data_3OEE
# 
_entry.id   3OEE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OEE         
RCSB  RCSB061010   
WWPDB D_1000061010 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HLD 'YEAST MITOCHONDRIAL F1-ATPASE'                       unspecified 
PDB 3FKS 'YEAST F1 ATPASE IN THE ABSENCE OF BOUND NUCLEOTIDES' unspecified 
PDB 1W0J 'BERYLLIUM FLUORIDE INHIBITED BOVINE F1-ATPASE'       unspecified 
PDB 3OE7 'YEAST F1 ATPASE MUTANT GAMMA-I270T'                  unspecified 
PDB 3OEH 'YEAST F1 ATPASE MUTANT BETA-V279F'                   unspecified 
PDB 3OFN 'YEAST F1 ATPASE MUTANT ALPHA-N67I'                   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OEE 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arsenieva, D.' 1 
'Symersky, J.'  2 
'Wang, Y.'      3 
'Pagadala, V.'  4 
'Mueller, D.M.' 5 
# 
_citation.id                        primary 
_citation.title                     'Structure of four mutant forms of yeast F1 ATPase: alpha-F405S' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arsenieva, D.' 1 
primary 'Symersky, J.'  2 
primary 'Wang, Y.'      3 
primary 'Pagadala, V.'  4 
primary 'Mueller, D.M.' 5 
# 
_cell.entry_id           3OEE 
_cell.length_a           110.430 
_cell.length_b           288.580 
_cell.length_c           187.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.37 
_cell.angle_gamma        90.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OEE 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP synthase subunit alpha'                  54947.309 9  3.6.3.14 F405S 'UNP RESIDUES 36-545' ? 
2 polymer     man 'ATP synthase subunit beta'                   52009.965 9  3.6.3.14 ?     'UNP RESIDUES 34-511' ? 
3 polymer     man 'ATP synthase subunit gamma'                  30657.160 3  3.6.3.14 ?     'UNP RESIDUES 34-311' ? 
4 polymer     man 'ATP synthase subunit delta'                  14565.385 3  3.6.3.14 ?     'UNP RESIDUES 23-160' ? 
5 polymer     man 'ATP synthase subunit epsilon'                6618.359  3  3.6.3.14 ?     'UNP RESIDUES 2-62'   ? 
6 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   15 ?        ?     ?                     ? 
7 non-polymer syn 'MAGNESIUM ION'                               24.305    15 ?        ?     ?                     ? 
8 non-polymer syn 'PHOSPHATE ION'                               94.971    2  ?        ?     ?                     ? 
9 water       nat water                                         18.015    84 ?        ?     ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'F-ATPase gamma subunit' 
4 'F-ATPase delta subunit' 
5 'ATPase subunit epsilon' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAASAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAASAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
A,B,C,J,K,L,S,T,U ? 
2 'polypeptide(L)' no no 
;ASHHHHHHAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE
KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIG
LFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVAL
TGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMD
ELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLA
AEAN
;
;ASHHHHHHAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE
KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIG
LFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVAL
TGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMD
ELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLA
AEAN
;
D,E,F,M,N,O,V,W,X ? 
3 'polypeptide(L)' no no 
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
G,P,Y             ? 
4 'polypeptide(L)' no no 
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
H,Q,Z             ? 
5 'polypeptide(L)' no no SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 
SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK I,R,1             ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   THR n 
1 4   LYS n 
1 5   ALA n 
1 6   GLN n 
1 7   PRO n 
1 8   THR n 
1 9   GLU n 
1 10  VAL n 
1 11  SER n 
1 12  SER n 
1 13  ILE n 
1 14  LEU n 
1 15  GLU n 
1 16  GLU n 
1 17  ARG n 
1 18  ILE n 
1 19  LYS n 
1 20  GLY n 
1 21  VAL n 
1 22  SER n 
1 23  ASP n 
1 24  GLU n 
1 25  ALA n 
1 26  ASN n 
1 27  LEU n 
1 28  ASN n 
1 29  GLU n 
1 30  THR n 
1 31  GLY n 
1 32  ARG n 
1 33  VAL n 
1 34  LEU n 
1 35  ALA n 
1 36  VAL n 
1 37  GLY n 
1 38  ASP n 
1 39  GLY n 
1 40  ILE n 
1 41  ALA n 
1 42  ARG n 
1 43  VAL n 
1 44  PHE n 
1 45  GLY n 
1 46  LEU n 
1 47  ASN n 
1 48  ASN n 
1 49  ILE n 
1 50  GLN n 
1 51  ALA n 
1 52  GLU n 
1 53  GLU n 
1 54  LEU n 
1 55  VAL n 
1 56  GLU n 
1 57  PHE n 
1 58  SER n 
1 59  SER n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  GLY n 
1 64  MET n 
1 65  ALA n 
1 66  LEU n 
1 67  ASN n 
1 68  LEU n 
1 69  GLU n 
1 70  PRO n 
1 71  GLY n 
1 72  GLN n 
1 73  VAL n 
1 74  GLY n 
1 75  ILE n 
1 76  VAL n 
1 77  LEU n 
1 78  PHE n 
1 79  GLY n 
1 80  SER n 
1 81  ASP n 
1 82  ARG n 
1 83  LEU n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  GLY n 
1 88  GLU n 
1 89  LEU n 
1 90  VAL n 
1 91  LYS n 
1 92  ARG n 
1 93  THR n 
1 94  GLY n 
1 95  ASN n 
1 96  ILE n 
1 97  VAL n 
1 98  ASP n 
1 99  VAL n 
1 100 PRO n 
1 101 VAL n 
1 102 GLY n 
1 103 PRO n 
1 104 GLY n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 ARG n 
1 109 VAL n 
1 110 VAL n 
1 111 ASP n 
1 112 ALA n 
1 113 LEU n 
1 114 GLY n 
1 115 ASN n 
1 116 PRO n 
1 117 ILE n 
1 118 ASP n 
1 119 GLY n 
1 120 LYS n 
1 121 GLY n 
1 122 PRO n 
1 123 ILE n 
1 124 ASP n 
1 125 ALA n 
1 126 ALA n 
1 127 GLY n 
1 128 ARG n 
1 129 SER n 
1 130 ARG n 
1 131 ALA n 
1 132 GLN n 
1 133 VAL n 
1 134 LYS n 
1 135 ALA n 
1 136 PRO n 
1 137 GLY n 
1 138 ILE n 
1 139 LEU n 
1 140 PRO n 
1 141 ARG n 
1 142 ARG n 
1 143 SER n 
1 144 VAL n 
1 145 HIS n 
1 146 GLU n 
1 147 PRO n 
1 148 VAL n 
1 149 GLN n 
1 150 THR n 
1 151 GLY n 
1 152 LEU n 
1 153 LYS n 
1 154 ALA n 
1 155 VAL n 
1 156 ASP n 
1 157 ALA n 
1 158 LEU n 
1 159 VAL n 
1 160 PRO n 
1 161 ILE n 
1 162 GLY n 
1 163 ARG n 
1 164 GLY n 
1 165 GLN n 
1 166 ARG n 
1 167 GLU n 
1 168 LEU n 
1 169 ILE n 
1 170 ILE n 
1 171 GLY n 
1 172 ASP n 
1 173 ARG n 
1 174 GLN n 
1 175 THR n 
1 176 GLY n 
1 177 LYS n 
1 178 THR n 
1 179 ALA n 
1 180 VAL n 
1 181 ALA n 
1 182 LEU n 
1 183 ASP n 
1 184 THR n 
1 185 ILE n 
1 186 LEU n 
1 187 ASN n 
1 188 GLN n 
1 189 LYS n 
1 190 ARG n 
1 191 TRP n 
1 192 ASN n 
1 193 ASN n 
1 194 GLY n 
1 195 SER n 
1 196 ASP n 
1 197 GLU n 
1 198 SER n 
1 199 LYS n 
1 200 LYS n 
1 201 LEU n 
1 202 TYR n 
1 203 CYS n 
1 204 VAL n 
1 205 TYR n 
1 206 VAL n 
1 207 ALA n 
1 208 VAL n 
1 209 GLY n 
1 210 GLN n 
1 211 LYS n 
1 212 ARG n 
1 213 SER n 
1 214 THR n 
1 215 VAL n 
1 216 ALA n 
1 217 GLN n 
1 218 LEU n 
1 219 VAL n 
1 220 GLN n 
1 221 THR n 
1 222 LEU n 
1 223 GLU n 
1 224 GLN n 
1 225 HIS n 
1 226 ASP n 
1 227 ALA n 
1 228 MET n 
1 229 LYS n 
1 230 TYR n 
1 231 SER n 
1 232 ILE n 
1 233 ILE n 
1 234 VAL n 
1 235 ALA n 
1 236 ALA n 
1 237 THR n 
1 238 ALA n 
1 239 SER n 
1 240 GLU n 
1 241 ALA n 
1 242 ALA n 
1 243 PRO n 
1 244 LEU n 
1 245 GLN n 
1 246 TYR n 
1 247 LEU n 
1 248 ALA n 
1 249 PRO n 
1 250 PHE n 
1 251 THR n 
1 252 ALA n 
1 253 ALA n 
1 254 SER n 
1 255 ILE n 
1 256 GLY n 
1 257 GLU n 
1 258 TRP n 
1 259 PHE n 
1 260 ARG n 
1 261 ASP n 
1 262 ASN n 
1 263 GLY n 
1 264 LYS n 
1 265 HIS n 
1 266 ALA n 
1 267 LEU n 
1 268 ILE n 
1 269 VAL n 
1 270 TYR n 
1 271 ASP n 
1 272 ASP n 
1 273 LEU n 
1 274 SER n 
1 275 LYS n 
1 276 GLN n 
1 277 ALA n 
1 278 VAL n 
1 279 ALA n 
1 280 TYR n 
1 281 ARG n 
1 282 GLN n 
1 283 LEU n 
1 284 SER n 
1 285 LEU n 
1 286 LEU n 
1 287 LEU n 
1 288 ARG n 
1 289 ARG n 
1 290 PRO n 
1 291 PRO n 
1 292 GLY n 
1 293 ARG n 
1 294 GLU n 
1 295 ALA n 
1 296 TYR n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 VAL n 
1 301 PHE n 
1 302 TYR n 
1 303 LEU n 
1 304 HIS n 
1 305 SER n 
1 306 ARG n 
1 307 LEU n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 ALA n 
1 312 ALA n 
1 313 LYS n 
1 314 LEU n 
1 315 SER n 
1 316 GLU n 
1 317 LYS n 
1 318 GLU n 
1 319 GLY n 
1 320 SER n 
1 321 GLY n 
1 322 SER n 
1 323 LEU n 
1 324 THR n 
1 325 ALA n 
1 326 LEU n 
1 327 PRO n 
1 328 VAL n 
1 329 ILE n 
1 330 GLU n 
1 331 THR n 
1 332 GLN n 
1 333 GLY n 
1 334 GLY n 
1 335 ASP n 
1 336 VAL n 
1 337 SER n 
1 338 ALA n 
1 339 TYR n 
1 340 ILE n 
1 341 PRO n 
1 342 THR n 
1 343 ASN n 
1 344 VAL n 
1 345 ILE n 
1 346 SER n 
1 347 ILE n 
1 348 THR n 
1 349 ASP n 
1 350 GLY n 
1 351 GLN n 
1 352 ILE n 
1 353 PHE n 
1 354 LEU n 
1 355 GLU n 
1 356 ALA n 
1 357 GLU n 
1 358 LEU n 
1 359 PHE n 
1 360 TYR n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ARG n 
1 365 PRO n 
1 366 ALA n 
1 367 ILE n 
1 368 ASN n 
1 369 VAL n 
1 370 GLY n 
1 371 LEU n 
1 372 SER n 
1 373 VAL n 
1 374 SER n 
1 375 ARG n 
1 376 VAL n 
1 377 GLY n 
1 378 SER n 
1 379 ALA n 
1 380 ALA n 
1 381 GLN n 
1 382 VAL n 
1 383 LYS n 
1 384 ALA n 
1 385 LEU n 
1 386 LYS n 
1 387 GLN n 
1 388 VAL n 
1 389 ALA n 
1 390 GLY n 
1 391 SER n 
1 392 LEU n 
1 393 LYS n 
1 394 LEU n 
1 395 PHE n 
1 396 LEU n 
1 397 ALA n 
1 398 GLN n 
1 399 TYR n 
1 400 ARG n 
1 401 GLU n 
1 402 VAL n 
1 403 ALA n 
1 404 ALA n 
1 405 SER n 
1 406 ALA n 
1 407 GLN n 
1 408 PHE n 
1 409 GLY n 
1 410 SER n 
1 411 ASP n 
1 412 LEU n 
1 413 ASP n 
1 414 ALA n 
1 415 SER n 
1 416 THR n 
1 417 LYS n 
1 418 GLN n 
1 419 THR n 
1 420 LEU n 
1 421 VAL n 
1 422 ARG n 
1 423 GLY n 
1 424 GLU n 
1 425 ARG n 
1 426 LEU n 
1 427 THR n 
1 428 GLN n 
1 429 LEU n 
1 430 LEU n 
1 431 LYS n 
1 432 GLN n 
1 433 ASN n 
1 434 GLN n 
1 435 TYR n 
1 436 SER n 
1 437 PRO n 
1 438 LEU n 
1 439 ALA n 
1 440 THR n 
1 441 GLU n 
1 442 GLU n 
1 443 GLN n 
1 444 VAL n 
1 445 PRO n 
1 446 LEU n 
1 447 ILE n 
1 448 TYR n 
1 449 ALA n 
1 450 GLY n 
1 451 VAL n 
1 452 ASN n 
1 453 GLY n 
1 454 HIS n 
1 455 LEU n 
1 456 ASP n 
1 457 GLY n 
1 458 ILE n 
1 459 GLU n 
1 460 LEU n 
1 461 SER n 
1 462 ARG n 
1 463 ILE n 
1 464 GLY n 
1 465 GLU n 
1 466 PHE n 
1 467 GLU n 
1 468 SER n 
1 469 SER n 
1 470 PHE n 
1 471 LEU n 
1 472 SER n 
1 473 TYR n 
1 474 LEU n 
1 475 LYS n 
1 476 SER n 
1 477 ASN n 
1 478 HIS n 
1 479 ASN n 
1 480 GLU n 
1 481 LEU n 
1 482 LEU n 
1 483 THR n 
1 484 GLU n 
1 485 ILE n 
1 486 ARG n 
1 487 GLU n 
1 488 LYS n 
1 489 GLY n 
1 490 GLU n 
1 491 LEU n 
1 492 SER n 
1 493 LYS n 
1 494 GLU n 
1 495 LEU n 
1 496 LEU n 
1 497 ALA n 
1 498 SER n 
1 499 LEU n 
1 500 LYS n 
1 501 SER n 
1 502 ALA n 
1 503 THR n 
1 504 GLU n 
1 505 SER n 
1 506 PHE n 
1 507 VAL n 
1 508 ALA n 
1 509 THR n 
1 510 PHE n 
2 1   ALA n 
2 2   SER n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   ALA n 
2 10  ALA n 
2 11  GLN n 
2 12  SER n 
2 13  THR n 
2 14  PRO n 
2 15  ILE n 
2 16  THR n 
2 17  GLY n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  ALA n 
2 22  VAL n 
2 23  ILE n 
2 24  GLY n 
2 25  ALA n 
2 26  ILE n 
2 27  VAL n 
2 28  ASP n 
2 29  VAL n 
2 30  HIS n 
2 31  PHE n 
2 32  GLU n 
2 33  GLN n 
2 34  SER n 
2 35  GLU n 
2 36  LEU n 
2 37  PRO n 
2 38  ALA n 
2 39  ILE n 
2 40  LEU n 
2 41  ASN n 
2 42  ALA n 
2 43  LEU n 
2 44  GLU n 
2 45  ILE n 
2 46  LYS n 
2 47  THR n 
2 48  PRO n 
2 49  GLN n 
2 50  GLY n 
2 51  LYS n 
2 52  LEU n 
2 53  VAL n 
2 54  LEU n 
2 55  GLU n 
2 56  VAL n 
2 57  ALA n 
2 58  GLN n 
2 59  HIS n 
2 60  LEU n 
2 61  GLY n 
2 62  GLU n 
2 63  ASN n 
2 64  THR n 
2 65  VAL n 
2 66  ARG n 
2 67  THR n 
2 68  ILE n 
2 69  ALA n 
2 70  MET n 
2 71  ASP n 
2 72  GLY n 
2 73  THR n 
2 74  GLU n 
2 75  GLY n 
2 76  LEU n 
2 77  VAL n 
2 78  ARG n 
2 79  GLY n 
2 80  GLU n 
2 81  LYS n 
2 82  VAL n 
2 83  LEU n 
2 84  ASP n 
2 85  THR n 
2 86  GLY n 
2 87  GLY n 
2 88  PRO n 
2 89  ILE n 
2 90  SER n 
2 91  VAL n 
2 92  PRO n 
2 93  VAL n 
2 94  GLY n 
2 95  ARG n 
2 96  GLU n 
2 97  THR n 
2 98  LEU n 
2 99  GLY n 
2 100 ARG n 
2 101 ILE n 
2 102 ILE n 
2 103 ASN n 
2 104 VAL n 
2 105 ILE n 
2 106 GLY n 
2 107 GLU n 
2 108 PRO n 
2 109 ILE n 
2 110 ASP n 
2 111 GLU n 
2 112 ARG n 
2 113 GLY n 
2 114 PRO n 
2 115 ILE n 
2 116 LYS n 
2 117 SER n 
2 118 LYS n 
2 119 LEU n 
2 120 ARG n 
2 121 LYS n 
2 122 PRO n 
2 123 ILE n 
2 124 HIS n 
2 125 ALA n 
2 126 ASP n 
2 127 PRO n 
2 128 PRO n 
2 129 SER n 
2 130 PHE n 
2 131 ALA n 
2 132 GLU n 
2 133 GLN n 
2 134 SER n 
2 135 THR n 
2 136 SER n 
2 137 ALA n 
2 138 GLU n 
2 139 ILE n 
2 140 LEU n 
2 141 GLU n 
2 142 THR n 
2 143 GLY n 
2 144 ILE n 
2 145 LYS n 
2 146 VAL n 
2 147 VAL n 
2 148 ASP n 
2 149 LEU n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 TYR n 
2 154 ALA n 
2 155 ARG n 
2 156 GLY n 
2 157 GLY n 
2 158 LYS n 
2 159 ILE n 
2 160 GLY n 
2 161 LEU n 
2 162 PHE n 
2 163 GLY n 
2 164 GLY n 
2 165 ALA n 
2 166 GLY n 
2 167 VAL n 
2 168 GLY n 
2 169 LYS n 
2 170 THR n 
2 171 VAL n 
2 172 PHE n 
2 173 ILE n 
2 174 GLN n 
2 175 GLU n 
2 176 LEU n 
2 177 ILE n 
2 178 ASN n 
2 179 ASN n 
2 180 ILE n 
2 181 ALA n 
2 182 LYS n 
2 183 ALA n 
2 184 HIS n 
2 185 GLY n 
2 186 GLY n 
2 187 PHE n 
2 188 SER n 
2 189 VAL n 
2 190 PHE n 
2 191 THR n 
2 192 GLY n 
2 193 VAL n 
2 194 GLY n 
2 195 GLU n 
2 196 ARG n 
2 197 THR n 
2 198 ARG n 
2 199 GLU n 
2 200 GLY n 
2 201 ASN n 
2 202 ASP n 
2 203 LEU n 
2 204 TYR n 
2 205 ARG n 
2 206 GLU n 
2 207 MET n 
2 208 LYS n 
2 209 GLU n 
2 210 THR n 
2 211 GLY n 
2 212 VAL n 
2 213 ILE n 
2 214 ASN n 
2 215 LEU n 
2 216 GLU n 
2 217 GLY n 
2 218 GLU n 
2 219 SER n 
2 220 LYS n 
2 221 VAL n 
2 222 ALA n 
2 223 LEU n 
2 224 VAL n 
2 225 PHE n 
2 226 GLY n 
2 227 GLN n 
2 228 MET n 
2 229 ASN n 
2 230 GLU n 
2 231 PRO n 
2 232 PRO n 
2 233 GLY n 
2 234 ALA n 
2 235 ARG n 
2 236 ALA n 
2 237 ARG n 
2 238 VAL n 
2 239 ALA n 
2 240 LEU n 
2 241 THR n 
2 242 GLY n 
2 243 LEU n 
2 244 THR n 
2 245 ILE n 
2 246 ALA n 
2 247 GLU n 
2 248 TYR n 
2 249 PHE n 
2 250 ARG n 
2 251 ASP n 
2 252 GLU n 
2 253 GLU n 
2 254 GLY n 
2 255 GLN n 
2 256 ASP n 
2 257 VAL n 
2 258 LEU n 
2 259 LEU n 
2 260 PHE n 
2 261 ILE n 
2 262 ASP n 
2 263 ASN n 
2 264 ILE n 
2 265 PHE n 
2 266 ARG n 
2 267 PHE n 
2 268 THR n 
2 269 GLN n 
2 270 ALA n 
2 271 GLY n 
2 272 SER n 
2 273 GLU n 
2 274 VAL n 
2 275 SER n 
2 276 ALA n 
2 277 LEU n 
2 278 LEU n 
2 279 GLY n 
2 280 ARG n 
2 281 ILE n 
2 282 PRO n 
2 283 SER n 
2 284 ALA n 
2 285 VAL n 
2 286 GLY n 
2 287 TYR n 
2 288 GLN n 
2 289 PRO n 
2 290 THR n 
2 291 LEU n 
2 292 ALA n 
2 293 THR n 
2 294 ASP n 
2 295 MET n 
2 296 GLY n 
2 297 LEU n 
2 298 LEU n 
2 299 GLN n 
2 300 GLU n 
2 301 ARG n 
2 302 ILE n 
2 303 THR n 
2 304 THR n 
2 305 THR n 
2 306 LYS n 
2 307 LYS n 
2 308 GLY n 
2 309 SER n 
2 310 VAL n 
2 311 THR n 
2 312 SER n 
2 313 VAL n 
2 314 GLN n 
2 315 ALA n 
2 316 VAL n 
2 317 TYR n 
2 318 VAL n 
2 319 PRO n 
2 320 ALA n 
2 321 ASP n 
2 322 ASP n 
2 323 LEU n 
2 324 THR n 
2 325 ASP n 
2 326 PRO n 
2 327 ALA n 
2 328 PRO n 
2 329 ALA n 
2 330 THR n 
2 331 THR n 
2 332 PHE n 
2 333 ALA n 
2 334 HIS n 
2 335 LEU n 
2 336 ASP n 
2 337 ALA n 
2 338 THR n 
2 339 THR n 
2 340 VAL n 
2 341 LEU n 
2 342 SER n 
2 343 ARG n 
2 344 GLY n 
2 345 ILE n 
2 346 SER n 
2 347 GLU n 
2 348 LEU n 
2 349 GLY n 
2 350 ILE n 
2 351 TYR n 
2 352 PRO n 
2 353 ALA n 
2 354 VAL n 
2 355 ASP n 
2 356 PRO n 
2 357 LEU n 
2 358 ASP n 
2 359 SER n 
2 360 LYS n 
2 361 SER n 
2 362 ARG n 
2 363 LEU n 
2 364 LEU n 
2 365 ASP n 
2 366 ALA n 
2 367 ALA n 
2 368 VAL n 
2 369 VAL n 
2 370 GLY n 
2 371 GLN n 
2 372 GLU n 
2 373 HIS n 
2 374 TYR n 
2 375 ASP n 
2 376 VAL n 
2 377 ALA n 
2 378 SER n 
2 379 LYS n 
2 380 VAL n 
2 381 GLN n 
2 382 GLU n 
2 383 THR n 
2 384 LEU n 
2 385 GLN n 
2 386 THR n 
2 387 TYR n 
2 388 LYS n 
2 389 SER n 
2 390 LEU n 
2 391 GLN n 
2 392 ASP n 
2 393 ILE n 
2 394 ILE n 
2 395 ALA n 
2 396 ILE n 
2 397 LEU n 
2 398 GLY n 
2 399 MET n 
2 400 ASP n 
2 401 GLU n 
2 402 LEU n 
2 403 SER n 
2 404 GLU n 
2 405 GLN n 
2 406 ASP n 
2 407 LYS n 
2 408 LEU n 
2 409 THR n 
2 410 VAL n 
2 411 GLU n 
2 412 ARG n 
2 413 ALA n 
2 414 ARG n 
2 415 LYS n 
2 416 ILE n 
2 417 GLN n 
2 418 ARG n 
2 419 PHE n 
2 420 LEU n 
2 421 SER n 
2 422 GLN n 
2 423 PRO n 
2 424 PHE n 
2 425 ALA n 
2 426 VAL n 
2 427 ALA n 
2 428 GLU n 
2 429 VAL n 
2 430 PHE n 
2 431 THR n 
2 432 GLY n 
2 433 ILE n 
2 434 PRO n 
2 435 GLY n 
2 436 LYS n 
2 437 LEU n 
2 438 VAL n 
2 439 ARG n 
2 440 LEU n 
2 441 LYS n 
2 442 ASP n 
2 443 THR n 
2 444 VAL n 
2 445 ALA n 
2 446 SER n 
2 447 PHE n 
2 448 LYS n 
2 449 ALA n 
2 450 VAL n 
2 451 LEU n 
2 452 GLU n 
2 453 GLY n 
2 454 LYS n 
2 455 TYR n 
2 456 ASP n 
2 457 ASN n 
2 458 ILE n 
2 459 PRO n 
2 460 GLU n 
2 461 HIS n 
2 462 ALA n 
2 463 PHE n 
2 464 TYR n 
2 465 MET n 
2 466 VAL n 
2 467 GLY n 
2 468 GLY n 
2 469 ILE n 
2 470 GLU n 
2 471 ASP n 
2 472 VAL n 
2 473 VAL n 
2 474 ALA n 
2 475 LYS n 
2 476 ALA n 
2 477 GLU n 
2 478 LYS n 
2 479 LEU n 
2 480 ALA n 
2 481 ALA n 
2 482 GLU n 
2 483 ALA n 
2 484 ASN n 
3 1   ALA n 
3 2   THR n 
3 3   LEU n 
3 4   LYS n 
3 5   GLU n 
3 6   VAL n 
3 7   GLU n 
3 8   MET n 
3 9   ARG n 
3 10  LEU n 
3 11  LYS n 
3 12  SER n 
3 13  ILE n 
3 14  LYS n 
3 15  ASN n 
3 16  ILE n 
3 17  GLU n 
3 18  LYS n 
3 19  ILE n 
3 20  THR n 
3 21  LYS n 
3 22  THR n 
3 23  MET n 
3 24  LYS n 
3 25  ILE n 
3 26  VAL n 
3 27  ALA n 
3 28  SER n 
3 29  THR n 
3 30  ARG n 
3 31  LEU n 
3 32  SER n 
3 33  LYS n 
3 34  ALA n 
3 35  GLU n 
3 36  LYS n 
3 37  ALA n 
3 38  LYS n 
3 39  ILE n 
3 40  SER n 
3 41  ALA n 
3 42  LYS n 
3 43  LYS n 
3 44  MET n 
3 45  ASP n 
3 46  GLU n 
3 47  ALA n 
3 48  GLU n 
3 49  GLN n 
3 50  LEU n 
3 51  PHE n 
3 52  TYR n 
3 53  LYS n 
3 54  ASN n 
3 55  ALA n 
3 56  GLU n 
3 57  THR n 
3 58  LYS n 
3 59  ASN n 
3 60  LEU n 
3 61  ASP n 
3 62  VAL n 
3 63  GLU n 
3 64  ALA n 
3 65  THR n 
3 66  GLU n 
3 67  THR n 
3 68  GLY n 
3 69  ALA n 
3 70  PRO n 
3 71  LYS n 
3 72  GLU n 
3 73  LEU n 
3 74  ILE n 
3 75  VAL n 
3 76  ALA n 
3 77  ILE n 
3 78  THR n 
3 79  SER n 
3 80  ASP n 
3 81  LYS n 
3 82  GLY n 
3 83  LEU n 
3 84  CYS n 
3 85  GLY n 
3 86  SER n 
3 87  ILE n 
3 88  HIS n 
3 89  SER n 
3 90  GLN n 
3 91  LEU n 
3 92  ALA n 
3 93  LYS n 
3 94  ALA n 
3 95  VAL n 
3 96  ARG n 
3 97  ARG n 
3 98  HIS n 
3 99  LEU n 
3 100 ASN n 
3 101 ASP n 
3 102 GLN n 
3 103 PRO n 
3 104 ASN n 
3 105 ALA n 
3 106 ASP n 
3 107 ILE n 
3 108 VAL n 
3 109 THR n 
3 110 ILE n 
3 111 GLY n 
3 112 ASP n 
3 113 LYS n 
3 114 ILE n 
3 115 LYS n 
3 116 MET n 
3 117 GLN n 
3 118 LEU n 
3 119 LEU n 
3 120 ARG n 
3 121 THR n 
3 122 HIS n 
3 123 PRO n 
3 124 ASN n 
3 125 ASN n 
3 126 ILE n 
3 127 LYS n 
3 128 LEU n 
3 129 SER n 
3 130 ILE n 
3 131 ASN n 
3 132 GLY n 
3 133 ILE n 
3 134 GLY n 
3 135 LYS n 
3 136 ASP n 
3 137 ALA n 
3 138 PRO n 
3 139 THR n 
3 140 PHE n 
3 141 GLN n 
3 142 GLU n 
3 143 SER n 
3 144 ALA n 
3 145 LEU n 
3 146 ILE n 
3 147 ALA n 
3 148 ASP n 
3 149 LYS n 
3 150 LEU n 
3 151 LEU n 
3 152 SER n 
3 153 VAL n 
3 154 MET n 
3 155 LYS n 
3 156 ALA n 
3 157 GLY n 
3 158 THR n 
3 159 TYR n 
3 160 PRO n 
3 161 LYS n 
3 162 ILE n 
3 163 SER n 
3 164 ILE n 
3 165 PHE n 
3 166 TYR n 
3 167 ASN n 
3 168 ASP n 
3 169 PRO n 
3 170 VAL n 
3 171 SER n 
3 172 SER n 
3 173 LEU n 
3 174 SER n 
3 175 PHE n 
3 176 GLU n 
3 177 PRO n 
3 178 SER n 
3 179 GLU n 
3 180 LYS n 
3 181 PRO n 
3 182 ILE n 
3 183 PHE n 
3 184 ASN n 
3 185 ALA n 
3 186 LYS n 
3 187 THR n 
3 188 ILE n 
3 189 GLU n 
3 190 GLN n 
3 191 SER n 
3 192 PRO n 
3 193 SER n 
3 194 PHE n 
3 195 GLY n 
3 196 LYS n 
3 197 PHE n 
3 198 GLU n 
3 199 ILE n 
3 200 ASP n 
3 201 THR n 
3 202 ASP n 
3 203 ALA n 
3 204 ASN n 
3 205 VAL n 
3 206 PRO n 
3 207 ARG n 
3 208 ASP n 
3 209 LEU n 
3 210 PHE n 
3 211 GLU n 
3 212 TYR n 
3 213 THR n 
3 214 LEU n 
3 215 ALA n 
3 216 ASN n 
3 217 GLN n 
3 218 MET n 
3 219 LEU n 
3 220 THR n 
3 221 ALA n 
3 222 MET n 
3 223 ALA n 
3 224 GLN n 
3 225 GLY n 
3 226 TYR n 
3 227 ALA n 
3 228 ALA n 
3 229 GLU n 
3 230 ILE n 
3 231 SER n 
3 232 ALA n 
3 233 ARG n 
3 234 ARG n 
3 235 ASN n 
3 236 ALA n 
3 237 MET n 
3 238 ASP n 
3 239 ASN n 
3 240 ALA n 
3 241 SER n 
3 242 LYS n 
3 243 ASN n 
3 244 ALA n 
3 245 GLY n 
3 246 ASP n 
3 247 MET n 
3 248 ILE n 
3 249 ASN n 
3 250 ARG n 
3 251 TYR n 
3 252 SER n 
3 253 ILE n 
3 254 LEU n 
3 255 TYR n 
3 256 ASN n 
3 257 ARG n 
3 258 THR n 
3 259 ARG n 
3 260 GLN n 
3 261 ALA n 
3 262 VAL n 
3 263 ILE n 
3 264 THR n 
3 265 ASN n 
3 266 GLU n 
3 267 LEU n 
3 268 VAL n 
3 269 ASP n 
3 270 ILE n 
3 271 ILE n 
3 272 THR n 
3 273 GLY n 
3 274 ALA n 
3 275 SER n 
3 276 SER n 
3 277 LEU n 
3 278 GLY n 
4 1   ALA n 
4 2   GLU n 
4 3   ALA n 
4 4   ALA n 
4 5   ALA n 
4 6   ALA n 
4 7   SER n 
4 8   SER n 
4 9   GLY n 
4 10  LEU n 
4 11  LYS n 
4 12  LEU n 
4 13  GLN n 
4 14  PHE n 
4 15  ALA n 
4 16  LEU n 
4 17  PRO n 
4 18  HIS n 
4 19  GLU n 
4 20  THR n 
4 21  LEU n 
4 22  TYR n 
4 23  SER n 
4 24  GLY n 
4 25  SER n 
4 26  GLU n 
4 27  VAL n 
4 28  THR n 
4 29  GLN n 
4 30  VAL n 
4 31  ASN n 
4 32  LEU n 
4 33  PRO n 
4 34  ALA n 
4 35  LYS n 
4 36  SER n 
4 37  GLY n 
4 38  ARG n 
4 39  ILE n 
4 40  GLY n 
4 41  VAL n 
4 42  LEU n 
4 43  ALA n 
4 44  ASN n 
4 45  HIS n 
4 46  VAL n 
4 47  PRO n 
4 48  THR n 
4 49  VAL n 
4 50  GLU n 
4 51  GLN n 
4 52  LEU n 
4 53  LEU n 
4 54  PRO n 
4 55  GLY n 
4 56  VAL n 
4 57  VAL n 
4 58  GLU n 
4 59  VAL n 
4 60  MET n 
4 61  GLU n 
4 62  GLY n 
4 63  SER n 
4 64  ASN n 
4 65  SER n 
4 66  LYS n 
4 67  LYS n 
4 68  PHE n 
4 69  PHE n 
4 70  ILE n 
4 71  SER n 
4 72  GLY n 
4 73  GLY n 
4 74  PHE n 
4 75  ALA n 
4 76  THR n 
4 77  VAL n 
4 78  GLN n 
4 79  PRO n 
4 80  ASP n 
4 81  SER n 
4 82  GLN n 
4 83  LEU n 
4 84  CYS n 
4 85  VAL n 
4 86  THR n 
4 87  ALA n 
4 88  ILE n 
4 89  GLU n 
4 90  ALA n 
4 91  PHE n 
4 92  PRO n 
4 93  LEU n 
4 94  GLU n 
4 95  SER n 
4 96  PHE n 
4 97  SER n 
4 98  GLN n 
4 99  GLU n 
4 100 ASN n 
4 101 ILE n 
4 102 LYS n 
4 103 ASN n 
4 104 LEU n 
4 105 LEU n 
4 106 ALA n 
4 107 GLU n 
4 108 ALA n 
4 109 LYS n 
4 110 LYS n 
4 111 ASN n 
4 112 VAL n 
4 113 SER n 
4 114 SER n 
4 115 SER n 
4 116 ASP n 
4 117 ALA n 
4 118 ARG n 
4 119 GLU n 
4 120 ALA n 
4 121 ALA n 
4 122 GLU n 
4 123 ALA n 
4 124 ALA n 
4 125 ILE n 
4 126 GLN n 
4 127 VAL n 
4 128 GLU n 
4 129 VAL n 
4 130 LEU n 
4 131 GLU n 
4 132 ASN n 
4 133 LEU n 
4 134 GLN n 
4 135 SER n 
4 136 VAL n 
4 137 LEU n 
4 138 LYS n 
5 1   SER n 
5 2   ALA n 
5 3   TRP n 
5 4   ARG n 
5 5   LYS n 
5 6   ALA n 
5 7   GLY n 
5 8   ILE n 
5 9   SER n 
5 10  TYR n 
5 11  ALA n 
5 12  ALA n 
5 13  TYR n 
5 14  LEU n 
5 15  ASN n 
5 16  VAL n 
5 17  ALA n 
5 18  ALA n 
5 19  GLN n 
5 20  ALA n 
5 21  ILE n 
5 22  ARG n 
5 23  SER n 
5 24  SER n 
5 25  LEU n 
5 26  LYS n 
5 27  THR n 
5 28  GLU n 
5 29  LEU n 
5 30  GLN n 
5 31  THR n 
5 32  ALA n 
5 33  SER n 
5 34  VAL n 
5 35  LEU n 
5 36  ASN n 
5 37  ARG n 
5 38  SER n 
5 39  GLN n 
5 40  THR n 
5 41  ASP n 
5 42  ALA n 
5 43  PHE n 
5 44  TYR n 
5 45  THR n 
5 46  GLN n 
5 47  TYR n 
5 48  LYS n 
5 49  ASN n 
5 50  GLY n 
5 51  THR n 
5 52  ALA n 
5 53  ALA n 
5 54  SER n 
5 55  GLU n 
5 56  PRO n 
5 57  THR n 
5 58  PRO n 
5 59  ILE n 
5 60  THR n 
5 61  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP1, YBL099W, YBL0827'               ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP2, YJR121W, J2041'                 ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP3, ATP3a, ATP3b, YBR039W, YBR0408' ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP16, YDL004W, YD8119.03, D2935'     ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP15, YPL271W, P0345'                ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ATPA_YEAST  P07251 1 
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
36 ? 
2 UNP ATPB_YEAST  P00830 2 
;AAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGP
ISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVG
KTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEY
FRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAP
ATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKL
TVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN
;
36 ? 
3 UNP ATPG_YEAST  P38077 3 
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
34 ? 
4 UNP ATPD_YEAST  Q12165 4 
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
23 ? 
