ? 4.383   15.746  -51.355  1.00 37.89  ? 957  SER C CB  1 
ATOM   3928 O  OG  . SER C 1 135 ? 5.315   14.677  -51.332  1.00 37.89  ? 957  SER C OG  1 
ATOM   3929 N  N   . MET C 1 136 ? 3.403   12.924  -51.573  1.00 47.84  ? 958  MET C N   1 
ATOM   3930 C  CA  . MET C 1 136 ? 3.302   11.553  -51.099  1.00 47.11  ? 958  MET C CA  1 
ATOM   3931 C  C   . MET C 1 136 ? 4.123   11.358  -49.826  1.00 43.70  ? 958  MET C C   1 
ATOM   3932 O  O   . MET C 1 136 ? 3.872   10.445  -49.036  1.00 43.78  ? 958  MET C O   1 
ATOM   3933 C  CB  . MET C 1 136 ? 3.826   10.630  -52.196  1.00 59.96  ? 958  MET C CB  1 
ATOM   3934 C  CG  . MET C 1 136 ? 3.632   9.157   -51.951  1.00 64.05  ? 958  MET C CG  1 
ATOM   3935 S  SD  . MET C 1 136 ? 4.081   8.222   -53.423  1.00 72.46  ? 958  MET C SD  1 
ATOM   3936 C  CE  . MET C 1 136 ? 2.958   8.949   -54.648  1.00 71.49  ? 958  MET C CE  1 
ATOM   3937 N  N   . TYR C 1 137 ? 5.114   12.218  -49.638  1.00 29.50  ? 959  TYR C N   1 
ATOM   3938 C  CA  . TYR C 1 137 ? 5.966   12.128  -48.467  1.00 24.97  ? 959  TYR C CA  1 
ATOM   3939 C  C   . TYR C 1 137 ? 5.411   12.966  -47.316  1.00 23.83  ? 959  TYR C C   1 
ATOM   3940 O  O   . TYR C 1 137 ? 5.222   14.168  -47.450  1.00 22.79  ? 959  TYR C O   1 
ATOM   3941 C  CB  . TYR C 1 137 ? 7.384   12.596  -48.820  1.00 22.63  ? 959  TYR C CB  1 
ATOM   3942 C  CG  . TYR C 1 137 ? 8.005   11.876  -50.008  1.00 19.00  ? 959  TYR C CG  1 
ATOM   3943 C  CD1 . TYR C 1 137 ? 7.830   10.507  -50.188  1.00 17.24  ? 959  TYR C CD1 1 
ATOM   3944 C  CD2 . TYR C 1 137 ? 8.813   12.557  -50.915  1.00 18.88  ? 959  TYR C CD2 1 
ATOM   3945 C  CE1 . TYR C 1 137 ? 8.446   9.824   -51.242  1.00 21.74  ? 959  TYR C CE1 1 
ATOM   3946 C  CE2 . TYR C 1 137 ? 9.437   11.885  -51.977  1.00 17.89  ? 959  TYR C CE2 1 
ATOM   3947 C  CZ  . TYR C 1 137 ? 9.248   10.518  -52.132  1.00 19.50  ? 959  TYR C CZ  1 
ATOM   3948 O  OH  . TYR C 1 137 ? 9.861   9.849   -53.173  1.00 22.37  ? 959  TYR C OH  1 
ATOM   3949 N  N   . SER C 1 138 ? 5.151   12.328  -46.183  1.00 23.38  ? 960  SER C N   1 
ATOM   3950 C  CA  . SER C 1 138 ? 4.630   13.039  -45.014  1.00 23.15  ? 960  SER C CA  1 
ATOM   3951 C  C   . SER C 1 138 ? 5.668   13.077  -43.892  1.00 22.90  ? 960  SER C C   1 
ATOM   3952 O  O   . SER C 1 138 ? 5.555   13.867  -42.946  1.00 23.72  ? 960  SER C O   1 
ATOM   3953 C  CB  . SER C 1 138 ? 3.349   12.365  -44.519  1.00 28.58  ? 960  SER C CB  1 
ATOM   3954 O  OG  . SER C 1 138 ? 3.585   11.000  -44.233  1.00 33.62  ? 960  SER C OG  1 
ATOM   3955 N  N   . LYS C 1 139 ? 6.671   12.209  -43.996  1.00 22.27  ? 961  LYS C N   1 
ATOM   3956 C  CA  . LYS C 1 139 ? 7.746   12.144  -43.015  1.00 22.69  ? 961  LYS C CA  1 
ATOM   3957 C  C   . LYS C 1 139 ? 9.017   11.639  -43.707  1.00 22.60  ? 961  LYS C C   1 
ATOM   3958 O  O   . LYS C 1 139 ? 8.951   10.968  -44.739  1.00 20.16  ? 961  LYS C O   1 
ATOM   3959 C  CB  . LYS C 1 139 ? 7.355   11.229  -41.851  1.00 29.38  ? 961  LYS C CB  1 
ATOM   3960 C  CG  . LYS C 1 139 ? 7.014   9.812   -42.249  1.00 32.95  ? 961  LYS C CG  1 
ATOM   3961 C  CD  . LYS C 1 139 ? 6.526   9.022   -41.040  1.00 33.44  ? 961  LYS C CD  1 
ATOM   3962 C  CE  . LYS C 1 139 ? 6.294   7.561   -41.389  1.00 36.68  ? 961  LYS C CE  1 
ATOM   3963 N  NZ  . LYS C 1 139 ? 5.369   7.389   -42.547  1.00 35.87  ? 961  LYS C NZ  1 
ATOM   3964 N  N   . PRO C 1 140 ? 10.192  11.946  -43.139  1.00 20.77  ? 962  PRO C N   1 
ATOM   3965 C  CA  . PRO C 1 140 ? 11.467  11.524  -43.727  1.00 21.90  ? 962  PRO C CA  1 
ATOM   3966 C  C   . PRO C 1 140 ? 11.562  10.048  -44.098  1.00 20.60  ? 962  PRO C C   1 
ATOM   3967 O  O   . PRO C 1 140 ? 12.132  9.707   -45.131  1.00 18.40  ? 962  PRO C O   1 
ATOM   3968 C  CB  . PRO C 1 140 ? 12.484  11.922  -42.662  1.00 24.19  ? 962  PRO C CB  1 
ATOM   3969 C  CG  . PRO C 1 140 ? 11.855  13.129  -42.038  1.00 26.56  ? 962  PRO C CG  1 
ATOM   3970 C  CD  . PRO C 1 140 ? 10.417  12.689  -41.886  1.00 24.86  ? 962  PRO C CD  1 
ATOM   3971 N  N   . GLU C 1 141 ? 11.017  9.173   -43.256  1.00 21.90  ? 963  GLU C N   1 
ATOM   3972 C  CA  . GLU C 1 141 ? 11.065  7.738   -43.521  1.00 21.54  ? 963  GLU C CA  1 
ATOM   3973 C  C   . GLU C 1 141 ? 10.438  7.379   -44.869  1.00 22.19  ? 963  GLU C C   1 
ATOM   3974 O  O   . GLU C 1 141 ? 10.805  6.371   -45.492  1.00 18.83  ? 963  GLU C O   1 
ATOM   3975 C  CB  . GLU C 1 141 ? 10.349  6.958   -42.408  1.00 27.90  ? 963  GLU C CB  1 
ATOM   3976 C  CG  . GLU C 1 141 ? 11.138  6.803   -41.112  1.00 27.86  ? 963  GLU C CG  1 
ATOM   3977 C  CD  . GLU C 1 141 ? 11.102  8.033   -40.213  1.00 33.91  ? 963  GLU C CD  1 
ATOM   3978 O  OE1 . GLU C 1 141 ? 10.440  9.043   -40.562  1.00 27.26  ? 963  GLU C OE1 1 
ATOM   3979 O  OE2 . GLU C 1 141 ? 11.743  7.984   -39.140  1.00 35.61  ? 963  GLU C OE2 1 
ATOM   3980 N  N   . ASP C 1 142 ? 9.485   8.200   -45.306  1.00 18.91  ? 964  ASP C N   1 
ATOM   3981 C  CA  . ASP C 1 142 ? 8.807   7.979   -46.577  1.00 18.43  ? 964  ASP C CA  1 
ATOM   3982 C  C   . ASP C 1 142 ? 9.750   8.135   -47.755  1.00 17.07  ? 964  ASP C C   1 
ATOM   3983 O  O   . ASP C 1 142 ? 9.771   7.285   -48.646  1.00 17.01  ? 964  ASP C O   1 
ATOM   3984 C  CB  . ASP C 1 142 ? 7.633   8.949   -46.750  1.00 26.09  ? 964  ASP C CB  1 
ATOM   3985 C  CG  . ASP C 1 142 ? 6.508   8.695   -45.762  1.00 28.97  ? 964  ASP C CG  1 
ATOM   3986 O  OD1 . ASP C 1 142 ? 6.494   7.614   -45.136  1.00 28.45  ? 964  ASP C OD1 1 
ATOM   3987 O  OD2 . ASP C 1 142 ? 5.631   9.576   -45.621  1.00 30.43  ? 964  ASP C OD2 1 
ATOM   3988 N  N   . PHE C 1 143 ? 10.528  9.217   -47.793  1.00 16.74  ? 965  PHE C N   1 
ATOM   3989 C  CA  . PHE C 1 143 ? 11.431  9.346   -48.927  1.00 15.79  ? 965  PHE C CA  1 
ATOM   3990 C  C   . PHE C 1 143 ? 12.657  8.455   -48.790  1.00 16.01  ? 965  PHE C C   1 
ATOM   3991 O  O   . PHE C 1 143 ? 13.215  8.014   -49.790  1.00 14.05  ? 965  PHE C O   1 
ATOM   3992 C  CB  . PHE C 1 143 ? 11.814  10.820  -49.215  1.00 17.11  ? 965  PHE C CB  1 
ATOM   3993 C  CG  . PHE C 1 143 ? 12.484  11.551  -48.075  1.00 19.35  ? 965  PHE C CG  1 
ATOM   3994 C  CD1 . PHE C 1 143 ? 13.791  11.255  -47.702  1.00 20.29  ? 965  PHE C CD1 1 
ATOM   3995 C  CD2 . PHE C 1 143 ? 11.829  12.599  -47.430  1.00 19.17  ? 965  PHE C CD2 1 
ATOM   3996 C  CE1 . PHE C 1 143 ? 14.438  11.998  -46.703  1.00 25.12  ? 965  PHE C CE1 1 
ATOM   3997 C  CE2 . PHE C 1 143 ? 12.473  13.347  -46.429  1.00 18.52  ? 965  PHE C CE2 1 
ATOM   3998 C  CZ  . PHE C 1 143 ? 13.775  13.045  -46.070  1.00 23.27  ? 965  PHE C CZ  1 
ATOM   3999 N  N   . VAL C 1 144 ? 13.063  8.167   -47.558  1.00 19.06  ? 966  VAL C N   1 
ATOM   4000 C  CA  . VAL C 1 144 ? 14.216  7.295   -47.361  1.00 20.46  ? 966  VAL C CA  1 
ATOM   4001 C  C   . VAL C 1 144 ? 13.896  5.917   -47.938  1.00 19.61  ? 966  VAL C C   1 
ATOM   4002 O  O   . VAL C 1 144 ? 14.739  5.296   -48.576  1.00 18.53  ? 966  VAL C O   1 
ATOM   4003 C  CB  . VAL C 1 144 ? 14.586  7.168   -45.862  1.00 20.54  ? 966  VAL C CB  1 
ATOM   4004 C  CG1 . VAL C 1 144 ? 15.624  6.060   -45.668  1.00 22.78  ? 966  VAL C CG1 1 
ATOM   4005 C  CG2 . VAL C 1 144 ? 15.140  8.491   -45.360  1.00 17.29  ? 966  VAL C CG2 1 
ATOM   4006 N  N   . ALA C 1 145 ? 12.668  5.452   -47.726  1.00 18.26  ? 967  ALA C N   1 
ATOM   4007 C  CA  . ALA C 1 145 ? 12.248  4.161   -48.251  1.00 19.70  ? 967  ALA C CA  1 
ATOM   4008 C  C   . ALA C 1 145 ? 12.342  4.140   -49.775  1.00 20.12  ? 967  ALA C C   1 
ATOM   4009 O  O   . ALA C 1 145 ? 12.682  3.116   -50.364  1.00 19.21  ? 967  ALA C O   1 
ATOM   4010 C  CB  . ALA C 1 145 ? 10.820  3.855   -47.812  1.00 31.53  ? 967  ALA C CB  1 
ATOM   4011 N  N   . ASP C 1 146 ? 12.047  5.270   -50.422  1.00 18.63  ? 968  ASP C N   1 
ATOM   4012 C  CA  . ASP C 1 146 ? 12.118  5.319   -51.879  1.00 18.03  ? 968  ASP C CA  1 
ATOM   4013 C  C   . ASP C 1 146 ? 13.564  5.250   -52.358  1.00 18.58  ? 968  ASP C C   1 
ATOM   4014 O  O   . ASP C 1 146 ? 13.865  4.579   -53.353  1.00 16.90  ? 968  ASP C O   1 
ATOM   4015 C  CB  . ASP C 1 146 ? 11.409  6.572   -52.424  1.00 22.60  ? 968  ASP C CB  1 
ATOM   4016 C  CG  . ASP C 1 146 ? 9.907   6.358   -52.604  1.00 22.59  ? 968  ASP C CG  1 
ATOM   4017 O  OD1 . ASP C 1 146 ? 9.431   5.246   -52.284  1.00 25.41  ? 968  ASP C OD1 1 
ATOM   4018 O  OD2 . ASP C 1 146 ? 9.203   7.287   -53.064  1.00 25.86  ? 968  ASP C OD2 1 
ATOM   4019 N  N   . PHE C 1 147 ? 14.460  5.935   -51.653  1.00 17.97  ? 969  PHE C N   1 
ATOM   4020 C  CA  . PHE C 1 147 ? 15.879  5.902   -52.003  1.00 18.42  ? 969  PHE C CA  1 
ATOM   4021 C  C   . PHE C 1 147 ? 16.390  4.467   -51.898  1.00 19.90  ? 969  PHE C C   1 
ATOM   4022 O  O   . PHE C 1 147 ? 17.061  3.949   -52.800  1.00 18.93  ? 969  PHE C O   1 
ATOM   4023 C  CB  . PHE C 1 147 ? 16.693  6.769   -51.038  1.00 18.37  ? 969  PHE C CB  1 
ATOM   4024 C  CG  . PHE C 1 147 ? 16.758  8.221   -51.417  1.00 17.73  ? 969  PHE C CG  1 
ATOM   4025 C  CD1 . PHE C 1 147 ? 17.569  8.646   -52.465  1.00 17.17  ? 969  PHE C CD1 1 
ATOM   4026 C  CD2 . PHE C 1 147 ? 16.039  9.166   -50.700  1.00 16.48  ? 969  PHE C CD2 1 
ATOM   4027 C  CE1 . PHE C 1 147 ? 17.663  10.008  -52.784  1.00 20.01  ? 969  PHE C CE1 1 
ATOM   4028 C  CE2 . PHE C 1 147 ? 16.123  10.520  -51.008  1.00 22.52  ? 969  PHE C CE2 1 
ATOM   4029 C  CZ  . PHE C 1 147 ? 16.935  10.944  -52.048  1.00 19.54  ? 969  PHE C CZ  1 
ATOM   4030 N  N   . ARG C 1 148 ? 16.072  3.822   -50.782  1.00 18.67  ? 970  ARG C N   1 
ATOM   4031 C  CA  . ARG C 1 148 ? 16.537  2.464   -50.573  1.00 20.08  ? 970  ARG C CA  1 
ATOM   4032 C  C   . ARG C 1 148 ? 15.933  1.462   -51.553  1.00 20.58  ? 970  ARG C C   1 
ATOM   4033 O  O   . ARG C 1 148 ? 16.541  0.433   -51.845  1.00 18.37  ? 970  ARG C O   1 
ATOM   4034 C  CB  . ARG C 1 148 ? 16.331  2.073   -49.104  1.00 20.61  ? 970  ARG C CB  1 
ATOM   4035 C  CG  . ARG C 1 148 ? 17.172  2.986   -48.194  1.00 20.97  ? 970  ARG C CG  1 
ATOM   4036 C  CD  . ARG C 1 148 ? 17.719  2.323   -46.940  1.00 31.09  ? 970  ARG C CD  1 
ATOM   4037 N  NE  . ARG C 1 148 ? 16.858  2.524   -45.789  1.00 33.37  ? 970  ARG C NE  1 
ATOM   4038 C  CZ  . ARG C 1 148 ? 17.229  3.126   -44.662  1.00 40.55  ? 970  ARG C CZ  1 
ATOM   4039 N  NH1 . ARG C 1 148 ? 18.459  3.598   -44.516  1.00 48.54  ? 970  ARG C NH1 1 
ATOM   4040 N  NH2 . ARG C 1 148 ? 16.358  3.256   -43.676  1.00 37.04  ? 970  ARG C NH2 1 
ATOM   4041 N  N   . LEU C 1 149 ? 14.760  1.787   -52.096  1.00 19.63  ? 971  LEU C N   1 
ATOM   4042 C  CA  . LEU C 1 149 ? 14.107  0.927   -53.075  1.00 19.61  ? 971  LEU C CA  1 
ATOM   4043 C  C   . LEU C 1 149 ? 14.943  0.907   -54.363  1.00 18.89  ? 971  LEU C C   1 
ATOM   4044 O  O   . LEU C 1 149 ? 15.023  -0.115  -55.049  1.00 17.76  ? 971  LEU C O   1 
ATOM   4045 C  CB  . LEU C 1 149 ? 12.690  1.440   -53.364  1.00 22.17  ? 971  LEU C CB  1 
ATOM   4046 C  CG  . LEU C 1 149 ? 11.837  0.598   -54.313  1.00 27.68  ? 971  LEU C CG  1 
ATOM   4047 C  CD1 . LEU C 1 149 ? 11.765  -0.844  -53.808  1.00 28.30  ? 971  LEU C CD1 1 
ATOM   4048 C  CD2 . LEU C 1 149 ? 10.442  1.206   -54.418  1.00 28.65  ? 971  LEU C CD2 1 
ATOM   4049 N  N   . ILE C 1 150 ? 15.558  2.042   -54.694  1.00 17.41  ? 972  ILE C N   1 
ATOM   4050 C  CA  . ILE C 1 150 ? 16.413  2.126   -55.874  1.00 18.02  ? 972  ILE C CA  1 
ATOM   4051 C  C   . ILE C 1 150 ? 17.557  1.100   -55.768  1.00 17.48  ? 972  ILE C C   1 
ATOM   4052 O  O   . ILE C 1 150 ? 17.838  0.353   -56.707  1.00 16.15  ? 972  ILE C O   1 
ATOM   4053 C  CB  . ILE C 1 150 ? 17.050  3.539   -56.023  1.00 22.02  ? 972  ILE C CB  1 
ATOM   4054 C  CG1 . ILE C 1 150 ? 15.972  4.589   -56.317  1.00 18.42  ? 972  ILE C CG1 1 
ATOM   4055 C  CG2 . ILE C 1 150 ? 18.090  3.529   -57.144  1.00 27.13  ? 972  ILE C CG2 1 
ATOM   4056 C  CD1 . ILE C 1 150 ? 16.505  6.002   -56.332  1.00 22.99  ? 972  ILE C CD1 1 
ATOM   4057 N  N   . PHE C 1 151 ? 18.225  1.079   -54.623  1.00 17.79  ? 973  PHE C N   1 
ATOM   4058 C  CA  . PHE C 1 151 ? 19.338  0.163   -54.417  1.00 19.13  ? 973  PHE C CA  1 
ATOM   4059 C  C   . PHE C 1 151 ? 18.894  -1.288  -54.313  1.00 19.99  ? 973  PHE C C   1 
ATOM   4060 O  O   . PHE C 1 151 ? 19.600  -2.192  -54.768  1.00 20.26  ? 973  PHE C O   1 
ATOM   4061 C  CB  . PHE C 1 151 ? 20.105  0.578   -53.164  1.00 21.87  ? 973  PHE C CB  1 
ATOM   4062 C  CG  . PHE C 1 151 ? 20.469  2.033   -53.158  1.00 24.43  ? 973  PHE C CG  1 
ATOM   4063 C  CD1 . PHE C 1 151 ? 21.121  2.593   -54.255  1.00 22.42  ? 973  PHE C CD1 1 
ATOM   4064 C  CD2 . PHE C 1 151 ? 20.101  2.860   -52.100  1.00 28.36  ? 973  PHE C CD2 1 
ATOM   4065 C  CE1 . PHE C 1 151 ? 21.395  3.966   -54.306  1.00 26.46  ? 973  PHE C CE1 1 
ATOM   4066 C  CE2 . PHE C 1 151 ? 20.370  4.233   -52.140  1.00 24.91  ? 973  PHE C CE2 1 
ATOM   4067 C  CZ  . PHE C 1 151 ? 21.018  4.785   -53.250  1.00 25.32  ? 973  PHE C CZ  1 
ATOM   4068 N  N   . GLN C 1 152 ? 17.732  -1.506  -53.709  1.00 25.33  ? 974  GLN C N   1 
ATOM   4069 C  CA  . GLN C 1 152 ? 17.213  -2.855  -53.557  1.00 27.43  ? 974  GLN C CA  1 
ATOM   4070 C  C   . GLN C 1 152 ? 16.834  -3.416  -54.930  1.00 26.05  ? 974  GLN C C   1 
ATOM   4071 O  O   . GLN C 1 152 ? 17.069  -4.588  -55.206  1.00 27.15  ? 974  GLN C O   1 
ATOM   4072 C  CB  . GLN C 1 152 ? 16.019  -2.846  -52.588  1.00 28.00  ? 974  GLN C CB  1 
ATOM   4073 C  CG  . GLN C 1 152 ? 16.361  -2.240  -51.218  1.00 34.87  ? 974  GLN C CG  1 
ATOM   4074 C  CD  . GLN C 1 152 ? 15.149  -2.031  -50.308  1.00 44.64  ? 974  GLN C CD  1 
ATOM   4075 O  OE1 . GLN C 1 152 ? 14.098  -1.551  -50.741  1.00 40.05  ? 974  GLN C OE1 1 
ATOM   4076 N  NE2 . GLN C 1 152 ? 15.304  -2.374  -49.032  1.00 47.28  ? 974  GLN C NE2 1 
ATOM   4077 N  N   . ASN C 1 153 ? 16.270  -2.581  -55.801  1.00 21.83  ? 975  ASN C N   1 
ATOM   4078 C  CA  . ASN C 1 153 ? 15.910  -3.044  -57.136  1.00 21.14  ? 975  ASN C CA  1 
ATOM   4079 C  C   . ASN C 1 153 ? 17.177  -3.388  -57.924  1.00 22.41  ? 975  ASN C C   1 
ATOM   4080 O  O   . ASN C 1 153 ? 17.225  -4.405  -58.619  1.00 17.81  ? 975  ASN C O   1 
ATOM   4081 C  CB  . ASN C 1 153 ? 15.087  -1.991  -57.895  1.00 20.53  ? 975  ASN C CB  1 
ATOM   4082 C  CG  . ASN C 1 153 ? 13.659  -1.869  -57.367  1.00 21.71  ? 975  ASN C CG  1 
ATOM   4083 O  OD1 . ASN C 1 153 ? 13.117  -2.815  -56.791  1.00 20.58  ? 975  ASN C OD1 1 
ATOM   4084 N  ND2 . ASN C 1 153 ? 13.041  -0.707  -57.578  1.00 22.68  ? 975  ASN C ND2 1 
ATOM   4085 N  N   . CYS C 1 154 ? 18.200  -2.544  -57.807  1.00 17.55  ? 976  CYS C N   1 
ATOM   4086 C  CA  . CYS C 1 154 ? 19.467  -2.777  -58.495  1.00 20.07  ? 976  CYS C CA  1 
ATOM   4087 C  C   . CYS C 1 154 ? 20.028  -4.143  -58.076  1.00 20.46  ? 976  CYS C C   1 
ATOM   4088 O  O   . CYS C 1 154 ? 20.393  -4.968  -58.916  1.00 20.94  ? 976  CYS C O   1 
ATOM   4089 C  CB  . CYS C 1 154 ? 20.468  -1.667  -58.129  1.00 20.25  ? 976  CYS C CB  1 
ATOM   4090 S  SG  . CYS C 1 154 ? 22.130  -1.786  -58.872  1.00 23.81  ? 976  CYS C SG  1 
ATOM   4091 N  N   . ALA C 1 155 ? 20.085  -4.370  -56.768  1.00 24.44  ? 977  ALA C N   1 
ATOM   4092 C  CA  . ALA C 1 155 ? 20.606  -5.620  -56.219  1.00 27.77  ? 977  ALA C CA  1 
ATOM   4093 C  C   . ALA C 1 155 ? 19.816  -6.859  -56.642  1.00 27.61  ? 977  ALA C C   1 
ATOM   4094 O  O   . ALA C 1 155 ? 20.401  -7.901  -56.922  1.00 29.02  ? 977  ALA C O   1 
ATOM   4095 C  CB  . ALA C 1 155 ? 20.650  -5.530  -54.706  1.00 26.73  ? 977  ALA C CB  1 
ATOM   4096 N  N   . GLU C 1 156 ? 18.492  -6.751  -56.691  1.00 32.43  ? 978  GLU C N   1 
ATOM   4097 C  CA  . GLU C 1 156 ? 17.658  -7.887  -57.080  1.00 35.08  ? 978  GLU C CA  1 
ATOM   4098 C  C   . GLU C 1 156 ? 17.805  -8.280  -58.544  1.00 35.18  ? 978  GLU C C   1 
ATOM   4099 O  O   . GLU C 1 156 ? 17.954  -9.459  -58.876  1.00 34.29  ? 978  GLU C O   1 
ATOM   4100 C  CB  . GLU C 1 156 ? 16.177  -7.595  -56.845  1.00 57.49  ? 978  GLU C CB  1 
ATOM   4101 C  CG  . GLU C 1 156 ? 15.794  -7.233  -55.441  1.00 65.18  ? 978  GLU C CG  1 
ATOM   4102 C  CD  . GLU C 1 156 ? 14.293  -7.267  -55.256  1.00 68.95  ? 978  GLU C CD  1 
ATOM   4103 O  OE1 . GLU C 1 156 ? 13.745  -8.379  -55.095  1.00 70.99  ? 978  GLU C OE1 1 
ATOM   4104 O  OE2 . GLU C 1 156 ? 13.663  -6.186  -55.291  1.00 69.88  ? 978  GLU C OE2 1 
ATOM   4105 N  N   . PHE C 1 157 ? 17.750  -7.283  -59.419  1.00 30.39  ? 979  PHE C N   1 
ATOM   4106 C  CA  . PHE C 1 157 ? 17.823  -7.531  -60.850  1.00 29.57  ? 979  PHE C CA  1 
ATOM   4107 C  C   . PHE C 1 157 ? 19.188  -7.805  -61.467  1.00 30.44  ? 979  PHE C C   1 
ATOM   4108 O  O   . PHE C 1 157 ? 19.324  -8.712  -62.287  1.00 29.56  ? 979  PHE C O   1 
ATOM   4109 C  CB  . PHE C 1 157 ? 17.181  -6.370  -61.608  1.00 27.07  ? 979  PHE C CB  1 
ATOM   4110 C  CG  . PHE C 1 157 ? 17.207  -6.542  -63.094  1.00 23.42  ? 979  PHE C CG  1 
ATOM   4111 C  CD1 . PHE C 1 157 ? 16.252  -7.329  -63.731  1.00 23.31  ? 979  PHE C CD1 1 
ATOM   4112 C  CD2 . PHE C 1 157 ? 18.205  -5.942  -63.854  1.00 23.57  ? 979  PHE C CD2 1 
ATOM   4113 C  CE1 . PHE C 1 157 ? 16.291  -7.518  -65.109  1.00 20.26  ? 979  PHE C CE1 1 
ATOM   4114 C  CE2 . PHE C 1 157 ? 18.258  -6.122  -65.231  1.00 26.98  ? 979  PHE C CE2 1 
ATOM   4115 C  CZ  . PHE C 1 157 ? 17.298  -6.912  -65.864  1.00 21.19  ? 979  PHE C CZ  1 
ATOM   4116 N  N   . ASN C 1 158 ? 20.195  -7.022  -61.097  1.00 26.97  ? 980  ASN C N   1 
ATOM   4117 C  CA  . ASN C 1 158 ? 21.517  -7.190  -61.689  1.00 24.39  ? 980  ASN C CA  1 
ATOM   4118 C  C   . ASN C 1 158 ? 22.398  -8.304  -61.141  1.00 25.11  ? 980  ASN C C   1 
ATOM   4119 O  O   . ASN C 1 158 ? 22.400  -8.596  -59.947  1.00 23.60  ? 980  ASN C O   1 
ATOM   4120 C  CB  . ASN C 1 158 ? 22.281  -5.868  -61.631  1.00 25.71  ? 980  ASN C CB  1 
ATOM   4121 C  CG  . ASN C 1 158 ? 21.538  -4.745  -62.312  1.00 25.56  ? 980  ASN C CG  1 
ATOM   4122 O  OD1 . ASN C 1 158 ? 20.829  -3.965  -61.671  1.00 26.18  ? 980  ASN C OD1 1 
ATOM   4123 N  ND2 . ASN C 1 158 ? 21.682  -4.665  -63.622  1.00 17.85  ? 980  ASN C ND2 1 
ATOM   4124 N  N   . GLU C 1 159 ? 23.160  -8.916  -62.038  1.00 25.39  ? 981  GLU C N   1 
ATOM   4125 C  CA  . GLU C 1 159 ? 24.058  -10.001 -61.666  1.00 28.08  ? 981  GLU C CA  1 
ATOM   4126 C  C   . GLU C 1 159 ? 25.027  -9.575  -60.571  1.00 26.19  ? 981  GLU C C   1 
ATOM   4127 O  O   . GLU C 1 159 ? 25.521  -8.445  -60.558  1.00 25.62  ? 981  GLU C O   1 
ATOM   4128 C  CB  . GLU C 1 159 ? 24.860  -10.470 -62.885  1.00 38.06  ? 981  GLU C CB  1 
ATOM   4129 C  CG  . GLU C 1 159 ? 24.014  -10.983 -64.029  1.00 44.32  ? 981  GLU C CG  1 
ATOM   4130 C  CD  . GLU C 1 159 ? 23.087  -12.100 -63.601  1.00 53.13  ? 981  GLU C CD  1 
ATOM   4131 O  OE1 . GLU C 1 159 ? 23.588  -13.150 -63.142  1.00 57.36  ? 981  GLU C OE1 1 
ATOM   4132 O  OE2 . GLU C 1 159 ? 21.855  -11.927 -63.720  1.00 58.06  ? 981  GLU C OE2 1 
ATOM   4133 N  N   . PRO C 1 160 ? 25.309  -10.482 -59.627  1.00 28.98  ? 982  PRO C N   1 
ATOM   4134 C  CA  . PRO C 1 160 ? 26.237  -10.174 -58.537  1.00 27.93  ? 982  PRO C CA  1 
ATOM   4135 C  C   . PRO C 1 160 ? 27.577  -9.716  -59.117  1.00 26.90  ? 982  PRO C C   1 
ATOM   4136 O  O   . PRO C 1 160 ? 28.021  -10.225 -60.138  1.00 27.39  ? 982  PRO C O   1 
ATOM   4137 C  CB  . PRO C 1 160 ? 26.344  -11.509 -57.803  1.00 44.37  ? 982  PRO C CB  1 
ATOM   4138 C  CG  . PRO C 1 160 ? 24.969  -12.086 -57.984  1.00 44.13  ? 982  PRO C CG  1 
ATOM   4139 C  CD  . PRO C 1 160 ? 24.698  -11.810 -59.444  1.00 41.25  ? 982  PRO C CD  1 
ATOM   4140 N  N   . ASP C 1 161 ? 28.199  -8.738  -58.473  1.00 28.04  ? 983  ASP C N   1 
ATOM   4141 C  CA  . ASP C 1 161 ? 29.478  -8.202  -58.915  1.00 29.51  ? 983  ASP C CA  1 
ATOM   4142 C  C   . ASP C 1 161 ? 29.523  -7.650  -60.344  1.00 28.46  ? 983  ASP C C   1 
ATOM   4143 O  O   . ASP C 1 161 ? 30.605  -7.479  -60.903  1.00 28.18  ? 983  ASP C O   1 
ATOM   4144 C  CB  . ASP C 1 161 ? 30.584  -9.250  -58.749  1.00 31.24  ? 983  ASP C CB  1 
ATOM   4145 C  CG  . ASP C 1 161 ? 31.975  -8.657  -58.925  1.00 34.61  ? 983  ASP C CG  1 
ATOM   4146 O  OD1 . ASP C 1 161 ? 32.283  -7.648  -58.246  1.00 31.46  ? 983  ASP C OD1 1 
ATOM   4147 O  OD2 . ASP C 1 161 ? 32.755  -9.196  -59.736  1.00 35.20  ? 983  ASP C OD2 1 
ATOM   4148 N  N   . SER C 1 162 ? 28.367  -7.385  -60.946  1.00 23.73  ? 984  SER C N   1 
ATOM   4149 C  CA  . SER C 1 162 ? 28.351  -6.812  -62.294  1.00 23.86  ? 984  SER C CA  1 
ATOM   4150 C  C   . SER C 1 162 ? 28.608  -5.307  -62.163  1.00 23.50  ? 984  SER C C   1 
ATOM   4151 O  O   . SER C 1 162 ? 28.515  -4.752  -61.068  1.00 22.56  ? 984  SER C O   1 
ATOM   4152 C  CB  . SER C 1 162 ? 26.996  -7.049  -62.977  1.00 26.90  ? 984  SER C CB  1 
ATOM   4153 O  OG  . SER C 1 162 ? 25.928  -6.481  -62.234  1.00 24.12  ? 984  SER C OG  1 
ATOM   4154 N  N   . GLU C 1 163 ? 28.927  -4.649  -63.273  1.00 24.65  ? 985  GLU C N   1 
ATOM   4155 C  CA  . GLU C 1 163 ? 29.201  -3.214  -63.254  1.00 24.56  ? 985  GLU C CA  1 
ATOM   4156 C  C   . GLU C 1 163 ? 28.084  -2.392  -62.626  1.00 23.50  ? 985  GLU C C   1 
ATOM   4157 O  O   . GLU C 1 163 ? 28.335  -1.549  -61.766  1.00 22.62  ? 985  GLU C O   1 
ATOM   4158 C  CB  . GLU C 1 163 ? 29.440  -2.693  -64.669  1.00 29.35  ? 985  GLU C CB  1 
ATOM   4159 C  CG  . GLU C 1 163 ? 30.799  -3.002  -65.230  1.00 34.98  ? 985  GLU C CG  1 
ATOM   4160 C  CD  . GLU C 1 163 ? 31.120  -2.124  -66.417  1.00 42.18  ? 985  GLU C CD  1 
ATOM   4161 O  OE1 . GLU C 1 163 ? 30.366  -2.168  -67.410  1.00 44.21  ? 985  GLU C OE1 1 
ATOM   4162 O  OE2 . GLU C 1 163 ? 32.120  -1.383  -66.354  1.00 44.75  ? 985  GLU C OE2 1 
ATOM   4163 N  N   . VAL C 1 164 ? 26.854  -2.630  -63.070  1.00 21.22  ? 986  VAL C N   1 
ATOM   4164 C  CA  . VAL C 1 164 ? 25.696  -1.899  -62.562  1.00 22.21  ? 986  VAL C CA  1 
ATOM   4165 C  C   . VAL C 1 164 ? 25.446  -2.213  -61.096  1.00 21.55  ? 986  VAL C C   1 
ATOM   4166 O  O   . VAL C 1 164 ? 25.131  -1.323  -60.306  1.00 21.98  ? 986  VAL C O   1 
ATOM   4167 C  CB  . VAL C 1 164 ? 24.416  -2.240  -63.364  1.00 25.92  ? 986  VAL C CB  1 
ATOM   4168 C  CG1 . VAL C 1 164 ? 23.215  -1.510  -62.765  1.00 25.86  ? 986  VAL C CG1 1 
ATOM   4169 C  CG2 . VAL C 1 164 ? 24.597  -1.854  -64.822  1.00 27.85  ? 986  VAL C CG2 1 
ATOM   4170 N  N   . ALA C 1 165 ? 25.582  -3.483  -60.735  1.00 21.25  ? 987  ALA C N   1 
ATOM   4171 C  CA  . ALA C 1 165 ? 25.382  -3.897  -59.353  1.00 20.42  ? 987  ALA C CA  1 
ATOM   4172 C  C   . ALA C 1 165 ? 26.406  -3.227  -58.435  1.00 20.17  ? 987  ALA C C   1 
ATOM   4173 O  O   . ALA C 1 165 ? 26.069  -2.799  -57.332  1.00 17.64  ? 987  ALA C O   1 
ATOM   4174 C  CB  . ALA C 1 165 ? 25.489  -5.413  -59.239  1.00 19.90  ? 987  ALA C CB  1 
ATOM   4175 N  N   . ASN C 1 166 ? 27.655  -3.141  -58.885  1.00 22.25  ? 988  ASN C N   1 
ATOM   4176 C  CA  . ASN C 1 166 ? 28.684  -2.510  -58.071  1.00 23.56  ? 988  ASN C CA  1 
ATOM   4177 C  C   . ASN C 1 166 ? 28.440  -1.004  -57.987  1.00 24.04  ? 988  ASN C C   1 
ATOM   4178 O  O   . ASN C 1 166 ? 28.693  -0.392  -56.947  1.00 23.66  ? 988  ASN C O   1 
ATOM   4179 C  CB  . ASN C 1 166 ? 30.080  -2.808  -58.623  1.00 21.63  ? 988  ASN C CB  1 
ATOM   4180 C  CG  . ASN C 1 166 ? 30.492  -4.260  -58.399  1.00 24.30  ? 988  ASN C CG  1 
ATOM   4181 O  OD1 . ASN C 1 166 ? 30.025  -4.902  -57.465  1.00 22.90  ? 988  ASN C OD1 1 
ATOM   4182 N  ND2 . ASN C 1 166 ? 31.371  -4.773  -59.249  1.00 24.70  ? 988  ASN C ND2 1 
ATOM   4183 N  N   . ALA C 1 167 ? 27.946  -0.415  -59.075  1.00 22.49  ? 989  ALA C N   1 
ATOM   4184 C  CA  . ALA C 1 167 ? 27.631  1.014   -59.080  1.00 22.99  ? 989  ALA C CA  1 
ATOM   4185 C  C   . ALA C 1 167 ? 26.527  1.229   -58.045  1.00 23.35  ? 989  ALA C C   1 
ATOM   4186 O  O   . ALA C 1 167 ? 26.559  2.190   -57.275  1.00 22.07  ? 989  ALA C O   1 
ATOM   4187 C  CB  . ALA C 1 167 ? 27.147  1.460   -60.459  1.00 16.33  ? 989  ALA C CB  1 
ATOM   4188 N  N   . GLY C 1 168 ? 25.556  0.319   -58.026  1.00 25.36  ? 990  GLY C N   1 
ATOM   4189 C  CA  . GLY C 1 168 ? 24.467  0.421   -57.071  1.00 25.88  ? 990  GLY C CA  1 
ATOM   4190 C  C   . GLY C 1 168 ? 24.953  0.409   -55.627  1.00 26.53  ? 990  GLY C C   1 
ATOM   4191 O  O   . GLY C 1 168 ? 24.508  1.205   -54.804  1.00 25.12  ? 990  GLY C O   1 
ATOM   4192 N  N   . ILE C 1 169 ? 25.863  -0.508  -55.316  1.00 21.97  ? 991  ILE C N   1 
ATOM   4193 C  CA  . ILE C 1 169 ? 26.412  -0.621  -53.972  1.00 22.00  ? 991  ILE C CA  1 
ATOM   4194 C  C   . ILE C 1 169 ? 27.210  0.626   -53.588  1.00 20.71  ? 991  ILE C C   1 
ATOM   4195 O  O   . ILE C 1 169 ? 27.136  1.092   -52.452  1.00 18.92  ? 991  ILE C O   1 
ATOM   4196 C  CB  . ILE C 1 169 ? 27.298  -1.877  -53.869  1.00 28.48  ? 991  ILE C CB  1 
ATOM   4197 C  CG1 . ILE C 1 169 ? 26.402  -3.126  -53.906  1.00 27.80  ? 991  ILE C CG1 1 
ATOM   4198 C  CG2 . ILE C 1 169 ? 28.143  -1.834  -52.591  1.00 31.71  ? 991  ILE C CG2 1 
ATOM   4199 C  CD1 . ILE C 1 169 ? 27.150  -4.426  -54.085  1.00 36.73  ? 991  ILE C CD1 1 
ATOM   4200 N  N   . LYS C 1 170 ? 27.970  1.166   -54.535  1.00 23.50  ? 992  LYS C N   1 
ATOM   4201 C  CA  . LYS C 1 170 ? 28.752  2.363   -54.264  1.00 25.26  ? 992  LYS C CA  1 
ATOM   4202 C  C   . LYS C 1 170 ? 27.822  3.528   -53.932  1.00 23.42  ? 992  LYS C C   1 
ATOM   4203 O  O   . LYS C 1 170 ? 28.013  4.226   -52.937  1.00 22.37  ? 992  LYS C O   1 
ATOM   4204 C  CB  . LYS C 1 170 ? 29.616  2.731   -55.468  1.00 34.18  ? 992  LYS C CB  1 
ATOM   4205 C  CG  . LYS C 1 170 ? 31.094  2.507   -55.245  1.00 40.77  ? 992  LYS C CG  1 
ATOM   4206 C  CD  . LYS C 1 170 ? 31.930  3.255   -56.270  1.00 48.80  ? 992  LYS C CD  1 
ATOM   4207 C  CE  . LYS C 1 170 ? 33.411  2.996   -56.052  1.00 54.94  ? 992  LYS C CE  1 
ATOM   4208 N  NZ  . LYS C 1 170 ? 33.820  3.300   -54.649  1.00 54.53  ? 992  LYS C NZ  1 
ATOM   4209 N  N   . LEU C 1 171 ? 26.813  3.730   -54.769  1.00 21.01  ? 993  LEU C N   1 
ATOM   4210 C  CA  . LEU C 1 171 ? 25.864  4.811   -54.548  1.00 20.95  ? 993  LEU C CA  1 
ATOM   4211 C  C   . LEU C 1 171 ? 25.100  4.623   -53.234  1.00 20.53  ? 993  LEU C C   1 
ATOM   4212 O  O   . LEU C 1 171 ? 24.797  5.598   -52.536  1.00 19.85  ? 993  LEU C O   1 
ATOM   4213 C  CB  . LEU C 1 171 ? 24.885  4.900   -55.720  1.00 22.92  ? 993  LEU C CB  1 
ATOM   4214 C  CG  . LEU C 1 171 ? 24.110  6.221   -55.795  1.00 27.93  ? 993  LEU C CG  1 
ATOM   4215 C  CD1 . LEU C 1 171 ? 25.098  7.381   -55.909  1.00 29.90  ? 993  LEU C CD1 1 
ATOM   4216 C  CD2 . LEU C 1 171 ? 23.175  6.204   -56.988  1.00 28.33  ? 993  LEU C CD2 1 
ATOM   4217 N  N   . GLU C 1 172 ? 24.800  3.371   -52.892  1.00 23.03  ? 994  GLU C N   1 
ATOM   4218 C  CA  . GLU C 1 172 ? 24.073  3.082   -51.658  1.00 22.43  ? 994  GLU C CA  1 
ATOM   4219 C  C   . GLU C 1 172 ? 24.885  3.420   -50.412  1.00 22.53  ? 994  GLU C C   1 
ATOM   4220 O  O   . GLU C 1 172 ? 24.348  3.963   -49.441  1.00 19.75  ? 994  GLU C O   1 
ATOM   4221 C  CB  . GLU C 1 172 ? 23.660  1.611   -51.610  1.00 26.02  ? 994  GLU C CB  1 
ATOM   4222 C  CG  . GLU C 1 172 ? 22.969  1.229   -50.314  1.00 31.06  ? 994  GLU C CG  1 
ATOM   4223 C  CD  . GLU C 1 172 ? 22.462  -0.197  -50.327  1.00 36.01  ? 994  GLU C CD  1 
ATOM   4224 O  OE1 . GLU C 1 172 ? 23.225  -1.093  -50.738  1.00 37.19  ? 994  GLU C OE1 1 
ATOM   4225 O  OE2 . GLU C 1 172 ? 21.303  -0.423  -49.924  1.00 41.95  ? 994  GLU C OE2 1 
ATOM   4226 N  N   . ASN C 1 173 ? 26.175  3.088   -50.436  1.00 22.72  ? 995  ASN C N   1 
ATOM   4227 C  CA  . ASN C 1 173 ? 27.062  3.374   -49.309  1.00 24.32  ? 995  ASN C CA  1 
ATOM   4228 C  C   . ASN C 1 173 ? 27.199  4.882   -49.128  1.00 24.44  ? 995  ASN C C   1 
ATOM   4229 O  O   . ASN C 1 173 ? 27.284  5.390   -48.013  1.00 26.00  ? 995  ASN C O   1 
ATOM   4230 C  CB  . ASN C 1 173 ? 28.448  2.762   -49.548  1.00 21.44  ? 995  ASN C CB  1 
ATOM   4231 C  CG  . ASN C 1 173 ? 28.436  1.246   -49.455  1.00 25.94  ? 995  ASN C CG  1 
ATOM   4232 O  OD1 . ASN C 1 173 ? 27.575  0.665   -48.795  1.00 27.24  ? 995  ASN C OD1 1 
ATOM   4233 N  ND2 . ASN C 1 173 ? 29.398  0.598   -50.103  1.00 27.15  ? 995  ASN C ND2 1 
ATOM   4234 N  N   . TYR C 1 174 ? 27.222  5.589   -50.244  1.00 22.37  ? 996  TYR C N   1 
ATOM   4235 C  CA  . TYR C 1 174 ? 27.335  7.037   -50.229  1.00 21.74  ? 996  TYR C CA  1 
ATOM   4236 C  C   . TYR C 1 174 ? 26.081  7.602   -49.568  1.00 20.84  ? 996  TYR C C   1 
ATOM   4237 O  O   . TYR C 1 174 ? 26.151  8.449   -48.677  1.00 18.61  ? 996  TYR C O   1 
ATOM   4238 C  CB  . TYR C 1 174 ? 27.452  7.525   -51.667  1.00 22.29  ? 996  TYR C CB  1 
ATOM   4239 C  CG  . TYR C 1 174 ? 27.734  8.991   -51.829  1.00 22.25  ? 996  TYR C CG  1 
ATOM   4240 C  CD1 . TYR C 1 174 ? 28.928  9.546   -51.377  1.00 28.58  ? 996  TYR C CD1 1 
ATOM   4241 C  CD2 . TYR C 1 174 ? 26.838  9.814   -52.513  1.00 21.26  ? 996  TYR C CD2 1 
ATOM   4242 C  CE1 . TYR C 1 174 ? 29.227  10.882  -51.614  1.00 29.76  ? 996  TYR C CE1 1 
ATOM   4243 C  CE2 . TYR C 1 174 ? 27.128  11.144  -52.750  1.00 20.56  ? 996  TYR C CE2 1 
ATOM   4244 C  CZ  . TYR C 1 174 ? 28.322  11.670  -52.303  1.00 26.15  ? 996  TYR C CZ  1 
ATOM   4245 O  OH  . TYR C 1 174 ? 28.624  12.981  -52.576  1.00 29.45  ? 996  TYR C OH  1 
ATOM   4246 N  N   . PHE C 1 175 ? 24.929  7.114   -50.007  1.00 19.77  ? 997  PHE C N   1 
ATOM   4247 C  CA  . PHE C 1 175 ? 23.648  7.553   -49.472  1.00 20.23  ? 997  PHE C CA  1 
ATOM   4248 C  C   . PHE C 1 175 ? 23.538  7.358   -47.957  1.00 20.35  ? 997  PHE C C   1 
ATOM   4249 O  O   . PHE C 1 175 ? 23.124  8.262   -47.227  1.00 17.01  ? 997  PHE C O   1 
ATOM   4250 C  CB  . PHE C 1 175 ? 22.503  6.793   -50.149  1.00 23.08  ? 997  PHE C CB  1 
ATOM   4251 C  CG  . PHE C 1 175 ? 21.159  7.068   -49.540  1.00 22.31  ? 997  PHE C CG  1 
ATOM   4252 C  CD1 . PHE C 1 175 ? 20.516  8.281   -49.759  1.00 26.76  ? 997  PHE C CD1 1 
ATOM   4253 C  CD2 . PHE C 1 175 ? 20.555  6.131   -48.711  1.00 23.72  ? 997  PHE C CD2 1 
ATOM   4254 C  CE1 . PHE C 1 175 ? 19.288  8.561   -49.157  1.00 24.91  ? 997  PHE C CE1 1 
ATOM   4255 C  CE2 . PHE C 1 175 ? 19.333  6.397   -48.107  1.00 24.15  ? 997  PHE C CE2 1 
ATOM   4256 C  CZ  . PHE C 1 175 ? 18.696  7.613   -48.328  1.00 21.70  ? 997  PHE C CZ  1 
ATOM   4257 N  N   . GLU C 1 176 ? 23.890  6.171   -47.486  1.00 20.83  ? 998  GLU C N   1 
ATOM   4258 C  CA  . GLU C 1 176 ? 23.793  5.893   -46.064  1.00 22.53  ? 998  GLU C CA  1 
ATOM   4259 C  C   . GLU C 1 176 ? 24.673  6.836   -45.252  1.00 22.70  ? 998  GLU C C   1 
ATOM   4260 O  O   . GLU C 1 176 ? 24.309  7.238   -44.149  1.00 23.53  ? 998  GLU C O   1 
ATOM   4261 C  CB  . GLU C 1 176 ? 24.153  4.432   -45.792  1.00 28.81  ? 998  GLU C CB  1 
ATOM   4262 C  CG  . GLU C 1 176 ? 23.161  3.433   -46.395  1.00 29.95  ? 998  GLU C CG  1 
ATOM   4263 C  CD  . GLU C 1 176 ? 21.708  3.689   -45.976  1.00 32.68  ? 998  GLU C CD  1 
ATOM   4264 O  OE1 . GLU C 1 176 ? 21.479  4.261   -44.890  1.00 34.90  ? 998  GLU C OE1 1 
ATOM   4265 O  OE2 . GLU C 1 176 ? 20.790  3.302   -46.731  1.00 30.50  ? 998  GLU C OE2 1 
ATOM   4266 N  N   . GLU C 1 177 ? 25.823  7.198   -45.801  1.00 24.02  ? 999  GLU C N   1 
ATOM   4267 C  CA  . GLU C 1 177 ? 26.721  8.111   -45.112  1.00 25.20  ? 999  GLU C CA  1 
ATOM   4268 C  C   . GLU C 1 177 ? 26.106  9.499   -45.079  1.00 23.47  ? 999  GLU C C   1 
ATOM   4269 O  O   . GLU C 1 177 ? 26.182  10.190  -44.071  1.00 21.21  ? 999  GLU C O   1 
ATOM   4270 C  CB  . GLU C 1 177 ? 28.086  8.155   -45.804  1.00 38.16  ? 999  GLU C CB  1 
ATOM   4271 C  CG  . GLU C 1 177 ? 28.870  6.861   -45.678  1.00 44.17  ? 999  GLU C CG  1 
ATOM   4272 C  CD  . GLU C 1 177 ? 29.092  6.463   -44.228  1.00 52.49  ? 999  GLU C CD  1 
ATOM   4273 O  OE1 . GLU C 1 177 ? 29.732  7.243   -43.490  1.00 55.04  ? 999  GLU C OE1 1 
ATOM   4274 O  OE2 . GLU C 1 177 ? 28.624  5.374   -43.824  1.00 54.52  ? 999  GLU C OE2 1 
ATOM   4275 N  N   . LEU C 1 178 ? 25.498  9.908   -46.188  1.00 20.97  ? 1000 LEU C N   1 
ATOM   4276 C  CA  . LEU C 1 178 ? 24.849  11.211  -46.246  1.00 20.95  ? 1000 LEU C CA  1 
ATOM   4277 C  C   . LEU C 1 178 ? 23.712  11.255  -45.225  1.00 18.73  ? 1000 LEU C C   1 
ATOM   4278 O  O   . LEU C 1 178 ? 23.542  12.249  -44.523  1.00 16.47  ? 1000 LEU C O   1 
ATOM   4279 C  CB  . LEU C 1 178 ? 24.298  11.477  -47.652  1.00 23.75  ? 1000 LEU C CB  1 
ATOM   4280 C  CG  . LEU C 1 178 ? 25.321  11.539  -48.791  1.00 26.43  ? 1000 LEU C CG  1 
ATOM   4281 C  CD1 . LEU C 1 178 ? 24.589  11.629  -50.116  1.00 29.53  ? 1000 LEU C CD1 1 
ATOM   4282 C  CD2 . LEU C 1 178 ? 26.236  12.734  -48.606  1.00 30.36  ? 1000 LEU C CD2 1 
ATOM   4283 N  N   . LEU C 1 179 ? 22.941  10.174  -45.145  1.00 21.93  ? 1001 LEU C N   1 
ATOM   4284 C  CA  . LEU C 1 179 ? 21.831  10.087  -44.195  1.00 21.83  ? 1001 LEU C CA  1 
ATOM   4285 C  C   . LEU C 1 179 ? 22.297  10.241  -42.754  1.00 23.92  ? 1001 LEU C C   1 
ATOM   4286 O  O   . LEU C 1 179 ? 21.606  10.847  -41.943  1.00 23.89  ? 1001 LEU C O   1 
ATOM   4287 C  CB  . LEU C 1 179 ? 21.105  8.743   -44.306  1.00 26.67  ? 1001 LEU C CB  1 
ATOM   4288 C  CG  . LEU C 1 179 ? 19.718  8.639   -44.943  1.00 25.44  ? 1001 LEU C CG  1 
ATOM   4289 C  CD1 . LEU C 1 179 ? 19.075  7.349   -44.439  1.00 25.27  ? 1001 LEU C CD1 1 
ATOM   4290 C  CD2 . LEU C 1 179 ? 18.842  9.826   -44.580  1.00 26.62  ? 1001 LEU C CD2 1 
ATOM   4291 N  N   . LYS C 1 180 ? 23.451  9.666   -42.423  1.00 25.30  ? 1002 LYS C N   1 
ATOM   4292 C  CA  . LYS C 1 180 ? 23.966  9.774   -41.059  1.00 27.28  ? 1002 LYS C CA  1 
ATOM   4293 C  C   . LYS C 1 180 ? 24.327  11.221  -40.743  1.00 26.10  ? 1002 LYS C C   1 
ATOM   4294 O  O   . LYS C 1 180 ? 24.252  11.653  -39.594  1.00 27.87  ? 1002 LYS C O   1 
ATOM   4295 C  CB  . LYS C 1 180 ? 25.204  8.886   -40.865  1.00 34.01  ? 1002 LYS C CB  1 
ATOM   4296 C  CG  . LYS C 1 180 ? 25.008  7.431   -41.239  1.00 40.35  ? 1002 LYS C CG  1 
ATOM   4297 C  CD  . LYS C 1 180 ? 26.234  6.597   -40.883  1.00 43.73  ? 1002 LYS C CD  1 
ATOM   4298 C  CE  . LYS C 1 180 ? 26.190  5.221   -41.545  1.00 51.91  ? 1002 LYS C CE  1 
ATOM   4299 N  NZ  . LYS C 1 180 ? 24.972  4.441   -41.189  1.00 54.25  ? 1002 LYS C NZ  1 
ATOM   4300 N  N   . ASN C 1 181 ? 24.733  11.971  -41.764  1.00 25.57  ? 1003 ASN C N   1 
ATOM   4301 C  CA  . ASN C 1 181 ? 25.089  13.373  -41.570  1.00 22.99  ? 1003 ASN C CA  1 
ATOM   4302 C  C   . ASN C 1 181 ? 23.856  14.260  -41.428  1.00 23.05  ? 1003 ASN C C   1 
ATOM   4303 O  O   . ASN C 1 181 ? 23.839  15.179  -40.618  1.00 21.45  ? 1003 ASN C O   1 
ATOM   4304 C  CB  . ASN C 1 181 ? 25.947  13.884  -42.729  1.00 26.64  ? 1003 ASN C CB  1 
ATOM   4305 C  CG  . ASN C 1 181 ? 27.329  13.259  -42.750  1.00 30.95  ? 1003 ASN C CG  1 
ATOM   4306 O  OD1 . ASN C 1 181 ? 27.758  12.636  -41.777  1.00 33.01  ? 1003 ASN C OD1 1 
ATOM   4307 N  ND2 . ASN C 1 181 ? 28.038  13.429  -43.863  1.00 31.73  ? 1003 ASN C ND2 1 
ATOM   4308 N  N   . LEU C 1 182 ? 22.824  13.975  -42.216  1.00 23.39  ? 1004 LEU C N   1 
ATOM   4309 C  CA  . LEU C 1 182 ? 21.594  14.761  -42.180  1.00 23.19  ? 1004 LEU C CA  1 
ATOM   4310 C  C   . LEU C 1 182 ? 20.619  14.377  -41.074  1.00 23.09  ? 1004 LEU C C   1 
ATOM   4311 O  O   . LEU C 1 182 ? 19.835  15.208  -40.631  1.00 22.54  ? 1004 LEU C O   1 
ATOM   4312 C  CB  . LEU C 1 182 ? 20.889  14.692  -43.537  1.00 22.48  ? 1004 LEU C CB  1 
ATOM   4313 C  CG  . LEU C 1 182 ? 21.665  15.360  -44.668  1.00 26.43  ? 1004 LEU C CG  1 
ATOM   4314 C  CD1 . LEU C 1 182 ? 20.908  15.194  -45.981  1.00 25.91  ? 1004 LEU C CD1 1 
ATOM   4315 C  CD2 . LEU C 1 182 ? 21.867  16.837  -44.336  1.00 25.88  ? 1004 LEU C CD2 1 
ATOM   4316 N  N   . TYR C 1 183 ? 20.661  13.124  -40.628  1.00 16.67  ? 1005 TYR C N   1 
ATOM   4317 C  CA  . TYR C 1 183 ? 19.777  12.679  -39.557  1.00 18.95  ? 1005 TYR C CA  1 
ATOM   4318 C  C   . TYR C 1 183 ? 20.591  11.956  -38.488  1.00 18.10  ? 1005 TYR C C   1 
ATOM   4319 O  O   . TYR C 1 183 ? 20.435  10.754  -38.293  1.00 20.10  ? 1005 TYR C O   1 
ATOM   4320 C  CB  . TYR C 1 183 ? 18.693  11.750  -40.114  1.00 22.99  ? 1005 TYR C CB  1 
ATOM   4321 C  CG  . TYR C 1 183 ? 17.637  12.467  -40.935  1.00 26.02  ? 1005 TYR C CG  1 
ATOM   4322 C  CD1 . TYR C 1 183 ? 16.644  13.235  -40.316  1.00 21.52  ? 1005 TYR C CD1 1 
ATOM   4323 C  CD2 . TYR C 1 183 ? 17.660  12.419  -42.324  1.00 21.19  ? 1005 TYR C CD2 1 
ATOM   4324 C  CE1 . TYR C 1 183 ? 15.705  13.940  -41.067  1.00 20.48  ? 1005 TYR C CE1 1 
ATOM   4325 C  CE2 . TYR C 1 183 ? 16.727  13.122  -43.086  1.00 21.91  ? 1005 TYR C CE2 1 
ATOM   4326 C  CZ  . TYR C 1 183 ? 15.757  13.882  -42.452  1.00 19.39  ? 1005 TYR C CZ  1 
ATOM   4327 O  OH  . TYR C 1 183 ? 14.868  14.609  -43.204  1.00 19.24  ? 1005 TYR C OH  1 
ATOM   4328 N  N   . PRO C 1 184 ? 21.476  12.690  -37.786  1.00 44.41  ? 1006 PRO C N   1 
ATOM   4329 C  CA  . PRO C 1 184 ? 22.338  12.155  -36.727  1.00 44.41  ? 1006 PRO C CA  1 
ATOM   4330 C  C   . PRO C 1 184 ? 21.578  11.765  -35.464  1.00 44.41  ? 1006 PRO C C   1 
ATOM   4331 O  O   . PRO C 1 184 ? 21.974  10.759  -34.835  1.00 44.41  ? 1006 PRO C O   1 
ATOM   4332 C  CB  . PRO C 1 184 ? 23.327  13.292  -36.484  1.00 32.31  ? 1006 PRO C CB  1 
ATOM   4333 C  CG  . PRO C 1 184 ? 22.473  14.507  -36.715  1.00 32.31  ? 1006 PRO C CG  1 
ATOM   4334 C  CD  . PRO C 1 184 ? 21.713  14.135  -37.965  1.00 32.31  ? 1006 PRO C CD  1 
ATOM   4335 O  OXT . PRO C 1 184 ? 20.612  12.476  -35.109  1.00 39.64  ? 1006 PRO C OXT 1 
ATOM   4336 N  N   . ASN D 1 3   ? 32.968  23.616  -86.437  1.00 66.41  ? 825  ASN D N   1 
ATOM   4337 C  CA  . ASN D 1 3   ? 34.344  23.267  -85.987  1.00 66.41  ? 825  ASN D CA  1 
ATOM   4338 C  C   . ASN D 1 3   ? 34.637  23.891  -84.617  1.00 66.41  ? 825  ASN D C   1 
ATOM   4339 O  O   . ASN D 1 3   ? 35.362  23.312  -83.809  1.00 66.41  ? 825  ASN D O   1 
ATOM   4340 C  CB  . ASN D 1 3   ? 35.368  23.741  -87.024  1.00 81.02  ? 825  ASN D CB  1 
ATOM   4341 C  CG  . ASN D 1 3   ? 36.675  22.964  -86.958  1.00 81.02  ? 825  ASN D CG  1 
ATOM   4342 O  OD1 . ASN D 1 3   ? 36.700  21.747  -87.159  1.00 81.02  ? 825  ASN D OD1 1 
ATOM   4343 N  ND2 . ASN D 1 3   ? 37.769  23.668  -86.687  1.00 81.02  ? 825  ASN D ND2 1 
ATOM   4344 N  N   . GLU D 1 4   ? 34.074  25.068  -84.355  1.00 56.00  ? 826  GLU D N   1 
ATOM   4345 C  CA  . GLU D 1 4   ? 34.273  25.735  -83.068  1.00 56.00  ? 826  GLU D CA  1 
ATOM   4346 C  C   . GLU D 1 4   ? 33.508  24.986  -81.975  1.00 56.00  ? 826  GLU D C   1 
ATOM   4347 O  O   . GLU D 1 4   ? 32.557  24.262  -82.264  1.00 56.00  ? 826  GLU D O   1 
ATOM   4348 C  CB  . GLU D 1 4   ? 33.810  27.191  -83.158  1.00 79.77  ? 826  GLU D CB  1 
ATOM   4349 C  CG  . GLU D 1 4   ? 34.742  28.059  -83.986  1.00 79.77  ? 826  GLU D CG  1 
ATOM   4350 C  CD  . GLU D 1 4   ? 34.034  29.220  -84.648  1.00 79.77  ? 826  GLU D CD  1 
ATOM   4351 O  OE1 . GLU D 1 4   ? 33.373  30.004  -83.938  1.00 79.77  ? 826  GLU D OE1 1 
ATOM   4352 O  OE2 . GLU D 1 4   ? 34.146  29.349  -85.885  1.00 79.77  ? 826  GLU D OE2 1 
ATOM   4353 N  N   . ASP D 1 5   ? 33.919  25.151  -80.722  1.00 49.75  ? 827  ASP D N   1 
ATOM   4354 C  CA  . ASP D 1 5   ? 33.257  24.440  -79.632  1.00 49.75  ? 827  ASP D CA  1 
ATOM   4355 C  C   . ASP D 1 5   ? 32.202  25.260  -78.899  1.00 49.75  ? 827  ASP D C   1 
ATOM   4356 O  O   . ASP D 1 5   ? 31.434  24.720  -78.100  1.00 49.75  ? 827  ASP D O   1 
ATOM   4357 C  CB  . ASP D 1 5   ? 34.298  23.946  -78.623  1.00 82.40  ? 827  ASP D CB  1 
ATOM   4358 C  CG  . ASP D 1 5   ? 35.350  23.058  -79.258  1.00 82.40  ? 827  ASP D CG  1 
ATOM   4359 O  OD1 . ASP D 1 5   ? 34.980  22.006  -79.823  1.00 82.40  ? 827  ASP D OD1 1 
ATOM   4360 O  OD2 . ASP D 1 5   ? 36.547  23.414  -79.194  1.00 82.40  ? 827  ASP D OD2 1 
ATOM   4361 N  N   . TRP D 1 6   ? 32.151  26.557  -79.182  1.00 38.73  ? 828  TRP D N   1 
ATOM   4362 C  CA  . TRP D 1 6   ? 31.201  27.429  -78.506  1.00 38.83  ? 828  TRP D CA  1 
ATOM   4363 C  C   . TRP D 1 6   ? 30.261  28.153  -79.455  1.00 36.25  ? 828  TRP D C   1 
ATOM   4364 O  O   . TRP D 1 6   ? 30.638  28.515  -80.566  1.00 34.50  ? 828  TRP D O   1 
ATOM   4365 C  CB  . TRP D 1 6   ? 31.976  28.432  -77.658  1.00 53.22  ? 828  TRP D CB  1 
ATOM   4366 C  CG  . TRP D 1 6   ? 32.972  27.751  -76.774  1.00 61.87  ? 828  TRP D CG  1 
ATOM   4367 C  CD1 . TRP D 1 6   ? 32.720  27.107  -75.597  1.00 67.26  ? 828  TRP D CD1 1 
ATOM   4368 C  CD2 . TRP D 1 6   ? 34.370  27.578  -77.034  1.00 70.54  ? 828  TRP D CD2 1 
ATOM   4369 N  NE1 . TRP D 1 6   ? 33.872  26.542  -75.110  1.00 71.72  ? 828  TRP D NE1 1 
ATOM   4370 C  CE2 . TRP D 1 6   ? 34.901  26.813  -75.974  1.00 72.65  ? 828  TRP D CE2 1 
ATOM   4371 C  CE3 . TRP D 1 6   ? 35.226  27.991  -78.067  1.00 72.68  ? 828  TRP D CE3 1 
ATOM   4372 C  CZ2 . TRP D 1 6   ? 36.254  26.454  -75.910  1.00 73.97  ? 828  TRP D CZ2 1 
ATOM   4373 C  CZ3 . TRP D 1 6   ? 36.572  27.633  -78.005  1.00 74.34  ? 828  TRP D CZ3 1 
ATOM   4374 C  CH2 . TRP D 1 6   ? 37.071  26.870  -76.933  1.00 75.99  ? 828  TRP D CH2 1 
ATOM   4375 N  N   . CYS D 1 7   ? 29.028  28.353  -79.001  1.00 34.76  ? 829  CYS D N   1 
ATOM   4376 C  CA  . CYS D 1 7   ? 28.000  29.035  -79.782  1.00 33.96  ? 829  CYS D CA  1 
ATOM   4377 C  C   . CYS D 1 7   ? 28.499  30.394  -80.274  1.00 32.93  ? 829  CYS D C   1 
ATOM   4378 O  O   . CYS D 1 7   ? 29.030  31.189  -79.494  1.00 33.43  ? 829  CYS D O   1 
ATOM   4379 C  CB  . CYS D 1 7   ? 26.748  29.224  -78.922  1.00 26.84  ? 829  CYS D CB  1 
ATOM   4380 S  SG  . CYS D 1 7   ? 25.389  30.137  -79.701  1.00 26.35  ? 829  CYS D SG  1 
ATOM   4381 N  N   . ALA D 1 8   ? 28.320  30.654  -81.565  1.00 32.87  ? 830  ALA D N   1 
ATOM   4382 C  CA  . ALA D 1 8   ? 28.749  31.914  -82.164  1.00 32.10  ? 830  ALA D CA  1 
ATOM   4383 C  C   . ALA D 1 8   ? 28.060  33.126  -81.531  1.00 32.12  ? 830  ALA D C   1 
ATOM   4384 O  O   . ALA D 1 8   ? 28.563  34.250  -81.612  1.00 32.67  ? 830  ALA D O   1 
ATOM   4385 C  CB  . ALA D 1 8   ? 28.478  31.894  -83.661  1.00 35.59  ? 830  ALA D CB  1 
ATOM   4386 N  N   . VAL D 1 9   ? 26.910  32.902  -80.901  1.00 32.53  ? 831  VAL D N   1 
ATOM   4387 C  CA  . VAL D 1 9   ? 26.181  34.001  -80.282  1.00 33.23  ? 831  VAL D CA  1 
ATOM   4388 C  C   . VAL D 1 9   ? 26.430  34.206  -78.792  1.00 32.79  ? 831  VAL D C   1 
ATOM   4389 O  O   . VAL D 1 9   ? 26.879  35.276  -78.393  1.00 31.03  ? 831  VAL D O   1 
ATOM   4390 C  CB  . VAL D 1 9   ? 24.657  33.866  -80.499  1.00 31.92  ? 831  VAL D CB  1 
ATOM   4391 C  CG1 . VAL D 1 9   ? 23.924  34.951  -79.722  1.00 31.23  ? 831  VAL D CG1 1 
ATOM   4392 C  CG2 . VAL D 1 9   ? 24.332  33.979  -81.978  1.00 32.91  ? 831  VAL D CG2 1 
ATOM   4393 N  N   . CYS D 1 10  ? 26.142  33.194  -77.973  1.00 29.60  ? 832  CYS D N   1 
ATOM   4394 C  CA  . CYS D 1 10  ? 26.309  33.323  -76.524  1.00 29.65  ? 832  CYS D CA  1 
ATOM   4395 C  C   . CYS D 1 10  ? 27.627  32.818  -75.945  1.00 31.45  ? 832  CYS D C   1 
ATOM   4396 O  O   . CYS D 1 10  ? 27.906  33.036  -74.765  1.00 32.36  ? 832  CYS D O   1 
ATOM   4397 C  CB  . CYS D 1 10  ? 25.151  32.639  -75.798  1.00 34.03  ? 832  CYS D CB  1 
ATOM   4398 S  SG  . CYS D 1 10  ? 25.112  30.840  -75.974  1.00 31.47  ? 832  CYS D SG  1 
ATOM   4399 N  N   . GLN D 1 11  ? 28.427  32.139  -76.761  1.00 36.91  ? 833  GLN D N   1 
ATOM   4400 C  CA  . GLN D 1 11  ? 29.726  31.623  -76.328  1.00 38.19  ? 833  GLN D CA  1 
ATOM   4401 C  C   . GLN D 1 11  ? 29.659  30.457  -75.347  1.00 37.78  ? 833  GLN D C   1 
ATOM   4402 O  O   . GLN D 1 11  ? 30.667  30.103  -74.738  1.00 36.81  ? 833  GLN D O   1 
ATOM   4403 C  CB  . GLN D 1 11  ? 30.560  32.740  -75.696  1.00 51.00  ? 833  GLN D CB  1 
ATOM   4404 C  CG  . GLN D 1 11  ? 30.652  33.999  -76.528  1.00 55.29  ? 833  GLN D CG  1 
ATOM   4405 C  CD  . GLN D 1 11  ? 31.110  33.725  -77.938  1.00 61.65  ? 833  GLN D CD  1 
ATOM   4406 O  OE1 . GLN D 1 11  ? 32.131  33.075  -78.154  1.00 64.60  ? 833  GLN D OE1 1 
ATOM   4407 N  NE2 . GLN D 1 11  ? 30.357  34.223  -78.912  1.00 64.90  ? 833  GLN D NE2 1 
ATOM   4408 N  N   . ASN D 1 12  ? 28.484  29.869  -75.173  1.00 31.75  ? 834  ASN D N   1 
ATOM   4409 C  CA  . ASN D 1 12  ? 28.366  28.736  -74.265  1.00 33.11  ? 834  ASN D CA  1 
ATOM   4410 C  C   . ASN D 1 12  ? 28.460  27.419  -75.039  1.00 33.70  ? 834  ASN D C   1 
ATOM   4411 O  O   . ASN D 1 12  ? 28.375  27.400  -76.271  1.00 33.19  ? 834  ASN D O   1 
ATOM   4412 C  CB  . ASN D 1 12  ? 27.039  28.786  -73.493  1.00 34.47  ? 834  ASN D CB  1 
ATOM   4413 C  CG  . ASN D 1 12  ? 26.944  29.989  -72.568  1.00 33.58  ? 834  ASN D CG  1 
ATOM   4414 O  OD1 . ASN D 1 12  ? 27.941  30.432  -72.000  1.00 36.57  ? 834  ASN D OD1 1 
ATOM   4415 N  ND2 . ASN D 1 12  ? 25.738  30.509  -72.400  1.00 34.63  ? 834  ASN D ND2 1 
ATOM   4416 N  N   . GLY D 1 13  ? 28.645  26.324  -74.309  1.00 38.09  ? 835  GLY D N   1 
ATOM   4417 C  CA  . GLY D 1 13  ? 28.728  25.017  -74.937  1.00 39.16  ? 835  GLY D CA  1 
ATOM   4418 C  C   . GLY D 1 13  ? 27.396  24.302  -74.814  1.00 39.31  ? 835  GLY D C   1 
ATOM   4419 O  O   . GLY D 1 13  ? 26.360  24.951  -74.672  1.00 37.10  ? 835  GLY D O   1 
ATOM   4420 N  N   . GLY D 1 14  ? 27.413  22.973  -74.868  1.00 40.94  ? 836  GLY D N   1 
ATOM   4421 C  CA  . GLY D 1 14  ? 26.181  22.211  -74.750  1.00 42.90  ? 836  GLY D CA  1 
ATOM   4422 C  C   . GLY D 1 14  ? 25.658  21.659  -76.065  1.00 44.32  ? 836  GLY D C   1 
ATOM   4423 O  O   . GLY D 1 14  ? 26.433  21.258  -76.934  1.00 44.96  ? 836  GLY D O   1 
ATOM   4424 N  N   . GLU D 1 15  ? 24.337  21.637  -76.206  1.00 49.23  ? 837  GLU D N   1 
ATOM   4425 C  CA  . GLU D 1 15  ? 23.685  21.132  -77.411  1.00 51.42  ? 837  GLU D CA  1 
ATOM   4426 C  C   . GLU D 1 15  ? 23.820  22.168  -78.522  1.00 50.06  ? 837  GLU D C   1 
ATOM   4427 O  O   . GLU D 1 15  ? 23.147  23.199  -78.505  1.00 50.14  ? 837  GLU D O   1 
ATOM   4428 C  CB  . GLU D 1 15  ? 22.208  20.861  -77.118  1.00 74.79  ? 837  GLU D CB  1 
ATOM   4429 C  CG  . GLU D 1 15  ? 21.995  20.084  -75.830  1.00 80.27  ? 837  GLU D CG  1 
ATOM   4430 C  CD  . GLU D 1 15  ? 21.190  18.817  -76.030  1.00 87.59  ? 837  GLU D CD  1 
ATOM   4431 O  OE1 . GLU D 1 15  ? 21.480  18.076  -76.994  1.00 90.20  ? 837  GLU D OE1 1 
ATOM   4432 O  OE2 . GLU D 1 15  ? 20.278  18.555  -75.217  1.00 91.33  ? 837  GLU D OE2 1 
ATOM   4433 N  N   . LEU D 1 16  ? 24.678  21.878  -79.494  1.00 51.58  ? 838  LEU D N   1 
ATOM   4434 C  CA  . LEU D 1 16  ? 24.934  22.804  -80.590  1.00 50.93  ? 838  LEU D CA  1 
ATOM   4435 C  C   . LEU D 1 16  ? 24.683  22.283  -82.003  1.00 51.61  ? 838  LEU D C   1 
ATOM   4436 O  O   . LEU D 1 16  ? 24.776  21.088  -82.269  1.00 52.43  ? 838  LEU D O   1 
ATOM   4437 C  CB  . LEU D 1 16  ? 26.380  23.280  -80.505  1.00 45.25  ? 838  LEU D CB  1 
ATOM   4438 C  CG  . LEU D 1 16  ? 26.775  23.921  -79.178  1.00 45.01  ? 838  LEU D CG  1 
ATOM   4439 C  CD1 . LEU D 1 16  ? 28.278  24.129  -79.137  1.00 41.59  ? 838  LEU D CD1 1 
ATOM   4440 C  CD2 . LEU D 1 16  ? 26.031  25.237  -79.016  1.00 43.00  ? 838  LEU D CD2 1 
ATOM   4441 N  N   . LEU D 1 17  ? 24.369  23.211  -82.901  1.00 51.76  ? 839  LEU D N   1 
ATOM   4442 C  CA  . LEU D 1 17  ? 24.139  22.918  -84.311  1.00 52.64  ? 839  LEU D CA  1 
ATOM   4443 C  C   . LEU D 1 17  ? 25.475  23.218  -84.976  1.00 53.26  ? 839  LEU D C   1 
ATOM   4444 O  O   . LEU D 1 17  ? 26.094  24.234  -84.676  1.00 52.33  ? 839  LEU D O   1 
ATOM   4445 C  CB  . LEU D 1 17  ? 23.070  23.851  -84.886  1.00 53.21  ? 839  LEU D CB  1 
ATOM   4446 C  CG  . LEU D 1 17  ? 21.595  23.602  -84.566  1.00 53.48  ? 839  LEU D CG  1 
ATOM   4447 C  CD1 . LEU D 1 17  ? 20.876  24.925  -84.374  1.00 46.34  ? 839  LEU D CD1 1 
ATOM   4448 C  CD2 . LEU D 1 17  ? 20.965  22.804  -85.694  1.00 54.36  ? 839  LEU D CD2 1 
ATOM   4449 N  N   . CYS D 1 18  ? 25.927  22.347  -85.870  1.00 48.42  ? 840  CYS D N   1 
ATOM   4450 C  CA  . CYS D 1 18  ? 27.206  22.574  -86.530  1.00 50.18  ? 840  CYS D CA  1 
ATOM   4451 C  C   . CYS D 1 18  ? 27.054  22.820  -88.025  1.00 49.98  ? 840  CYS D C   1 
ATOM   4452 O  O   . CYS D 1 18  ? 26.660  21.927  -88.775  1.00 49.24  ? 840  CYS D O   1 
ATOM   4453 C  CB  . CYS D 1 18  ? 28.135  21.382  -86.290  1.00 83.10  ? 840  CYS D CB  1 
ATOM   4454 S  SG  . CYS D 1 18  ? 28.395  20.986  -84.547  1.00 91.87  ? 840  CYS D SG  1 
ATOM   4455 N  N   . CYS D 1 19  ? 27.369  24.036  -88.457  1.00 47.40  ? 841  CYS D N   1 
ATOM   4456 C  CA  . CYS D 1 19  ? 27.261  24.376  -89.868  1.00 47.40  ? 841  CYS D CA  1 
ATOM   4457 C  C   . CYS D 1 19  ? 28.228  23.529  -90.687  1.00 47.40  ? 841  CYS D C   1 
ATOM   4458 O  O   . CYS D 1 19  ? 29.332  23.227  -90.236  1.00 47.40  ? 841  CYS D O   1 
ATOM   4459 C  CB  . CYS D 1 19  ? 27.572  25.855  -90.089  1.00 39.27  ? 841  CYS D CB  1 
ATOM   4460 S  SG  . CYS D 1 19  ? 27.250  26.404  -91.780  1.00 39.27  ? 841  CYS D SG  1 
ATOM   4461 N  N   . GLU D 1 20  ? 27.805  23.156  -91.891  1.00 68.16  ? 842  GLU D N   1 
ATOM   4462 C  CA  . GLU D 1 20  ? 28.621  22.342  -92.788  1.00 68.16  ? 842  GLU D CA  1 
ATOM   4463 C  C   . GLU D 1 20  ? 29.537  23.182  -93.670  1.00 68.16  ? 842  GLU D C   1 
ATOM   4464 O  O   . GLU D 1 20  ? 30.591  22.719  -94.097  1.00 68.16  ? 842  GLU D O   1 
ATOM   4465 C  CB  . GLU D 1 20  ? 27.716  21.479  -93.675  1.00 92.87  ? 842  GLU D CB  1 
ATOM   4466 C  CG  . GLU D 1 20  ? 26.945  20.414  -92.919  1.00 92.87  ? 842  GLU D CG  1 
ATOM   4467 C  CD  . GLU D 1 20  ? 27.777  19.178  -92.634  1.00 92.87  ? 842  GLU D CD  1 
ATOM   4468 O  OE1 . GLU D 1 20  ? 29.003  19.314  -92.436  1.00 92.87  ? 842  GLU D OE1 1 
ATOM   4469 O  OE2 . GLU D 1 20  ? 27.199  18.071  -92.595  1.00 92.87  ? 842  GLU D OE2 1 
ATOM   4470 N  N   . LYS D 1 21  ? 29.134  24.418  -93.938  1.00 45.45  ? 843  LYS D N   1 
ATOM   4471 C  CA  . LYS D 1 21  ? 29.911  25.310  -94.792  1.00 45.45  ? 843  LYS D CA  1 
ATOM   4472 C  C   . LYS D 1 21  ? 30.894  26.202  -94.034  1.00 45.45  ? 843  LYS D C   1 
ATOM   4473 O  O   . LYS D 1 21  ? 31.864  26.690  -94.614  1.00 45.45  ? 843  LYS D O   1 
ATOM   4474 C  CB  . LYS D 1 21  ? 28.969  26.194  -95.611  1.00 62.79  ? 843  LYS D CB  1 
ATOM   4475 C  CG  . LYS D 1 21  ? 27.929  25.436  -96.419  1.00 62.79  ? 843  LYS D CG  1 
ATOM   4476 C  CD  . LYS D 1 21  ? 28.551  24.683  -97.583  1.00 62.79  ? 843  LYS D CD  1 
ATOM   4477 C  CE  . LYS D 1 21  ? 27.473  24.088  -98.482  1.00 62.79  ? 843  LYS D CE  1 
ATOM   4478 N  NZ  . LYS D 1 21  ? 28.039  23.473  -99.716  1.00 62.79  ? 843  LYS D NZ  1 
ATOM   4479 N  N   . CYS D 1 22  ? 30.643  26.427  -92.747  1.00 48.89  ? 844  CYS D N   1 
ATOM   4480 C  CA  . CYS D 1 22  ? 31.525  27.273  -91.944  1.00 47.78  ? 844  CYS D CA  1 
ATOM   4481 C  C   . CYS D 1 22  ? 31.820  26.637  -90.580  1.00 47.69  ? 844  CYS D C   1 
ATOM   4482 O  O   . CYS D 1 22  ? 31.239  25.611  -90.224  1.00 47.60  ? 844  CYS D O   1 
ATOM   4483 C  CB  . CYS D 1 22  ? 30.901  28.666  -91.756  1.00 39.45  ? 844  CYS D CB  1 
ATOM   4484 S  SG  . CYS D 1 22  ? 29.627  28.761  -90.475  1.00 40.75  ? 844  CYS D SG  1 
ATOM   4485 N  N   . PRO D 1 23  ? 32.740  27.234  -89.805  1.00 46.10  ? 845  PRO D N   1 
ATOM   4486 C  CA  . PRO D 1 23  ? 33.121  26.726  -88.480  1.00 45.93  ? 845  PRO D CA  1 
ATOM   4487 C  C   . PRO D 1 23  ? 32.079  26.931  -87.379  1.00 45.90  ? 845  PRO D C   1 
ATOM   4488 O  O   . PRO D 1 23  ? 31.981  26.131  -86.450  1.00 46.37  ? 845  PRO D O   1 
ATOM   4489 C  CB  . PRO D 1 23  ? 34.408  27.493  -88.171  1.00 45.33  ? 845  PRO D CB  1 
ATOM   4490 C  CG  . PRO D 1 23  ? 34.935  27.873  -89.523  1.00 45.18  ? 845  PRO D CG  1 
ATOM   4491 C  CD  . PRO D 1 23  ? 33.683  28.277  -90.244  1.00 45.37  ? 845  PRO D CD  1 
ATOM   4492 N  N   . LYS D 1 24  ? 31.310  28.007  -87.488  1.00 44.05  ? 846  LYS D N   1 
ATOM   4493 C  CA  . LYS D 1 24  ? 30.303  28.346  -86.492  1.00 42.30  ? 846  LYS D CA  1 
ATOM   4494 C  C   . LYS D 1 24  ? 29.350  27.235  -86.071  1.00 41.46  ? 846  LYS D C   1 
ATOM   4495 O  O   . LYS D 1 24  ? 29.002  26.358  -86.862  1.00 41.98  ? 846  LYS D O   1 
ATOM   4496 C  CB  . LYS D 1 24  ? 29.476  29.535  -86.974  1.00 36.03  ? 846  LYS D CB  1 
ATOM   4497 C  CG  . LYS D 1 24  ? 30.253  30.829  -87.112  1.00 38.29  ? 846  LYS D CG  1 
ATOM   4498 C  CD  . LYS D 1 24  ? 29.306  31.966  -87.472  1.00 42.82  ? 846  LYS D CD  1 
ATOM   4499 C  CE  . LYS D 1 24  ? 30.016  33.305  -87.499  1.00 45.03  ? 846  LYS D CE  1 
ATOM   4500 N  NZ  . LYS D 1 24  ? 31.046  33.366  -88.564  1.00 43.89  ? 846  LYS D NZ  1 
ATOM   4501 N  N   . VAL D 1 25  ? 28.942  27.301  -84.805  1.00 31.95  ? 847  VAL D N   1 
ATOM   4502 C  CA  . VAL D 1 25  ? 27.997  26.368  -84.199  1.00 30.32  ? 847  VAL D CA  1 
ATOM   4503 C  C   . VAL D 1 25  ? 26.976  27.233  -83.451  1.00 28.32  ? 847  VAL D C   1 
ATOM   4504 O  O   . VAL D 1 25  ? 27.296  28.352  -83.043  1.00 26.94  ? 847  VAL D O   1 
ATOM   4505 C  CB  . VAL D 1 25  ? 28.695  25.408  -83.201  1.00 39.55  ? 847  VAL D CB  1 
ATOM   4506 C  CG1 . VAL D 1 25  ? 29.715  24.552  -83.936  1.00 39.86  ? 847  VAL D CG1 1 
ATOM   4507 C  CG2 . VAL D 1 25  ? 29.365  26.198  -82.086  1.00 38.99  ? 847  VAL D CG2 1 
ATOM   4508 N  N   . PHE D 1 26  ? 25.758  26.730  -83.270  1.00 32.58  ? 848  PHE D N   1 
ATOM   4509 C  CA  . PHE D 1 26  ? 24.713  27.508  -82.603  1.00 32.76  ? 848  PHE D CA  1 
ATOM   4510 C  C   . PHE D 1 26  ? 23.780  26.673  -81.742  1.00 32.53  ? 848  PHE D C   1 
ATOM   4511 O  O   . PHE D 1 26  ? 23.582  25.488  -81.998  1.00 34.68  ? 848  PHE D O   1 
ATOM   4512 C  CB  . PHE D 1 26  ? 23.821  28.204  -83.640  1.00 29.35  ? 848  PHE D CB  1 
ATOM   4513 C  CG  . PHE D 1 26  ? 24.562  29.020  -84.649  1.00 30.26  ? 848  PHE D CG  1 
ATOM   4514 C  CD1 . PHE D 1 26  ? 24.770  30.380  -84.445  1.00 31.26  ? 848  PHE D CD1 1 
ATOM   4515 C  CD2 . PHE D 1 26  ? 25.045  28.433  -85.816  1.00 28.77  ? 848  PHE D CD2 1 
ATOM   4516 C  CE1 . PHE D 1 26  ? 25.448  31.149  -85.388  1.00 31.43  ? 848  PHE D CE1 1 
ATOM   4517 C  CE2 . PHE D 1 26  ? 25.725  29.191  -86.765  1.00 29.96  ? 848  PHE D CE2 1 
ATOM   4518 C  CZ  . PHE D 1 26  ? 25.928  30.554  -86.551  1.00 34.61  ? 848  PHE D CZ  1 
ATOM   4519 N  N   . HIS D 1 27  ? 23.198  27.309  -80.728  1.00 33.01  ? 849  HIS D N   1 
ATOM   4520 C  CA  . HIS D 1 27  ? 22.207  26.655  -79.886  1.00 31.63  ? 849  HIS D CA  1 
ATOM   4521 C  C   . HIS D 1 27  ? 20.941  26.777  -80.731  1.00 32.18  ? 849  HIS D C   1 
ATOM   4522 O  O   . HIS D 1 27  ? 20.858  27.648  -81.601  1.00 31.12  ? 849  HIS D O   1 
ATOM   4523 C  CB  . HIS D 1 27  ? 21.996  27.405  -78.569  1.00 32.75  ? 849  HIS D CB  1 
ATOM   4524 C  CG  . HIS D 1 27  ? 23.084  27.190  -77.566  1.00 33.45  ? 849  HIS D CG  1 
ATOM   4525 N  ND1 . HIS D 1 27  ? 24.076  28.118  -77.332  1.00 36.85  ? 849  HIS D ND1 1 
ATOM   4526 C  CD2 . HIS D 1 27  ? 23.339  26.150  -76.739  1.00 35.36  ? 849  HIS D CD2 1 
ATOM   4527 C  CE1 . HIS D 1 27  ? 24.894  27.658  -76.403  1.00 32.29  ? 849  HIS D CE1 1 
ATOM   4528 N  NE2 . HIS D 1 27  ? 24.470  26.466  -76.026  1.00 35.48  ? 849  HIS D NE2 1 
ATOM   4529 N  N   . LEU D 1 28  ? 19.952  25.930  -80.484  1.00 31.25  ? 850  LEU D N   1 
ATOM   4530 C  CA  . LEU D 1 28  ? 18.733  25.996  -81.276  1.00 33.09  ? 850  LEU D CA  1 
ATOM   4531 C  C   . LEU D 1 28  ? 18.057  27.370  -81.288  1.00 32.07  ? 850  LEU D C   1 
ATOM   4532 O  O   . LEU D 1 28  ? 17.584  27.820  -82.334  1.00 30.02  ? 850  LEU D O   1 
ATOM   4533 C  CB  . LEU D 1 28  ? 17.734  24.938  -80.803  1.00 40.58  ? 850  LEU D CB  1 
ATOM   4534 C  CG  . LEU D 1 28  ? 18.142  23.473  -81.005  1.00 43.95  ? 850  LEU D CG  1 
ATOM   4535 C  CD1 . LEU D 1 28  ? 16.977  22.569  -80.622  1.00 41.65  ? 850  LEU D CD1 1 
ATOM   4536 C  CD2 . LEU D 1 28  ? 18.539  23.233  -82.455  1.00 44.52  ? 850  LEU D CD2 1 
ATOM   4537 N  N   . SER D 1 29  ? 18.009  28.038  -80.139  1.00 31.41  ? 851  SER D N   1 
ATOM   4538 C  CA  . SER D 1 29  ? 17.353  29.340  -80.068  1.00 32.15  ? 851  SER D CA  1 
ATOM   4539 C  C   . SER D 1 29  ? 18.292  30.532  -80.199  1.00 30.88  ? 851  SER D C   1 
ATOM   4540 O  O   . SER D 1 29  ? 17.850  31.674  -80.147  1.00 30.50  ? 851  SER D O   1 
ATOM   4541 C  CB  . SER D 1 29  ? 16.543  29.464  -78.772  1.00 40.95  ? 851  SER D CB  1 
ATOM   4542 O  OG  . SER D 1 29  ? 17.384  29.409  -77.637  1.00 43.45  ? 851  SER D OG  1 
ATOM   4543 N  N   . CYS D 1 30  ? 19.587  30.279  -80.353  1.00 27.03  ? 852  CYS D N   1 
ATOM   4544 C  CA  . CYS D 1 30  ? 20.522  31.383  -80.531  1.00 26.11  ? 852  CYS D CA  1 
ATOM   4545 C  C   . CYS D 1 30  ? 20.576  31.684  -82.022  1.00 25.15  ? 852  CYS D C   1 
ATOM   4546 O  O   . CYS D 1 30  ? 20.783  32.827  -82.439  1.00 23.04  ? 852  CYS D O   1 
ATOM   4547 C  CB  . CYS D 1 30  ? 21.914  31.019  -80.003  1.00 29.58  ? 852  CYS D CB  1 
ATOM   4548 S  SG  . CYS D 1 30  ? 22.049  31.185  -78.191  1.00 32.68  ? 852  CYS D SG  1 
ATOM   4549 N  N   . HIS D 1 31  ? 20.371  30.643  -82.820  1.00 27.73  ? 853  HIS D N   1 
ATOM   4550 C  CA  . HIS D 1 31  ? 20.379  30.780  -84.267  1.00 25.92  ? 853  HIS D CA  1 
ATOM   4551 C  C   . HIS D 1 31  ? 19.147  31.577  -84.692  1.00 25.80  ? 853  HIS D C   1 
ATOM   4552 O  O   . HIS D 1 31  ? 18.160  31.655  -83.953  1.00 23.78  ? 853  HIS D O   1 
ATOM   4553 C  CB  . HIS D 1 31  ? 20.350  29.396  -84.928  1.00 26.26  ? 853  HIS D CB  1 
ATOM   4554 C  CG  . HIS D 1 31  ? 20.440  29.437  -86.423  1.00 30.14  ? 853  HIS D CG  1 
ATOM   4555 N  ND1 . HIS D 1 31  ? 21.616  29.701  -87.092  1.00 34.12  ? 853  HIS D ND1 1 
ATOM   4556 C  CD2 . HIS D 1 31  ? 19.494  29.270  -87.378  1.00 31.42  ? 853  HIS D CD2 1 
ATOM   4557 C  CE1 . HIS D 1 31  ? 21.390  29.697  -88.394  1.00 32.47  ? 853  HIS D CE1 1 
ATOM   4558 N  NE2 . HIS D 1 31  ? 20.109  29.438  -88.594  1.00 33.58  ? 853  HIS D NE2 1 
ATOM   4559 N  N   . VAL D 1 32  ? 19.229  32.188  -85.868  1.00 30.24  ? 854  VAL D N   1 
ATOM   4560 C  CA  . VAL D 1 32  ? 18.121  32.953  -86.433  1.00 30.24  ? 854  VAL D CA  1 
ATOM   4561 C  C   . VAL D 1 32  ? 17.894  32.397  -87.838  1.00 30.24  ? 854  VAL D C   1 
ATOM   4562 O  O   . VAL D 1 32  ? 18.777  32.472  -88.689  1.00 30.24  ? 854  VAL D O   1 
ATOM   4563 C  CB  . VAL D 1 32  ? 18.442  34.462  -86.564  1.00 20.61  ? 854  VAL D CB  1 
ATOM   4564 C  CG1 . VAL D 1 32  ? 17.241  35.190  -87.191  1.00 20.61  ? 854  VAL D CG1 1 
ATOM   4565 C  CG2 . VAL D 1 32  ? 18.766  35.059  -85.202  1.00 20.61  ? 854  VAL D CG2 1 