5 UNP ATP5E_YEAST P21306 5 SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 2  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3OEE A 1 ? 510 ? P07251 36 ? 545 ? 1 510 
2  1 3OEE B 1 ? 510 ? P07251 36 ? 545 ? 1 510 
3  1 3OEE C 1 ? 510 ? P07251 36 ? 545 ? 1 510 
4  2 3OEE D 9 ? 484 ? P00830 36 ? 511 ? 3 478 
5  2 3OEE E 9 ? 484 ? P00830 36 ? 511 ? 3 478 
6  2 3OEE F 9 ? 484 ? P00830 36 ? 511 ? 3 478 
7  3 3OEE G 1 ? 278 ? P38077 34 ? 311 ? 1 278 
8  4 3OEE H 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
9  5 3OEE I 1 ? 61  ? P21306 2  ? 62  ? 1 61  
10 1 3OEE J 1 ? 510 ? P07251 36 ? 545 ? 1 510 
11 1 3OEE K 1 ? 510 ? P07251 36 ? 545 ? 1 510 
12 1 3OEE L 1 ? 510 ? P07251 36 ? 545 ? 1 510 
13 2 3OEE M 9 ? 484 ? P00830 36 ? 511 ? 3 478 
14 2 3OEE N 9 ? 484 ? P00830 36 ? 511 ? 3 478 
15 2 3OEE O 9 ? 484 ? P00830 36 ? 511 ? 3 478 
16 3 3OEE P 1 ? 278 ? P38077 34 ? 311 ? 1 278 
17 4 3OEE Q 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
18 5 3OEE R 1 ? 61  ? P21306 2  ? 62  ? 1 61  
19 1 3OEE S 1 ? 510 ? P07251 36 ? 545 ? 1 510 
20 1 3OEE T 1 ? 510 ? P07251 36 ? 545 ? 1 510 
21 1 3OEE U 1 ? 510 ? P07251 36 ? 545 ? 1 510 
22 2 3OEE V 9 ? 484 ? P00830 36 ? 511 ? 3 478 
23 2 3OEE W 9 ? 484 ? P00830 36 ? 511 ? 3 478 
24 2 3OEE X 9 ? 484 ? P00830 36 ? 511 ? 3 478 
25 3 3OEE Y 1 ? 278 ? P38077 34 ? 311 ? 1 278 
26 4 3OEE Z 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
27 5 3OEE 1 1 ? 61  ? P21306 2  ? 62  ? 1 61  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3OEE SER A 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 1  
2  3OEE SER B 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 2  
3  3OEE SER C 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 3  
4  3OEE ALA D 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  4  
4  3OEE SER D 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  5  
4  3OEE HIS D 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  6  
4  3OEE HIS D 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  7  
4  3OEE HIS D 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  8  
4  3OEE HIS D 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   9  
4  3OEE HIS D 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   10 
4  3OEE HIS D 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   11 
5  3OEE ALA E 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  12 
5  3OEE SER E 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  13 
5  3OEE HIS E 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  14 
5  3OEE HIS E 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  15 
5  3OEE HIS E 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  16 
5  3OEE HIS E 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   17 
5  3OEE HIS E 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   18 
5  3OEE HIS E 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   19 
6  3OEE ALA F 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  20 
6  3OEE SER F 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  21 
6  3OEE HIS F 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  22 
6  3OEE HIS F 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  23 
6  3OEE HIS F 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  24 
6  3OEE HIS F 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   25 
6  3OEE HIS F 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   26 
6  3OEE HIS F 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   27 
10 3OEE SER J 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 28 
11 3OEE SER K 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 29 
12 3OEE SER L 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 30 
13 3OEE ALA M 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  31 
13 3OEE SER M 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  32 
13 3OEE HIS M 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  33 
13 3OEE HIS M 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  34 
13 3OEE HIS M 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  35 
13 3OEE HIS M 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   36 
13 3OEE HIS M 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   37 
13 3OEE HIS M 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   38 
14 3OEE ALA N 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  39 
14 3OEE SER N 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  40 
14 3OEE HIS N 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  41 
14 3OEE HIS N 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  42 
14 3OEE HIS N 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  43 
14 3OEE HIS N 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   44 
14 3OEE HIS N 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   45 
14 3OEE HIS N 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   46 
15 3OEE ALA O 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  47 
15 3OEE SER O 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  48 
15 3OEE HIS O 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  49 
15 3OEE HIS O 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  50 
15 3OEE HIS O 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  51 
15 3OEE HIS O 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   52 
15 3OEE HIS O 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   53 
15 3OEE HIS O 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   54 
19 3OEE SER S 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 55 
20 3OEE SER T 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 56 
21 3OEE SER U 405 ? UNP P07251 PHE 440 'ENGINEERED MUTATION' 405 57 
22 3OEE ALA V 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  58 
22 3OEE SER V 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  59 
22 3OEE HIS V 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  60 
22 3OEE HIS V 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  61 
22 3OEE HIS V 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  62 
22 3OEE HIS V 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   63 
22 3OEE HIS V 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   64 
22 3OEE HIS V 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   65 
23 3OEE ALA W 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  66 
23 3OEE SER W 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  67 
23 3OEE HIS W 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  68 
23 3OEE HIS W 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  69 
23 3OEE HIS W 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  70 
23 3OEE HIS W 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   71 
23 3OEE HIS W 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   72 
23 3OEE HIS W 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   73 
24 3OEE ALA X 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  74 
24 3OEE SER X 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  75 
24 3OEE HIS X 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  76 
24 3OEE HIS X 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  77 
24 3OEE HIS X 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  78 
24 3OEE HIS X 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   79 
24 3OEE HIS X 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   80 
24 3OEE HIS X 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   81 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                               ? 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OEE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-06-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_wavelength             0.97931 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3OEE 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.740 
_reflns.number_obs                   289154 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06900 
_reflns.pdbx_netI_over_sigmaI        11.3000 
_reflns.B_iso_Wilson_estimate        73.00 
_reflns.pdbx_redundancy              2.500 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.74 
_reflns_shell.d_res_low              2.84 
_reflns_shell.percent_possible_all   97.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.71800 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3OEE 
_refine.ls_number_reflns_obs                     289050 
_refine.ls_number_reflns_all                     289050 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.74 
_refine.ls_percent_reflns_obs                    98.63 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  5965 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.920 
_refine.B_iso_mean                               89.90 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MSAK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2HLD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.359 
_refine.overall_SU_ML                            0.323 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3OEE 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.359 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        72101 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         490 
_refine_hist.number_atoms_solvent             84 
_refine_hist.number_atoms_total               72675 
_refine_hist.d_res_high                       2.74 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.260 ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.74 
_refine_ls_shell.d_res_low                        2.81 
_refine_ls_shell.number_reflns_R_work             21128 
_refine_ls_shell.R_factor_R_work                  0.3070 
_refine_ls_shell.percent_reflns_obs               99.37 
_refine_ls_shell.R_factor_R_free                  0.3310 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             465 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3OEE 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3OEE 
_struct.title                     'Structure of four mutant forms of yeast F1 ATPase: alpha-F405S' 
_struct.pdbx_descriptor           
;ATP synthase subunit alpha (E.C.3.6.3.14), ATP synthase subunit beta (E.C.3.6.3.14), ATP synthase subunit gamma (E.C.3.6.3.14), ATP synthase subunit delta (E.C.3.6.3.14), ATP synthase subunit epsilon (E.C.3.6.3.14)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OEE 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ATP SYNTHASE, ATP PHOSPHATASE, F1F0 ATPASE, ATP SYNTHESIS, HYDROLASE, ADP, PO4, MITOCHONDRIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 6 ? 
CA N N 7 ? 
DA N N 6 ? 
EA N N 7 ? 
FA N N 6 ? 
GA N N 7 ? 
HA N N 6 ? 
IA N N 7 ? 
JA N N 8 ? 
KA N N 6 ? 
LA N N 7 ? 
MA N N 6 ? 
NA N N 7 ? 
OA N N 6 ? 
PA N N 7 ? 
QA N N 6 ? 
RA N N 7 ? 
SA N N 6 ? 
TA N N 7 ? 
UA N N 8 ? 
VA N N 6 ? 
WA N N 7 ? 
XA N N 6 ? 
YA N N 7 ? 
ZA N N 6 ? 
AB N N 7 ? 
BB N N 6 ? 
CB N N 7 ? 
DB N N 6 ? 
EB N N 7 ? 
FB N N 6 ? 
GB N N 7 ? 
HB N N 9 ? 
IB N N 9 ? 
JB N N 9 ? 
KB N N 9 ? 
LB N N 9 ? 
MB N N 9 ? 
NB N N 9 ? 
OB N N 9 ? 
PB N N 9 ? 
QB N N 9 ? 
RB N N 9 ? 
SB N N 9 ? 
TB N N 9 ? 
UB N N 9 ? 
VB N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A  102 ? LEU A  106 ? GLY A 102 LEU A 106 5 ? 5  
HELX_P HELX_P2   2   LEU A  152 ? VAL A  159 ? LEU A 152 VAL A 159 1 ? 8  
HELX_P HELX_P3   3   GLY A  176 ? GLN A  188 ? GLY A 176 GLN A 188 1 ? 13 
HELX_P HELX_P4   4   GLN A  188 ? ASN A  193 ? GLN A 188 ASN A 193 1 ? 6  
HELX_P HELX_P5   5   LYS A  211 ? HIS A  225 ? LYS A 211 HIS A 225 1 ? 15 
HELX_P HELX_P6   6   ALA A  227 ? LYS A  229 ? ALA A 227 LYS A 229 5 ? 3  
HELX_P HELX_P7   7   ALA A  241 ? ASN A  262 ? ALA A 241 ASN A 262 1 ? 22 
HELX_P HELX_P8   8   ASP A  272 ? LEU A  287 ? ASP A 272 LEU A 287 1 ? 16 
HELX_P HELX_P9   9   GLY A  292 ? TYR A  296 ? GLY A 292 TYR A 296 5 ? 5  
HELX_P HELX_P10  10  ASP A  299 ? GLU A  309 ? ASP A 299 GLU A 309 1 ? 11 
HELX_P HELX_P11  11  ALA A  338 ? THR A  348 ? ALA A 338 THR A 348 1 ? 11 
HELX_P HELX_P12  12  GLU A  355 ? LYS A  361 ? GLU A 355 LYS A 361 1 ? 7  
HELX_P HELX_P13  13  ASN A  368 ? SER A  372 ? ASN A 368 SER A 372 5 ? 5  
HELX_P HELX_P14  14  VAL A  376 ? GLN A  381 ? VAL A 376 GLN A 381 5 ? 6  
HELX_P HELX_P15  15  VAL A  382 ? GLY A  390 ? VAL A 382 GLY A 390 1 ? 9  
HELX_P HELX_P16  16  SER A  391 ? ALA A  403 ? SER A 391 ALA A 403 1 ? 13 
HELX_P HELX_P17  17  ALA A  404 ? ALA A  406 ? ALA A 404 ALA A 406 5 ? 3  
HELX_P HELX_P18  18  ASP A  413 ? LYS A  431 ? ASP A 413 LYS A 431 1 ? 19 
HELX_P HELX_P19  19  ALA A  439 ? ASN A  452 ? ALA A 439 ASN A 452 1 ? 14 
HELX_P HELX_P20  20  GLU A  459 ? SER A  461 ? GLU A 459 SER A 461 5 ? 3  
HELX_P HELX_P21  21  ARG A  462 ? HIS A  478 ? ARG A 462 HIS A 478 1 ? 17 
HELX_P HELX_P22  22  HIS A  478 ? GLY A  489 ? HIS A 478 GLY A 489 1 ? 12 
HELX_P HELX_P23  23  SER A  492 ? THR A  509 ? SER A 492 THR A 509 1 ? 18 
HELX_P HELX_P24  24  SER B  80  ? VAL B  84  ? SER B 80  VAL B 84  5 ? 5  
HELX_P HELX_P25  25  GLY B  102 ? LEU B  106 ? GLY B 102 LEU B 106 5 ? 5  
HELX_P HELX_P26  26  LEU B  152 ? VAL B  159 ? LEU B 152 VAL B 159 1 ? 8  
HELX_P HELX_P27  27  GLY B  176 ? GLN B  188 ? GLY B 176 GLN B 188 1 ? 13 
HELX_P HELX_P28  28  LYS B  189 ? TRP B  191 ? LYS B 189 TRP B 191 5 ? 3  
HELX_P HELX_P29  29  LYS B  211 ? HIS B  225 ? LYS B 211 HIS B 225 1 ? 15 
HELX_P HELX_P30  30  ALA B  227 ? LYS B  229 ? ALA B 227 LYS B 229 5 ? 3  
HELX_P HELX_P31  31  ALA B  241 ? ASN B  262 ? ALA B 241 ASN B 262 1 ? 22 
HELX_P HELX_P32  32  ASP B  272 ? LEU B  287 ? ASP B 272 LEU B 287 1 ? 16 
HELX_P HELX_P33  33  GLY B  292 ? TYR B  296 ? GLY B 292 TYR B 296 5 ? 5  
HELX_P HELX_P34  34  PRO B  297 ? GLY B  298 ? PRO B 297 GLY B 298 5 ? 2  
HELX_P HELX_P35  35  ASP B  299 ? ARG B  310 ? ASP B 299 ARG B 310 1 ? 12 
HELX_P HELX_P36  36  ALA B  338 ? SER B  346 ? ALA B 338 SER B 346 1 ? 9  
HELX_P HELX_P37  37  GLU B  355 ? GLY B  362 ? GLU B 355 GLY B 362 1 ? 8  
HELX_P HELX_P38  38  VAL B  376 ? GLN B  381 ? VAL B 376 GLN B 381 1 ? 6  
HELX_P HELX_P39  39  VAL B  382 ? ALA B  389 ? VAL B 382 ALA B 389 1 ? 8  
HELX_P HELX_P40  40  SER B  391 ? GLN B  407 ? SER B 391 GLN B 407 1 ? 17 
HELX_P HELX_P41  41  ALA B  414 ? LYS B  431 ? ALA B 414 LYS B 431 1 ? 18 
HELX_P HELX_P42  42  ALA B  439 ? ASN B  452 ? ALA B 439 ASN B 452 1 ? 14 
HELX_P HELX_P43  43  GLU B  459 ? HIS B  478 ? GLU B 459 HIS B 478 1 ? 20 
HELX_P HELX_P44  44  HIS B  478 ? GLY B  489 ? HIS B 478 GLY B 489 1 ? 12 
HELX_P HELX_P45  45  SER B  492 ? ALA B  508 ? SER B 492 ALA B 508 1 ? 17 
HELX_P HELX_P46  46  GLY C  102 ? LEU C  106 ? GLY C 102 LEU C 106 5 ? 5  
HELX_P HELX_P47  47  LEU C  152 ? VAL C  159 ? LEU C 152 VAL C 159 1 ? 8  
HELX_P HELX_P48  48  GLY C  176 ? GLN C  188 ? GLY C 176 GLN C 188 1 ? 13 
HELX_P HELX_P49  49  GLN C  188 ? ASN C  193 ? GLN C 188 ASN C 193 1 ? 6  
HELX_P HELX_P50  50  LYS C  211 ? HIS C  225 ? LYS C 211 HIS C 225 1 ? 15 
HELX_P HELX_P51  51  ALA C  227 ? LYS C  229 ? ALA C 227 LYS C 229 5 ? 3  
HELX_P HELX_P52  52  ALA C  241 ? ASN C  262 ? ALA C 241 ASN C 262 1 ? 22 
HELX_P HELX_P53  53  ASP C  272 ? LEU C  287 ? ASP C 272 LEU C 287 1 ? 16 
HELX_P HELX_P54  54  GLY C  292 ? TYR C  296 ? GLY C 292 TYR C 296 5 ? 5  
HELX_P HELX_P55  55  ASP C  299 ? ARG C  310 ? ASP C 299 ARG C 310 1 ? 12 
HELX_P HELX_P56  56  SER C  315 ? GLY C  319 ? SER C 315 GLY C 319 5 ? 5  
HELX_P HELX_P57  57  ALA C  338 ? SER C  346 ? ALA C 338 SER C 346 1 ? 9  
HELX_P HELX_P58  58  GLU C  355 ? GLY C  362 ? GLU C 355 GLY C 362 1 ? 8  
HELX_P HELX_P59  59  VAL C  376 ? GLN C  381 ? VAL C 376 GLN C 381 5 ? 6  
HELX_P HELX_P60  60  VAL C  382 ? ALA C  389 ? VAL C 382 ALA C 389 1 ? 8  
HELX_P HELX_P61  61  SER C  391 ? ALA C  406 ? SER C 391 ALA C 406 1 ? 16 
HELX_P HELX_P62  62  ASP C  413 ? LYS C  431 ? ASP C 413 LYS C 431 1 ? 19 
HELX_P HELX_P63  63  ALA C  439 ? GLY C  453 ? ALA C 439 GLY C 453 1 ? 15 
HELX_P HELX_P64  64  GLU C  459 ? SER C  461 ? GLU C 459 SER C 461 5 ? 3  
HELX_P HELX_P65  65  ARG C  462 ? ASN C  477 ? ARG C 462 ASN C 477 1 ? 16 
HELX_P HELX_P66  66  HIS C  478 ? GLY C  489 ? HIS C 478 GLY C 489 1 ? 12 
HELX_P HELX_P67  67  SER C  492 ? VAL C  507 ? SER C 492 VAL C 507 1 ? 16 
HELX_P HELX_P68  68  GLY D  94  ? LEU D  98  ? GLY D 88  LEU D 92  5 ? 5  
HELX_P HELX_P69  69  SER D  129 ? GLN D  133 ? SER D 123 GLN D 127 5 ? 5  
HELX_P HELX_P70  70  ILE D  144 ? ALA D  151 ? ILE D 138 ALA D 145 1 ? 8  
HELX_P HELX_P71  71  GLY D  168 ? ALA D  181 ? GLY D 162 ALA D 175 1 ? 14 
HELX_P HELX_P72  72  ARG D  196 ? GLY D  211 ? ARG D 190 GLY D 205 1 ? 16 
HELX_P HELX_P73  73  PRO D  231 ? GLU D  253 ? PRO D 225 GLU D 247 1 ? 23 
HELX_P HELX_P74  74  ILE D  264 ? ALA D  276 ? ILE D 258 ALA D 270 1 ? 13 
HELX_P HELX_P75  75  SER D  283 ? TYR D  287 ? SER D 277 TYR D 281 5 ? 5  
HELX_P HELX_P76  76  THR D  290 ? GLU D  300 ? THR D 284 GLU D 294 1 ? 11 
HELX_P HELX_P77  77  PRO D  319 ? ASP D  322 ? PRO D 313 ASP D 316 5 ? 4  
HELX_P HELX_P78  78  ASP D  325 ? PHE D  332 ? ASP D 319 PHE D 326 1 ? 8  
HELX_P HELX_P79  79  ALA D  333 ? LEU D  335 ? ALA D 327 LEU D 329 5 ? 3  
HELX_P HELX_P80  80  SER D  342 ? LEU D  348 ? SER D 336 LEU D 342 1 ? 7  
HELX_P HELX_P81  81  ASP D  365 ? GLY D  370 ? ASP D 359 GLY D 364 1 ? 6  
HELX_P HELX_P82  82  GLY D  370 ? GLN D  391 ? GLY D 364 GLN D 385 1 ? 22 
HELX_P HELX_P83  83  ASP D  392 ? ILE D  396 ? ASP D 386 ILE D 390 5 ? 5  
HELX_P HELX_P84  84  SER D  403 ? LEU D  420 ? SER D 397 LEU D 414 1 ? 18 
HELX_P HELX_P85  85  ALA D  427 ? GLY D  432 ? ALA D 421 GLY D 426 1 ? 6  
HELX_P HELX_P86  86  ARG D  439 ? GLY D  453 ? ARG D 433 GLY D 447 1 ? 15 
HELX_P HELX_P87  87  PRO D  459 ? PHE D  463 ? PRO D 453 PHE D 457 5 ? 5  
HELX_P HELX_P88  88  GLY D  468 ? ALA D  481 ? GLY D 462 ALA D 475 1 ? 14 
HELX_P HELX_P89  89  GLY E  94  ? LEU E  98  ? GLY E 88  LEU E 92  5 ? 5  
HELX_P HELX_P90  90  SER E  129 ? GLN E  133 ? SER E 123 GLN E 127 5 ? 5  
HELX_P HELX_P91  91  ILE E  144 ? ALA E  151 ? ILE E 138 ALA E 145 1 ? 8  
HELX_P HELX_P92  92  GLY E  168 ? GLY E  185 ? GLY E 162 GLY E 179 1 ? 18 
HELX_P HELX_P93  93  ARG E  196 ? GLY E  211 ? ARG E 190 GLY E 205 1 ? 16 
HELX_P HELX_P94  94  PRO E  231 ? GLU E  252 ? PRO E 225 GLU E 246 1 ? 22 
HELX_P HELX_P95  95  ILE E  264 ? LEU E  278 ? ILE E 258 LEU E 272 1 ? 15 
HELX_P HELX_P96  96  SER E  283 ? TYR E  287 ? SER E 277 TYR E 281 5 ? 5  
HELX_P HELX_P97  97  THR E  290 ? GLU E  300 ? THR E 284 GLU E 294 1 ? 11 
HELX_P HELX_P98  98  VAL E  318 ? ASP E  322 ? VAL E 312 ASP E 316 5 ? 5  
HELX_P HELX_P99  99  ASP E  325 ? ALA E  333 ? ASP E 319 ALA E 327 1 ? 9  
HELX_P HELX_P100 100 SER E  342 ? GLU E  347 ? SER E 336 GLU E 341 1 ? 6  
HELX_P HELX_P101 101 ASP E  365 ? GLY E  370 ? ASP E 359 GLY E 364 1 ? 6  
HELX_P HELX_P102 102 GLY E  370 ? LEU E  390 ? GLY E 364 LEU E 384 1 ? 21 
HELX_P HELX_P103 103 LEU E  390 ? ALA E  395 ? LEU E 384 ALA E 389 1 ? 6  
HELX_P HELX_P104 104 SER E  403 ? LEU E  420 ? SER E 397 LEU E 414 1 ? 18 
HELX_P HELX_P105 105 ALA E  427 ? GLY E  432 ? ALA E 421 GLY E 426 1 ? 6  
HELX_P HELX_P106 106 ARG E  439 ? GLU E  452 ? ARG E 433 GLU E 446 1 ? 14 
HELX_P HELX_P107 107 PRO E  459 ? TYR E  464 ? PRO E 453 TYR E 458 5 ? 6  
HELX_P HELX_P108 108 GLY E  468 ? ALA E  480 ? GLY E 462 ALA E 474 1 ? 13 
HELX_P HELX_P109 109 GLY F  94  ? LEU F  98  ? GLY F 88  LEU F 92  5 ? 5  
HELX_P HELX_P110 110 SER F  129 ? GLN F  133 ? SER F 123 GLN F 127 5 ? 5  
HELX_P HELX_P111 111 ILE F  144 ? ALA F  151 ? ILE F 138 ALA F 145 1 ? 8  
HELX_P HELX_P112 112 GLY F  168 ? ALA F  181 ? GLY F 162 ALA F 175 1 ? 14 
HELX_P HELX_P113 113 ARG F  196 ? GLY F  211 ? ARG F 190 GLY F 205 1 ? 16 
HELX_P HELX_P114 114 PRO F  231 ? ASP F  251 ? PRO F 225 ASP F 245 1 ? 21 
HELX_P HELX_P115 115 ILE F  264 ? ALA F  276 ? ILE F 258 ALA F 270 1 ? 13 
HELX_P HELX_P116 116 LEU F  277 ? GLY F  279 ? LEU F 271 GLY F 273 5 ? 3  
HELX_P HELX_P117 117 SER F  283 ? TYR F  287 ? SER F 277 TYR F 281 5 ? 5  
HELX_P HELX_P118 118 THR F  290 ? GLU F  300 ? THR F 284 GLU F 294 1 ? 11 
HELX_P HELX_P119 119 PRO F  319 ? ASP F  322 ? PRO F 313 ASP F 316 5 ? 4  
HELX_P HELX_P120 120 ASP F  325 ? PHE F  332 ? ASP F 319 PHE F 326 1 ? 8  
HELX_P HELX_P121 121 ALA F  333 ? LEU F  335 ? ALA F 327 LEU F 329 5 ? 3  
HELX_P HELX_P122 122 SER F  342 ? GLU F  347 ? SER F 336 GLU F 341 1 ? 6  
HELX_P HELX_P123 123 ASP F  365 ? GLY F  370 ? ASP F 359 GLY F 364 1 ? 6  
HELX_P HELX_P124 124 GLY F  370 ? GLY F  398 ? GLY F 364 GLY F 392 1 ? 29 
HELX_P HELX_P125 125 MET F  399 ? LEU F  402 ? MET F 393 LEU F 396 5 ? 4  
HELX_P HELX_P126 126 SER F  403 ? LEU F  420 ? SER F 397 LEU F 414 1 ? 18 
HELX_P HELX_P127 127 ALA F  427 ? GLY F  432 ? ALA F 421 GLY F 426 1 ? 6  
HELX_P HELX_P128 128 ARG F  439 ? GLU F  452 ? ARG F 433 GLU F 446 1 ? 14 
HELX_P HELX_P129 129 PRO F  459 ? TYR F  464 ? PRO F 453 TYR F 458 5 ? 6  
HELX_P HELX_P130 130 GLY F  468 ? ALA F  480 ? GLY F 462 ALA F 474 1 ? 13 
HELX_P HELX_P131 131 THR G  2   ? ALA G  55  ? THR G 2   ALA G 55  1 ? 54 
HELX_P HELX_P132 132 SER G  86  ? LEU G  99  ? SER G 86  LEU G 99  1 ? 14 
HELX_P HELX_P133 133 GLY G  111 ? HIS G  122 ? GLY G 111 HIS G 122 1 ? 12 
HELX_P HELX_P134 134 THR G  139 ? VAL G  153 ? THR G 139 VAL G 153 1 ? 15 
HELX_P HELX_P135 135 LYS G  155 ? TYR G  159 ? LYS G 155 TYR G 159 5 ? 5  
HELX_P HELX_P136 136 ASN G  184 ? GLN G  190 ? ASN G 184 GLN G 190 1 ? 7  
HELX_P HELX_P137 137 ASN G  204 ? SER G  276 ? ASN G 204 SER G 276 1 ? 73 
HELX_P HELX_P138 138 ALA H  106 ? VAL H  112 ? ALA H 106 VAL H 112 1 ? 7  
HELX_P HELX_P139 139 ARG H  118 ? GLU H  122 ? ARG H 118 GLU H 122 5 ? 5  
HELX_P HELX_P140 140 ALA H  124 ? ASN H  132 ? ALA H 124 ASN H 132 1 ? 9  
HELX_P HELX_P141 141 SER I  9   ? ALA I  17  ? SER I 9   ALA I 17  1 ? 9  
HELX_P HELX_P142 142 THR I  31  ? ASN I  36  ? THR I 31  ASN I 36  1 ? 6  
HELX_P HELX_P143 143 SER J  80  ? VAL J  84  ? SER J 80  VAL J 84  5 ? 5  
HELX_P HELX_P144 144 GLY J  102 ? LEU J  106 ? GLY J 102 LEU J 106 5 ? 5  
HELX_P HELX_P145 145 LEU J  152 ? VAL J  159 ? LEU J 152 VAL J 159 1 ? 8  
HELX_P HELX_P146 146 GLY J  176 ? GLN J  188 ? GLY J 176 GLN J 188 1 ? 13 
HELX_P HELX_P147 147 GLN J  188 ? ASN J  193 ? GLN J 188 ASN J 193 1 ? 6  
HELX_P HELX_P148 148 ASP J  196 ? LYS J  200 ? ASP J 196 LYS J 200 5 ? 5  
HELX_P HELX_P149 149 LYS J  211 ? HIS J  225 ? LYS J 211 HIS J 225 1 ? 15 
HELX_P HELX_P150 150 ALA J  227 ? LYS J  229 ? ALA J 227 LYS J 229 5 ? 3  
HELX_P HELX_P151 151 ALA J  241 ? ASN J  262 ? ALA J 241 ASN J 262 1 ? 22 
HELX_P HELX_P152 152 ASP J  272 ? LEU J  287 ? ASP J 272 LEU J 287 1 ? 16 
HELX_P HELX_P153 153 GLY J  292 ? TYR J  296 ? GLY J 292 TYR J 296 5 ? 5  
HELX_P HELX_P154 154 ASP J  299 ? GLU J  309 ? ASP J 299 GLU J 309 1 ? 11 
HELX_P HELX_P155 155 ALA J  338 ? THR J  348 ? ALA J 338 THR J 348 1 ? 11 
HELX_P HELX_P156 156 GLU J  355 ? LYS J  361 ? GLU J 355 LYS J 361 1 ? 7  
HELX_P HELX_P157 157 VAL J  376 ? GLN J  381 ? VAL J 376 GLN J 381 5 ? 6  
HELX_P HELX_P158 158 VAL J  382 ? GLY J  390 ? VAL J 382 GLY J 390 1 ? 9  
HELX_P HELX_P159 159 LEU J  392 ? ALA J  403 ? LEU J 392 ALA J 403 1 ? 12 
HELX_P HELX_P160 160 ASP J  413 ? LEU J  430 ? ASP J 413 LEU J 430 1 ? 18 
HELX_P HELX_P161 161 ALA J  439 ? ASN J  452 ? ALA J 439 ASN J 452 1 ? 14 
HELX_P HELX_P162 162 GLU J  459 ? SER J  461 ? GLU J 459 SER J 461 5 ? 3  
HELX_P HELX_P163 163 ARG J  462 ? ASN J  477 ? ARG J 462 ASN J 477 1 ? 16 
HELX_P HELX_P164 164 HIS J  478 ? GLY J  489 ? HIS J 478 GLY J 489 1 ? 12 
HELX_P HELX_P165 165 SER J  492 ? ALA J  508 ? SER J 492 ALA J 508 1 ? 17 
HELX_P HELX_P166 166 SER K  80  ? VAL K  84  ? SER K 80  VAL K 84  5 ? 5  
HELX_P HELX_P167 167 GLY K  102 ? LEU K  106 ? GLY K 102 LEU K 106 5 ? 5  
HELX_P HELX_P168 168 LEU K  152 ? VAL K  159 ? LEU K 152 VAL K 159 1 ? 8  
HELX_P HELX_P169 169 GLY K  176 ? GLN K  188 ? GLY K 176 GLN K 188 1 ? 13 
HELX_P HELX_P170 170 GLN K  188 ? ASN K  193 ? GLN K 188 ASN K 193 1 ? 6  
HELX_P HELX_P171 171 ASP K  196 ? LYS K  199 ? ASP K 196 LYS K 199 5 ? 4  
HELX_P HELX_P172 172 LYS K  211 ? HIS K  225 ? LYS K 211 HIS K 225 1 ? 15 
HELX_P HELX_P173 173 ALA K  227 ? LYS K  229 ? ALA K 227 LYS K 229 5 ? 3  
HELX_P HELX_P174 174 ALA K  241 ? ASN K  262 ? ALA K 241 ASN K 262 1 ? 22 
HELX_P HELX_P175 175 ASP K  272 ? LEU K  287 ? ASP K 272 LEU K 287 1 ? 16 
HELX_P HELX_P176 176 GLY K  292 ? TYR K  296 ? GLY K 292 TYR K 296 5 ? 5  
HELX_P HELX_P177 177 PRO K  297 ? GLY K  298 ? PRO K 297 GLY K 298 5 ? 2  
HELX_P HELX_P178 178 ASP K  299 ? GLU K  309 ? ASP K 299 GLU K 309 1 ? 11 
HELX_P HELX_P179 179 ALA K  338 ? SER K  346 ? ALA K 338 SER K 346 1 ? 9  
HELX_P HELX_P180 180 GLU K  355 ? LYS K  361 ? GLU K 355 LYS K 361 1 ? 7  
HELX_P HELX_P181 181 VAL K  376 ? ALA K  380 ? VAL K 376 ALA K 380 5 ? 5  
HELX_P HELX_P182 182 VAL K  382 ? ALA K  389 ? VAL K 382 ALA K 389 1 ? 8  
HELX_P HELX_P183 183 SER K  391 ? ALA K  406 ? SER K 391 ALA K 406 1 ? 16 
HELX_P HELX_P184 184 ASP K  413 ? GLN K  418 ? ASP K 413 GLN K 418 1 ? 6  
HELX_P HELX_P185 185 GLN K  418 ? LEU K  429 ? GLN K 418 LEU K 429 1 ? 12 
HELX_P HELX_P186 186 ALA K  439 ? ASN K  452 ? ALA K 439 ASN K 452 1 ? 14 
HELX_P HELX_P187 187 GLU K  459 ? SER K  461 ? GLU K 459 SER K 461 5 ? 3  
HELX_P HELX_P188 188 ARG K  462 ? ASN K  477 ? ARG K 462 ASN K 477 1 ? 16 
HELX_P HELX_P189 189 HIS K  478 ? GLY K  489 ? HIS K 478 GLY K 489 1 ? 12 
HELX_P HELX_P190 190 SER K  492 ? ALA K  508 ? SER K 492 ALA K 508 1 ? 17 
HELX_P HELX_P191 191 GLY L  102 ? LEU L  106 ? GLY L 102 LEU L 106 5 ? 5  
HELX_P HELX_P192 192 LEU L  152 ? VAL L  159 ? LEU L 152 VAL L 159 1 ? 8  
HELX_P HELX_P193 193 GLY L  176 ? GLN L  188 ? GLY L 176 GLN L 188 1 ? 13 
HELX_P HELX_P194 194 GLN L  188 ? ASN L  193 ? GLN L 188 ASN L 193 1 ? 6  
HELX_P HELX_P195 195 ASP L  196 ? LYS L  200 ? ASP L 196 LYS L 200 5 ? 5  
HELX_P HELX_P196 196 LYS L  211 ? HIS L  225 ? LYS L 211 HIS L 225 1 ? 15 
HELX_P HELX_P197 197 ALA L  227 ? LYS L  229 ? ALA L 227 LYS L 229 5 ? 3  
HELX_P HELX_P198 198 ALA L  241 ? ASN L  262 ? ALA L 241 ASN L 262 1 ? 22 