ATOM   4566 N  N   . PRO D 1 33  ? 16.712  31.824  -88.094  1.00 30.44  ? 855  PRO D N   1 
ATOM   4567 C  CA  . PRO D 1 33  ? 15.620  31.688  -87.129  1.00 30.44  ? 855  PRO D CA  1 
ATOM   4568 C  C   . PRO D 1 33  ? 15.906  30.572  -86.134  1.00 30.44  ? 855  PRO D C   1 
ATOM   4569 O  O   . PRO D 1 33  ? 16.814  29.766  -86.334  1.00 30.44  ? 855  PRO D O   1 
ATOM   4570 C  CB  . PRO D 1 33  ? 14.428  31.367  -88.016  1.00 34.08  ? 855  PRO D CB  1 
ATOM   4571 C  CG  . PRO D 1 33  ? 15.048  30.481  -89.046  1.00 34.08  ? 855  PRO D CG  1 
ATOM   4572 C  CD  . PRO D 1 33  ? 16.341  31.216  -89.386  1.00 34.08  ? 855  PRO D CD  1 
ATOM   4573 N  N   . THR D 1 34  ? 15.123  30.534  -85.064  1.00 36.13  ? 856  THR D N   1 
ATOM   4574 C  CA  . THR D 1 34  ? 15.266  29.514  -84.037  1.00 36.13  ? 856  THR D CA  1 
ATOM   4575 C  C   . THR D 1 34  ? 14.724  28.182  -84.554  1.00 36.13  ? 856  THR D C   1 
ATOM   4576 O  O   . THR D 1 34  ? 13.658  28.145  -85.170  1.00 36.13  ? 856  THR D O   1 
ATOM   4577 C  CB  . THR D 1 34  ? 14.476  29.907  -82.768  1.00 32.95  ? 856  THR D CB  1 
ATOM   4578 O  OG1 . THR D 1 34  ? 15.110  31.026  -82.140  1.00 32.95  ? 856  THR D OG1 1 
ATOM   4579 C  CG2 . THR D 1 34  ? 14.408  28.747  -81.793  1.00 32.95  ? 856  THR D CG2 1 
ATOM   4580 N  N   . LEU D 1 35  ? 15.465  27.101  -84.318  1.00 36.73  ? 857  LEU D N   1 
ATOM   4581 C  CA  . LEU D 1 35  ? 15.032  25.767  -84.728  1.00 36.73  ? 857  LEU D CA  1 
ATOM   4582 C  C   . LEU D 1 35  ? 14.376  25.089  -83.535  1.00 36.73  ? 857  LEU D C   1 
ATOM   4583 O  O   . LEU D 1 35  ? 14.843  25.222  -82.404  1.00 36.73  ? 857  LEU D O   1 
ATOM   4584 C  CB  . LEU D 1 35  ? 16.214  24.920  -85.201  1.00 39.69  ? 857  LEU D CB  1 
ATOM   4585 C  CG  . LEU D 1 35  ? 16.724  25.162  -86.620  1.00 39.69  ? 857  LEU D CG  1 
ATOM   4586 C  CD1 . LEU D 1 35  ? 17.339  26.542  -86.716  1.00 39.69  ? 857  LEU D CD1 1 
ATOM   4587 C  CD2 . LEU D 1 35  ? 17.739  24.093  -86.977  1.00 39.69  ? 857  LEU D CD2 1 
ATOM   4588 N  N   . THR D 1 36  ? 13.296  24.358  -83.789  1.00 47.90  ? 858  THR D N   1 
ATOM   4589 C  CA  . THR D 1 36  ? 12.575  23.685  -82.718  1.00 47.90  ? 858  THR D CA  1 
ATOM   4590 C  C   . THR D 1 36  ? 13.352  22.506  -82.145  1.00 47.90  ? 858  THR D C   1 
ATOM   4591 O  O   . THR D 1 36  ? 13.292  22.236  -80.944  1.00 47.90  ? 858  THR D O   1 
ATOM   4592 C  CB  . THR D 1 36  ? 11.211  23.191  -83.200  1.00 58.20  ? 858  THR D CB  1 
ATOM   4593 O  OG1 . THR D 1 36  ? 10.598  24.207  -84.001  1.00 58.20  ? 858  THR D OG1 1 
ATOM   4594 C  CG2 . THR D 1 36  ? 10.315  22.896  -82.009  1.00 58.20  ? 858  THR D CG2 1 
ATOM   4595 N  N   . ASN D 1 37  ? 14.072  21.801  -83.010  1.00 56.68  ? 859  ASN D N   1 
ATOM   4596 C  CA  . ASN D 1 37  ? 14.878  20.663  -82.590  1.00 56.68  ? 859  ASN D CA  1 
ATOM   4597 C  C   . ASN D 1 37  ? 15.978  20.403  -83.605  1.00 56.68  ? 859  ASN D C   1 
ATOM   4598 O  O   . ASN D 1 37  ? 15.967  20.964  -84.698  1.00 56.68  ? 859  ASN D O   1 
ATOM   4599 C  CB  . ASN D 1 37  ? 13.999  19.419  -82.395  1.00 93.56  ? 859  ASN D CB  1 
ATOM   4600 C  CG  . ASN D 1 37  ? 13.081  19.159  -83.569  1.00 93.56  ? 859  ASN D CG  1 
ATOM   4601 O  OD1 . ASN D 1 37  ? 11.891  18.897  -83.391  1.00 93.56  ? 859  ASN D OD1 1 
ATOM   4602 N  ND2 . ASN D 1 37  ? 13.628  19.220  -84.777  1.00 93.56  ? 859  ASN D ND2 1 
ATOM   4603 N  N   . PHE D 1 38  ? 16.932  19.558  -83.240  1.00 53.23  ? 860  PHE D N   1 
ATOM   4604 C  CA  . PHE D 1 38  ? 18.050  19.264  -84.120  1.00 53.23  ? 860  PHE D CA  1 
ATOM   4605 C  C   . PHE D 1 38  ? 17.697  18.480  -85.365  1.00 53.23  ? 860  PHE D C   1 
ATOM   4606 O  O   . PHE D 1 38  ? 16.854  17.585  -85.338  1.00 53.23  ? 860  PHE D O   1 
ATOM   4607 C  CB  . PHE D 1 38  ? 19.143  18.517  -83.360  1.00 56.86  ? 860  PHE D CB  1 
ATOM   4608 C  CG  . PHE D 1 38  ? 19.649  19.257  -82.172  1.00 56.86  ? 860  PHE D CG  1 
ATOM   4609 C  CD1 . PHE D 1 38  ? 18.943  19.237  -80.976  1.00 56.86  ? 860  PHE D CD1 1 
ATOM   4610 C  CD2 . PHE D 1 38  ? 20.805  20.020  -82.261  1.00 56.86  ? 860  PHE D CD2 1 
ATOM   4611 C  CE1 . PHE D 1 38  ? 19.380  19.968  -79.881  1.00 56.86  ? 860  PHE D CE1 1 
ATOM   4612 C  CE2 . PHE D 1 38  ? 21.252  20.757  -81.174  1.00 56.86  ? 860  PHE D CE2 1 
ATOM   4613 C  CZ  . PHE D 1 38  ? 20.539  20.732  -79.981  1.00 56.86  ? 860  PHE D CZ  1 
ATOM   4614 N  N   . PRO D 1 39  ? 18.353  18.814  -86.483  1.00 76.27  ? 861  PRO D N   1 
ATOM   4615 C  CA  . PRO D 1 39  ? 18.128  18.146  -87.763  1.00 76.27  ? 861  PRO D CA  1 
ATOM   4616 C  C   . PRO D 1 39  ? 19.014  16.916  -87.843  1.00 76.27  ? 861  PRO D C   1 
ATOM   4617 O  O   . PRO D 1 39  ? 20.090  16.880  -87.244  1.00 76.27  ? 861  PRO D O   1 
ATOM   4618 C  CB  . PRO D 1 39  ? 18.557  19.195  -88.797  1.00 63.33  ? 861  PRO D CB  1 
ATOM   4619 C  CG  . PRO D 1 39  ? 18.841  20.459  -87.995  1.00 63.33  ? 861  PRO D CG  1 
ATOM   4620 C  CD  . PRO D 1 39  ? 19.263  19.954  -86.658  1.00 63.33  ? 861  PRO D CD  1 
ATOM   4621 N  N   . SER D 1 40  ? 18.560  15.906  -88.571  1.00 82.24  ? 862  SER D N   1 
ATOM   4622 C  CA  . SER D 1 40  ? 19.362  14.710  -88.743  1.00 82.24  ? 862  SER D CA  1 
ATOM   4623 C  C   . SER D 1 40  ? 19.958  14.850  -90.136  1.00 82.24  ? 862  SER D C   1 
ATOM   4624 O  O   . SER D 1 40  ? 19.235  14.877  -91.132  1.00 82.24  ? 862  SER D O   1 
ATOM   4625 C  CB  . SER D 1 40  ? 18.502  13.451  -88.654  1.00 87.69  ? 862  SER D CB  1 
ATOM   4626 O  OG  . SER D 1 40  ? 19.317  12.302  -88.488  1.00 87.69  ? 862  SER D OG  1 
ATOM   4627 N  N   . GLY D 1 41  ? 21.278  14.971  -90.196  1.00 68.66  ? 863  GLY D N   1 
ATOM   4628 C  CA  . GLY D 1 41  ? 21.945  15.125  -91.472  1.00 68.66  ? 863  GLY D CA  1 
ATOM   4629 C  C   . GLY D 1 41  ? 22.464  16.537  -91.672  1.00 68.66  ? 863  GLY D C   1 
ATOM   4630 O  O   . GLY D 1 41  ? 22.322  17.395  -90.804  1.00 68.66  ? 863  GLY D O   1 
ATOM   4631 N  N   . GLU D 1 42  ? 23.069  16.765  -92.830  1.00 68.42  ? 864  GLU D N   1 
ATOM   4632 C  CA  . GLU D 1 42  ? 23.657  18.049  -93.198  1.00 69.14  ? 864  GLU D CA  1 
ATOM   4633 C  C   . GLU D 1 42  ? 22.830  19.265  -92.776  1.00 67.93  ? 864  GLU D C   1 
ATOM   4634 O  O   . GLU D 1 42  ? 21.618  19.316  -92.991  1.00 68.00  ? 864  GLU D O   1 
ATOM   4635 C  CB  . GLU D 1 42  ? 23.851  18.098  -94.710  1.00 108.51 ? 864  GLU D CB  1 
ATOM   4636 C  CG  . GLU D 1 42  ? 25.114  18.796  -95.166  1.00 111.22 ? 864  GLU D CG  1 
ATOM   4637 C  CD  . GLU D 1 42  ? 26.149  17.817  -95.673  1.00 114.77 ? 864  GLU D CD  1 
ATOM   4638 O  OE1 . GLU D 1 42  ? 27.176  18.266  -96.224  1.00 115.53 ? 864  GLU D OE1 1 
ATOM   4639 O  OE2 . GLU D 1 42  ? 25.932  16.595  -95.523  1.00 115.09 ? 864  GLU D OE2 1 
ATOM   4640 N  N   . TRP D 1 43  ? 23.497  20.246  -92.178  1.00 68.58  ? 865  TRP D N   1 
ATOM   4641 C  CA  . TRP D 1 43  ? 22.846  21.483  -91.756  1.00 66.55  ? 865  TRP D CA  1 
ATOM   4642 C  C   . TRP D 1 43  ? 23.690  22.684  -92.162  1.00 64.46  ? 865  TRP D C   1 
ATOM   4643 O  O   . TRP D 1 43  ? 24.898  22.719  -91.930  1.00 64.83  ? 865  TRP D O   1 
ATOM   4644 C  CB  . TRP D 1 43  ? 22.600  21.492  -90.236  1.00 52.16  ? 865  TRP D CB  1 
ATOM   4645 C  CG  . TRP D 1 43  ? 22.934  22.806  -89.547  1.00 55.07  ? 865  TRP D CG  1 
ATOM   4646 C  CD1 . TRP D 1 43  ? 24.167  23.218  -89.127  1.00 54.30  ? 865  TRP D CD1 1 
ATOM   4647 C  CD2 . TRP D 1 43  ? 22.030  23.871  -89.226  1.00 55.32  ? 865  TRP D CD2 1 
ATOM   4648 N  NE1 . TRP D 1 43  ? 24.091  24.469  -88.567  1.00 58.85  ? 865  TRP D NE1 1 
ATOM   4649 C  CE2 . TRP D 1 43  ? 22.791  24.896  -88.614  1.00 58.37  ? 865  TRP D CE2 1 
ATOM   4650 C  CE3 . TRP D 1 43  ? 20.655  24.063  -89.396  1.00 56.25  ? 865  TRP D CE3 1 
ATOM   4651 C  CZ2 . TRP D 1 43  ? 22.222  26.092  -88.171  1.00 58.63  ? 865  TRP D CZ2 1 
ATOM   4652 C  CZ3 . TRP D 1 43  ? 20.091  25.252  -88.955  1.00 59.31  ? 865  TRP D CZ3 1 
ATOM   4653 C  CH2 . TRP D 1 43  ? 20.875  26.252  -88.349  1.00 59.67  ? 865  TRP D CH2 1 
ATOM   4654 N  N   . ILE D 1 44  ? 23.040  23.661  -92.783  1.00 44.63  ? 866  ILE D N   1 
ATOM   4655 C  CA  . ILE D 1 44  ? 23.714  24.873  -93.216  1.00 41.79  ? 866  ILE D CA  1 
ATOM   4656 C  C   . ILE D 1 44  ? 23.136  26.014  -92.383  1.00 39.72  ? 866  ILE D C   1 
ATOM   4657 O  O   . ILE D 1 44  ? 21.925  26.068  -92.162  1.00 38.90  ? 866  ILE D O   1 
ATOM   4658 C  CB  . ILE D 1 44  ? 23.459  25.149  -94.713  1.00 47.87  ? 866  ILE D CB  1 
ATOM   4659 C  CG1 . ILE D 1 44  ? 23.788  23.906  -95.543  1.00 50.76  ? 866  ILE D CG1 1 
ATOM   4660 C  CG2 . ILE D 1 44  ? 24.323  26.303  -95.183  1.00 46.68  ? 866  ILE D CG2 1 
ATOM   4661 C  CD1 . ILE D 1 44  ? 25.269  23.567  -95.592  1.00 56.10  ? 866  ILE D CD1 1 
ATOM   4662 N  N   . CYS D 1 45  ? 23.993  26.917  -91.910  1.00 35.01  ? 867  CYS D N   1 
ATOM   4663 C  CA  . CYS D 1 45  ? 23.522  28.029  -91.090  1.00 31.67  ? 867  CYS D CA  1 
ATOM   4664 C  C   . CYS D 1 45  ? 23.006  29.166  -91.959  1.00 29.67  ? 867  CYS D C   1 
ATOM   4665 O  O   . CYS D 1 45  ? 23.190  29.166  -93.173  1.00 29.91  ? 867  CYS D O   1 
ATOM   4666 C  CB  . CYS D 1 45  ? 24.636  28.533  -90.159  1.00 34.70  ? 867  CYS D CB  1 
ATOM   4667 S  SG  . CYS D 1 45  ? 25.795  29.704  -90.883  1.00 34.19  ? 867  CYS D SG  1 
ATOM   4668 N  N   . THR D 1 46  ? 22.356  30.130  -91.319  1.00 32.88  ? 868  THR D N   1 
ATOM   4669 C  CA  . THR D 1 46  ? 21.781  31.283  -91.997  1.00 31.31  ? 868  THR D CA  1 
ATOM   4670 C  C   . THR D 1 46  ? 22.806  32.147  -92.728  1.00 31.09  ? 868  THR D C   1 
ATOM   4671 O  O   . THR D 1 46  ? 22.468  32.837  -93.694  1.00 31.03  ? 868  THR D O   1 
ATOM   4672 C  CB  . THR D 1 46  ? 20.981  32.147  -90.987  1.00 30.38  ? 868  THR D CB  1 
ATOM   4673 O  OG1 . THR D 1 46  ? 19.681  31.568  -90.805  1.00 30.09  ? 868  THR D OG1 1 
ATOM   4674 C  CG2 . THR D 1 46  ? 20.838  33.583  -91.468  1.00 31.13  ? 868  THR D CG2 1 
ATOM   4675 N  N   . PHE D 1 47  ? 24.051  32.123  -92.264  1.00 29.56  ? 869  PHE D N   1 
ATOM   4676 C  CA  . PHE D 1 47  ? 25.103  32.909  -92.901  1.00 31.28  ? 869  PHE D CA  1 
ATOM   4677 C  C   . PHE D 1 47  ? 25.493  32.277  -94.228  1.00 31.85  ? 869  PHE D C   1 
ATOM   4678 O  O   . PHE D 1 47  ? 25.722  32.969  -95.224  1.00 30.55  ? 869  PHE D O   1 
ATOM   4679 C  CB  . PHE D 1 47  ? 26.357  32.963  -92.019  1.00 30.75  ? 869  PHE D CB  1 
ATOM   4680 C  CG  . PHE D 1 47  ? 26.222  33.840  -90.813  1.00 28.87  ? 869  PHE D CG  1 
ATOM   4681 C  CD1 . PHE D 1 47  ? 25.852  35.175  -90.945  1.00 33.11  ? 869  PHE D CD1 1 
ATOM   4682 C  CD2 . PHE D 1 47  ? 26.487  33.338  -89.540  1.00 33.05  ? 869  PHE D CD2 1 
ATOM   4683 C  CE1 . PHE D 1 47  ? 25.748  36.000  -89.824  1.00 31.03  ? 869  PHE D CE1 1 
ATOM   4684 C  CE2 . PHE D 1 47  ? 26.387  34.156  -88.418  1.00 32.13  ? 869  PHE D CE2 1 
ATOM   4685 C  CZ  . PHE D 1 47  ? 26.017  35.489  -88.562  1.00 30.61  ? 869  PHE D CZ  1 
ATOM   4686 N  N   . CYS D 1 48  ? 25.561  30.950  -94.220  1.00 34.89  ? 870  CYS D N   1 
ATOM   4687 C  CA  . CYS D 1 48  ? 25.976  30.181  -95.384  1.00 38.48  ? 870  CYS D CA  1 
ATOM   4688 C  C   . CYS D 1 48  ? 24.885  29.797  -96.378  1.00 39.29  ? 870  CYS D C   1 
ATOM   4689 O  O   . CYS D 1 48  ? 25.142  29.735  -97.581  1.00 40.46  ? 870  CYS D O   1 
ATOM   4690 C  CB  . CYS D 1 48  ? 26.702  28.921  -94.906  1.00 35.26  ? 870  CYS D CB  1 
ATOM   4691 S  SG  . CYS D 1 48  ? 28.100  29.265  -93.798  1.00 40.05  ? 870  CYS D SG  1 
ATOM   4692 N  N   . ARG D 1 49  ? 23.676  29.543  -95.885  1.00 42.80  ? 871  ARG D N   1 
ATOM   4693 C  CA  . ARG D 1 49  ? 22.569  29.139  -96.752  1.00 44.73  ? 871  ARG D CA  1 
ATOM   4694 C  C   . ARG D 1 49  ? 22.263  30.163  -97.842  1.00 45.75  ? 871  ARG D C   1 
ATOM   4695 O  O   . ARG D 1 49  ? 22.340  31.370  -97.618  1.00 47.35  ? 871  ARG D O   1 
ATOM   4696 C  CB  . ARG D 1 49  ? 21.311  28.877  -95.918  1.00 36.93  ? 871  ARG D CB  1 
ATOM   4697 C  CG  . ARG D 1 49  ? 20.276  28.015  -96.629  1.00 37.68  ? 871  ARG D CG  1 
ATOM   4698 C  CD  . ARG D 1 49  ? 19.039  27.762  -95.771  1.00 39.02  ? 871  ARG D CD  1 
ATOM   4699 N  NE  . ARG D 1 49  ? 18.284  28.985  -95.510  1.00 42.98  ? 871  ARG D NE  1 
ATOM   4700 C  CZ  . ARG D 1 49  ? 17.111  29.027  -94.884  1.00 41.92  ? 871  ARG D CZ  1 
ATOM   4701 N  NH1 . ARG D 1 49  ? 16.545  27.912  -94.446  1.00 45.54  ? 871  ARG D NH1 1 
ATOM   4702 N  NH2 . ARG D 1 49  ? 16.504  30.190  -94.697  1.00 40.46  ? 871  ARG D NH2 1 
ATOM   4703 N  N   . ASP D 1 50  ? 21.917  29.675  -99.029  1.00 40.19  ? 872  ASP D N   1 
ATOM   4704 C  CA  . ASP D 1 50  ? 21.610  30.553  -100.151 1.00 41.27  ? 872  ASP D CA  1 
ATOM   4705 C  C   . ASP D 1 50  ? 20.301  31.308  -99.910  1.00 40.78  ? 872  ASP D C   1 
ATOM   4706 O  O   . ASP D 1 50  ? 19.318  30.729  -99.456  1.00 39.68  ? 872  ASP D O   1 
ATOM   4707 C  CB  . ASP D 1 50  ? 21.507  29.727  -101.435 1.00 51.98  ? 872  ASP D CB  1 
ATOM   4708 C  CG  . ASP D 1 50  ? 21.760  30.551  -102.676 1.00 56.13  ? 872  ASP D CG  1 
ATOM   4709 O  OD1 . ASP D 1 50  ? 20.946  31.447  -102.985 1.00 59.59  ? 872  ASP D OD1 1 
ATOM   4710 O  OD2 . ASP D 1 50  ? 22.788  30.303  -103.339 1.00 61.85  ? 872  ASP D OD2 1 
ATOM   4711 N  N   . LEU D 1 51  ? 20.293  32.602  -100.215 1.00 41.41  ? 873  LEU D N   1 
ATOM   4712 C  CA  . LEU D 1 51  ? 19.099  33.420  -100.025 1.00 41.59  ? 873  LEU D CA  1 
ATOM   4713 C  C   . LEU D 1 51  ? 17.990  33.130  -101.038 1.00 44.00  ? 873  LEU D C   1 
ATOM   4714 O  O   . LEU D 1 51  ? 16.810  33.100  -100.683 1.00 42.65  ? 873  LEU D O   1 
ATOM   4715 C  CB  . LEU D 1 51  ? 19.461  34.906  -100.091 1.00 36.06  ? 873  LEU D CB  1 
ATOM   4716 C  CG  . LEU D 1 51  ? 20.328  35.496  -98.977  1.00 32.63  ? 873  LEU D CG  1 
ATOM   4717 C  CD1 . LEU D 1 51  ? 20.758  36.890  -99.381  1.00 22.46  ? 873  LEU D CD1 1 
ATOM   4718 C  CD2 . LEU D 1 51  ? 19.560  35.533  -97.661  1.00 27.21  ? 873  LEU D CD2 1 
ATOM   4719 N  N   . SER D 1 52  ? 18.371  32.920  -102.296 1.00 44.38  ? 874  SER D N   1 
ATOM   4720 C  CA  . SER D 1 52  ? 17.410  32.651  -103.369 1.00 46.93  ? 874  SER D CA  1 
ATOM   4721 C  C   . SER D 1 52  ? 16.706  31.310  -103.226 1.00 47.62  ? 874  SER D C   1 
ATOM   4722 O  O   . SER D 1 52  ? 15.490  31.248  -103.079 1.00 48.48  ? 874  SER D O   1 
ATOM   4723 C  CB  . SER D 1 52  ? 18.110  32.702  -104.727 1.00 86.68  ? 874  SER D CB  1 
ATOM   4724 O  OG  . SER D 1 52  ? 18.855  33.897  -104.867 1.00 87.78  ? 874  SER D OG  1 
ATOM   4725 N  N   . LYS D 1 53  ? 17.476  30.233  -103.285 1.00 52.98  ? 875  LYS D N   1 
ATOM   4726 C  CA  . LYS D 1 53  ? 16.918  28.898  -103.151 1.00 54.40  ? 875  LYS D CA  1 
ATOM   4727 C  C   . LYS D 1 53  ? 17.716  28.131  -102.105 1.00 54.96  ? 875  LYS D C   1 
ATOM   4728 O  O   . LYS D 1 53  ? 18.745  27.525  -102.411 1.00 54.93  ? 875  LYS D O   1 
ATOM   4729 C  CB  . LYS D 1 53  ? 16.948  28.167  -104.499 1.00 78.86  ? 875  LYS D CB  1 
ATOM   4730 C  CG  . LYS D 1 53  ? 16.051  28.797  -105.564 1.00 81.82  ? 875  LYS D CG  1 
ATOM   4731 C  CD  . LYS D 1 53  ? 16.795  29.824  -106.403 1.00 84.77  ? 875  LYS D CD  1 
ATOM   4732 C  CE  . LYS D 1 53  ? 17.701  29.145  -107.424 1.00 87.18  ? 875  LYS D CE  1 
ATOM   4733 N  NZ  . LYS D 1 53  ? 16.914  28.425  -108.469 1.00 86.75  ? 875  LYS D NZ  1 
ATOM   4734 N  N   . PRO D 1 54  ? 17.249  28.159  -100.844 1.00 52.23  ? 876  PRO D N   1 
ATOM   4735 C  CA  . PRO D 1 54  ? 17.907  27.474  -99.727  1.00 52.56  ? 876  PRO D CA  1 
ATOM   4736 C  C   . PRO D 1 54  ? 18.061  25.976  -99.934  1.00 52.87  ? 876  PRO D C   1 
ATOM   4737 O  O   . PRO D 1 54  ? 17.101  25.281  -100.265 1.00 52.63  ? 876  PRO D O   1 
ATOM   4738 C  CB  . PRO D 1 54  ? 16.997  27.791  -98.544  1.00 62.57  ? 876  PRO D CB  1 
ATOM   4739 C  CG  . PRO D 1 54  ? 16.421  29.116  -98.909  1.00 62.92  ? 876  PRO D CG  1 
ATOM   4740 C  CD  . PRO D 1 54  ? 16.083  28.920  -100.364 1.00 62.70  ? 876  PRO D CD  1 
ATOM   4741 N  N   . GLU D 1 55  ? 19.276  25.487  -99.716  1.00 68.54  ? 877  GLU D N   1 
ATOM   4742 C  CA  . GLU D 1 55  ? 19.571  24.073  -99.873  1.00 69.10  ? 877  GLU D CA  1 
ATOM   4743 C  C   . GLU D 1 55  ? 18.901  23.250  -98.779  1.00 68.61  ? 877  GLU D C   1 
ATOM   4744 O  O   . GLU D 1 55  ? 18.808  22.028  -98.881  1.00 68.84  ? 877  GLU D O   1 
ATOM   4745 C  CB  . GLU D 1 55  ? 21.084  23.842  -99.843  1.00 67.47  ? 877  GLU D CB  1 
ATOM   4746 C  CG  . GLU D 1 55  ? 21.848  24.615  -100.907 1.00 68.20  ? 877  GLU D CG  1 
ATOM   4747 C  CD  . GLU D 1 55  ? 22.263  26.009  -100.456 1.00 67.54  ? 877  GLU D CD  1 
ATOM   4748 O  OE1 . GLU D 1 55  ? 21.405  26.781  -99.974  1.00 64.12  ? 877  GLU D OE1 1 
ATOM   4749 O  OE2 . GLU D 1 55  ? 23.460  26.335  -100.592 1.00 70.25  ? 877  GLU D OE2 1 
ATOM   4750 N  N   . VAL D 1 56  ? 18.442  23.918  -97.726  1.00 58.78  ? 878  VAL D N   1 
ATOM   4751 C  CA  . VAL D 1 56  ? 17.776  23.220  -96.632  1.00 58.25  ? 878  VAL D CA  1 
ATOM   4752 C  C   . VAL D 1 56  ? 16.692  24.091  -95.997  1.00 58.38  ? 878  VAL D C   1 
ATOM   4753 O  O   . VAL D 1 56  ? 16.799  25.318  -95.986  1.00 57.06  ? 878  VAL D O   1 
ATOM   4754 C  CB  . VAL D 1 56  ? 18.790  22.790  -95.520  1.00 59.10  ? 878  VAL D CB  1 
ATOM   4755 C  CG1 . VAL D 1 56  ? 20.044  22.193  -96.147  1.00 59.51  ? 878  VAL D CG1 1 
ATOM   4756 C  CG2 . VAL D 1 56  ? 19.146  23.970  -94.631  1.00 59.56  ? 878  VAL D CG2 1 
ATOM   4757 N  N   . GLU D 1 57  ? 15.638  23.454  -95.494  1.00 55.63  ? 879  GLU D N   1 
ATOM   4758 C  CA  . GLU D 1 57  ? 14.563  24.180  -94.826  1.00 56.52  ? 879  GLU D CA  1 
ATOM   4759 C  C   . GLU D 1 57  ? 14.724  23.921  -93.339  1.00 55.55  ? 879  GLU D C   1 
ATOM   4760 O  O   . GLU D 1 57  ? 15.146  22.841  -92.937  1.00 55.15  ? 879  GLU D O   1 
ATOM   4761 C  CB  . GLU D 1 57  ? 13.183  23.709  -95.295  1.00 89.21  ? 879  GLU D CB  1 
ATOM   4762 C  CG  . GLU D 1 57  ? 12.725  24.334  -96.606  1.00 92.55  ? 879  GLU D CG  1 
ATOM   4763 C  CD  . GLU D 1 57  ? 11.213  24.412  -96.717  1.00 95.94  ? 879  GLU D CD  1 
ATOM   4764 O  OE1 . GLU D 1 57  ? 10.524  23.631  -96.027  1.00 94.96  ? 879  GLU D OE1 1 
ATOM   4765 O  OE2 . GLU D 1 57  ? 10.712  25.248  -97.500  1.00 98.41  ? 879  GLU D OE2 1 
ATOM   4766 N  N   . TYR D 1 58  ? 14.393  24.908  -92.517  1.00 76.46  ? 880  TYR D N   1 
ATOM   4767 C  CA  . TYR D 1 58  ? 14.559  24.752  -91.082  1.00 76.46  ? 880  TYR D CA  1 
ATOM   4768 C  C   . TYR D 1 58  ? 13.432  24.030  -90.352  1.00 76.46  ? 880  TYR D C   1 
ATOM   4769 O  O   . TYR D 1 58  ? 13.706  23.118  -89.573  1.00 76.46  ? 880  TYR D O   1 
ATOM   4770 C  CB  . TYR D 1 58  ? 14.861  26.120  -90.460  1.00 34.79  ? 880  TYR D CB  1 
ATOM   4771 C  CG  . TYR D 1 58  ? 16.207  26.654  -90.913  1.00 34.79  ? 880  TYR D CG  1 
ATOM   4772 C  CD1 . TYR D 1 58  ? 16.392  28.009  -91.195  1.00 34.79  ? 880  TYR D CD1 1 
ATOM   4773 C  CD2 . TYR D 1 58  ? 17.294  25.792  -91.091  1.00 34.79  ? 880  TYR D CD2 1 
ATOM   4774 C  CE1 . TYR D 1 58  ? 17.630  28.490  -91.648  1.00 34.79  ? 880  TYR D CE1 1 
ATOM   4775 C  CE2 . TYR D 1 58  ? 18.523  26.259  -91.539  1.00 34.79  ? 880  TYR D CE2 1 
ATOM   4776 C  CZ  . TYR D 1 58  ? 18.688  27.607  -91.818  1.00 34.79  ? 880  TYR D CZ  1 
ATOM   4777 O  OH  . TYR D 1 58  ? 19.910  28.061  -92.275  1.00 34.79  ? 880  TYR D OH  1 
ATOM   4778 N  N   . ASP D 1 59  ? 12.185  24.421  -90.607  1.00 87.50  ? 881  ASP D N   1 
ATOM   4779 C  CA  . ASP D 1 59  ? 11.010  23.794  -89.986  1.00 87.50  ? 881  ASP D CA  1 
ATOM   4780 C  C   . ASP D 1 59  ? 9.892   24.801  -89.742  1.00 87.50  ? 881  ASP D C   1 
ATOM   4781 O  O   . ASP D 1 59  ? 9.035   24.591  -88.881  1.00 87.50  ? 881  ASP D O   1 
ATOM   4782 C  CB  . ASP D 1 59  ? 11.371  23.120  -88.654  1.00 112.71 ? 881  ASP D CB  1 
ATOM   4783 C  CG  . ASP D 1 59  ? 11.797  24.114  -87.588  1.00 112.71 ? 881  ASP D CG  1 
ATOM   4784 O  OD1 . ASP D 1 59  ? 12.290  23.677  -86.527  1.00 112.71 ? 881  ASP D OD1 1 
ATOM   4785 O  OD2 . ASP D 1 59  ? 11.635  25.333  -87.807  1.00 112.71 ? 881  ASP D OD2 1 
ATOM   4786 N  N   . LYS D 1 70  ? -3.202  27.545  -101.177 1.00 65.68  ? 892  LYS D N   1 
ATOM   4787 C  CA  . LYS D 1 70  ? -3.931  28.243  -100.121 1.00 65.68  ? 892  LYS D CA  1 
ATOM   4788 C  C   . LYS D 1 70  ? -3.402  29.667  -100.010 1.00 65.68  ? 892  LYS D C   1 
ATOM   4789 O  O   . LYS D 1 70  ? -2.711  30.004  -99.051  1.00 65.68  ? 892  LYS D O   1 
ATOM   4790 C  CB  . LYS D 1 70  ? -3.726  27.530  -98.785  1.00 90.43  ? 892  LYS D CB  1 
ATOM   4791 C  CG  . LYS D 1 70  ? -3.092  26.154  -98.908  1.00 90.43  ? 892  LYS D CG  1 
ATOM   4792 C  CD  . LYS D 1 70  ? -2.717  25.593  -97.547  1.00 90.43  ? 892  LYS D CD  1 
ATOM   4793 C  CE  . LYS D 1 70  ? -2.155  24.184  -97.663  1.00 90.43  ? 892  LYS D CE  1 
ATOM   4794 N  NZ  . LYS D 1 70  ? -1.471  23.762  -96.406  1.00 90.43  ? 892  LYS D NZ  1 
ATOM   4795 N  N   . LYS D 1 71  ? -3.732  30.505  -100.985 1.00 46.34  ? 893  LYS D N   1 
ATOM   4796 C  CA  . LYS D 1 71  ? -3.243  31.878  -100.985 1.00 46.34  ? 893  LYS D CA  1 
ATOM   4797 C  C   . LYS D 1 71  ? -4.038  32.829  -100.106 1.00 46.34  ? 893  LYS D C   1 
ATOM   4798 O  O   . LYS D 1 71  ? -5.260  32.913  -100.203 1.00 46.34  ? 893  LYS D O   1 
ATOM   4799 C  CB  . LYS D 1 71  ? -3.192  32.399  -102.419 1.00 34.71  ? 893  LYS D CB  1 
ATOM   4800 C  CG  . LYS D 1 71  ? -2.110  31.708  -103.232 1.00 34.71  ? 893  LYS D CG  1 
ATOM   4801 C  CD  . LYS D 1 71  ? -2.188  32.039  -104.701 1.00 34.71  ? 893  LYS D CD  1 
ATOM   4802 C  CE  . LYS D 1 71  ? -1.113  31.277  -105.454 1.00 34.71  ? 893  LYS D CE  1 
ATOM   4803 N  NZ  . LYS D 1 71  ? -1.223  29.809  -105.198 1.00 34.71  ? 893  LYS D NZ  1 
ATOM   4804 N  N   . THR D 1 72  ? -3.327  33.546  -99.241  1.00 39.25  ? 894  THR D N   1 
ATOM   4805 C  CA  . THR D 1 72  ? -3.956  34.499  -98.338  1.00 39.57  ? 894  THR D CA  1 
ATOM   4806 C  C   . THR D 1 72  ? -4.256  35.805  -99.054  1.00 38.90  ? 894  THR D C   1 
ATOM   4807 O  O   . THR D 1 72  ? -3.369  36.441  -99.626  1.00 37.82  ? 894  THR D O   1 
ATOM   4808 C  CB  . THR D 1 72  ? -3.063  34.796  -97.124  1.00 41.09  ? 894  THR D CB  1 
ATOM   4809 O  OG1 . THR D 1 72  ? -2.831  33.582  -96.404  1.00 40.84  ? 894  THR D OG1 1 
ATOM   4810 C  CG2 . THR D 1 72  ? -3.736  35.807  -96.205  1.00 42.59  ? 894  THR D CG2 1 
ATOM   4811 N  N   . GLU D 1 73  ? -5.520  36.202  -98.996  1.00 34.47  ? 895  GLU D N   1 
ATOM   4812 C  CA  . GLU D 1 73  ? -5.984  37.415  -99.644  1.00 33.68  ? 895  GLU D CA  1 
ATOM   4813 C  C   . GLU D 1 73  ? -5.839  38.651  -98.764  1.00 33.60  ? 895  GLU D C   1 
ATOM   4814 O  O   . GLU D 1 73  ? -5.726  38.545  -97.544  1.00 32.87  ? 895  GLU D O   1 
ATOM   4815 C  CB  . GLU D 1 73  ? -7.442  37.227  -100.048 1.00 39.45  ? 895  GLU D CB  1 
ATOM   4816 C  CG  . GLU D 1 73  ? -7.648  36.060  -100.994 1.00 40.11  ? 895  GLU D CG  1 
ATOM   4817 C  CD  . GLU D 1 73  ? -9.087  35.605  -101.044 1.00 45.90  ? 895  GLU D CD  1 
ATOM   4818 O  OE1 . GLU D 1 73  ? -9.983  36.472  -100.980 1.00 45.00  ? 895  GLU D OE1 1 
ATOM   4819 O  OE2 . GLU D 1 73  ? -9.323  34.382  -101.158 1.00 49.25  ? 895  GLU D OE2 1 
ATOM   4820 N  N   . GLY D 1 74  ? -5.838  39.818  -99.403  1.00 30.35  ? 896  GLY D N   1 
ATOM   4821 C  CA  . GLY D 1 74  ? -5.715  41.079  -98.695  1.00 30.53  ? 896  GLY D CA  1 
ATOM   4822 C  C   . GLY D 1 74  ? -4.579  41.163  -97.692  1.00 31.45  ? 896  GLY D C   1 
ATOM   4823 O  O   . GLY D 1 74  ? -4.717  41.788  -96.641  1.00 31.76  ? 896  GLY D O   1 
ATOM   4824 N  N   . LEU D 1 75  ? -3.446  40.550  -98.005  1.00 30.94  ? 897  LEU D N   1 
ATOM   4825 C  CA  . LEU D 1 75  ? -2.324  40.589  -97.081  1.00 31.26  ? 897  LEU D CA  1 
ATOM   4826 C  C   . LEU D 1 75  ? -0.974  40.609  -97.780  1.00 30.34  ? 897  LEU D C   1 
ATOM   4827 O  O   . LEU D 1 75  ? -0.677  39.740  -98.597  1.00 29.31  ? 897  LEU D O   1 
ATOM   4828 C  CB  . LEU D 1 75  ? -2.375  39.386  -96.144  1.00 35.62  ? 897  LEU D CB  1 
ATOM   4829 C  CG  . LEU D 1 75  ? -1.261  39.405  -95.101  1.00 38.10  ? 897  LEU D CG  1 
ATOM   4830 C  CD1 . LEU D 1 75  ? -1.411  40.646  -94.240  1.00 37.91  ? 897  LEU D CD1 1 
ATOM   4831 C  CD2 . LEU D 1 75  ? -1.320  38.149  -94.257  1.00 40.28  ? 897  LEU D CD2 1 
ATOM   4832 N  N   . VAL D 1 76  ? -0.163  41.607  -97.450  1.00 28.45  ? 898  VAL D N   1 
ATOM   4833 C  CA  . VAL D 1 76  ? 1.166   41.729  -98.024  1.00 29.20  ? 898  VAL D CA  1 
ATOM   4834 C  C   . VAL D 1 76  ? 2.171   41.180  -97.012  1.00 28.43  ? 898  VAL D C   1 
ATOM   4835 O  O   . VAL D 1 76  ? 2.229   41.641  -95.874  1.00 29.44  ? 898  VAL D O   1 
ATOM   4836 C  CB  . VAL D 1 76  ? 1.513   43.196  -98.323  1.00 33.06  ? 898  VAL D CB  1 
ATOM   4837 C  CG1 . VAL D 1 76  ? 2.892   43.280  -98.970  1.00 33.07  ? 898  VAL D CG1 1 
ATOM   4838 C  CG2 . VAL D 1 76  ? 0.458   43.805  -99.231  1.00 36.19  ? 898  VAL D CG2 1 
ATOM   4839 N  N   . LYS D 1 77  ? 2.949   40.187  -97.425  1.00 30.06  ? 899  LYS D N   1 
ATOM   4840 C  CA  . LYS D 1 77  ? 3.955   39.586  -96.552  1.00 29.30  ? 899  LYS D CA  1 
ATOM   4841 C  C   . LYS D 1 77  ? 5.343   39.704  -97.188  1.00 27.57  ? 899  LYS D C   1 
ATOM   4842 O  O   . LYS D 1 77  ? 5.464   39.782  -98.408  1.00 25.63  ? 899  LYS D O   1 
ATOM   4843 C  CB  . LYS D 1 77  ? 3.603   38.115  -96.318  1.00 41.08  ? 899  LYS D CB  1 
ATOM   4844 C  CG  . LYS D 1 77  ? 2.170   37.927  -95.849  1.00 44.84  ? 899  LYS D CG  1 
ATOM   4845 C  CD  . LYS D 1 77  ? 1.627   36.537  -96.146  1.00 48.89  ? 899  LYS D CD  1 
ATOM   4846 C  CE  . LYS D 1 77  ? 2.246   35.471  -95.266  1.00 51.44  ? 899  LYS D CE  1 
ATOM   4847 N  NZ  . LYS D 1 77  ? 1.523   34.180  -95.453  1.00 53.24  ? 899  LYS D NZ  1 
ATOM   4848 N  N   . LEU D 1 78  ? 6.388   39.735  -96.365  1.00 29.40  ? 900  LEU D N   1 
ATOM   4849 C  CA  . LEU D 1 78  ? 7.753   39.819  -96.880  1.00 28.14  ? 900  LEU D CA  1 
ATOM   4850 C  C   . LEU D 1 78  ? 8.008   38.656  -97.829  1.00 28.49  ? 900  LEU D C   1 
ATOM   4851 O  O   . LEU D 1 78  ? 7.552   37.539  -97.584  1.00 27.22  ? 900  LEU D O   1 
ATOM   4852 C  CB  . LEU D 1 78  ? 8.774   39.734  -95.737  1.00 25.65  ? 900  LEU D CB  1 
ATOM   4853 C  CG  . LEU D 1 78  ? 8.863   40.864  -94.715  1.00 25.63  ? 900  LEU D CG  1 
ATOM   4854 C  CD1 . LEU D 1 78  ? 9.845   40.475  -93.615  1.00 25.18  ? 900  LEU D CD1 1 
ATOM   4855 C  CD2 . LEU D 1 78  ? 9.306   42.139  -95.403  1.00 25.33  ? 900  LEU D CD2 1 
ATOM   4856 N  N   . THR D 1 79  ? 8.733   38.896  -98.915  1.00 25.07  ? 901  THR D N   1 
ATOM   4857 C  CA  . THR D 1 79  ? 9.019   37.790  -99.815  1.00 25.91  ? 901  THR D CA  1 
ATOM   4858 C  C   . THR D 1 79  ? 9.944   36.894  -98.990  1.00 25.97  ? 901  THR D C   1 
ATOM   4859 O  O   . THR D 1 79  ? 10.533  37.345  -98.003  1.00 24.87  ? 901  THR D O   1 
ATOM   4860 C  CB  . THR D 1 79  ? 9.778   38.236  -101.088 1.00 28.82  ? 901  THR D CB  1 
ATOM   4861 O  OG1 . THR D 1 79  ? 11.148  38.494  -100.757 1.00 28.60  ? 901  THR D OG1 1 
ATOM   4862 C  CG2 . THR D 1 79  ? 9.151   39.498  -101.683 1.00 25.50  ? 901  THR D CG2 1 
ATOM   4863 N  N   . PRO D 1 80  ? 10.066  35.614  -99.361  1.00 29.39  ? 902  PRO D N   1 
ATOM   4864 C  CA  . PRO D 1 80  ? 10.944  34.716  -98.603  1.00 29.65  ? 902  PRO D CA  1 
ATOM   4865 C  C   . PRO D 1 80  ? 12.392  35.213  -98.583  1.00 30.17  ? 902  PRO D C   1 
ATOM   4866 O  O   . PRO D 1 80  ? 13.103  35.068  -97.581  1.00 30.43  ? 902  PRO D O   1 
ATOM   4867 C  CB  . PRO D 1 80  ? 10.791  33.390  -99.339  1.00 31.89  ? 902  PRO D CB  1 
ATOM   4868 C  CG  . PRO D 1 80  ? 9.350   33.438  -99.797  1.00 32.00  ? 902  PRO D CG  1 
ATOM   4869 C  CD  . PRO D 1 80  ? 9.245   34.860  -100.327 1.00 32.42  ? 902  PRO D CD  1 
ATOM   4870 N  N   . ILE D 1 81  ? 12.822  35.802  -99.693  1.00 26.06  ? 903  ILE D N   1 
ATOM   4871 C  CA  . ILE D 1 81  ? 14.179  36.327  -99.804  1.00 26.38  ? 903  ILE D CA  1 
ATOM   4872 C  C   . ILE D 1 81  ? 14.439  37.425  -98.777  1.00 25.41  ? 903  ILE D C   1 
ATOM   4873 O  O   . ILE D 1 81  ? 15.490  37.452  -98.140  1.00 23.34  ? 903  ILE D O   1 
ATOM   4874 C  CB  . ILE D 1 81  ? 14.435  36.901  -101.213 1.00 27.05  ? 903  ILE D CB  1 
ATOM   4875 C  CG1 . ILE D 1 81  ? 14.658  35.762  -102.208 1.00 26.50  ? 903  ILE D CG1 1 
ATOM   4876 C  CG2 . ILE D 1 81  ? 15.627  37.851  -101.195 1.00 27.99  ? 903  ILE D CG2 1 
ATOM   4877 C  CD1 . ILE D 1 81  ? 14.788  36.235  -103.642 1.00 33.89  ? 903  ILE D CD1 1 
ATOM   4878 N  N   . ASP D 1 82  ? 13.481  38.330  -98.614  1.00 25.63  ? 904  ASP D N   1 
ATOM   4879 C  CA  . ASP D 1 82  ? 13.652  39.420  -97.671  1.00 25.15  ? 904  ASP D CA  1 
ATOM   4880 C  C   . ASP D 1 82  ? 13.580  38.955  -96.220  1.00 24.32  ? 904  ASP D C   1 
ATOM   4881 O  O   . ASP D 1 82  ? 14.246  39.513  -95.353  1.00 24.25  ? 904  ASP D O   1 
ATOM   4882 C  CB  . ASP D 1 82  ? 12.637  40.518  -97.962  1.00 27.93  ? 904  ASP D CB  1 
ATOM   4883 C  CG  . ASP D 1 82  ? 12.858  41.155  -99.330  1.00 29.63  ? 904  ASP D CG  1 
ATOM   4884 O  OD1 . ASP D 1 82  ? 13.974  41.668  -99.578  1.00 28.03  ? 904  ASP D OD1 1 
ATOM   4885 O  OD2 . ASP D 1 82  ? 11.924  41.137  -100.159 1.00 29.46  ? 904  ASP D OD2 1 
ATOM   4886 N  N   . LYS D 1 83  ? 12.780  37.931  -95.955  1.00 23.75  ? 905  LYS D N   1 
ATOM   4887 C  CA  . LYS D 1 83  ? 12.690  37.399  -94.607  1.00 23.69  ? 905  LYS D CA  1 
ATOM   4888 C  C   . LYS D 1 83  ? 14.057  36.799  -94.287  1.00 24.32  ? 905  LYS D C   1 
ATOM   4889 O  O   . LYS D 1 83  ? 14.590  36.988  -93.195  1.00 22.11  ? 905  LYS D O   1 
ATOM   4890 C  CB  . LYS D 1 83  ? 11.609  36.318  -94.533  1.00 27.12  ? 905  LYS D CB  1 
ATOM   4891 C  CG  . LYS D 1 83  ? 11.456  35.671  -93.163  1.00 32.26  ? 905  LYS D CG  1 
ATOM   4892 C  CD  . LYS D 1 83  ? 10.250  34.746  -93.141  1.00 37.40  ? 905  LYS D CD  1 
ATOM   4893 C  CE  . LYS D 1 83  ? 10.103  34.029  -91.806  1.00 41.11  ? 905  LYS D CE  1 
ATOM   4894 N  NZ  . LYS D 1 83  ? 11.151  32.987  -91.613  1.00 43.61  ? 905  LYS D NZ  1 
ATOM   4895 N  N   . ARG D 1 84  ? 14.626  36.086  -95.256  1.00 22.78  ? 906  ARG D N   1 
ATOM   4896 C  CA  . ARG D 1 84  ? 15.936  35.471  -95.081  1.00 24.62  ? 906  ARG D CA  1 
ATOM   4897 C  C   . ARG D 1 84  ? 17.030  36.522  -94.918  1.00 22.46  ? 906  ARG D C   1 
ATOM   4898 O  O   . ARG D 1 84  ? 18.009  36.283  -94.217  1.00 24.03  ? 906  ARG D O   1 
ATOM   4899 C  CB  . ARG D 1 84  ? 16.274  34.549  -96.260  1.00 32.75  ? 906  ARG D CB  1 
ATOM   4900 C  CG  . ARG D 1 84  ? 15.299  33.395  -96.443  1.00 37.35  ? 906  ARG D CG  1 
ATOM   4901 C  CD  . ARG D 1 84  ? 15.839  32.349  -97.410  1.00 45.86  ? 906  ARG D CD  1 
ATOM   4902 N  NE  . ARG D 1 84  ? 14.803  31.395  -97.799  1.00 50.85  ? 906  ARG D NE  1 
ATOM   4903 C  CZ  . ARG D 1 84  ? 14.082  31.483  -98.913  1.00 50.83  ? 906  ARG D CZ  1 
ATOM   4904 N  NH1 . ARG D 1 84  ? 14.285  32.480  -99.763  1.00 46.22  ? 906  ARG D NH1 1 
ATOM   4905 N  NH2 . ARG D 1 84  ? 13.146  30.580  -99.168  1.00 52.33  ? 906  ARG D NH2 1 
ATOM   4906 N  N   . LYS D 1 85  ? 16.860  37.685  -95.547  1.00 22.48  ? 907  LYS D N   1 
ATOM   4907 C  CA  . LYS D 1 85  ? 17.849  38.754  -95.427  1.00 20.91  ? 907  LYS D CA  1 
ATOM   4908 C  C   . LYS D 1 85  ? 17.802  39.368  -94.028  1.00 20.61  ? 907  LYS D C   1 
ATOM   4909 O  O   . LYS D 1 85  ? 18.834  39.752  -93.479  1.00 20.03  ? 907  LYS D O   1 
ATOM   4910 C  CB  . LYS D 1 85  ? 17.612  39.850  -96.473  1.00 23.82  ? 907  LYS D CB  1 
ATOM   4911 C  CG  . LYS D 1 85  ? 17.976  39.451  -97.898  1.00 24.15  ? 907  LYS D CG  1 
ATOM   4912 C  CD  . LYS D 1 85  ? 17.874  40.632  -98.852  1.00 22.49  ? 907  LYS D CD  1 
ATOM   4913 C  CE  . LYS D 1 85  ? 18.303  40.229  -100.271 1.00 19.75  ? 907  LYS D CE  1 
ATOM   4914 N  NZ  . LYS D 1 85  ? 18.187  41.369  -101.234 1.00 17.37  ? 907  LYS D NZ  1 
ATOM   4915 N  N   . CYS D 1 86  ? 16.602  39.461  -93.462  1.00 20.79  ? 908  CYS D N   1 
ATOM   4916 C  CA  . CYS D 1 86  ? 16.425  40.018  -92.127  1.00 22.18  ? 908  CYS D CA  1 
ATOM   4917 C  C   . CYS D 1 86  ? 16.953  39.015  -91.107  1.00 21.42  ? 908  CYS D C   1 
ATOM   4918 O  O   . CYS D 1 86  ? 17.497  39.394  -90.055  1.00 20.19  ? 908  CYS D O   1 
ATOM   4919 C  CB  . CYS D 1 86  ? 14.944  40.308  -91.856  1.00 22.42  ? 908  CYS D CB  1 
ATOM   4920 S  SG  . CYS D 1 86  ? 14.632  41.179  -90.282  1.00 27.40  ? 908  CYS D SG  1 
ATOM   4921 N  N   . GLU D 1 87  ? 16.788  37.733  -91.421  1.00 20.50  ? 909  GLU D N   1 
ATOM   4922 C  CA  . GLU D 1 87  ? 17.269  36.676  -90.542  1.00 23.60  ? 909  GLU D CA  1 
ATOM   4923 C  C   . GLU D 1 87  ? 18.794  36.745  -90.507  1.00 23.48  ? 909  GLU D C   1 
ATOM   4924 O  O   . GLU D 1 87  ? 19.407  36.518  -89.470  1.00 23.15  ? 909  GLU D O   1 
ATOM   4925 C  CB  . GLU D 1 87  ? 16.816  35.297  -91.044  1.00 27.30  ? 909  GLU D CB  1 
ATOM   4926 C  CG  . GLU D 1 87  ? 15.302  35.137  -91.093  1.00 31.36  ? 909  GLU D CG  1 
ATOM   4927 C  CD  . GLU D 1 87  ? 14.862  33.730  -91.446  1.00 35.89  ? 909  GLU D CD  1 
ATOM   4928 O  OE1 . GLU D 1 87  ? 15.495  33.103  -92.323  1.00 35.37  ? 909  GLU D OE1 1 
ATOM   4929 O  OE2 . GLU D 1 87  ? 13.869  33.253  -90.855  1.00 35.90  ? 909  GLU D OE2 1 
ATOM   4930 N  N   . ARG D 1 88  ? 19.398  37.075  -91.643  1.00 26.38  ? 910  ARG D N   1 
ATOM   4931 C  CA  . ARG D 1 88  ? 20.849  37.185  -91.724  1.00 27.79  ? 910  ARG D CA  1 
ATOM   4932 C  C   . ARG D 1 88  ? 21.300  38.442  -90.981  1.00 26.77  ? 910  ARG D C   1 
ATOM   4933 O  O   . ARG D 1 88  ? 22.285  38.413  -90.249  1.00 26.37  ? 910  ARG D O   1 
ATOM   4934 C  CB  . ARG D 1 88  ? 21.295  37.230  -93.191  1.00 29.05  ? 910  ARG D CB  1 
ATOM   4935 C  CG  . ARG D 1 88  ? 22.800  37.117  -93.390  1.00 35.29  ? 910  ARG D CG  1 
ATOM   4936 C  CD  . ARG D 1 88  ? 23.184  36.925  -94.855  1.00 35.49  ? 910  ARG D CD  1 
ATOM   4937 N  NE  . ARG D 1 88  ? 22.935  35.569  -95.344  1.00 37.34  ? 910  ARG D NE  1 
ATOM   4938 C  CZ  . ARG D 1 88  ? 23.343  35.121  -96.528  1.00 35.75  ? 910  ARG D CZ  1 
ATOM   4939 N  NH1 . ARG D 1 88  ? 24.020  35.919  -97.341  1.00 33.93  ? 910  ARG D NH1 1 
ATOM   4940 N  NH2 . ARG D 1 88  ? 23.071  33.882  -96.907  1.00 36.98  ? 910  ARG D NH2 1 
ATOM   4941 N  N   . LEU D 1 89  ? 20.570  39.542  -91.161  1.00 23.71  ? 911  LEU D N   1 
ATOM   4942 C  CA  . LEU D 1 89  ? 20.902  40.785  -90.481  1.00 23.71  ? 911  LEU D CA  1 
ATOM   4943 C  C   . LEU D 1 89  ? 20.854  40.567  -88.973  1.00 22.54  ? 911  LEU D C   1 
ATOM   4944 O  O   . LEU D 1 89  ? 21.760  40.979  -88.257  1.00 22.56  ? 911  LEU D O   1 
ATOM   4945 C  CB  . LEU D 1 89  ? 19.928  41.902  -90.870  1.00 21.08  ? 911  LEU D CB  1 
ATOM   4946 C  CG  . LEU D 1 89  ? 20.127  42.537  -92.249  1.00 20.52  ? 911  LEU D CG  1 
ATOM   4947 C  CD1 . LEU D 1 89  ? 18.997  43.506  -92.544  1.00 26.00  ? 911  LEU D CD1 1 
ATOM   4948 C  CD2 . LEU D 1 89  ? 21.473  43.255  -92.280  1.00 20.10  ? 911  LEU D CD2 1 
ATOM   4949 N  N   . LEU D 1 90  ? 19.790  39.928  -88.498  1.00 20.81  ? 912  LEU D N   1 
ATOM   4950 C  CA  . LEU D 1 90  ? 19.655  39.653  -87.075  1.00 20.48  ? 912  LEU D CA  1 
ATOM   4951 C  C   . LEU D 1 90  ? 20.832  38.848  -86.548  1.00 20.60  ? 912  LEU D C   1 
ATOM   4952 O  O   . LEU D 1 90  ? 21.428  39.207  -85.532  1.00 20.91  ? 912  LEU D O   1 
ATOM   4953 C  CB  . LEU D 1 90  ? 18.363  38.884  -86.793  1.00 21.97  ? 912  LEU D CB  1 
ATOM   4954 C  CG  . LEU D 1 90  ? 17.076  39.708  -86.811  1.00 20.05  ? 912  LEU D CG  1 
ATOM   4955 C  CD1 . LEU D 1 90  ? 15.869  38.773  -86.668  1.00 22.39  ? 912  LEU D CD1 1 
ATOM   4956 C  CD2 . LEU D 1 90  ? 17.119  40.748  -85.678  1.00 17.00  ? 912  LEU D CD2 1 
ATOM   4957 N  N   . LEU D 1 91  ? 21.158  37.759  -87.236  1.00 21.82  ? 913  LEU D N   1 
ATOM   4958 C  CA  . LEU D 1 91  ? 22.256  36.896  -86.826  1.00 20.35  ? 913  LEU D CA  1 
ATOM   4959 C  C   . LEU D 1 91  ? 23.595  37.631  -86.792  1.00 20.03  ? 913  LEU D C   1 
ATOM   4960 O  O   . LEU D 1 91  ? 24.367  37.478  -85.841  1.00 19.72  ? 913  LEU D O   1 
ATOM   4961 C  CB  . LEU D 1 91  ? 22.330  35.672  -87.742  1.00 28.39  ? 913  LEU D CB  1 
ATOM   4962 C  CG  . LEU D 1 91  ? 23.156  34.486  -87.240  1.00 29.11  ? 913  LEU D CG  1 
ATOM   4963 C  CD1 . LEU D 1 91  ? 22.688  34.064  -85.851  1.00 34.59  ? 913  LEU D CD1 1 
ATOM   4964 C  CD2 . LEU D 1 91  ? 23.008  33.330  -88.214  1.00 36.94  ? 913  LEU D CD2 1 
ATOM   4965 N  N   . PHE D 1 92  ? 23.879  38.428  -87.819  1.00 18.68  ? 914  PHE D N   1 
ATOM   4966 C  CA  . PHE D 1 92  ? 25.119  39.198  -87.838  1.00 21.34  ? 914  PHE D CA  1 
ATOM   4967 C  C   . PHE D 1 92  ? 25.203  40.067  -86.581  1.00 21.89  ? 914  PHE D C   1 
ATOM   4968 O  O   . PHE D 1 92  ? 26.248  40.126  -85.930  1.00 23.80  ? 914  PHE D O   1 
ATOM   4969 C  CB  . PHE D 1 92  ? 25.191  40.124  -89.058  1.00 26.09  ? 914  PHE D CB  1 
ATOM   4970 C  CG  . PHE D 1 92  ? 25.881  39.523  -90.254  1.00 27.90  ? 914  PHE D CG  1 
ATOM   4971 C  CD1 . PHE D 1 92  ? 25.144  39.051  -91.337  1.00 34.53  ? 914  PHE D CD1 1 
ATOM   4972 C  CD2 . PHE D 1 92  ? 27.270  39.441  -90.306  1.00 29.35  ? 914  PHE D CD2 1 
ATOM   4973 C  CE1 . PHE D 1 92  ? 25.785  38.509  -92.458  1.00 34.42  ? 914  PHE D CE1 1 
ATOM   4974 C  CE2 . PHE D 1 92  ? 27.919  38.899  -91.420  1.00 33.65  ? 914  PHE D CE2 1 
ATOM   4975 C  CZ  . PHE D 1 92  ? 27.176  38.434  -92.496  1.00 33.18  ? 914  PHE D CZ  1 
ATOM   4976 N  N   . LEU D 1 93  ? 24.110  40.748  -86.241  1.00 23.63  ? 915  LEU D N   1 
ATOM   4977 C  CA  . LEU D 1 93  ? 24.126  41.604  -85.059  1.00 25.15  ? 915  LEU D CA  1 
ATOM   4978 C  C   . LEU D 1 93  ? 24.223  40.778  -83.770  1.00 25.26  ? 915  LEU D C   1 
ATOM   4979 O  O   . LEU D 1 93  ? 24.979  41.126  -82.866  1.00 23.52  ? 915  LEU D O   1 
ATOM   4980 C  CB  . LEU D 1 93  ? 22.894  42.515  -85.033  1.00 26.17  ? 915  LEU D CB  1 
ATOM   4981 C  CG  . LEU D 1 93  ? 22.734  43.490  -86.213  1.00 31.10  ? 915  LEU D CG  1 
ATOM   4982 C  CD1 . LEU D 1 93  ? 21.617  44.483  -85.910  1.00 30.81  ? 915  LEU D CD1 1 
ATOM   4983 C  CD2 . LEU D 1 93  ? 24.027  44.242  -86.460  1.00 25.07  ? 915  LEU D CD2 1 
ATOM   4984 N  N   . TYR D 1 94  ? 23.475  39.683  -83.683  1.00 26.44  ? 916  TYR D N   1 
ATOM   4985 C  CA  . TYR D 1 94  ? 23.536  38.841  -82.491  1.00 27.12  ? 916  TYR D CA  1 
ATOM   4986 C  C   . TYR D 1 94  ? 24.966  38.369  -82.230  1.00 28.36  ? 916  TYR D C   1 
ATOM   4987 O  O   . TYR D 1 94  ? 25.390  38.271  -81.081  1.00 27.30  ? 916  TYR D O   1 
ATOM   4988 C  CB  . TYR D 1 94  ? 22.636  37.612  -82.634  1.00 21.22  ? 916  TYR D CB  1 
ATOM   4989 C  CG  . TYR D 1 94  ? 21.273  37.764  -82.002  1.00 22.70  ? 916  TYR D CG  1 
ATOM   4990 C  CD1 . TYR D 1 94  ? 20.138  37.916  -82.790  1.00 22.82  ? 916  TYR D CD1 1 
ATOM   4991 C  CD2 . TYR D 1 94  ? 21.120  37.755  -80.610  1.00 24.50  ? 916  TYR D CD2 1 
ATOM   4992 C  CE1 . TYR D 1 94  ? 18.882  38.055  -82.221  1.00 24.88  ? 916  TYR D CE1 1 
ATOM   4993 C  CE2 . TYR D 1 94  ? 19.866  37.891  -80.026  1.00 27.16  ? 916  TYR D CE2 1 
ATOM   4994 C  CZ  . TYR D 1 94  ? 18.750  38.040  -80.843  1.00 28.95  ? 916  TYR D CZ  1 
ATOM   4995 O  OH  . TYR D 1 94  ? 17.498  38.164  -80.300  1.00 24.49  ? 916  TYR D OH  1 
ATOM   4996 N  N   . CYS D 1 95  ? 25.705  38.084  -83.299  1.00 29.69  ? 917  CYS D N   1 
ATOM   4997 C  CA  . CYS D 1 95  ? 27.082  37.608  -83.173  1.00 29.76  ? 917  CYS D CA  1 
ATOM   4998 C  C   . CYS D 1 95  ? 28.118  38.709  -82.936  1.00 30.74  ? 917  CYS D C   1 
ATOM   4999 O  O   . CYS D 1 95  ? 29.272  38.415  -82.627  1.00 32.38  ? 917  CYS D O   1 
ATOM   5000 C  CB  . CYS D 1 95  ? 27.474  36.791  -84.413  1.00 30.41  ? 917  CYS D CB  1 
ATOM   5001 S  SG  . CYS D 1 95  ? 26.596  35.206  -84.595  1.00 31.94  ? 917  CYS D SG  1 
ATOM   5002 N  N   . HIS D 1 96  ? 27.716  39.970  -83.071  1.00 27.31  ? 918  HIS D N   1 
ATOM   5003 C  CA  . HIS D 1 96  ? 28.639  41.087  -82.866  1.00 27.00  ? 918  HIS D CA  1 
ATOM   5004 C  C   . HIS D 1 96  ? 28.683  41.471  -81.375  1.00 26.92  ? 918  HIS D C   1 
ATOM   5005 O  O   . HIS D 1 96  ? 27.643  41.630  -80.745  1.00 27.14  ? 918  HIS D O   1 
ATOM   5006 C  CB  . HIS D 1 96  ? 28.195  42.281  -83.716  1.00 26.22  ? 918  HIS D CB  1 
ATOM   5007 C  CG  . HIS D 1 96  ? 29.211  43.377  -83.793  1.00 30.07  ? 918  HIS D CG  1 
ATOM   5008 N  ND1 . HIS D 1 96  ? 29.636  44.079  -82.686  1.00 28.36  ? 918  HIS D ND1 1 
ATOM   5009 C  CD2 . HIS D 1 96  ? 29.893  43.885  -84.845  1.00 29.64  ? 918  HIS D CD2 1 
ATOM   5010 C  CE1 . HIS D 1 96  ? 30.537  44.972  -83.053  1.00 29.58  ? 918  HIS D CE1 1 
ATOM   5011 N  NE2 . HIS D 1 96  ? 30.711  44.875  -84.358  1.00 33.04  ? 918  HIS D NE2 1 
ATOM   5012 N  N   . GLU D 1 97  ? 29.879  41.633  -80.815  1.00 27.20  ? 919  GLU D N   1 
ATOM   5013 C  CA  . GLU D 1 97  ? 30.005  41.955  -79.391  1.00 27.66  ? 919  GLU D CA  1 
ATOM   5014 C  C   . GLU D 1 97  ? 29.285  43.207  -78.905  1.00 27.29  ? 919  GLU D C   1 
ATOM   5015 O  O   . GLU D 1 97  ? 28.876  43.278  -77.745  1.00 27.36  ? 919  GLU D O   1 
ATOM   5016 C  CB  . GLU D 1 97  ? 31.478  42.030  -78.980  1.00 41.85  ? 919  GLU D CB  1 
ATOM   5017 C  CG  . GLU D 1 97  ? 32.342  42.915  -79.849  1.00 48.02  ? 919  GLU D CG  1 
ATOM   5018 C  CD  . GLU D 1 97  ? 33.675  43.226  -79.195  1.00 55.71  ? 919  GLU D CD  1 
ATOM   5019 O  OE1 . GLU D 1 97  ? 34.166  42.380  -78.415  1.00 57.89  ? 919  GLU D OE1 1 
ATOM   5020 O  OE2 . GLU D 1 97  ? 34.237  44.309  -79.467  1.00 55.17  ? 919  GLU D OE2 1 
ATOM   5021 N  N   . MET D 1 98  ? 29.123  44.192  -79.779  1.00 25.13  ? 920  MET D N   1 
ATOM   5022 C  CA  . MET D 1 98  ? 28.446  45.426  -79.397  1.00 24.92  ? 920  MET D CA  1 
ATOM   5023 C  C   . MET D 1 98  ? 26.925  45.310  -79.314  1.00 23.47  ? 920  MET D C   1 
ATOM   5024 O  O   . MET D 1 98  ? 26.246  46.292  -79.044  1.00 22.75  ? 920  MET D O   1 
ATOM   5025 C  CB  . MET D 1 98  ? 28.822  46.553  -80.365  1.00 23.92  ? 920  MET D CB  1 
ATOM   5026 C  CG  . MET D 1 98  ? 30.290  46.954  -80.307  1.00 26.20  ? 920  MET D CG  1 
ATOM   5027 S  SD  . MET D 1 98  ? 30.839  47.395  -78.633  1.00 35.14  ? 920  MET D SD  1 
ATOM   5028 C  CE  . MET D 1 98  ? 31.900  46.037  -78.251  1.00 37.93  ? 920  MET D CE  1 
ATOM   5029 N  N   . SER D 1 99  ? 26.387  44.114  -79.519  1.00 25.27  ? 921  SER D N   1 
ATOM   5030 C  CA  . SER D 1 99  ? 24.933  43.934  -79.476  1.00 25.47  ? 921  SER D CA  1 
ATOM   5031 C  C   . SER D 1 99  ? 24.391  43.455  -78.133  1.00 23.01  ? 921  SER D C   1 
ATOM   5032 O  O   . SER D 1 99  ? 23.174  43.362  -77.948  1.00 22.32  ? 921  SER D O   1 
ATOM   5033 C  CB  . SER D 1 99  ? 24.504  42.927  -80.539  1.00 24.57  ? 921  SER D CB  1 
ATOM   5034 O  OG  . SER D 1 99  ? 24.850  41.617  -80.127  1.00 27.37  ? 921  SER D OG  1 
ATOM   5035 N  N   . LEU D 1 100 ? 25.291  43.140  -77.206  1.00 22.47  ? 922  LEU D N   1 
ATOM   5036 C  CA  . LEU D 1 100 ? 24.909  42.638  -75.890  1.00 22.94  ? 922  LEU D CA  1 
ATOM   5037 C  C   . LEU D 1 100 ? 23.833  43.422  -75.138  1.00 21.92  ? 922  LEU D C   1 
ATOM   5038 O  O   . LEU D 1 100 ? 22.919  42.832  -74.558  1.00 21.45  ? 922  LEU D O   1 
ATOM   5039 C  CB  . LEU D 1 100 ? 26.158  42.504  -75.017  1.00 32.03  ? 922  LEU D CB  1 
ATOM   5040 C  CG  . LEU D 1 100 ? 27.083  41.370  -75.460  1.00 31.50  ? 922  LEU D CG  1 
ATOM   5041 C  CD1 . LEU D 1 100 ? 28.378  41.407  -74.660  1.00 32.05  ? 922  LEU D CD1 1 
ATOM   5042 C  CD2 . LEU D 1 100 ? 26.366  40.036  -75.274  1.00 35.49  ? 922  LEU D CD2 1 
ATOM   5043 N  N   . ALA D 1 101 ? 23.932  44.744  -75.152  1.00 24.42  ? 923  ALA D N   1 
ATOM   5044 C  CA  . ALA D 1 101 ? 22.956  45.572  -74.454  1.00 25.95  ? 923  ALA D CA  1 
ATOM   5045 C  C   . ALA D 1 101 ? 21.672  45.715  -75.258  1.00 25.41  ? 923  ALA D C   1 
ATOM   5046 O  O   . ALA D 1 101 ? 20.698  46.298  -74.781  1.00 26.84  ? 923  ALA D O   1 
ATOM   5047 C  CB  . ALA D 1 101 ? 23.547  46.958  -74.180  1.00 21.40  ? 923  ALA D CB  1 
ATOM   5048 N  N   . PHE D 1 102 ? 21.657  45.167  -76.469  1.00 20.02  ? 924  PHE D N   1 
ATOM   5049 C  CA  . PHE D 1 102 ? 20.484  45.313  -77.321  1.00 20.18  ? 924  PHE D CA  1 
ATOM   5050 C  C   . PHE D 1 102 ? 19.790  44.041  -77.757  1.00 21.79  ? 924  PHE D C   1 
ATOM   5051 O  O   . PHE D 1 102 ? 18.888  44.093  -78.589  1.00 20.60  ? 924  PHE D O   1 
ATOM   5052 C  CB  . PHE D 1 102 ? 20.875  46.114  -78.560  1.00 23.98  ? 924  PHE D CB  1 
ATOM   5053 C  CG  . PHE D 1 102 ? 21.726  47.304  -78.253  1.00 23.23  ? 924  PHE D CG  1 
ATOM   5054 C  CD1 . PHE D 1 102 ? 21.195  48.400  -77.582  1.00 23.76  ? 924  PHE D CD1 1 
ATOM   5055 C  CD2 . PHE D 1 102 ? 23.072  47.317  -78.597  1.00 24.53  ? 924  PHE D CD2 1 
ATOM   5056 C  CE1 . PHE D 1 102 ? 21.990  49.491  -77.256  1.00 22.35  ? 924  PHE D CE1 1 
ATOM   5057 C  CE2 . PHE D 1 102 ? 23.879  48.408  -78.272  1.00 20.56  ? 924  PHE D CE2 1 
ATOM   5058 C  CZ  . PHE D 1 102 ? 23.336  49.493  -77.602  1.00 24.89  ? 924  PHE D CZ  1 
ATOM   5059 N  N   . GLN D 1 103 ? 20.191  42.902  -77.202  1.00 22.40  ? 925  GLN D N   1 
ATOM   5060 C  CA  . GLN D 1 103 ? 19.586  41.637  -77.594  1.00 24.05  ? 925  GLN D CA  1 
ATOM   5061 C  C   . GLN D 1 103 ? 18.238  41.361  -76.958  1.00 24.53  ? 925  GLN D C   1 
ATOM   5062 O  O   . GLN D 1 103 ? 17.353  40.778  -77.581  1.00 24.23  ? 925  GLN D O   1 
ATOM   5063 C  CB  . GLN D 1 103 ? 20.534  40.490  -77.284  1.00 23.97  ? 925  GLN D CB  1 
ATOM   5064 C  CG  . GLN D 1 103 ? 21.766  40.502  -78.149  1.00 23.92  ? 925  GLN D CG  1 
ATOM   5065 C  CD  . GLN D 1 103 ? 22.769  39.464  -77.724  1.00 25.85  ? 925  GLN D CD  1 
ATOM   5066 O  OE1 . GLN D 1 103 ? 22.434  38.521  -77.013  1.00 25.97  ? 925  GLN D OE1 1 
ATOM   5067 N  NE2 . GLN D 1 103 ? 24.009  39.627  -78.164  1.00 26.31  ? 925  GLN D NE2 1 
ATOM   5068 N  N   . ASP D 1 104 ? 18.076  41.783  -75.716  1.00 20.24  ? 926  ASP D N   1 
ATOM   5069 C  CA  . ASP D 1 104 ? 16.825  41.550  -75.026  1.00 23.11  ? 926  ASP D CA  1 
ATOM   5070 C  C   . ASP D 1 104 ? 16.275  42.867  -74.534  1.00 22.95  ? 926  ASP D C   1 
ATOM   5071 O  O   . ASP D 1 104 ? 16.997  43.865  -74.467  1.00 22.78  ? 926  ASP D O   1 
ATOM   5072 C  CB  . ASP D 1 104 ? 17.049  40.605  -73.846  1.00 37.13  ? 926  ASP D CB  1 
ATOM   5073 C  CG  . ASP D 1 104 ? 17.567  39.252  -74.285  1.00 41.89  ? 926  ASP D CG  1 
ATOM   5074 O  OD1 . ASP D 1 104 ? 16.876  38.596  -75.098  1.00 39.93  ? 926  ASP D OD1 1 
ATOM   5075 O  OD2 . ASP D 1 104 ? 18.660  38.851  -73.826  1.00 46.48  ? 926  ASP D OD2 1 
ATOM   5076 N  N   . PRO D 1 105 ? 14.982  42.893  -74.192  1.00 28.15  ? 927  PRO D N   1 
ATOM   5077 C  CA  . PRO D 1 105 ? 14.353  44.119  -73.699  1.00 27.90  ? 927  PRO D CA  1 
ATOM   5078 C  C   . PRO D 1 105 ? 15.166  44.683  -72.546  1.00 27.21  ? 927  PRO D C   1 
ATOM   5079 O  O   . PRO D 1 105 ? 15.748  43.931  -71.765  1.00 25.22  ? 927  PRO D O   1 
ATOM   5080 C  CB  . PRO D 1 105 ? 12.980  43.638  -73.249  1.00 34.18  ? 927  PRO D CB  1 
ATOM   5081 C  CG  . PRO D 1 105 ? 12.693  42.516  -74.214  1.00 32.29  ? 927  PRO D CG  1 
ATOM   5082 C  CD  . PRO D 1 105 ? 14.009  41.788  -74.254  1.00 32.26  ? 927  PRO D CD  1 
ATOM   5083 N  N   . VAL D 1 106 ? 15.229  46.005  -72.463  1.00 22.33  ? 928  VAL D N   1 
ATOM   5084 C  CA  . VAL D 1 106 ? 15.951  46.667  -71.392  1.00 24.92  ? 928  VAL D CA  1 
ATOM   5085 C  C   . VAL D 1 106 ? 15.246  46.294  -70.089  1.00 26.55  ? 928  VAL D C   1 
ATOM   5086 O  O   . VAL D 1 106 ? 14.021  46.354  -70.003  1.00 26.28  ? 928  VAL D O   1 
ATOM   5087 C  CB  . VAL D 1 106 ? 15.914  48.207  -71.556  1.00 30.25  ? 928  VAL D CB  1 
ATOM   5088 C  CG1 . VAL D 1 106 ? 16.523  48.878  -70.334  1.00 32.10  ? 928  VAL D CG1 1 
ATOM   5089 C  CG2 . VAL D 1 106 ? 16.667  48.615  -72.819  1.00 29.43  ? 928  VAL D CG2 1 
ATOM   5090 N  N   . PRO D 1 107 ? 16.013  45.883  -69.069  1.00 27.38  ? 929  PRO D N   1 
ATOM   5091 C  CA  . PRO D 1 107 ? 15.451  45.500  -67.769  1.00 29.22  ? 929  PRO D CA  1 
ATOM   5092 C  C   . PRO D 1 107 ? 14.697  46.659  -67.126  1.00 28.17  ? 929  PRO D C   1 
ATOM   5093 O  O   . PRO D 1 107 ? 14.913  47.814  -67.483  1.00 28.27  ? 929  PRO D O   1 
ATOM   5094 C  CB  . PRO D 1 107 ? 16.686  45.111  -66.963  1.00 37.32  ? 929  PRO D CB  1 
ATOM   5095 C  CG  . PRO D 1 107 ? 17.617  44.578  -68.017  1.00 39.85  ? 929  PRO D CG  1 
ATOM   5096 C  CD  . PRO D 1 107 ? 17.456  45.591  -69.124  1.00 37.20  ? 929  PRO D CD  1 
ATOM   5097 N  N   . LEU D 1 108 ? 13.819  46.348  -66.179  1.00 32.24  ? 930  LEU D N   1 
ATOM   5098 C  CA  . LEU D 1 108 ? 13.048  47.372  -65.486  1.00 33.15  ? 930  LEU D CA  1 
ATOM   5099 C  C   . LEU D 1 108 ? 13.932  48.079  -64.469  1.00 34.33  ? 930  LEU D C   1 
ATOM   5100 O  O   . LEU D 1 108 ? 13.577  49.136  -63.947  1.00 35.21  ? 930  LEU D O   1 
ATOM   5101 C  CB  . LEU D 1 108 ? 11.849  46.747  -64.770  1.00 34.80  ? 930  LEU D CB  1 
ATOM   5102 C  CG  . LEU D 1 108 ? 10.818  46.018  -65.637  1.00 35.74  ? 930  LEU D CG  1 
ATOM   5103 C  CD1 . LEU D 1 108 ? 9.693   45.494  -64.747  1.00 34.68  ? 930  LEU D CD1 1 
ATOM   5104 C  CD2 . LEU D 1 108 ? 10.263  46.967  -66.700  1.00 34.82  ? 930  LEU D CD2 1 
ATOM   5105 N  N   . THR D 1 109 ? 15.092  47.490  -64.195  1.00 37.87  ? 931  THR D N   1 
ATOM   5106 C  CA  . THR D 1 109 ? 16.029  48.054  -63.233  1.00 38.62  ? 931  THR D CA  1 
ATOM   5107 C  C   . THR D 1 109 ? 16.805  49.259  -63.759  1.00 38.61  ? 931  THR D C   1 
ATOM   5108 O  O   . THR D 1 109 ? 17.440  49.974  -62.987  1.00 38.49  ? 931  THR D O   1 
ATOM   5109 C  CB  . THR D 1 109 ? 17.030  46.989  -62.750  1.00 47.04  ? 931  THR D CB  1 
ATOM   5110 O  OG1 . THR D 1 109 ? 17.501  46.233  -63.872  1.00 51.62  ? 931  THR D OG1 1 
ATOM   5111 C  CG2 . THR D 1 109 ? 16.369  46.053  -61.744  1.00 47.99  ? 931  THR D CG2 1 
ATOM   5112 N  N   . VAL D 1 110 ? 16.768  49.483  -65.070  1.00 34.31  ? 932  VAL D N   1 
ATOM   5113 C  CA  . VAL D 1 110 ? 17.464  50.634  -65.643  1.00 34.10  ? 932  VAL D CA  1 
ATOM   5114 C  C   . VAL D 1 110 ? 16.602  51.855  -65.329  1.00 34.02  ? 932  VAL D C   1 
ATOM   5115 O  O   . VAL D 1 110 ? 15.482  51.985  -65.831  1.00 33.85  ? 932  VAL D O   1 
ATOM   5116 C  CB  . VAL D 1 110 ? 17.639  50.495  -67.168  1.00 33.31  ? 932  VAL D CB  1 
ATOM   5117 C  CG1 . VAL D 1 110 ? 18.337  51.730  -67.722  1.00 36.75  ? 932  VAL D CG1 1 
ATOM   5118 C  CG2 . VAL D 1 110 ? 18.450  49.247  -67.485  1.00 31.94  ? 932  VAL D CG2 1 
ATOM   5119 N  N   . PRO D 1 111 ? 17.118  52.765  -64.486  1.00 35.97  ? 933  PRO D N   1 
ATOM   5120 C  CA  . PRO D 1 111 ? 16.439  53.992  -64.054  1.00 34.78  ? 933  PRO D CA  1 
ATOM   5121 C  C   . PRO D 1 111 ? 15.682  54.804  -65.100  1.00 32.69  ? 933  PRO D C   1 
ATOM   5122 O  O   . PRO D 1 111 ? 16.284  55.404  -65.989  1.00 34.05  ? 933  PRO D O   1 
ATOM   5123 C  CB  . PRO D 1 111 ? 17.567  54.799  -63.412  1.00 41.62  ? 933  PRO D CB  1 
ATOM   5124 C  CG  . PRO D 1 111 ? 18.441  53.737  -62.834  1.00 43.92  ? 933  PRO D CG  1 
ATOM   5125 C  CD  . PRO D 1 111 ? 18.497  52.730  -63.964  1.00 42.70  ? 933  PRO D CD  1 
ATOM   5126 N  N   . ASP D 1 112 ? 14.359  54.823  -64.965  1.00 34.67  ? 934  ASP D N   1 
ATOM   5127 C  CA  . ASP D 1 112 ? 13.466  55.591  -65.836  1.00 33.41  ? 934  ASP D CA  1 
ATOM   5128 C  C   . ASP D 1 112 ? 13.549  55.292  -67.328  1.00 31.76  ? 934  ASP D C   1 
ATOM   5129 O  O   . ASP D 1 112 ? 13.179  56.140  -68.145  1.00 30.77  ? 934  ASP D O   1 
ATOM   5130 C  CB  . ASP D 1 112 ? 13.708  57.096  -65.644  1.00 30.99  ? 934  ASP D CB  1 
ATOM   5131 C  CG  . ASP D 1 112 ? 13.510  57.554  -64.204  1.00 33.56  ? 934  ASP D CG  1 
ATOM   5132 O  OD1 . ASP D 1 112 ? 12.489  57.194  -63.588  1.00 31.89  ? 934  ASP D OD1 1 
ATOM   5133 O  OD2 . ASP D 1 112 ? 14.377  58.291  -63.690  1.00 41.43  ? 934  ASP D OD2 1 
ATOM   5134 N  N   . TYR D 1 113 ? 14.023  54.106  -67.698  1.00 27.25  ? 935  TYR D N   1 
ATOM   5135 C  CA  . TYR D 1 113 ? 14.130  53.782  -69.115  1.00 24.54  ? 935  TYR D CA  1 
ATOM   5136 C  C   . TYR D 1 113 ? 12.796  53.829  -69.862  1.00 24.23  ? 935  TYR D C   1 
ATOM   5137 O  O   . TYR D 1 113 ? 12.705  54.409  -70.944  1.00 25.66  ? 935  TYR D O   1 
ATOM   5138 C  CB  . TYR D 1 113 ? 14.749  52.399  -69.325  1.00 26.41  ? 935  TYR D CB  1 
ATOM   5139 C  CG  . TYR D 1 113 ? 15.033  52.135  -70.789  1.00 24.54  ? 935  TYR D CG  1 
ATOM   5140 C  CD1 . TYR D 1 113 ? 16.177  52.650  -71.396  1.00 24.78  ? 935  TYR D CD1 1 
ATOM   5141 C  CD2 . TYR D 1 113 ? 14.130  51.424  -71.579  1.00 24.94  ? 935  TYR D CD2 1 
ATOM   5142 C  CE1 . TYR D 1 113 ? 16.419  52.469  -72.754  1.00 29.33  ? 935  TYR D CE1 1 
ATOM   5143 C  CE2 . TYR D 1 113 ? 14.359  51.234  -72.944  1.00 27.63  ? 935  TYR D CE2 1 
ATOM   5144 C  CZ  . TYR D 1 113 ? 15.505  51.762  -73.524  1.00 28.48  ? 935  TYR D CZ  1 
ATOM   5145 O  OH  . TYR D 1 113 ? 15.735  51.604  -74.873  1.00 27.76  ? 935  TYR D OH  1 
ATOM   5146 N  N   . TYR D 1 114 ? 11.762  53.220  -69.291  1.00 23.95  ? 936  TYR D N   1 
ATOM   5147 C  CA  . TYR D 1 114 ? 10.457  53.192  -69.947  1.00 22.95  ? 936  TYR D CA  1 
ATOM   5148 C  C   . TYR D 1 114 ? 9.614   54.447  -69.781  1.00 22.39  ? 936  TYR D C   1 
ATOM   5149 O  O   . TYR D 1 114 ? 8.593   54.613  -70.459  1.00 19.14  ? 936  TYR D O   1 
ATOM   5150 C  CB  . TYR D 1 114 ? 9.695   51.950  -69.498  1.00 23.21  ? 936  TYR D CB  1 
ATOM   5151 C  CG  . TYR D 1 114 ? 10.339  50.705  -70.057  1.00 25.92  ? 936  TYR D CG  1 
ATOM   5152 C  CD1 . TYR D 1 114 ? 10.153  50.344  -71.393  1.00 24.48  ? 936  TYR D CD1 1 
ATOM   5153 C  CD2 . TYR D 1 114 ? 11.197  49.928  -69.276  1.00 22.22  ? 936  TYR D CD2 1 
ATOM   5154 C  CE1 . TYR D 1 114 ? 10.806  49.238  -71.938  1.00 24.33  ? 936  TYR D CE1 1 
ATOM   5155 C  CE2 . TYR D 1 114 ? 11.857  48.822  -69.809  1.00 25.51  ? 936  TYR D CE2 1 
ATOM   5156 C  CZ  . TYR D 1 114 ? 11.657  48.483  -71.139  1.00 27.77  ? 936  TYR D CZ  1 
ATOM   5157 O  OH  . TYR D 1 114 ? 12.302  47.386  -71.666  1.00 26.92  ? 936  TYR D OH  1 
ATOM   5158 N  N   . LYS D 1 115 ? 10.041  55.328  -68.885  1.00 25.05  ? 937  LYS D N   1 
ATOM   5159 C  CA  . LYS D 1 115 ? 9.343   56.588  -68.685  1.00 27.45  ? 937  LYS D CA  1 
ATOM   5160 C  C   . LYS D 1 115 ? 9.849   57.510  -69.791  1.00 28.32  ? 937  LYS D C   1 
ATOM   5161 O  O   . LYS D 1 115 ? 9.121   58.370  -70.285  1.00 28.90  ? 937  LYS D O   1 
ATOM   5162 C  CB  . LYS D 1 115 ? 9.673   57.191  -67.309  1.00 25.41  ? 937  LYS D CB  1 
ATOM   5163 C  CG  . LYS D 1 115 ? 9.030   56.463  -66.135  1.00 28.12  ? 937  LYS D CG  1 
ATOM   5164 C  CD  . LYS D 1 115 ? 9.200   57.234  -64.829  1.00 26.03  ? 937  LYS D CD  1 
ATOM   5165 C  CE  . LYS D 1 115 ? 8.370   56.607  -63.700  1.00 33.91  ? 937  LYS D CE  1 
ATOM   5166 N  NZ  . LYS D 1 115 ? 8.373   57.425  -62.442  1.00 34.58  ? 937  LYS D NZ  1 
ATOM   5167 N  N   . ILE D 1 116 ? 11.100  57.295  -70.193  1.00 28.17  ? 938  ILE D N   1 
ATOM   5168 C  CA  . ILE D 1 116 ? 11.746  58.108  -71.228  1.00 28.62  ? 938  ILE D CA  1 
ATOM   5169 C  C   . ILE D 1 116 ? 11.534  57.599  -72.658  1.00 29.03  ? 938  ILE D C   1 
ATOM   5170 O  O   . ILE D 1 116 ? 10.987  58.309  -73.498  1.00 29.49  ? 938  ILE D O   1 
ATOM   5171 C  CB  . ILE D 1 116 ? 13.266  58.212  -70.955  1.00 28.72  ? 938  ILE D CB  1 
ATOM   5172 C  CG1 . ILE D 1 116 ? 13.497  58.956  -69.636  1.00 27.18  ? 938  ILE D CG1 1 
ATOM   5173 C  CG2 . ILE D 1 116 ? 13.975  58.908  -72.113  1.00 25.95  ? 938  ILE D CG2 1 
ATOM   5174 C  CD1 . ILE D 1 116 ? 14.952  59.099  -69.252  1.00 32.32  ? 938  ILE D CD1 1 
ATOM   5175 N  N   . ILE D 1 117 ? 11.967  56.371  -72.925  1.00 26.04  ? 939  ILE D N   1 
ATOM   5176 C  CA  . ILE D 1 117 ? 11.845  55.773  -74.251  1.00 26.33  ? 939  ILE D CA  1 
ATOM   5177 C  C   . ILE D 1 117 ? 10.411  55.356  -74.563  1.00 28.21  ? 939  ILE D C   1 
ATOM   5178 O  O   . ILE D 1 117 ? 9.894   54.387  -74.003  1.00 26.80  ? 939  ILE D O   1 
ATOM   5179 C  CB  . ILE D 1 117 ? 12.787  54.547  -74.377  1.00 22.88  ? 939  ILE D CB  1 
ATOM   5180 C  CG1 . ILE D 1 117 ? 14.233  54.994  -74.144  1.00 21.17  ? 939  ILE D CG1 1 
ATOM   5181 C  CG2 . ILE D 1 117 ? 12.648  53.906  -75.742  1.00 21.31  ? 939  ILE D CG2 1 
ATOM   5182 C  CD1 . ILE D 1 117 ? 14.698  56.085  -75.100  1.00 25.67  ? 939  ILE D CD1 1 
ATOM   5183 N  N   . LYS D 1 118 ? 9.779   56.091  -75.472  1.00 31.92  ? 940  LYS D N   1 
ATOM   5184 C  CA  . LYS D 1 118 ? 8.396   55.830  -75.858  1.00 33.16  ? 940  LYS D CA  1 
ATOM   5185 C  C   . LYS D 1 118 ? 8.144   54.517  -76.603  1.00 31.69  ? 940  LYS D C   1 
ATOM   5186 O  O   . LYS D 1 118 ? 7.151   53.839  -76.344  1.00 30.98  ? 940  LYS D O   1 
ATOM   5187 C  CB  . LYS D 1 118 ? 7.863   56.999  -76.699  1.00 60.91  ? 940  LYS D CB  1 
ATOM   5188 C  CG  . LYS D 1 118 ? 6.490   56.755  -77.321  1.00 65.77  ? 940  LYS D CG  1 
ATOM   5189 C  CD  . LYS D 1 118 ? 6.040   57.944  -78.166  1.00 72.58  ? 940  LYS D CD  1 
ATOM   5190 C  CE  . LYS D 1 118 ? 4.714   57.668  -78.870  1.00 77.01  ? 940  LYS D CE  1 
ATOM   5191 N  NZ  . LYS D 1 118 ? 4.806   56.551  -79.856  1.00 76.95  ? 940  LYS D NZ  1 
ATOM   5192 N  N   . ASN D 1 119 ? 9.028   54.170  -77.532  1.00 27.26  ? 941  ASN D N   1 
ATOM   5193 C  CA  . ASN D 1 119 ? 8.877   52.946  -78.322  1.00 27.84  ? 941  ASN D CA  1 
ATOM   5194 C  C   . ASN D 1 119 ? 10.097  52.037  -78.208  1.00 26.43  ? 941  ASN D C   1 
ATOM   5195 O  O   . ASN D 1 119 ? 10.966  52.033  -79.078  1.00 26.40  ? 941  ASN D O   1 
ATOM   5196 C  CB  . ASN D 1 119 ? 8.650   53.299  -79.791  1.00 32.05  ? 941  ASN D CB  1 
ATOM   5197 C  CG  . ASN D 1 119 ? 7.427   54.161  -79.996  1.00 36.60  ? 941  ASN D CG  1 
ATOM   5198 O  OD1 . ASN D 1 119 ? 7.520   55.278  -80.505  1.00 41.18  ? 941  ASN D OD1 1 
ATOM   5199 N  ND2 . ASN D 1 119 ? 6.271   53.649  -79.597  1.00 40.38  ? 941  ASN D ND2 1 
ATOM   5200 N  N   . PRO D 1 120 ? 10.163  51.236  -77.140  1.00 27.33  ? 942  PRO D N   1 
ATOM   5201 C  CA  . PRO D 1 120 ? 11.293  50.325  -76.929  1.00 27.39  ? 942  PRO D CA  1 
ATOM   5202 C  C   . PRO D 1 120 ? 11.426  49.356  -78.091  1.00 25.62  ? 942  PRO D C   1 
ATOM   5203 O  O   . PRO D 1 120 ? 10.456  49.078  -78.798  1.00 25.23  ? 942  PRO D O   1 