HELX_P HELX_P199 199 ASP L  272 ? LEU L  287 ? ASP L 272 LEU L 287 1 ? 16 
HELX_P HELX_P200 200 GLY L  292 ? TYR L  296 ? GLY L 292 TYR L 296 5 ? 5  
HELX_P HELX_P201 201 ASP L  299 ? GLU L  309 ? ASP L 299 GLU L 309 1 ? 11 
HELX_P HELX_P202 202 ALA L  338 ? SER L  346 ? ALA L 338 SER L 346 1 ? 9  
HELX_P HELX_P203 203 GLU L  355 ? GLY L  362 ? GLU L 355 GLY L 362 1 ? 8  
HELX_P HELX_P204 204 VAL L  376 ? GLN L  381 ? VAL L 376 GLN L 381 5 ? 6  
HELX_P HELX_P205 205 VAL L  382 ? ALA L  389 ? VAL L 382 ALA L 389 1 ? 8  
HELX_P HELX_P206 206 SER L  391 ? SER L  405 ? SER L 391 SER L 405 1 ? 15 
HELX_P HELX_P207 207 ASP L  413 ? LYS L  431 ? ASP L 413 LYS L 431 1 ? 19 
HELX_P HELX_P208 208 ALA L  439 ? ASN L  452 ? ALA L 439 ASN L 452 1 ? 14 
HELX_P HELX_P209 209 GLU L  459 ? SER L  461 ? GLU L 459 SER L 461 5 ? 3  
HELX_P HELX_P210 210 ARG L  462 ? HIS L  478 ? ARG L 462 HIS L 478 1 ? 17 
HELX_P HELX_P211 211 HIS L  478 ? GLY L  489 ? HIS L 478 GLY L 489 1 ? 12 
HELX_P HELX_P212 212 SER L  492 ? ALA L  508 ? SER L 492 ALA L 508 1 ? 17 
HELX_P HELX_P213 213 GLY M  94  ? LEU M  98  ? GLY M 88  LEU M 92  5 ? 5  
HELX_P HELX_P214 214 ILE M  144 ? ALA M  151 ? ILE M 138 ALA M 145 1 ? 8  
HELX_P HELX_P215 215 GLY M  168 ? ALA M  181 ? GLY M 162 ALA M 175 1 ? 14 
HELX_P HELX_P216 216 ARG M  196 ? GLU M  209 ? ARG M 190 GLU M 203 1 ? 14 
HELX_P HELX_P217 217 PRO M  231 ? GLU M  252 ? PRO M 225 GLU M 246 1 ? 22 
HELX_P HELX_P218 218 ILE M  264 ? ALA M  276 ? ILE M 258 ALA M 270 1 ? 13 
HELX_P HELX_P219 219 LEU M  277 ? GLY M  279 ? LEU M 271 GLY M 273 5 ? 3  
HELX_P HELX_P220 220 SER M  283 ? TYR M  287 ? SER M 277 TYR M 281 5 ? 5  
HELX_P HELX_P221 221 THR M  290 ? GLU M  300 ? THR M 284 GLU M 294 1 ? 11 
HELX_P HELX_P222 222 PRO M  319 ? ASP M  322 ? PRO M 313 ASP M 316 5 ? 4  
HELX_P HELX_P223 223 ASP M  325 ? PHE M  332 ? ASP M 319 PHE M 326 1 ? 8  
HELX_P HELX_P224 224 ALA M  333 ? LEU M  335 ? ALA M 327 LEU M 329 5 ? 3  
HELX_P HELX_P225 225 SER M  342 ? LEU M  348 ? SER M 336 LEU M 342 1 ? 7  
HELX_P HELX_P226 226 ASP M  365 ? GLY M  370 ? ASP M 359 GLY M 364 1 ? 6  
HELX_P HELX_P227 227 GLY M  370 ? LEU M  390 ? GLY M 364 LEU M 384 1 ? 21 
HELX_P HELX_P228 228 GLY M  398 ? LEU M  402 ? GLY M 392 LEU M 396 5 ? 5  
HELX_P HELX_P229 229 GLN M  405 ? LEU M  420 ? GLN M 399 LEU M 414 1 ? 16 
HELX_P HELX_P230 230 ALA M  427 ? GLY M  432 ? ALA M 421 GLY M 426 1 ? 6  
HELX_P HELX_P231 231 ARG M  439 ? LEU M  451 ? ARG M 433 LEU M 445 1 ? 13 
HELX_P HELX_P232 232 GLU M  460 ? TYR M  464 ? GLU M 454 TYR M 458 5 ? 5  
HELX_P HELX_P233 233 GLY M  468 ? ALA M  481 ? GLY M 462 ALA M 475 1 ? 14 
HELX_P HELX_P234 234 GLY N  94  ? LEU N  98  ? GLY N 88  LEU N 92  5 ? 5  
HELX_P HELX_P235 235 SER N  129 ? GLN N  133 ? SER N 123 GLN N 127 5 ? 5  
HELX_P HELX_P236 236 ILE N  144 ? ALA N  151 ? ILE N 138 ALA N 145 1 ? 8  
HELX_P HELX_P237 237 GLY N  168 ? GLY N  185 ? GLY N 162 GLY N 179 1 ? 18 
HELX_P HELX_P238 238 ARG N  196 ? GLY N  211 ? ARG N 190 GLY N 205 1 ? 16 
HELX_P HELX_P239 239 PRO N  231 ? GLU N  252 ? PRO N 225 GLU N 246 1 ? 22 
HELX_P HELX_P240 240 ASN N  263 ? LEU N  278 ? ASN N 257 LEU N 272 1 ? 16 
HELX_P HELX_P241 241 SER N  283 ? TYR N  287 ? SER N 277 TYR N 281 5 ? 5  
HELX_P HELX_P242 242 THR N  290 ? GLU N  300 ? THR N 284 GLU N 294 1 ? 11 
HELX_P HELX_P243 243 VAL N  318 ? ASP N  322 ? VAL N 312 ASP N 316 5 ? 5  
HELX_P HELX_P244 244 ASP N  325 ? ALA N  333 ? ASP N 319 ALA N 327 1 ? 9  
HELX_P HELX_P245 245 SER N  342 ? GLU N  347 ? SER N 336 GLU N 341 1 ? 6  
HELX_P HELX_P246 246 ASP N  365 ? GLY N  370 ? ASP N 359 GLY N 364 1 ? 6  
HELX_P HELX_P247 247 GLY N  370 ? ALA N  395 ? GLY N 364 ALA N 389 1 ? 26 
HELX_P HELX_P248 248 SER N  403 ? LEU N  420 ? SER N 397 LEU N 414 1 ? 18 
HELX_P HELX_P249 249 ALA N  427 ? GLY N  432 ? ALA N 421 GLY N 426 1 ? 6  
HELX_P HELX_P250 250 ARG N  439 ? GLU N  452 ? ARG N 433 GLU N 446 1 ? 14 
HELX_P HELX_P251 251 PRO N  459 ? PHE N  463 ? PRO N 453 PHE N 457 5 ? 5  
HELX_P HELX_P252 252 ILE N  469 ? LEU N  479 ? ILE N 463 LEU N 473 1 ? 11 
HELX_P HELX_P253 253 GLY O  94  ? LEU O  98  ? GLY O 88  LEU O 92  5 ? 5  
HELX_P HELX_P254 254 SER O  129 ? GLN O  133 ? SER O 123 GLN O 127 5 ? 5  
HELX_P HELX_P255 255 ILE O  144 ? ALA O  151 ? ILE O 138 ALA O 145 1 ? 8  
HELX_P HELX_P256 256 GLY O  168 ? ALA O  181 ? GLY O 162 ALA O 175 1 ? 14 
HELX_P HELX_P257 257 LYS O  182 ? GLY O  185 ? LYS O 176 GLY O 179 5 ? 4  
HELX_P HELX_P258 258 ARG O  196 ? THR O  210 ? ARG O 190 THR O 204 1 ? 15 
HELX_P HELX_P259 259 PRO O  231 ? GLY O  254 ? PRO O 225 GLY O 248 1 ? 24 
HELX_P HELX_P260 260 ILE O  264 ? ALA O  276 ? ILE O 258 ALA O 270 1 ? 13 
HELX_P HELX_P261 261 SER O  283 ? TYR O  287 ? SER O 277 TYR O 281 5 ? 5  
HELX_P HELX_P262 262 THR O  290 ? GLU O  300 ? THR O 284 GLU O 294 1 ? 11 
HELX_P HELX_P263 263 PRO O  319 ? ASP O  322 ? PRO O 313 ASP O 316 5 ? 4  
HELX_P HELX_P264 264 ASP O  325 ? PHE O  332 ? ASP O 319 PHE O 326 1 ? 8  
HELX_P HELX_P265 265 ALA O  333 ? LEU O  335 ? ALA O 327 LEU O 329 5 ? 3  
HELX_P HELX_P266 266 SER O  342 ? LEU O  348 ? SER O 336 LEU O 342 1 ? 7  
HELX_P HELX_P267 267 ASP O  365 ? GLY O  398 ? ASP O 359 GLY O 392 1 ? 34 
HELX_P HELX_P268 268 MET O  399 ? LEU O  402 ? MET O 393 LEU O 396 5 ? 4  
HELX_P HELX_P269 269 SER O  403 ? LEU O  420 ? SER O 397 LEU O 414 1 ? 18 
HELX_P HELX_P270 270 ALA O  427 ? GLY O  432 ? ALA O 421 GLY O 426 1 ? 6  
HELX_P HELX_P271 271 ARG O  439 ? GLU O  452 ? ARG O 433 GLU O 446 1 ? 14 
HELX_P HELX_P272 272 PRO O  459 ? PHE O  463 ? PRO O 453 PHE O 457 5 ? 5  
HELX_P HELX_P273 273 GLY O  468 ? ALA O  480 ? GLY O 462 ALA O 474 1 ? 13 
HELX_P HELX_P274 274 THR P  2   ? VAL P  26  ? THR P 2   VAL P 26  1 ? 25 
HELX_P HELX_P275 275 SER P  28  ? SER P  32  ? SER P 28  SER P 32  5 ? 5  
HELX_P HELX_P276 276 GLU P  35  ? LYS P  43  ? GLU P 35  LYS P 43  1 ? 9  
HELX_P HELX_P277 277 LEU P  50  ? ALA P  55  ? LEU P 50  ALA P 55  1 ? 6  
HELX_P HELX_P278 278 SER P  86  ? HIS P  98  ? SER P 86  HIS P 98  1 ? 13 
HELX_P HELX_P279 279 GLY P  111 ? MET P  116 ? GLY P 111 MET P 116 1 ? 6  
HELX_P HELX_P280 280 THR P  139 ? VAL P  153 ? THR P 139 VAL P 153 1 ? 15 
HELX_P HELX_P281 281 ASN P  204 ? GLY P  225 ? ASN P 204 GLY P 225 1 ? 22 
HELX_P HELX_P282 282 GLY P  225 ? ILE P  230 ? GLY P 225 ILE P 230 1 ? 6  
HELX_P HELX_P283 283 ALA P  232 ? SER P  276 ? ALA P 232 SER P 276 1 ? 45 
HELX_P HELX_P284 284 VAL Q  127 ? GLU Q  131 ? VAL Q 127 GLU Q 131 5 ? 5  
HELX_P HELX_P285 285 ALA R  12  ? ILE R  21  ? ALA R 12  ILE R 21  1 ? 10 
HELX_P HELX_P286 286 SER S  80  ? VAL S  84  ? SER S 80  VAL S 84  5 ? 5  
HELX_P HELX_P287 287 LEU S  152 ? VAL S  159 ? LEU S 152 VAL S 159 1 ? 8  
HELX_P HELX_P288 288 GLY S  176 ? ASN S  187 ? GLY S 176 ASN S 187 1 ? 12 
HELX_P HELX_P289 289 GLN S  188 ? TRP S  191 ? GLN S 188 TRP S 191 5 ? 4  
HELX_P HELX_P290 290 LYS S  211 ? HIS S  225 ? LYS S 211 HIS S 225 1 ? 15 
HELX_P HELX_P291 291 ALA S  241 ? ASN S  262 ? ALA S 241 ASN S 262 1 ? 22 
HELX_P HELX_P292 292 ASP S  272 ? LEU S  287 ? ASP S 272 LEU S 287 1 ? 16 
HELX_P HELX_P293 293 GLY S  292 ? TYR S  296 ? GLY S 292 TYR S 296 5 ? 5  
HELX_P HELX_P294 294 ASP S  299 ? GLU S  309 ? ASP S 299 GLU S 309 1 ? 11 
HELX_P HELX_P295 295 SER S  315 ? GLY S  319 ? SER S 315 GLY S 319 5 ? 5  
HELX_P HELX_P296 296 ALA S  338 ? THR S  348 ? ALA S 338 THR S 348 1 ? 11 
HELX_P HELX_P297 297 GLU S  355 ? LYS S  361 ? GLU S 355 LYS S 361 1 ? 7  
HELX_P HELX_P298 298 GLY S  377 ? GLN S  381 ? GLY S 377 GLN S 381 5 ? 5  
HELX_P HELX_P299 299 ALA S  384 ? VAL S  388 ? ALA S 384 VAL S 388 5 ? 5  
HELX_P HELX_P300 300 LYS S  393 ? GLN S  398 ? LYS S 393 GLN S 398 1 ? 6  
HELX_P HELX_P301 301 LYS S  417 ? LYS S  431 ? LYS S 417 LYS S 431 1 ? 15 
HELX_P HELX_P302 302 ALA S  439 ? ASN S  452 ? ALA S 439 ASN S 452 1 ? 14 
HELX_P HELX_P303 303 GLU S  459 ? SER S  461 ? GLU S 459 SER S 461 5 ? 3  
HELX_P HELX_P304 304 ARG S  462 ? ASN S  477 ? ARG S 462 ASN S 477 1 ? 16 
HELX_P HELX_P305 305 HIS S  478 ? LYS S  488 ? HIS S 478 LYS S 488 1 ? 11 
HELX_P HELX_P306 306 SER S  492 ? ALA S  508 ? SER S 492 ALA S 508 1 ? 17 
HELX_P HELX_P307 307 SER T  80  ? VAL T  84  ? SER T 80  VAL T 84  5 ? 5  
HELX_P HELX_P308 308 LEU T  152 ? VAL T  159 ? LEU T 152 VAL T 159 1 ? 8  
HELX_P HELX_P309 309 GLY T  176 ? GLN T  188 ? GLY T 176 GLN T 188 1 ? 13 
HELX_P HELX_P310 310 LYS T  189 ? TRP T  191 ? LYS T 189 TRP T 191 5 ? 3  
HELX_P HELX_P311 311 LYS T  211 ? HIS T  225 ? LYS T 211 HIS T 225 1 ? 15 
HELX_P HELX_P312 312 ALA T  227 ? LYS T  229 ? ALA T 227 LYS T 229 5 ? 3  
HELX_P HELX_P313 313 ALA T  241 ? ASN T  262 ? ALA T 241 ASN T 262 1 ? 22 
HELX_P HELX_P314 314 SER T  274 ? LEU T  286 ? SER T 274 LEU T 286 1 ? 13 
HELX_P HELX_P315 315 GLY T  292 ? TYR T  296 ? GLY T 292 TYR T 296 5 ? 5  
HELX_P HELX_P316 316 PRO T  297 ? VAL T  300 ? PRO T 297 VAL T 300 5 ? 4  
HELX_P HELX_P317 317 PHE T  301 ? ARG T  310 ? PHE T 301 ARG T 310 1 ? 10 
HELX_P HELX_P318 318 SER T  315 ? GLY T  319 ? SER T 315 GLY T 319 5 ? 5  
HELX_P HELX_P319 319 ALA T  338 ? SER T  346 ? ALA T 338 SER T 346 1 ? 9  
HELX_P HELX_P320 320 GLU T  355 ? GLY T  362 ? GLU T 355 GLY T 362 1 ? 8  
HELX_P HELX_P321 321 ASN T  368 ? SER T  372 ? ASN T 368 SER T 372 5 ? 5  
HELX_P HELX_P322 322 VAL T  382 ? ALA T  389 ? VAL T 382 ALA T 389 1 ? 8  
HELX_P HELX_P323 323 SER T  391 ? ALA T  403 ? SER T 391 ALA T 403 1 ? 13 
HELX_P HELX_P324 324 ASP T  413 ? LEU T  429 ? ASP T 413 LEU T 429 1 ? 17 
HELX_P HELX_P325 325 ALA T  439 ? ASN T  452 ? ALA T 439 ASN T 452 1 ? 14 
HELX_P HELX_P326 326 GLU T  459 ? SER T  461 ? GLU T 459 SER T 461 5 ? 3  
HELX_P HELX_P327 327 ARG T  462 ? ASN T  477 ? ARG T 462 ASN T 477 1 ? 16 
HELX_P HELX_P328 328 HIS T  478 ? GLY T  489 ? HIS T 478 GLY T 489 1 ? 12 
HELX_P HELX_P329 329 SER T  492 ? THR T  509 ? SER T 492 THR T 509 1 ? 18 
HELX_P HELX_P330 330 GLY U  102 ? LEU U  106 ? GLY U 102 LEU U 106 5 ? 5  
HELX_P HELX_P331 331 LEU U  152 ? VAL U  159 ? LEU U 152 VAL U 159 1 ? 8  
HELX_P HELX_P332 332 LYS U  177 ? GLN U  188 ? LYS U 177 GLN U 188 1 ? 12 
HELX_P HELX_P333 333 LYS U  189 ? TRP U  191 ? LYS U 189 TRP U 191 5 ? 3  
HELX_P HELX_P334 334 LYS U  211 ? GLN U  224 ? LYS U 211 GLN U 224 1 ? 14 
HELX_P HELX_P335 335 ALA U  227 ? LYS U  229 ? ALA U 227 LYS U 229 5 ? 3  
HELX_P HELX_P336 336 ALA U  241 ? ASN U  262 ? ALA U 241 ASN U 262 1 ? 22 
HELX_P HELX_P337 337 ASP U  272 ? ARG U  288 ? ASP U 272 ARG U 288 1 ? 17 
HELX_P HELX_P338 338 GLY U  292 ? TYR U  296 ? GLY U 292 TYR U 296 5 ? 5  
HELX_P HELX_P339 339 PRO U  297 ? GLY U  298 ? PRO U 297 GLY U 298 5 ? 2  
HELX_P HELX_P340 340 ASP U  299 ? ALA U  311 ? ASP U 299 ALA U 311 1 ? 13 
HELX_P HELX_P341 341 ALA U  338 ? SER U  346 ? ALA U 338 SER U 346 1 ? 9  
HELX_P HELX_P342 342 GLU U  355 ? GLY U  362 ? GLU U 355 GLY U 362 1 ? 8  
HELX_P HELX_P343 343 VAL U  376 ? GLN U  381 ? VAL U 376 GLN U 381 5 ? 6  
HELX_P HELX_P344 344 VAL U  382 ? ALA U  389 ? VAL U 382 ALA U 389 1 ? 8  
HELX_P HELX_P345 345 SER U  391 ? ALA U  406 ? SER U 391 ALA U 406 1 ? 16 
HELX_P HELX_P346 346 SER U  415 ? LEU U  430 ? SER U 415 LEU U 430 1 ? 16 
HELX_P HELX_P347 347 ALA U  439 ? GLU U  442 ? ALA U 439 GLU U 442 5 ? 4  
HELX_P HELX_P348 348 GLN U  443 ? ASN U  452 ? GLN U 443 ASN U 452 1 ? 10 
HELX_P HELX_P349 349 ARG U  462 ? SER U  472 ? ARG U 462 SER U 472 1 ? 11 
HELX_P HELX_P350 350 HIS U  478 ? GLU U  487 ? HIS U 478 GLU U 487 1 ? 10 
HELX_P HELX_P351 351 SER U  492 ? ALA U  502 ? SER U 492 ALA U 502 1 ? 11 
HELX_P HELX_P352 352 ALA U  502 ? ALA U  508 ? ALA U 502 ALA U 508 1 ? 7  
HELX_P HELX_P353 353 VAL V  93  ? LEU V  98  ? VAL V 87  LEU V 92  5 ? 6  
HELX_P HELX_P354 354 SER V  129 ? GLN V  133 ? SER V 123 GLN V 127 5 ? 5  
HELX_P HELX_P355 355 ILE V  144 ? ALA V  151 ? ILE V 138 ALA V 145 1 ? 8  
HELX_P HELX_P356 356 GLY V  168 ? HIS V  184 ? GLY V 162 HIS V 178 1 ? 17 
HELX_P HELX_P357 357 ARG V  198 ? MET V  207 ? ARG V 192 MET V 201 1 ? 10 
HELX_P HELX_P358 358 PRO V  231 ? ASP V  251 ? PRO V 225 ASP V 245 1 ? 21 
HELX_P HELX_P359 359 ASN V  263 ? ALA V  276 ? ASN V 257 ALA V 270 1 ? 14 
HELX_P HELX_P360 360 LEU V  277 ? GLY V  279 ? LEU V 271 GLY V 273 5 ? 3  
HELX_P HELX_P361 361 THR V  290 ? GLU V  300 ? THR V 284 GLU V 294 1 ? 11 
HELX_P HELX_P362 362 PRO V  319 ? ASP V  322 ? PRO V 313 ASP V 316 5 ? 4  
HELX_P HELX_P363 363 ASP V  325 ? THR V  330 ? ASP V 319 THR V 324 1 ? 6  
HELX_P HELX_P364 364 SER V  342 ? GLU V  347 ? SER V 336 GLU V 341 1 ? 6  
HELX_P HELX_P365 365 ASP V  365 ? GLY V  370 ? ASP V 359 GLY V 364 1 ? 6  
HELX_P HELX_P366 366 GLY V  370 ? SER V  389 ? GLY V 364 SER V 383 1 ? 20 
HELX_P HELX_P367 367 LEU V  390 ? ALA V  395 ? LEU V 384 ALA V 389 1 ? 6  
HELX_P HELX_P368 368 GLY V  398 ? LEU V  402 ? GLY V 392 LEU V 396 5 ? 5  
HELX_P HELX_P369 369 SER V  403 ? LEU V  420 ? SER V 397 LEU V 414 1 ? 18 
HELX_P HELX_P370 370 PHE V  424 ? VAL V  426 ? PHE V 418 VAL V 420 5 ? 3  
HELX_P HELX_P371 371 ALA V  427 ? GLY V  432 ? ALA V 421 GLY V 426 1 ? 6  
HELX_P HELX_P372 372 ARG V  439 ? GLU V  452 ? ARG V 433 GLU V 446 1 ? 14 
HELX_P HELX_P373 373 PRO V  459 ? PHE V  463 ? PRO V 453 PHE V 457 5 ? 5  
HELX_P HELX_P374 374 ILE V  469 ? ALA V  474 ? ILE V 463 ALA V 468 1 ? 6  
HELX_P HELX_P375 375 GLY W  94  ? LEU W  98  ? GLY W 88  LEU W 92  5 ? 5  
HELX_P HELX_P376 376 SER W  129 ? GLN W  133 ? SER W 123 GLN W 127 5 ? 5  
HELX_P HELX_P377 377 ILE W  144 ? LEU W  150 ? ILE W 138 LEU W 144 1 ? 7  
HELX_P HELX_P378 378 GLY W  168 ? ALA W  183 ? GLY W 162 ALA W 177 1 ? 16 
HELX_P HELX_P379 379 ARG W  196 ? GLY W  211 ? ARG W 190 GLY W 205 1 ? 16 
HELX_P HELX_P380 380 PRO W  231 ? GLU W  252 ? PRO W 225 GLU W 246 1 ? 22 
HELX_P HELX_P381 381 ASN W  263 ? LEU W  278 ? ASN W 257 LEU W 272 1 ? 16 
HELX_P HELX_P382 382 SER W  283 ? TYR W  287 ? SER W 277 TYR W 281 5 ? 5  
HELX_P HELX_P383 383 THR W  290 ? GLU W  300 ? THR W 284 GLU W 294 1 ? 11 
HELX_P HELX_P384 384 VAL W  318 ? ASP W  322 ? VAL W 312 ASP W 316 5 ? 5  
HELX_P HELX_P385 385 ASP W  325 ? ALA W  333 ? ASP W 319 ALA W 327 1 ? 9  
HELX_P HELX_P386 386 SER W  342 ? GLU W  347 ? SER W 336 GLU W 341 1 ? 6  
HELX_P HELX_P387 387 ASP W  365 ? GLY W  370 ? ASP W 359 GLY W 364 1 ? 6  
HELX_P HELX_P388 388 GLY W  370 ? GLY W  398 ? GLY W 364 GLY W 392 1 ? 29 
HELX_P HELX_P389 389 SER W  403 ? LEU W  420 ? SER W 397 LEU W 414 1 ? 18 
HELX_P HELX_P390 390 ALA W  427 ? GLY W  432 ? ALA W 421 GLY W 426 1 ? 6  
HELX_P HELX_P391 391 ARG W  439 ? GLU W  452 ? ARG W 433 GLU W 446 1 ? 14 
HELX_P HELX_P392 392 PRO W  459 ? TYR W  464 ? PRO W 453 TYR W 458 5 ? 6  
HELX_P HELX_P393 393 GLY W  468 ? ALA W  480 ? GLY W 462 ALA W 474 1 ? 13 
HELX_P HELX_P394 394 GLY X  94  ? LEU X  98  ? GLY X 88  LEU X 92  5 ? 5  
HELX_P HELX_P395 395 ILE X  144 ? ALA X  151 ? ILE X 138 ALA X 145 1 ? 8  
HELX_P HELX_P396 396 GLY X  168 ? ALA X  181 ? GLY X 162 ALA X 175 1 ? 14 
HELX_P HELX_P397 397 ARG X  196 ? GLY X  211 ? ARG X 190 GLY X 205 1 ? 16 
HELX_P HELX_P398 398 PRO X  231 ? GLU X  253 ? PRO X 225 GLU X 247 1 ? 23 
HELX_P HELX_P399 399 ILE X  264 ? VAL X  274 ? ILE X 258 VAL X 268 1 ? 11 
HELX_P HELX_P400 400 SER X  275 ? GLY X  279 ? SER X 269 GLY X 273 5 ? 5  
HELX_P HELX_P401 401 SER X  283 ? TYR X  287 ? SER X 277 TYR X 281 5 ? 5  
HELX_P HELX_P402 402 GLN X  288 ? PRO X  289 ? GLN X 282 PRO X 283 5 ? 2  
HELX_P HELX_P403 403 THR X  290 ? GLU X  300 ? THR X 284 GLU X 294 1 ? 11 
HELX_P HELX_P404 404 PRO X  319 ? ASP X  322 ? PRO X 313 ASP X 316 5 ? 4  
HELX_P HELX_P405 405 ASP X  325 ? PHE X  332 ? ASP X 319 PHE X 326 1 ? 8  
HELX_P HELX_P406 406 ALA X  333 ? LEU X  335 ? ALA X 327 LEU X 329 5 ? 3  
HELX_P HELX_P407 407 SER X  342 ? GLU X  347 ? SER X 336 GLU X 341 1 ? 6  
HELX_P HELX_P408 408 ASP X  365 ? LEU X  390 ? ASP X 359 LEU X 384 1 ? 26 
HELX_P HELX_P409 409 LEU X  390 ? GLY X  398 ? LEU X 384 GLY X 392 1 ? 9  
HELX_P HELX_P410 410 MET X  399 ? LEU X  402 ? MET X 393 LEU X 396 5 ? 4  
HELX_P HELX_P411 411 SER X  403 ? LEU X  420 ? SER X 397 LEU X 414 1 ? 18 
HELX_P HELX_P412 412 ALA X  427 ? GLY X  432 ? ALA X 421 GLY X 426 1 ? 6  
HELX_P HELX_P413 413 ARG X  439 ? GLU X  452 ? ARG X 433 GLU X 446 1 ? 14 
HELX_P HELX_P414 414 PRO X  459 ? TYR X  464 ? PRO X 453 TYR X 458 5 ? 6  
HELX_P HELX_P415 415 GLY X  468 ? ALA X  481 ? GLY X 462 ALA X 475 1 ? 14 
HELX_P HELX_P416 416 THR Y  2   ? LYS Y  42  ? THR Y 2   LYS Y 42  1 ? 41 
HELX_P HELX_P417 417 SER Y  86  ? ARG Y  97  ? SER Y 86  ARG Y 97  1 ? 12 
HELX_P HELX_P418 418 GLY Y  111 ? ARG Y  120 ? GLY Y 111 ARG Y 120 1 ? 10 
HELX_P HELX_P419 419 THR Y  139 ? LEU Y  151 ? THR Y 139 LEU Y 151 1 ? 13 
HELX_P HELX_P420 420 TYR Y  212 ? ASP Y  269 ? TYR Y 212 ASP Y 269 1 ? 58 
HELX_P HELX_P421 421 ASP Y  269 ? ALA Y  274 ? ASP Y 269 ALA Y 274 1 ? 6  
HELX_P HELX_P422 422 ALA Z  120 ? ALA Z  123 ? ALA Z 120 ALA Z 123 5 ? 4  
HELX_P HELX_P423 423 ALA Z  124 ? GLN Z  134 ? ALA Z 124 GLN Z 134 1 ? 11 
HELX_P HELX_P424 424 TYR AA 10  ? LEU AA 14  ? TYR 1 10  LEU 1 14  5 ? 5  
HELX_P HELX_P425 425 LEU AA 35  ? GLN AA 39  ? LEU 1 35  GLN 1 39  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K  THR 178 OG1 ? ? ? 1_555 PA MG . MG ? ? K THR 178 K MG 700 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc2  metalc ? ? OA ANP .   O2G ? ? ? 1_555 PA MG . MG ? ? K ANP 600 K MG 700 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc3  metalc ? ? BA ANP .   O2G ? ? ? 1_555 CA MG . MG ? ? A ANP 600 A MG 700 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc4  metalc ? ? QA ANP .   O2G ? ? ? 1_555 RA MG . MG ? ? L ANP 600 L MG 700 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc5  metalc ? ? KA ANP .   O2G ? ? ? 1_555 LA MG . MG ? ? F ANP 600 F MG 700 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc6  metalc ? ? F  THR 170 OG1 ? ? ? 1_555 LA MG . MG ? ? F THR 164 F MG 700 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc7  metalc ? ? L  THR 178 OG1 ? ? ? 1_555 RA MG . MG ? ? L THR 178 L MG 700 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc8  metalc ? ? VA ANP .   O2G ? ? ? 1_555 WA MG . MG ? ? O ANP 600 O MG 700 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc9  metalc ? ? M  THR 170 OG1 ? ? ? 1_555 TA MG . MG ? ? M THR 164 M MG 700 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc10 metalc ? ? FA ANP .   O2G ? ? ? 1_555 GA MG . MG ? ? C ANP 600 C MG 700 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc11 metalc ? ? MA ANP .   O2G ? ? ? 1_555 NA MG . MG ? ? J ANP 600 J MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc12 metalc ? ? J  THR 178 OG1 ? ? ? 1_555 NA MG . MG ? ? J THR 178 J MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc13 metalc ? ? SA ANP .   O2G ? ? ? 1_555 TA MG . MG ? ? M ANP 600 M MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc14 metalc ? ? HA ANP .   O2G ? ? ? 1_555 IA MG . MG ? ? D ANP 600 D MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc15 metalc ? ? D  THR 170 OG1 ? ? ? 1_555 IA MG . MG ? ? D THR 164 D MG 700 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc16 metalc ? ? T  THR 178 OG1 ? ? ? 1_555 AB MG . MG ? ? T THR 178 T MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc17 metalc ? ? DA ANP .   O2G ? ? ? 1_555 EA MG . MG ? ? B ANP 600 B MG 700 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc18 metalc ? ? MA ANP .   O2B ? ? ? 1_555 NA MG . MG ? ? J ANP 600 J MG 700 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc19 metalc ? ? FA ANP .   O2B ? ? ? 1_555 GA MG . MG ? ? C ANP 600 C MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc20 metalc ? ? XA ANP .   O2B ? ? ? 1_555 YA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc21 metalc ? ? DA ANP .   O2B ? ? ? 1_555 EA MG . MG ? ? B ANP 600 B MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc22 metalc ? ? C  THR 178 OG1 ? ? ? 1_555 GA MG . MG ? ? C THR 178 C MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc23 metalc ? ? B  THR 178 OG1 ? ? ? 1_555 EA MG . MG ? ? B THR 178 B MG 700 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc24 metalc ? ? A  THR 178 OG1 ? ? ? 1_555 CA MG . MG ? ? A THR 178 A MG 700 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc25 metalc ? ? XA ANP .   O2G ? ? ? 1_555 YA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc26 metalc ? ? ZA ANP .   O2B ? ? ? 1_555 AB MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc27 metalc ? ? V  THR 170 OG1 ? ? ? 1_555 EB MG . MG ? ? V THR 164 V MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc28 metalc ? ? X  THR 170 OG1 ? ? ? 1_555 GB MG . MG ? ? X THR 164 X MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc29 metalc ? ? SA ANP .   O2B ? ? ? 1_555 TA MG . MG ? ? M ANP 600 M MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc30 metalc ? ? OA ANP .   O2B ? ? ? 1_555 PA MG . MG ? ? K ANP 600 K MG 700 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc31 metalc ? ? BB ANP .   O2G ? ? ? 1_555 CB MG . MG ? ? U ANP 600 U MG 700 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc32 metalc ? ? ZA ANP .   O2G ? ? ? 1_555 AB MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc33 metalc ? ? DB ANP .   O2G ? ? ? 1_555 EB MG . MG ? ? V ANP 600 V MG 700 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc34 metalc ? ? O  THR 170 OG1 ? ? ? 1_555 WA MG . MG ? ? O THR 164 O MG 700 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc35 metalc ? ? FB ANP .   O2B ? ? ? 1_555 GB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc36 metalc ? ? BB ANP .   O2B ? ? ? 1_555 CB MG . MG ? ? U ANP 600 U MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc37 metalc ? ? FB ANP .   O2G ? ? ? 1_555 GB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc38 metalc ? ? DB ANP .   O2B ? ? ? 1_555 EB MG . MG ? ? V ANP 600 V MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc39 metalc ? ? S  THR 178 OG1 ? ? ? 1_555 YA MG . MG ? ? S THR 178 S MG 700 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc40 metalc ? ? HA ANP .   O2B ? ? ? 1_555 IA MG . MG ? ? D ANP 600 D MG 700 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc41 metalc ? ? VA ANP .   O2B ? ? ? 1_555 WA MG . MG ? ? O ANP 600 O MG 700 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc42 metalc ? ? BA ANP .   O2B ? ? ? 1_555 CA MG . MG ? ? A ANP 600 A MG 700 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc43 metalc ? ? QA ANP .   O2B ? ? ? 1_555 RA MG . MG ? ? L ANP 600 L MG 700 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc44 metalc ? ? KA ANP .   O2B ? ? ? 1_555 LA MG . MG ? ? F ANP 600 F MG 700 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc45 metalc ? ? U  THR 178 OG1 ? ? ? 1_555 CB MG . MG ? ? U THR 178 U MG 700 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc46 metalc ? ? XA ANP .   O1B ? ? ? 1_555 YA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc47 metalc ? ? X  GLU 195 OE1 ? ? ? 1_555 GB MG . MG ? ? X GLU 189 X MG 700 1_555 ? ? ? ? ? ? ? 2.828 ? 
metalc48 metalc ? ? FB ANP .   O3G ? ? ? 1_555 GB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc49 metalc ? ? ZA ANP .   O1G ? ? ? 1_555 AB MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.975 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 271 A . ? ASP 271 A ASP 272 A ? ASP 272 A 1 6.98   
2  ARG 364 A . ? ARG 364 A PRO 365 A ? PRO 365 A 1 -6.57  
3  ASP 271 B . ? ASP 271 B ASP 272 B ? ASP 272 B 1 -10.00 
4  ARG 364 B . ? ARG 364 B PRO 365 B ? PRO 365 B 1 -7.55  
5  ASP 271 C . ? ASP 271 C ASP 272 C ? ASP 272 C 1 -5.56  
6  ARG 364 C . ? ARG 364 C PRO 365 C ? PRO 365 C 1 -3.66  
7  ASP 262 D . ? ASP 256 D ASN 263 D ? ASN 257 D 1 11.97  
8  TYR 351 D . ? TYR 345 D PRO 352 D ? PRO 346 D 1 -5.97  
9  ASP 262 E . ? ASP 256 E ASN 263 E ? ASN 257 E 1 8.50   
10 TYR 351 E . ? TYR 345 E PRO 352 E ? PRO 346 E 1 6.68   
11 ASP 262 F . ? ASP 256 F ASN 263 F ? ASN 257 F 1 8.83   
12 TYR 351 F . ? TYR 345 F PRO 352 F ? PRO 346 F 1 -3.18  
13 SER 113 H . ? SER 113 H SER 114 H ? SER 114 H 1 5.59   
14 ASP 271 J . ? ASP 271 J ASP 272 J ? ASP 272 J 1 0.07   
15 ARG 364 J . ? ARG 364 J PRO 365 J ? PRO 365 J 1 0.14   
16 ASP 271 K . ? ASP 271 K ASP 272 K ? ASP 272 K 1 1.55   
17 ARG 364 K . ? ARG 364 K PRO 365 K ? PRO 365 K 1 -6.07  
18 ASP 271 L . ? ASP 271 L ASP 272 L ? ASP 272 L 1 2.25   
19 ARG 364 L . ? ARG 364 L PRO 365 L ? PRO 365 L 1 -5.23  
20 ASP 262 M . ? ASP 256 M ASN 263 M ? ASN 257 M 1 6.43   
21 TYR 351 M . ? TYR 345 M PRO 352 M ? PRO 346 M 1 -3.34  
22 ASP 262 N . ? ASP 256 N ASN 263 N ? ASN 257 N 1 2.17   
23 TYR 351 N . ? TYR 345 N PRO 352 N ? PRO 346 N 1 2.73   
24 ASP 262 O . ? ASP 256 O ASN 263 O ? ASN 257 O 1 5.08   
25 TYR 351 O . ? TYR 345 O PRO 352 O ? PRO 346 O 1 -3.57  
26 ASP 271 S . ? ASP 271 S ASP 272 S ? ASP 272 S 1 2.10   
27 ARG 364 S . ? ARG 364 S PRO 365 S ? PRO 365 S 1 4.12   
28 ASP 271 T . ? ASP 271 T ASP 272 T ? ASP 272 T 1 -4.28  
29 ARG 364 T . ? ARG 364 T PRO 365 T ? PRO 365 T 1 -6.42  
30 ASP 271 U . ? ASP 271 U ASP 272 U ? ASP 272 U 1 2.90   
31 ARG 364 U . ? ARG 364 U PRO 365 U ? PRO 365 U 1 -5.61  
32 ASP 262 V . ? ASP 256 V ASN 263 V ? ASN 257 V 1 7.19   
33 TYR 351 V . ? TYR 345 V PRO 352 V ? PRO 346 V 1 8.97   
34 ASP 262 W . ? ASP 256 W ASN 263 W ? ASN 257 W 1 15.31  
35 TYR 351 W . ? TYR 345 W PRO 352 W ? PRO 346 W 1 1.67   
36 ASP 262 X . ? ASP 256 X ASN 263 X ? ASN 257 X 1 3.92   
37 TYR 351 X . ? TYR 345 X PRO 352 X ? PRO 346 X 1 -0.19  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 14 ? 
B  ? 2  ? 
C  ? 6  ? 
D  ? 8  ? 
E  ? 2  ? 
F  ? 14 ? 
G  ? 2  ? 
H  ? 6  ? 
I  ? 8  ? 
J  ? 2  ? 
K  ? 14 ? 
L  ? 2  ? 
M  ? 6  ? 
N  ? 8  ? 
O  ? 2  ? 
P  ? 2  ? 
Q  ? 8  ? 
R  ? 2  ? 
S  ? 7  ? 
T  ? 2  ? 
U  ? 2  ? 
V  ? 8  ? 
W  ? 2  ? 
X  ? 7  ? 
Y  ? 4  ? 
Z  ? 2  ? 
AA ? 2  ? 
AB ? 14 ? 
AC ? 2  ? 
AD ? 6  ? 
AE ? 8  ? 
AF ? 2  ? 
AG ? 7  ? 
AH ? 2  ? 
AI ? 6  ? 
AJ ? 8  ? 
AK ? 2  ? 
AL ? 14 ? 
AM ? 2  ? 
AN ? 7  ? 
AO ? 2  ? 
AP ? 2  ? 
AQ ? 8  ? 
AR ? 2  ? 
AS ? 2  ? 
AT ? 7  ? 
AU ? 2  ? 
AV ? 7  ? 
AW ? 2  ? 
AX ? 8  ? 
AY ? 5  ? 
AZ ? 2  ? 
BA ? 7  ? 
BB ? 12 ? 
BC ? 2  ? 
BD ? 8  ? 
BE ? 14 ? 
BF ? 2  ? 
BG ? 7  ? 
BH ? 6  ? 
BI ? 2  ? 
BJ ? 8  ? 
BK ? 8  ? 
BL ? 2  ? 
BM ? 7  ? 
BN ? 2  ? 
BO ? 7  ? 
BP ? 2  ? 
BQ ? 2  ? 
BR ? 8  ? 