ATOM   5204 C  CB  . PRO D 1 120 ? 10.924  49.594  -75.634  1.00 21.30  ? 942  PRO D CB  1 
ATOM   5205 C  CG  . PRO D 1 120 ? 9.915   50.501  -74.980  1.00 24.33  ? 942  PRO D CG  1 
ATOM   5206 C  CD  . PRO D 1 120 ? 9.119   51.025  -76.125  1.00 23.73  ? 942  PRO D CD  1 
ATOM   5207 N  N   . MET D 1 121 ? 12.630  48.835  -78.278  1.00 23.30  ? 943  MET D N   1 
ATOM   5208 C  CA  . MET D 1 121 ? 12.878  47.881  -79.342  1.00 23.07  ? 943  MET D CA  1 
ATOM   5209 C  C   . MET D 1 121 ? 14.187  47.171  -79.042  1.00 21.89  ? 943  MET D C   1 
ATOM   5210 O  O   . MET D 1 121 ? 15.098  47.747  -78.447  1.00 21.27  ? 943  MET D O   1 
ATOM   5211 C  CB  . MET D 1 121 ? 12.954  48.602  -80.691  1.00 22.05  ? 943  MET D CB  1 
ATOM   5212 C  CG  . MET D 1 121 ? 13.039  47.668  -81.904  1.00 25.14  ? 943  MET D CG  1 
ATOM   5213 S  SD  . MET D 1 121 ? 11.773  46.378  -81.924  1.00 26.73  ? 943  MET D SD  1 
ATOM   5214 C  CE  . MET D 1 121 ? 10.259  47.368  -82.034  1.00 29.36  ? 943  MET D CE  1 
ATOM   5215 N  N   . ASP D 1 122 ? 14.265  45.908  -79.433  1.00 20.73  ? 944  ASP D N   1 
ATOM   5216 C  CA  . ASP D 1 122 ? 15.466  45.114  -79.217  1.00 21.10  ? 944  ASP D CA  1 
ATOM   5217 C  C   . ASP D 1 122 ? 15.502  44.021  -80.275  1.00 20.16  ? 944  ASP D C   1 
ATOM   5218 O  O   . ASP D 1 122 ? 14.516  43.810  -80.990  1.00 19.85  ? 944  ASP D O   1 
ATOM   5219 C  CB  . ASP D 1 122 ? 15.454  44.500  -77.819  1.00 31.63  ? 944  ASP D CB  1 
ATOM   5220 C  CG  . ASP D 1 122 ? 14.275  43.579  -77.602  1.00 34.85  ? 944  ASP D CG  1 
ATOM   5221 O  OD1 . ASP D 1 122 ? 13.140  44.077  -77.450  1.00 44.25  ? 944  ASP D OD1 1 
ATOM   5222 O  OD2 . ASP D 1 122 ? 14.489  42.352  -77.596  1.00 38.13  ? 944  ASP D OD2 1 
ATOM   5223 N  N   . LEU D 1 123 ? 16.627  43.321  -80.378  1.00 20.41  ? 945  LEU D N   1 
ATOM   5224 C  CA  . LEU D 1 123 ? 16.769  42.276  -81.390  1.00 19.06  ? 945  LEU D CA  1 
ATOM   5225 C  C   . LEU D 1 123 ? 15.813  41.102  -81.228  1.00 21.19  ? 945  LEU D C   1 
ATOM   5226 O  O   . LEU D 1 123 ? 15.345  40.543  -82.226  1.00 20.76  ? 945  LEU D O   1 
ATOM   5227 C  CB  . LEU D 1 123 ? 18.204  41.756  -81.416  1.00 21.79  ? 945  LEU D CB  1 
ATOM   5228 C  CG  . LEU D 1 123 ? 19.281  42.796  -81.737  1.00 21.81  ? 945  LEU D CG  1 
ATOM   5229 C  CD1 . LEU D 1 123 ? 20.651  42.155  -81.606  1.00 22.19  ? 945  LEU D CD1 1 
ATOM   5230 C  CD2 . LEU D 1 123 ? 19.073  43.351  -83.135  1.00 19.36  ? 945  LEU D CD2 1 
ATOM   5231 N  N   . SER D 1 124 ? 15.518  40.718  -79.987  1.00 22.18  ? 946  SER D N   1 
ATOM   5232 C  CA  . SER D 1 124 ? 14.620  39.589  -79.774  1.00 23.68  ? 946  SER D CA  1 
ATOM   5233 C  C   . SER D 1 124 ? 13.208  39.927  -80.241  1.00 23.36  ? 946  SER D C   1 
ATOM   5234 O  O   . SER D 1 124 ? 12.466  39.051  -80.685  1.00 24.74  ? 946  SER D O   1 
ATOM   5235 C  CB  . SER D 1 124 ? 14.603  39.169  -78.297  1.00 31.10  ? 946  SER D CB  1 
ATOM   5236 O  OG  . SER D 1 124 ? 13.746  40.001  -77.536  1.00 31.29  ? 946  SER D OG  1 
ATOM   5237 N  N   . THR D 1 125 ? 12.839  41.200  -80.157  1.00 27.18  ? 947  THR D N   1 
ATOM   5238 C  CA  . THR D 1 125 ? 11.512  41.611  -80.591  1.00 27.63  ? 947  THR D CA  1 
ATOM   5239 C  C   . THR D 1 125 ? 11.418  41.559  -82.107  1.00 27.43  ? 947  THR D C   1 
ATOM   5240 O  O   . THR D 1 125 ? 10.401  41.138  -82.656  1.00 26.85  ? 947  THR D O   1 
ATOM   5241 C  CB  . THR D 1 125 ? 11.172  43.029  -80.119  1.00 25.76  ? 947  THR D CB  1 
ATOM   5242 O  OG1 . THR D 1 125 ? 11.209  43.071  -78.688  1.00 26.54  ? 947  THR D OG1 1 
ATOM   5243 C  CG2 . THR D 1 125 ? 9.788   43.419  -80.590  1.00 27.13  ? 947  THR D CG2 1 
ATOM   5244 N  N   . ILE D 1 126 ? 12.473  41.995  -82.786  1.00 23.99  ? 948  ILE D N   1 
ATOM   5245 C  CA  . ILE D 1 126 ? 12.482  41.951  -84.240  1.00 24.60  ? 948  ILE D CA  1 
ATOM   5246 C  C   . ILE D 1 126 ? 12.473  40.472  -84.635  1.00 24.72  ? 948  ILE D C   1 
ATOM   5247 O  O   . ILE D 1 126 ? 11.731  40.060  -85.523  1.00 24.66  ? 948  ILE D O   1 
ATOM   5248 C  CB  . ILE D 1 126 ? 13.739  42.648  -84.823  1.00 18.76  ? 948  ILE D CB  1 
ATOM   5249 C  CG1 . ILE D 1 126 ? 13.741  44.134  -84.434  1.00 21.48  ? 948  ILE D CG1 1 
ATOM   5250 C  CG2 . ILE D 1 126 ? 13.765  42.489  -86.338  1.00 21.07  ? 948  ILE D CG2 1 
ATOM   5251 C  CD1 . ILE D 1 126 ? 14.991  44.896  -84.878  1.00 18.69  ? 948  ILE D CD1 1 
ATOM   5252 N  N   . LYS D 1 127 ? 13.275  39.671  -83.941  1.00 24.41  ? 949  LYS D N   1 
ATOM   5253 C  CA  . LYS D 1 127 ? 13.354  38.241  -84.218  1.00 25.13  ? 949  LYS D CA  1 
ATOM   5254 C  C   . LYS D 1 127 ? 11.995  37.555  -84.102  1.00 26.65  ? 949  LYS D C   1 
ATOM   5255 O  O   . LYS D 1 127 ? 11.655  36.704  -84.922  1.00 25.73  ? 949  LYS D O   1 
ATOM   5256 C  CB  . LYS D 1 127 ? 14.349  37.566  -83.266  1.00 25.86  ? 949  LYS D CB  1 
ATOM   5257 C  CG  . LYS D 1 127 ? 14.473  36.057  -83.468  1.00 25.21  ? 949  LYS D CG  1 
ATOM   5258 C  CD  . LYS D 1 127 ? 15.495  35.437  -82.518  1.00 25.58  ? 949  LYS D CD  1 
ATOM   5259 C  CE  . LYS D 1 127 ? 15.591  33.933  -82.732  1.00 19.43  ? 949  LYS D CE  1 
ATOM   5260 N  NZ  . LYS D 1 127 ? 16.604  33.299  -81.848  1.00 23.65  ? 949  LYS D NZ  1 
ATOM   5261 N  N   . LYS D 1 128 ? 11.218  37.923  -83.090  1.00 28.07  ? 950  LYS D N   1 
ATOM   5262 C  CA  . LYS D 1 128 ? 9.906   37.312  -82.897  1.00 29.25  ? 950  LYS D CA  1 
ATOM   5263 C  C   . LYS D 1 128 ? 8.894   37.830  -83.909  1.00 28.84  ? 950  LYS D C   1 
ATOM   5264 O  O   . LYS D 1 128 ? 8.038   37.079  -84.384  1.00 28.22  ? 950  LYS D O   1 
ATOM   5265 C  CB  . LYS D 1 128 ? 9.385   37.572  -81.478  1.00 37.64  ? 950  LYS D CB  1 
ATOM   5266 C  CG  . LYS D 1 128 ? 8.021   36.942  -81.221  1.00 41.91  ? 950  LYS D CG  1 
ATOM   5267 C  CD  . LYS D 1 128 ? 7.467   37.288  -79.845  1.00 51.45  ? 950  LYS D CD  1 
ATOM   5268 C  CE  . LYS D 1 128 ? 6.058   36.724  -79.670  1.00 56.85  ? 950  LYS D CE  1 
ATOM   5269 N  NZ  . LYS D 1 128 ? 5.447   37.088  -78.359  1.00 59.33  ? 950  LYS D NZ  1 
ATOM   5270 N  N   . ARG D 1 129 ? 8.988   39.114  -84.235  1.00 28.18  ? 951  ARG D N   1 
ATOM   5271 C  CA  . ARG D 1 129 ? 8.073   39.701  -85.194  1.00 29.00  ? 951  ARG D CA  1 
ATOM   5272 C  C   . ARG D 1 129 ? 8.277   39.135  -86.588  1.00 29.02  ? 951  ARG D C   1 
ATOM   5273 O  O   . ARG D 1 129 ? 7.340   39.045  -87.380  1.00 28.65  ? 951  ARG D O   1 
ATOM   5274 C  CB  . ARG D 1 129 ? 8.215   41.223  -85.199  1.00 29.72  ? 951  ARG D CB  1 
ATOM   5275 C  CG  . ARG D 1 129 ? 7.131   41.875  -84.368  1.00 34.93  ? 951  ARG D CG  1 
ATOM   5276 C  CD  . ARG D 1 129 ? 7.649   42.876  -83.374  1.00 38.46  ? 951  ARG D CD  1 
ATOM   5277 N  NE  . ARG D 1 129 ? 7.739   44.200  -83.961  1.00 44.22  ? 951  ARG D NE  1 
ATOM   5278 C  CZ  . ARG D 1 129 ? 7.282   45.303  -83.382  1.00 45.31  ? 951  ARG D CZ  1 
ATOM   5279 N  NH1 . ARG D 1 129 ? 6.697   45.240  -82.193  1.00 47.40  ? 951  ARG D NH1 1 
ATOM   5280 N  NH2 . ARG D 1 129 ? 7.412   46.469  -83.996  1.00 43.21  ? 951  ARG D NH2 1 
ATOM   5281 N  N   . LEU D 1 130 ? 9.507   38.740  -86.881  1.00 33.74  ? 952  LEU D N   1 
ATOM   5282 C  CA  . LEU D 1 130 ? 9.820   38.175  -88.184  1.00 33.43  ? 952  LEU D CA  1 
ATOM   5283 C  C   . LEU D 1 130 ? 9.290   36.744  -88.283  1.00 35.31  ? 952  LEU D C   1 
ATOM   5284 O  O   . LEU D 1 130 ? 8.841   36.305  -89.340  1.00 39.46  ? 952  LEU D O   1 
ATOM   5285 C  CB  . LEU D 1 130 ? 11.332  38.192  -88.391  1.00 27.60  ? 952  LEU D CB  1 
ATOM   5286 C  CG  . LEU D 1 130 ? 11.862  37.733  -89.741  1.00 26.52  ? 952  LEU D CG  1 
ATOM   5287 C  CD1 . LEU D 1 130 ? 11.349  38.664  -90.837  1.00 23.38  ? 952  LEU D CD1 1 
ATOM   5288 C  CD2 . LEU D 1 130 ? 13.393  37.730  -89.681  1.00 23.96  ? 952  LEU D CD2 1 
ATOM   5289 N  N   . GLN D 1 131 ? 9.329   36.040  -87.158  1.00 46.23  ? 953  GLN D N   1 
ATOM   5290 C  CA  . GLN D 1 131 ? 8.895   34.650  -87.059  1.00 46.23  ? 953  GLN D CA  1 
ATOM   5291 C  C   . GLN D 1 131 ? 7.376   34.425  -87.014  1.00 46.23  ? 953  GLN D C   1 
ATOM   5292 O  O   . GLN D 1 131 ? 6.899   33.336  -87.332  1.00 46.23  ? 953  GLN D O   1 
ATOM   5293 C  CB  . GLN D 1 131 ? 9.582   34.025  -85.835  1.00 61.23  ? 953  GLN D CB  1 
ATOM   5294 C  CG  . GLN D 1 131 ? 9.106   32.654  -85.403  1.00 61.23  ? 953  GLN D CG  1 
ATOM   5295 C  CD  . GLN D 1 131 ? 8.049   32.726  -84.317  1.00 61.23  ? 953  GLN D CD  1 
ATOM   5296 O  OE1 . GLN D 1 131 ? 7.975   33.705  -83.572  1.00 61.23  ? 953  GLN D OE1 1 
ATOM   5297 N  NE2 . GLN D 1 131 ? 7.237   31.678  -84.209  1.00 61.23  ? 953  GLN D NE2 1 
ATOM   5298 N  N   . GLU D 1 132 ? 6.617   35.446  -86.631  1.00 57.51  ? 954  GLU D N   1 
ATOM   5299 C  CA  . GLU D 1 132 ? 5.163   35.322  -86.555  1.00 57.51  ? 954  GLU D CA  1 
ATOM   5300 C  C   . GLU D 1 132 ? 4.540   35.001  -87.910  1.00 57.51  ? 954  GLU D C   1 
ATOM   5301 O  O   . GLU D 1 132 ? 4.850   35.652  -88.911  1.00 57.51  ? 954  GLU D O   1 
ATOM   5302 C  CB  . GLU D 1 132 ? 4.557   36.610  -86.003  1.00 78.62  ? 954  GLU D CB  1 
ATOM   5303 C  CG  . GLU D 1 132 ? 4.858   36.837  -84.534  1.00 78.62  ? 954  GLU D CG  1 
ATOM   5304 C  CD  . GLU D 1 132 ? 4.532   38.246  -84.084  1.00 78.62  ? 954  GLU D CD  1 
ATOM   5305 O  OE1 . GLU D 1 132 ? 3.763   38.932  -84.791  1.00 78.62  ? 954  GLU D OE1 1 
ATOM   5306 O  OE2 . GLU D 1 132 ? 5.039   38.664  -83.019  1.00 78.62  ? 954  GLU D OE2 1 
ATOM   5307 N  N   . ASP D 1 133 ? 3.665   33.995  -87.931  1.00 93.77  ? 955  ASP D N   1 
ATOM   5308 C  CA  . ASP D 1 133 ? 2.989   33.566  -89.157  1.00 93.77  ? 955  ASP D CA  1 
ATOM   5309 C  C   . ASP D 1 133 ? 2.491   34.767  -89.949  1.00 93.77  ? 955  ASP D C   1 
ATOM   5310 O  O   . ASP D 1 133 ? 2.662   34.841  -91.166  1.00 93.77  ? 955  ASP D O   1 
ATOM   5311 C  CB  . ASP D 1 133 ? 1.805   32.649  -88.832  1.00 104.64 ? 955  ASP D CB  1 
ATOM   5312 C  CG  . ASP D 1 133 ? 2.239   31.274  -88.354  1.00 104.64 ? 955  ASP D CG  1 
ATOM   5313 O  OD1 . ASP D 1 133 ? 3.435   30.938  -88.501  1.00 104.64 ? 955  ASP D OD1 1 
ATOM   5314 O  OD2 . ASP D 1 133 ? 1.379   30.525  -87.840  1.00 104.64 ? 955  ASP D OD2 1 
ATOM   5315 N  N   . TYR D 1 134 ? 1.858   35.699  -89.248  1.00 84.78  ? 956  TYR D N   1 
ATOM   5316 C  CA  . TYR D 1 134 ? 1.355   36.910  -89.869  1.00 84.78  ? 956  TYR D CA  1 
ATOM   5317 C  C   . TYR D 1 134 ? 2.084   38.083  -89.250  1.00 84.78  ? 956  TYR D C   1 
ATOM   5318 O  O   . TYR D 1 134 ? 1.589   38.738  -88.333  1.00 84.78  ? 956  TYR D O   1 
ATOM   5319 C  CB  . TYR D 1 134 ? -0.153  37.033  -89.656  1.00 109.43 ? 956  TYR D CB  1 
ATOM   5320 C  CG  . TYR D 1 134 ? -0.976  36.227  -90.637  1.00 109.43 ? 956  TYR D CG  1 
ATOM   5321 C  CD1 . TYR D 1 134 ? -2.272  35.832  -90.319  1.00 109.43 ? 956  TYR D CD1 1 
ATOM   5322 C  CD2 . TYR D 1 134 ? -0.471  35.884  -91.894  1.00 109.43 ? 956  TYR D CD2 1 
ATOM   5323 C  CE1 . TYR D 1 134 ? -3.048  35.116  -91.221  1.00 109.43 ? 956  TYR D CE1 1 
ATOM   5324 C  CE2 . TYR D 1 134 ? -1.241  35.169  -92.808  1.00 109.43 ? 956  TYR D CE2 1 
ATOM   5325 C  CZ  . TYR D 1 134 ? -2.529  34.790  -92.462  1.00 109.43 ? 956  TYR D CZ  1 
ATOM   5326 O  OH  . TYR D 1 134 ? -3.303  34.088  -93.355  1.00 109.43 ? 956  TYR D OH  1 
ATOM   5327 N  N   . SER D 1 135 ? 3.281   38.319  -89.766  1.00 55.41  ? 957  SER D N   1 
ATOM   5328 C  CA  . SER D 1 135 ? 4.140   39.392  -89.312  1.00 55.41  ? 957  SER D CA  1 
ATOM   5329 C  C   . SER D 1 135 ? 3.576   40.759  -89.665  1.00 55.41  ? 957  SER D C   1 
ATOM   5330 O  O   . SER D 1 135 ? 2.743   40.890  -90.564  1.00 55.41  ? 957  SER D O   1 
ATOM   5331 C  CB  . SER D 1 135 ? 5.526   39.223  -89.941  1.00 58.77  ? 957  SER D CB  1 
ATOM   5332 O  OG  . SER D 1 135 ? 6.386   40.292  -89.590  1.00 58.77  ? 957  SER D OG  1 
ATOM   5333 N  N   . MET D 1 136 ? 4.034   41.772  -88.940  1.00 52.10  ? 958  MET D N   1 
ATOM   5334 C  CA  . MET D 1 136 ? 3.616   43.146  -89.180  1.00 52.10  ? 958  MET D CA  1 
ATOM   5335 C  C   . MET D 1 136 ? 4.602   43.760  -90.164  1.00 52.10  ? 958  MET D C   1 
ATOM   5336 O  O   . MET D 1 136 ? 4.539   44.948  -90.478  1.00 52.10  ? 958  MET D O   1 
ATOM   5337 C  CB  . MET D 1 136 ? 3.604   43.939  -87.872  1.00 77.87  ? 958  MET D CB  1 
ATOM   5338 C  CG  . MET D 1 136 ? 4.916   43.920  -87.107  1.00 77.87  ? 958  MET D CG  1 
ATOM   5339 S  SD  . MET D 1 136 ? 4.745   44.759  -85.524  1.00 77.87  ? 958  MET D SD  1 
ATOM   5340 C  CE  . MET D 1 136 ? 3.845   43.521  -84.593  1.00 77.87  ? 958  MET D CE  1 
ATOM   5341 N  N   . TYR D 1 137 ? 5.529   42.930  -90.629  1.00 33.45  ? 959  TYR D N   1 
ATOM   5342 C  CA  . TYR D 1 137 ? 6.516   43.356  -91.606  1.00 31.49  ? 959  TYR D CA  1 
ATOM   5343 C  C   . TYR D 1 137 ? 5.982   42.977  -92.978  1.00 31.72  ? 959  TYR D C   1 
ATOM   5344 O  O   . TYR D 1 137 ? 5.837   41.797  -93.293  1.00 31.22  ? 959  TYR D O   1 
ATOM   5345 C  CB  . TYR D 1 137 ? 7.858   42.654  -91.376  1.00 30.52  ? 959  TYR D CB  1 
ATOM   5346 C  CG  . TYR D 1 137 ? 8.522   42.969  -90.056  1.00 28.19  ? 959  TYR D CG  1 
ATOM   5347 C  CD1 . TYR D 1 137 ? 8.413   44.234  -89.484  1.00 26.98  ? 959  TYR D CD1 1 
ATOM   5348 C  CD2 . TYR D 1 137 ? 9.306   42.017  -89.406  1.00 27.29  ? 959  TYR D CD2 1 
ATOM   5349 C  CE1 . TYR D 1 137 ? 9.071   44.547  -88.300  1.00 25.74  ? 959  TYR D CE1 1 
ATOM   5350 C  CE2 . TYR D 1 137 ? 9.971   42.322  -88.220  1.00 22.26  ? 959  TYR D CE2 1 
ATOM   5351 C  CZ  . TYR D 1 137 ? 9.848   43.588  -87.675  1.00 23.80  ? 959  TYR D CZ  1 
ATOM   5352 O  OH  . TYR D 1 137 ? 10.506  43.899  -86.509  1.00 25.29  ? 959  TYR D OH  1 
ATOM   5353 N  N   . SER D 1 138 ? 5.675   43.970  -93.797  1.00 31.11  ? 960  SER D N   1 
ATOM   5354 C  CA  . SER D 1 138 ? 5.165   43.673  -95.127  1.00 32.08  ? 960  SER D CA  1 
ATOM   5355 C  C   . SER D 1 138 ? 6.257   43.892  -96.173  1.00 31.38  ? 960  SER D C   1 
ATOM   5356 O  O   . SER D 1 138 ? 6.210   43.315  -97.258  1.00 32.37  ? 960  SER D O   1 
ATOM   5357 C  CB  . SER D 1 138 ? 3.951   44.553  -95.432  1.00 41.77  ? 960  SER D CB  1 
ATOM   5358 O  OG  . SER D 1 138 ? 4.288   45.929  -95.370  1.00 44.60  ? 960  SER D OG  1 
ATOM   5359 N  N   . LYS D 1 139 ? 7.244   44.715  -95.826  1.00 30.23  ? 961  LYS D N   1 
ATOM   5360 C  CA  . LYS D 1 139 ? 8.361   45.033  -96.713  1.00 30.39  ? 961  LYS D CA  1 
ATOM   5361 C  C   . LYS D 1 139 ? 9.632   45.308  -95.897  1.00 29.93  ? 961  LYS D C   1 
ATOM   5362 O  O   . LYS D 1 139 ? 9.565   45.562  -94.694  1.00 29.72  ? 961  LYS D O   1 
ATOM   5363 C  CB  . LYS D 1 139 ? 8.014   46.259  -97.553  1.00 42.87  ? 961  LYS D CB  1 
ATOM   5364 C  CG  . LYS D 1 139 ? 7.386   47.348  -96.725  1.00 44.40  ? 961  LYS D CG  1 
ATOM   5365 C  CD  . LYS D 1 139 ? 7.903   48.718  -97.089  1.00 50.89  ? 961  LYS D CD  1 
ATOM   5366 C  CE  . LYS D 1 139 ? 7.242   49.276  -98.328  1.00 55.22  ? 961  LYS D CE  1 
ATOM   5367 N  NZ  . LYS D 1 139 ? 7.705   50.676  -98.533  1.00 57.30  ? 961  LYS D NZ  1 
ATOM   5368 N  N   . PRO D 1 140 ? 10.807  45.281  -96.554  1.00 30.05  ? 962  PRO D N   1 
ATOM   5369 C  CA  . PRO D 1 140 ? 12.096  45.519  -95.895  1.00 28.65  ? 962  PRO D CA  1 
ATOM   5370 C  C   . PRO D 1 140 ? 12.172  46.782  -95.039  1.00 28.42  ? 962  PRO D C   1 
ATOM   5371 O  O   . PRO D 1 140 ? 12.688  46.751  -93.922  1.00 26.54  ? 962  PRO D O   1 
ATOM   5372 C  CB  . PRO D 1 140 ? 13.077  45.552  -97.064  1.00 30.64  ? 962  PRO D CB  1 
ATOM   5373 C  CG  . PRO D 1 140 ? 12.468  44.585  -98.025  1.00 30.65  ? 962  PRO D CG  1 
ATOM   5374 C  CD  . PRO D 1 140 ? 11.005  44.984  -97.985  1.00 33.03  ? 962  PRO D CD  1 
ATOM   5375 N  N   . GLU D 1 141 ? 11.670  47.895  -95.562  1.00 25.45  ? 963  GLU D N   1 
ATOM   5376 C  CA  . GLU D 1 141 ? 11.711  49.139  -94.818  1.00 25.14  ? 963  GLU D CA  1 
ATOM   5377 C  C   . GLU D 1 141 ? 11.027  49.005  -93.460  1.00 24.11  ? 963  GLU D C   1 
ATOM   5378 O  O   . GLU D 1 141 ? 11.315  49.765  -92.539  1.00 22.06  ? 963  GLU D O   1 
ATOM   5379 C  CB  . GLU D 1 141 ? 11.071  50.276  -95.625  1.00 36.15  ? 963  GLU D CB  1 
ATOM   5380 C  CG  . GLU D 1 141 ? 11.904  50.733  -96.825  1.00 41.91  ? 963  GLU D CG  1 
ATOM   5381 C  CD  . GLU D 1 141 ? 11.588  49.970  -98.103  1.00 48.95  ? 963  GLU D CD  1 
ATOM   5382 O  OE1 . GLU D 1 141 ? 11.077  48.830  -98.021  1.00 47.79  ? 963  GLU D OE1 1 
ATOM   5383 O  OE2 . GLU D 1 141 ? 11.862  50.514  -99.197  1.00 54.41  ? 963  GLU D OE2 1 
ATOM   5384 N  N   . ASP D 1 142 ? 10.122  48.041  -93.330  1.00 26.56  ? 964  ASP D N   1 
ATOM   5385 C  CA  . ASP D 1 142 ? 9.443   47.857  -92.054  1.00 25.33  ? 964  ASP D CA  1 
ATOM   5386 C  C   . ASP D 1 142 ? 10.386  47.316  -90.990  1.00 23.65  ? 964  ASP D C   1 
ATOM   5387 O  O   . ASP D 1 142 ? 10.400  47.826  -89.874  1.00 21.73  ? 964  ASP D O   1 
ATOM   5388 C  CB  . ASP D 1 142 ? 8.234   46.932  -92.196  1.00 28.38  ? 964  ASP D CB  1 
ATOM   5389 C  CG  . ASP D 1 142 ? 7.104   47.569  -92.982  1.00 30.85  ? 964  ASP D CG  1 
ATOM   5390 O  OD1 . ASP D 1 142 ? 6.962   48.809  -92.915  1.00 35.54  ? 964  ASP D OD1 1 
ATOM   5391 O  OD2 . ASP D 1 142 ? 6.349   46.833  -93.653  1.00 36.08  ? 964  ASP D OD2 1 
ATOM   5392 N  N   . PHE D 1 143 ? 11.176  46.293  -91.312  1.00 23.57  ? 965  PHE D N   1 
ATOM   5393 C  CA  . PHE D 1 143 ? 12.078  45.774  -90.293  1.00 22.19  ? 965  PHE D CA  1 
ATOM   5394 C  C   . PHE D 1 143 ? 13.308  46.647  -90.151  1.00 23.07  ? 965  PHE D C   1 
ATOM   5395 O  O   . PHE D 1 143 ? 13.895  46.716  -89.077  1.00 21.19  ? 965  PHE D O   1 
ATOM   5396 C  CB  . PHE D 1 143 ? 12.451  44.297  -90.533  1.00 23.15  ? 965  PHE D CB  1 
ATOM   5397 C  CG  . PHE D 1 143 ? 13.176  44.018  -91.826  1.00 26.78  ? 965  PHE D CG  1 
ATOM   5398 C  CD1 . PHE D 1 143 ? 14.465  44.497  -92.047  1.00 28.44  ? 965  PHE D CD1 1 
ATOM   5399 C  CD2 . PHE D 1 143 ? 12.595  43.193  -92.790  1.00 28.19  ? 965  PHE D CD2 1 
ATOM   5400 C  CE1 . PHE D 1 143 ? 15.167  44.154  -93.204  1.00 29.70  ? 965  PHE D CE1 1 
ATOM   5401 C  CE2 . PHE D 1 143 ? 13.289  42.846  -93.948  1.00 26.54  ? 965  PHE D CE2 1 
ATOM   5402 C  CZ  . PHE D 1 143 ? 14.580  43.327  -94.153  1.00 27.39  ? 965  PHE D CZ  1 
ATOM   5403 N  N   . VAL D 1 144 ? 13.687  47.338  -91.224  1.00 23.99  ? 966  VAL D N   1 
ATOM   5404 C  CA  . VAL D 1 144 ? 14.834  48.228  -91.152  1.00 24.28  ? 966  VAL D CA  1 
ATOM   5405 C  C   . VAL D 1 144 ? 14.532  49.311  -90.121  1.00 23.99  ? 966  VAL D C   1 
ATOM   5406 O  O   . VAL D 1 144 ? 15.401  49.687  -89.334  1.00 24.26  ? 966  VAL D O   1 
ATOM   5407 C  CB  . VAL D 1 144 ? 15.136  48.898  -92.518  1.00 25.19  ? 966  VAL D CB  1 
ATOM   5408 C  CG1 . VAL D 1 144 ? 16.003  50.145  -92.312  1.00 26.33  ? 966  VAL D CG1 1 
ATOM   5409 C  CG2 . VAL D 1 144 ? 15.863  47.912  -93.424  1.00 26.25  ? 966  VAL D CG2 1 
ATOM   5410 N  N   . ALA D 1 145 ? 13.293  49.795  -90.119  1.00 20.22  ? 967  ALA D N   1 
ATOM   5411 C  CA  . ALA D 1 145 ? 12.878  50.836  -89.179  1.00 21.14  ? 967  ALA D CA  1 
ATOM   5412 C  C   . ALA D 1 145 ? 13.025  50.394  -87.719  1.00 20.22  ? 967  ALA D C   1 
ATOM   5413 O  O   . ALA D 1 145 ? 13.385  51.195  -86.859  1.00 20.37  ? 967  ALA D O   1 
ATOM   5414 C  CB  . ALA D 1 145 ? 11.427  51.250  -89.455  1.00 21.37  ? 967  ALA D CB  1 
ATOM   5415 N  N   . ASP D 1 146 ? 12.733  49.124  -87.442  1.00 24.72  ? 968  ASP D N   1 
ATOM   5416 C  CA  . ASP D 1 146 ? 12.847  48.613  -86.081  1.00 24.38  ? 968  ASP D CA  1 
ATOM   5417 C  C   . ASP D 1 146 ? 14.311  48.533  -85.678  1.00 24.54  ? 968  ASP D C   1 
ATOM   5418 O  O   . ASP D 1 146 ? 14.655  48.815  -84.532  1.00 21.65  ? 968  ASP D O   1 
ATOM   5419 C  CB  . ASP D 1 146 ? 12.185  47.232  -85.948  1.00 20.25  ? 968  ASP D CB  1 
ATOM   5420 C  CG  . ASP D 1 146 ? 10.686  47.328  -85.689  1.00 24.73  ? 968  ASP D CG  1 
ATOM   5421 O  OD1 . ASP D 1 146 ? 10.226  48.424  -85.310  1.00 27.46  ? 968  ASP D OD1 1 
ATOM   5422 O  OD2 . ASP D 1 146 ? 9.969   46.314  -85.839  1.00 28.43  ? 968  ASP D OD2 1 
ATOM   5423 N  N   . PHE D 1 147 ? 15.173  48.147  -86.618  1.00 21.27  ? 969  PHE D N   1 
ATOM   5424 C  CA  . PHE D 1 147 ? 16.598  48.077  -86.322  1.00 22.69  ? 969  PHE D CA  1 
ATOM   5425 C  C   . PHE D 1 147 ? 17.069  49.475  -85.967  1.00 23.88  ? 969  PHE D C   1 
ATOM   5426 O  O   . PHE D 1 147 ? 17.771  49.680  -84.985  1.00 22.47  ? 969  PHE D O   1 
ATOM   5427 C  CB  . PHE D 1 147 ? 17.381  47.582  -87.537  1.00 19.58  ? 969  PHE D CB  1 
ATOM   5428 C  CG  . PHE D 1 147 ? 17.422  46.094  -87.665  1.00 17.35  ? 969  PHE D CG  1 
ATOM   5429 C  CD1 . PHE D 1 147 ? 18.222  45.339  -86.825  1.00 19.96  ? 969  PHE D CD1 1 
ATOM   5430 C  CD2 . PHE D 1 147 ? 16.674  45.450  -88.636  1.00 20.74  ? 969  PHE D CD2 1 
ATOM   5431 C  CE1 . PHE D 1 147 ? 18.280  43.960  -86.949  1.00 24.81  ? 969  PHE D CE1 1 
ATOM   5432 C  CE2 . PHE D 1 147 ? 16.721  44.068  -88.772  1.00 22.87  ? 969  PHE D CE2 1 
ATOM   5433 C  CZ  . PHE D 1 147 ? 17.525  43.321  -87.929  1.00 27.52  ? 969  PHE D CZ  1 
ATOM   5434 N  N   . ARG D 1 148 ? 16.669  50.448  -86.773  1.00 24.86  ? 970  ARG D N   1 
ATOM   5435 C  CA  . ARG D 1 148 ? 17.085  51.814  -86.520  1.00 25.90  ? 970  ARG D CA  1 
ATOM   5436 C  C   . ARG D 1 148 ? 16.499  52.370  -85.229  1.00 24.67  ? 970  ARG D C   1 
ATOM   5437 O  O   . ARG D 1 148 ? 17.109  53.221  -84.587  1.00 24.23  ? 970  ARG D O   1 
ATOM   5438 C  CB  . ARG D 1 148 ? 16.731  52.693  -87.721  1.00 20.40  ? 970  ARG D CB  1 
ATOM   5439 C  CG  . ARG D 1 148 ? 17.619  52.374  -88.906  1.00 25.04  ? 970  ARG D CG  1 
ATOM   5440 C  CD  . ARG D 1 148 ? 17.361  53.262  -90.100  1.00 31.68  ? 970  ARG D CD  1 
ATOM   5441 N  NE  . ARG D 1 148 ? 18.291  52.942  -91.176  1.00 36.28  ? 970  ARG D NE  1 
ATOM   5442 C  CZ  . ARG D 1 148 ? 18.058  53.182  -92.462  1.00 39.40  ? 970  ARG D CZ  1 
ATOM   5443 N  NH1 . ARG D 1 148 ? 16.918  53.745  -92.837  1.00 44.62  ? 970  ARG D NH1 1 
ATOM   5444 N  NH2 . ARG D 1 148 ? 18.964  52.849  -93.372  1.00 37.62  ? 970  ARG D NH2 1 
ATOM   5445 N  N   . LEU D 1 149 ? 15.331  51.869  -84.835  1.00 23.15  ? 971  LEU D N   1 
ATOM   5446 C  CA  . LEU D 1 149 ? 14.696  52.330  -83.610  1.00 22.96  ? 971  LEU D CA  1 
ATOM   5447 C  C   . LEU D 1 149 ? 15.583  51.987  -82.419  1.00 22.55  ? 971  LEU D C   1 
ATOM   5448 O  O   . LEU D 1 149 ? 15.655  52.743  -81.444  1.00 21.89  ? 971  LEU D O   1 
ATOM   5449 C  CB  . LEU D 1 149 ? 13.319  51.688  -83.456  1.00 25.66  ? 971  LEU D CB  1 
ATOM   5450 C  CG  . LEU D 1 149 ? 12.511  52.064  -82.211  1.00 25.81  ? 971  LEU D CG  1 
ATOM   5451 C  CD1 . LEU D 1 149 ? 12.387  53.584  -82.112  1.00 25.55  ? 971  LEU D CD1 1 
ATOM   5452 C  CD2 . LEU D 1 149 ? 11.135  51.406  -82.284  1.00 27.34  ? 971  LEU D CD2 1 
ATOM   5453 N  N   . ILE D 1 150 ? 16.261  50.846  -82.505  1.00 23.46  ? 972  ILE D N   1 
ATOM   5454 C  CA  . ILE D 1 150 ? 17.170  50.412  -81.446  1.00 23.99  ? 972  ILE D CA  1 
ATOM   5455 C  C   . ILE D 1 150 ? 18.322  51.407  -81.241  1.00 24.08  ? 972  ILE D C   1 
ATOM   5456 O  O   . ILE D 1 150 ? 18.659  51.752  -80.105  1.00 23.95  ? 972  ILE D O   1 
ATOM   5457 C  CB  . ILE D 1 150 ? 17.778  49.031  -81.766  1.00 18.68  ? 972  ILE D CB  1 
ATOM   5458 C  CG1 . ILE D 1 150 ? 16.681  47.953  -81.749  1.00 19.07  ? 972  ILE D CG1 1 
ATOM   5459 C  CG2 . ILE D 1 150 ? 18.873  48.691  -80.755  1.00 21.27  ? 972  ILE D CG2 1 
ATOM   5460 C  CD1 . ILE D 1 150 ? 17.175  46.578  -82.206  1.00 20.17  ? 972  ILE D CD1 1 
ATOM   5461 N  N   . PHE D 1 151 ? 18.931  51.862  -82.336  1.00 25.33  ? 973  PHE D N   1 
ATOM   5462 C  CA  . PHE D 1 151 ? 20.043  52.802  -82.231  1.00 28.67  ? 973  PHE D CA  1 
ATOM   5463 C  C   . PHE D 1 151 ? 19.530  54.172  -81.801  1.00 28.72  ? 973  PHE D C   1 
ATOM   5464 O  O   . PHE D 1 151 ? 20.228  54.921  -81.112  1.00 27.91  ? 973  PHE D O   1 
ATOM   5465 C  CB  . PHE D 1 151 ? 20.791  52.898  -83.568  1.00 25.62  ? 973  PHE D CB  1 
ATOM   5466 C  CG  . PHE D 1 151 ? 21.144  51.561  -84.153  1.00 30.66  ? 973  PHE D CG  1 
ATOM   5467 C  CD1 . PHE D 1 151 ? 21.849  50.625  -83.405  1.00 32.01  ? 973  PHE D CD1 1 
ATOM   5468 C  CD2 . PHE D 1 151 ? 20.740  51.220  -85.439  1.00 28.15  ? 973  PHE D CD2 1 
ATOM   5469 C  CE1 . PHE D 1 151 ? 22.141  49.365  -83.925  1.00 31.21  ? 973  PHE D CE1 1 
ATOM   5470 C  CE2 . PHE D 1 151 ? 21.029  49.961  -85.969  1.00 31.75  ? 973  PHE D CE2 1 
ATOM   5471 C  CZ  . PHE D 1 151 ? 21.729  49.033  -85.208  1.00 30.07  ? 973  PHE D CZ  1 
ATOM   5472 N  N   . GLN D 1 152 ? 18.303  54.492  -82.206  1.00 28.16  ? 974  GLN D N   1 
ATOM   5473 C  CA  . GLN D 1 152 ? 17.686  55.762  -81.833  1.00 30.63  ? 974  GLN D CA  1 
ATOM   5474 C  C   . GLN D 1 152 ? 17.508  55.822  -80.325  1.00 29.63  ? 974  GLN D C   1 
ATOM   5475 O  O   . GLN D 1 152 ? 17.925  56.779  -79.673  1.00 28.21  ? 974  GLN D O   1 
ATOM   5476 C  CB  . GLN D 1 152 ? 16.303  55.911  -82.468  1.00 42.59  ? 974  GLN D CB  1 
ATOM   5477 C  CG  . GLN D 1 152 ? 16.281  56.465  -83.868  1.00 51.74  ? 974  GLN D CG  1 
ATOM   5478 C  CD  . GLN D 1 152 ? 14.863  56.737  -84.333  1.00 57.84  ? 974  GLN D CD  1 
ATOM   5479 O  OE1 . GLN D 1 152 ? 14.115  57.480  -83.687  1.00 57.86  ? 974  GLN D OE1 1 
ATOM   5480 N  NE2 . GLN D 1 152 ? 14.482  56.134  -85.454  1.00 59.21  ? 974  GLN D NE2 1 
ATOM   5481 N  N   . ASN D 1 153 ? 16.866  54.798  -79.773  1.00 27.81  ? 975  ASN D N   1 
ATOM   5482 C  CA  . ASN D 1 153 ? 16.633  54.766  -78.343  1.00 26.58  ? 975  ASN D CA  1 
ATOM   5483 C  C   . ASN D 1 153 ? 17.934  54.783  -77.563  1.00 27.30  ? 975  ASN D C   1 
ATOM   5484 O  O   . ASN D 1 153 ? 18.018  55.412  -76.501  1.00 25.27  ? 975  ASN D O   1 
ATOM   5485 C  CB  . ASN D 1 153 ? 15.804  53.539  -77.961  1.00 27.98  ? 975  ASN D CB  1 
ATOM   5486 C  CG  . ASN D 1 153 ? 14.421  53.571  -78.563  1.00 27.66  ? 975  ASN D CG  1 
ATOM   5487 O  OD1 . ASN D 1 153 ? 13.890  54.644  -78.867  1.00 26.18  ? 975  ASN D OD1 1 
ATOM   5488 N  ND2 . ASN D 1 153 ? 13.819  52.400  -78.729  1.00 30.48  ? 975  ASN D ND2 1 
ATOM   5489 N  N   . CYS D 1 154 ? 18.944  54.090  -78.083  1.00 24.41  ? 976  CYS D N   1 
ATOM   5490 C  CA  . CYS D 1 154 ? 20.245  54.038  -77.421  1.00 25.37  ? 976  CYS D CA  1 
ATOM   5491 C  C   . CYS D 1 154 ? 20.843  55.436  -77.306  1.00 25.85  ? 976  CYS D C   1 
ATOM   5492 O  O   . CYS D 1 154 ? 21.338  55.822  -76.243  1.00 27.11  ? 976  CYS D O   1 
ATOM   5493 C  CB  . CYS D 1 154 ? 21.220  53.140  -78.195  1.00 23.85  ? 976  CYS D CB  1 
ATOM   5494 S  SG  . CYS D 1 154 ? 22.917  53.139  -77.534  1.00 24.50  ? 976  CYS D SG  1 
ATOM   5495 N  N   . ALA D 1 155 ? 20.794  56.192  -78.400  1.00 27.86  ? 977  ALA D N   1 
ATOM   5496 C  CA  . ALA D 1 155 ? 21.347  57.545  -78.418  1.00 30.44  ? 977  ALA D CA  1 
ATOM   5497 C  C   . ALA D 1 155 ? 20.554  58.532  -77.556  1.00 30.86  ? 977  ALA D C   1 
ATOM   5498 O  O   . ALA D 1 155 ? 21.133  59.414  -76.928  1.00 32.30  ? 977  ALA D O   1 
ATOM   5499 C  CB  . ALA D 1 155 ? 21.430  58.053  -79.852  1.00 32.26  ? 977  ALA D CB  1 
ATOM   5500 N  N   . GLU D 1 156 ? 19.236  58.379  -77.517  1.00 33.42  ? 978  GLU D N   1 
ATOM   5501 C  CA  . GLU D 1 156 ? 18.390  59.273  -76.731  1.00 34.71  ? 978  GLU D CA  1 
ATOM   5502 C  C   . GLU D 1 156 ? 18.499  59.063  -75.219  1.00 35.41  ? 978  GLU D C   1 
ATOM   5503 O  O   . GLU D 1 156 ? 18.470  60.024  -74.445  1.00 34.69  ? 978  GLU D O   1 
ATOM   5504 C  CB  . GLU D 1 156 ? 16.926  59.102  -77.139  1.00 46.01  ? 978  GLU D CB  1 
ATOM   5505 C  CG  . GLU D 1 156 ? 16.004  60.150  -76.541  1.00 52.42  ? 978  GLU D CG  1 
ATOM   5506 C  CD  . GLU D 1 156 ? 14.540  59.772  -76.639  1.00 58.72  ? 978  GLU D CD  1 
ATOM   5507 O  OE1 . GLU D 1 156 ? 14.118  59.282  -77.708  1.00 61.51  ? 978  GLU D OE1 1 
ATOM   5508 O  OE2 . GLU D 1 156 ? 13.809  59.976  -75.647  1.00 61.10  ? 978  GLU D OE2 1 
ATOM   5509 N  N   . PHE D 1 157 ? 18.627  57.808  -74.800  1.00 30.60  ? 979  PHE D N   1 
ATOM   5510 C  CA  . PHE D 1 157 ? 18.690  57.492  -73.380  1.00 31.17  ? 979  PHE D CA  1 
ATOM   5511 C  C   . PHE D 1 157 ? 20.058  57.525  -72.708  1.00 31.34  ? 979  PHE D C   1 
ATOM   5512 O  O   . PHE D 1 157 ? 20.201  58.063  -71.609  1.00 31.05  ? 979  PHE D O   1 
ATOM   5513 C  CB  . PHE D 1 157 ? 18.075  56.118  -73.122  1.00 30.09  ? 979  PHE D CB  1 
ATOM   5514 C  CG  . PHE D 1 157 ? 18.144  55.701  -71.692  1.00 31.40  ? 979  PHE D CG  1 
ATOM   5515 C  CD1 . PHE D 1 157 ? 17.233  56.195  -70.767  1.00 31.56  ? 979  PHE D CD1 1 
ATOM   5516 C  CD2 . PHE D 1 157 ? 19.150  54.853  -71.255  1.00 29.11  ? 979  PHE D CD2 1 
ATOM   5517 C  CE1 . PHE D 1 157 ? 17.326  55.849  -69.423  1.00 34.05  ? 979  PHE D CE1 1 
ATOM   5518 C  CE2 . PHE D 1 157 ? 19.251  54.503  -69.917  1.00 33.69  ? 979  PHE D CE2 1 
ATOM   5519 C  CZ  . PHE D 1 157 ? 18.335  55.003  -68.997  1.00 32.70  ? 979  PHE D CZ  1 
ATOM   5520 N  N   . ASN D 1 158 ? 21.054  56.935  -73.357  1.00 29.77  ? 980  ASN D N   1 
ATOM   5521 C  CA  . ASN D 1 158 ? 22.402  56.859  -72.797  1.00 30.96  ? 980  ASN D CA  1 
ATOM   5522 C  C   . ASN D 1 158 ? 23.267  58.105  -72.936  1.00 31.53  ? 980  ASN D C   1 
ATOM   5523 O  O   . ASN D 1 158 ? 23.172  58.832  -73.919  1.00 32.85  ? 980  ASN D O   1 
ATOM   5524 C  CB  . ASN D 1 158 ? 23.130  55.674  -73.421  1.00 33.99  ? 980  ASN D CB  1 
ATOM   5525 C  CG  . ASN D 1 158 ? 22.468  54.365  -73.094  1.00 32.84  ? 980  ASN D CG  1 
ATOM   5526 O  OD1 . ASN D 1 158 ? 22.619  53.848  -71.994  1.00 31.99  ? 980  ASN D OD1 1 
ATOM   5527 N  ND2 . ASN D 1 158 ? 21.709  53.830  -74.041  1.00 31.55  ? 980  ASN D ND2 1 
ATOM   5528 N  N   . GLU D 1 159 ? 24.131  58.317  -71.945  1.00 31.75  ? 981  GLU D N   1 
ATOM   5529 C  CA  . GLU D 1 159 ? 25.049  59.453  -71.913  1.00 33.92  ? 981  GLU D CA  1 
ATOM   5530 C  C   . GLU D 1 159 ? 26.048  59.425  -73.057  1.00 34.12  ? 981  GLU D C   1 
ATOM   5531 O  O   . GLU D 1 159 ? 26.656  58.397  -73.338  1.00 31.94  ? 981  GLU D O   1 
ATOM   5532 C  CB  . GLU D 1 159 ? 25.831  59.468  -70.596  1.00 67.82  ? 981  GLU D CB  1 
ATOM   5533 C  CG  . GLU D 1 159 ? 25.066  60.009  -69.410  1.00 70.79  ? 981  GLU D CG  1 
ATOM   5534 C  CD  . GLU D 1 159 ? 24.751  61.483  -69.555  1.00 79.55  ? 981  GLU D CD  1 
ATOM   5535 O  OE1 . GLU D 1 159 ? 25.696  62.274  -69.765  1.00 82.00  ? 981  GLU D OE1 1 
ATOM   5536 O  OE2 . GLU D 1 159 ? 23.562  61.853  -69.458  1.00 82.96  ? 981  GLU D OE2 1 
ATOM   5537 N  N   . PRO D 1 160 ? 26.242  60.568  -73.725  1.00 46.07  ? 982  PRO D N   1 
ATOM   5538 C  CA  . PRO D 1 160 ? 27.192  60.625  -74.835  1.00 46.72  ? 982  PRO D CA  1 
ATOM   5539 C  C   . PRO D 1 160 ? 28.555  60.101  -74.395  1.00 46.03  ? 982  PRO D C   1 
ATOM   5540 O  O   . PRO D 1 160 ? 29.044  60.449  -73.321  1.00 45.48  ? 982  PRO D O   1 
ATOM   5541 C  CB  . PRO D 1 160 ? 27.226  62.110  -75.179  1.00 47.75  ? 982  PRO D CB  1 
ATOM   5542 C  CG  . PRO D 1 160 ? 25.835  62.550  -74.861  1.00 47.47  ? 982  PRO D CG  1 
ATOM   5543 C  CD  . PRO D 1 160 ? 25.580  61.870  -73.535  1.00 46.73  ? 982  PRO D CD  1 
ATOM   5544 N  N   . ASP D 1 161 ? 29.150  59.253  -75.225  1.00 36.02  ? 983  ASP D N   1 
ATOM   5545 C  CA  . ASP D 1 161 ? 30.456  58.673  -74.945  1.00 36.81  ? 983  ASP D CA  1 
ATOM   5546 C  C   . ASP D 1 161 ? 30.494  57.648  -73.806  1.00 35.01  ? 983  ASP D C   1 
ATOM   5547 O  O   . ASP D 1 161 ? 31.568  57.281  -73.334  1.00 34.99  ? 983  ASP D O   1 
ATOM   5548 C  CB  . ASP D 1 161 ? 31.484  59.784  -74.691  1.00 75.80  ? 983  ASP D CB  1 
ATOM   5549 C  CG  . ASP D 1 161 ? 31.726  60.647  -75.922  1.00 81.18  ? 983  ASP D CG  1 
ATOM   5550 O  OD1 . ASP D 1 161 ? 31.828  60.081  -77.033  1.00 84.62  ? 983  ASP D OD1 1 
ATOM   5551 O  OD2 . ASP D 1 161 ? 31.826  61.886  -75.781  1.00 85.59  ? 983  ASP D OD2 1 
ATOM   5552 N  N   . SER D 1 162 ? 29.327  57.191  -73.356  1.00 33.31  ? 984  SER D N   1 
ATOM   5553 C  CA  . SER D 1 162 ? 29.281  56.172  -72.310  1.00 31.14  ? 984  SER D CA  1 
ATOM   5554 C  C   . SER D 1 162 ? 29.481  54.841  -73.037  1.00 30.53  ? 984  SER D C   1 
ATOM   5555 O  O   . SER D 1 162 ? 29.411  54.794  -74.266  1.00 29.80  ? 984  SER D O   1 
ATOM   5556 C  CB  . SER D 1 162 ? 27.930  56.188  -71.580  1.00 35.44  ? 984  SER D CB  1 
ATOM   5557 O  OG  . SER D 1 162 ? 26.840  55.990  -72.467  1.00 36.21  ? 984  SER D OG  1 
ATOM   5558 N  N   . GLU D 1 163 ? 29.726  53.766  -72.294  1.00 32.11  ? 985  GLU D N   1 
ATOM   5559 C  CA  . GLU D 1 163 ? 29.949  52.460  -72.912  1.00 32.02  ? 985  GLU D CA  1 
ATOM   5560 C  C   . GLU D 1 163 ? 28.819  52.058  -73.863  1.00 30.83  ? 985  GLU D C   1 
ATOM   5561 O  O   . GLU D 1 163 ? 29.062  51.749  -75.030  1.00 30.78  ? 985  GLU D O   1 
ATOM   5562 C  CB  . GLU D 1 163 ? 30.106  51.378  -71.841  1.00 30.03  ? 985  GLU D CB  1 
ATOM   5563 C  CG  . GLU D 1 163 ? 30.553  50.022  -72.392  1.00 35.03  ? 985  GLU D CG  1 
ATOM   5564 C  CD  . GLU D 1 163 ? 30.181  48.851  -71.487  1.00 37.24  ? 985  GLU D CD  1 
ATOM   5565 O  OE1 . GLU D 1 163 ? 30.039  49.061  -70.267  1.00 38.32  ? 985  GLU D OE1 1 
ATOM   5566 O  OE2 . GLU D 1 163 ? 30.042  47.716  -71.996  1.00 35.67  ? 985  GLU D OE2 1 
ATOM   5567 N  N   . VAL D 1 164 ? 27.589  52.053  -73.360  1.00 27.25  ? 986  VAL D N   1 
ATOM   5568 C  CA  . VAL D 1 164 ? 26.444  51.668  -74.176  1.00 27.63  ? 986  VAL D CA  1 
ATOM   5569 C  C   . VAL D 1 164 ? 26.256  52.600  -75.375  1.00 25.57  ? 986  VAL D C   1 
ATOM   5570 O  O   . VAL D 1 164 ? 25.976  52.144  -76.485  1.00 24.28  ? 986  VAL D O   1 
ATOM   5571 C  CB  . VAL D 1 164 ? 25.145  51.640  -73.336  1.00 33.64  ? 986  VAL D CB  1 
ATOM   5572 C  CG1 . VAL D 1 164 ? 23.970  51.222  -74.207  1.00 32.59  ? 986  VAL D CG1 1 
ATOM   5573 C  CG2 . VAL D 1 164 ? 25.304  50.679  -72.170  1.00 37.51  ? 986  VAL D CG2 1 
ATOM   5574 N  N   . ALA D 1 165 ? 26.416  53.899  -75.153  1.00 27.75  ? 987  ALA D N   1 
ATOM   5575 C  CA  . ALA D 1 165 ? 26.271  54.866  -76.238  1.00 27.36  ? 987  ALA D CA  1 
ATOM   5576 C  C   . ALA D 1 165 ? 27.213  54.525  -77.395  1.00 27.54  ? 987  ALA D C   1 
ATOM   5577 O  O   . ALA D 1 165 ? 26.787  54.476  -78.548  1.00 25.73  ? 987  ALA D O   1 
ATOM   5578 C  CB  . ALA D 1 165 ? 26.555  56.278  -75.729  1.00 26.62  ? 987  ALA D CB  1 
ATOM   5579 N  N   . ASN D 1 166 ? 28.487  54.286  -77.082  1.00 26.13  ? 988  ASN D N   1 
ATOM   5580 C  CA  . ASN D 1 166 ? 29.480  53.960  -78.107  1.00 28.75  ? 988  ASN D CA  1 
ATOM   5581 C  C   . ASN D 1 166 ? 29.185  52.623  -78.774  1.00 27.17  ? 988  ASN D C   1 
ATOM   5582 O  O   . ASN D 1 166 ? 29.417  52.452  -79.974  1.00 25.31  ? 988  ASN D O   1 
ATOM   5583 C  CB  . ASN D 1 166 ? 30.894  53.924  -77.513  1.00 40.28  ? 988  ASN D CB  1 
ATOM   5584 C  CG  . ASN D 1 166 ? 31.387  55.293  -77.087  1.00 44.54  ? 988  ASN D CG  1 
ATOM   5585 O  OD1 . ASN D 1 166 ? 31.059  56.306  -77.705  1.00 48.36  ? 988  ASN D OD1 1 
ATOM   5586 N  ND2 . ASN D 1 166 ? 32.198  55.327  -76.035  1.00 48.43  ? 988  ASN D ND2 1 
ATOM   5587 N  N   . ALA D 1 167 ? 28.692  51.671  -77.989  1.00 25.66  ? 989  ALA D N   1 
ATOM   5588 C  CA  . ALA D 1 167 ? 28.341  50.360  -78.514  1.00 24.70  ? 989  ALA D CA  1 
ATOM   5589 C  C   . ALA D 1 167 ? 27.248  50.561  -79.560  1.00 24.98  ? 989  ALA D C   1 
ATOM   5590 O  O   . ALA D 1 167 ? 27.316  50.009  -80.662  1.00 23.65  ? 989  ALA D O   1 
ATOM   5591 C  CB  . ALA D 1 167 ? 27.837  49.454  -77.383  1.00 22.61  ? 989  ALA D CB  1 
ATOM   5592 N  N   . GLY D 1 168 ? 26.248  51.360  -79.200  1.00 23.54  ? 990  GLY D N   1 
ATOM   5593 C  CA  . GLY D 1 168 ? 25.152  51.648  -80.105  1.00 24.56  ? 990  GLY D CA  1 
ATOM   5594 C  C   . GLY D 1 168 ? 25.680  52.196  -81.417  1.00 26.35  ? 990  GLY D C   1 
ATOM   5595 O  O   . GLY D 1 168 ? 25.321  51.698  -82.488  1.00 25.34  ? 990  GLY D O   1 
ATOM   5596 N  N   . ILE D 1 169 ? 26.535  53.216  -81.332  1.00 29.97  ? 991  ILE D N   1 
ATOM   5597 C  CA  . ILE D 1 169 ? 27.134  53.840  -82.515  1.00 31.63  ? 991  ILE D CA  1 
ATOM   5598 C  C   . ILE D 1 169 ? 27.858  52.798  -83.380  1.00 31.61  ? 991  ILE D C   1 
ATOM   5599 O  O   . ILE D 1 169 ? 27.679  52.750  -84.605  1.00 30.91  ? 991  ILE D O   1 
ATOM   5600 C  CB  . ILE D 1 169 ? 28.162  54.929  -82.118  1.00 38.49  ? 991  ILE D CB  1 
ATOM   5601 C  CG1 . ILE D 1 169 ? 27.519  55.978  -81.201  1.00 38.66  ? 991  ILE D CG1 1 
ATOM   5602 C  CG2 . ILE D 1 169 ? 28.717  55.596  -83.368  1.00 39.42  ? 991  ILE D CG2 1 
ATOM   5603 C  CD1 . ILE D 1 169 ? 26.477  56.844  -81.865  1.00 45.76  ? 991  ILE D CD1 1 
ATOM   5604 N  N   . LYS D 1 170 ? 28.676  51.967  -82.743  1.00 31.16  ? 992  LYS D N   1 
ATOM   5605 C  CA  . LYS D 1 170 ? 29.416  50.946  -83.470  1.00 32.51  ? 992  LYS D CA  1 
ATOM   5606 C  C   . LYS D 1 170 ? 28.493  49.927  -84.111  1.00 32.10  ? 992  LYS D C   1 
ATOM   5607 O  O   . LYS D 1 170 ? 28.678  49.572  -85.273  1.00 32.25  ? 992  LYS D O   1 
ATOM   5608 C  CB  . LYS D 1 170 ? 30.405  50.222  -82.553  1.00 36.99  ? 992  LYS D CB  1 
ATOM   5609 C  CG  . LYS D 1 170 ? 31.622  51.052  -82.179  1.00 40.33  ? 992  LYS D CG  1 
ATOM   5610 C  CD  . LYS D 1 170 ? 32.614  50.238  -81.365  1.00 45.06  ? 992  LYS D CD  1 
ATOM   5611 C  CE  . LYS D 1 170 ? 33.801  51.092  -80.924  1.00 48.87  ? 992  LYS D CE  1 
ATOM   5612 N  NZ  . LYS D 1 170 ? 33.386  52.197  -80.008  1.00 49.74  ? 992  LYS D NZ  1 
ATOM   5613 N  N   . LEU D 1 171 ? 27.503  49.453  -83.360  1.00 28.94  ? 993  LEU D N   1 
ATOM   5614 C  CA  . LEU D 1 171 ? 26.575  48.472  -83.897  1.00 27.97  ? 993  LEU D CA  1 
ATOM   5615 C  C   . LEU D 1 171 ? 25.797  49.074  -85.061  1.00 26.78  ? 993  LEU D C   1 
ATOM   5616 O  O   . LEU D 1 171 ? 25.534  48.394  -86.052  1.00 26.34  ? 993  LEU D O   1 
ATOM   5617 C  CB  . LEU D 1 171 ? 25.603  47.986  -82.818  1.00 30.22  ? 993  LEU D CB  1 
ATOM   5618 C  CG  . LEU D 1 171 ? 24.766  46.756  -83.204  1.00 31.12  ? 993  LEU D CG  1 
ATOM   5619 C  CD1 . LEU D 1 171 ? 25.681  45.542  -83.393  1.00 24.29  ? 993  LEU D CD1 1 
ATOM   5620 C  CD2 . LEU D 1 171 ? 23.736  46.472  -82.121  1.00 26.91  ? 993  LEU D CD2 1 
ATOM   5621 N  N   . GLU D 1 172 ? 25.444  50.352  -84.950  1.00 30.60  ? 994  GLU D N   1 
ATOM   5622 C  CA  . GLU D 1 172 ? 24.700  51.015  -86.015  1.00 31.31  ? 994  GLU D CA  1 
ATOM   5623 C  C   . GLU D 1 172 ? 25.514  51.119  -87.299  1.00 31.88  ? 994  GLU D C   1 
ATOM   5624 O  O   . GLU D 1 172 ? 24.989  50.894  -88.388  1.00 31.30  ? 994  GLU D O   1 
ATOM   5625 C  CB  . GLU D 1 172 ? 24.261  52.410  -85.582  1.00 33.39  ? 994  GLU D CB  1 
ATOM   5626 C  CG  . GLU D 1 172 ? 23.697  53.236  -86.716  1.00 34.47  ? 994  GLU D CG  1 
ATOM   5627 C  CD  . GLU D 1 172 ? 23.274  54.615  -86.270  1.00 36.79  ? 994  GLU D CD  1 
ATOM   5628 O  OE1 . GLU D 1 172 ? 24.073  55.300  -85.588  1.00 39.09  ? 994  GLU D OE1 1 
ATOM   5629 O  OE2 . GLU D 1 172 ? 22.142  55.017  -86.605  1.00 38.87  ? 994  GLU D OE2 1 
ATOM   5630 N  N   . ASN D 1 173 ? 26.794  51.459  -87.177  1.00 33.41  ? 995  ASN D N   1 
ATOM   5631 C  CA  . ASN D 1 173 ? 27.638  51.572  -88.362  1.00 33.72  ? 995  ASN D CA  1 
ATOM   5632 C  C   . ASN D 1 173 ? 27.792  50.198  -88.997  1.00 31.35  ? 995  ASN D C   1 
ATOM   5633 O  O   . ASN D 1 173 ? 27.809  50.068  -90.218  1.00 33.24  ? 995  ASN D O   1 
ATOM   5634 C  CB  . ASN D 1 173 ? 29.014  52.146  -88.004  1.00 35.49  ? 995  ASN D CB  1 
ATOM   5635 C  CG  . ASN D 1 173 ? 28.942  53.598  -87.561  1.00 40.11  ? 995  ASN D CG  1 
ATOM   5636 O  OD1 . ASN D 1 173 ? 27.952  54.286  -87.812  1.00 44.65  ? 995  ASN D OD1 1 
ATOM   5637 N  ND2 . ASN D 1 173 ? 29.997  54.075  -86.911  1.00 43.43  ? 995  ASN D ND2 1 
ATOM   5638 N  N   . TYR D 1 174 ? 27.895  49.174  -88.158  1.00 24.56  ? 996  TYR D N   1 
ATOM   5639 C  CA  . TYR D 1 174 ? 28.032  47.807  -88.632  1.00 23.24  ? 996  TYR D CA  1 
ATOM   5640 C  C   . TYR D 1 174 ? 26.773  47.416  -89.405  1.00 23.03  ? 996  TYR D C   1 
ATOM   5641 O  O   . TYR D 1 174 ? 26.855  46.853  -90.507  1.00 20.77  ? 996  TYR D O   1 
ATOM   5642 C  CB  . TYR D 1 174 ? 28.240  46.871  -87.440  1.00 26.09  ? 996  TYR D CB  1 
ATOM   5643 C  CG  . TYR D 1 174 ? 28.497  45.423  -87.787  1.00 26.39  ? 996  TYR D CG  1 
ATOM   5644 C  CD1 . TYR D 1 174 ? 29.664  45.032  -88.449  1.00 31.74  ? 996  TYR D CD1 1 
ATOM   5645 C  CD2 . TYR D 1 174 ? 27.586  44.432  -87.422  1.00 29.57  ? 996  TYR D CD2 1 
ATOM   5646 C  CE1 . TYR D 1 174 ? 29.912  43.686  -88.734  1.00 29.84  ? 996  TYR D CE1 1 
ATOM   5647 C  CE2 . TYR D 1 174 ? 27.825  43.093  -87.700  1.00 28.89  ? 996  TYR D CE2 1 
ATOM   5648 C  CZ  . TYR D 1 174 ? 28.986  42.726  -88.356  1.00 31.03  ? 996  TYR D CZ  1 
ATOM   5649 O  OH  . TYR D 1 174 ? 29.212  41.394  -88.631  1.00 27.29  ? 996  TYR D OH  1 
ATOM   5650 N  N   . PHE D 1 175 ? 25.614  47.725  -88.825  1.00 23.00  ? 997  PHE D N   1 
ATOM   5651 C  CA  . PHE D 1 175 ? 24.321  47.420  -89.434  1.00 23.10  ? 997  PHE D CA  1 
ATOM   5652 C  C   . PHE D 1 175 ? 24.166  48.068  -90.800  1.00 23.73  ? 997  PHE D C   1 
ATOM   5653 O  O   . PHE D 1 175 ? 23.758  47.419  -91.758  1.00 24.58  ? 997  PHE D O   1 
ATOM   5654 C  CB  . PHE D 1 175 ? 23.173  47.900  -88.540  1.00 25.02  ? 997  PHE D CB  1 
ATOM   5655 C  CG  . PHE D 1 175 ? 21.814  47.836  -89.205  1.00 20.81  ? 997  PHE D CG  1 
ATOM   5656 C  CD1 . PHE D 1 175 ? 21.187  46.617  -89.426  1.00 24.61  ? 997  PHE D CD1 1 
ATOM   5657 C  CD2 . PHE D 1 175 ? 21.179  48.999  -89.635  1.00 20.70  ? 997  PHE D CD2 1 
ATOM   5658 C  CE1 . PHE D 1 175 ? 19.947  46.550  -90.067  1.00 26.56  ? 997  PHE D CE1 1 
ATOM   5659 C  CE2 . PHE D 1 175 ? 19.935  48.942  -90.279  1.00 20.93  ? 997  PHE D CE2 1 
ATOM   5660 C  CZ  . PHE D 1 175 ? 19.323  47.712  -90.493  1.00 20.65  ? 997  PHE D CZ  1 
ATOM   5661 N  N   . GLU D 1 176 ? 24.465  49.358  -90.875  1.00 29.03  ? 998  GLU D N   1 
ATOM   5662 C  CA  . GLU D 1 176 ? 24.336  50.086  -92.129  1.00 32.16  ? 998  GLU D CA  1 
ATOM   5663 C  C   . GLU D 1 176 ? 25.208  49.468  -93.220  1.00 32.85  ? 998  GLU D C   1 
ATOM   5664 O  O   . GLU D 1 176 ? 24.805  49.396  -94.382  1.00 34.97  ? 998  GLU D O   1 
ATOM   5665 C  CB  . GLU D 1 176 ? 24.700  51.557  -91.927  1.00 30.43  ? 998  GLU D CB  1 
ATOM   5666 C  CG  . GLU D 1 176 ? 23.725  52.322  -91.042  1.00 36.10  ? 998  GLU D CG  1 
ATOM   5667 C  CD  . GLU D 1 176 ? 22.295  52.288  -91.562  1.00 43.17  ? 998  GLU D CD  1 
ATOM   5668 O  OE1 . GLU D 1 176 ? 22.105  52.400  -92.789  1.00 45.75  ? 998  GLU D OE1 1 
ATOM   5669 O  OE2 . GLU D 1 176 ? 21.358  52.161  -90.742  1.00 45.76  ? 998  GLU D OE2 1 
ATOM   5670 N  N   . GLU D 1 177 ? 26.398  49.014  -92.844  1.00 29.72  ? 999  GLU D N   1 
ATOM   5671 C  CA  . GLU D 1 177 ? 27.292  48.395  -93.809  1.00 30.15  ? 999  GLU D CA  1 
ATOM   5672 C  C   . GLU D 1 177 ? 26.716  47.071  -94.287  1.00 28.53  ? 999  GLU D C   1 
ATOM   5673 O  O   . GLU D 1 177 ? 26.838  46.722  -95.461  1.00 27.55  ? 999  GLU D O   1 
ATOM   5674 C  CB  . GLU D 1 177 ? 28.674  48.157  -93.203  1.00 61.36  ? 999  GLU D CB  1 
ATOM   5675 C  CG  . GLU D 1 177 ? 29.649  47.540  -94.192  1.00 69.68  ? 999  GLU D CG  1 
ATOM   5676 C  CD  . GLU D 1 177 ? 30.067  48.505  -95.294  1.00 77.01  ? 999  GLU D CD  1 
ATOM   5677 O  OE1 . GLU D 1 177 ? 29.229  49.321  -95.737  1.00 75.00  ? 999  GLU D OE1 1 
ATOM   5678 O  OE2 . GLU D 1 177 ? 31.238  48.437  -95.726  1.00 80.40  ? 999  GLU D OE2 1 
ATOM   5679 N  N   . LEU D 1 178 ? 26.095  46.325  -93.377  1.00 25.55  ? 1000 LEU D N   1 
ATOM   5680 C  CA  . LEU D 1 178 ? 25.493  45.052  -93.746  1.00 24.57  ? 1000 LEU D CA  1 
ATOM   5681 C  C   . LEU D 1 178 ? 24.301  45.320  -94.664  1.00 24.28  ? 1000 LEU D C   1 
ATOM   5682 O  O   . LEU D 1 178 ? 24.044  44.574  -95.611  1.00 23.48  ? 1000 LEU D O   1 
ATOM   5683 C  CB  . LEU D 1 178 ? 25.022  44.292  -92.501  1.00 30.15  ? 1000 LEU D CB  1 
ATOM   5684 C  CG  . LEU D 1 178 ? 26.099  43.685  -91.596  1.00 30.90  ? 1000 LEU D CG  1 
ATOM   5685 C  CD1 . LEU D 1 178 ? 25.440  43.101  -90.366  1.00 33.78  ? 1000 LEU D CD1 1 
ATOM   5686 C  CD2 . LEU D 1 178 ? 26.880  42.612  -92.341  1.00 24.46  ? 1000 LEU D CD2 1 
ATOM   5687 N  N   . LEU D 1 179 ? 23.577  46.395  -94.384  1.00 29.68  ? 1001 LEU D N   1 
ATOM   5688 C  CA  . LEU D 1 179 ? 22.414  46.745  -95.185  1.00 31.79  ? 1001 LEU D CA  1 
ATOM   5689 C  C   . LEU D 1 179 ? 22.838  47.084  -96.621  1.00 32.73  ? 1001 LEU D C   1 
ATOM   5690 O  O   . LEU D 1 179 ? 22.117  46.784  -97.576  1.00 31.79  ? 1001 LEU D O   1 
ATOM   5691 C  CB  . LEU D 1 179 ? 21.674  47.923  -94.536  1.00 32.39  ? 1001 LEU D CB  1 
ATOM   5692 C  CG  . LEU D 1 179 ? 20.183  48.106  -94.844  1.00 33.94  ? 1001 LEU D CG  1 
ATOM   5693 C  CD1 . LEU D 1 179 ? 19.394  46.885  -94.383  1.00 30.09  ? 1001 LEU D CD1 1 
ATOM   5694 C  CD2 . LEU D 1 179 ? 19.673  49.361  -94.145  1.00 26.34  ? 1001 LEU D CD2 1 
ATOM   5695 N  N   . LYS D 1 180 ? 24.010  47.698  -96.774  1.00 34.15  ? 1002 LYS D N   1 
ATOM   5696 C  CA  . LYS D 1 180 ? 24.516  48.049  -98.102  1.00 35.55  ? 1002 LYS D CA  1 
ATOM   5697 C  C   . LYS D 1 180 ? 24.874  46.776  -98.849  1.00 34.70  ? 1002 LYS D C   1 
ATOM   5698 O  O   . LYS D 1 180 ? 24.815  46.719  -100.074 1.00 34.16  ? 1002 LYS D O   1 
ATOM   5699 C  CB  . LYS D 1 180 ? 25.764  48.929  -97.998  1.00 57.64  ? 1002 LYS D CB  1 
ATOM   5700 C  CG  . LYS D 1 180 ? 25.551  50.257  -97.302  1.00 59.09  ? 1002 LYS D CG  1 
ATOM   5701 C  CD  . LYS D 1 180 ? 26.850  51.048  -97.244  1.00 66.01  ? 1002 LYS D CD  1 
ATOM   5702 C  CE  . LYS D 1 180 ? 26.682  52.342  -96.463  1.00 70.39  ? 1002 LYS D CE  1 
ATOM   5703 N  NZ  . LYS D 1 180 ? 25.635  53.220  -97.054  1.00 74.29  ? 1002 LYS D NZ  1 
ATOM   5704 N  N   . ASN D 1 181 ? 25.251  45.752  -98.096  1.00 32.68  ? 1003 ASN D N   1 
ATOM   5705 C  CA  . ASN D 1 181 ? 25.619  44.476  -98.683  1.00 31.63  ? 1003 ASN D CA  1 
ATOM   5706 C  C   . ASN D 1 181 ? 24.410  43.657  -99.121  1.00 31.23  ? 1003 ASN D C   1 
ATOM   5707 O  O   . ASN D 1 181 ? 24.454  42.983  -100.149 1.00 29.69  ? 1003 ASN D O   1 
ATOM   5708 C  CB  . ASN D 1 181 ? 26.447  43.662  -97.685  1.00 42.94  ? 1003 ASN D CB  1 
ATOM   5709 C  CG  . ASN D 1 181 ? 27.862  44.179  -97.545  1.00 46.63  ? 1003 ASN D CG  1 
ATOM   5710 O  OD1 . ASN D 1 181 ? 28.153  45.322  -97.893  1.00 47.14  ? 1003 ASN D OD1 1 
ATOM   5711 N  ND2 . ASN D 1 181 ? 28.749  43.340  -97.024  1.00 54.37  ? 1003 ASN D ND2 1 
ATOM   5712 N  N   . LEU D 1 182 ? 23.331  43.718  -98.345  1.00 31.63  ? 1004 LEU D N   1 
ATOM   5713 C  CA  . LEU D 1 182 ? 22.140  42.940  -98.656  1.00 30.05  ? 1004 LEU D CA  1 
ATOM   5714 C  C   . LEU D 1 182 ? 21.136  43.639  -99.565  1.00 30.00  ? 1004 LEU D C   1 
ATOM   5715 O  O   . LEU D 1 182 ? 20.333  42.983  -100.224 1.00 30.46  ? 1004 LEU D O   1 
ATOM   5716 C  CB  . LEU D 1 182 ? 21.458  42.501  -97.360  1.00 33.39  ? 1004 LEU D CB  1 
ATOM   5717 C  CG  . LEU D 1 182 ? 22.291  41.545  -96.499  1.00 34.70  ? 1004 LEU D CG  1 
ATOM   5718 C  CD1 . LEU D 1 182 ? 21.536  41.199  -95.224  1.00 33.83  ? 1004 LEU D CD1 1 
ATOM   5719 C  CD2 . LEU D 1 182 ? 22.593  40.280  -97.283  1.00 37.73  ? 1004 LEU D CD2 1 
ATOM   5720 N  N   . TYR D 1 183 ? 21.183  44.963  -99.609  1.00 27.59  ? 1005 TYR D N   1 
ATOM   5721 C  CA  . TYR D 1 183 ? 20.269  45.715  -100.455 1.00 27.50  ? 1005 TYR D CA  1 
ATOM   5722 C  C   . TYR D 1 183 ? 21.018  46.743  -101.277 1.00 27.76  ? 1005 TYR D C   1 
ATOM   5723 O  O   . TYR D 1 183 ? 20.851  47.943  -101.083 1.00 29.66  ? 1005 TYR D O   1 
ATOM   5724 C  CB  . TYR D 1 183 ? 19.213  46.414  -99.607  1.00 28.27  ? 1005 TYR D CB  1 
ATOM   5725 C  CG  . TYR D 1 183 ? 18.185  45.467  -99.036  1.00 28.81  ? 1005 TYR D CG  1 
ATOM   5726 C  CD1 . TYR D 1 183 ? 17.160  44.957  -99.831  1.00 25.28  ? 1005 TYR D CD1 1 
ATOM   5727 C  CD2 . TYR D 1 183 ? 18.248  45.069  -97.706  1.00 26.24  ? 1005 TYR D CD2 1 
ATOM   5728 C  CE1 . TYR D 1 183 ? 16.220  44.079  -99.310  1.00 25.45  ? 1005 TYR D CE1 1 
ATOM   5729 C  CE2 . TYR D 1 183 ? 17.319  44.187  -97.177  1.00 26.66  ? 1005 TYR D CE2 1 
ATOM   5730 C  CZ  . TYR D 1 183 ? 16.305  43.696  -97.980  1.00 26.61  ? 1005 TYR D CZ  1 
ATOM   5731 O  OH  . TYR D 1 183 ? 15.380  42.821  -97.448  1.00 27.45  ? 1005 TYR D OH  1 
ATOM   5732 N  N   . PRO D 1 184 ? 21.868  46.282  -102.204 1.00 41.97  ? 1006 PRO D N   1 
ATOM   5733 C  CA  . PRO D 1 184 ? 22.625  47.217  -103.034 1.00 41.97  ? 1006 PRO D CA  1 
ATOM   5734 C  C   . PRO D 1 184 ? 21.772  47.845  -104.140 1.00 41.97  ? 1006 PRO D C   1 
ATOM   5735 O  O   . PRO D 1 184 ? 20.655  47.338  -104.392 1.00 41.97  ? 1006 PRO D O   1 
ATOM   5736 C  CB  . PRO D 1 184 ? 23.756  46.347  -103.574 1.00 44.79  ? 1006 PRO D CB  1 
ATOM   5737 C  CG  . PRO D 1 184 ? 23.120  45.010  -103.701 1.00 44.79  ? 1006 PRO D CG  1 
ATOM   5738 C  CD  . PRO D 1 184 ? 22.308  44.893  -102.434 1.00 44.79  ? 1006 PRO D CD  1 
ATOM   5739 O  OXT . PRO D 1 184 ? 22.231  48.843  -104.739 1.00 52.12  ? 1006 PRO D OXT 1 
HETATM 5740 ZN ZN  . ZN  E 2 .   ? 24.059  51.192  -3.340   1.00 30.64  ? 1    ZN  A ZN  1 
HETATM 5741 ZN ZN  . ZN  F 2 .   ? 27.736  52.784  10.761   1.00 41.84  ? 2    ZN  A ZN  1 
HETATM 5742 ZN ZN  . ZN  G 2 .   ? 41.327  16.758  -14.937  1.00 25.94  ? 1    ZN  B ZN  1 
HETATM 5743 ZN ZN  . ZN  H 2 .   ? 45.134  10.424  -27.438  1.00 26.94  ? 2    ZN  B ZN  1 
HETATM 5744 ZN ZN  . ZN  I 2 .   ? 26.905  25.953  -53.697  1.00 26.54  ? 1    ZN  C ZN  1 
HETATM 5745 ZN ZN  . ZN  J 2 .   ? 23.114  19.678  -66.183  1.00 25.34  ? 2    ZN  C ZN  1 
HETATM 5746 ZN ZN  . ZN  K 2 .   ? 24.060  30.121  -77.754  1.00 32.04  ? 1    ZN  D ZN  1 
HETATM 5747 ZN ZN  . ZN  L 2 .   ? 27.721  28.499  -91.852  1.00 40.14  ? 2    ZN  D ZN  1 
HETATM 5748 O  O   . HOH M 3 .   ? 26.114  34.997  -4.912   1.00 31.18  ? 100  HOH A O   1 
HETATM 5749 O  O   . HOH M 3 .   ? 24.309  25.488  -1.978   1.00 25.26  ? 101  HOH A O   1 
HETATM 5750 O  O   . HOH M 3 .   ? 13.135  46.264  5.503    1.00 31.22  ? 102  HOH A O   1 
HETATM 5751 O  O   . HOH M 3 .   ? 2.367   42.227  18.845   1.00 31.72  ? 103  HOH A O   1 
HETATM 5752 O  O   . HOH M 3 .   ? 15.305  39.671  20.821   1.00 30.75  ? 104  HOH A O   1 
HETATM 5753 O  O   . HOH M 3 .   ? 20.454  38.678  -6.949   1.00 29.83  ? 105  HOH A O   1 
HETATM 5754 O  O   . HOH M 3 .   ? 4.843   40.574  5.365    1.00 43.77  ? 106  HOH A O   1 
HETATM 5755 O  O   . HOH M 3 .   ? 13.195  48.522  3.903    1.00 34.54  ? 107  HOH A O   1 
HETATM 5756 O  O   . HOH M 3 .   ? 13.019  27.628  5.680    1.00 26.23  ? 108  HOH A O   1 
HETATM 5757 O  O   . HOH M 3 .   ? 18.185  30.797  -3.301   1.00 24.07  ? 109  HOH A O   1 
HETATM 5758 O  O   . HOH M 3 .   ? 10.686  22.647  -19.092  1.00 38.55  ? 110  HOH A O   1 
HETATM 5759 O  O   . HOH M 3 .   ? 17.889  35.043  -5.782   1.00 30.82  ? 111  HOH A O   1 
HETATM 5760 O  O   . HOH M 3 .   ? 13.500  49.556  -1.021   1.00 40.67  ? 112  HOH A O   1 
HETATM 5761 O  O   . HOH M 3 .   ? 10.381  49.379  8.048    1.00 44.89  ? 113  HOH A O   1 
HETATM 5762 O  O   . HOH M 3 .   ? 31.341  31.995  5.331    1.00 36.62  ? 114  HOH A O   1 
HETATM 5763 O  O   . HOH M 3 .   ? 22.944  26.526  0.081    1.00 25.45  ? 115  HOH A O   1 
HETATM 5764 O  O   . HOH M 3 .   ? 25.219  44.034  -3.858   1.00 46.04  ? 116  HOH A O   1 
HETATM 5765 O  O   . HOH M 3 .   ? 18.420  29.357  -5.689   1.00 34.38  ? 117  HOH A O   1 
HETATM 5766 O  O   . HOH M 3 .   ? 17.895  21.906  -0.306   1.00 38.15  ? 118  HOH A O   1 
HETATM 5767 O  O   . HOH M 3 .   ? 13.756  33.636  -6.673   1.00 32.43  ? 119  HOH A O   1 
HETATM 5768 O  O   . HOH M 3 .   ? 12.314  47.215  7.741    1.00 36.26  ? 120  HOH A O   1 
HETATM 5769 O  O   . HOH M 3 .   ? 12.973  29.356  12.078   1.00 39.91  ? 121  HOH A O   1 
HETATM 5770 O  O   . HOH M 3 .   ? 28.713  36.134  -5.528   1.00 36.12  ? 122  HOH A O   1 
HETATM 5771 O  O   . HOH M 3 .   ? 24.308  24.733  -11.012  1.00 48.20  ? 123  HOH A O   1 
HETATM 5772 O  O   . HOH M 3 .   ? 18.768  37.442  -8.967   1.00 33.83  ? 124  HOH A O   1 
HETATM 5773 O  O   . HOH M 3 .   ? 9.539   39.575  17.923   1.00 29.47  ? 125  HOH A O   1 
HETATM 5774 O  O   . HOH M 3 .   ? 5.743   38.713  -0.230   1.00 49.47  ? 126  HOH A O   1 
HETATM 5775 O  O   . HOH M 3 .   ? 17.434  33.359  -3.754   1.00 28.92  ? 127  HOH A O   1 
HETATM 5776 O  O   . HOH M 3 .   ? 22.491  58.470  -6.161   1.00 49.75  ? 128  HOH A O   1 
HETATM 5777 O  O   . HOH M 3 .   ? 30.688  51.936  2.103    1.00 44.18  ? 129  HOH A O   1 
HETATM 5778 O  O   . HOH M 3 .   ? 14.035  31.133  -14.171  1.00 37.43  ? 130  HOH A O   1 
HETATM 5779 O  O   . HOH M 3 .   ? 27.180  28.639  -10.457  1.00 39.66  ? 131  HOH A O   1 
HETATM 5780 O  O   . HOH M 3 .   ? 23.064  45.414  -4.563   1.00 42.50  ? 132  HOH A O   1 
HETATM 5781 O  O   . HOH M 3 .   ? 28.853  41.544  5.431    1.00 35.32  ? 133  HOH A O   1 
HETATM 5782 O  O   . HOH M 3 .   ? 18.883  31.540  20.881   1.00 45.85  ? 134  HOH A O   1 
HETATM 5783 O  O   . HOH M 3 .   ? 17.714  43.784  -3.530   1.00 46.81  ? 135  HOH A O   1 
HETATM 5784 O  O   . HOH M 3 .   ? 11.910  29.347  -14.830  1.00 45.85  ? 136  HOH A O   1 
HETATM 5785 O  O   . HOH M 3 .   ? 11.347  25.701  -2.453   1.00 33.31  ? 137  HOH A O   1 
HETATM 5786 O  O   . HOH M 3 .   ? 26.673  25.698  4.932    1.00 48.90  ? 138  HOH A O   1 
HETATM 5787 O  O   . HOH M 3 .   ? 25.550  43.152  14.883   1.00 48.89  ? 139  HOH A O   1 
HETATM 5788 O  O   . HOH M 3 .   ? 17.864  48.885  11.980   1.00 32.15  ? 140  HOH A O   1 
HETATM 5789 O  O   . HOH M 3 .   ? 5.949   42.391  12.343   1.00 40.67  ? 141  HOH A O   1 
HETATM 5790 O  O   . HOH M 3 .   ? 31.175  31.088  -5.344   1.00 38.71  ? 142  HOH A O   1 
HETATM 5791 O  O   . HOH M 3 .   ? 20.798  41.175  -8.020   1.00 43.33  ? 143  HOH A O   1 
HETATM 5792 O  O   . HOH M 3 .   ? 27.193  42.639  -2.436   1.00 47.93  ? 144  HOH A O   1 
HETATM 5793 O  O   . HOH M 3 .   ? 24.885  32.071  20.245   1.00 40.95  ? 145  HOH A O   1 
HETATM 5794 O  O   . HOH M 3 .   ? 7.924   31.603  -1.494   1.00 39.69  ? 146  HOH A O   1 
HETATM 5795 O  O   . HOH M 3 .   ? 4.800   41.652  19.766   1.00 48.53  ? 147  HOH A O   1 
HETATM 5796 O  O   . HOH M 3 .   ? 8.332   51.829  11.104   1.00 49.14  ? 148  HOH A O   1 
HETATM 5797 O  O   . HOH M 3 .   ? 32.245  40.076  1.531    1.00 32.44  ? 149  HOH A O   1 
HETATM 5798 O  O   . HOH N 3 .   ? 34.647  19.580  -15.366  1.00 20.00  ? 100  HOH B O   1 
HETATM 5799 O  O   . HOH N 3 .   ? 14.810  16.957  -39.480  1.00 19.61  ? 101  HOH B O   1 
HETATM 5800 O  O   . HOH N 3 .   ? 41.877  40.066  -24.720  1.00 21.03  ? 102  HOH B O   1 
HETATM 5801 O  O   . HOH N 3 .   ? 29.661  16.798  -27.012  1.00 23.63  ? 103  HOH B O   1 
HETATM 5802 O  O   . HOH N 3 .   ? 36.423  19.660  -19.864  1.00 25.17  ? 104  HOH B O   1 
HETATM 5803 O  O   . HOH N 3 .   ? 30.413  16.660  -22.477  1.00 28.18  ? 105  HOH B O   1 
HETATM 5804 O  O   . HOH N 3 .   ? 20.080  17.525  -38.816  1.00 30.85  ? 106  HOH B O   1 
HETATM 5805 O  O   . HOH N 3 .   ? 48.626  31.451  -29.221  1.00 27.34  ? 107  HOH B O   1 
HETATM 5806 O  O   . HOH N 3 .   ? 47.909  19.433  -21.427  1.00 27.70  ? 108  HOH B O   1 
HETATM 5807 O  O   . HOH N 3 .   ? 30.536  18.142  -24.772  1.00 25.42  ? 109  HOH B O   1 
HETATM 5808 O  O   . HOH N 3 .   ? 46.238  22.405  -26.050  1.00 24.56  ? 110  HOH B O   1 
HETATM 5809 O  O   . HOH N 3 .   ? 34.925  23.464  -17.162  1.00 34.49  ? 111  HOH B O   1 
HETATM 5810 O  O   . HOH N 3 .   ? 23.366  19.528  -32.959  1.00 27.83  ? 112  HOH B O   1 
HETATM 5811 O  O   . HOH N 3 .   ? 41.289  44.543  -23.826  1.00 31.46  ? 113  HOH B O   1 
HETATM 5812 O  O   . HOH N 3 .   ? 22.668  17.575  -40.021  1.00 29.18  ? 114  HOH B O   1 
HETATM 5813 O  O   . HOH N 3 .   ? 34.774  33.585  -20.376  1.00 30.23  ? 115  HOH B O   1 
HETATM 5814 O  O   . HOH N 3 .   ? 40.256  12.075  -38.980  1.00 29.38  ? 116  HOH B O   1 
HETATM 5815 O  O   . HOH N 3 .   ? 38.349  18.848  -42.079  1.00 34.00  ? 117  HOH B O   1 
HETATM 5816 O  O   . HOH N 3 .   ? 40.902  30.824  -38.149  1.00 26.70  ? 118  HOH B O   1 
HETATM 5817 O  O   . HOH N 3 .   ? 44.573  40.899  -15.796  1.00 29.07  ? 119  HOH B O   1 
HETATM 5818 O  O   . HOH N 3 .   ? 30.457  17.676  -17.786  1.00 37.38  ? 120  HOH B O   1 
HETATM 5819 O  O   . HOH N 3 .   ? 38.660  39.201  -15.529  1.00 39.92  ? 121  HOH B O   1 
HETATM 5820 O  O   . HOH N 3 .   ? 49.935  16.615  -17.909  1.00 34.28  ? 122  HOH B O   1 
HETATM 5821 O  O   . HOH N 3 .   ? 49.204  36.769  -19.690  1.00 33.98  ? 123  HOH B O   1 
HETATM 5822 O  O   . HOH N 3 .   ? 35.435  13.406  -30.163  1.00 24.22  ? 124  HOH B O   1 
HETATM 5823 O  O   . HOH N 3 .   ? 31.259  34.279  -18.403  1.00 37.77  ? 125  HOH B O   1 
HETATM 5824 O  O   . HOH N 3 .   ? 26.034  30.700  -31.634  1.00 35.67  ? 126  HOH B O   1 
HETATM 5825 O  O   . HOH N 3 .   ? 42.866  2.850   -23.449  1.00 36.75  ? 127  HOH B O   1 
HETATM 5826 O  O   . HOH N 3 .   ? 42.099  23.231  -16.018  1.00 39.42  ? 128  HOH B O   1 
HETATM 5827 O  O   . HOH N 3 .   ? 40.813  38.292  -26.381  1.00 30.64  ? 129  HOH B O   1 
HETATM 5828 O  O   . HOH N 3 .   ? 30.533  31.828  -36.833  1.00 34.59  ? 130  HOH B O   1 
HETATM 5829 O  O   . HOH N 3 .   ? 30.621  35.742  -31.664  1.00 25.69  ? 131  HOH B O   1 
HETATM 5830 O  O   . HOH N 3 .   ? 49.414  28.663  -17.246  1.00 37.50  ? 132  HOH B O   1 
HETATM 5831 O  O   . HOH N 3 .   ? 47.981  13.914  -19.607  1.00 30.09  ? 133  HOH B O   1 
HETATM 5832 O  O   . HOH N 3 .   ? 29.816  9.465   -37.845  1.00 34.92  ? 134  HOH B O   1 
HETATM 5833 O  O   . HOH N 3 .   ? 35.907  37.982  -20.238  1.00 29.45  ? 135  HOH B O   1 
HETATM 5834 O  O   . HOH N 3 .   ? 35.186  32.627  -18.058  1.00 35.30  ? 136  HOH B O   1 
HETATM 5835 O  O   . HOH N 3 .   ? 32.579  19.107  -17.842  1.00 35.71  ? 137  HOH B O   1 
HETATM 5836 O  O   . HOH N 3 .   ? 35.760  13.319  -13.518  1.00 33.10  ? 138  HOH B O   1 
HETATM 5837 O  O   . HOH N 3 .   ? 32.188  35.754  -20.502  1.00 33.37  ? 139  HOH B O   1 
HETATM 5838 O  O   . HOH N 3 .   ? 43.822  16.037  -32.826  1.00 35.89  ? 140  HOH B O   1 
HETATM 5839 O  O   . HOH N 3 .   ? 49.402  19.346  -25.159  1.00 47.99  ? 141  HOH B O   1 
HETATM 5840 O  O   . HOH N 3 .   ? 49.185  15.746  -22.301  1.00 39.33  ? 142  HOH B O   1 
HETATM 5841 O  O   . HOH N 3 .   ? 47.451  18.817  -27.575  1.00 40.18  ? 143  HOH B O   1 
HETATM 5842 O  O   . HOH N 3 .   ? 26.024  30.992  -36.756  1.00 45.16  ? 144  HOH B O   1 