BS ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? anti-parallel 
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
A  5  6  ? anti-parallel 
A  6  7  ? anti-parallel 
A  7  8  ? anti-parallel 
A  8  9  ? anti-parallel 
A  9  10 ? anti-parallel 
A  10 11 ? anti-parallel 
A  11 12 ? anti-parallel 
A  12 13 ? anti-parallel 
A  13 14 ? anti-parallel 
B  1  2  ? anti-parallel 
C  1  2  ? parallel      
C  2  3  ? parallel      
C  3  4  ? parallel      
C  4  5  ? parallel      
C  5  6  ? anti-parallel 
D  1  2  ? parallel      
D  2  3  ? parallel      
D  3  4  ? parallel      
D  4  5  ? parallel      
D  5  6  ? parallel      
D  6  7  ? parallel      
D  7  8  ? anti-parallel 
E  1  2  ? anti-parallel 
F  1  2  ? anti-parallel 
F  2  3  ? anti-parallel 
F  3  4  ? anti-parallel 
F  4  5  ? anti-parallel 
F  5  6  ? anti-parallel 
F  6  7  ? anti-parallel 
F  7  8  ? anti-parallel 
F  8  9  ? anti-parallel 
F  9  10 ? anti-parallel 
F  10 11 ? anti-parallel 
F  11 12 ? anti-parallel 
F  12 13 ? anti-parallel 
F  13 14 ? anti-parallel 
G  1  2  ? anti-parallel 
H  1  2  ? parallel      
H  2  3  ? parallel      
H  3  4  ? parallel      
H  4  5  ? parallel      
H  5  6  ? anti-parallel 
I  1  2  ? parallel      
I  2  3  ? parallel      
I  3  4  ? parallel      
I  4  5  ? parallel      
I  5  6  ? parallel      
I  6  7  ? parallel      
I  7  8  ? anti-parallel 
J  1  2  ? anti-parallel 
K  1  2  ? anti-parallel 
K  2  3  ? anti-parallel 
K  3  4  ? anti-parallel 
K  4  5  ? anti-parallel 
K  5  6  ? anti-parallel 
K  6  7  ? anti-parallel 
K  7  8  ? anti-parallel 
K  8  9  ? anti-parallel 
K  9  10 ? anti-parallel 
K  10 11 ? anti-parallel 
K  11 12 ? anti-parallel 
K  12 13 ? anti-parallel 
K  13 14 ? anti-parallel 
L  1  2  ? anti-parallel 
M  1  2  ? parallel      
M  2  3  ? parallel      
M  3  4  ? parallel      
M  4  5  ? parallel      
M  5  6  ? anti-parallel 
N  1  2  ? parallel      
N  2  3  ? parallel      
N  3  4  ? parallel      
N  4  5  ? parallel      
N  5  6  ? parallel      
N  6  7  ? parallel      
N  7  8  ? anti-parallel 
O  1  2  ? anti-parallel 
P  1  2  ? anti-parallel 
Q  1  2  ? parallel      
Q  2  3  ? parallel      
Q  3  4  ? parallel      
Q  4  5  ? parallel      
Q  5  6  ? parallel      
Q  6  7  ? parallel      
Q  7  8  ? anti-parallel 
R  1  2  ? anti-parallel 
S  1  2  ? parallel      
S  2  3  ? parallel      
S  3  4  ? parallel      
S  4  5  ? parallel      
S  5  6  ? parallel      
S  6  7  ? parallel      
T  1  2  ? anti-parallel 
U  1  2  ? anti-parallel 
V  1  2  ? parallel      
V  2  3  ? parallel      
V  3  4  ? parallel      
V  4  5  ? parallel      
V  5  6  ? parallel      
V  6  7  ? parallel      
V  7  8  ? anti-parallel 
W  1  2  ? anti-parallel 
X  1  2  ? anti-parallel 
X  2  3  ? parallel      
X  3  4  ? parallel      
X  4  5  ? parallel      
X  5  6  ? anti-parallel 
X  6  7  ? anti-parallel 
Y  1  2  ? parallel      
Y  2  3  ? anti-parallel 
Y  3  4  ? anti-parallel 
Z  1  2  ? anti-parallel 
AA 1  2  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? anti-parallel 
AB 5  6  ? anti-parallel 
AB 6  7  ? anti-parallel 
AB 7  8  ? anti-parallel 
AB 8  9  ? anti-parallel 
AB 9  10 ? anti-parallel 
AB 10 11 ? anti-parallel 
AB 11 12 ? anti-parallel 
AB 12 13 ? anti-parallel 
AB 13 14 ? anti-parallel 
AC 1  2  ? anti-parallel 
AD 1  2  ? parallel      
AD 2  3  ? parallel      
AD 3  4  ? parallel      
AD 4  5  ? parallel      
AD 5  6  ? anti-parallel 
AE 1  2  ? parallel      
AE 2  3  ? parallel      
AE 3  4  ? parallel      
AE 4  5  ? parallel      
AE 5  6  ? parallel      
AE 6  7  ? parallel      
AE 7  8  ? anti-parallel 
AF 1  2  ? anti-parallel 
AG 1  2  ? anti-parallel 
AG 2  3  ? anti-parallel 
AG 3  4  ? anti-parallel 
AG 4  5  ? anti-parallel 
AG 5  6  ? anti-parallel 
AG 6  7  ? anti-parallel 
AH 1  2  ? anti-parallel 
AI 1  2  ? parallel      
AI 2  3  ? parallel      
AI 3  4  ? parallel      
AI 4  5  ? parallel      
AI 5  6  ? anti-parallel 
AJ 1  2  ? parallel      
AJ 2  3  ? parallel      
AJ 3  4  ? parallel      
AJ 4  5  ? parallel      
AJ 5  6  ? parallel      
AJ 6  7  ? parallel      
AJ 7  8  ? anti-parallel 
AK 1  2  ? anti-parallel 
AL 1  2  ? anti-parallel 
AL 2  3  ? anti-parallel 
AL 3  4  ? anti-parallel 
AL 4  5  ? anti-parallel 
AL 5  6  ? anti-parallel 
AL 6  7  ? anti-parallel 
AL 7  8  ? anti-parallel 
AL 8  9  ? anti-parallel 
AL 9  10 ? anti-parallel 
AL 10 11 ? anti-parallel 
AL 11 12 ? anti-parallel 
AL 12 13 ? anti-parallel 
AL 13 14 ? anti-parallel 
AM 1  2  ? anti-parallel 
AN 1  2  ? parallel      
AN 2  3  ? parallel      
AN 3  4  ? parallel      
AN 4  5  ? parallel      
AN 5  6  ? parallel      
AN 6  7  ? parallel      
AO 1  2  ? anti-parallel 
AP 1  2  ? anti-parallel 
AQ 1  2  ? parallel      
AQ 2  3  ? parallel      
AQ 3  4  ? parallel      
AQ 4  5  ? parallel      
AQ 5  6  ? parallel      
AQ 6  7  ? parallel      
AQ 7  8  ? anti-parallel 
AR 1  2  ? anti-parallel 
AS 1  2  ? anti-parallel 
AT 1  2  ? parallel      
AT 2  3  ? parallel      
AT 3  4  ? parallel      
AT 4  5  ? parallel      
AT 5  6  ? parallel      
AT 6  7  ? parallel      
AU 1  2  ? anti-parallel 
AV 1  2  ? anti-parallel 
AV 2  3  ? anti-parallel 
AV 3  4  ? anti-parallel 
AV 4  5  ? anti-parallel 
AV 5  6  ? anti-parallel 
AV 6  7  ? anti-parallel 
AW 1  2  ? anti-parallel 
AX 1  2  ? parallel      
AX 2  3  ? parallel      
AX 3  4  ? parallel      
AX 4  5  ? parallel      
AX 5  6  ? parallel      
AX 6  7  ? parallel      
AX 7  8  ? anti-parallel 
AY 1  2  ? parallel      
AY 2  3  ? parallel      
AY 3  4  ? parallel      
AY 4  5  ? anti-parallel 
AZ 1  2  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? anti-parallel 
BA 4  5  ? anti-parallel 
BA 5  6  ? anti-parallel 
BA 6  7  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? anti-parallel 
BB 5  6  ? anti-parallel 
BB 6  7  ? anti-parallel 
BB 7  8  ? anti-parallel 
BB 9  10 ? anti-parallel 
BB 10 11 ? anti-parallel 
BB 11 12 ? anti-parallel 
BC 1  2  ? anti-parallel 
BD 1  2  ? parallel      
BD 2  3  ? parallel      
BD 3  4  ? parallel      
BD 4  5  ? parallel      
BD 5  6  ? parallel      
BD 6  7  ? parallel      
BD 7  8  ? anti-parallel 
BE 1  2  ? anti-parallel 
BE 2  3  ? anti-parallel 
BE 3  4  ? anti-parallel 
BE 4  5  ? anti-parallel 
BE 5  6  ? anti-parallel 
BE 6  7  ? anti-parallel 
BE 7  8  ? anti-parallel 
BE 8  9  ? anti-parallel 
BE 9  10 ? anti-parallel 
BE 10 11 ? anti-parallel 
BE 11 12 ? anti-parallel 
BE 12 13 ? anti-parallel 
BE 13 14 ? anti-parallel 
BF 1  2  ? anti-parallel 
BG 1  2  ? parallel      
BG 2  3  ? parallel      
BG 3  4  ? parallel      
BG 4  5  ? parallel      
BG 5  6  ? parallel      
BG 6  7  ? parallel      
BH 1  2  ? anti-parallel 
BH 2  3  ? anti-parallel 
BH 3  4  ? anti-parallel 
BH 4  5  ? anti-parallel 
BH 5  6  ? anti-parallel 
BI 1  2  ? anti-parallel 
BJ 1  2  ? parallel      
BJ 2  3  ? parallel      
BJ 3  4  ? parallel      
BJ 4  5  ? parallel      
BJ 5  6  ? parallel      
BJ 6  7  ? parallel      
BJ 7  8  ? anti-parallel 
BK 1  2  ? parallel      
BK 2  3  ? parallel      
BK 3  4  ? parallel      
BK 4  5  ? parallel      
BK 5  6  ? parallel      
BK 6  7  ? parallel      
BK 7  8  ? anti-parallel 
BL 1  2  ? anti-parallel 
BM 1  2  ? anti-parallel 
BM 2  3  ? anti-parallel 
BM 3  4  ? anti-parallel 
BM 4  5  ? anti-parallel 
BM 5  6  ? anti-parallel 
BM 6  7  ? anti-parallel 
BN 1  2  ? anti-parallel 
BO 1  2  ? parallel      
BO 2  3  ? parallel      
BO 3  4  ? parallel      
BO 4  5  ? parallel      
BO 5  6  ? parallel      
BO 6  7  ? parallel      
BP 1  2  ? anti-parallel 
BQ 1  2  ? anti-parallel 
BR 1  2  ? parallel      
BR 2  3  ? parallel      
BR 3  4  ? parallel      
BR 4  5  ? parallel      
BR 5  6  ? parallel      
BR 6  7  ? parallel      
BR 7  8  ? anti-parallel 
BS 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  LYS A 62  ? LEU A 68  ? LYS A 62  LEU A 68  
A  2  GLU A 53  ? PHE A 57  ? GLU A 53  PHE A 57  
A  3  LEU A 89  ? ILE A 96  ? LEU A 89  ILE A 96  
A  4  THR A 30  ? GLY A 37  ? THR A 30  GLY A 37  
A  5  ILE A 40  ? GLY A 45  ? ILE A 40  GLY A 45  
A  6  VAL A 73  ? LEU A 77  ? VAL A 73  LEU A 77  
A  7  LYS A 62  ? LEU A 68  ? LYS A 62  LEU A 68  
A  8  THR E 16  ? ILE E 23  ? THR E 10  ILE E 17  
A  9  LYS E 81  ? ASP E 84  ? LYS E 75  ASP E 78  
A  10 ALA E 42  ? ILE E 45  ? ALA E 36  ILE E 39  
A  11 LEU E 52  ? GLY E 61  ? LEU E 46  GLY E 55  
A  12 THR E 64  ? ALA E 69  ? THR E 58  ALA E 63  
A  13 ILE E 26  ? HIS E 30  ? ILE E 20  HIS E 24  
A  14 THR E 16  ? ILE E 23  ? THR E 10  ILE E 17  
B  1  ASP A 98  ? VAL A 101 ? ASP A 98  VAL A 101 
B  2  GLY A 127 ? ARG A 130 ? GLY A 127 ARG A 130 
C  1  VAL A 109 ? VAL A 110 ? VAL A 109 VAL A 110 
C  2  SER A 231 ? ALA A 236 ? SER A 231 ALA A 236 
C  3  TYR A 202 ? VAL A 208 ? TYR A 202 VAL A 208 
C  4  HIS A 265 ? ASP A 271 ? HIS A 265 ASP A 271 
C  5  SER A 322 ? GLU A 330 ? SER A 322 GLU A 330 
C  6  ALA A 312 ? LYS A 313 ? ALA A 312 LYS A 313 
D  1  VAL A 109 ? VAL A 110 ? VAL A 109 VAL A 110 
D  2  SER A 231 ? ALA A 236 ? SER A 231 ALA A 236 
D  3  TYR A 202 ? VAL A 208 ? TYR A 202 VAL A 208 
D  4  HIS A 265 ? ASP A 271 ? HIS A 265 ASP A 271 
D  5  SER A 322 ? GLU A 330 ? SER A 322 GLU A 330 
D  6  LEU A 168 ? GLY A 171 ? LEU A 168 GLY A 171 
D  7  GLY A 350 ? LEU A 354 ? GLY A 350 LEU A 354 
D  8  VAL A 373 ? SER A 374 ? VAL A 373 SER A 374 
E  1  PRO A 147 ? VAL A 148 ? PRO A 147 VAL A 148 
E  2  ILE A 161 ? GLY A 162 ? ILE A 161 GLY A 162 
F  1  LYS B 62  ? GLU B 69  ? LYS B 62  GLU B 69  
F  2  GLU B 53  ? PHE B 57  ? GLU B 53  PHE B 57  
F  3  LEU B 89  ? ILE B 96  ? LEU B 89  ILE B 96  
F  4  THR B 30  ? GLY B 37  ? THR B 30  GLY B 37  
F  5  ILE B 40  ? GLY B 45  ? ILE B 40  GLY B 45  
F  6  GLN B 72  ? LEU B 77  ? GLN B 72  LEU B 77  
F  7  LYS B 62  ? GLU B 69  ? LYS B 62  GLU B 69  
F  8  ILE F 15  ? ILE F 23  ? ILE F 9   ILE F 17  
F  9  LYS F 81  ? PRO F 88  ? LYS F 75  PRO F 82  
F  10 ASN F 41  ? LYS F 46  ? ASN F 35  LYS F 40  
F  11 LYS F 51  ? GLY F 61  ? LYS F 45  GLY F 55  
F  12 THR F 64  ? ALA F 69  ? THR F 58  ALA F 63  
F  13 ILE F 26  ? PHE F 31  ? ILE F 20  PHE F 25  
F  14 ILE F 15  ? ILE F 23  ? ILE F 9   ILE F 17  
G  1  ASP B 98  ? VAL B 101 ? ASP B 98  VAL B 101 
G  2  GLY B 127 ? ARG B 130 ? GLY B 127 ARG B 130 
H  1  VAL B 109 ? VAL B 110 ? VAL B 109 VAL B 110 
H  2  SER B 231 ? ALA B 236 ? SER B 231 ALA B 236 
H  3  TYR B 202 ? VAL B 208 ? TYR B 202 VAL B 208 
H  4  HIS B 265 ? ASP B 271 ? HIS B 265 ASP B 271 
H  5  SER B 322 ? GLU B 330 ? SER B 322 GLU B 330 
H  6  ALA B 312 ? LYS B 313 ? ALA B 312 LYS B 313 
I  1  VAL B 109 ? VAL B 110 ? VAL B 109 VAL B 110 
I  2  SER B 231 ? ALA B 236 ? SER B 231 ALA B 236 
I  3  TYR B 202 ? VAL B 208 ? TYR B 202 VAL B 208 
I  4  HIS B 265 ? ASP B 271 ? HIS B 265 ASP B 271 
I  5  SER B 322 ? GLU B 330 ? SER B 322 GLU B 330 
I  6  LEU B 168 ? GLY B 171 ? LEU B 168 GLY B 171 
I  7  GLY B 350 ? LEU B 354 ? GLY B 350 LEU B 354 
I  8  VAL B 373 ? SER B 374 ? VAL B 373 SER B 374 
J  1  PRO B 147 ? VAL B 148 ? PRO B 147 VAL B 148 
J  2  ILE B 161 ? GLY B 162 ? ILE B 161 GLY B 162 
K  1  LYS C 62  ? GLU C 69  ? LYS C 62  GLU C 69  
K  2  GLU C 53  ? PHE C 57  ? GLU C 53  PHE C 57  
K  3  LEU C 89  ? ILE C 96  ? LEU C 89  ILE C 96  
K  4  THR C 30  ? GLY C 37  ? THR C 30  GLY C 37  
K  5  ILE C 40  ? GLY C 45  ? ILE C 40  GLY C 45  
K  6  GLN C 72  ? LEU C 77  ? GLN C 72  LEU C 77  
K  7  LYS C 62  ? GLU C 69  ? LYS C 62  GLU C 69  
K  8  THR D 16  ? ILE D 23  ? THR D 10  ILE D 17  
K  9  LYS D 81  ? ASP D 84  ? LYS D 75  ASP D 78  
K  10 ALA D 42  ? LYS D 46  ? ALA D 36  LYS D 40  
K  11 LYS D 51  ? GLY D 61  ? LYS D 45  GLY D 55  
K  12 THR D 64  ? ALA D 69  ? THR D 58  ALA D 63  
K  13 ILE D 26  ? HIS D 30  ? ILE D 20  HIS D 24  
K  14 THR D 16  ? ILE D 23  ? THR D 10  ILE D 17  
L  1  ASP C 98  ? VAL C 101 ? ASP C 98  VAL C 101 
L  2  GLY C 127 ? ARG C 130 ? GLY C 127 ARG C 130 
M  1  VAL C 109 ? VAL C 110 ? VAL C 109 VAL C 110 
M  2  SER C 231 ? ALA C 236 ? SER C 231 ALA C 236 
M  3  TYR C 202 ? VAL C 208 ? TYR C 202 VAL C 208 
M  4  HIS C 265 ? ASP C 271 ? HIS C 265 ASP C 271 
M  5  SER C 322 ? THR C 331 ? SER C 322 THR C 331 
M  6  ALA C 312 ? LYS C 313 ? ALA C 312 LYS C 313 
N  1  VAL C 109 ? VAL C 110 ? VAL C 109 VAL C 110 
N  2  SER C 231 ? ALA C 236 ? SER C 231 ALA C 236 
N  3  TYR C 202 ? VAL C 208 ? TYR C 202 VAL C 208 
N  4  HIS C 265 ? ASP C 271 ? HIS C 265 ASP C 271 
N  5  SER C 322 ? THR C 331 ? SER C 322 THR C 331 
N  6  LEU C 168 ? ASP C 172 ? LEU C 168 ASP C 172 
N  7  GLY C 350 ? LEU C 354 ? GLY C 350 LEU C 354 
N  8  VAL C 373 ? SER C 374 ? VAL C 373 SER C 374 
O  1  PRO C 147 ? VAL C 148 ? PRO C 147 VAL C 148 
O  2  ILE C 161 ? GLY C 162 ? ILE C 161 GLY C 162 
P  1  SER D 90  ? PRO D 92  ? SER D 84  PRO D 86  
P  2  ARG D 120 ? PRO D 122 ? ARG D 114 PRO D 116 
Q  1  ILE D 101 ? ILE D 102 ? ILE D 95  ILE D 96  
Q  2  VAL D 221 ? GLY D 226 ? VAL D 215 GLY D 220 
Q  3  SER D 188 ? VAL D 193 ? SER D 182 VAL D 187 
Q  4  VAL D 257 ? ASP D 262 ? VAL D 251 ASP D 256 
Q  5  VAL D 310 ? TYR D 317 ? VAL D 304 TYR D 311 
Q  6  LYS D 158 ? GLY D 163 ? LYS D 152 GLY D 157 
Q  7  ALA D 337 ? VAL D 340 ? ALA D 331 VAL D 334 
Q  8  LYS D 360 ? SER D 361 ? LYS D 354 SER D 355 
R  1  SER E 90  ? PRO E 92  ? SER E 84  PRO E 86  
R  2  ARG E 120 ? PRO E 122 ? ARG E 114 PRO E 116 
S  1  ILE E 101 ? ILE E 102 ? ILE E 95  ILE E 96  
S  2  VAL E 221 ? GLN E 227 ? VAL E 215 GLN E 221 
S  3  SER E 188 ? GLU E 195 ? SER E 182 GLU E 189 
S  4  ASP E 256 ? ASP E 262 ? ASP E 250 ASP E 256 
S  5  SER E 309 ? ALA E 315 ? SER E 303 ALA E 309 
S  6  LYS E 158 ? PHE E 162 ? LYS E 152 PHE E 156 
S  7  ALA E 337 ? VAL E 340 ? ALA E 331 VAL E 334 
T  1  ILE E 139 ? LEU E 140 ? ILE E 133 LEU E 134 
T  2  TYR E 153 ? ALA E 154 ? TYR E 147 ALA E 148 
U  1  SER F 90  ? VAL F 93  ? SER F 84  VAL F 87  
U  2  LEU F 119 ? PRO F 122 ? LEU F 113 PRO F 116 
V  1  ILE F 101 ? ILE F 102 ? ILE F 95  ILE F 96  
V  2  VAL F 221 ? GLY F 226 ? VAL F 215 GLY F 220 
V  3  PHE F 187 ? VAL F 193 ? PHE F 181 VAL F 187 
V  4  VAL F 257 ? ASP F 262 ? VAL F 251 ASP F 256 
V  5  VAL F 310 ? TYR F 317 ? VAL F 304 TYR F 311 
V  6  LYS F 158 ? GLY F 163 ? LYS F 152 GLY F 157 
V  7  ALA F 337 ? VAL F 340 ? ALA F 331 VAL F 334 
V  8  LYS F 360 ? SER F 361 ? LYS F 354 SER F 355 
W  1  ILE F 139 ? LEU F 140 ? ILE F 133 LEU F 134 
W  2  TYR F 153 ? ALA F 154 ? TYR F 147 ALA F 148 
X  1  PHE G 175 ? ILE G 182 ? PHE G 175 ILE G 182 
X  2  LYS G 161 ? PRO G 169 ? LYS G 161 PRO G 169 
X  3  GLU G 72  ? ILE G 77  ? GLU G 72  ILE G 77  
X  4  ASP G 106 ? ILE G 110 ? ASP G 106 ILE G 110 
X  5  ILE G 126 ? ILE G 130 ? ILE G 126 ILE G 130 
X  6  PHE I 43  ? GLN I 46  ? PHE I 43  GLN I 46  
X  7  ILE I 59  ? THR I 60  ? ILE I 59  THR I 60  
Y  1  LEU H 12  ? ALA H 15  ? LEU H 12  ALA H 15  
Y  2  LEU H 83  ? THR H 86  ? LEU H 83  THR H 86  
Y  3  GLY H 73  ? VAL H 77  ? GLY H 73  VAL H 77  
Y  4  VAL H 49  ? LEU H 52  ? VAL H 49  LEU H 52  
Z  1  VAL H 30  ? ASN H 31  ? VAL H 30  ASN H 31  
Z  2  GLY H 40  ? VAL H 41  ? GLY H 40  VAL H 41  
AA 1  GLY H 55  ? VAL H 59  ? GLY H 55  VAL H 59  
AA 2  LYS H 66  ? ILE H 70  ? LYS H 66  ILE H 70  
AB 1  LYS J 62  ? GLU J 69  ? LYS J 62  GLU J 69  
AB 2  GLU J 53  ? PHE J 57  ? GLU J 53  PHE J 57  
AB 3  LEU J 89  ? ILE J 96  ? LEU J 89  ILE J 96  
AB 4  THR J 30  ? GLY J 37  ? THR J 30  GLY J 37  
AB 5  ILE J 40  ? GLY J 45  ? ILE J 40  GLY J 45  
AB 6  GLN J 72  ? LEU J 77  ? GLN J 72  LEU J 77  
AB 7  LYS J 62  ? GLU J 69  ? LYS J 62  GLU J 69  
AB 8  THR N 16  ? ILE N 23  ? THR N 10  ILE N 17  
AB 9  LYS N 81  ? PRO N 88  ? LYS N 75  PRO N 82  
AB 10 ASN N 41  ? LYS N 46  ? ASN N 35  LYS N 40  
AB 11 LYS N 51  ? GLY N 61  ? LYS N 45  GLY N 55  
AB 12 THR N 64  ? ALA N 69  ? THR N 58  ALA N 63  
AB 13 ILE N 26  ? HIS N 30  ? ILE N 20  HIS N 24  
AB 14 THR N 16  ? ILE N 23  ? THR N 10  ILE N 17  
AC 1  ASP J 98  ? VAL J 101 ? ASP J 98  VAL J 101 
AC 2  GLY J 127 ? ARG J 130 ? GLY J 127 ARG J 130 
AD 1  VAL J 109 ? VAL J 110 ? VAL J 109 VAL J 110 
AD 2  SER J 231 ? ALA J 236 ? SER J 231 ALA J 236 
AD 3  TYR J 202 ? VAL J 208 ? TYR J 202 VAL J 208 
AD 4  HIS J 265 ? ASP J 271 ? HIS J 265 ASP J 271 
AD 5  SER J 322 ? THR J 331 ? SER J 322 THR J 331 
AD 6  ALA J 312 ? LYS J 313 ? ALA J 312 LYS J 313 
AE 1  VAL J 109 ? VAL J 110 ? VAL J 109 VAL J 110 
AE 2  SER J 231 ? ALA J 236 ? SER J 231 ALA J 236 
AE 3  TYR J 202 ? VAL J 208 ? TYR J 202 VAL J 208 
AE 4  HIS J 265 ? ASP J 271 ? HIS J 265 ASP J 271 
AE 5  SER J 322 ? THR J 331 ? SER J 322 THR J 331 
AE 6  GLU J 167 ? ASP J 172 ? GLU J 167 ASP J 172 
AE 7  GLY J 350 ? LEU J 354 ? GLY J 350 LEU J 354 
AE 8  VAL J 373 ? SER J 374 ? VAL J 373 SER J 374 
AF 1  PRO J 147 ? VAL J 148 ? PRO J 147 VAL J 148 
AF 2  ILE J 161 ? GLY J 162 ? ILE J 161 GLY J 162 
AG 1  THR K 30  ? GLY K 37  ? THR K 30  GLY K 37  
AG 2  ILE K 40  ? GLY K 45  ? ILE K 40  GLY K 45  
AG 3  GLN K 72  ? LEU K 77  ? GLN K 72  LEU K 77  
AG 4  LYS K 62  ? GLU K 69  ? LYS K 62  GLU K 69  
AG 5  GLU K 53  ? PHE K 57  ? GLU K 53  PHE K 57  
AG 6  LEU K 89  ? ILE K 96  ? LEU K 89  ILE K 96  
AG 7  THR K 30  ? GLY K 37  ? THR K 30  GLY K 37  
AH 1  ASP K 98  ? VAL K 101 ? ASP K 98  VAL K 101 
AH 2  GLY K 127 ? ARG K 130 ? GLY K 127 ARG K 130 
AI 1  VAL K 109 ? ASP K 111 ? VAL K 109 ASP K 111 
AI 2  SER K 231 ? ALA K 236 ? SER K 231 ALA K 236 
AI 3  LEU K 201 ? VAL K 208 ? LEU K 201 VAL K 208 
AI 4  HIS K 265 ? ASP K 271 ? HIS K 265 ASP K 271 
AI 5  SER K 322 ? THR K 331 ? SER K 322 THR K 331 
AI 6  ALA K 312 ? LYS K 313 ? ALA K 312 LYS K 313 
AJ 1  VAL K 109 ? ASP K 111 ? VAL K 109 ASP K 111 
AJ 2  SER K 231 ? ALA K 236 ? SER K 231 ALA K 236 
AJ 3  LEU K 201 ? VAL K 208 ? LEU K 201 VAL K 208 
AJ 4  HIS K 265 ? ASP K 271 ? HIS K 265 ASP K 271 
AJ 5  SER K 322 ? THR K 331 ? SER K 322 THR K 331 
AJ 6  LEU K 168 ? ASP K 172 ? LEU K 168 ASP K 172 
AJ 7  GLY K 350 ? LEU K 354 ? GLY K 350 LEU K 354 
AJ 8  VAL K 373 ? SER K 374 ? VAL K 373 SER K 374 
AK 1  PRO K 147 ? VAL K 148 ? PRO K 147 VAL K 148 
AK 2  ILE K 161 ? GLY K 162 ? ILE K 161 GLY K 162 
AL 1  LYS L 62  ? LEU L 68  ? LYS L 62  LEU L 68  
AL 2  GLU L 53  ? PHE L 57  ? GLU L 53  PHE L 57  
AL 3  LEU L 89  ? ILE L 96  ? LEU L 89  ILE L 96  
AL 4  THR L 30  ? GLY L 37  ? THR L 30  GLY L 37  
AL 5  ILE L 40  ? GLY L 45  ? ILE L 40  GLY L 45  
AL 6  VAL L 73  ? LEU L 77  ? VAL L 73  LEU L 77  
AL 7  LYS L 62  ? LEU L 68  ? LYS L 62  LEU L 68  
AL 8  THR M 16  ? ILE M 23  ? THR M 10  ILE M 17  
AL 9  LYS M 81  ? ASP M 84  ? LYS M 75  ASP M 78  
AL 10 ALA M 42  ? LYS M 46  ? ALA M 36  LYS M 40  
AL 11 LYS M 51  ? GLY M 61  ? LYS M 45  GLY M 55  
AL 12 THR M 64  ? ALA M 69  ? THR M 58  ALA M 63  
AL 13 ILE M 26  ? HIS M 30  ? ILE M 20  HIS M 24  
AL 14 THR M 16  ? ILE M 23  ? THR M 10  ILE M 17  
AM 1  ASP L 98  ? VAL L 101 ? ASP L 98  VAL L 101 
AM 2  GLY L 127 ? ARG L 130 ? GLY L 127 ARG L 130 
AN 1  VAL L 109 ? ASP L 111 ? VAL L 109 ASP L 111 
AN 2  SER L 231 ? ALA L 236 ? SER L 231 ALA L 236 
AN 3  TYR L 202 ? VAL L 208 ? TYR L 202 VAL L 208 
AN 4  HIS L 265 ? ASP L 271 ? HIS L 265 ASP L 271 
AN 5  SER L 322 ? GLU L 330 ? SER L 322 GLU L 330 
AN 6  LEU L 168 ? GLY L 171 ? LEU L 168 GLY L 171 
AN 7  GLN L 351 ? LEU L 354 ? GLN L 351 LEU L 354 
AO 1  PRO L 147 ? VAL L 148 ? PRO L 147 VAL L 148 
AO 2  ILE L 161 ? GLY L 162 ? ILE L 161 GLY L 162 
AP 1  SER M 90  ? PRO M 92  ? SER M 84  PRO M 86  
AP 2  ARG M 120 ? PRO M 122 ? ARG M 114 PRO M 116 
AQ 1  ILE M 101 ? ILE M 102 ? ILE M 95  ILE M 96  
AQ 2  VAL M 221 ? GLY M 226 ? VAL M 215 GLY M 220 
AQ 3  SER M 188 ? VAL M 193 ? SER M 182 VAL M 187 
AQ 4  VAL M 257 ? ASP M 262 ? VAL M 251 ASP M 256 
AQ 5  VAL M 310 ? TYR M 317 ? VAL M 304 TYR M 311 
AQ 6  LYS M 158 ? GLY M 163 ? LYS M 152 GLY M 157 
AQ 7  ALA M 337 ? VAL M 340 ? ALA M 331 VAL M 334 
AQ 8  LYS M 360 ? SER M 361 ? LYS M 354 SER M 355 
AR 1  ILE M 139 ? LEU M 140 ? ILE M 133 LEU M 134 
AR 2  TYR M 153 ? ALA M 154 ? TYR M 147 ALA M 148 
AS 1  SER N 90  ? PRO N 92  ? SER N 84  PRO N 86  
AS 2  ARG N 120 ? PRO N 122 ? ARG N 114 PRO N 116 
AT 1  ILE N 101 ? ILE N 102 ? ILE N 95  ILE N 96  
AT 2  VAL N 221 ? GLN N 227 ? VAL N 215 GLN N 221 
AT 3  SER N 188 ? GLU N 195 ? SER N 182 GLU N 189 
AT 4  ASP N 256 ? ASP N 262 ? ASP N 250 ASP N 256 
AT 5  SER N 309 ? ALA N 315 ? SER N 303 ALA N 309 
AT 6  LYS N 158 ? PHE N 162 ? LYS N 152 PHE N 156 
AT 7  ALA N 337 ? VAL N 340 ? ALA N 331 VAL N 334 
AU 1  ILE N 139 ? LEU N 140 ? ILE N 133 LEU N 134 
AU 2  TYR N 153 ? ALA N 154 ? TYR N 147 ALA N 148 
AV 1  THR O 16  ? ILE O 23  ? THR O 10  ILE O 17  
AV 2  ILE O 26  ? PHE O 31  ? ILE O 20  PHE O 25  
AV 3  THR O 64  ? ALA O 69  ? THR O 58  ALA O 63  
AV 4  LYS O 51  ? GLY O 61  ? LYS O 45  GLY O 55  
AV 5  ALA O 42  ? LYS O 46  ? ALA O 36  LYS O 40  
AV 6  LYS O 81  ? ASP O 84  ? LYS O 75  ASP O 78  
AV 7  THR O 16  ? ILE O 23  ? THR O 10  ILE O 17  
AW 1  PRO O 92  ? VAL O 93  ? PRO O 86  VAL O 87  
AW 2  LEU O 119 ? ARG O 120 ? LEU O 113 ARG O 114 
AX 1  ILE O 101 ? ILE O 102 ? ILE O 95  ILE O 96  
AX 2  VAL O 221 ? GLY O 226 ? VAL O 215 GLY O 220 
AX 3  SER O 188 ? VAL O 193 ? SER O 182 VAL O 187 
AX 4  ASP O 256 ? ASP O 262 ? ASP O 250 ASP O 256 
AX 5  SER O 309 ? TYR O 317 ? SER O 303 TYR O 311 
AX 6  LYS O 158 ? GLY O 163 ? LYS O 152 GLY O 157 
AX 7  ALA O 337 ? VAL O 340 ? ALA O 331 VAL O 334 
AX 8  LYS O 360 ? SER O 361 ? LYS O 354 SER O 355 
AY 1  LEU P 128 ? ILE P 130 ? LEU P 128 ILE P 130 
AY 2  ASP P 106 ? ILE P 110 ? ASP P 106 ILE P 110 
AY 3  GLU P 72  ? ILE P 77  ? GLU P 72  ILE P 77  
AY 4  LYS P 161 ? PRO P 169 ? LYS P 161 PRO P 169 
AY 5  PHE P 175 ? PRO P 181 ? PHE P 175 PRO P 181 
AZ 1  PHE Q 74  ? THR Q 76  ? PHE Q 74  THR Q 76  
AZ 2  CYS Q 84  ? THR Q 86  ? CYS Q 84  THR Q 86  
BA 1  GLU V 44  ? THR V 47  ? GLU V 38  THR V 41  
BA 2  GLY V 50  ? HIS V 59  ? GLY V 44  HIS V 53  
BA 3  THR S 30  ? GLY S 37  ? THR S 30  GLY S 37  
BA 4  THR V 64  ? ALA V 69  ? THR V 58  ALA V 63  
BA 5  ILE V 26  ? HIS V 30  ? ILE V 20  HIS V 24  
BA 6  GLY V 17  ? ILE V 23  ? GLY V 11  ILE V 17  
BA 7  LYS V 81  ? VAL V 82  ? LYS V 75  VAL V 76  
BB 1  GLU V 44  ? THR V 47  ? GLU V 38  THR V 41  
BB 2  GLY V 50  ? HIS V 59  ? GLY V 44  HIS V 53  
BB 3  LEU S 89  ? LYS S 91  ? LEU S 89  LYS S 91  
BB 4  LEU S 54  ? PHE S 57  ? LEU S 54  PHE S 57  
BB 5  LYS S 62  ? LEU S 68  ? LYS S 62  LEU S 68  
BB 6  VAL S 73  ? LEU S 77  ? VAL S 73  LEU S 77  
BB 7  ILE S 40  ? GLY S 45  ? ILE S 40  GLY S 45  
BB 8  THR S 30  ? GLY S 37  ? THR S 30  GLY S 37  
BB 9  THR V 64  ? ALA V 69  ? THR V 58  ALA V 63  
BB 10 ILE V 26  ? HIS V 30  ? ILE V 20  HIS V 24  
BB 11 GLY V 17  ? ILE V 23  ? GLY V 11  ILE V 17  
BB 12 LYS V 81  ? VAL V 82  ? LYS V 75  VAL V 76  
BC 1  ASP S 98  ? PRO S 100 ? ASP S 98  PRO S 100 
BC 2  ARG S 128 ? ARG S 130 ? ARG S 128 ARG S 130 
BD 1  ARG S 108 ? ASP S 111 ? ARG S 108 ASP S 111 
BD 2  ILE S 232 ? ALA S 236 ? ILE S 232 ALA S 236 
BD 3  LEU S 201 ? VAL S 208 ? LEU S 201 VAL S 208 
BD 4  HIS S 265 ? ASP S 271 ? HIS S 265 ASP S 271 
BD 5  LEU S 323 ? GLU S 330 ? LEU S 323 GLU S 330 
BD 6  GLU S 167 ? GLY S 171 ? GLU S 167 GLY S 171 
BD 7  GLY S 350 ? PHE S 353 ? GLY S 350 PHE S 353 
BD 8  VAL S 373 ? SER S 374 ? VAL S 373 SER S 374 
BE 1  LYS T 62  ? LEU T 68  ? LYS T 62  LEU T 68  
BE 2  LEU T 54  ? GLU T 56  ? LEU T 54  GLU T 56  
BE 3  LEU T 89  ? LYS T 91  ? LEU T 89  LYS T 91  
BE 4  THR T 30  ? GLY T 37  ? THR T 30  GLY T 37  
BE 5  ILE T 40  ? GLY T 45  ? ILE T 40  GLY T 45  
BE 6  GLN T 72  ? LEU T 77  ? GLN T 72  LEU T 77  
BE 7  LYS T 62  ? LEU T 68  ? LYS T 62  LEU T 68  
BE 8  THR X 16  ? ILE X 23  ? THR X 10  ILE X 17  
BE 9  LYS X 81  ? PRO X 88  ? LYS X 75  PRO X 82  
BE 10 ASN X 41  ? LYS X 46  ? ASN X 35  LYS X 40  
BE 11 LYS X 51  ? GLY X 61  ? LYS X 45  GLY X 55  
BE 12 THR X 64  ? ALA X 69  ? THR X 58  ALA X 63  
BE 13 ILE X 26  ? HIS X 30  ? ILE X 20  HIS X 24  
BE 14 THR X 16  ? ILE X 23  ? THR X 10  ILE X 17  
BF 1  ASP T 98  ? PRO T 100 ? ASP T 98  PRO T 100 
BF 2  ARG T 128 ? ARG T 130 ? ARG T 128 ARG T 130 
BG 1  VAL T 109 ? ASP T 111 ? VAL T 109 ASP T 111 
BG 2  SER T 231 ? ALA T 236 ? SER T 231 ALA T 236 
BG 3  TYR T 202 ? VAL T 208 ? TYR T 202 VAL T 208 