HETATM 5843 O  O   . HOH N 3 .   ? 50.764  18.152  -12.315  1.00 48.37  ? 145  HOH B O   1 
HETATM 5844 O  O   . HOH N 3 .   ? 38.013  27.901  -40.888  1.00 38.76  ? 146  HOH B O   1 
HETATM 5845 O  O   . HOH N 3 .   ? 45.362  43.570  -24.589  1.00 36.52  ? 147  HOH B O   1 
HETATM 5846 O  O   . HOH N 3 .   ? 45.713  2.257   -21.889  1.00 51.83  ? 148  HOH B O   1 
HETATM 5847 O  O   . HOH N 3 .   ? 47.451  16.276  -8.151   1.00 42.03  ? 149  HOH B O   1 
HETATM 5848 O  O   . HOH N 3 .   ? 33.817  34.588  -6.108   1.00 31.57  ? 150  HOH B O   1 
HETATM 5849 O  O   . HOH N 3 .   ? 22.389  23.564  -27.208  1.00 40.59  ? 151  HOH B O   1 
HETATM 5850 O  O   . HOH N 3 .   ? 25.338  32.277  -27.717  1.00 33.33  ? 152  HOH B O   1 
HETATM 5851 O  O   . HOH N 3 .   ? 41.748  42.014  -15.869  1.00 42.60  ? 153  HOH B O   1 
HETATM 5852 O  O   . HOH N 3 .   ? 13.942  23.532  -36.043  1.00 37.70  ? 154  HOH B O   1 
HETATM 5853 O  O   . HOH N 3 .   ? 27.298  20.522  -39.233  1.00 27.73  ? 155  HOH B O   1 
HETATM 5854 O  O   . HOH N 3 .   ? 47.813  3.969   -22.840  1.00 39.67  ? 156  HOH B O   1 
HETATM 5855 O  O   . HOH N 3 .   ? 30.665  10.936  -32.112  1.00 31.78  ? 157  HOH B O   1 
HETATM 5856 O  O   . HOH N 3 .   ? 46.020  32.725  -35.082  1.00 34.60  ? 158  HOH B O   1 
HETATM 5857 O  O   . HOH N 3 .   ? 31.720  12.089  -29.802  1.00 36.95  ? 159  HOH B O   1 
HETATM 5858 O  O   . HOH N 3 .   ? 49.659  29.168  -27.640  1.00 36.58  ? 160  HOH B O   1 
HETATM 5859 O  O   . HOH N 3 .   ? 29.262  32.455  -19.246  1.00 42.61  ? 161  HOH B O   1 
HETATM 5860 O  O   . HOH N 3 .   ? 28.594  40.327  -24.235  1.00 35.72  ? 162  HOH B O   1 
HETATM 5861 O  O   . HOH N 3 .   ? 29.419  17.948  -20.107  1.00 50.32  ? 163  HOH B O   1 
HETATM 5862 O  O   . HOH N 3 .   ? 23.665  10.879  -26.556  1.00 51.35  ? 164  HOH B O   1 
HETATM 5863 O  O   . HOH N 3 .   ? 31.458  11.867  -15.395  1.00 45.67  ? 165  HOH B O   1 
HETATM 5864 O  O   . HOH N 3 .   ? 27.519  33.254  -30.230  1.00 41.14  ? 166  HOH B O   1 
HETATM 5865 O  O   . HOH N 3 .   ? 38.818  47.066  -22.373  1.00 37.46  ? 167  HOH B O   1 
HETATM 5866 O  O   . HOH N 3 .   ? 33.190  19.308  -41.524  1.00 21.29  ? 168  HOH B O   1 
HETATM 5867 O  O   . HOH O 3 .   ? 17.151  22.969  -50.951  1.00 23.10  ? 100  HOH C O   1 
HETATM 5868 O  O   . HOH O 3 .   ? 11.399  19.651  -54.040  1.00 23.18  ? 101  HOH C O   1 
HETATM 5869 O  O   . HOH O 3 .   ? 12.242  19.840  -58.558  1.00 24.46  ? 102  HOH C O   1 
HETATM 5870 O  O   . HOH O 3 .   ? 18.195  16.672  -61.129  1.00 24.70  ? 103  HOH C O   1 
HETATM 5871 O  O   . HOH O 3 .   ? 27.981  13.747  -55.052  1.00 25.64  ? 104  HOH C O   1 
HETATM 5872 O  O   . HOH O 3 .   ? 23.627  -3.614  -56.339  1.00 24.76  ? 105  HOH C O   1 
HETATM 5873 O  O   . HOH O 3 .   ? 9.172   15.962  -41.868  1.00 25.46  ? 106  HOH C O   1 
HETATM 5874 O  O   . HOH O 3 .   ? 16.948  3.733   -63.092  1.00 35.15  ? 107  HOH C O   1 
HETATM 5875 O  O   . HOH O 3 .   ? 13.088  27.615  -51.954  1.00 26.14  ? 108  HOH C O   1 
HETATM 5876 O  O   . HOH O 3 .   ? 30.359  4.920   -51.832  1.00 27.89  ? 109  HOH C O   1 
HETATM 5877 O  O   . HOH O 3 .   ? 12.465  0.692   -49.536  1.00 30.87  ? 110  HOH C O   1 
HETATM 5878 O  O   . HOH O 3 .   ? 12.386  18.650  -63.469  1.00 37.94  ? 111  HOH C O   1 
HETATM 5879 O  O   . HOH O 3 .   ? 26.314  -4.479  -65.269  1.00 27.51  ? 112  HOH C O   1 
HETATM 5880 O  O   . HOH O 3 .   ? 30.948  -0.503  -61.459  1.00 35.36  ? 113  HOH C O   1 
HETATM 5881 O  O   . HOH O 3 .   ? 12.361  18.234  -56.309  1.00 22.29  ? 114  HOH C O   1 
HETATM 5882 O  O   . HOH O 3 .   ? 29.703  17.338  -54.219  1.00 37.93  ? 115  HOH C O   1 
HETATM 5883 O  O   . HOH O 3 .   ? 16.337  17.120  -65.564  1.00 33.79  ? 116  HOH C O   1 
HETATM 5884 O  O   . HOH O 3 .   ? 19.213  -1.909  -63.114  1.00 32.45  ? 117  HOH C O   1 
HETATM 5885 O  O   . HOH O 3 .   ? 12.178  4.433   -44.271  1.00 34.50  ? 118  HOH C O   1 
HETATM 5886 O  O   . HOH O 3 .   ? 16.628  12.985  -63.883  1.00 32.02  ? 119  HOH C O   1 
HETATM 5887 O  O   . HOH O 3 .   ? 13.955  0.429   -60.160  1.00 34.69  ? 120  HOH C O   1 
HETATM 5888 O  O   . HOH O 3 .   ? 22.440  -1.923  -54.762  1.00 32.85  ? 121  HOH C O   1 
HETATM 5889 O  O   . HOH O 3 .   ? 4.153   12.869  -54.008  1.00 38.11  ? 122  HOH C O   1 
HETATM 5890 O  O   . HOH O 3 .   ? 22.572  5.525   -42.834  1.00 28.39  ? 123  HOH C O   1 
HETATM 5891 O  O   . HOH O 3 .   ? 16.606  2.815   -60.689  1.00 32.57  ? 124  HOH C O   1 
HETATM 5892 O  O   . HOH O 3 .   ? 31.819  19.614  -63.325  1.00 41.30  ? 125  HOH C O   1 
HETATM 5893 O  O   . HOH O 3 .   ? 17.576  -1.527  -60.907  1.00 28.97  ? 126  HOH C O   1 
HETATM 5894 O  O   . HOH O 3 .   ? 4.379   18.844  -41.164  1.00 33.72  ? 127  HOH C O   1 
HETATM 5895 O  O   . HOH O 3 .   ? 10.118  11.054  -38.657  1.00 37.77  ? 128  HOH C O   1 
HETATM 5896 O  O   . HOH O 3 .   ? 13.576  24.247  -51.393  1.00 36.47  ? 129  HOH C O   1 
HETATM 5897 O  O   . HOH O 3 .   ? 29.647  17.082  -59.593  1.00 32.37  ? 130  HOH C O   1 
HETATM 5898 O  O   . HOH O 3 .   ? 14.624  17.260  -63.429  1.00 38.62  ? 131  HOH C O   1 
HETATM 5899 O  O   . HOH O 3 .   ? 5.301   16.816  -48.093  1.00 30.01  ? 132  HOH C O   1 
HETATM 5900 O  O   . HOH O 3 .   ? 29.687  22.302  -61.565  1.00 31.31  ? 133  HOH C O   1 
HETATM 5901 O  O   . HOH O 3 .   ? 22.391  -2.865  -52.424  1.00 41.12  ? 134  HOH C O   1 
HETATM 5902 O  O   . HOH O 3 .   ? 7.743   5.725   -49.307  1.00 39.76  ? 135  HOH C O   1 
HETATM 5903 O  O   . HOH O 3 .   ? 29.122  20.060  -72.994  1.00 40.09  ? 136  HOH C O   1 
HETATM 5904 O  O   . HOH O 3 .   ? 17.390  23.065  -67.476  1.00 36.96  ? 137  HOH C O   1 
HETATM 5905 O  O   . HOH O 3 .   ? 22.732  13.913  -65.530  1.00 52.90  ? 138  HOH C O   1 
HETATM 5906 O  O   . HOH O 3 .   ? 9.208   3.112   -50.811  1.00 42.11  ? 139  HOH C O   1 
HETATM 5907 O  O   . HOH O 3 .   ? 18.539  24.921  -48.268  1.00 43.32  ? 140  HOH C O   1 
HETATM 5908 O  O   . HOH O 3 .   ? 7.040   20.808  -46.961  1.00 35.52  ? 141  HOH C O   1 
HETATM 5909 O  O   . HOH O 3 .   ? 23.050  -8.220  -57.304  1.00 30.44  ? 142  HOH C O   1 
HETATM 5910 O  O   . HOH O 3 .   ? 7.040   -4.075  -62.888  1.00 41.05  ? 143  HOH C O   1 
HETATM 5911 O  O   . HOH O 3 .   ? 4.181   21.795  -57.026  1.00 52.37  ? 144  HOH C O   1 
HETATM 5912 O  O   . HOH O 3 .   ? 10.425  -3.801  -56.880  1.00 38.02  ? 145  HOH C O   1 
HETATM 5913 O  O   . HOH O 3 .   ? 18.422  14.119  -34.574  1.00 55.31  ? 146  HOH C O   1 
HETATM 5914 O  O   . HOH O 3 .   ? 12.515  -3.318  -47.563  1.00 45.51  ? 147  HOH C O   1 
HETATM 5915 O  O   . HOH O 3 .   ? -1.020  20.597  -43.802  1.00 49.58  ? 148  HOH C O   1 
HETATM 5916 O  O   . HOH O 3 .   ? 17.652  4.701   -67.002  1.00 34.25  ? 149  HOH C O   1 
HETATM 5917 O  O   . HOH O 3 .   ? 22.183  24.218  -42.072  1.00 36.62  ? 150  HOH C O   1 
HETATM 5918 O  O   . HOH O 3 .   ? 15.670  1.956   -74.944  1.00 30.32  ? 151  HOH C O   1 
HETATM 5919 O  O   . HOH O 3 .   ? 13.061  2.094   -62.942  1.00 33.40  ? 152  HOH C O   1 
HETATM 5920 O  O   . HOH O 3 .   ? 20.950  -9.491  -65.001  1.00 45.24  ? 153  HOH C O   1 
HETATM 5921 O  O   . HOH O 3 .   ? 32.682  -0.589  -64.127  1.00 42.47  ? 154  HOH C O   1 
HETATM 5922 O  O   . HOH O 3 .   ? 24.615  9.674   -37.599  1.00 29.44  ? 155  HOH C O   1 
HETATM 5923 O  O   . HOH O 3 .   ? 12.718  33.361  -55.894  1.00 40.66  ? 156  HOH C O   1 
HETATM 5924 O  O   . HOH O 3 .   ? 19.847  8.423   -40.104  1.00 46.55  ? 157  HOH C O   1 
HETATM 5925 O  O   . HOH O 3 .   ? 12.460  25.433  -48.852  1.00 32.35  ? 158  HOH C O   1 
HETATM 5926 O  O   . HOH O 3 .   ? 26.474  29.359  -68.755  1.00 36.84  ? 159  HOH C O   1 
HETATM 5927 O  O   . HOH O 3 .   ? 18.733  6.602   -65.740  1.00 37.72  ? 160  HOH C O   1 
HETATM 5928 O  O   . HOH O 3 .   ? 10.911  22.443  -58.762  1.00 32.73  ? 161  HOH C O   1 
HETATM 5929 O  O   . HOH O 3 .   ? -4.109  12.872  -44.922  1.00 37.45  ? 162  HOH C O   1 
HETATM 5930 O  O   . HOH O 3 .   ? 24.586  10.510  -34.964  1.00 45.18  ? 163  HOH C O   1 
HETATM 5931 O  O   . HOH O 3 .   ? 31.915  -7.049  -63.110  1.00 40.91  ? 164  HOH C O   1 
HETATM 5932 O  O   . HOH O 3 .   ? 22.956  31.025  -43.139  1.00 48.82  ? 165  HOH C O   1 
HETATM 5933 O  O   . HOH O 3 .   ? 32.292  19.888  -57.460  1.00 44.87  ? 166  HOH C O   1 
HETATM 5934 O  O   . HOH O 3 .   ? 17.723  -1.785  -73.223  1.00 45.83  ? 167  HOH C O   1 
HETATM 5935 O  O   . HOH O 3 .   ? -0.297  29.610  -43.112  1.00 46.33  ? 168  HOH C O   1 
HETATM 5936 O  O   . HOH O 3 .   ? 11.099  2.762   -68.284  1.00 46.22  ? 169  HOH C O   1 
HETATM 5937 O  O   . HOH O 3 .   ? 27.638  3.560   -46.066  1.00 37.55  ? 170  HOH C O   1 
HETATM 5938 O  O   . HOH O 3 .   ? 24.329  13.364  -68.516  1.00 49.61  ? 171  HOH C O   1 
HETATM 5939 O  O   . HOH O 3 .   ? 31.384  7.247   -53.410  1.00 44.12  ? 172  HOH C O   1 
HETATM 5940 O  O   . HOH O 3 .   ? 7.602   5.178   -44.382  1.00 56.57  ? 173  HOH C O   1 
HETATM 5941 O  O   . HOH P 3 .   ? 26.085  46.230  -76.036  1.00 29.47  ? 100  HOH D O   1 
HETATM 5942 O  O   . HOH P 3 .   ? 24.379  55.759  -79.039  1.00 24.48  ? 101  HOH D O   1 
HETATM 5943 O  O   . HOH P 3 .   ? 13.057  53.688  -86.735  1.00 29.10  ? 102  HOH D O   1 
HETATM 5944 O  O   . HOH P 3 .   ? 11.208  55.569  -78.514  1.00 30.50  ? 103  HOH D O   1 
HETATM 5945 O  O   . HOH P 3 .   ? 15.288  41.708  -101.937 1.00 34.98  ? 104  HOH D O   1 
HETATM 5946 O  O   . HOH P 3 .   ? 9.584   41.717  -98.995  1.00 25.28  ? 105  HOH D O   1 
HETATM 5947 O  O   . HOH P 3 .   ? 4.784   40.933  -86.527  1.00 44.05  ? 106  HOH D O   1 
HETATM 5948 O  O   . HOH P 3 .   ? 13.113  34.951  -86.624  1.00 27.86  ? 107  HOH D O   1 
HETATM 5949 O  O   . HOH P 3 .   ? 18.315  51.887  -75.359  1.00 40.51  ? 108  HOH D O   1 
HETATM 5950 O  O   . HOH P 3 .   ? 10.358  32.123  -89.137  1.00 35.61  ? 109  HOH D O   1 
HETATM 5951 O  O   . HOH P 3 .   ? 10.703  58.754  -61.759  1.00 42.30  ? 110  HOH D O   1 
HETATM 5952 O  O   . HOH P 3 .   ? 28.748  45.319  -75.778  1.00 35.95  ? 111  HOH D O   1 
HETATM 5953 O  O   . HOH P 3 .   ? 20.343  42.580  -73.996  1.00 41.23  ? 112  HOH D O   1 
HETATM 5954 O  O   . HOH P 3 .   ? 12.236  46.185  -76.284  1.00 41.59  ? 113  HOH D O   1 
HETATM 5955 O  O   . HOH P 3 .   ? 2.390   39.021  -99.898  1.00 34.32  ? 114  HOH D O   1 
HETATM 5956 O  O   . HOH P 3 .   ? 17.939  46.314  -75.234  1.00 37.30  ? 115  HOH D O   1 
HETATM 5957 O  O   . HOH P 3 .   ? 18.708  43.858  -72.047  1.00 29.09  ? 116  HOH D O   1 
HETATM 5958 O  O   . HOH P 3 .   ? 28.852  39.791  -86.652  1.00 33.77  ? 117  HOH D O   1 
HETATM 5959 O  O   . HOH P 3 .   ? 17.607  47.965  -77.355  1.00 30.80  ? 118  HOH D O   1 
HETATM 5960 O  O   . HOH P 3 .   ? 14.479  57.265  -79.767  1.00 32.76  ? 119  HOH D O   1 
HETATM 5961 O  O   . HOH P 3 .   ? 26.794  55.607  -85.826  1.00 47.06  ? 120  HOH D O   1 
HETATM 5962 O  O   . HOH P 3 .   ? 14.493  49.766  -76.170  1.00 33.15  ? 121  HOH D O   1 
HETATM 5963 O  O   . HOH P 3 .   ? 14.152  50.182  -66.832  1.00 42.70  ? 122  HOH D O   1 
HETATM 5964 O  O   . HOH P 3 .   ? 18.406  46.494  -103.457 1.00 46.65  ? 123  HOH D O   1 
HETATM 5965 O  O   . HOH P 3 .   ? 13.492  31.958  -79.925  1.00 38.62  ? 124  HOH D O   1 
HETATM 5966 O  O   . HOH P 3 .   ? 32.222  41.244  -82.643  1.00 32.15  ? 125  HOH D O   1 
HETATM 5967 O  O   . HOH P 3 .   ? 31.281  50.219  -75.798  1.00 34.35  ? 126  HOH D O   1 
HETATM 5968 O  O   . HOH P 3 .   ? 27.040  52.905  -70.686  1.00 39.89  ? 127  HOH D O   1 
HETATM 5969 O  O   . HOH P 3 .   ? 7.996   53.055  -72.710  1.00 34.42  ? 128  HOH D O   1 
HETATM 5970 O  O   . HOH P 3 .   ? 31.235  49.287  -86.502  1.00 44.18  ? 129  HOH D O   1 
HETATM 5971 O  O   . HOH P 3 .   ? 18.030  50.517  -77.881  1.00 30.79  ? 130  HOH D O   1 
HETATM 5972 O  O   . HOH P 3 .   ? 5.764   39.024  -93.319  1.00 39.17  ? 131  HOH D O   1 
HETATM 5973 O  O   . HOH P 3 .   ? 12.224  34.120  -88.862  1.00 33.09  ? 132  HOH D O   1 
HETATM 5974 O  O   . HOH P 3 .   ? 19.757  20.574  -73.797  1.00 48.36  ? 133  HOH D O   1 
HETATM 5975 O  O   . HOH P 3 .   ? 12.914  51.997  -93.154  1.00 39.19  ? 134  HOH D O   1 
HETATM 5976 O  O   . HOH P 3 .   ? 11.240  57.910  -76.811  1.00 41.09  ? 135  HOH D O   1 
HETATM 5977 O  O   . HOH P 3 .   ? 23.086  54.642  -81.251  1.00 32.20  ? 136  HOH D O   1 
HETATM 5978 O  O   . HOH P 3 .   ? 22.561  23.289  -74.775  1.00 44.95  ? 137  HOH D O   1 
HETATM 5979 O  O   . HOH P 3 .   ? 30.590  29.157  -83.322  1.00 44.53  ? 138  HOH D O   1 
HETATM 5980 O  O   . HOH P 3 .   ? 2.680   41.583  -93.294  1.00 55.80  ? 139  HOH D O   1 
HETATM 5981 O  O   . HOH P 3 .   ? 24.414  54.509  -70.160  1.00 43.13  ? 140  HOH D O   1 
HETATM 5982 O  O   . HOH P 3 .   ? 23.826  59.452  -76.425  1.00 35.35  ? 141  HOH D O   1 
HETATM 5983 O  O   . HOH P 3 .   ? 11.318  39.756  -77.094  1.00 50.98  ? 142  HOH D O   1 
HETATM 5984 O  O   . HOH P 3 .   ? 17.918  59.267  -80.992  1.00 36.38  ? 143  HOH D O   1 
HETATM 5985 O  O   . HOH P 3 .   ? 8.296   51.625  -92.498  1.00 47.65  ? 144  HOH D O   1 
HETATM 5986 O  O   . HOH P 3 .   ? -2.707  21.431  -103.925 1.00 51.24  ? 145  HOH D O   1 
HETATM 5987 O  O   . HOH P 3 .   ? 11.865  52.057  -66.257  1.00 45.33  ? 146  HOH D O   1 
HETATM 5988 O  O   . HOH P 3 .   ? 33.251  58.050  -76.230  1.00 44.40  ? 147  HOH D O   1 
HETATM 5989 O  O   . HOH P 3 .   ? 7.888   49.638  -79.666  1.00 37.86  ? 148  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   823  ?    ?   ?   A . n 
A 1 2   PRO 2   824  ?    ?   ?   A . n 
A 1 3   ASN 3   825  825  ASN ASN A . n 
A 1 4   GLU 4   826  826  GLU GLU A . n 
A 1 5   ASP 5   827  827  ASP ASP A . n 
A 1 6   TRP 6   828  828  TRP TRP A . n 
A 1 7   CYS 7   829  829  CYS CYS A . n 
A 1 8   ALA 8   830  830  ALA ALA A . n 
A 1 9   VAL 9   831  831  VAL VAL A . n 
A 1 10  CYS 10  832  832  CYS CYS A . n 
A 1 11  GLN 11  833  833  GLN GLN A . n 
A 1 12  ASN 12  834  834  ASN ASN A . n 
A 1 13  GLY 13  835  835  GLY GLY A . n 
A 1 14  GLY 14  836  836  GLY GLY A . n 
A 1 15  GLU 15  837  837  GLU GLU A . n 
A 1 16  LEU 16  838  838  LEU LEU A . n 
A 1 17  LEU 17  839  839  LEU LEU A . n 
A 1 18  CYS 18  840  840  CYS CYS A . n 
A 1 19  CYS 19  841  841  CYS CYS A . n 
A 1 20  GLU 20  842  842  GLU GLU A . n 
A 1 21  LYS 21  843  843  LYS LYS A . n 
A 1 22  CYS 22  844  844  CYS CYS A . n 
A 1 23  PRO 23  845  845  PRO PRO A . n 
A 1 24  LYS 24  846  846  LYS LYS A . n 
A 1 25  VAL 25  847  847  VAL VAL A . n 
A 1 26  PHE 26  848  848  PHE PHE A . n 
A 1 27  HIS 27  849  849  HIS HIS A . n 
A 1 28  LEU 28  850  850  LEU LEU A . n 
A 1 29  SER 29  851  851  SER SER A . n 
A 1 30  CYS 30  852  852  CYS CYS A . n 
A 1 31  HIS 31  853  853  HIS HIS A . n 
A 1 32  VAL 32  854  854  VAL VAL A . n 
A 1 33  PRO 33  855  855  PRO PRO A . n 
A 1 34  THR 34  856  856  THR THR A . n 
A 1 35  LEU 35  857  857  LEU LEU A . n 
A 1 36  THR 36  858  858  THR THR A . n 
A 1 37  ASN 37  859  859  ASN ASN A . n 
A 1 38  PHE 38  860  860  PHE PHE A . n 
A 1 39  PRO 39  861  861  PRO PRO A . n 
A 1 40  SER 40  862  862  SER SER A . n 
A 1 41  GLY 41  863  863  GLY GLY A . n 
A 1 42  GLU 42  864  864  GLU GLU A . n 
A 1 43  TRP 43  865  865  TRP TRP A . n 
A 1 44  ILE 44  866  866  ILE ILE A . n 
A 1 45  CYS 45  867  867  CYS CYS A . n 
A 1 46  THR 46  868  868  THR THR A . n 
A 1 47  PHE 47  869  869  PHE PHE A . n 
A 1 48  CYS 48  870  870  CYS CYS A . n 
A 1 49  ARG 49  871  871  ARG ARG A . n 
A 1 50  ASP 50  872  872  ASP ASP A . n 
A 1 51  LEU 51  873  873  LEU LEU A . n 
A 1 52  SER 52  874  874  SER SER A . n 
A 1 53  LYS 53  875  875  LYS LYS A . n 
A 1 54  PRO 54  876  876  PRO PRO A . n 
A 1 55  GLU 55  877  877  GLU GLU A . n 
A 1 56  VAL 56  878  878  VAL VAL A . n 
A 1 57  GLU 57  879  879  GLU GLU A . n 
A 1 58  TYR 58  880  880  TYR TYR A . n 
A 1 59  ASP 59  881  881  ASP ASP A . n 
A 1 60  CYS 60  882  ?    ?   ?   A . n 
A 1 61  ASP 61  883  ?    ?   ?   A . n 
A 1 62  ALA 62  884  ?    ?   ?   A . n 
A 1 63  PRO 63  885  ?    ?   ?   A . n 
A 1 64  SER 64  886  ?    ?   ?   A . n 
A 1 65  HIS 65  887  ?    ?   ?   A . n 
A 1 66  ASN 66  888  ?    ?   ?   A . n 
A 1 67  SER 67  889  ?    ?   ?   A . n 
A 1 68  GLU 68  890  ?    ?   ?   A . n 
A 1 69  LYS 69  891  ?    ?   ?   A . n 
A 1 70  LYS 70  892  892  LYS LYS A . n 
A 1 71  LYS 71  893  893  LYS LYS A . n 
A 1 72  THR 72  894  894  THR THR A . n 
A 1 73  GLU 73  895  895  GLU GLU A . n 
A 1 74  GLY 74  896  896  GLY GLY A . n 
A 1 75  LEU 75  897  897  LEU LEU A . n 
A 1 76  VAL 76  898  898  VAL VAL A . n 
A 1 77  LYS 77  899  899  LYS LYS A . n 
A 1 78  LEU 78  900  900  LEU LEU A . n 
A 1 79  THR 79  901  901  THR THR A . n 
A 1 80  PRO 80  902  902  PRO PRO A . n 
A 1 81  ILE 81  903  903  ILE ILE A . n 
A 1 82  ASP 82  904  904  ASP ASP A . n 
A 1 83  LYS 83  905  905  LYS LYS A . n 
A 1 84  ARG 84  906  906  ARG ARG A . n 
A 1 85  LYS 85  907  907  LYS LYS A . n 
A 1 86  CYS 86  908  908  CYS CYS A . n 
A 1 87  GLU 87  909  909  GLU GLU A . n 
A 1 88  ARG 88  910  910  ARG ARG A . n 
A 1 89  LEU 89  911  911  LEU LEU A . n 
A 1 90  LEU 90  912  912  LEU LEU A . n 
A 1 91  LEU 91  913  913  LEU LEU A . n 
A 1 92  PHE 92  914  914  PHE PHE A . n 
A 1 93  LEU 93  915  915  LEU LEU A . n 
A 1 94  TYR 94  916  916  TYR TYR A . n 
A 1 95  CYS 95  917  917  CYS CYS A . n 
A 1 96  HIS 96  918  918  HIS HIS A . n 
A 1 97  GLU 97  919  919  GLU GLU A . n 
A 1 98  MET 98  920  920  MET MET A . n 
A 1 99  SER 99  921  921  SER SER A . n 
A 1 100 LEU 100 922  922  LEU LEU A . n 
A 1 101 ALA 101 923  923  ALA ALA A . n 
A 1 102 PHE 102 924  924  PHE PHE A . n 
A 1 103 GLN 103 925  925  GLN GLN A . n 
A 1 104 ASP 104 926  926  ASP ASP A . n 
A 1 105 PRO 105 927  927  PRO PRO A . n 
A 1 106 VAL 106 928  928  VAL VAL A . n 
A 1 107 PRO 107 929  929  PRO PRO A . n 
A 1 108 LEU 108 930  930  LEU LEU A . n 
A 1 109 THR 109 931  931  THR THR A . n 
A 1 110 VAL 110 932  932  VAL VAL A . n 
A 1 111 PRO 111 933  933  PRO PRO A . n 
A 1 112 ASP 112 934  934  ASP ASP A . n 
A 1 113 TYR 113 935  935  TYR TYR A . n 
A 1 114 TYR 114 936  936  TYR TYR A . n 
A 1 115 LYS 115 937  937  LYS LYS A . n 
A 1 116 ILE 116 938  938  ILE ILE A . n 
A 1 117 ILE 117 939  939  ILE ILE A . n 
A 1 118 LYS 118 940  940  LYS LYS A . n 
A 1 119 ASN 119 941  941  ASN ASN A . n 
A 1 120 PRO 120 942  942  PRO PRO A . n 
A 1 121 MET 121 943  943  MET MET A . n 
A 1 122 ASP 122 944  944  ASP ASP A . n 
A 1 123 LEU 123 945  945  LEU LEU A . n 
A 1 124 SER 124 946  946  SER SER A . n 
A 1 125 THR 125 947  947  THR THR A . n 
A 1 126 ILE 126 948  948  ILE ILE A . n 
A 1 127 LYS 127 949  949  LYS LYS A . n 
A 1 128 LYS 128 950  950  LYS LYS A . n 
A 1 129 ARG 129 951  951  ARG ARG A . n 
A 1 130 LEU 130 952  952  LEU LEU A . n 
A 1 131 GLN 131 953  953  GLN GLN A . n 
A 1 132 GLU 132 954  954  GLU GLU A . n 
A 1 133 ASP 133 955  955  ASP ASP A . n 
A 1 134 TYR 134 956  956  TYR TYR A . n 
A 1 135 SER 135 957  957  SER SER A . n 
A 1 136 MET 136 958  958  MET MET A . n 
A 1 137 TYR 137 959  959  TYR TYR A . n 
A 1 138 SER 138 960  960  SER SER A . n 
A 1 139 LYS 139 961  961  LYS LYS A . n 
A 1 140 PRO 140 962  962  PRO PRO A . n 
A 1 141 GLU 141 963  963  GLU GLU A . n 
A 1 142 ASP 142 964  964  ASP ASP A . n 
A 1 143 PHE 143 965  965  PHE PHE A . n 
A 1 144 VAL 144 966  966  VAL VAL A . n 
A 1 145 ALA 145 967  967  ALA ALA A . n 
A 1 146 ASP 146 968  968  ASP ASP A . n 
A 1 147 PHE 147 969  969  PHE PHE A . n 
A 1 148 ARG 148 970  970  ARG ARG A . n 
A 1 149 LEU 149 971  971  LEU LEU A . n 
A 1 150 ILE 150 972  972  ILE ILE A . n 
A 1 151 PHE 151 973  973  PHE PHE A . n 
A 1 152 GLN 152 974  974  GLN GLN A . n 
A 1 153 ASN 153 975  975  ASN ASN A . n 
A 1 154 CYS 154 976  976  CYS CYS A . n 
A 1 155 ALA 155 977  977  ALA ALA A . n 
A 1 156 GLU 156 978  978  GLU GLU A . n 
A 1 157 PHE 157 979  979  PHE PHE A . n 
A 1 158 ASN 158 980  980  ASN ASN A . n 
A 1 159 GLU 159 981  981  GLU GLU A . n 
A 1 160 PRO 160 982  982  PRO PRO A . n 
A 1 161 ASP 161 983  983  ASP ASP A . n 
A 1 162 SER 162 984  984  SER SER A . n 
A 1 163 GLU 163 985  985  GLU GLU A . n 
A 1 164 VAL 164 986  986  VAL VAL A . n 
A 1 165 ALA 165 987  987  ALA ALA A . n 
A 1 166 ASN 166 988  988  ASN ASN A . n 
A 1 167 ALA 167 989  989  ALA ALA A . n 
A 1 168 GLY 168 990  990  GLY GLY A . n 
A 1 169 ILE 169 991  991  ILE ILE A . n 
A 1 170 LYS 170 992  992  LYS LYS A . n 
A 1 171 LEU 171 993  993  LEU LEU A . n 
A 1 172 GLU 172 994  994  GLU GLU A . n 
A 1 173 ASN 173 995  995  ASN ASN A . n 
A 1 174 TYR 174 996  996  TYR TYR A . n 
A 1 175 PHE 175 997  997  PHE PHE A . n 
A 1 176 GLU 176 998  998  GLU GLU A . n 
A 1 177 GLU 177 999  999  GLU GLU A . n 
A 1 178 LEU 178 1000 1000 LEU LEU A . n 
A 1 179 LEU 179 1001 1001 LEU LEU A . n 
A 1 180 LYS 180 1002 1002 LYS LYS A . n 
A 1 181 ASN 181 1003 1003 ASN ASN A . n 
A 1 182 LEU 182 1004 1004 LEU LEU A . n 
A 1 183 TYR 183 1005 1005 TYR TYR A . n 
A 1 184 PRO 184 1006 1006 PRO PRO A . n 
B 1 1   SER 1   823  ?    ?   ?   B . n 
B 1 2   PRO 2   824  824  PRO PRO B . n 
B 1 3   ASN 3   825  825  ASN ASN B . n 
B 1 4   GLU 4   826  826  GLU GLU B . n 
B 1 5   ASP 5   827  827  ASP ASP B . n 
B 1 6   TRP 6   828  828  TRP TRP B . n 
B 1 7   CYS 7   829  829  CYS CYS B . n 
B 1 8   ALA 8   830  830  ALA ALA B . n 
B 1 9   VAL 9   831  831  VAL VAL B . n 
B 1 10  CYS 10  832  832  CYS CYS B . n 
B 1 11  GLN 11  833  833  GLN GLN B . n 
B 1 12  ASN 12  834  834  ASN ASN B . n 
B 1 13  GLY 13  835  835  GLY GLY B . n 
B 1 14  GLY 14  836  836  GLY GLY B . n 
B 1 15  GLU 15  837  837  GLU GLU B . n 
B 1 16  LEU 16  838  838  LEU LEU B . n 
B 1 17  LEU 17  839  839  LEU LEU B . n 
B 1 18  CYS 18  840  840  CYS CYS B . n 
B 1 19  CYS 19  841  841  CYS CYS B . n 
B 1 20  GLU 20  842  842  GLU GLU B . n 
B 1 21  LYS 21  843  843  LYS LYS B . n 
B 1 22  CYS 22  844  844  CYS CYS B . n 
B 1 23  PRO 23  845  845  PRO PRO B . n 
B 1 24  LYS 24  846  846  LYS LYS B . n 
B 1 25  VAL 25  847  847  VAL VAL B . n 
B 1 26  PHE 26  848  848  PHE PHE B . n 
B 1 27  HIS 27  849  849  HIS HIS B . n 
B 1 28  LEU 28  850  850  LEU LEU B . n 
B 1 29  SER 29  851  851  SER SER B . n 
B 1 30  CYS 30  852  852  CYS CYS B . n 
B 1 31  HIS 31  853  853  HIS HIS B . n 
B 1 32  VAL 32  854  854  VAL VAL B . n 
B 1 33  PRO 33  855  855  PRO PRO B . n 
B 1 34  THR 34  856  856  THR THR B . n 
B 1 35  LEU 35  857  857  LEU LEU B . n 
B 1 36  THR 36  858  858  THR THR B . n 
B 1 37  ASN 37  859  859  ASN ASN B . n 
B 1 38  PHE 38  860  860  PHE PHE B . n 
B 1 39  PRO 39  861  861  PRO PRO B . n 
B 1 40  SER 40  862  862  SER SER B . n 
B 1 41  GLY 41  863  863  GLY GLY B . n 
B 1 42  GLU 42  864  864  GLU GLU B . n 
B 1 43  TRP 43  865  865  TRP TRP B . n 
B 1 44  ILE 44  866  866  ILE ILE B . n 
B 1 45  CYS 45  867  867  CYS CYS B . n 
B 1 46  THR 46  868  868  THR THR B . n 
B 1 47  PHE 47  869  869  PHE PHE B . n 
B 1 48  CYS 48  870  870  CYS CYS B . n 
B 1 49  ARG 49  871  871  ARG ARG B . n 
B 1 50  ASP 50  872  872  ASP ASP B . n 
B 1 51  LEU 51  873  873  LEU LEU B . n 
B 1 52  SER 52  874  874  SER SER B . n 
B 1 53  LYS 53  875  875  LYS LYS B . n 
B 1 54  PRO 54  876  876  PRO PRO B . n 
B 1 55  GLU 55  877  877  GLU GLU B . n 
B 1 56  VAL 56  878  878  VAL VAL B . n 
B 1 57  GLU 57  879  879  GLU GLU B . n 
B 1 58  TYR 58  880  880  TYR TYR B . n 
B 1 59  ASP 59  881  881  ASP ASP B . n 
B 1 60  CYS 60  882  882  CYS CYS B . n 
B 1 61  ASP 61  883  883  ASP ASP B . n 
B 1 62  ALA 62  884  884  ALA ALA B . n 
B 1 63  PRO 63  885  885  PRO PRO B . n 
B 1 64  SER 64  886  886  SER SER B . n 
B 1 65  HIS 65  887  887  HIS HIS B . n 
B 1 66  ASN 66  888  888  ASN ASN B . n 
B 1 67  SER 67  889  889  SER SER B . n 
B 1 68  GLU 68  890  890  GLU GLU B . n 
B 1 69  LYS 69  891  891  LYS LYS B . n 
B 1 70  LYS 70  892  892  LYS LYS B . n 
B 1 71  LYS 71  893  893  LYS LYS B . n 
B 1 72  THR 72  894  894  THR THR B . n 
B 1 73  GLU 73  895  895  GLU GLU B . n 
B 1 74  GLY 74  896  896  GLY GLY B . n 
B 1 75  LEU 75  897  897  LEU LEU B . n 
B 1 76  VAL 76  898  898  VAL VAL B . n 
B 1 77  LYS 77  899  899  LYS LYS B . n 
B 1 78  LEU 78  900  900  LEU LEU B . n 
B 1 79  THR 79  901  901  THR THR B . n 
B 1 80  PRO 80  902  902  PRO PRO B . n 
B 1 81  ILE 81  903  903  ILE ILE B . n 
B 1 82  ASP 82  904  904  ASP ASP B . n 
B 1 83  LYS 83  905  905  LYS LYS B . n 
B 1 84  ARG 84  906  906  ARG ARG B . n 
B 1 85  LYS 85  907  907  LYS LYS B . n 
B 1 86  CYS 86  908  908  CYS CYS B . n 
B 1 87  GLU 87  909  909  GLU GLU B . n 
B 1 88  ARG 88  910  910  ARG ARG B . n 
B 1 89  LEU 89  911  911  LEU LEU B . n 
B 1 90  LEU 90  912  912  LEU LEU B . n 
B 1 91  LEU 91  913  913  LEU LEU B . n 
B 1 92  PHE 92  914  914  PHE PHE B . n 
B 1 93  LEU 93  915  915  LEU LEU B . n 
B 1 94  TYR 94  916  916  TYR TYR B . n 
B 1 95  CYS 95  917  917  CYS CYS B . n 
B 1 96  HIS 96  918  918  HIS HIS B . n 
B 1 97  GLU 97  919  919  GLU GLU B . n 
B 1 98  MET 98  920  920  MET MET B . n 
B 1 99  SER 99  921  921  SER SER B . n 
B 1 100 LEU 100 922  922  LEU LEU B . n 
B 1 101 ALA 101 923  923  ALA ALA B . n 
B 1 102 PHE 102 924  924  PHE PHE B . n 
B 1 103 GLN 103 925  925  GLN GLN B . n 
B 1 104 ASP 104 926  926  ASP ASP B . n 
B 1 105 PRO 105 927  927  PRO PRO B . n 
B 1 106 VAL 106 928  928  VAL VAL B . n 
B 1 107 PRO 107 929  929  PRO PRO B . n 
B 1 108 LEU 108 930  930  LEU LEU B . n 
B 1 109 THR 109 931  931  THR THR B . n 
B 1 110 VAL 110 932  932  VAL VAL B . n 
B 1 111 PRO 111 933  933  PRO PRO B . n 
B 1 112 ASP 112 934  934  ASP ASP B . n 
B 1 113 TYR 113 935  935  TYR TYR B . n 
B 1 114 TYR 114 936  936  TYR TYR B . n 
B 1 115 LYS 115 937  937  LYS LYS B . n 
B 1 116 ILE 116 938  938  ILE ILE B . n 
B 1 117 ILE 117 939  939  ILE ILE B . n 
B 1 118 LYS 118 940  940  LYS LYS B . n 
B 1 119 ASN 119 941  941  ASN ASN B . n 
B 1 120 PRO 120 942  942  PRO PRO B . n 
B 1 121 MET 121 943  943  MET MET B . n 
B 1 122 ASP 122 944  944  ASP ASP B . n 
B 1 123 LEU 123 945  945  LEU LEU B . n 
B 1 124 SER 124 946  946  SER SER B . n 
B 1 125 THR 125 947  947  THR THR B . n 
B 1 126 ILE 126 948  948  ILE ILE B . n 
B 1 127 LYS 127 949  949  LYS LYS B . n 
B 1 128 LYS 128 950  950  LYS LYS B . n 
B 1 129 ARG 129 951  951  ARG ARG B . n 
B 1 130 LEU 130 952  952  LEU LEU B . n 
B 1 131 GLN 131 953  953  GLN GLN B . n 
B 1 132 GLU 132 954  954  GLU GLU B . n 
B 1 133 ASP 133 955  955  ASP ASP B . n 
B 1 134 TYR 134 956  956  TYR TYR B . n 
B 1 135 SER 135 957  957  SER SER B . n 
B 1 136 MET 136 958  958  MET MET B . n 
B 1 137 TYR 137 959  959  TYR TYR B . n 
B 1 138 SER 138 960  960  SER SER B . n 
B 1 139 LYS 139 961  961  LYS LYS B . n 
B 1 140 PRO 140 962  962  PRO PRO B . n 
B 1 141 GLU 141 963  963  GLU GLU B . n 
B 1 142 ASP 142 964  964  ASP ASP B . n 
B 1 143 PHE 143 965  965  PHE PHE B . n 
B 1 144 VAL 144 966  966  VAL VAL B . n 
B 1 145 ALA 145 967  967  ALA ALA B . n 
B 1 146 ASP 146 968  968  ASP ASP B . n 
B 1 147 PHE 147 969  969  PHE PHE B . n 
B 1 148 ARG 148 970  970  ARG ARG B . n 
B 1 149 LEU 149 971  971  LEU LEU B . n 
B 1 150 ILE 150 972  972  ILE ILE B . n 
B 1 151 PHE 151 973  973  PHE PHE B . n 
B 1 152 GLN 152 974  974  GLN GLN B . n 
B 1 153 ASN 153 975  975  ASN ASN B . n 
B 1 154 CYS 154 976  976  CYS CYS B . n 
B 1 155 ALA 155 977  977  ALA ALA B . n 
B 1 156 GLU 156 978  978  GLU GLU B . n 
B 1 157 PHE 157 979  979  PHE PHE B . n 
B 1 158 ASN 158 980  980  ASN ASN B . n 
B 1 159 GLU 159 981  981  GLU GLU B . n 
B 1 160 PRO 160 982  982  PRO PRO B . n 
B 1 161 ASP 161 983  983  ASP ASP B . n 
B 1 162 SER 162 984  984  SER SER B . n 
B 1 163 GLU 163 985  985  GLU GLU B . n 
B 1 164 VAL 164 986  986  VAL VAL B . n 
B 1 165 ALA 165 987  987  ALA ALA B . n 
B 1 166 ASN 166 988  988  ASN ASN B . n 
B 1 167 ALA 167 989  989  ALA ALA B . n 
B 1 168 GLY 168 990  990  GLY GLY B . n 
B 1 169 ILE 169 991  991  ILE ILE B . n 
B 1 170 LYS 170 992  992  LYS LYS B . n 
B 1 171 LEU 171 993  993  LEU LEU B . n 
B 1 172 GLU 172 994  994  GLU GLU B . n 
B 1 173 ASN 173 995  995  ASN ASN B . n 
B 1 174 TYR 174 996  996  TYR TYR B . n 
B 1 175 PHE 175 997  997  PHE PHE B . n 
B 1 176 GLU 176 998  998  GLU GLU B . n 
B 1 177 GLU 177 999  999  GLU GLU B . n 
B 1 178 LEU 178 1000 1000 LEU LEU B . n 
B 1 179 LEU 179 1001 1001 LEU LEU B . n 
B 1 180 LYS 180 1002 1002 LYS LYS B . n 
B 1 181 ASN 181 1003 1003 ASN ASN B . n 
B 1 182 LEU 182 1004 1004 LEU LEU B . n 
B 1 183 TYR 183 1005 1005 TYR TYR B . n 
B 1 184 PRO 184 1006 1006 PRO PRO B . n 
C 1 1   SER 1   823  ?    ?   ?   C . n 
C 1 2   PRO 2   824  824  PRO PRO C . n 
C 1 3   ASN 3   825  825  ASN ASN C . n 
C 1 4   GLU 4   826  826  GLU GLU C . n 
C 1 5   ASP 5   827  827  ASP ASP C . n 
C 1 6   TRP 6   828  828  TRP TRP C . n 
C 1 7   CYS 7   829  829  CYS CYS C . n 
C 1 8   ALA 8   830  830  ALA ALA C . n 
C 1 9   VAL 9   831  831  VAL VAL C . n 
C 1 10  CYS 10  832  832  CYS CYS C . n 
C 1 11  GLN 11  833  833  GLN GLN C . n 
C 1 12  ASN 12  834  834  ASN ASN C . n 
C 1 13  GLY 13  835  835  GLY GLY C . n 
C 1 14  GLY 14  836  836  GLY GLY C . n 
C 1 15  GLU 15  837  837  GLU GLU C . n 
C 1 16  LEU 16  838  838  LEU LEU C . n 
C 1 17  LEU 17  839  839  LEU LEU C . n 
C 1 18  CYS 18  840  840  CYS CYS C . n 