BG 4  HIS T 265 ? ASP T 271 ? HIS T 265 ASP T 271 
BG 5  SER T 322 ? GLU T 330 ? SER T 322 GLU T 330 
BG 6  LEU T 168 ? GLY T 171 ? LEU T 168 GLY T 171 
BG 7  GLN T 351 ? LEU T 354 ? GLN T 351 LEU T 354 
BH 1  GLU U 53  ? PHE U 57  ? GLU U 53  PHE U 57  
BH 2  LEU U 89  ? ILE U 96  ? LEU U 89  ILE U 96  
BH 3  THR U 30  ? GLY U 37  ? THR U 30  GLY U 37  
BH 4  ILE U 40  ? GLY U 45  ? ILE U 40  GLY U 45  
BH 5  VAL U 73  ? LEU U 77  ? VAL U 73  LEU U 77  
BH 6  GLY U 63  ? ALA U 65  ? GLY U 63  ALA U 65  
BI 1  ASP U 98  ? VAL U 101 ? ASP U 98  VAL U 101 
BI 2  GLY U 127 ? ARG U 130 ? GLY U 127 ARG U 130 
BJ 1  ARG U 108 ? VAL U 110 ? ARG U 108 VAL U 110 
BJ 2  SER U 231 ? ALA U 236 ? SER U 231 ALA U 236 
BJ 3  LEU U 201 ? VAL U 208 ? LEU U 201 VAL U 208 
BJ 4  HIS U 265 ? ASP U 271 ? HIS U 265 ASP U 271 
BJ 5  SER U 322 ? THR U 331 ? SER U 322 THR U 331 
BJ 6  LEU U 168 ? ASP U 172 ? LEU U 168 ASP U 172 
BJ 7  GLY U 350 ? LEU U 354 ? GLY U 350 LEU U 354 
BJ 8  VAL U 373 ? SER U 374 ? VAL U 373 SER U 374 
BK 1  ILE V 101 ? ILE V 102 ? ILE V 95  ILE V 96  
BK 2  VAL V 221 ? GLY V 226 ? VAL V 215 GLY V 220 
BK 3  SER V 188 ? VAL V 193 ? SER V 182 VAL V 187 
BK 4  VAL V 257 ? ASP V 262 ? VAL V 251 ASP V 256 
BK 5  VAL V 310 ? TYR V 317 ? VAL V 304 TYR V 311 
BK 6  LYS V 158 ? GLY V 163 ? LYS V 152 GLY V 157 
BK 7  ALA V 337 ? LEU V 341 ? ALA V 331 LEU V 335 
BK 8  LYS V 360 ? SER V 361 ? LYS V 354 SER V 355 
BL 1  ILE V 139 ? LEU V 140 ? ILE V 133 LEU V 134 
BL 2  TYR V 153 ? ALA V 154 ? TYR V 147 ALA V 148 
BM 1  THR W 16  ? ILE W 23  ? THR W 10  ILE W 17  
BM 2  ILE W 26  ? HIS W 30  ? ILE W 20  HIS W 24  
BM 3  THR W 64  ? ALA W 69  ? THR W 58  ALA W 63  
BM 4  LYS W 51  ? GLY W 61  ? LYS W 45  GLY W 55  
BM 5  ALA W 42  ? LYS W 46  ? ALA W 36  LYS W 40  
BM 6  LYS W 81  ? ASP W 84  ? LYS W 75  ASP W 78  
BM 7  THR W 16  ? ILE W 23  ? THR W 10  ILE W 17  
BN 1  SER W 90  ? VAL W 93  ? SER W 84  VAL W 87  
BN 2  LEU W 119 ? PRO W 122 ? LEU W 113 PRO W 116 
BO 1  ILE W 101 ? ILE W 102 ? ILE W 95  ILE W 96  
BO 2  VAL W 221 ? GLN W 227 ? VAL W 215 GLN W 221 
BO 3  SER W 188 ? GLU W 195 ? SER W 182 GLU W 189 
BO 4  ASP W 256 ? ASP W 262 ? ASP W 250 ASP W 256 
BO 5  SER W 309 ? ALA W 315 ? SER W 303 ALA W 309 
BO 6  ILE W 159 ? PHE W 162 ? ILE W 153 PHE W 156 
BO 7  ALA W 337 ? VAL W 340 ? ALA W 331 VAL W 334 
BP 1  ILE W 139 ? LEU W 140 ? ILE W 133 LEU W 134 
BP 2  TYR W 153 ? ALA W 154 ? TYR W 147 ALA W 148 
BQ 1  SER X 90  ? PRO X 92  ? SER X 84  PRO X 86  
BQ 2  ARG X 120 ? PRO X 122 ? ARG X 114 PRO X 116 
BR 1  ILE X 101 ? ILE X 102 ? ILE X 95  ILE X 96  
BR 2  VAL X 221 ? GLY X 226 ? VAL X 215 GLY X 220 
BR 3  SER X 188 ? VAL X 193 ? SER X 182 VAL X 187 
BR 4  ASP X 256 ? ASP X 262 ? ASP X 250 ASP X 256 
BR 5  SER X 309 ? TYR X 317 ? SER X 303 TYR X 311 
BR 6  LYS X 158 ? GLY X 163 ? LYS X 152 GLY X 157 
BR 7  ALA X 337 ? VAL X 340 ? ALA X 331 VAL X 334 
BR 8  LYS X 360 ? SER X 361 ? LYS X 354 SER X 355 
BS 1  ILE X 139 ? LEU X 140 ? ILE X 133 LEU X 134 
BS 2  TYR X 153 ? ALA X 154 ? TYR X 147 ALA X 148 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  O ALA A 65  ? O ALA A 65  N GLU A 53  ? N GLU A 53  
A  2  3  N GLU A 56  ? N GLU A 56  O LYS A 91  ? O LYS A 91  
A  3  4  O VAL A 90  ? O VAL A 90  N GLY A 31  ? N GLY A 31  
A  4  5  N ARG A 32  ? N ARG A 32  O PHE A 44  ? O PHE A 44  
A  5  6  N ALA A 41  ? N ALA A 41  O ILE A 75  ? O ILE A 75  
A  6  7  O GLY A 74  ? O GLY A 74  N ASN A 67  ? N ASN A 67  
A  7  8  N LEU A 68  ? N LEU A 68  O VAL E 22  ? O VAL E 16  
A  8  9  N GLY E 17  ? N GLY E 11  O VAL E 82  ? O VAL E 76  
A  9  10 O LEU E 83  ? O LEU E 77  N GLU E 44  ? N GLU E 38  
A  10 11 N ILE E 45  ? N ILE E 39  O LEU E 52  ? O LEU E 46  
A  11 12 N ALA E 57  ? N ALA E 51  O ARG E 66  ? O ARG E 60  
A  12 13 O VAL E 65  ? O VAL E 59  N VAL E 29  ? N VAL E 23  
A  13 14 O ASP E 28  ? O ASP E 22  N THR E 20  ? N THR E 14  
B  1  2  N VAL A 99  ? N VAL A 99  O SER A 129 ? O SER A 129 
C  1  2  N VAL A 110 ? N VAL A 110 O ALA A 235 ? O ALA A 235 
C  2  3  O ILE A 232 ? O ILE A 232 N TYR A 205 ? N TYR A 205 
C  3  4  N VAL A 204 ? N VAL A 204 O LEU A 267 ? O LEU A 267 
C  4  5  N ILE A 268 ? N ILE A 268 O LEU A 326 ? O LEU A 326 
C  5  6  O LEU A 323 ? O LEU A 323 N ALA A 312 ? N ALA A 312 
D  1  2  N VAL A 110 ? N VAL A 110 O ALA A 235 ? O ALA A 235 
D  2  3  O ILE A 232 ? O ILE A 232 N TYR A 205 ? N TYR A 205 
D  3  4  N VAL A 204 ? N VAL A 204 O LEU A 267 ? O LEU A 267 
D  4  5  N ILE A 268 ? N ILE A 268 O LEU A 326 ? O LEU A 326 
D  5  6  O PRO A 327 ? O PRO A 327 N ILE A 169 ? N ILE A 169 
D  6  7  N LEU A 168 ? N LEU A 168 O ILE A 352 ? O ILE A 352 
D  7  8  N GLN A 351 ? N GLN A 351 O VAL A 373 ? O VAL A 373 
E  1  2  N VAL A 148 ? N VAL A 148 O ILE A 161 ? O ILE A 161 
F  1  2  O ALA B 65  ? O ALA B 65  N GLU B 53  ? N GLU B 53  
F  2  3  N GLU B 56  ? N GLU B 56  O LYS B 91  ? O LYS B 91  
F  3  4  O VAL B 90  ? O VAL B 90  N GLY B 31  ? N GLY B 31  
F  4  5  N LEU B 34  ? N LEU B 34  O ARG B 42  ? O ARG B 42  
F  5  6  N VAL B 43  ? N VAL B 43  O VAL B 73  ? O VAL B 73  
F  6  7  O GLN B 72  ? O GLN B 72  N GLU B 69  ? N GLU B 69  
F  7  8  N LEU B 68  ? N LEU B 68  O VAL F 22  ? O VAL F 16  
F  8  9  N GLY F 17  ? N GLY F 11  O VAL F 82  ? O VAL F 76  
F  9  10 O GLY F 87  ? O GLY F 81  N ALA F 42  ? N ALA F 36  
F  10 11 N LEU F 43  ? N LEU F 37  O LEU F 54  ? O LEU F 48  
F  11 12 N ALA F 57  ? N ALA F 51  O ARG F 66  ? O ARG F 60  
F  12 13 O VAL F 65  ? O VAL F 59  N VAL F 29  ? N VAL F 23  
F  13 14 O HIS F 30  ? O HIS F 24  N LYS F 18  ? N LYS F 12  
G  1  2  N VAL B 99  ? N VAL B 99  O SER B 129 ? O SER B 129 
H  1  2  N VAL B 110 ? N VAL B 110 O ILE B 233 ? O ILE B 233 
H  2  3  O ILE B 232 ? O ILE B 232 N CYS B 203 ? N CYS B 203 
H  3  4  N VAL B 204 ? N VAL B 204 O LEU B 267 ? O LEU B 267 
H  4  5  N ILE B 268 ? N ILE B 268 O LEU B 326 ? O LEU B 326 
H  5  6  O LEU B 323 ? O LEU B 323 N ALA B 312 ? N ALA B 312 
I  1  2  N VAL B 110 ? N VAL B 110 O ILE B 233 ? O ILE B 233 
I  2  3  O ILE B 232 ? O ILE B 232 N CYS B 203 ? N CYS B 203 
I  3  4  N VAL B 204 ? N VAL B 204 O LEU B 267 ? O LEU B 267 
I  4  5  N ILE B 268 ? N ILE B 268 O LEU B 326 ? O LEU B 326 
I  5  6  O PRO B 327 ? O PRO B 327 N ILE B 169 ? N ILE B 169 
I  6  7  N LEU B 168 ? N LEU B 168 O ILE B 352 ? O ILE B 352 
I  7  8  N GLN B 351 ? N GLN B 351 O VAL B 373 ? O VAL B 373 
J  1  2  N VAL B 148 ? N VAL B 148 O ILE B 161 ? O ILE B 161 
K  1  2  O GLY C 63  ? O GLY C 63  N VAL C 55  ? N VAL C 55  
K  2  3  N LEU C 54  ? N LEU C 54  O ASN C 95  ? O ASN C 95  
K  3  4  O VAL C 90  ? O VAL C 90  N GLY C 31  ? N GLY C 31  
K  4  5  N LEU C 34  ? N LEU C 34  O ARG C 42  ? O ARG C 42  
K  5  6  N VAL C 43  ? N VAL C 43  O VAL C 73  ? O VAL C 73  
K  6  7  O GLY C 74  ? O GLY C 74  N ASN C 67  ? N ASN C 67  
K  7  8  N LEU C 68  ? N LEU C 68  O VAL D 22  ? O VAL D 16  
K  8  9  N GLY D 17  ? N GLY D 11  O VAL D 82  ? O VAL D 76  
K  9  10 O LEU D 83  ? O LEU D 77  N GLU D 44  ? N GLU D 38  
K  10 11 N LEU D 43  ? N LEU D 37  O LEU D 54  ? O LEU D 48  
K  11 12 N ALA D 57  ? N ALA D 51  O ARG D 66  ? O ARG D 60  
K  12 13 O VAL D 65  ? O VAL D 59  N VAL D 29  ? N VAL D 23  
K  13 14 O ASP D 28  ? O ASP D 22  N THR D 20  ? N THR D 14  
L  1  2  N VAL C 101 ? N VAL C 101 O GLY C 127 ? O GLY C 127 
M  1  2  N VAL C 110 ? N VAL C 110 O ILE C 233 ? O ILE C 233 
M  2  3  O ALA C 236 ? O ALA C 236 N ALA C 207 ? N ALA C 207 
M  3  4  N VAL C 206 ? N VAL C 206 O VAL C 269 ? O VAL C 269 
M  4  5  N ILE C 268 ? N ILE C 268 O LEU C 326 ? O LEU C 326 
M  5  6  O LEU C 323 ? O LEU C 323 N ALA C 312 ? N ALA C 312 
N  1  2  N VAL C 110 ? N VAL C 110 O ILE C 233 ? O ILE C 233 
N  2  3  O ALA C 236 ? O ALA C 236 N ALA C 207 ? N ALA C 207 
N  3  4  N VAL C 206 ? N VAL C 206 O VAL C 269 ? O VAL C 269 
N  4  5  N ILE C 268 ? N ILE C 268 O LEU C 326 ? O LEU C 326 
N  5  6  O PRO C 327 ? O PRO C 327 N ILE C 169 ? N ILE C 169 
N  6  7  N ILE C 170 ? N ILE C 170 O LEU C 354 ? O LEU C 354 
N  7  8  N GLN C 351 ? N GLN C 351 O VAL C 373 ? O VAL C 373 
O  1  2  N VAL C 148 ? N VAL C 148 O ILE C 161 ? O ILE C 161 
P  1  2  N VAL D 91  ? N VAL D 85  O LYS D 121 ? O LYS D 115 
Q  1  2  N ILE D 102 ? N ILE D 96  O LEU D 223 ? O LEU D 217 
Q  2  3  O VAL D 224 ? O VAL D 218 N GLY D 192 ? N GLY D 186 
Q  3  4  N VAL D 189 ? N VAL D 183 O LEU D 258 ? O LEU D 252 
Q  4  5  N ILE D 261 ? N ILE D 255 O ALA D 315 ? O ALA D 309 
Q  5  6  O SER D 312 ? O SER D 306 N ILE D 159 ? N ILE D 153 
Q  6  7  N GLY D 160 ? N GLY D 154 O THR D 339 ? O THR D 333 
Q  7  8  N THR D 338 ? N THR D 332 O LYS D 360 ? O LYS D 354 
R  1  2  N VAL E 91  ? N VAL E 85  O LYS E 121 ? O LYS E 115 
S  1  2  N ILE E 102 ? N ILE E 96  O PHE E 225 ? O PHE E 219 
S  2  3  O GLY E 226 ? O GLY E 220 N GLY E 192 ? N GLY E 186 
S  3  4  N THR E 191 ? N THR E 185 O PHE E 260 ? O PHE E 254 
S  4  5  N VAL E 257 ? N VAL E 251 O THR E 311 ? O THR E 305 
S  5  6  O GLN E 314 ? O GLN E 308 N LEU E 161 ? N LEU E 155 
S  6  7  N GLY E 160 ? N GLY E 154 O ALA E 337 ? O ALA E 331 
T  1  2  N LEU E 140 ? N LEU E 134 O TYR E 153 ? O TYR E 147 
U  1  2  N VAL F 91  ? N VAL F 85  O LYS F 121 ? O LYS F 115 
V  1  2  N ILE F 102 ? N ILE F 96  O PHE F 225 ? O PHE F 219 
V  2  3  O VAL F 224 ? O VAL F 218 N GLY F 192 ? N GLY F 186 
V  3  4  N THR F 191 ? N THR F 185 O PHE F 260 ? O PHE F 254 
V  4  5  N ILE F 261 ? N ILE F 255 O ALA F 315 ? O ALA F 309 
V  5  6  O VAL F 316 ? O VAL F 310 N LEU F 161 ? N LEU F 155 
V  6  7  N PHE F 162 ? N PHE F 156 O THR F 339 ? O THR F 333 
V  7  8  N THR F 338 ? N THR F 332 O LYS F 360 ? O LYS F 354 
W  1  2  N LEU F 140 ? N LEU F 134 O TYR F 153 ? O TYR F 147 
X  1  2  O SER G 178 ? O SER G 178 N TYR G 166 ? N TYR G 166 
X  2  3  O PHE G 165 ? O PHE G 165 N ILE G 77  ? N ILE G 77  
X  3  4  N ALA G 76  ? N ALA G 76  O ILE G 110 ? O ILE G 110 
X  4  5  N THR G 109 ? N THR G 109 O ILE G 130 ? O ILE G 130 
X  5  6  N SER G 129 ? N SER G 129 O THR I 45  ? O THR I 45  
X  6  7  N TYR I 44  ? N TYR I 44  O ILE I 59  ? O ILE I 59  
Y  1  2  N GLN H 13  ? N GLN H 13  O VAL H 85  ? O VAL H 85  
Y  2  3  O CYS H 84  ? O CYS H 84  N THR H 76  ? N THR H 76  
Y  3  4  O GLY H 73  ? O GLY H 73  N LEU H 52  ? N LEU H 52  
Z  1  2  N VAL H 30  ? N VAL H 30  O VAL H 41  ? O VAL H 41  
AA 1  2  N GLY H 55  ? N GLY H 55  O ILE H 70  ? O ILE H 70  
AB 1  2  O GLY J 63  ? O GLY J 63  N VAL J 55  ? N VAL J 55  
AB 2  3  N LEU J 54  ? N LEU J 54  O ASN J 95  ? O ASN J 95  
AB 3  4  O VAL J 90  ? O VAL J 90  N GLY J 31  ? N GLY J 31  
AB 4  5  N LEU J 34  ? N LEU J 34  O ARG J 42  ? O ARG J 42  
AB 5  6  N ALA J 41  ? N ALA J 41  O ILE J 75  ? O ILE J 75  
AB 6  7  O GLY J 74  ? O GLY J 74  N ASN J 67  ? N ASN J 67  
AB 7  8  N LEU J 68  ? N LEU J 68  O VAL N 22  ? O VAL N 16  
AB 8  9  N GLY N 17  ? N GLY N 11  O VAL N 82  ? O VAL N 76  
AB 9  10 O GLY N 87  ? O GLY N 81  N ALA N 42  ? N ALA N 36  
AB 10 11 N LEU N 43  ? N LEU N 37  O LEU N 54  ? O LEU N 48  
AB 11 12 N ALA N 57  ? N ALA N 51  O ARG N 66  ? O ARG N 60  
AB 12 13 O VAL N 65  ? O VAL N 59  N VAL N 29  ? N VAL N 23  
AB 13 14 O ASP N 28  ? O ASP N 22  N THR N 20  ? N THR N 14  
AC 1  2  N VAL J 99  ? N VAL J 99  O SER J 129 ? O SER J 129 
AD 1  2  N VAL J 110 ? N VAL J 110 O ILE J 233 ? O ILE J 233 
AD 2  3  O ILE J 232 ? O ILE J 232 N TYR J 205 ? N TYR J 205 
AD 3  4  N VAL J 204 ? N VAL J 204 O LEU J 267 ? O LEU J 267 
AD 4  5  N ILE J 268 ? N ILE J 268 O THR J 324 ? O THR J 324 
AD 5  6  O LEU J 323 ? O LEU J 323 N ALA J 312 ? N ALA J 312 
AE 1  2  N VAL J 110 ? N VAL J 110 O ILE J 233 ? O ILE J 233 
AE 2  3  O ILE J 232 ? O ILE J 232 N TYR J 205 ? N TYR J 205 
AE 3  4  N VAL J 204 ? N VAL J 204 O LEU J 267 ? O LEU J 267 
AE 4  5  N ILE J 268 ? N ILE J 268 O THR J 324 ? O THR J 324 
AE 5  6  O PRO J 327 ? O PRO J 327 N ILE J 169 ? N ILE J 169 
AE 6  7  N LEU J 168 ? N LEU J 168 O ILE J 352 ? O ILE J 352 
AE 7  8  N GLN J 351 ? N GLN J 351 O VAL J 373 ? O VAL J 373 
AF 1  2  N VAL J 148 ? N VAL J 148 O ILE J 161 ? O ILE J 161 
AG 1  2  N LEU K 34  ? N LEU K 34  O ARG K 42  ? O ARG K 42  
AG 2  3  N ALA K 41  ? N ALA K 41  O ILE K 75  ? O ILE K 75  
AG 3  4  O GLY K 74  ? O GLY K 74  N LEU K 66  ? N LEU K 66  
AG 4  5  O ALA K 65  ? O ALA K 65  N GLU K 53  ? N GLU K 53  
AG 5  6  N LEU K 54  ? N LEU K 54  O ASN K 95  ? O ASN K 95  
AG 6  7  O VAL K 90  ? O VAL K 90  N GLY K 31  ? N GLY K 31  
AH 1  2  N VAL K 99  ? N VAL K 99  O SER K 129 ? O SER K 129 
AI 1  2  N VAL K 110 ? N VAL K 110 O ILE K 233 ? O ILE K 233 
AI 2  3  O VAL K 234 ? O VAL K 234 N TYR K 205 ? N TYR K 205 
AI 3  4  N TYR K 202 ? N TYR K 202 O LEU K 267 ? O LEU K 267 
AI 4  5  N ILE K 268 ? N ILE K 268 O THR K 324 ? O THR K 324 
AI 5  6  O LEU K 323 ? O LEU K 323 N ALA K 312 ? N ALA K 312 
AJ 1  2  N VAL K 110 ? N VAL K 110 O ILE K 233 ? O ILE K 233 
AJ 2  3  O VAL K 234 ? O VAL K 234 N TYR K 205 ? N TYR K 205 
AJ 3  4  N TYR K 202 ? N TYR K 202 O LEU K 267 ? O LEU K 267 
AJ 4  5  N ILE K 268 ? N ILE K 268 O THR K 324 ? O THR K 324 
AJ 5  6  O PRO K 327 ? O PRO K 327 N ILE K 169 ? N ILE K 169 
AJ 6  7  N LEU K 168 ? N LEU K 168 O ILE K 352 ? O ILE K 352 
AJ 7  8  N GLN K 351 ? N GLN K 351 O VAL K 373 ? O VAL K 373 
AK 1  2  N VAL K 148 ? N VAL K 148 O ILE K 161 ? O ILE K 161 
AL 1  2  O GLY L 63  ? O GLY L 63  N VAL L 55  ? N VAL L 55  
AL 2  3  N GLU L 56  ? N GLU L 56  O LYS L 91  ? O LYS L 91  
AL 3  4  O VAL L 90  ? O VAL L 90  N GLY L 31  ? N GLY L 31  
AL 4  5  N ARG L 32  ? N ARG L 32  O PHE L 44  ? O PHE L 44  
AL 5  6  N ALA L 41  ? N ALA L 41  O ILE L 75  ? O ILE L 75  
AL 6  7  O GLY L 74  ? O GLY L 74  N LEU L 66  ? N LEU L 66  
AL 7  8  N LEU L 68  ? N LEU L 68  O VAL M 22  ? O VAL M 16  
AL 8  9  N GLY M 17  ? N GLY M 11  O VAL M 82  ? O VAL M 76  
AL 9  10 O LEU M 83  ? O LEU M 77  N GLU M 44  ? N GLU M 38  
AL 10 11 N LEU M 43  ? N LEU M 37  O LEU M 54  ? O LEU M 48  
AL 11 12 N ALA M 57  ? N ALA M 51  O ARG M 66  ? O ARG M 60  
AL 12 13 O VAL M 65  ? O VAL M 59  N VAL M 29  ? N VAL M 23  
AL 13 14 O HIS M 30  ? O HIS M 24  N LYS M 18  ? N LYS M 12  
AM 1  2  N VAL L 99  ? N VAL L 99  O SER L 129 ? O SER L 129 
AN 1  2  N VAL L 110 ? N VAL L 110 O ILE L 233 ? O ILE L 233 
AN 2  3  O ILE L 232 ? O ILE L 232 N TYR L 205 ? N TYR L 205 
AN 3  4  N VAL L 206 ? N VAL L 206 O VAL L 269 ? O VAL L 269 
AN 4  5  N ILE L 268 ? N ILE L 268 O THR L 324 ? O THR L 324 
AN 5  6  O PRO L 327 ? O PRO L 327 N ILE L 169 ? N ILE L 169 
AN 6  7  N LEU L 168 ? N LEU L 168 O ILE L 352 ? O ILE L 352 
AO 1  2  N VAL L 148 ? N VAL L 148 O ILE L 161 ? O ILE L 161 
AP 1  2  N VAL M 91  ? N VAL M 85  O LYS M 121 ? O LYS M 115 
AQ 1  2  N ILE M 102 ? N ILE M 96  O LEU M 223 ? O LEU M 217 
AQ 2  3  O VAL M 224 ? O VAL M 218 N GLY M 192 ? N GLY M 186 
AQ 3  4  N THR M 191 ? N THR M 185 O PHE M 260 ? O PHE M 254 
AQ 4  5  N ILE M 261 ? N ILE M 255 O ALA M 315 ? O ALA M 309 
AQ 5  6  O GLN M 314 ? O GLN M 308 N ILE M 159 ? N ILE M 153 
AQ 6  7  N PHE M 162 ? N PHE M 156 O THR M 339 ? O THR M 333 
AQ 7  8  N THR M 338 ? N THR M 332 O LYS M 360 ? O LYS M 354 
AR 1  2  N LEU M 140 ? N LEU M 134 O TYR M 153 ? O TYR M 147 
AS 1  2  N VAL N 91  ? N VAL N 85  O LYS N 121 ? O LYS N 115 
AT 1  2  N ILE N 102 ? N ILE N 96  O LEU N 223 ? O LEU N 217 
AT 2  3  O GLY N 226 ? O GLY N 220 N GLY N 194 ? N GLY N 188 
AT 3  4  N VAL N 189 ? N VAL N 183 O PHE N 260 ? O PHE N 254 
AT 4  5  N VAL N 257 ? N VAL N 251 O SER N 309 ? O SER N 303 
AT 5  6  O GLN N 314 ? O GLN N 308 N LEU N 161 ? N LEU N 155 
AT 6  7  N PHE N 162 ? N PHE N 156 O THR N 339 ? O THR N 333 
AU 1  2  N LEU N 140 ? N LEU N 134 O TYR N 153 ? O TYR N 147 
AV 1  2  N THR O 20  ? N THR O 14  O ASP O 28  ? O ASP O 22  
AV 2  3  N VAL O 29  ? N VAL O 23  O VAL O 65  ? O VAL O 59  
AV 3  4  O ARG O 66  ? O ARG O 60  N ALA O 57  ? N ALA O 51  
AV 4  5  O LEU O 54  ? O LEU O 48  N LEU O 43  ? N LEU O 37  
AV 5  6  N GLU O 44  ? N GLU O 38  O LEU O 83  ? O LEU O 77  
AV 6  7  O VAL O 82  ? O VAL O 76  N GLY O 17  ? N GLY O 11  
AW 1  2  N VAL O 93  ? N VAL O 87  O LEU O 119 ? O LEU O 113 
AX 1  2  N ILE O 102 ? N ILE O 96  O LEU O 223 ? O LEU O 217 
AX 2  3  O VAL O 224 ? O VAL O 218 N PHE O 190 ? N PHE O 184 
AX 3  4  N VAL O 189 ? N VAL O 183 O LEU O 258 ? O LEU O 252 
AX 4  5  N ILE O 261 ? N ILE O 255 O ALA O 315 ? O ALA O 309 
AX 5  6  O VAL O 316 ? O VAL O 310 N LEU O 161 ? N LEU O 155 
AX 6  7  N GLY O 160 ? N GLY O 154 O THR O 339 ? O THR O 333 
AX 7  8  N THR O 338 ? N THR O 332 O LYS O 360 ? O LYS O 354 
AY 1  2  O LEU P 128 ? O LEU P 128 N THR P 109 ? N THR P 109 
AY 2  3  O VAL P 108 ? O VAL P 108 N ALA P 76  ? N ALA P 76  
AY 3  4  N VAL P 75  ? N VAL P 75  O SER P 163 ? O SER P 163 
AY 4  5  N ASP P 168 ? N ASP P 168 O GLU P 176 ? O GLU P 176 
AZ 1  2  N PHE Q 74  ? N PHE Q 74  O THR Q 86  ? O THR Q 86  
BA 1  2  N THR V 47  ? N THR V 41  O GLY V 50  ? O GLY V 44  
BA 2  3  O HIS V 59  ? O HIS V 53  N VAL S 36  ? N VAL S 36  
BA 4  5  O THR V 67  ? O THR V 61  N VAL V 27  ? N VAL V 21  
BA 5  6  O HIS V 30  ? O HIS V 24  N LYS V 18  ? N LYS V 12  
BA 6  7  N GLY V 17  ? N GLY V 11  O VAL V 82  ? O VAL V 76  
BB 1  2  N THR V 47  ? N THR V 41  O GLY V 50  ? O GLY V 44  
BB 3  4  O LYS S 91  ? O LYS S 91  N GLU S 56  ? N GLU S 56  
BB 4  5  N VAL S 55  ? N VAL S 55  O GLY S 63  ? O GLY S 63  
BB 5  6  N MET S 64  ? N MET S 64  O VAL S 76  ? O VAL S 76  
BB 6  7  O ILE S 75  ? O ILE S 75  N ALA S 41  ? N ALA S 41  
BB 7  8  O PHE S 44  ? O PHE S 44  N ARG S 32  ? N ARG S 32  
BB 9  10 O THR V 67  ? O THR V 61  N VAL V 27  ? N VAL V 21  
BB 10 11 O HIS V 30  ? O HIS V 24  N LYS V 18  ? N LYS V 12  
BB 11 12 N GLY V 17  ? N GLY V 11  O VAL V 82  ? O VAL V 76  
BC 1  2  N VAL S 99  ? N VAL S 99  O SER S 129 ? O SER S 129 
BD 1  2  N VAL S 110 ? N VAL S 110 O ILE S 233 ? O ILE S 233 
BD 2  3  O ILE S 232 ? O ILE S 232 N TYR S 205 ? N TYR S 205 
BD 3  4  N VAL S 206 ? N VAL S 206 O VAL S 269 ? O VAL S 269 
BD 4  5  N ILE S 268 ? N ILE S 268 O THR S 324 ? O THR S 324 
BD 5  6  O PRO S 327 ? O PRO S 327 N ILE S 169 ? N ILE S 169 
BD 6  7  N LEU S 168 ? N LEU S 168 O ILE S 352 ? O ILE S 352 
BD 7  8  N GLN S 351 ? N GLN S 351 O VAL S 373 ? O VAL S 373 
BE 1  2  O GLY T 63  ? O GLY T 63  N VAL T 55  ? N VAL T 55  
BE 2  3  N GLU T 56  ? N GLU T 56  O LYS T 91  ? O LYS T 91  
BE 3  4  O VAL T 90  ? O VAL T 90  N GLY T 31  ? N GLY T 31  
BE 4  5  N ARG T 32  ? N ARG T 32  O PHE T 44  ? O PHE T 44  
BE 5  6  N ALA T 41  ? N ALA T 41  O ILE T 75  ? O ILE T 75  
BE 6  7  O GLY T 74  ? O GLY T 74  N ASN T 67  ? N ASN T 67  
BE 7  8  N LEU T 68  ? N LEU T 68  O VAL X 22  ? O VAL X 16  
BE 8  9  N GLY X 17  ? N GLY X 11  O VAL X 82  ? O VAL X 76  
BE 9  10 O LEU X 83  ? O LEU X 77  N GLU X 44  ? N GLU X 38  
BE 10 11 N LEU X 43  ? N LEU X 37  O LEU X 54  ? O LEU X 48  
BE 11 12 N GLY X 61  ? N GLY X 55  O THR X 64  ? O THR X 58  
BE 12 13 O VAL X 65  ? O VAL X 59  N VAL X 29  ? N VAL X 23  
BE 13 14 O ASP X 28  ? O ASP X 22  N ALA X 21  ? N ALA X 15  
BF 1  2  N VAL T 99  ? N VAL T 99  O SER T 129 ? O SER T 129 
BG 1  2  N VAL T 110 ? N VAL T 110 O ILE T 233 ? O ILE T 233 
BG 2  3  O VAL T 234 ? O VAL T 234 N ALA T 207 ? N ALA T 207 
BG 3  4  N VAL T 206 ? N VAL T 206 O VAL T 269 ? O VAL T 269 
BG 4  5  N ILE T 268 ? N ILE T 268 O THR T 324 ? O THR T 324 
BG 5  6  O PRO T 327 ? O PRO T 327 N ILE T 169 ? N ILE T 169 
BG 6  7  N ILE T 170 ? N ILE T 170 O LEU T 354 ? O LEU T 354 
BH 1  2  N LEU U 54  ? N LEU U 54  O ASN U 95  ? O ASN U 95  
BH 2  3  O VAL U 90  ? O VAL U 90  N GLY U 31  ? N GLY U 31  
BH 3  4  N ARG U 32  ? N ARG U 32  O PHE U 44  ? O PHE U 44  
BH 4  5  N ALA U 41  ? N ALA U 41  O ILE U 75  ? O ILE U 75  
BH 5  6  O VAL U 76  ? O VAL U 76  N MET U 64  ? N MET U 64  
BI 1  2  N VAL U 99  ? N VAL U 99  O SER U 129 ? O SER U 129 
BJ 1  2  N VAL U 110 ? N VAL U 110 O ILE U 233 ? O ILE U 233 
BJ 2  3  O ALA U 236 ? O ALA U 236 N ALA U 207 ? N ALA U 207 
BJ 3  4  N VAL U 204 ? N VAL U 204 O LEU U 267 ? O LEU U 267 
BJ 4  5  N TYR U 270 ? N TYR U 270 O VAL U 328 ? O VAL U 328 
BJ 5  6  O THR U 331 ? O THR U 331 N GLY U 171 ? N GLY U 171 
BJ 6  7  N ILE U 170 ? N ILE U 170 O ILE U 352 ? O ILE U 352 
BJ 7  8  N GLN U 351 ? N GLN U 351 O VAL U 373 ? O VAL U 373 
BK 1  2  N ILE V 102 ? N ILE V 96  O PHE V 225 ? O PHE V 219 
BK 2  3  O GLY V 226 ? O GLY V 220 N GLY V 192 ? N GLY V 186 
BK 3  4  N THR V 191 ? N THR V 185 O PHE V 260 ? O PHE V 254 
BK 4  5  N ILE V 261 ? N ILE V 255 O ALA V 315 ? O ALA V 309 
BK 5  6  O SER V 312 ? O SER V 306 N ILE V 159 ? N ILE V 153 
BK 6  7  N GLY V 160 ? N GLY V 154 O THR V 339 ? O THR V 333 
BK 7  8  N THR V 338 ? N THR V 332 O LYS V 360 ? O LYS V 354 
BL 1  2  N LEU V 140 ? N LEU V 134 O TYR V 153 ? O TYR V 147 
BM 1  2  N ILE W 23  ? N ILE W 17  O ILE W 26  ? O ILE W 20  
BM 2  3  N VAL W 27  ? N VAL W 21  O THR W 67  ? O THR W 61  
BM 3  4  O ARG W 66  ? O ARG W 60  N ALA W 57  ? N ALA W 51  
BM 4  5  O LEU W 54  ? O LEU W 48  N LEU W 43  ? N LEU W 37  
BM 5  6  N GLU W 44  ? N GLU W 38  O LEU W 83  ? O LEU W 77  
BM 6  7  O VAL W 82  ? O VAL W 76  N GLY W 17  ? N GLY W 11  
BN 1  2  N VAL W 91  ? N VAL W 85  O LYS W 121 ? O LYS W 115 
BO 1  2  N ILE W 102 ? N ILE W 96  O LEU W 223 ? O LEU W 217 
BO 2  3  O VAL W 224 ? O VAL W 218 N GLY W 192 ? N GLY W 186 
BO 3  4  N VAL W 189 ? N VAL W 183 O PHE W 260 ? O PHE W 254 
BO 4  5  N LEU W 259 ? N LEU W 253 O VAL W 313 ? O VAL W 307 
BO 5  6  O GLN W 314 ? O GLN W 308 N ILE W 159 ? N ILE W 153 
BO 6  7  N PHE W 162 ? N PHE W 156 O THR W 339 ? O THR W 333 
BP 1  2  N LEU W 140 ? N LEU W 134 O TYR W 153 ? O TYR W 147 
BQ 1  2  N VAL X 91  ? N VAL X 85  O LYS X 121 ? O LYS X 115 
BR 1  2  N ILE X 102 ? N ILE X 96  O LEU X 223 ? O LEU X 217 
BR 2  3  O VAL X 224 ? O VAL X 218 N GLY X 192 ? N GLY X 186 
BR 3  4  N VAL X 189 ? N VAL X 183 O LEU X 258 ? O LEU X 252 
BR 4  5  N ILE X 261 ? N ILE X 255 O ALA X 315 ? O ALA X 309 
BR 5  6  O GLN X 314 ? O GLN X 308 N ILE X 159 ? N ILE X 153 
BR 6  7  N GLY X 160 ? N GLY X 154 O ALA X 337 ? O ALA X 331 
BR 7  8  N THR X 338 ? N THR X 332 O LYS X 360 ? O LYS X 354 
BS 1  2  N LEU X 140 ? N LEU X 134 O TYR X 153 ? O TYR X 147 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP A 600' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 700'  
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP B 600' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 700'  
AC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP C 600' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG C 700'  
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP D 600' 
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 700'  
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PO4 E 800' 
BC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP F 600' 
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG F 700'  
BC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP J 600' 
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG J 700'  
BC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP K 600' 
BC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG K 700'  
BC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP L 600' 
BC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG L 700'  
BC9 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP M 600' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG M 700'  
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PO4 N 800' 
CC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ANP O 600' 
CC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG O 700'  
CC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP S 600' 
CC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG S 700'  
CC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP T 600' 
CC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG T 700'  
CC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP U 600' 
DC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG U 700'  
DC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ANP V 600' 
DC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG V 700'  
DC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP X 600' 
DC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG X 700'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 13 ARG A  173 ? ARG A 173 . ? 1_555 ? 
2   AC1 13 GLN A  174 ? GLN A 174 . ? 1_555 ? 
3   AC1 13 THR A  175 ? THR A 175 . ? 1_555 ? 
4   AC1 13 GLY A  176 ? GLY A 176 . ? 1_555 ? 
5   AC1 13 LYS A  177 ? LYS A 177 . ? 1_555 ? 
6   AC1 13 THR A  178 ? THR A 178 . ? 1_555 ? 
7   AC1 13 ALA A  179 ? ALA A 179 . ? 1_555 ? 
8   AC1 13 GLU A  330 ? GLU A 330 . ? 1_555 ? 
9   AC1 13 PHE A  359 ? PHE A 359 . ? 1_555 ? 
10  AC1 13 ARG A  364 ? ARG A 364 . ? 1_555 ? 
11  AC1 13 GLN A  432 ? GLN A 432 . ? 1_555 ? 
12  AC1 13 GLN A  434 ? GLN A 434 . ? 1_555 ? 
13  AC1 13 MG  CA .   ? MG  A 700 . ? 1_555 ? 
14  AC2 2  THR A  178 ? THR A 178 . ? 1_555 ? 
15  AC2 2  ANP BA .   ? ANP A 600 . ? 1_555 ? 
16  AC3 12 ARG B  173 ? ARG B 173 . ? 1_555 ? 
17  AC3 12 GLN B  174 ? GLN B 174 . ? 1_555 ? 
18  AC3 12 THR B  175 ? THR B 175 . ? 1_555 ? 
19  AC3 12 GLY B  176 ? GLY B 176 . ? 1_555 ? 
20  AC3 12 LYS B  177 ? LYS B 177 . ? 1_555 ? 
21  AC3 12 THR B  178 ? THR B 178 . ? 1_555 ? 
22  AC3 12 ALA B  179 ? ALA B 179 . ? 1_555 ? 
23  AC3 12 PHE B  359 ? PHE B 359 . ? 1_555 ? 
24  AC3 12 ARG B  364 ? ARG B 364 . ? 1_555 ? 
25  AC3 12 GLN B  432 ? GLN B 432 . ? 1_555 ? 
26  AC3 12 GLN B  434 ? GLN B 434 . ? 1_555 ? 
27  AC3 12 MG  EA .   ? MG  B 700 . ? 1_555 ? 
28  AC4 2  THR B  178 ? THR B 178 . ? 1_555 ? 
29  AC4 2  ANP DA .   ? ANP B 600 . ? 1_555 ? 
30  AC5 13 ARG C  173 ? ARG C 173 . ? 1_555 ? 
31  AC5 13 GLN C  174 ? GLN C 174 . ? 1_555 ? 
32  AC5 13 THR C  175 ? THR C 175 . ? 1_555 ? 
33  AC5 13 GLY C  176 ? GLY C 176 . ? 1_555 ? 
34  AC5 13 LYS C  177 ? LYS C 177 . ? 1_555 ? 
35  AC5 13 THR C  178 ? THR C 178 . ? 1_555 ? 
36  AC5 13 ALA C  179 ? ALA C 179 . ? 1_555 ? 
37  AC5 13 PHE C  359 ? PHE C 359 . ? 1_555 ? 
38  AC5 13 ARG C  364 ? ARG C 364 . ? 1_555 ? 
39  AC5 13 GLN C  432 ? GLN C 432 . ? 1_555 ? 
40  AC5 13 GLN C  434 ? GLN C 434 . ? 1_555 ? 
41  AC5 13 MG  GA .   ? MG  C 700 . ? 1_555 ? 
42  AC5 13 TYR F  374 ? TYR F 368 . ? 1_555 ? 
43  AC6 2  THR C  178 ? THR C 178 . ? 1_555 ? 
44  AC6 2  ANP FA .   ? ANP C 600 . ? 1_555 ? 
45  AC7 13 ARG C  375 ? ARG C 375 . ? 1_555 ? 
46  AC7 13 GLY D  164 ? GLY D 158 . ? 1_555 ? 
47  AC7 13 ALA D  165 ? ALA D 159 . ? 1_555 ? 
48  AC7 13 GLY D  166 ? GLY D 160 . ? 1_555 ? 
49  AC7 13 VAL D  167 ? VAL D 161 . ? 1_555 ? 
50  AC7 13 GLY D  168 ? GLY D 162 . ? 1_555 ? 
51  AC7 13 LYS D  169 ? LYS D 163 . ? 1_555 ? 
52  AC7 13 THR D  170 ? THR D 164 . ? 1_555 ? 
53  AC7 13 VAL D  171 ? VAL D 165 . ? 1_555 ? 
54  AC7 13 ARG D  196 ? ARG D 190 . ? 1_555 ? 
55  AC7 13 TYR D  351 ? TYR D 345 . ? 1_555 ? 
56  AC7 13 PHE D  424 ? PHE D 418 . ? 1_555 ? 
57  AC7 13 MG  IA .   ? MG  D 700 . ? 1_555 ? 
58  AC8 2  THR D  170 ? THR D 164 . ? 1_555 ? 
59  AC8 2  ANP HA .   ? ANP D 600 . ? 1_555 ? 
60  AC9 5  GLY E  166 ? GLY E 160 . ? 1_555 ? 
61  AC9 5  VAL E  167 ? VAL E 161 . ? 1_555 ? 
62  AC9 5  GLY E  168 ? GLY E 162 . ? 1_555 ? 
63  AC9 5  LYS E  169 ? LYS E 163 . ? 1_555 ? 
64  AC9 5  THR E  170 ? THR E 164 . ? 1_555 ? 
65  BC1 18 ILE B  345 ? ILE B 345 . ? 1_555 ? 
66  BC1 18 SER B  346 ? SER B 346 . ? 1_555 ? 
67  BC1 18 VAL B  373 ? VAL B 373 . ? 1_555 ? 
68  BC1 18 ARG B  375 ? ARG B 375 . ? 1_555 ? 
69  BC1 18 GLY F  164 ? GLY F 158 . ? 1_555 ? 
70  BC1 18 ALA F  165 ? ALA F 159 . ? 1_555 ? 
71  BC1 18 GLY F  166 ? GLY F 160 . ? 1_555 ? 
72  BC1 18 VAL F  167 ? VAL F 161 . ? 1_555 ? 
73  BC1 18 GLY F  168 ? GLY F 162 . ? 1_555 ? 
74  BC1 18 LYS F  169 ? LYS F 163 . ? 1_555 ? 
75  BC1 18 THR F  170 ? THR F 164 . ? 1_555 ? 
76  BC1 18 VAL F  171 ? VAL F 165 . ? 1_555 ? 
77  BC1 18 ARG F  196 ? ARG F 190 . ? 1_555 ? 
78  BC1 18 TYR F  351 ? TYR F 345 . ? 1_555 ? 
79  BC1 18 PHE F  424 ? PHE F 418 . ? 1_555 ? 
80  BC1 18 ALA F  427 ? ALA F 421 . ? 1_555 ? 
81  BC1 18 PHE F  430 ? PHE F 424 . ? 1_555 ? 
82  BC1 18 MG  LA .   ? MG  F 700 . ? 1_555 ? 
83  BC2 3  THR F  170 ? THR F 164 . ? 1_555 ? 
84  BC2 3  GLU F  195 ? GLU F 189 . ? 1_555 ? 
85  BC2 3  ANP KA .   ? ANP F 600 . ? 1_555 ? 
86  BC3 12 GLN J  174 ? GLN J 174 . ? 1_555 ? 
87  BC3 12 THR J  175 ? THR J 175 . ? 1_555 ? 
88  BC3 12 GLY J  176 ? GLY J 176 . ? 1_555 ? 
89  BC3 12 LYS J  177 ? LYS J 177 . ? 1_555 ? 
90  BC3 12 THR J  178 ? THR J 178 . ? 1_555 ? 
91  BC3 12 ALA J  179 ? ALA J 179 . ? 1_555 ? 
92  BC3 12 PHE J  359 ? PHE J 359 . ? 1_555 ? 
93  BC3 12 ARG J  364 ? ARG J 364 . ? 1_555 ? 
94  BC3 12 GLN J  432 ? GLN J 432 . ? 1_555 ? 
95  BC3 12 GLN J  434 ? GLN J 434 . ? 1_555 ? 
96  BC3 12 MG  NA .   ? MG  J 700 . ? 1_555 ? 
97  BC3 12 TYR M  374 ? TYR M 368 . ? 1_555 ? 
98  BC4 2  THR J  178 ? THR J 178 . ? 1_555 ? 
99  BC4 2  ANP MA .   ? ANP J 600 . ? 1_555 ? 
100 BC5 13 ARG K  173 ? ARG K 173 . ? 1_555 ? 
101 BC5 13 GLN K  174 ? GLN K 174 . ? 1_555 ? 
102 BC5 13 THR K  175 ? THR K 175 . ? 1_555 ? 
103 BC5 13 GLY K  176 ? GLY K 176 . ? 1_555 ? 
104 BC5 13 LYS K  177 ? LYS K 177 . ? 1_555 ? 
105 BC5 13 THR K  178 ? THR K 178 . ? 1_555 ? 
106 BC5 13 ALA K  179 ? ALA K 179 . ? 1_555 ? 
107 BC5 13 PHE K  359 ? PHE K 359 . ? 1_555 ? 
108 BC5 13 ARG K  364 ? ARG K 364 . ? 1_555 ? 
109 BC5 13 GLN K  432 ? GLN K 432 . ? 1_555 ? 
110 BC5 13 GLN K  434 ? GLN K 434 . ? 1_555 ? 
111 BC5 13 HOH PB .   ? HOH K 512 . ? 1_555 ? 
112 BC5 13 MG  PA .   ? MG  K 700 . ? 1_555 ? 
113 BC6 2  THR K  178 ? THR K 178 . ? 1_555 ? 
114 BC6 2  ANP OA .   ? ANP K 600 . ? 1_555 ? 
115 BC7 11 ARG L  173 ? ARG L 173 . ? 1_555 ? 
116 BC7 11 GLN L  174 ? GLN L 174 . ? 1_555 ? 
117 BC7 11 THR L  175 ? THR L 175 . ? 1_555 ? 
118 BC7 11 GLY L  176 ? GLY L 176 . ? 1_555 ? 
119 BC7 11 LYS L  177 ? LYS L 177 . ? 1_555 ? 
120 BC7 11 THR L  178 ? THR L 178 . ? 1_555 ? 
121 BC7 11 ALA L  179 ? ALA L 179 . ? 1_555 ? 
122 BC7 11 PHE L  359 ? PHE L 359 . ? 1_555 ? 
123 BC7 11 GLN L  432 ? GLN L 432 . ? 1_555 ? 
124 BC7 11 GLN L  434 ? GLN L 434 . ? 1_555 ? 
125 BC7 11 MG  RA .   ? MG  L 700 . ? 1_555 ? 
126 BC8 2  THR L  178 ? THR L 178 . ? 1_555 ? 
127 BC8 2  ANP QA .   ? ANP L 600 . ? 1_555 ? 
128 BC9 13 ARG L  375 ? ARG L 375 . ? 1_555 ? 
129 BC9 13 ALA M  165 ? ALA M 159 . ? 1_555 ? 
130 BC9 13 GLY M  166 ? GLY M 160 . ? 1_555 ? 
131 BC9 13 VAL M  167 ? VAL M 161 . ? 1_555 ? 
132 BC9 13 GLY M  168 ? GLY M 162 . ? 1_555 ? 
133 BC9 13 LYS M  169 ? LYS M 163 . ? 1_555 ? 
134 BC9 13 THR M  170 ? THR M 164 . ? 1_555 ? 
135 BC9 13 VAL M  171 ? VAL M 165 . ? 1_555 ? 
136 BC9 13 GLU M  195 ? GLU M 189 . ? 1_555 ? 
137 BC9 13 ARG M  196 ? ARG M 190 . ? 1_555 ? 
138 BC9 13 TYR M  351 ? TYR M 345 . ? 1_555 ? 
139 BC9 13 PHE M  430 ? PHE M 424 . ? 1_555 ? 
140 BC9 13 MG  TA .   ? MG  M 700 . ? 1_555 ? 
141 CC1 5  THR M  170 ? THR M 164 . ? 1_555 ? 
142 CC1 5  GLU M  195 ? GLU M 189 . ? 1_555 ? 
143 CC1 5  ARG M  196 ? ARG M 190 . ? 1_555 ? 
144 CC1 5  GLU M  199 ? GLU M 193 . ? 1_555 ? 
145 CC1 5  ANP SA .   ? ANP M 600 . ? 1_555 ? 
146 CC2 5  ALA N  165 ? ALA N 159 . ? 1_555 ? 
147 CC2 5  GLY N  166 ? GLY N 160 . ? 1_555 ? 
148 CC2 5  GLY N  168 ? GLY N 162 . ? 1_555 ? 
149 CC2 5  LYS N  169 ? LYS N 163 . ? 1_555 ? 
150 CC2 5  THR N  170 ? THR N 164 . ? 1_555 ? 
151 CC3 17 SER K  346 ? SER K 346 . ? 1_555 ? 
152 CC3 17 VAL K  373 ? VAL K 373 . ? 1_555 ? 
153 CC3 17 ARG K  375 ? ARG K 375 . ? 1_555 ? 
154 CC3 17 ALA O  165 ? ALA O 159 . ? 1_555 ? 
155 CC3 17 GLY O  166 ? GLY O 160 . ? 1_555 ? 
156 CC3 17 VAL O  167 ? VAL O 161 . ? 1_555 ? 
157 CC3 17 GLY O  168 ? GLY O 162 . ? 1_555 ? 
158 CC3 17 LYS O  169 ? LYS O 163 . ? 1_555 ? 
159 CC3 17 THR O  170 ? THR O 164 . ? 1_555 ? 
160 CC3 17 VAL O  171 ? VAL O 165 . ? 1_555 ? 
161 CC3 17 ARG O  196 ? ARG O 190 . ? 1_555 ? 
162 CC3 17 TYR O  351 ? TYR O 345 . ? 1_555 ? 
163 CC3 17 PHE O  424 ? PHE O 418 . ? 1_555 ? 
164 CC3 17 ALA O  427 ? ALA O 421 . ? 1_555 ? 
165 CC3 17 PHE O  430 ? PHE O 424 . ? 1_555 ? 
166 CC3 17 THR O  431 ? THR O 425 . ? 1_555 ? 
167 CC3 17 MG  WA .   ? MG  O 700 . ? 1_555 ? 
168 CC4 3  THR O  170 ? THR O 164 . ? 1_555 ? 
169 CC4 3  GLU O  199 ? GLU O 193 . ? 1_555 ? 
170 CC4 3  ANP VA .   ? ANP O 600 . ? 1_555 ? 
171 CC5 11 GLN S  174 ? GLN S 174 . ? 1_555 ? 
172 CC5 11 GLY S  176 ? GLY S 176 . ? 1_555 ? 
173 CC5 11 LYS S  177 ? LYS S 177 . ? 1_555 ? 
174 CC5 11 THR S  178 ? THR S 178 . ? 1_555 ? 
175 CC5 11 ALA S  179 ? ALA S 179 . ? 1_555 ? 
176 CC5 11 GLU S  330 ? GLU S 330 . ? 1_555 ? 
177 CC5 11 ARG S  364 ? ARG S 364 . ? 1_555 ? 
178 CC5 11 GLN S  432 ? GLN S 432 . ? 1_555 ? 
179 CC5 11 ASN S  433 ? ASN S 433 . ? 1_555 ? 
180 CC5 11 GLN S  434 ? GLN S 434 . ? 1_555 ? 
181 CC5 11 MG  YA .   ? MG  S 700 . ? 1_555 ? 
182 CC6 3  THR S  178 ? THR S 178 . ? 1_555 ? 
183 CC6 3  ASP S  271 ? ASP S 271 . ? 1_555 ? 
184 CC6 3  ANP XA .   ? ANP S 600 . ? 1_555 ? 
185 CC7 12 GLN T  174 ? GLN T 174 . ? 1_555 ? 
186 CC7 12 THR T  175 ? THR T 175 . ? 1_555 ? 
187 CC7 12 GLY T  176 ? GLY T 176 . ? 1_555 ? 
188 CC7 12 LYS T  177 ? LYS T 177 . ? 1_555 ? 
189 CC7 12 THR T  178 ? THR T 178 . ? 1_555 ? 
190 CC7 12 ALA T  179 ? ALA T 179 . ? 1_555 ? 
191 CC7 12 PHE T  359 ? PHE T 359 . ? 1_555 ? 
192 CC7 12 ARG T  364 ? ARG T 364 . ? 1_555 ? 
193 CC7 12 GLN T  432 ? GLN T 432 . ? 1_555 ? 
194 CC7 12 GLN T  434 ? GLN T 434 . ? 1_555 ? 
195 CC7 12 MG  AB .   ? MG  T 700 . ? 1_555 ? 
196 CC7 12 ASP W  365 ? ASP W 359 . ? 1_555 ? 
197 CC8 2  THR T  178 ? THR T 178 . ? 1_555 ? 
198 CC8 2  ANP ZA .   ? ANP T 600 . ? 1_555 ? 
199 CC9 11 ARG U  173 ? ARG U 173 . ? 1_555 ? 
200 CC9 11 GLN U  174 ? GLN U 174 . ? 1_555 ? 
201 CC9 11 GLY U  176 ? GLY U 176 . ? 1_555 ? 
202 CC9 11 LYS U  177 ? LYS U 177 . ? 1_555 ? 
203 CC9 11 THR U  178 ? THR U 178 . ? 1_555 ? 
204 CC9 11 ALA U  179 ? ALA U 179 . ? 1_555 ? 
205 CC9 11 PHE U  359 ? PHE U 359 . ? 1_555 ? 
206 CC9 11 GLN U  432 ? GLN U 432 . ? 1_555 ? 
207 CC9 11 GLN U  434 ? GLN U 434 . ? 1_555 ? 
208 CC9 11 MG  CB .   ? MG  U 700 . ? 1_555 ? 
209 CC9 11 TYR X  374 ? TYR X 368 . ? 1_555 ? 
210 DC1 3  THR U  178 ? THR U 178 . ? 1_555 ? 
211 DC1 3  ASP U  271 ? ASP U 271 . ? 1_555 ? 
212 DC1 3  ANP BB .   ? ANP U 600 . ? 1_555 ? 
213 DC2 17 SER U  346 ? SER U 346 . ? 1_555 ? 
214 DC2 17 ARG U  375 ? ARG U 375 . ? 1_555 ? 
215 DC2 17 ALA V  165 ? ALA V 159 . ? 1_555 ? 
216 DC2 17 GLY V  166 ? GLY V 160 . ? 1_555 ? 
217 DC2 17 VAL V  167 ? VAL V 161 . ? 1_555 ? 
218 DC2 17 GLY V  168 ? GLY V 162 . ? 1_555 ? 
219 DC2 17 LYS V  169 ? LYS V 163 . ? 1_555 ? 
220 DC2 17 THR V  170 ? THR V 164 . ? 1_555 ? 
221 DC2 17 VAL V  171 ? VAL V 165 . ? 1_555 ? 
222 DC2 17 ARG V  196 ? ARG V 190 . ? 1_555 ? 
223 DC2 17 TYR V  317 ? TYR V 311 . ? 1_555 ? 
224 DC2 17 TYR V  351 ? TYR V 345 . ? 1_555 ? 
225 DC2 17 PHE V  424 ? PHE V 418 . ? 1_555 ? 
226 DC2 17 ALA V  427 ? ALA V 421 . ? 1_555 ? 
227 DC2 17 PHE V  430 ? PHE V 424 . ? 1_555 ? 
228 DC2 17 THR V  431 ? THR V 425 . ? 1_555 ? 
229 DC2 17 MG  EB .   ? MG  V 700 . ? 1_555 ? 
230 DC3 3  LYS V  169 ? LYS V 163 . ? 1_555 ? 
231 DC3 3  THR V  170 ? THR V 164 . ? 1_555 ? 
232 DC3 3  ANP DB .   ? ANP V 600 . ? 1_555 ? 
233 DC4 18 ILE T  345 ? ILE T 345 . ? 1_555 ? 
234 DC4 18 SER T  346 ? SER T 346 . ? 1_555 ? 
235 DC4 18 VAL T  373 ? VAL T 373 . ? 1_555 ? 
236 DC4 18 ARG T  375 ? ARG T 375 . ? 1_555 ? 
237 DC4 18 GLY X  166 ? GLY X 160 . ? 1_555 ? 
238 DC4 18 VAL X  167 ? VAL X 161 . ? 1_555 ? 
239 DC4 18 GLY X  168 ? GLY X 162 . ? 1_555 ? 
240 DC4 18 LYS X  169 ? LYS X 163 . ? 1_555 ? 
241 DC4 18 THR X  170 ? THR X 164 . ? 1_555 ? 
242 DC4 18 VAL X  171 ? VAL X 165 . ? 1_555 ? 
243 DC4 18 GLU X  195 ? GLU X 189 . ? 1_555 ? 
244 DC4 18 ARG X  196 ? ARG X 190 . ? 1_555 ? 
245 DC4 18 TYR X  351 ? TYR X 345 . ? 1_555 ? 
246 DC4 18 PHE X  424 ? PHE X 418 . ? 1_555 ? 
247 DC4 18 ALA X  427 ? ALA X 421 . ? 1_555 ? 
248 DC4 18 PHE X  430 ? PHE X 424 . ? 1_555 ? 
249 DC4 18 THR X  431 ? THR X 425 . ? 1_555 ? 
250 DC4 18 MG  GB .   ? MG  X 700 . ? 1_555 ? 
251 DC5 4  LYS X  169 ? LYS X 163 . ? 1_555 ? 
252 DC5 4  THR X  170 ? THR X 164 . ? 1_555 ? 
253 DC5 4  GLU X  195 ? GLU X 189 . ? 1_555 ? 
254 DC5 4  ANP FB .   ? ANP X 600 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OEE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OEE 
_atom_sites.fract_transf_matrix[1][1]   0.009056 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001821 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003465 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005450 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A  1 26  ? 30.052  -4.342   94.763  1.00 92.36  ? 26  ASN A N     1 
ATOM   2     C  CA    . ASN A  1 26  ? 28.655  -4.866   94.839  1.00 90.11  ? 26  ASN A CA    1 
ATOM   3     C  C     . ASN A  1 26  ? 28.301  -5.773   93.641  1.00 85.44  ? 26  ASN A C     1 
ATOM   4     O  O     . ASN A  1 26  ? 28.282  -7.007   93.774  1.00 86.50  ? 26  ASN A O     1 
ATOM   5     C  CB    . ASN A  1 26  ? 27.672  -3.701   94.973  1.00 89.02  ? 26  ASN A CB    1 
ATOM   6     C  CG    . ASN A  1 26  ? 26.266  -4.157   95.322  1.00 89.12  ? 26  ASN A CG    1 
ATOM   7     O  OD1   . ASN A  1 26  ? 25.638  -4.919   94.575  1.00 85.61  ? 26  ASN A OD1   1 
ATOM   8     N  ND2   . ASN A  1 26  ? 25.755  -3.676   96.461  1.00 93.42  ? 26  ASN A ND2   1 
ATOM   9     N  N     . LEU A  1 27  ? 28.001  -5.145   92.496  1.00 80.55  ? 27  LEU A N     1 
ATOM   10    C  CA    . LEU A  1 27  ? 27.952  -5.782   91.162  1.00 75.90  ? 27  LEU A CA    1 
ATOM   11    C  C     . LEU A  1 27  ? 26.757  -6.655   90.813  1.00 73.35  ? 27  LEU A C     1 
ATOM   12    O  O     . LEU A  1 27  ? 26.390  -6.760   89.642  1.00 69.93  ? 27  LEU A O     1 
ATOM   13    C  CB    . LEU A  1 27  ? 29.274  -6.460   90.794  1.00 77.22  ? 27  LEU A CB    1 
ATOM   14    C  CG    . LEU A  1 27  ? 30.437  -5.520   90.446  1.00 78.17  ? 27  LEU A CG    1 
ATOM   15    C  CD1   . LEU A  1 27  ? 31.509  -6.255   89.671  1.00 79.83  ? 27  LEU A CD1   1 
ATOM   16    C  CD2   . LEU A  1 27  ? 29.999  -4.306   89.649  1.00 74.73  ? 27  LEU A CD2   1 
ATOM   17    N  N     . ASN A  1 28  ? 26.152  -7.304   91.799  1.00 75.49  ? 28  ASN A N     1 
ATOM   18    C  CA    . ASN A  1 28  ? 24.909  -8.034   91.541  1.00 73.37  ? 28  ASN A CA    1 
ATOM   19    C  C     . ASN A  1 28  ? 23.738  -7.076   91.396  1.00 71.28  ? 28  ASN A C     1 
ATOM   20    O  O     . ASN A  1 28  ? 22.849  -7.281   90.570  1.00 68.40  ? 28  ASN A O     1 
ATOM   21    C  CB    . ASN A  1 28  ? 24.647  -9.073   92.631  1.00 76.75  ? 28  ASN A CB    1 
ATOM   22    C  CG    . ASN A  1 28  ? 25.606  -10.253  92.549  1.00 79.04  ? 28  ASN A CG    1 
ATOM   23    O  OD1   . ASN A  1 28  ? 26.043  -10.645  91.457  1.00 77.23  ? 28  ASN A OD1   1 
ATOM   24    N  ND2   . ASN A  1 28  ? 25.940  -10.827  93.703  1.00 83.36  ? 28  ASN A ND2   1 
ATOM   25    N  N     . GLU A  1 29  ? 23.772  -6.006   92.181  1.00 73.22  ? 29  GLU A N     1 
ATOM   26    C  CA    . GLU A  1 29  ? 22.694  -5.040   92.185  1.00 72.49  ? 29  GLU A CA    1 
ATOM   27    C  C     . GLU A  1 29  ? 23.090  -3.728   91.517  1.00 70.69  ? 29  GLU A C     1 
ATOM   28    O  O     . GLU A  1 29  ? 22.239  -2.862   91.305  1.00 69.97  ? 29  GLU A O     1 
ATOM   29    C  CB    . GLU A  1 29  ? 22.175  -4.812   93.611  1.00 76.59  ? 29  GLU A CB    1 
ATOM   30    C  CG    . GLU A  1 29  ? 21.715  -6.091   94.334  1.00 80.00  ? 29  GLU A CG    1 
ATOM   31    C  CD    . GLU A  1 29  ? 20.770  -6.958   93.500  1.00 79.37  ? 29  GLU A CD    1 
ATOM   32    O  OE1   . GLU A  1 29  ? 19.866  -6.395   92.854  1.00 78.69  ? 29  GLU A OE1   1 
ATOM   33    O  OE2   . GLU A  1 29  ? 20.923  -8.203   93.489  1.00 80.52  ? 29  GLU A OE2   1 
ATOM   34    N  N     . THR A  1 30  ? 24.367  -3.591   91.163  1.00 70.42  ? 30  THR A N     1 
ATOM   35    C  CA    . THR A  1 30  ? 24.852  -2.343   90.559  1.00 69.12  ? 30  THR A CA    1 
ATOM   36    C  C     . THR A  1 30  ? 25.772  -2.483   89.355  1.00 66.77  ? 30  THR A C     1 
ATOM   37    O  O     . THR A  1 30  ? 26.197  -3.579   88.994  1.00 66.15  ? 30  THR A O     1 
ATOM   38    C  CB    . THR A  1 30  ? 25.564  -1.483   91.573  1.00 72.64  ? 30  THR A CB    1 
ATOM   39    O  OG1   . THR A  1 30  ? 26.071  -2.333   92.602  1.00 76.90  ? 30  THR A OG1   1 
ATOM   40    C  CG2   . THR A  1 30  ? 24.597  -0.505   92.163  1.00 73.91  ? 30  THR A CG2   1 
ATOM   41    N  N     . GLY A  1 31  ? 26.083  -1.339   88.753  1.00 65.81  ? 31  GLY A N     1 
ATOM   42    C  CA    . GLY A  1 31  ? 26.885  -1.302   87.544  1.00 63.70  ? 31  GLY A CA    1 
ATOM   43    C  C     . GLY A  1 31  ? 27.699  -0.044   87.370  1.00 64.40  ? 31  GLY A C     1 
ATOM   44    O  O     . GLY A  1 31  ? 27.453  0.975    88.024  1.00 66.02  ? 31  GLY A O     1 
ATOM   45    N  N     . ARG A  1 32  ? 28.683  -0.141   86.485  1.00 63.67  ? 32  ARG A N     1 
ATOM   46    C  CA    . ARG A  1 32  ? 29.499  0.987    86.062  1.00 64.35  ? 32  ARG A CA    1 
ATOM   47    C  C     . ARG A  1 32  ? 29.220  1.282    84.587  1.00 60.66  ? 32  ARG A C     1 
ATOM   48    O  O     . ARG A  1 32  ? 29.181  0.371    83.764  1.00 59.10  ? 32  ARG A O     1 
ATOM   49    C  CB    . ARG A  1 32  ? 30.995  0.676    86.259  1.00 67.66  ? 32  ARG A CB    1 
ATOM   50    C  CG    . ARG A  1 32  ? 31.448  0.502    87.702  1.00 72.55  ? 32  ARG A CG    1 
ATOM   51    C  CD    . ARG A  1 32  ? 30.789  1.552    88.579  1.00 75.52  ? 32  ARG A CD    1 
ATOM   52    N  NE    . ARG A  1 32  ? 31.569  1.917    89.765  1.00 81.50  ? 32  ARG A NE    1 
ATOM   53    C  CZ    . ARG A  1 32  ? 31.344  3.017    90.483  1.00 84.30  ? 32  ARG A CZ    1 
ATOM   54    N  NH1   . ARG A  1 32  ? 30.367  3.854    90.142  1.00 82.21  ? 32  ARG A NH1   1 
ATOM   55    N  NH2   . ARG A  1 32  ? 32.086  3.286    91.548  1.00 90.16  ? 32  ARG A NH2   1 
ATOM   56    N  N     . VAL A  1 33  ? 29.030  2.546    84.245  1.00 59.66  ? 33  VAL A N     1 
ATOM   57    C  CA    . VAL A  1 33  ? 28.872  2.887    82.850  1.00 57.47  ? 33  VAL A CA    1 
ATOM   58    C  C     . VAL A  1 33  ? 30.197  2.719    82.114  1.00 58.55  ? 33  VAL A C     1 
ATOM   59    O  O     . VAL A  1 33  ? 31.177  3.375    82.440  1.00 60.92  ? 33  VAL A O     1 
ATOM   60    C  CB    . VAL A  1 33  ? 28.305  4.290    82.640  1.00 57.23  ? 33  VAL A CB    1 
ATOM   61    C  CG1   . VAL A  1 33  ? 28.181  4.576    81.153  1.00 55.87  ? 33  VAL A CG1   1 
ATOM   62    C  CG2   . VAL A  1 33  ? 26.945  4.403    83.279  1.00 56.51  ? 33  VAL A CG2   1 
ATOM   63    N  N     . LEU A  1 34  ? 30.205  1.822    81.129  1.00 57.24  ? 34  LEU A N     1 
ATOM   64    C  CA    . LEU A  1 34  ? 31.375  1.562    80.297  1.00 58.63  ? 34  LEU A CA    1 
ATOM   65    C  C     . LEU A  1 34  ? 31.497  2.607    79.209  1.00 58.61  ? 34  LEU A C     1 
ATOM   66    O  O     . LEU A  1 34  ? 32.595  3.086    78.899  1.00 61.24  ? 34  LEU A O     1 
ATOM   67    C  CB    . LEU A  1 34  ? 31.254  0.195    79.631  1.00 57.55  ? 34  LEU A CB    1 
ATOM   68    C  CG    . LEU A  1 34  ? 31.563  -1.075   80.430  1.00 58.73  ? 34  LEU A CG    1 
ATOM   69    C  CD1   . LEU A  1 34  ? 31.176  -2.315   79.604  1.00 55.33  ? 34  LEU A CD1   1 
ATOM   70    C  CD2   . LEU A  1 34  ? 33.028  -1.123   80.875  1.00 59.53  ? 34  LEU A CD2   1 
ATOM   71    N  N     . ALA A  1 35  ? 30.351  2.937    78.623  1.00 55.96  ? 35  ALA A N     1 
ATOM   72    C  CA    . ALA A  1 35  ? 30.263  3.845    77.497  1.00 55.47  ? 35  ALA A CA    1 
ATOM   73    C  C     . ALA A  1 35  ? 28.831  4.330    77.395  1.00 53.35  ? 35  ALA A C     1 
ATOM   74    O  O     . ALA A  1 35  ? 27.889  3.604    77.742  1.00 52.01  ? 35  ALA A O     1 
ATOM   75    C  CB    . ALA A  1 35  ? 30.662  3.136    76.221  1.00 55.25  ? 35  ALA A CB    1 
ATOM   76    N  N     . VAL A  1 36  ? 28.660  5.562    76.933  1.00 53.53  ? 36  VAL A N     1 
ATOM   77    C  CA    . VAL A  1 36  ? 27.328  6.061    76.642  1.00 51.89  ? 36  VAL A CA    1 
ATOM   78    C  C     . VAL A  1 36  ? 27.345  6.934    75.404  1.00 52.50  ? 36  VAL A C     1 
ATOM   79    O  O     . VAL A  1 36  ? 28.349  7.573    75.095  1.00 54.06  ? 36  VAL A O     1 
ATOM   80    C  CB    . VAL A  1 36  ? 26.688  6.777    77.849  1.00 52.01  ? 36  VAL A CB    1 
ATOM   81    C  CG1   . VAL A  1 36  ? 27.566  7.907    78.323  1.00 54.74  ? 36  VAL A CG1   1 
ATOM   82    C  CG2   . VAL A  1 36  ? 25.296  7.275    77.502  1.00 50.52  ? 36  VAL A CG2   1 
ATOM   83    N  N     . GLY A  1 37  ? 26.228  6.931    74.688  1.00 51.41  ? 37  GLY A N     1 
ATOM   84    C  CA    . GLY A  1 37  ? 26.119  7.673    73.454  1.00 52.95  ? 37  GLY A CA    1 
ATOM   85    C  C     . GLY A  1 37  ? 24.882  7.287    72.692  1.00 52.30  ? 37  GLY A C     1 
ATOM   86    O  O     . GLY A  1 37  ? 24.584  6.105    72.541  1.00 51.64  ? 37  GLY A O     1 
ATOM   87    N  N     . ASP A  1 38  ? 24.159  8.300    72.228  1.00 53.54  ? 38  ASP A N     1 
ATOM   88    C  CA    . ASP A  1 38  ? 22.955  8.115    71.437  1.00 53.72  ? 38  ASP A CA    1 
ATOM   89    C  C     . ASP A  1 38  ? 21.847  7.395    72.197  1.00 52.20  ? 38  ASP A C     1 
ATOM   90    O  O     . ASP A  1 38  ? 21.143  6.573    71.646  1.00 51.90  ? 38  ASP A O     1 
ATOM   91    C  CB    . ASP A  1 38  ? 23.296  7.411    70.125  1.00 54.29  ? 38  ASP A CB    1 
ATOM   92    C  CG    . ASP A  1 38  ? 24.209  8.246    69.249  1.00 57.72  ? 38  ASP A CG    1 
ATOM   93    O  OD1   . ASP A  1 38  ? 24.330  9.460    69.516  1.00 61.36  ? 38  ASP A OD1   1 
ATOM   94    O  OD2   . ASP A  1 38  ? 24.804  7.713    68.291  1.00 59.06  ? 38  ASP A OD2   1 
ATOM   95    N  N     . GLY A  1 39  ? 21.701  7.704    73.475  1.00 51.96  ? 39  GLY A N     1 
ATOM   96    C  CA    . GLY A  1 39  ? 20.656  7.084    74.262  1.00 51.40  ? 39  GLY A CA    1 
ATOM   97    C  C     . GLY A  1 39  ? 20.946  5.638    74.592  1.00 50.14  ? 39  GLY A C     1 
ATOM   98    O  O     . GLY A  1 39  ? 20.097  4.962    75.177  1.00 49.84  ? 39  GLY A O     1 
ATOM   99    N  N     . ILE A  1 40  ? 22.134  5.156    74.209  1.00 49.94  ? 40  ILE A N     1 
ATOM   100   C  CA    . ILE A  1 40  ? 22.608  3.846    74.659  1.00 48.69  ? 40  ILE A CA    1 
ATOM   101   C  C     . ILE A  1 40  ? 23.667  4.017    75.735  1.00 49.03  ? 40  ILE A C     1 
ATOM   102   O  O     . ILE A  1 40  ? 24.648  4.723    75.539  1.00 50.31  ? 40  ILE A O     1 
ATOM   103   C  CB    . ILE A  1 40  ? 23.163  2.963    73.526  1.00 48.75  ? 40  ILE A CB    1 
ATOM   104   C  CG1   . ILE A  1 40  ? 22.195  2.890    72.344  1.00 49.95  ? 40  ILE A CG1   1 
ATOM   105   C  CG2   . ILE A  1 40  ? 23.389  1.550    74.027  1.00 47.50  ? 40  ILE A CG2   1 
ATOM   106   C  CD1   . ILE A  1 40  ? 20.812  2.379    72.697  1.00 49.50  ? 40  ILE A CD1   1 
ATOM   107   N  N     . ALA A  1 41  ? 23.427  3.390    76.883  1.00 48.32  ? 41  ALA A N     1 
ATOM   108   C  CA    . ALA A  1 41  ? 24.402  3.274    77.939  1.00 48.98  ? 41  ALA A CA    1 
ATOM   109   C  C     . ALA A  1 41  ? 24.771  1.806    77.977  1.00 48.82  ? 41  ALA A C     1 
ATOM   110   O  O     . ALA A  1 41  ? 23.897  0.964    78.218  1.00 47.91  ? 41  ALA A O     1 
ATOM   111   C  CB    . ALA A  1 41  ? 23.803  3.700    79.257  1.00 49.25  ? 41  ALA A CB    1 
ATOM   112   N  N     . ARG A  1 42  ? 26.047  1.513    77.678  1.00 50.00  ? 42  ARG A N     1 
ATOM   113   C  CA    . ARG A  1 42  ? 26.655  0.178    77.808  1.00 50.03  ? 42  ARG A CA    1 
ATOM   114   C  C     . ARG A  1 42  ? 27.200  0.060    79.234  1.00 51.39  ? 42  ARG A C     1 
ATOM   115   O  O     . ARG A  1 42  ? 28.016  0.887    79.667  1.00 52.92  ? 42  ARG A O     1 
ATOM   116   C  CB    . ARG A  1 42  ? 27.779  -0.014   76.777  1.00 50.97  ? 42  ARG A CB    1 
ATOM   117   C  CG    . ARG A  1 42  ? 27.295  -0.257   75.325  1.00 51.42  ? 42  ARG A CG    1 
ATOM   118   C  CD    . ARG A  1 42  ? 28.428  -0.225   74.252  1.00 53.03  ? 42  ARG A CD    1 
ATOM   119   N  NE    . ARG A  1 42  ? 29.563  -1.069   74.629  1.00 55.48  ? 42  ARG A NE    1 
ATOM   120   C  CZ    . ARG A  1 42  ? 30.814  -0.642   74.812  1.00 58.02  ? 42  ARG A CZ    1 
ATOM   121   N  NH1   . ARG A  1 42  ? 31.139  0.628    74.610  1.00 59.52  ? 42  ARG A NH1   1 
ATOM   122   N  NH2   . ARG A  1 42  ? 31.758  -1.494   75.187  1.00 59.20  ? 42  ARG A NH2   1 
ATOM   123   N  N     . VAL A  1 43  ? 26.754  -0.954   79.973  1.00 51.07  ? 43  VAL A N     1 
ATOM   124   C  CA    . VAL A  1 43  ? 27.013  -0.991   81.421  1.00 52.71  ? 43  VAL A CA    1 
ATOM   125   C  C     . VAL A  1 43  ? 27.652  -2.290   81.933  1.00 54.35  ? 43  VAL A C     1 
ATOM   126   O  O     . VAL A  1 43  ? 27.165  -3.384   81.657  1.00 53.70  ? 43  VAL A O     1 
ATOM   127   C  CB    . VAL A  1 43  ? 25.705  -0.686   82.218  1.00 51.85  ? 43  VAL A CB    1 
ATOM   128   C  CG1   . VAL A  1 43  ? 25.943  -0.749   83.718  1.00 53.63  ? 43  VAL A CG1   1 
ATOM   129   C  CG2   . VAL A  1 43  ? 25.156  0.663    81.822  1.00 50.35  ? 43  VAL A CG2   1 
ATOM   130   N  N     . PHE A  1 44  ? 28.729  -2.154   82.702  1.00 57.00  ? 44  PHE A N     1 
ATOM   131   C  CA    . PHE A  1 44  ? 29.366  -3.290   83.381  1.00 59.25  ? 44  PHE A CA    1 
ATOM   132   C  C     . PHE A  1 44  ? 28.664  -3.643   84.694  1.00 59.93  ? 44  PHE A C     1 
ATOM   133   O  O     . PHE A  1 44  ? 28.278  -2.767   85.448  1.00 61.04  ? 44  PHE A O     1 
ATOM   134   C  CB    . PHE A  1 44  ? 30.843  -2.969   83.646  1.00 62.60  ? 44  PHE A CB    1 
ATOM   135   C  CG    . PHE A  1 44  ? 31.650  -4.134   84.154  1.00 65.82  ? 44  PHE A CG    1 
ATOM   136   C  CD1   . PHE A  1 44  ? 32.130  -5.096   83.281  1.00 67.20  ? 44  PHE A CD1   1 
ATOM   137   C  CD2   . PHE A  1 44  ? 31.956  -4.253   85.502  1.00 69.64  ? 44  PHE A CD2   1 
ATOM   138   C  CE1   . PHE A  1 44  ? 32.894  -6.178   83.750  1.00 70.79  ? 44  PHE A CE1   1 
ATOM   139   C  CE2   . PHE A  1 44  ? 32.709  -5.330   85.976  1.00 72.95  ? 44  PHE A CE2   1 