C 1 19  CYS 19  841  841  CYS CYS C . n 
C 1 20  GLU 20  842  842  GLU GLU C . n 
C 1 21  LYS 21  843  843  LYS LYS C . n 
C 1 22  CYS 22  844  844  CYS CYS C . n 
C 1 23  PRO 23  845  845  PRO PRO C . n 
C 1 24  LYS 24  846  846  LYS LYS C . n 
C 1 25  VAL 25  847  847  VAL VAL C . n 
C 1 26  PHE 26  848  848  PHE PHE C . n 
C 1 27  HIS 27  849  849  HIS HIS C . n 
C 1 28  LEU 28  850  850  LEU LEU C . n 
C 1 29  SER 29  851  851  SER SER C . n 
C 1 30  CYS 30  852  852  CYS CYS C . n 
C 1 31  HIS 31  853  853  HIS HIS C . n 
C 1 32  VAL 32  854  854  VAL VAL C . n 
C 1 33  PRO 33  855  855  PRO PRO C . n 
C 1 34  THR 34  856  856  THR THR C . n 
C 1 35  LEU 35  857  857  LEU LEU C . n 
C 1 36  THR 36  858  858  THR THR C . n 
C 1 37  ASN 37  859  859  ASN ASN C . n 
C 1 38  PHE 38  860  860  PHE PHE C . n 
C 1 39  PRO 39  861  861  PRO PRO C . n 
C 1 40  SER 40  862  862  SER SER C . n 
C 1 41  GLY 41  863  863  GLY GLY C . n 
C 1 42  GLU 42  864  864  GLU GLU C . n 
C 1 43  TRP 43  865  865  TRP TRP C . n 
C 1 44  ILE 44  866  866  ILE ILE C . n 
C 1 45  CYS 45  867  867  CYS CYS C . n 
C 1 46  THR 46  868  868  THR THR C . n 
C 1 47  PHE 47  869  869  PHE PHE C . n 
C 1 48  CYS 48  870  870  CYS CYS C . n 
C 1 49  ARG 49  871  871  ARG ARG C . n 
C 1 50  ASP 50  872  872  ASP ASP C . n 
C 1 51  LEU 51  873  873  LEU LEU C . n 
C 1 52  SER 52  874  874  SER SER C . n 
C 1 53  LYS 53  875  875  LYS LYS C . n 
C 1 54  PRO 54  876  876  PRO PRO C . n 
C 1 55  GLU 55  877  877  GLU GLU C . n 
C 1 56  VAL 56  878  878  VAL VAL C . n 
C 1 57  GLU 57  879  879  GLU GLU C . n 
C 1 58  TYR 58  880  880  TYR TYR C . n 
C 1 59  ASP 59  881  881  ASP ASP C . n 
C 1 60  CYS 60  882  882  CYS CYS C . n 
C 1 61  ASP 61  883  883  ASP ASP C . n 
C 1 62  ALA 62  884  884  ALA ALA C . n 
C 1 63  PRO 63  885  885  PRO PRO C . n 
C 1 64  SER 64  886  ?    ?   ?   C . n 
C 1 65  HIS 65  887  ?    ?   ?   C . n 
C 1 66  ASN 66  888  ?    ?   ?   C . n 
C 1 67  SER 67  889  ?    ?   ?   C . n 
C 1 68  GLU 68  890  ?    ?   ?   C . n 
C 1 69  LYS 69  891  891  LYS LYS C . n 
C 1 70  LYS 70  892  892  LYS LYS C . n 
C 1 71  LYS 71  893  893  LYS LYS C . n 
C 1 72  THR 72  894  894  THR THR C . n 
C 1 73  GLU 73  895  895  GLU GLU C . n 
C 1 74  GLY 74  896  896  GLY GLY C . n 
C 1 75  LEU 75  897  897  LEU LEU C . n 
C 1 76  VAL 76  898  898  VAL VAL C . n 
C 1 77  LYS 77  899  899  LYS LYS C . n 
C 1 78  LEU 78  900  900  LEU LEU C . n 
C 1 79  THR 79  901  901  THR THR C . n 
C 1 80  PRO 80  902  902  PRO PRO C . n 
C 1 81  ILE 81  903  903  ILE ILE C . n 
C 1 82  ASP 82  904  904  ASP ASP C . n 
C 1 83  LYS 83  905  905  LYS LYS C . n 
C 1 84  ARG 84  906  906  ARG ARG C . n 
C 1 85  LYS 85  907  907  LYS LYS C . n 
C 1 86  CYS 86  908  908  CYS CYS C . n 
C 1 87  GLU 87  909  909  GLU GLU C . n 
C 1 88  ARG 88  910  910  ARG ARG C . n 
C 1 89  LEU 89  911  911  LEU LEU C . n 
C 1 90  LEU 90  912  912  LEU LEU C . n 
C 1 91  LEU 91  913  913  LEU LEU C . n 
C 1 92  PHE 92  914  914  PHE PHE C . n 
C 1 93  LEU 93  915  915  LEU LEU C . n 
C 1 94  TYR 94  916  916  TYR TYR C . n 
C 1 95  CYS 95  917  917  CYS CYS C . n 
C 1 96  HIS 96  918  918  HIS HIS C . n 
C 1 97  GLU 97  919  919  GLU GLU C . n 
C 1 98  MET 98  920  920  MET MET C . n 
C 1 99  SER 99  921  921  SER SER C . n 
C 1 100 LEU 100 922  922  LEU LEU C . n 
C 1 101 ALA 101 923  923  ALA ALA C . n 
C 1 102 PHE 102 924  924  PHE PHE C . n 
C 1 103 GLN 103 925  925  GLN GLN C . n 
C 1 104 ASP 104 926  926  ASP ASP C . n 
C 1 105 PRO 105 927  927  PRO PRO C . n 
C 1 106 VAL 106 928  928  VAL VAL C . n 
C 1 107 PRO 107 929  929  PRO PRO C . n 
C 1 108 LEU 108 930  930  LEU LEU C . n 
C 1 109 THR 109 931  931  THR THR C . n 
C 1 110 VAL 110 932  932  VAL VAL C . n 
C 1 111 PRO 111 933  933  PRO PRO C . n 
C 1 112 ASP 112 934  934  ASP ASP C . n 
C 1 113 TYR 113 935  935  TYR TYR C . n 
C 1 114 TYR 114 936  936  TYR TYR C . n 
C 1 115 LYS 115 937  937  LYS LYS C . n 
C 1 116 ILE 116 938  938  ILE ILE C . n 
C 1 117 ILE 117 939  939  ILE ILE C . n 
C 1 118 LYS 118 940  940  LYS LYS C . n 
C 1 119 ASN 119 941  941  ASN ASN C . n 
C 1 120 PRO 120 942  942  PRO PRO C . n 
C 1 121 MET 121 943  943  MET MET C . n 
C 1 122 ASP 122 944  944  ASP ASP C . n 
C 1 123 LEU 123 945  945  LEU LEU C . n 
C 1 124 SER 124 946  946  SER SER C . n 
C 1 125 THR 125 947  947  THR THR C . n 
C 1 126 ILE 126 948  948  ILE ILE C . n 
C 1 127 LYS 127 949  949  LYS LYS C . n 
C 1 128 LYS 128 950  950  LYS LYS C . n 
C 1 129 ARG 129 951  951  ARG ARG C . n 
C 1 130 LEU 130 952  952  LEU LEU C . n 
C 1 131 GLN 131 953  953  GLN GLN C . n 
C 1 132 GLU 132 954  954  GLU GLU C . n 
C 1 133 ASP 133 955  955  ASP ASP C . n 
C 1 134 TYR 134 956  956  TYR TYR C . n 
C 1 135 SER 135 957  957  SER SER C . n 
C 1 136 MET 136 958  958  MET MET C . n 
C 1 137 TYR 137 959  959  TYR TYR C . n 
C 1 138 SER 138 960  960  SER SER C . n 
C 1 139 LYS 139 961  961  LYS LYS C . n 
C 1 140 PRO 140 962  962  PRO PRO C . n 
C 1 141 GLU 141 963  963  GLU GLU C . n 
C 1 142 ASP 142 964  964  ASP ASP C . n 
C 1 143 PHE 143 965  965  PHE PHE C . n 
C 1 144 VAL 144 966  966  VAL VAL C . n 
C 1 145 ALA 145 967  967  ALA ALA C . n 
C 1 146 ASP 146 968  968  ASP ASP C . n 
C 1 147 PHE 147 969  969  PHE PHE C . n 
C 1 148 ARG 148 970  970  ARG ARG C . n 
C 1 149 LEU 149 971  971  LEU LEU C . n 
C 1 150 ILE 150 972  972  ILE ILE C . n 
C 1 151 PHE 151 973  973  PHE PHE C . n 
C 1 152 GLN 152 974  974  GLN GLN C . n 
C 1 153 ASN 153 975  975  ASN ASN C . n 
C 1 154 CYS 154 976  976  CYS CYS C . n 
C 1 155 ALA 155 977  977  ALA ALA C . n 
C 1 156 GLU 156 978  978  GLU GLU C . n 
C 1 157 PHE 157 979  979  PHE PHE C . n 
C 1 158 ASN 158 980  980  ASN ASN C . n 
C 1 159 GLU 159 981  981  GLU GLU C . n 
C 1 160 PRO 160 982  982  PRO PRO C . n 
C 1 161 ASP 161 983  983  ASP ASP C . n 
C 1 162 SER 162 984  984  SER SER C . n 
C 1 163 GLU 163 985  985  GLU GLU C . n 
C 1 164 VAL 164 986  986  VAL VAL C . n 
C 1 165 ALA 165 987  987  ALA ALA C . n 
C 1 166 ASN 166 988  988  ASN ASN C . n 
C 1 167 ALA 167 989  989  ALA ALA C . n 
C 1 168 GLY 168 990  990  GLY GLY C . n 
C 1 169 ILE 169 991  991  ILE ILE C . n 
C 1 170 LYS 170 992  992  LYS LYS C . n 
C 1 171 LEU 171 993  993  LEU LEU C . n 
C 1 172 GLU 172 994  994  GLU GLU C . n 
C 1 173 ASN 173 995  995  ASN ASN C . n 
C 1 174 TYR 174 996  996  TYR TYR C . n 
C 1 175 PHE 175 997  997  PHE PHE C . n 
C 1 176 GLU 176 998  998  GLU GLU C . n 
C 1 177 GLU 177 999  999  GLU GLU C . n 
C 1 178 LEU 178 1000 1000 LEU LEU C . n 
C 1 179 LEU 179 1001 1001 LEU LEU C . n 
C 1 180 LYS 180 1002 1002 LYS LYS C . n 
C 1 181 ASN 181 1003 1003 ASN ASN C . n 
C 1 182 LEU 182 1004 1004 LEU LEU C . n 
C 1 183 TYR 183 1005 1005 TYR TYR C . n 
C 1 184 PRO 184 1006 1006 PRO PRO C . n 
D 1 1   SER 1   823  ?    ?   ?   D . n 
D 1 2   PRO 2   824  ?    ?   ?   D . n 
D 1 3   ASN 3   825  825  ASN ASN D . n 
D 1 4   GLU 4   826  826  GLU GLU D . n 
D 1 5   ASP 5   827  827  ASP ASP D . n 
D 1 6   TRP 6   828  828  TRP TRP D . n 
D 1 7   CYS 7   829  829  CYS CYS D . n 
D 1 8   ALA 8   830  830  ALA ALA D . n 
D 1 9   VAL 9   831  831  VAL VAL D . n 
D 1 10  CYS 10  832  832  CYS CYS D . n 
D 1 11  GLN 11  833  833  GLN GLN D . n 
D 1 12  ASN 12  834  834  ASN ASN D . n 
D 1 13  GLY 13  835  835  GLY GLY D . n 
D 1 14  GLY 14  836  836  GLY GLY D . n 
D 1 15  GLU 15  837  837  GLU GLU D . n 
D 1 16  LEU 16  838  838  LEU LEU D . n 
D 1 17  LEU 17  839  839  LEU LEU D . n 
D 1 18  CYS 18  840  840  CYS CYS D . n 
D 1 19  CYS 19  841  841  CYS CYS D . n 
D 1 20  GLU 20  842  842  GLU GLU D . n 
D 1 21  LYS 21  843  843  LYS LYS D . n 
D 1 22  CYS 22  844  844  CYS CYS D . n 
D 1 23  PRO 23  845  845  PRO PRO D . n 
D 1 24  LYS 24  846  846  LYS LYS D . n 
D 1 25  VAL 25  847  847  VAL VAL D . n 
D 1 26  PHE 26  848  848  PHE PHE D . n 
D 1 27  HIS 27  849  849  HIS HIS D . n 
D 1 28  LEU 28  850  850  LEU LEU D . n 
D 1 29  SER 29  851  851  SER SER D . n 
D 1 30  CYS 30  852  852  CYS CYS D . n 
D 1 31  HIS 31  853  853  HIS HIS D . n 
D 1 32  VAL 32  854  854  VAL VAL D . n 
D 1 33  PRO 33  855  855  PRO PRO D . n 
D 1 34  THR 34  856  856  THR THR D . n 
D 1 35  LEU 35  857  857  LEU LEU D . n 
D 1 36  THR 36  858  858  THR THR D . n 
D 1 37  ASN 37  859  859  ASN ASN D . n 
D 1 38  PHE 38  860  860  PHE PHE D . n 
D 1 39  PRO 39  861  861  PRO PRO D . n 
D 1 40  SER 40  862  862  SER SER D . n 
D 1 41  GLY 41  863  863  GLY GLY D . n 
D 1 42  GLU 42  864  864  GLU GLU D . n 
D 1 43  TRP 43  865  865  TRP TRP D . n 
D 1 44  ILE 44  866  866  ILE ILE D . n 
D 1 45  CYS 45  867  867  CYS CYS D . n 
D 1 46  THR 46  868  868  THR THR D . n 
D 1 47  PHE 47  869  869  PHE PHE D . n 
D 1 48  CYS 48  870  870  CYS CYS D . n 
D 1 49  ARG 49  871  871  ARG ARG D . n 
D 1 50  ASP 50  872  872  ASP ASP D . n 
D 1 51  LEU 51  873  873  LEU LEU D . n 
D 1 52  SER 52  874  874  SER SER D . n 
D 1 53  LYS 53  875  875  LYS LYS D . n 
D 1 54  PRO 54  876  876  PRO PRO D . n 
D 1 55  GLU 55  877  877  GLU GLU D . n 
D 1 56  VAL 56  878  878  VAL VAL D . n 
D 1 57  GLU 57  879  879  GLU GLU D . n 
D 1 58  TYR 58  880  880  TYR TYR D . n 
D 1 59  ASP 59  881  881  ASP ASP D . n 
D 1 60  CYS 60  882  ?    ?   ?   D . n 
D 1 61  ASP 61  883  ?    ?   ?   D . n 
D 1 62  ALA 62  884  ?    ?   ?   D . n 
D 1 63  PRO 63  885  ?    ?   ?   D . n 
D 1 64  SER 64  886  ?    ?   ?   D . n 
D 1 65  HIS 65  887  ?    ?   ?   D . n 
D 1 66  ASN 66  888  ?    ?   ?   D . n 
D 1 67  SER 67  889  ?    ?   ?   D . n 
D 1 68  GLU 68  890  ?    ?   ?   D . n 
D 1 69  LYS 69  891  ?    ?   ?   D . n 
D 1 70  LYS 70  892  892  LYS LYS D . n 
D 1 71  LYS 71  893  893  LYS LYS D . n 
D 1 72  THR 72  894  894  THR THR D . n 
D 1 73  GLU 73  895  895  GLU GLU D . n 
D 1 74  GLY 74  896  896  GLY GLY D . n 
D 1 75  LEU 75  897  897  LEU LEU D . n 
D 1 76  VAL 76  898  898  VAL VAL D . n 
D 1 77  LYS 77  899  899  LYS LYS D . n 
D 1 78  LEU 78  900  900  LEU LEU D . n 
D 1 79  THR 79  901  901  THR THR D . n 
D 1 80  PRO 80  902  902  PRO PRO D . n 
D 1 81  ILE 81  903  903  ILE ILE D . n 
D 1 82  ASP 82  904  904  ASP ASP D . n 
D 1 83  LYS 83  905  905  LYS LYS D . n 
D 1 84  ARG 84  906  906  ARG ARG D . n 
D 1 85  LYS 85  907  907  LYS LYS D . n 
D 1 86  CYS 86  908  908  CYS CYS D . n 
D 1 87  GLU 87  909  909  GLU GLU D . n 
D 1 88  ARG 88  910  910  ARG ARG D . n 
D 1 89  LEU 89  911  911  LEU LEU D . n 
D 1 90  LEU 90  912  912  LEU LEU D . n 
D 1 91  LEU 91  913  913  LEU LEU D . n 
D 1 92  PHE 92  914  914  PHE PHE D . n 
D 1 93  LEU 93  915  915  LEU LEU D . n 
D 1 94  TYR 94  916  916  TYR TYR D . n 
D 1 95  CYS 95  917  917  CYS CYS D . n 
D 1 96  HIS 96  918  918  HIS HIS D . n 
D 1 97  GLU 97  919  919  GLU GLU D . n 
D 1 98  MET 98  920  920  MET MET D . n 
D 1 99  SER 99  921  921  SER SER D . n 
D 1 100 LEU 100 922  922  LEU LEU D . n 
D 1 101 ALA 101 923  923  ALA ALA D . n 
D 1 102 PHE 102 924  924  PHE PHE D . n 
D 1 103 GLN 103 925  925  GLN GLN D . n 
D 1 104 ASP 104 926  926  ASP ASP D . n 
D 1 105 PRO 105 927  927  PRO PRO D . n 
D 1 106 VAL 106 928  928  VAL VAL D . n 
D 1 107 PRO 107 929  929  PRO PRO D . n 
D 1 108 LEU 108 930  930  LEU LEU D . n 
D 1 109 THR 109 931  931  THR THR D . n 
D 1 110 VAL 110 932  932  VAL VAL D . n 
D 1 111 PRO 111 933  933  PRO PRO D . n 
D 1 112 ASP 112 934  934  ASP ASP D . n 
D 1 113 TYR 113 935  935  TYR TYR D . n 
D 1 114 TYR 114 936  936  TYR TYR D . n 
D 1 115 LYS 115 937  937  LYS LYS D . n 
D 1 116 ILE 116 938  938  ILE ILE D . n 
D 1 117 ILE 117 939  939  ILE ILE D . n 
D 1 118 LYS 118 940  940  LYS LYS D . n 
D 1 119 ASN 119 941  941  ASN ASN D . n 
D 1 120 PRO 120 942  942  PRO PRO D . n 
D 1 121 MET 121 943  943  MET MET D . n 
D 1 122 ASP 122 944  944  ASP ASP D . n 
D 1 123 LEU 123 945  945  LEU LEU D . n 
D 1 124 SER 124 946  946  SER SER D . n 
D 1 125 THR 125 947  947  THR THR D . n 
D 1 126 ILE 126 948  948  ILE ILE D . n 
D 1 127 LYS 127 949  949  LYS LYS D . n 
D 1 128 LYS 128 950  950  LYS LYS D . n 
D 1 129 ARG 129 951  951  ARG ARG D . n 
D 1 130 LEU 130 952  952  LEU LEU D . n 
D 1 131 GLN 131 953  953  GLN GLN D . n 
D 1 132 GLU 132 954  954  GLU GLU D . n 
D 1 133 ASP 133 955  955  ASP ASP D . n 
D 1 134 TYR 134 956  956  TYR TYR D . n 
D 1 135 SER 135 957  957  SER SER D . n 
D 1 136 MET 136 958  958  MET MET D . n 
D 1 137 TYR 137 959  959  TYR TYR D . n 
D 1 138 SER 138 960  960  SER SER D . n 
D 1 139 LYS 139 961  961  LYS LYS D . n 
D 1 140 PRO 140 962  962  PRO PRO D . n 
D 1 141 GLU 141 963  963  GLU GLU D . n 
D 1 142 ASP 142 964  964  ASP ASP D . n 
D 1 143 PHE 143 965  965  PHE PHE D . n 
D 1 144 VAL 144 966  966  VAL VAL D . n 
D 1 145 ALA 145 967  967  ALA ALA D . n 
D 1 146 ASP 146 968  968  ASP ASP D . n 
D 1 147 PHE 147 969  969  PHE PHE D . n 
D 1 148 ARG 148 970  970  ARG ARG D . n 
D 1 149 LEU 149 971  971  LEU LEU D . n 
D 1 150 ILE 150 972  972  ILE ILE D . n 
D 1 151 PHE 151 973  973  PHE PHE D . n 
D 1 152 GLN 152 974  974  GLN GLN D . n 
D 1 153 ASN 153 975  975  ASN ASN D . n 
D 1 154 CYS 154 976  976  CYS CYS D . n 
D 1 155 ALA 155 977  977  ALA ALA D . n 
D 1 156 GLU 156 978  978  GLU GLU D . n 
D 1 157 PHE 157 979  979  PHE PHE D . n 
D 1 158 ASN 158 980  980  ASN ASN D . n 
D 1 159 GLU 159 981  981  GLU GLU D . n 
D 1 160 PRO 160 982  982  PRO PRO D . n 
D 1 161 ASP 161 983  983  ASP ASP D . n 
D 1 162 SER 162 984  984  SER SER D . n 
D 1 163 GLU 163 985  985  GLU GLU D . n 
D 1 164 VAL 164 986  986  VAL VAL D . n 
D 1 165 ALA 165 987  987  ALA ALA D . n 
D 1 166 ASN 166 988  988  ASN ASN D . n 
D 1 167 ALA 167 989  989  ALA ALA D . n 
D 1 168 GLY 168 990  990  GLY GLY D . n 
D 1 169 ILE 169 991  991  ILE ILE D . n 
D 1 170 LYS 170 992  992  LYS LYS D . n 
D 1 171 LEU 171 993  993  LEU LEU D . n 
D 1 172 GLU 172 994  994  GLU GLU D . n 
D 1 173 ASN 173 995  995  ASN ASN D . n 
D 1 174 TYR 174 996  996  TYR TYR D . n 
D 1 175 PHE 175 997  997  PHE PHE D . n 
D 1 176 GLU 176 998  998  GLU GLU D . n 
D 1 177 GLU 177 999  999  GLU GLU D . n 
D 1 178 LEU 178 1000 1000 LEU LEU D . n 
D 1 179 LEU 179 1001 1001 LEU LEU D . n 
D 1 180 LYS 180 1002 1002 LYS LYS D . n 
D 1 181 ASN 181 1003 1003 ASN ASN D . n 
D 1 182 LEU 182 1004 1004 LEU LEU D . n 
D 1 183 TYR 183 1005 1005 TYR TYR D . n 
D 1 184 PRO 184 1006 1006 PRO PRO D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F,M 
2 1 B,G,H,N 
3 1 C,I,J,O 
4 1 D,K,L,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? D HIS 27 ? D HIS 849 ? 1_555 ZN ? K ZN . ? D ZN 1 ? 1_555 SG ? D CYS 10 ? D CYS 832 ? 1_555 98.6  ? 
2  ND1 ? D HIS 27 ? D HIS 849 ? 1_555 ZN ? K ZN . ? D ZN 1 ? 1_555 SG ? D CYS 30 ? D CYS 852 ? 1_555 119.7 ? 
3  SG  ? D CYS 10 ? D CYS 832 ? 1_555 ZN ? K ZN . ? D ZN 1 ? 1_555 SG ? D CYS 30 ? D CYS 852 ? 1_555 114.8 ? 
4  ND1 ? D HIS 27 ? D HIS 849 ? 1_555 ZN ? K ZN . ? D ZN 1 ? 1_555 SG ? D CYS 7  ? D CYS 829 ? 1_555 99.9  ? 
5  SG  ? D CYS 10 ? D CYS 832 ? 1_555 ZN ? K ZN . ? D ZN 1 ? 1_555 SG ? D CYS 7  ? D CYS 829 ? 1_555 113.5 ? 
6  SG  ? D CYS 30 ? D CYS 852 ? 1_555 ZN ? K ZN . ? D ZN 1 ? 1_555 SG ? D CYS 7  ? D CYS 829 ? 1_555 109.3 ? 
7  ND1 ? C HIS 27 ? C HIS 849 ? 1_555 ZN ? J ZN . ? C ZN 2 ? 1_555 SG ? C CYS 7  ? C CYS 829 ? 1_555 99.7  ? 
8  ND1 ? C HIS 27 ? C HIS 849 ? 1_555 ZN ? J ZN . ? C ZN 2 ? 1_555 SG ? C CYS 30 ? C CYS 852 ? 1_555 120.2 ? 
9  SG  ? C CYS 7  ? C CYS 829 ? 1_555 ZN ? J ZN . ? C ZN 2 ? 1_555 SG ? C CYS 30 ? C CYS 852 ? 1_555 110.9 ? 
10 ND1 ? C HIS 27 ? C HIS 849 ? 1_555 ZN ? J ZN . ? C ZN 2 ? 1_555 SG ? C CYS 10 ? C CYS 832 ? 1_555 96.0  ? 
11 SG  ? C CYS 7  ? C CYS 829 ? 1_555 ZN ? J ZN . ? C ZN 2 ? 1_555 SG ? C CYS 10 ? C CYS 832 ? 1_555 111.7 ? 
12 SG  ? C CYS 30 ? C CYS 852 ? 1_555 ZN ? J ZN . ? C ZN 2 ? 1_555 SG ? C CYS 10 ? C CYS 832 ? 1_555 116.5 ? 
13 SG  ? A CYS 48 ? A CYS 870 ? 1_555 ZN ? F ZN . ? A ZN 2 ? 1_555 SG ? A CYS 19 ? A CYS 841 ? 1_555 114.7 ? 
14 SG  ? A CYS 48 ? A CYS 870 ? 1_555 ZN ? F ZN . ? A ZN 2 ? 1_555 SG ? A CYS 22 ? A CYS 844 ? 1_555 110.4 ? 
15 SG  ? A CYS 19 ? A CYS 841 ? 1_555 ZN ? F ZN . ? A ZN 2 ? 1_555 SG ? A CYS 22 ? A CYS 844 ? 1_555 103.5 ? 
16 SG  ? A CYS 48 ? A CYS 870 ? 1_555 ZN ? F ZN . ? A ZN 2 ? 1_555 SG ? A CYS 45 ? A CYS 867 ? 1_555 109.7 ? 
17 SG  ? A CYS 19 ? A CYS 841 ? 1_555 ZN ? F ZN . ? A ZN 2 ? 1_555 SG ? A CYS 45 ? A CYS 867 ? 1_555 109.0 ? 
18 SG  ? A CYS 22 ? A CYS 844 ? 1_555 ZN ? F ZN . ? A ZN 2 ? 1_555 SG ? A CYS 45 ? A CYS 867 ? 1_555 109.3 ? 
19 SG  ? D CYS 48 ? D CYS 870 ? 1_555 ZN ? L ZN . ? D ZN 2 ? 1_555 SG ? D CYS 19 ? D CYS 841 ? 1_555 114.9 ? 
20 SG  ? D CYS 48 ? D CYS 870 ? 1_555 ZN ? L ZN . ? D ZN 2 ? 1_555 SG ? D CYS 22 ? D CYS 844 ? 1_555 110.4 ? 
21 SG  ? D CYS 19 ? D CYS 841 ? 1_555 ZN ? L ZN . ? D ZN 2 ? 1_555 SG ? D CYS 22 ? D CYS 844 ? 1_555 105.4 ? 
22 SG  ? D CYS 48 ? D CYS 870 ? 1_555 ZN ? L ZN . ? D ZN 2 ? 1_555 SG ? D CYS 45 ? D CYS 867 ? 1_555 108.8 ? 
23 SG  ? D CYS 19 ? D CYS 841 ? 1_555 ZN ? L ZN . ? D ZN 2 ? 1_555 SG ? D CYS 45 ? D CYS 867 ? 1_555 107.0 ? 
24 SG  ? D CYS 22 ? D CYS 844 ? 1_555 ZN ? L ZN . ? D ZN 2 ? 1_555 SG ? D CYS 45 ? D CYS 867 ? 1_555 110.2 ? 
25 SG  ? B CYS 48 ? B CYS 870 ? 1_555 ZN ? H ZN . ? B ZN 2 ? 1_555 SG ? B CYS 19 ? B CYS 841 ? 1_555 110.9 ? 
26 SG  ? B CYS 48 ? B CYS 870 ? 1_555 ZN ? H ZN . ? B ZN 2 ? 1_555 SG ? B CYS 22 ? B CYS 844 ? 1_555 107.7 ? 
27 SG  ? B CYS 19 ? B CYS 841 ? 1_555 ZN ? H ZN . ? B ZN 2 ? 1_555 SG ? B CYS 22 ? B CYS 844 ? 1_555 106.4 ? 
28 SG  ? B CYS 48 ? B CYS 870 ? 1_555 ZN ? H ZN . ? B ZN 2 ? 1_555 SG ? B CYS 45 ? B CYS 867 ? 1_555 108.6 ? 
29 SG  ? B CYS 19 ? B CYS 841 ? 1_555 ZN ? H ZN . ? B ZN 2 ? 1_555 SG ? B CYS 45 ? B CYS 867 ? 1_555 111.2 ? 
30 SG  ? B CYS 22 ? B CYS 844 ? 1_555 ZN ? H ZN . ? B ZN 2 ? 1_555 SG ? B CYS 45 ? B CYS 867 ? 1_555 112.0 ? 
31 ND1 ? B HIS 27 ? B HIS 849 ? 1_555 ZN ? G ZN . ? B ZN 1 ? 1_555 SG ? B CYS 7  ? B CYS 829 ? 1_555 100.3 ? 
32 ND1 ? B HIS 27 ? B HIS 849 ? 1_555 ZN ? G ZN . ? B ZN 1 ? 1_555 SG ? B CYS 30 ? B CYS 852 ? 1_555 117.1 ? 
33 SG  ? B CYS 7  ? B CYS 829 ? 1_555 ZN ? G ZN . ? B ZN 1 ? 1_555 SG ? B CYS 30 ? B CYS 852 ? 1_555 110.6 ? 
34 ND1 ? B HIS 27 ? B HIS 849 ? 1_555 ZN ? G ZN . ? B ZN 1 ? 1_555 SG ? B CYS 10 ? B CYS 832 ? 1_555 96.3  ? 
35 SG  ? B CYS 7  ? B CYS 829 ? 1_555 ZN ? G ZN . ? B ZN 1 ? 1_555 SG ? B CYS 10 ? B CYS 832 ? 1_555 113.5 ? 
36 SG  ? B CYS 30 ? B CYS 852 ? 1_555 ZN ? G ZN . ? B ZN 1 ? 1_555 SG ? B CYS 10 ? B CYS 832 ? 1_555 117.3 ? 
37 ND1 ? A HIS 27 ? A HIS 849 ? 1_555 ZN ? E ZN . ? A ZN 1 ? 1_555 SG ? A CYS 10 ? A CYS 832 ? 1_555 91.3  ? 
38 ND1 ? A HIS 27 ? A HIS 849 ? 1_555 ZN ? E ZN . ? A ZN 1 ? 1_555 SG ? A CYS 30 ? A CYS 852 ? 1_555 118.6 ? 
39 SG  ? A CYS 10 ? A CYS 832 ? 1_555 ZN ? E ZN . ? A ZN 1 ? 1_555 SG ? A CYS 30 ? A CYS 852 ? 1_555 118.1 ? 
40 ND1 ? A HIS 27 ? A HIS 849 ? 1_555 ZN ? E ZN . ? A ZN 1 ? 1_555 SG ? A CYS 7  ? A CYS 829 ? 1_555 108.7 ? 
41 SG  ? A CYS 10 ? A CYS 832 ? 1_555 ZN ? E ZN . ? A ZN 1 ? 1_555 SG ? A CYS 7  ? A CYS 829 ? 1_555 109.3 ? 
42 SG  ? A CYS 30 ? A CYS 852 ? 1_555 ZN ? E ZN . ? A ZN 1 ? 1_555 SG ? A CYS 7  ? A CYS 829 ? 1_555 109.5 ? 
43 SG  ? C CYS 48 ? C CYS 870 ? 1_555 ZN ? I ZN . ? C ZN 1 ? 1_555 SG ? C CYS 19 ? C CYS 841 ? 1_555 109.4 ? 
44 SG  ? C CYS 48 ? C CYS 870 ? 1_555 ZN ? I ZN . ? C ZN 1 ? 1_555 SG ? C CYS 22 ? C CYS 844 ? 1_555 109.0 ? 
45 SG  ? C CYS 19 ? C CYS 841 ? 1_555 ZN ? I ZN . ? C ZN 1 ? 1_555 SG ? C CYS 22 ? C CYS 844 ? 1_555 104.4 ? 
46 SG  ? C CYS 48 ? C CYS 870 ? 1_555 ZN ? I ZN . ? C ZN 1 ? 1_555 SG ? C CYS 45 ? C CYS 867 ? 1_555 109.5 ? 
47 SG  ? C CYS 19 ? C CYS 841 ? 1_555 ZN ? I ZN . ? C ZN 1 ? 1_555 SG ? C CYS 45 ? C CYS 867 ? 1_555 110.4 ? 
48 SG  ? C CYS 22 ? C CYS 844 ? 1_555 ZN ? I ZN . ? C ZN 1 ? 1_555 SG ? C CYS 45 ? C CYS 867 ? 1_555 114.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-15 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' . ? 1 
CNS       refinement        . ? 2 
HKL-2000  'data reduction'  . ? 3 
HKL-2000  'data scaling'    . ? 4 
CNS       phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 831 ? ? -96.31  -61.67 
2 1 PRO A 933 ? ? -35.98  111.88 
3 1 ASP A 934 ? ? 56.49   19.64  
4 1 ASP B 934 ? ? 64.00   -3.10  
5 1 ASN B 941 ? ? -116.92 74.01  
6 1 ASP C 934 ? ? 59.69   3.97   
7 1 ASN C 941 ? ? -119.90 73.35  
8 1 ASP C 983 ? ? 57.19   16.60  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 823 ? A SER 1  
2  1 Y 1 A PRO 824 ? A PRO 2  
3  1 Y 1 A CYS 882 ? A CYS 60 
4  1 Y 1 A ASP 883 ? A ASP 61 
5  1 Y 1 A ALA 884 ? A ALA 62 
6  1 Y 1 A PRO 885 ? A PRO 63 
7  1 Y 1 A SER 886 ? A SER 64 
8  1 Y 1 A HIS 887 ? A HIS 65 
9  1 Y 1 A ASN 888 ? A ASN 66 
10 1 Y 1 A SER 889 ? A SER 67 
11 1 Y 1 A GLU 890 ? A GLU 68 
12 1 Y 1 A LYS 891 ? A LYS 69 
13 1 Y 1 B SER 823 ? B SER 1  
14 1 Y 1 C SER 823 ? C SER 1  
15 1 Y 1 C SER 886 ? C SER 64 
16 1 Y 1 C HIS 887 ? C HIS 65 
17 1 Y 1 C ASN 888 ? C ASN 66 
18 1 Y 1 C SER 889 ? C SER 67 
19 1 Y 1 C GLU 890 ? C GLU 68 
20 1 Y 1 D SER 823 ? D SER 1  
21 1 Y 1 D PRO 824 ? D PRO 2  
22 1 Y 1 D CYS 882 ? D CYS 60 
23 1 Y 1 D ASP 883 ? D ASP 61 
24 1 Y 1 D ALA 884 ? D ALA 62 
25 1 Y 1 D PRO 885 ? D PRO 63 
26 1 Y 1 D SER 886 ? D SER 64 
27 1 Y 1 D HIS 887 ? D HIS 65 
28 1 Y 1 D ASN 888 ? D ASN 66 
29 1 Y 1 D SER 889 ? D SER 67 
30 1 Y 1 D GLU 890 ? D GLU 68 
31 1 Y 1 D LYS 891 ? D LYS 69 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 ZN  1  1   1   ZN  ZN  A . 
F 2 ZN  1  2   2   ZN  ZN  A . 
G 2 ZN  1  1   1   ZN  ZN  B . 
H 2 ZN  1  2   2   ZN  ZN  B . 
I 2 ZN  1  1   1   ZN  ZN  C . 
J 2 ZN  1  2   2   ZN  ZN  C . 
K 2 ZN  1  1   1   ZN  ZN  D . 
L 2 ZN  1  2   2   ZN  ZN  D . 
M 3 HOH 1  100 100 HOH HOH A . 
M 3 HOH 2  101 101 HOH HOH A . 
M 3 HOH 3  102 102 HOH HOH A . 
M 3 HOH 4  103 103 HOH HOH A . 
M 3 HOH 5  104 104 HOH HOH A . 
M 3 HOH 6  105 105 HOH HOH A . 
M 3 HOH 7  106 106 HOH HOH A . 
M 3 HOH 8  107 107 HOH HOH A . 
M 3 HOH 9  108 108 HOH HOH A . 
M 3 HOH 10 109 109 HOH HOH A . 
M 3 HOH 11 110 110 HOH HOH A . 
M 3 HOH 12 111 111 HOH HOH A . 
M 3 HOH 13 112 112 HOH HOH A . 
M 3 HOH 14 113 113 HOH HOH A . 
M 3 HOH 15 114 114 HOH HOH A . 
M 3 HOH 16 115 115 HOH HOH A . 
M 3 HOH 17 116 116 HOH HOH A . 
M 3 HOH 18 117 117 HOH HOH A . 
M 3 HOH 19 118 118 HOH HOH A . 
M 3 HOH 20 119 119 HOH HOH A . 
M 3 HOH 21 120 120 HOH HOH A . 
M 3 HOH 22 121 121 HOH HOH A . 
M 3 HOH 23 122 122 HOH HOH A . 
M 3 HOH 24 123 123 HOH HOH A . 
M 3 HOH 25 124 124 HOH HOH A . 
M 3 HOH 26 125 125 HOH HOH A . 
M 3 HOH 27 126 126 HOH HOH A . 
M 3 HOH 28 127 127 HOH HOH A . 
M 3 HOH 29 128 128 HOH HOH A . 
M 3 HOH 30 129 129 HOH HOH A . 
M 3 HOH 31 130 130 HOH HOH A . 
M 3 HOH 32 131 131 HOH HOH A . 
M 3 HOH 33 132 132 HOH HOH A . 
M 3 HOH 34 133 133 HOH HOH A . 
M 3 HOH 35 134 134 HOH HOH A . 
M 3 HOH 36 135 135 HOH HOH A . 
M 3 HOH 37 136 136 HOH HOH A . 
M 3 HOH 38 137 137 HOH HOH A . 
M 3 HOH 39 138 138 HOH HOH A . 
M 3 HOH 40 139 139 HOH HOH A . 
M 3 HOH 41 140 140 HOH HOH A . 
M 3 HOH 42 141 141 HOH HOH A . 
M 3 HOH 43 142 142 HOH HOH A . 
M 3 HOH 44 143 143 HOH HOH A . 
M 3 HOH 45 144 144 HOH HOH A . 
M 3 HOH 46 145 145 HOH HOH A . 
M 3 HOH 47 146 146 HOH HOH A . 
M 3 HOH 48 147 147 HOH HOH A . 
M 3 HOH 49 148 148 HOH HOH A . 
M 3 HOH 50 149 149 HOH HOH A . 
N 3 HOH 1  100 100 HOH HOH B . 
N 3 HOH 2  101 101 HOH HOH B . 
N 3 HOH 3  102 102 HOH HOH B . 
N 3 HOH 4  103 103 HOH HOH B . 
N 3 HOH 5  104 104 HOH HOH B . 
N 3 HOH 6  105 105 HOH HOH B . 
N 3 HOH 7  106 106 HOH HOH B . 
N 3 HOH 8  107 107 HOH HOH B . 
N 3 HOH 9  108 108 HOH HOH B . 
N 3 HOH 10 109 109 HOH HOH B . 
N 3 HOH 11 110 110 HOH HOH B . 
N 3 HOH 12 111 111 HOH HOH B . 
N 3 HOH 13 112 112 HOH HOH B . 
N 3 HOH 14 113 113 HOH HOH B . 
N 3 HOH 15 114 114 HOH HOH B . 
N 3 HOH 16 115 115 HOH HOH B . 
N 3 HOH 17 116 116 HOH HOH B . 
N 3 HOH 18 117 117 HOH HOH B . 
N 3 HOH 19 118 118 HOH HOH B . 
N 3 HOH 20 119 119 HOH HOH B . 
N 3 HOH 21 120 120 HOH HOH B . 
N 3 HOH 22 121 121 HOH HOH B . 
N 3 HOH 23 122 122 HOH HOH B . 
N 3 HOH 24 123 123 HOH HOH B . 
N 3 HOH 25 124 124 HOH HOH B . 
N 3 HOH 26 125 125 HOH HOH B . 
N 3 HOH 27 126 126 HOH HOH B . 
N 3 HOH 28 127 127 HOH HOH B . 
N 3 HOH 29 128 128 HOH HOH B . 
N 3 HOH 30 129 129 HOH HOH B . 
N 3 HOH 31 130 130 HOH HOH B . 
N 3 HOH 32 131 131 HOH HOH B . 
N 3 HOH 33 132 132 HOH HOH B . 
N 3 HOH 34 133 133 HOH HOH B . 
N 3 HOH 35 134 134 HOH HOH B . 
N 3 HOH 36 135 135 HOH HOH B . 
N 3 HOH 37 136 136 HOH HOH B . 
N 3 HOH 38 137 137 HOH HOH B . 
N 3 HOH 39 138 138 HOH HOH B . 
N 3 HOH 40 139 139 HOH HOH B . 
N 3 HOH 41 140 140 HOH HOH B . 
N 3 HOH 42 141 141 HOH HOH B . 
N 3 HOH 43 142 142 HOH HOH B . 
N 3 HOH 44 143 143 HOH HOH B . 
N 3 HOH 45 144 144 HOH HOH B . 
N 3 HOH 46 145 145 HOH HOH B . 
N 3 HOH 47 146 146 HOH HOH B . 
N 3 HOH 48 147 147 HOH HOH B . 
N 3 HOH 49 148 148 HOH HOH B . 
N 3 HOH 50 149 149 HOH HOH B . 
N 3 HOH 51 150 150 HOH HOH B . 
N 3 HOH 52 151 151 HOH HOH B . 
N 3 HOH 53 152 152 HOH HOH B . 
N 3 HOH 54 153 153 HOH HOH B . 
N 3 HOH 55 154 154 HOH HOH B . 
N 3 HOH 56 155 155 HOH HOH B . 
N 3 HOH 57 156 156 HOH HOH B . 
N 3 HOH 58 157 157 HOH HOH B . 
N 3 HOH 59 158 158 HOH HOH B . 
N 3 HOH 60 159 159 HOH HOH B . 
N 3 HOH 61 160 160 HOH HOH B . 
N 3 HOH 62 161 161 HOH HOH B . 
N 3 HOH 63 162 162 HOH HOH B . 
N 3 HOH 64 163 163 HOH HOH B . 
N 3 HOH 65 164 164 HOH HOH B . 
N 3 HOH 66 165 165 HOH HOH B . 
N 3 HOH 67 166 166 HOH HOH B . 
N 3 HOH 68 167 167 HOH HOH B . 
N 3 HOH 69 168 168 HOH HOH B . 
O 3 HOH 1  100 100 HOH HOH C . 
O 3 HOH 2  101 101 HOH HOH C . 
O 3 HOH 3  102 102 HOH HOH C . 
O 3 HOH 4  103 103 HOH HOH C . 
O 3 HOH 5  104 104 HOH HOH C . 
O 3 HOH 6  105 105 HOH HOH C . 
O 3 HOH 7  106 106 HOH HOH C . 
O 3 HOH 8  107 107 HOH HOH C . 
O 3 HOH 9  108 108 HOH HOH C . 
O 3 HOH 10 109 109 HOH HOH C . 
O 3 HOH 11 110 110 HOH HOH C . 
O 3 HOH 12 111 111 HOH HOH C . 
O 3 HOH 13 112 112 HOH HOH C . 
O 3 HOH 14 113 113 HOH HOH C . 
O 3 HOH 15 114 114 HOH HOH C . 
O 3 HOH 16 115 115 HOH HOH C . 
O 3 HOH 17 116 116 HOH HOH C . 
O 3 HOH 18 117 117 HOH HOH C . 
O 3 HOH 19 118 118 HOH HOH C . 
O 3 HOH 20 119 119 HOH HOH C . 
O 3 HOH 21 120 120 HOH HOH C . 
O 3 HOH 22 121 121 HOH HOH C . 
O 3 HOH 23 122 122 HOH HOH C . 
O 3 HOH 24 123 123 HOH HOH C . 
O 3 HOH 25 124 124 HOH HOH C . 
O 3 HOH 26 125 125 HOH HOH C . 
O 3 HOH 27 126 126 HOH HOH C . 
O 3 HOH 28 127 127 HOH HOH C . 
O 3 HOH 29 128 128 HOH HOH C . 
O 3 HOH 30 129 129 HOH HOH C . 
O 3 HOH 31 130 130 HOH HOH C . 
O 3 HOH 32 131 131 HOH HOH C . 
O 3 HOH 33 132 132 HOH HOH C . 
O 3 HOH 34 133 133 HOH HOH C . 
O 3 HOH 35 134 134 HOH HOH C . 
O 3 HOH 36 135 135 HOH HOH C . 
O 3 HOH 37 136 136 HOH HOH C . 
O 3 HOH 38 137 137 HOH HOH C . 
O 3 HOH 39 138 138 HOH HOH C . 
O 3 HOH 40 139 139 HOH HOH C . 
O 3 HOH 41 140 140 HOH HOH C . 
O 3 HOH 42 141 141 HOH HOH C . 
O 3 HOH 43 142 142 HOH HOH C . 
O 3 HOH 44 143 143 HOH HOH C . 
O 3 HOH 45 144 144 HOH HOH C . 
O 3 HOH 46 145 145 HOH HOH C . 
O 3 HOH 47 146 146 HOH HOH C . 
O 3 HOH 48 147 147 HOH HOH C . 
O 3 HOH 49 148 148 HOH HOH C . 
O 3 HOH 50 149 149 HOH HOH C . 
O 3 HOH 51 150 150 HOH HOH C . 
O 3 HOH 52 151 151 HOH HOH C . 
O 3 HOH 53 152 152 HOH HOH C . 
O 3 HOH 54 153 153 HOH HOH C . 
O 3 HOH 55 154 154 HOH HOH C . 
O 3 HOH 56 155 155 HOH HOH C . 
O 3 HOH 57 156 156 HOH HOH C . 
O 3 HOH 58 157 157 HOH HOH C . 
O 3 HOH 59 158 158 HOH HOH C . 
O 3 HOH 60 159 159 HOH HOH C . 
O 3 HOH 61 160 160 HOH HOH C . 
O 3 HOH 62 161 161 HOH HOH C . 
O 3 HOH 63 162 162 HOH HOH C . 
O 3 HOH 64 163 163 HOH HOH C . 
O 3 HOH 65 164 164 HOH HOH C . 
O 3 HOH 66 165 165 HOH HOH C . 
O 3 HOH 67 166 166 HOH HOH C . 
O 3 HOH 68 167 167 HOH HOH C . 
O 3 HOH 69 168 168 HOH HOH C . 
O 3 HOH 70 169 169 HOH HOH C . 
O 3 HOH 71 170 170 HOH HOH C . 
O 3 HOH 72 171 171 HOH HOH C . 
O 3 HOH 73 172 172 HOH HOH C . 
O 3 HOH 74 173 173 HOH HOH C . 
P 3 HOH 1  100 100 HOH HOH D . 
P 3 HOH 2  101 101 HOH HOH D . 
P 3 HOH 3  102 102 HOH HOH D . 
P 3 HOH 4  103 103 HOH HOH D . 
P 3 HOH 5  104 104 HOH HOH D . 
P 3 HOH 6  105 105 HOH HOH D . 
P 3 HOH 7  106 106 HOH HOH D . 
P 3 HOH 8  107 107 HOH HOH D . 
P 3 HOH 9  108 108 HOH HOH D . 
P 3 HOH 10 109 109 HOH HOH D . 
P 3 HOH 11 110 110 HOH HOH D . 
P 3 HOH 12 111 111 HOH HOH D . 
P 3 HOH 13 112 112 HOH HOH D . 
P 3 HOH 14 113 113 HOH HOH D . 
P 3 HOH 15 114 114 HOH HOH D . 
P 3 HOH 16 115 115 HOH HOH D . 
P 3 HOH 17 116 116 HOH HOH D . 
P 3 HOH 18 117 117 HOH HOH D . 
P 3 HOH 19 118 118 HOH HOH D . 
P 3 HOH 20 119 119 HOH HOH D . 
P 3 HOH 21 120 120 HOH HOH D . 
P 3 HOH 22 121 121 HOH HOH D . 
P 3 HOH 23 122 122 HOH HOH D . 
P 3 HOH 24 123 123 HOH HOH D . 
P 3 HOH 25 124 124 HOH HOH D . 
P 3 HOH 26 125 125 HOH HOH D . 
P 3 HOH 27 126 126 HOH HOH D . 
P 3 HOH 28 127 127 HOH HOH D . 
P 3 HOH 29 128 128 HOH HOH D . 
P 3 HOH 30 129 129 HOH HOH D . 
P 3 HOH 31 130 130 HOH HOH D . 
P 3 HOH 32 131 131 HOH HOH D . 
P 3 HOH 33 132 132 HOH HOH D . 
P 3 HOH 34 133 133 HOH HOH D . 
P 3 HOH 35 134 134 HOH HOH D . 
P 3 HOH 36 135 135 HOH HOH D . 
P 3 HOH 37 136 136 HOH HOH D . 
P 3 HOH 38 137 137 HOH HOH D . 
P 3 HOH 39 138 138 HOH HOH D . 
P 3 HOH 40 139 139 HOH HOH D . 
P 3 HOH 41 140 140 HOH HOH D . 
P 3 HOH 42 141 141 HOH HOH D . 
P 3 HOH 43 142 142 HOH HOH D . 
P 3 HOH 44 143 143 HOH HOH D . 
P 3 HOH 45 144 144 HOH HOH D . 
P 3 HOH 46 145 145 HOH HOH D . 
P 3 HOH 47 146 146 HOH HOH D . 
P 3 HOH 48 147 147 HOH HOH D . 
P 3 HOH 49 148 148 HOH HOH D . 
#