ATOM   140   C  CZ    . PHE A  1 44  ? 33.179  -6.290   85.095  1.00 73.07  ? 44  PHE A CZ    1 
ATOM   141   N  N     . GLY A  1 45  ? 28.509  -4.932   84.963  1.00 60.44  ? 45  GLY A N     1 
ATOM   142   C  CA    . GLY A  1 45  ? 27.901  -5.403   86.204  1.00 61.48  ? 45  GLY A CA    1 
ATOM   143   C  C     . GLY A  1 45  ? 26.416  -5.643   86.060  1.00 59.23  ? 45  GLY A C     1 
ATOM   144   O  O     . GLY A  1 45  ? 25.941  -6.051   84.994  1.00 57.38  ? 45  GLY A O     1 
ATOM   145   N  N     . LEU A  1 46  ? 25.685  -5.374   87.140  1.00 60.18  ? 46  LEU A N     1 
ATOM   146   C  CA    . LEU A  1 46  ? 24.241  -5.571   87.205  1.00 58.48  ? 46  LEU A CA    1 
ATOM   147   C  C     . LEU A  1 46  ? 23.892  -7.030   86.958  1.00 58.10  ? 46  LEU A C     1 
ATOM   148   O  O     . LEU A  1 46  ? 22.910  -7.334   86.290  1.00 56.41  ? 46  LEU A O     1 
ATOM   149   C  CB    . LEU A  1 46  ? 23.536  -4.677   86.192  1.00 55.68  ? 46  LEU A CB    1 
ATOM   150   C  CG    . LEU A  1 46  ? 23.429  -3.171   86.433  1.00 56.60  ? 46  LEU A CG    1 
ATOM   151   C  CD1   . LEU A  1 46  ? 22.859  -2.471   85.180  1.00 53.81  ? 46  LEU A CD1   1 
ATOM   152   C  CD2   . LEU A  1 46  ? 22.569  -2.874   87.649  1.00 58.78  ? 46  LEU A CD2   1 
ATOM   153   N  N     . ASN A  1 47  ? 24.701  -7.928   87.509  1.00 60.13  ? 47  ASN A N     1 
ATOM   154   C  CA    . ASN A  1 47  ? 24.631  -9.354   87.178  1.00 59.88  ? 47  ASN A CA    1 
ATOM   155   C  C     . ASN A  1 47  ? 23.318  -10.084  87.494  1.00 59.69  ? 47  ASN A C     1 
ATOM   156   O  O     . ASN A  1 47  ? 23.172  -11.243  87.125  1.00 59.93  ? 47  ASN A O     1 
ATOM   157   C  CB    . ASN A  1 47  ? 25.791  -10.117  87.841  1.00 62.91  ? 47  ASN A CB    1 
ATOM   158   C  CG    . ASN A  1 47  ? 27.145  -9.552   87.495  1.00 63.28  ? 47  ASN A CG    1 
ATOM   159   O  OD1   . ASN A  1 47  ? 27.421  -9.189   86.354  1.00 62.01  ? 47  ASN A OD1   1 
ATOM   160   N  ND2   . ASN A  1 47  ? 28.011  -9.492   88.485  1.00 67.35  ? 47  ASN A ND2   1 
ATOM   161   N  N     . ASN A  1 48  ? 22.387  -9.440   88.193  1.00 60.09  ? 48  ASN A N     1 
ATOM   162   C  CA    . ASN A  1 48  ? 21.143  -10.107  88.593  1.00 60.88  ? 48  ASN A CA    1 
ATOM   163   C  C     . ASN A  1 48  ? 19.902  -9.484   87.966  1.00 59.03  ? 48  ASN A C     1 
ATOM   164   O  O     . ASN A  1 48  ? 18.774  -9.821   88.344  1.00 60.15  ? 48  ASN A O     1 
ATOM   165   C  CB    . ASN A  1 48  ? 20.976  -10.087  90.116  1.00 64.33  ? 48  ASN A CB    1 
ATOM   166   C  CG    . ASN A  1 48  ? 21.714  -11.209  90.822  1.00 67.37  ? 48  ASN A CG    1 
ATOM   167   O  OD1   . ASN A  1 48  ? 22.208  -12.154  90.202  1.00 66.96  ? 48  ASN A OD1   1 
ATOM   168   N  ND2   . ASN A  1 48  ? 21.783  -11.108  92.147  1.00 71.13  ? 48  ASN A ND2   1 
ATOM   169   N  N     . ILE A  1 49  ? 20.115  -8.572   87.022  1.00 56.99  ? 49  ILE A N     1 
ATOM   170   C  CA    . ILE A  1 49  ? 19.031  -7.809   86.401  1.00 55.36  ? 49  ILE A CA    1 
ATOM   171   C  C     . ILE A  1 49  ? 18.162  -8.646   85.453  1.00 54.40  ? 49  ILE A C     1 
ATOM   172   O  O     . ILE A  1 49  ? 18.650  -9.547   84.772  1.00 54.00  ? 49  ILE A O     1 
ATOM   173   C  CB    . ILE A  1 49  ? 19.551  -6.524   85.665  1.00 53.59  ? 49  ILE A CB    1 
ATOM   174   C  CG1   . ILE A  1 49  ? 18.369  -5.621   85.287  1.00 52.14  ? 49  ILE A CG1   1 
ATOM   175   C  CG2   . ILE A  1 49  ? 20.412  -6.876   84.433  1.00 50.52  ? 49  ILE A CG2   1 
ATOM   176   C  CD1   . ILE A  1 49  ? 18.730  -4.210   84.998  1.00 50.72  ? 49  ILE A CD1   1 
ATOM   177   N  N     . GLN A  1 50  ? 16.875  -8.322   85.414  1.00 54.75  ? 50  GLN A N     1 
ATOM   178   C  CA    . GLN A  1 50  ? 15.946  -8.975   84.508  1.00 54.45  ? 50  GLN A CA    1 
ATOM   179   C  C     . GLN A  1 50  ? 15.954  -8.340   83.130  1.00 52.75  ? 50  GLN A C     1 
ATOM   180   O  O     . GLN A  1 50  ? 16.176  -7.130   83.003  1.00 52.95  ? 50  GLN A O     1 
ATOM   181   C  CB    . GLN A  1 50  ? 14.545  -8.895   85.069  1.00 55.92  ? 50  GLN A CB    1 
ATOM   182   C  CG    . GLN A  1 50  ? 14.358  -9.738   86.283  1.00 58.54  ? 50  GLN A CG    1 
ATOM   183   C  CD    . GLN A  1 50  ? 13.067  -9.427   86.944  1.00 61.02  ? 50  GLN A CD    1 
ATOM   184   O  OE1   . GLN A  1 50  ? 12.900  -8.354   87.522  1.00 62.44  ? 50  GLN A OE1   1 
ATOM   185   N  NE2   . GLN A  1 50  ? 12.122  -10.346  86.847  1.00 62.49  ? 50  GLN A NE2   1 
ATOM   186   N  N     . ALA A  1 51  ? 15.696  -9.134   82.097  1.00 51.74  ? 51  ALA A N     1 
ATOM   187   C  CA    . ALA A  1 51  ? 15.492  -8.553   80.786  1.00 50.54  ? 51  ALA A CA    1 
ATOM   188   C  C     . ALA A  1 51  ? 14.298  -7.586   80.852  1.00 51.44  ? 51  ALA A C     1 
ATOM   189   O  O     . ALA A  1 51  ? 13.269  -7.880   81.470  1.00 52.34  ? 51  ALA A O     1 
ATOM   190   C  CB    . ALA A  1 51  ? 15.264  -9.630   79.756  1.00 50.48  ? 51  ALA A CB    1 
ATOM   191   N  N     . GLU A  1 52  ? 14.463  -6.422   80.230  1.00 51.15  ? 52  GLU A N     1 
ATOM   192   C  CA    . GLU A  1 52  ? 13.405  -5.419   80.150  1.00 52.27  ? 52  GLU A CA    1 
ATOM   193   C  C     . GLU A  1 52  ? 13.135  -4.745   81.510  1.00 53.61  ? 52  GLU A C     1 
ATOM   194   O  O     . GLU A  1 52  ? 12.107  -4.072   81.701  1.00 55.25  ? 52  GLU A O     1 
ATOM   195   C  CB    . GLU A  1 52  ? 12.132  -6.017   79.509  1.00 53.58  ? 52  GLU A CB    1 
ATOM   196   C  CG    . GLU A  1 52  ? 12.293  -6.411   78.025  1.00 54.17  ? 52  GLU A CG    1 
ATOM   197   C  CD    . GLU A  1 52  ? 11.013  -6.989   77.383  1.00 59.64  ? 52  GLU A CD    1 
ATOM   198   O  OE1   . GLU A  1 52  ? 9.929   -6.342   77.437  1.00 61.69  ? 52  GLU A OE1   1 
ATOM   199   O  OE2   . GLU A  1 52  ? 11.093  -8.098   76.793  1.00 61.45  ? 52  GLU A OE2   1 
ATOM   200   N  N     . GLU A  1 53  ? 14.072  -4.921   82.446  1.00 53.51  ? 53  GLU A N     1 
ATOM   201   C  CA    . GLU A  1 53  ? 13.988  -4.301   83.784  1.00 55.13  ? 53  GLU A CA    1 
ATOM   202   C  C     . GLU A  1 53  ? 14.438  -2.839   83.727  1.00 54.91  ? 53  GLU A C     1 
ATOM   203   O  O     . GLU A  1 53  ? 15.227  -2.448   82.855  1.00 53.13  ? 53  GLU A O     1 
ATOM   204   C  CB    . GLU A  1 53  ? 14.821  -5.093   84.806  1.00 55.67  ? 53  GLU A CB    1 
ATOM   205   C  CG    . GLU A  1 53  ? 14.802  -4.538   86.237  1.00 58.59  ? 53  GLU A CG    1 
ATOM   206   C  CD    . GLU A  1 53  ? 15.663  -5.328   87.219  1.00 59.87  ? 53  GLU A CD    1 
ATOM   207   O  OE1   . GLU A  1 53  ? 15.728  -6.578   87.153  1.00 59.85  ? 53  GLU A OE1   1 
ATOM   208   O  OE2   . GLU A  1 53  ? 16.279  -4.682   88.085  1.00 62.27  ? 53  GLU A OE2   1 
ATOM   209   N  N     . LEU A  1 54  ? 13.937  -2.052   84.670  1.00 57.12  ? 54  LEU A N     1 
ATOM   210   C  CA    . LEU A  1 54  ? 14.169  -0.617   84.732  1.00 58.03  ? 54  LEU A CA    1 
ATOM   211   C  C     . LEU A  1 54  ? 15.384  -0.273   85.608  1.00 58.99  ? 54  LEU A C     1 
ATOM   212   O  O     . LEU A  1 54  ? 15.539  -0.840   86.699  1.00 60.76  ? 54  LEU A O     1 
ATOM   213   C  CB    . LEU A  1 54  ? 12.923  0.022    85.325  1.00 60.72  ? 54  LEU A CB    1 
ATOM   214   C  CG    . LEU A  1 54  ? 12.360  1.284    84.693  1.00 62.33  ? 54  LEU A CG    1 
ATOM   215   C  CD1   . LEU A  1 54  ? 12.195  1.131    83.171  1.00 60.08  ? 54  LEU A CD1   1 
ATOM   216   C  CD2   . LEU A  1 54  ? 11.038  1.613    85.360  1.00 65.00  ? 54  LEU A CD2   1 
ATOM   217   N  N     . VAL A  1 55  ? 16.240  0.651    85.155  1.00 58.25  ? 55  VAL A N     1 
ATOM   218   C  CA    . VAL A  1 55  ? 17.392  1.083    85.983  1.00 59.53  ? 55  VAL A CA    1 
ATOM   219   C  C     . VAL A  1 55  ? 17.401  2.569    86.365  1.00 61.47  ? 55  VAL A C     1 
ATOM   220   O  O     . VAL A  1 55  ? 16.732  3.384    85.731  1.00 61.86  ? 55  VAL A O     1 
ATOM   221   C  CB    . VAL A  1 55  ? 18.749  0.715    85.341  1.00 57.74  ? 55  VAL A CB    1 
ATOM   222   C  CG1   . VAL A  1 55  ? 18.774  -0.742   84.967  1.00 56.27  ? 55  VAL A CG1   1 
ATOM   223   C  CG2   . VAL A  1 55  ? 19.027  1.576    84.111  1.00 56.98  ? 55  VAL A CG2   1 
ATOM   224   N  N     . GLU A  1 56  ? 18.156  2.906    87.410  1.00 63.60  ? 56  GLU A N     1 
ATOM   225   C  CA    . GLU A  1 56  ? 18.322  4.288    87.878  1.00 65.92  ? 56  GLU A CA    1 
ATOM   226   C  C     . GLU A  1 56  ? 19.812  4.674    87.849  1.00 65.48  ? 56  GLU A C     1 
ATOM   227   O  O     . GLU A  1 56  ? 20.678  3.901    88.276  1.00 65.43  ? 56  GLU A O     1 
ATOM   228   C  CB    . GLU A  1 56  ? 17.657  4.483    89.266  1.00 70.15  ? 56  GLU A CB    1 
ATOM   229   C  CG    . GLU A  1 56  ? 18.515  5.153    90.369  1.00 75.58  ? 56  GLU A CG    1 
ATOM   230   C  CD    . GLU A  1 56  ? 17.695  5.863    91.469  1.00 83.56  ? 56  GLU A CD    1 
ATOM   231   O  OE1   . GLU A  1 56  ? 16.691  6.528    91.120  1.00 85.44  ? 56  GLU A OE1   1 
ATOM   232   O  OE2   . GLU A  1 56  ? 18.071  5.789    92.677  1.00 87.39  ? 56  GLU A OE2   1 
ATOM   233   N  N     . PHE A  1 57  ? 20.101  5.855    87.307  1.00 65.24  ? 57  PHE A N     1 
ATOM   234   C  CA    . PHE A  1 57  ? 21.469  6.354    87.177  1.00 65.35  ? 57  PHE A CA    1 
ATOM   235   C  C     . PHE A  1 57  ? 21.789  7.380    88.263  1.00 69.44  ? 57  PHE A C     1 
ATOM   236   O  O     . PHE A  1 57  ? 20.875  7.969    88.847  1.00 71.56  ? 57  PHE A O     1 
ATOM   237   C  CB    . PHE A  1 57  ? 21.667  6.998    85.803  1.00 63.20  ? 57  PHE A CB    1 
ATOM   238   C  CG    . PHE A  1 57  ? 21.716  6.014    84.661  1.00 59.78  ? 57  PHE A CG    1 
ATOM   239   C  CD1   . PHE A  1 57  ? 20.549  5.632    83.996  1.00 57.06  ? 57  PHE A CD1   1 
ATOM   240   C  CD2   . PHE A  1 57  ? 22.940  5.473    84.243  1.00 58.15  ? 57  PHE A CD2   1 
ATOM   241   C  CE1   . PHE A  1 57  ? 20.594  4.720    82.930  1.00 53.98  ? 57  PHE A CE1   1 
ATOM   242   C  CE2   . PHE A  1 57  ? 22.993  4.560    83.190  1.00 55.25  ? 57  PHE A CE2   1 
ATOM   243   C  CZ    . PHE A  1 57  ? 21.815  4.183    82.530  1.00 53.23  ? 57  PHE A CZ    1 
ATOM   244   N  N     . SER A  1 58  ? 23.083  7.590    88.527  1.00 70.86  ? 58  SER A N     1 
ATOM   245   C  CA    . SER A  1 58  ? 23.547  8.631    89.460  1.00 74.95  ? 58  SER A CA    1 
ATOM   246   C  C     . SER A  1 58  ? 22.724  9.899    89.319  1.00 75.99  ? 58  SER A C     1 
ATOM   247   O  O     . SER A  1 58  ? 22.051  10.325   90.250  1.00 79.29  ? 58  SER A O     1 
ATOM   248   C  CB    . SER A  1 58  ? 25.014  9.002    89.195  1.00 75.66  ? 58  SER A CB    1 
ATOM   249   O  OG    . SER A  1 58  ? 25.915  7.968    89.546  1.00 77.34  ? 58  SER A OG    1 
ATOM   250   N  N     . SER A  1 59  ? 22.788  10.486   88.128  1.00 73.84  ? 59  SER A N     1 
ATOM   251   C  CA    . SER A  1 59  ? 22.188  11.779   87.834  1.00 75.01  ? 59  SER A CA    1 
ATOM   252   C  C     . SER A  1 59  ? 20.671  11.742   87.918  1.00 75.11  ? 59  SER A C     1 
ATOM   253   O  O     . SER A  1 59  ? 20.030  12.781   87.959  1.00 77.55  ? 59  SER A O     1 
ATOM   254   C  CB    . SER A  1 59  ? 22.616  12.240   86.444  1.00 72.66  ? 59  SER A CB    1 
ATOM   255   O  OG    . SER A  1 59  ? 22.306  11.245   85.483  1.00 69.16  ? 59  SER A OG    1 
ATOM   256   N  N     . GLY A  1 60  ? 20.097  10.547   87.936  1.00 73.17  ? 60  GLY A N     1 
ATOM   257   C  CA    . GLY A  1 60  ? 18.660  10.403   88.144  1.00 74.03  ? 60  GLY A CA    1 
ATOM   258   C  C     . GLY A  1 60  ? 17.871  10.057   86.894  1.00 70.82  ? 60  GLY A C     1 
ATOM   259   O  O     . GLY A  1 60  ? 16.643  9.927    86.934  1.00 71.86  ? 60  GLY A O     1 
ATOM   260   N  N     . VAL A  1 61  ? 18.567  9.919    85.776  1.00 67.42  ? 61  VAL A N     1 
ATOM   261   C  CA    . VAL A  1 61  ? 17.914  9.549    84.537  1.00 64.78  ? 61  VAL A CA    1 
ATOM   262   C  C     . VAL A  1 61  ? 17.611  8.052    84.600  1.00 62.80  ? 61  VAL A C     1 
ATOM   263   O  O     . VAL A  1 61  ? 18.382  7.285    85.181  1.00 62.88  ? 61  VAL A O     1 
ATOM   264   C  CB    . VAL A  1 61  ? 18.786  9.930    83.306  1.00 62.96  ? 61  VAL A CB    1 
ATOM   265   C  CG1   . VAL A  1 61  ? 19.832  8.878    83.005  1.00 59.82  ? 61  VAL A CG1   1 
ATOM   266   C  CG2   . VAL A  1 61  ? 17.916  10.160   82.088  1.00 62.94  ? 61  VAL A CG2   1 
ATOM   267   N  N     . LYS A  1 62  ? 16.481  7.635    84.037  1.00 61.70  ? 62  LYS A N     1 
ATOM   268   C  CA    . LYS A  1 62  ? 16.118  6.227    84.071  1.00 59.53  ? 62  LYS A CA    1 
ATOM   269   C  C     . LYS A  1 62  ? 16.372  5.609    82.718  1.00 56.19  ? 62  LYS A C     1 
ATOM   270   O  O     . LYS A  1 62  ? 16.724  6.302    81.767  1.00 55.69  ? 62  LYS A O     1 
ATOM   271   C  CB    . LYS A  1 62  ? 14.670  6.038    84.503  1.00 61.72  ? 62  LYS A CB    1 
ATOM   272   C  CG    . LYS A  1 62  ? 14.386  6.384    85.978  1.00 66.43  ? 62  LYS A CG    1 
ATOM   273   C  CD    . LYS A  1 62  ? 13.031  5.790    86.412  1.00 70.29  ? 62  LYS A CD    1 
ATOM   274   C  CE    . LYS A  1 62  ? 12.716  6.033    87.890  1.00 73.76  ? 62  LYS A CE    1 
ATOM   275   N  NZ    . LYS A  1 62  ? 11.782  7.171    88.085  1.00 76.47  ? 62  LYS A NZ    1 
ATOM   276   N  N     . GLY A  1 63  ? 16.231  4.295    82.638  1.00 54.31  ? 63  GLY A N     1 
ATOM   277   C  CA    . GLY A  1 63  ? 16.370  3.587    81.378  1.00 51.42  ? 63  GLY A CA    1 
ATOM   278   C  C     . GLY A  1 63  ? 15.898  2.176    81.611  1.00 50.66  ? 63  GLY A C     1 
ATOM   279   O  O     . GLY A  1 63  ? 15.537  1.822    82.756  1.00 51.70  ? 63  GLY A O     1 
ATOM   280   N  N     . MET A  1 64  ? 15.900  1.372    80.543  1.00 48.47  ? 64  MET A N     1 
ATOM   281   C  CA    . MET A  1 64  ? 15.572  -0.038   80.667  1.00 47.81  ? 64  MET A CA    1 
ATOM   282   C  C     . MET A  1 64  ? 16.589  -0.960   79.999  1.00 46.29  ? 64  MET A C     1 
ATOM   283   O  O     . MET A  1 64  ? 17.181  -0.618   78.969  1.00 45.81  ? 64  MET A O     1 
ATOM   284   C  CB    . MET A  1 64  ? 14.127  -0.310   80.224  1.00 48.69  ? 64  MET A CB    1 
ATOM   285   C  CG    . MET A  1 64  ? 13.852  -0.263   78.749  1.00 48.35  ? 64  MET A CG    1 
ATOM   286   S  SD    . MET A  1 64  ? 12.136  -0.705   78.314  1.00 53.48  ? 64  MET A SD    1 
ATOM   287   C  CE    . MET A  1 64  ? 11.867  -2.177   79.275  1.00 52.96  ? 64  MET A CE    1 
ATOM   288   N  N     . ALA A  1 65  ? 16.796  -2.139   80.584  1.00 46.37  ? 65  ALA A N     1 
ATOM   289   C  CA    . ALA A  1 65  ? 17.855  -3.047   80.098  1.00 45.43  ? 65  ALA A CA    1 
ATOM   290   C  C     . ALA A  1 65  ? 17.386  -3.985   79.003  1.00 44.59  ? 65  ALA A C     1 
ATOM   291   O  O     . ALA A  1 65  ? 16.935  -5.082   79.286  1.00 45.06  ? 65  ALA A O     1 
ATOM   292   C  CB    . ALA A  1 65  ? 18.463  -3.836   81.255  1.00 45.91  ? 65  ALA A CB    1 
ATOM   293   N  N     . LEU A  1 66  ? 17.493  -3.551   77.752  1.00 44.25  ? 66  LEU A N     1 
ATOM   294   C  CA    . LEU A  1 66  ? 17.040  -4.380   76.615  1.00 44.35  ? 66  LEU A CA    1 
ATOM   295   C  C     . LEU A  1 66  ? 18.020  -5.469   76.172  1.00 44.24  ? 66  LEU A C     1 
ATOM   296   O  O     . LEU A  1 66  ? 17.582  -6.550   75.795  1.00 45.02  ? 66  LEU A O     1 
ATOM   297   C  CB    . LEU A  1 66  ? 16.682  -3.539   75.395  1.00 44.25  ? 66  LEU A CB    1 
ATOM   298   C  CG    . LEU A  1 66  ? 15.529  -2.578   75.534  1.00 45.03  ? 66  LEU A CG    1 
ATOM   299   C  CD1   . LEU A  1 66  ? 15.385  -1.823   74.252  1.00 45.00  ? 66  LEU A CD1   1 
ATOM   300   C  CD2   . LEU A  1 66  ? 14.246  -3.323   75.871  1.00 47.36  ? 66  LEU A CD2   1 
ATOM   301   N  N     . ASN A  1 67  ? 19.319  -5.167   76.165  1.00 43.89  ? 67  ASN A N     1 
ATOM   302   C  CA    . ASN A  1 67  ? 20.349  -6.147   75.806  1.00 44.08  ? 67  ASN A CA    1 
ATOM   303   C  C     . ASN A  1 67  ? 21.057  -6.715   77.015  1.00 44.80  ? 67  ASN A C     1 
ATOM   304   O  O     . ASN A  1 67  ? 21.826  -6.002   77.668  1.00 45.24  ? 67  ASN A O     1 
ATOM   305   C  CB    . ASN A  1 67  ? 21.393  -5.518   74.888  1.00 43.76  ? 67  ASN A CB    1 
ATOM   306   C  CG    . ASN A  1 67  ? 21.018  -5.615   73.453  1.00 43.73  ? 67  ASN A CG    1 
ATOM   307   O  OD1   . ASN A  1 67  ? 19.852  -5.710   73.128  1.00 46.27  ? 67  ASN A OD1   1 
ATOM   308   N  ND2   . ASN A  1 67  ? 21.993  -5.615   72.580  1.00 43.49  ? 67  ASN A ND2   1 
ATOM   309   N  N     . LEU A  1 68  ? 20.813  -7.983   77.331  1.00 45.58  ? 68  LEU A N     1 
ATOM   310   C  CA    . LEU A  1 68  ? 21.652  -8.637   78.331  1.00 46.76  ? 68  LEU A CA    1 
ATOM   311   C  C     . LEU A  1 68  ? 22.694  -9.440   77.604  1.00 48.27  ? 68  LEU A C     1 
ATOM   312   O  O     . LEU A  1 68  ? 22.347  -10.345  76.852  1.00 48.77  ? 68  LEU A O     1 
ATOM   313   C  CB    . LEU A  1 68  ? 20.855  -9.521   79.291  1.00 47.09  ? 68  LEU A CB    1 
ATOM   314   C  CG    . LEU A  1 68  ? 19.617  -8.899   79.924  1.00 45.52  ? 68  LEU A CG    1 
ATOM   315   C  CD1   . LEU A  1 68  ? 19.031  -9.876   80.915  1.00 46.33  ? 68  LEU A CD1   1 
ATOM   316   C  CD2   . LEU A  1 68  ? 19.960  -7.591   80.575  1.00 45.40  ? 68  LEU A CD2   1 
ATOM   317   N  N     . GLU A  1 69  ? 23.964  -9.088   77.820  1.00 49.68  ? 69  GLU A N     1 
ATOM   318   C  CA    . GLU A  1 69  ? 25.109  -9.716   77.136  1.00 51.95  ? 69  GLU A CA    1 
ATOM   319   C  C     . GLU A  1 69  ? 26.150  -10.213  78.138  1.00 53.66  ? 69  GLU A C     1 
ATOM   320   O  O     . GLU A  1 69  ? 26.138  -9.793   79.293  1.00 53.94  ? 69  GLU A O     1 
ATOM   321   C  CB    . GLU A  1 69  ? 25.754  -8.704   76.186  1.00 52.19  ? 69  GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 69  ? 24.865  -8.287   75.021  1.00 54.02  ? 69  GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 69  ? 25.383  -7.048   74.304  1.00 58.92  ? 69  GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 69  ? 26.184  -7.186   73.348  1.00 63.27  ? 69  GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 69  ? 24.989  -5.926   74.693  1.00 59.21  ? 69  GLU A OE2   1 
ATOM   326   N  N     . PRO A  1 70  ? 27.082  -11.088  77.704  1.00 55.86  ? 70  PRO A N     1 
ATOM   327   C  CA    . PRO A  1 70  ? 28.097  -11.547  78.648  1.00 57.77  ? 70  PRO A CA    1 
ATOM   328   C  C     . PRO A  1 70  ? 28.857  -10.386  79.321  1.00 58.33  ? 70  PRO A C     1 
ATOM   329   O  O     . PRO A  1 70  ? 28.788  -10.220  80.539  1.00 58.92  ? 70  PRO A O     1 
ATOM   330   C  CB    . PRO A  1 70  ? 29.034  -12.359  77.767  1.00 60.09  ? 70  PRO A CB    1 
ATOM   331   C  CG    . PRO A  1 70  ? 28.225  -12.756  76.607  1.00 58.61  ? 70  PRO A CG    1 
ATOM   332   C  CD    . PRO A  1 70  ? 27.340  -11.613  76.347  1.00 56.76  ? 70  PRO A CD    1 
ATOM   333   N  N     . GLY A  1 71  ? 29.556  -9.571   78.547  1.00 58.55  ? 71  GLY A N     1 
ATOM   334   C  CA    . GLY A  1 71  ? 30.377  -8.531   79.151  1.00 59.40  ? 71  GLY A CA    1 
ATOM   335   C  C     . GLY A  1 71  ? 29.604  -7.473   79.916  1.00 57.33  ? 71  GLY A C     1 
ATOM   336   O  O     . GLY A  1 71  ? 30.011  -7.046   80.992  1.00 58.44  ? 71  GLY A O     1 
ATOM   337   N  N     . GLN A  1 72  ? 28.465  -7.080   79.361  1.00 54.59  ? 72  GLN A N     1 
ATOM   338   C  CA    . GLN A  1 72  ? 27.871  -5.783   79.643  1.00 52.85  ? 72  GLN A CA    1 
ATOM   339   C  C     . GLN A  1 72  ? 26.359  -5.874   79.577  1.00 50.60  ? 72  GLN A C     1 
ATOM   340   O  O     . GLN A  1 72  ? 25.808  -6.940   79.319  1.00 50.56  ? 72  GLN A O     1 
ATOM   341   C  CB    . GLN A  1 72  ? 28.363  -4.790   78.592  1.00 52.32  ? 72  GLN A CB    1 
ATOM   342   C  CG    . GLN A  1 72  ? 28.609  -5.454   77.245  1.00 53.62  ? 72  GLN A CG    1 
ATOM   343   C  CD    . GLN A  1 72  ? 28.979  -4.491   76.139  1.00 55.98  ? 72  GLN A CD    1 
ATOM   344   O  OE1   . GLN A  1 72  ? 29.664  -3.498   76.373  1.00 57.79  ? 72  GLN A OE1   1 
ATOM   345   N  NE2   . GLN A  1 72  ? 28.530  -4.786   74.912  1.00 55.52  ? 72  GLN A NE2   1 
ATOM   346   N  N     . VAL A  1 73  ? 25.689  -4.751   79.810  1.00 49.44  ? 73  VAL A N     1 
ATOM   347   C  CA    . VAL A  1 73  ? 24.247  -4.645   79.597  1.00 47.85  ? 73  VAL A CA    1 
ATOM   348   C  C     . VAL A  1 73  ? 23.992  -3.403   78.757  1.00 46.81  ? 73  VAL A C     1 
ATOM   349   O  O     . VAL A  1 73  ? 24.572  -2.351   79.017  1.00 48.04  ? 73  VAL A O     1 
ATOM   350   C  CB    . VAL A  1 73  ? 23.474  -4.574   80.935  1.00 48.01  ? 73  VAL A CB    1 
ATOM   351   C  CG1   . VAL A  1 73  ? 22.101  -3.986   80.733  1.00 47.56  ? 73  VAL A CG1   1 
ATOM   352   C  CG2   . VAL A  1 73  ? 23.331  -5.937   81.512  1.00 48.81  ? 73  VAL A CG2   1 
ATOM   353   N  N     . GLY A  1 74  ? 23.164  -3.523   77.733  1.00 45.58  ? 74  GLY A N     1 
ATOM   354   C  CA    . GLY A  1 74  ? 22.843  -2.370   76.903  1.00 45.08  ? 74  GLY A CA    1 
ATOM   355   C  C     . GLY A  1 74  ? 21.560  -1.740   77.402  1.00 44.89  ? 74  GLY A C     1 
ATOM   356   O  O     . GLY A  1 74  ? 20.478  -2.373   77.369  1.00 44.68  ? 74  GLY A O     1 
ATOM   357   N  N     . ILE A  1 75  ? 21.674  -0.502   77.876  1.00 45.09  ? 75  ILE A N     1 
ATOM   358   C  CA    . ILE A  1 75  ? 20.534  0.201    78.431  1.00 45.26  ? 75  ILE A CA    1 
ATOM   359   C  C     . ILE A  1 75  ? 20.146  1.370    77.549  1.00 45.80  ? 75  ILE A C     1 
ATOM   360   O  O     . ILE A  1 75  ? 20.986  2.203    77.212  1.00 46.06  ? 75  ILE A O     1 
ATOM   361   C  CB    . ILE A  1 75  ? 20.808  0.672    79.864  1.00 46.09  ? 75  ILE A CB    1 
ATOM   362   C  CG1   . ILE A  1 75  ? 20.893  -0.535   80.782  1.00 46.04  ? 75  ILE A CG1   1 
ATOM   363   C  CG2   . ILE A  1 75  ? 19.695  1.587    80.357  1.00 47.14  ? 75  ILE A CG2   1 
ATOM   364   C  CD1   . ILE A  1 75  ? 21.770  -0.314   81.948  1.00 47.52  ? 75  ILE A CD1   1 
ATOM   365   N  N     . VAL A  1 76  ? 18.866  1.406    77.177  1.00 46.39  ? 76  VAL A N     1 
ATOM   366   C  CA    . VAL A  1 76  ? 18.276  2.521    76.429  1.00 47.39  ? 76  VAL A CA    1 
ATOM   367   C  C     . VAL A  1 76  ? 17.758  3.563    77.414  1.00 48.63  ? 76  VAL A C     1 
ATOM   368   O  O     . VAL A  1 76  ? 17.153  3.203    78.420  1.00 49.31  ? 76  VAL A O     1 
ATOM   369   C  CB    . VAL A  1 76  ? 17.158  2.033    75.477  1.00 47.96  ? 76  VAL A CB    1 
ATOM   370   C  CG1   . VAL A  1 76  ? 17.727  1.039    74.471  1.00 47.52  ? 76  VAL A CG1   1 
ATOM   371   C  CG2   . VAL A  1 76  ? 16.009  1.378    76.248  1.00 48.40  ? 76  VAL A CG2   1 
ATOM   372   N  N     . LEU A  1 77  ? 18.014  4.847    77.142  1.00 49.73  ? 77  LEU A N     1 
ATOM   373   C  CA    . LEU A  1 77  ? 17.768  5.921    78.135  1.00 50.91  ? 77  LEU A CA    1 
ATOM   374   C  C     . LEU A  1 77  ? 16.445  6.624    77.936  1.00 52.70  ? 77  LEU A C     1 
ATOM   375   O  O     . LEU A  1 77  ? 15.995  6.812    76.800  1.00 53.27  ? 77  LEU A O     1 
ATOM   376   C  CB    . LEU A  1 77  ? 18.888  6.969    78.126  1.00 51.07  ? 77  LEU A CB    1 
ATOM   377   C  CG    . LEU A  1 77  ? 20.325  6.502    78.351  1.00 50.10  ? 77  LEU A CG    1 
ATOM   378   C  CD1   . LEU A  1 77  ? 21.279  7.538    77.841  1.00 51.20  ? 77  LEU A CD1   1 
ATOM   379   C  CD2   . LEU A  1 77  ? 20.600  6.231    79.809  1.00 49.77  ? 77  LEU A CD2   1 
ATOM   380   N  N     . PHE A  1 78  ? 15.843  7.039    79.048  1.00 54.23  ? 78  PHE A N     1 
ATOM   381   C  CA    . PHE A  1 78  ? 14.553  7.711    79.027  1.00 56.06  ? 78  PHE A CA    1 
ATOM   382   C  C     . PHE A  1 78  ? 14.716  9.226    78.948  1.00 58.50  ? 78  PHE A C     1 
ATOM   383   O  O     . PHE A  1 78  ? 13.732  9.970    78.846  1.00 61.07  ? 78  PHE A O     1 
ATOM   384   C  CB    . PHE A  1 78  ? 13.749  7.339    80.264  1.00 57.00  ? 78  PHE A CB    1 
ATOM   385   C  CG    . PHE A  1 78  ? 13.195  5.950    80.241  1.00 54.97  ? 78  PHE A CG    1 
ATOM   386   C  CD1   . PHE A  1 78  ? 13.330  5.135    79.131  1.00 52.72  ? 78  PHE A CD1   1 
ATOM   387   C  CD2   . PHE A  1 78  ? 12.490  5.467    81.328  1.00 56.69  ? 78  PHE A CD2   1 
ATOM   388   C  CE1   . PHE A  1 78  ? 12.794  3.848    79.120  1.00 52.07  ? 78  PHE A CE1   1 
ATOM   389   C  CE2   . PHE A  1 78  ? 11.947  4.188    81.318  1.00 56.51  ? 78  PHE A CE2   1 
ATOM   390   C  CZ    . PHE A  1 78  ? 12.105  3.377    80.207  1.00 53.10  ? 78  PHE A CZ    1 
ATOM   391   N  N     . GLY A  1 79  ? 15.965  9.677    79.008  1.00 58.05  ? 79  GLY A N     1 
ATOM   392   C  CA    . GLY A  1 79  ? 16.277  11.099   79.047  1.00 60.31  ? 79  GLY A CA    1 
ATOM   393   C  C     . GLY A  1 79  ? 17.601  11.381   78.377  1.00 59.42  ? 79  GLY A C     1 
ATOM   394   O  O     . GLY A  1 79  ? 18.264  10.472   77.889  1.00 57.71  ? 79  GLY A O     1 
ATOM   395   N  N     . SER A  1 80  ? 17.991  12.644   78.350  1.00 61.58  ? 80  SER A N     1 
ATOM   396   C  CA    . SER A  1 80  ? 19.152  13.051   77.589  1.00 61.45  ? 80  SER A CA    1 
ATOM   397   C  C     . SER A  1 80  ? 20.366  12.325   78.101  1.00 60.29  ? 80  SER A C     1 
ATOM   398   O  O     . SER A  1 80  ? 20.554  12.198   79.304  1.00 61.57  ? 80  SER A O     1 
ATOM   399   C  CB    . SER A  1 80  ? 19.363  14.547   77.703  1.00 64.08  ? 80  SER A CB    1 
ATOM   400   O  OG    . SER A  1 80  ? 20.491  14.922   76.946  1.00 65.13  ? 80  SER A OG    1 
ATOM   401   N  N     . ASP A  1 81  ? 21.194  11.832   77.198  1.00 59.12  ? 81  ASP A N     1 
ATOM   402   C  CA    . ASP A  1 81  ? 22.375  11.123   77.637  1.00 58.58  ? 81  ASP A CA    1 
ATOM   403   C  C     . ASP A  1 81  ? 23.516  12.082   77.961  1.00 60.16  ? 81  ASP A C     1 
ATOM   404   O  O     . ASP A  1 81  ? 24.647  11.648   78.141  1.00 60.05  ? 81  ASP A O     1 
ATOM   405   C  CB    . ASP A  1 81  ? 22.802  10.076   76.605  1.00 57.28  ? 81  ASP A CB    1 
ATOM   406   C  CG    . ASP A  1 81  ? 23.103  10.681   75.263  1.00 59.74  ? 81  ASP A CG    1 
ATOM   407   O  OD1   . ASP A  1 81  ? 23.862  11.676   75.239  1.00 63.67  ? 81  ASP A OD1   1 
ATOM   408   O  OD2   . ASP A  1 81  ? 22.587  10.170   74.241  1.00 60.37  ? 81  ASP A OD2   1 
ATOM   409   N  N     . ARG A  1 82  ? 23.228  13.384   78.022  1.00 62.14  ? 82  ARG A N     1 
ATOM   410   C  CA    . ARG A  1 82  ? 24.205  14.341   78.551  1.00 64.25  ? 82  ARG A CA    1 
ATOM   411   C  C     . ARG A  1 82  ? 24.306  14.133   80.053  1.00 65.27  ? 82  ARG A C     1 
ATOM   412   O  O     . ARG A  1 82  ? 25.268  14.551   80.683  1.00 67.44  ? 82  ARG A O     1 
ATOM   413   C  CB    . ARG A  1 82  ? 23.825  15.793   78.241  1.00 66.48  ? 82  ARG A CB    1 
ATOM   414   C  CG    . ARG A  1 82  ? 24.669  16.819   79.003  1.00 68.42  ? 82  ARG A CG    1 
ATOM   415   C  CD    . ARG A  1 82  ? 24.251  18.252   78.709  1.00 70.13  ? 82  ARG A CD    1 
ATOM   416   N  NE    . ARG A  1 82  ? 25.000  19.232   79.501  1.00 71.24  ? 82  ARG A NE    1 
ATOM   417   C  CZ    . ARG A  1 82  ? 26.233  19.647   79.222  1.00 70.80  ? 82  ARG A CZ    1 
ATOM   418   N  NH1   . ARG A  1 82  ? 26.893  19.170   78.172  1.00 68.92  ? 82  ARG A NH1   1 
ATOM   419   N  NH2   . ARG A  1 82  ? 26.807  20.538   80.005  1.00 73.20  ? 82  ARG A NH2   1 
ATOM   420   N  N     . LEU A  1 83  ? 23.303  13.474   80.618  1.00 64.36  ? 83  LEU A N     1 
ATOM   421   C  CA    . LEU A  1 83  ? 23.260  13.234   82.046  1.00 65.68  ? 83  LEU A CA    1 
ATOM   422   C  C     . LEU A  1 83  ? 24.083  12.011   82.478  1.00 64.56  ? 83  LEU A C     1 
ATOM   423   O  O     . LEU A  1 83  ? 24.426  11.885   83.658  1.00 66.96  ? 83  LEU A O     1 
ATOM   424   C  CB    . LEU A  1 83  ? 21.806  13.137   82.505  1.00 66.09  ? 83  LEU A CB    1 
ATOM   425   C  CG    . LEU A  1 83  ? 21.019  14.439   82.245  1.00 68.62  ? 83  LEU A CG    1 
ATOM   426   C  CD1   . LEU A  1 83  ? 19.498  14.199   82.136  1.00 67.51  ? 83  LEU A CD1   1 
ATOM   427   C  CD2   . LEU A  1 83  ? 21.362  15.539   83.274  1.00 70.81  ? 83  LEU A CD2   1 
ATOM   428   N  N     . VAL A  1 84  ? 24.433  11.140   81.531  1.00 61.53  ? 84  VAL A N     1 
ATOM   429   C  CA    . VAL A  1 84  ? 25.200  9.929    81.833  1.00 60.13  ? 84  VAL A CA    1 
ATOM   430   C  C     . VAL A  1 84  ? 26.677  10.067   81.427  1.00 61.08  ? 84  VAL A C     1 
ATOM   431   O  O     . VAL A  1 84  ? 26.980  10.643   80.380  1.00 61.01  ? 84  VAL A O     1 
ATOM   432   C  CB    . VAL A  1 84  ? 24.555  8.695    81.157  1.00 57.15  ? 84  VAL A CB    1 
ATOM   433   C  CG1   . VAL A  1 84  ? 25.367  7.426    81.395  1.00 55.95  ? 84  VAL A CG1   1 
ATOM   434   C  CG2   . VAL A  1 84  ? 23.161  8.501    81.678  1.00 56.70  ? 84  VAL A CG2   1 
ATOM   435   N  N     . LYS A  1 85  ? 27.577  9.540    82.263  1.00 62.07  ? 85  LYS A N     1 
ATOM   436   C  CA    . LYS A  1 85  ? 29.022  9.536    81.994  1.00 63.44  ? 85  LYS A CA    1 
ATOM   437   C  C     . LYS A  1 85  ? 29.660  8.143    82.177  1.00 63.24  ? 85  LYS A C     1 
ATOM   438   O  O     . LYS A  1 85  ? 29.109  7.296    82.864  1.00 62.58  ? 85  LYS A O     1 
ATOM   439   C  CB    . LYS A  1 85  ? 29.704  10.534   82.923  1.00 66.76  ? 85  LYS A CB    1 
ATOM   440   C  CG    . LYS A  1 85  ? 29.609  11.967   82.476  1.00 67.66  ? 85  LYS A CG    1 
ATOM   441   C  CD    . LYS A  1 85  ? 29.924  12.893   83.616  1.00 71.66  ? 85  LYS A CD    1 
ATOM   442   C  CE    . LYS A  1 85  ? 30.680  14.141   83.166  1.00 74.95  ? 85  LYS A CE    1 
ATOM   443   N  NZ    . LYS A  1 85  ? 31.497  14.758   84.297  1.00 79.24  ? 85  LYS A NZ    1 
ATOM   444   N  N     . GLU A  1 86  ? 30.818  7.895    81.568  1.00 64.51  ? 86  GLU A N     1 
ATOM   445   C  CA    . GLU A  1 86  ? 31.591  6.684    81.890  1.00 65.53  ? 86  GLU A CA    1 
ATOM   446   C  C     . GLU A  1 86  ? 31.980  6.673    83.373  1.00 68.65  ? 86  GLU A C     1 
ATOM   447   O  O     . GLU A  1 86  ? 32.282  7.721    83.943  1.00 71.27  ? 86  GLU A O     1 
ATOM   448   C  CB    . GLU A  1 86  ? 32.854  6.588    81.035  1.00 67.09  ? 86  GLU A CB    1 
ATOM   449   C  CG    . GLU A  1 86  ? 33.729  5.367    81.360  1.00 68.79  ? 86  GLU A CG    1 
ATOM   450   C  CD    . GLU A  1 86  ? 35.134  5.479    80.815  1.00 72.47  ? 86  GLU A CD    1 
ATOM   451   O  OE1   . GLU A  1 86  ? 35.280  5.769    79.613  1.00 72.31  ? 86  GLU A OE1   1 
ATOM   452   O  OE2   . GLU A  1 86  ? 36.097  5.279    81.590  1.00 77.84  ? 86  GLU A OE2   1 
ATOM   453   N  N     . GLY A  1 87  ? 31.968  5.494    83.992  1.00 68.93  ? 87  GLY A N     1 
ATOM   454   C  CA    . GLY A  1 87  ? 32.295  5.356    85.413  1.00 72.57  ? 87  GLY A CA    1 
ATOM   455   C  C     . GLY A  1 87  ? 31.100  5.489    86.346  1.00 72.55  ? 87  GLY A C     1 
ATOM   456   O  O     . GLY A  1 87  ? 31.100  4.962    87.451  1.00 74.91  ? 87  GLY A O     1 
ATOM   457   N  N     . GLU A  1 88  ? 30.083  6.206    85.895  1.00 70.77  ? 88  GLU A N     1 
ATOM   458   C  CA    . GLU A  1 88  ? 28.854  6.426    86.638  1.00 70.95  ? 88  GLU A CA    1 
ATOM   459   C  C     . GLU A  1 88  ? 28.202  5.157    87.201  1.00 69.87  ? 88  GLU A C     1 
ATOM   460   O  O     . GLU A  1 88  ? 28.168  4.125    86.541  1.00 67.50  ? 88  GLU A O     1 
ATOM   461   C  CB    . GLU A  1 88  ? 27.878  7.124    85.704  1.00 68.73  ? 88  GLU A CB    1 
ATOM   462   C  CG    . GLU A  1 88  ? 26.597  7.561    86.327  1.00 70.79  ? 88  GLU A CG    1 
ATOM   463   C  CD    . GLU A  1 88  ? 26.263  8.978    85.949  1.00 74.38  ? 88  GLU A CD    1 
ATOM   464   O  OE1   . GLU A  1 88  ? 27.207  9.817    85.884  1.00 76.85  ? 88  GLU A OE1   1 
ATOM   465   O  OE2   . GLU A  1 88  ? 25.056  9.246    85.728  1.00 74.48  ? 88  GLU A OE2   1 
ATOM   466   N  N     . LEU A  1 89  ? 27.669  5.268    88.417  1.00 72.04  ? 89  LEU A N     1 
ATOM   467   C  CA    . LEU A  1 89  ? 26.955  4.184    89.102  1.00 71.70  ? 89  LEU A CA    1 
ATOM   468   C  C     . LEU A  1 89  ? 25.484  4.046    88.657  1.00 68.53  ? 89  LEU A C     1 
ATOM   469   O  O     . LEU A  1 89  ? 24.764  5.047    88.569  1.00 68.56  ? 89  LEU A O     1 
ATOM   470   C  CB    . LEU A  1 89  ? 27.031  4.419    90.616  1.00 76.12  ? 89  LEU A CB    1 
ATOM   471   C  CG    . LEU A  1 89  ? 26.511  3.345    91.582  1.00 78.11  ? 89  LEU A CG    1 
ATOM   472   C  CD1   . LEU A  1 89  ? 27.349  2.064    91.513  1.00 78.30  ? 89  LEU A CD1   1 
ATOM   473   C  CD2   . LEU A  1 89  ? 26.453  3.874    93.013  1.00 82.65  ? 89  LEU A CD2   1 
ATOM   474   N  N     . VAL A  1 90  ? 25.055  2.803    88.394  1.00 66.10  ? 90  VAL A N     1 
ATOM   475   C  CA    . VAL A  1 90  ? 23.687  2.481    87.934  1.00 63.33  ? 90  VAL A CA    1 
ATOM   476   C  C     . VAL A  1 90  ? 23.058  1.399    88.816  1.00 64.13  ? 90  VAL A C     1 
ATOM   477   O  O     . VAL A  1 90  ? 23.655  0.345    89.018  1.00 64.74  ? 90  VAL A O     1 
ATOM   478   C  CB    . VAL A  1 90  ? 23.684  1.912    86.498  1.00 59.83  ? 90  VAL A CB    1 
ATOM   479   C  CG1   . VAL A  1 90  ? 22.314  2.098    85.840  1.00 58.51  ? 90  VAL A CG1   1 
ATOM   480   C  CG2   . VAL A  1 90  ? 24.753  2.550    85.653  1.00 59.59  ? 90  VAL A CG2   1 
ATOM   481   N  N     . LYS A  1 91  ? 21.850  1.631    89.314  1.00 64.49  ? 91  LYS A N     1 
ATOM   482   C  CA    . LYS A  1 91  ? 21.204  0.659    90.205  1.00 65.62  ? 91  LYS A CA    1 
ATOM   483   C  C     . LYS A  1 91  ? 20.058  -0.054   89.501  1.00 62.69  ? 91  LYS A C     1 
ATOM   484   O  O     . LYS A  1 91  ? 19.421  0.522    88.632  1.00 60.79  ? 91  LYS A O     1 
ATOM   485   C  CB    . LYS A  1 91  ? 20.655  1.342    91.470  1.00 69.64  ? 91  LYS A CB    1 
ATOM   486   C  CG    . LYS A  1 91  ? 21.590  2.337    92.158  1.00 72.94  ? 91  LYS A CG    1 
ATOM   487   C  CD    . LYS A  1 91  ? 20.881  3.102    93.280  1.00 77.87  ? 91  LYS A CD    1 
ATOM   488   C  CE    . LYS A  1 91  ? 21.907  3.708    94.270  1.00 82.82  ? 91  LYS A CE    1 
ATOM   489   N  NZ    . LYS A  1 91  ? 21.397  4.854    95.102  1.00 86.02  ? 91  LYS A NZ    1 
ATOM   490   N  N     . ARG A  1 92  ? 19.803  -1.303   89.884  1.00 62.66  ? 92  ARG A N     1 
ATOM   491   C  CA    . ARG A  1 92  ? 18.554  -1.991   89.551  1.00 61.41  ? 92  ARG A CA    1 
ATOM   492   C  C     . ARG A  1 92  ? 17.404  -1.320   90.279  1.00 63.88  ? 92  ARG A C     1 
ATOM   493   O  O     . ARG A  1 92  ? 17.607  -0.716   91.315  1.00 66.95  ? 92  ARG A O     1 
ATOM   494   C  CB    . ARG A  1 92  ? 18.594  -3.443   90.016  1.00 61.89  ? 92  ARG A CB    1 
ATOM   495   C  CG    . ARG A  1 92  ? 19.446  -4.355   89.199  1.00 59.73  ? 92  ARG A CG    1 
ATOM   496   C  CD    . ARG A  1 92  ? 19.340  -5.781   89.711  1.00 61.10  ? 92  ARG A CD    1 
ATOM   497   N  NE    . ARG A  1 92  ? 18.026  -6.378   89.485  1.00 59.71  ? 92  ARG A NE    1 
ATOM   498   C  CZ    . ARG A  1 92  ? 17.524  -7.364   90.223  1.00 61.22  ? 92  ARG A CZ    1 
ATOM   499   N  NH1   . ARG A  1 92  ? 18.224  -7.857   91.235  1.00 62.90  ? 92  ARG A NH1   1 
ATOM   500   N  NH2   . ARG A  1 92  ? 16.322  -7.851   89.960  1.00 60.81  ? 92  ARG A NH2   1 
ATOM   501   N  N     . THR A  1 93  ? 16.197  -1.430   89.747  1.00 63.28  ? 93  THR A N     1 
ATOM   502   C  CA    . THR A  1 93  ? 15.021  -1.015   90.492  1.00 66.80  ? 93  THR A CA    1 
ATOM   503   C  C     . THR A  1 93  ? 14.270  -2.276   90.848  1.00 67.87  ? 93  THR A C     1 
ATOM   504   O  O     . THR A  1 93  ? 13.379  -2.255   91.693  1.00 71.44  ? 93  THR A O     1 
ATOM   505   C  CB    . THR A  1 93  ? 14.097  -0.113   89.669  1.00 66.16  ? 93  THR A CB    1 
ATOM   506   O  OG1   . THR A  1 93  ? 13.645  -0.836   88.520  1.00 64.39  ? 93  THR A OG1   1 
ATOM   507   C  CG2   . THR A  1 93  ? 14.830  1.142    89.220  1.00 65.02  ? 93  THR A CG2   1 
ATOM   508   N  N     . GLY A  1 94  ? 14.637  -3.371   90.186  1.00 65.27  ? 94  GLY A N     1 
ATOM   509   C  CA    . GLY A  1 94  ? 13.976  -4.650   90.369  1.00 66.37  ? 94  GLY A CA    1 
ATOM   510   C  C     . GLY A  1 94  ? 12.637  -4.793   89.660  1.00 66.56  ? 94  GLY A C     1 
ATOM   511   O  O     . GLY A  1 94  ? 11.977  -5.832   89.792  1.00 67.69  ? 94  GLY A O     1 
ATOM   512   N  N     . ASN A  1 95  ? 12.228  -3.772   88.902  1.00 65.77  ? 95  ASN A N     1 
ATOM   513   C  CA    . ASN A  1 95  ? 10.924  -3.808   88.228  1.00 66.22  ? 95  ASN A CA    1 
ATOM   514   C  C     . ASN A  1 95  ? 10.992  -3.771   86.726  1.00 63.09  ? 95  ASN A C     1 
ATOM   515   O  O     . ASN A  1 95  ? 11.735  -2.982   86.151  1.00 61.43  ? 95  ASN A O     1 
ATOM   516   C  CB    . ASN A  1 95  ? 10.043  -2.645   88.663  1.00 69.24  ? 95  ASN A CB    1 
ATOM   517   C  CG    . ASN A  1 95  ? 9.996   -2.483   90.144  1.00 72.38  ? 95  ASN A CG    1 
ATOM   518   O  OD1   . ASN A  1 95  ? 9.637   -3.404   90.868  1.00 74.23  ? 95  ASN A OD1   1 
ATOM   519   N  ND2   . ASN A  1 95  ? 10.357  -1.301   90.612  1.00 72.82  ? 95  ASN A ND2   1 
ATOM   520   N  N     . ILE A  1 96  ? 10.190  -4.619   86.095  1.00 63.00  ? 96  ILE A N     1 
ATOM   521   C  CA    . ILE A  1 96  ? 9.912   -4.480   84.679  1.00 61.33  ? 96  ILE A CA    1 
ATOM   522   C  C     . ILE A  1 96  ? 9.007   -3.262   84.546  1.00 62.94  ? 96  ILE A C     1 
ATOM   523   O  O     . ILE A  1 96  ? 8.330   -2.902   85.511  1.00 66.01  ? 96  ILE A O     1 
ATOM   524   C  CB    . ILE A  1 96  ? 9.162   -5.699   84.144  1.00 61.89  ? 96  ILE A CB    1 
ATOM   525   C  CG1   . ILE A  1 96  ? 9.655   -6.992   84.805  1.00 62.45  ? 96  ILE A CG1   1 
ATOM   526   C  CG2   . ILE A  1 96  ? 9.326   -5.775   82.657  1.00 60.38  ? 96  ILE A CG2   1 
ATOM   527   C  CD1   . ILE A  1 96  ? 11.061  -7.459   84.352  1.00 59.76  ? 96  ILE A CD1   1 
ATOM   528   N  N     . VAL A  1 97  ? 8.988   -2.628   83.375  1.00 61.39  ? 97  VAL A N     1 
ATOM   529   C  CA    . VAL A  1 97  ? 8.157   -1.439   83.185  1.00 63.55  ? 97  VAL A CA    1 
ATOM   530   C  C     . VAL A  1 97  ? 6.708   -1.743   83.474  1.00 67.53  ? 97  VAL A C     1 
ATOM   531   O  O     . VAL A  1 97  ? 6.101   -2.613   82.839  1.00 68.07  ? 97  VAL A O     1 
ATOM   532   C  CB    . VAL A  1 97  ? 8.209   -0.884   81.766  1.00 62.00  ? 97  VAL A CB    1 
ATOM   533   C  CG1   . VAL A  1 97  ? 7.492   0.451    81.710  1.00 63.93  ? 97  VAL A CG1   1 
ATOM   534   C  CG2   . VAL A  1 97  ? 9.629   -0.733   81.317  1.00 58.79  ? 97  VAL A CG2   1 
ATOM   535   N  N     . ASP A  1 98  ? 6.165   -1.027   84.449  1.00 52.53  ? 98  ASP A N     1 
ATOM   536   C  CA    . ASP A  1 98  ? 4.756   -1.088   84.727  1.00 52.58  ? 98  ASP A CA    1 
ATOM   537   C  C     . ASP A  1 98  ? 4.190   0.339    84.594  1.00 52.02  ? 98  ASP A C     1 
ATOM   538   O  O     . ASP A  1 98  ? 4.915   1.239    84.183  1.00 51.76  ? 98  ASP A O     1 
ATOM   539   C  CB    . ASP A  1 98  ? 4.506   -1.750   86.085  1.00 54.37  ? 98  ASP A CB    1 
ATOM   540   C  CG    . ASP A  1 98  ? 5.012   -0.927   87.248  1.00 56.86  ? 98  ASP A CG    1 
ATOM   541   O  OD1   . ASP A  1 98  ? 5.557   0.164    87.015  1.00 58.66  ? 98  ASP A OD1   1 
ATOM   542   O  OD2   . ASP A  1 98  ? 4.865   -1.365   88.406  1.00 59.59  ? 98  ASP A OD2   1 
ATOM   543   N  N     . VAL A  1 99  ? 2.910   0.537    84.919  1.00 52.10  ? 99  VAL A N     1 
ATOM   544   C  CA    . VAL A  1 99  ? 2.214   1.810    84.715  1.00 51.10  ? 99  VAL A CA    1 
ATOM   545   C  C     . VAL A  1 99  ? 0.974   1.796    85.604  1.00 51.91  ? 99  VAL A C     1 
ATOM   546   O  O     . VAL A  1 99  ? 0.353   0.738    85.745  1.00 52.81  ? 99  VAL A O     1 
ATOM   547   C  CB    . VAL A  1 99  ? 1.799   1.985    83.216  1.00 49.52  ? 99  VAL A CB    1 
ATOM   548   C  CG1   . VAL A  1 99  ? 0.744   0.948    82.779  1.00 47.49  ? 99  VAL A CG1   1 
ATOM   549   C  CG2   . VAL A  1 99  ? 1.315   3.414    82.938  1.00 50.11  ? 99  VAL A CG2   1 
ATOM   550   N  N     . PRO A  1 100 ? 0.609   2.938    86.225  1.00 51.86  ? 100 PRO A N     1 
ATOM   551   C  CA    . PRO A  1 100 ? -0.610  2.881    87.015  1.00 52.52  ? 100 PRO A CA    1 
ATOM   552   C  C     . PRO A  1 100 ? -1.800  2.724    86.099  1.00 51.31  ? 100 PRO A C     1 
ATOM   553   O  O     . PRO A  1 100 ? -1.761  3.187    84.960  1.00 50.04  ? 100 PRO A O     1 
ATOM   554   C  CB    . PRO A  1 100 ? -0.659  4.254    87.699  1.00 53.32  ? 100 PRO A CB    1 
ATOM   555   C  CG    . PRO A  1 100 ? 0.247   5.102    86.938  1.00 52.45  ? 100 PRO A CG    1 
ATOM   556   C  CD    . PRO A  1 100 ? 1.304   4.220    86.400  1.00 52.14  ? 100 PRO A CD    1 
ATOM   557   N  N     . VAL A  1 101 ? -2.839  2.058    86.583  1.00 51.65  ? 101 VAL A N     1 
ATOM   558   C  CA    . VAL A  1 101 ? -4.062  1.906    85.820  1.00 50.56  ? 101 VAL A CA    1 
ATOM   559   C  C     . VAL A  1 101 ? -5.250  2.102    86.761  1.00 52.21  ? 101 VAL A C     1 
ATOM   560   O  O     . VAL A  1 101 ? -5.122  1.942    87.979  1.00 53.84  ? 101 VAL A O     1 
ATOM   561   C  CB    . VAL A  1 101 ? -4.153  0.520    85.107  1.00 49.89  ? 101 VAL A CB    1 
ATOM   562   C  CG1   . VAL A  1 101 ? -2.968  0.276    84.206  1.00 48.37  ? 101 VAL A CG1   1 
ATOM   563   C  CG2   . VAL A  1 101 ? -4.276  -0.601   86.099  1.00 51.09  ? 101 VAL A CG2   1 
ATOM   564   N  N     . GLY A  1 102 ? -6.402  2.449    86.200  1.00 51.73  ? 102 GLY A N     1 
ATOM   565   C  CA    . GLY A  1 102 ? -7.618  2.605    86.994  1.00 52.97  ? 102 GLY A CA    1 
ATOM   566   C  C     . GLY A  1 102 ? -8.458  3.760    86.486  1.00 52.59  ? 102 GLY A C     1 
ATOM   567   O  O     . GLY A  1 102 ? -7.992  4.545    85.670  1.00 51.78  ? 102 GLY A O     1 
ATOM   568   N  N     . PRO A  1 103 ? -9.694  3.887    86.974  1.00 53.70  ? 103 PRO A N     1 
ATOM   569   C  CA    . PRO A  1 103 ? -10.555 4.984    86.543  1.00 53.83  ? 103 PRO A CA    1 
ATOM   570   C  C     . PRO A  1 103 ? -9.985  6.361    86.862  1.00 54.15  ? 103 PRO A C     1 
ATOM   571   O  O     . PRO A  1 103 ? -10.402 7.352    86.264  1.00 53.75  ? 103 PRO A O     1 
ATOM   572   C  CB    . PRO A  1 103 ? -11.843 4.752    87.343  1.00 55.03  ? 103 PRO A CB    1 
ATOM   573   C  CG    . PRO A  1 103 ? -11.436 3.926    88.487  1.00 55.85  ? 103 PRO A CG    1 
ATOM   574   C  CD    . PRO A  1 103 ? -10.346 3.057    88.001  1.00 55.56  ? 103 PRO A CD    1 
ATOM   575   N  N     . GLY A  1 104 ? -9.033  6.417    87.789  1.00 54.96  ? 104 GLY A N     1 
ATOM   576   C  CA    . GLY A  1 104 ? -8.526  7.692    88.268  1.00 55.72  ? 104 GLY A CA    1 
ATOM   577   C  C     . GLY A  1 104 ? -7.703  8.413    87.228  1.00 54.44  ? 104 GLY A C     1 
ATOM   578   O  O     . GLY A  1 104 ? -7.231  9.535    87.454  1.00 55.47  ? 104 GLY A O     1 
ATOM   579   N  N     . LEU A  1 105 ? -7.531  7.765    86.087  1.00 52.74  ? 105 LEU A N     1 
ATOM   580   C  CA    . LEU A  1 105 ? -6.776  8.337    84.995  1.00 51.61  ? 105 LEU A CA    1 
ATOM   581   C  C     . LEU A  1 105 ? -7.687  9.098    84.031  1.00 50.95  ? 105 LEU A C     1 
ATOM   582   O  O     . LEU A  1 105 ? -7.199  9.882    83.209  1.00 50.14  ? 105 LEU A O     1 
ATOM   583   C  CB    . LEU A  1 105 ? -6.025  7.240    84.238  1.00 50.72  ? 105 LEU A CB    1 
ATOM   584   C  CG    . LEU A  1 105 ? -4.698  6.712    84.779  1.00 51.32  ? 105 LEU A CG    1 
ATOM   585   C  CD1   . LEU A  1 105 ? -4.456  5.344    84.248  1.00 52.32  ? 105 LEU A CD1   1 
ATOM   586   C  CD2   . LEU A  1 105 ? -3.569  7.586    84.347  1.00 50.99  ? 105 LEU A CD2   1 
ATOM   587   N  N     . LEU A  1 106 ? -8.999  8.858    84.121  1.00 50.87  ? 106 LEU A N     1 
ATOM   588   C  CA    . LEU A  1 106 ? -9.969  9.516    83.237  1.00 49.96  ? 106 LEU A CA    1 
ATOM   589   C  C     . LEU A  1 106 ? -9.872  11.028   83.338  1.00 50.06  ? 106 LEU A C     1 
ATOM   590   O  O     . LEU A  1 106 ? -9.799  11.568   84.432  1.00 51.61  ? 106 LEU A O     1 
ATOM   591   C  CB    . LEU A  1 106 ? -11.403 9.051    83.530  1.00 50.63  ? 106 LEU A CB    1 
ATOM   592   C  CG    . LEU A  1 106 ? -11.679 7.563    83.294  1.00 50.14  ? 106 LEU A CG    1 
ATOM   593   C  CD1   . LEU A  1 106 ? -12.995 7.121    83.927  1.00 49.56  ? 106 LEU A CD1   1 
ATOM   594   C  CD2   . LEU A  1 106 ? -11.602 7.184    81.816  1.00 46.93  ? 106 LEU A CD2   1 
ATOM   595   N  N     . GLY A  1 107 ? -9.860  11.691   82.188  1.00 48.76  ? 107 GLY A N     1 
ATOM   596   C  CA    . GLY A  1 107 ? -9.645  13.122   82.106  1.00 49.12  ? 107 GLY A CA    1 
ATOM   597   C  C     . GLY A  1 107 ? -8.208  13.591   82.200  1.00 49.08  ? 107 GLY A C     1 
ATOM   598   O  O     . GLY A  1 107 ? -7.939  14.769   82.007  1.00 49.86  ? 107 GLY A O     1 
ATOM   599   N  N     . ARG A  1 108 ? -7.284  12.683   82.501  1.00 48.83  ? 108 ARG A N     1 
ATOM   600   C  CA    . ARG A  1 108 ? -5.883  13.036   82.724  1.00 48.93  ? 108 ARG A CA    1 
ATOM   601   C  C     . ARG A  1 108 ? -5.060  12.922   81.460  1.00 47.51  ? 108 ARG A C     1 
ATOM   602   O  O     . ARG A  1 108 ? -5.437  12.211   80.538  1.00 46.14  ? 108 ARG A O     1 
ATOM   603   C  CB    . ARG A  1 108 ? -5.271  12.136   83.789  1.00 49.23  ? 108 ARG A CB    1 
ATOM   604   C  CG    . ARG A  1 108 ? -6.017  12.149   85.092  1.00 52.21  ? 108 ARG A CG    1 
ATOM   605   C  CD    . ARG A  1 108 ? -6.244  13.570   85.542  1.00 53.86  ? 108 ARG A CD    1 
ATOM   606   N  NE    . ARG A  1 108 ? -4.957  14.215   85.729  1.00 55.26  ? 108 ARG A NE    1 
ATOM   607   C  CZ    . ARG A  1 108 ? -4.356  14.348   86.902  1.00 55.67  ? 108 ARG A CZ    1 
ATOM   608   N  NH1   . ARG A  1 108 ? -4.948  13.904   87.998  1.00 57.48  ? 108 ARG A NH1   1 
ATOM   609   N  NH2   . ARG A  1 108 ? -3.174  14.943   86.972  1.00 55.42  ? 108 ARG A NH2   1 
ATOM   610   N  N     . VAL A  1 109 ? -3.935  13.636   81.431  1.00 47.98  ? 109 VAL A N     1 
ATOM   611   C  CA    . VAL A  1 109 ? -2.944  13.506   80.366  1.00 47.26  ? 109 VAL A CA    1 
ATOM   612   C  C     . VAL A  1 109 ? -1.631  13.054   80.957  1.00 47.52  ? 109 VAL A C     1 
ATOM   613   O  O     . VAL A  1 109 ? -1.059  13.754   81.789  1.00 49.10  ? 109 VAL A O     1 
ATOM   614   C  CB    . VAL A  1 109 ? -2.677  14.834   79.636  1.00 47.76  ? 109 VAL A CB    1 
ATOM   615   C  CG1   . VAL A  1 109 ? -1.725  14.590   78.448  1.00 46.49  ? 109 VAL A CG1   1 
ATOM   616   C  CG2   . VAL A  1 109 ? -3.971  15.471   79.164  1.00 47.03  ? 109 VAL A CG2   1 
ATOM   617   N  N     . VAL A  1 110 ? -1.145  11.902   80.500  1.00 46.74  ? 110 VAL A N     1 
ATOM   618   C  CA    . VAL A  1 110 ? 0.050   11.269   81.062  1.00 46.96  ? 110 VAL A CA    1 
ATOM   619   C  C     . VAL A  1 110 ? 1.171   10.999   80.037  1.00 46.40  ? 110 VAL A C     1 
ATOM   620   O  O     . VAL A  1 110 ? 0.914   10.864   78.830  1.00 45.10  ? 110 VAL A O     1 
ATOM   621   C  CB    . VAL A  1 110 ? -0.311  9.949    81.812  1.00 47.16  ? 110 VAL A CB    1 
ATOM   622   C  CG1   . VAL A  1 110 ? -1.142  10.242   83.040  1.00 48.28  ? 110 VAL A CG1   1 
ATOM   623   C  CG2   . VAL A  1 110 ? -1.048  8.969    80.908  1.00 45.40  ? 110 VAL A CG2   1 
ATOM   624   N  N     . ASP A  1 111 ? 2.418   10.922   80.516  1.00 47.16  ? 111 ASP A N     1 
ATOM   625   C  CA    . ASP A  1 111 ? 3.502   10.447   79.659  1.00 46.32  ? 111 ASP A CA    1 
ATOM   626   C  C     . ASP A  1 111 ? 3.406   8.943    79.623  1.00 45.37  ? 111 ASP A C     1 
ATOM   627   O  O     . ASP A  1 111 ? 2.403   8.376    80.094  1.00 45.45  ? 111 ASP A O     1 
ATOM   628   C  CB    . ASP A  1 111 ? 4.887   10.960   80.081  1.00 47.65  ? 111 ASP A CB    1 
ATOM   629   C  CG    . ASP A  1 111 ? 5.384   10.366   81.410  1.00 50.51  ? 111 ASP A CG    1 
ATOM   630   O  OD1   . ASP A  1 111 ? 4.734   9.437    81.941  1.00 52.50  ? 111 ASP A OD1   1 
ATOM   631   O  OD2   . ASP A  1 111 ? 6.445   10.830   81.916  1.00 51.01  ? 111 ASP A OD2   1 
ATOM   632   N  N     . ALA A  1 112 ? 4.422   8.292    79.066  1.00 44.42  ? 112 ALA A N     1 
ATOM   633   C  CA    . ALA A  1 112 ? 4.302   6.871    78.741  1.00 43.63  ? 112 ALA A CA    1 
ATOM   634   C  C     . ALA A  1 112 ? 4.428   5.997    79.983  1.00 44.85  ? 112 ALA A C     1 
ATOM   635   O  O     . ALA A  1 112 ? 4.071   4.814    79.959  1.00 44.28  ? 112 ALA A O     1 
ATOM   636   C  CB    . ALA A  1 112 ? 5.313   6.467    77.691  1.00 42.64  ? 112 ALA A CB    1 
ATOM   637   N  N     . LEU A  1 113 ? 4.938   6.587    81.060  1.00 46.11  ? 113 LEU A N     1 
ATOM   638   C  CA    . LEU A  1 113 ? 5.095   5.884    82.311  1.00 47.71  ? 113 LEU A CA    1 
ATOM   639   C  C     . LEU A  1 113 ? 3.962   6.210    83.281  1.00 49.00  ? 113 LEU A C     1 
ATOM   640   O  O     . LEU A  1 113 ? 3.978   5.733    84.427  1.00 50.42  ? 113 LEU A O     1 
ATOM   641   C  CB    . LEU A  1 113 ? 6.444   6.210    82.936  1.00 48.62  ? 113 LEU A CB    1 
ATOM   642   C  CG    . LEU A  1 113 ? 7.619   5.736    82.098  1.00 48.57  ? 113 LEU A CG    1 
ATOM   643   C  CD1   . LEU A  1 113 ? 8.941   6.130    82.750  1.00 48.44  ? 113 LEU A CD1   1 
ATOM   644   C  CD2   . LEU A  1 113 ? 7.518   4.227    81.886  1.00 48.17  ? 113 LEU A CD2   1 
ATOM   645   N  N     . GLY A  1 114 ? 2.993   7.009    82.820  1.00 48.33  ? 114 GLY A N     1 
ATOM   646   C  CA    . GLY A  1 114 ? 1.822   7.350    83.621  1.00 49.39  ? 114 GLY A CA    1 
ATOM   647   C  C     . GLY A  1 114 ? 1.969   8.511    84.588  1.00 51.02  ? 114 GLY A C     1 
ATOM   648   O  O     . GLY A  1 114 ? 1.112   8.713    85.460  1.00 51.92  ? 114 GLY A O     1 
ATOM   649   N  N     . ASN A  1 115 ? 3.059   9.262    84.453  1.00 51.43  ? 115 ASN A N     1 
ATOM   650   C  CA    . ASN A  1 115 ? 3.212   10.543   85.143  1.00 52.98  ? 115 ASN A CA    1 
ATOM   651   C  C     . ASN A  1 115 ? 2.252   11.589   84.586  1.00 52.92  ? 115 ASN A C     1 
ATOM   652   O  O     . ASN A  1 115 ? 2.131   11.735   83.359  1.00 52.01  ? 115 ASN A O     1 
ATOM   653   C  CB    . ASN A  1 115 ? 4.628   11.068   84.961  1.00 53.12  ? 115 ASN A CB    1 
ATOM   654   C  CG    . ASN A  1 115 ? 5.667   10.076   85.392  1.00 54.26  ? 115 ASN A CG    1 
ATOM   655   O  OD1   . ASN A  1 115 ? 5.731   9.700    86.562  1.00 56.00  ? 115 ASN A OD1   1 
ATOM   656   N  ND2   . ASN A  1 115 ? 6.499   9.643    84.450  1.00 53.98  ? 115 ASN A ND2   1 
ATOM   657   N  N     . PRO A  1 116 ? 1.576   12.336   85.474  1.00 54.20  ? 116 PRO A N     1 
ATOM   658   C  CA    . PRO A  1 116 ? 0.687   13.410   85.003  1.00 54.18  ? 116 PRO A CA    1 
ATOM   659   C  C     . PRO A  1 116 ? 1.502   14.519   84.353  1.00 54.54  ? 116 PRO A C     1 
ATOM   660   O  O     . PRO A  1 116 ? 2.572   14.891   84.874  1.00 55.73  ? 116 PRO A O     1 
ATOM   661   C  CB    . PRO A  1 116 ? 0.050   13.930   86.287  1.00 55.40  ? 116 PRO A CB    1 
ATOM   662   C  CG    . PRO A  1 116 ? 1.020   13.570   87.356  1.00 56.64  ? 116 PRO A CG    1 
ATOM   663   C  CD    . PRO A  1 116 ? 1.662   12.285   86.942  1.00 55.68  ? 116 PRO A CD    1 
ATOM   664   N  N     . ILE A  1 117 ? 1.021   15.034   83.222  1.00 53.63  ? 117 ILE A N     1 
ATOM   665   C  CA    . ILE A  1 117 ? 1.711   16.142   82.552  1.00 53.47  ? 117 ILE A CA    1 
ATOM   666   C  C     . ILE A  1 117 ? 0.799   17.328   82.312  1.00 53.90  ? 117 ILE A C     1 
ATOM   667   O  O     . ILE A  1 117 ? 1.137   18.228   81.553  1.00 54.34  ? 117 ILE A O     1 
ATOM   668   C  CB    . ILE A  1 117 ? 2.418   15.712   81.226  1.00 52.00  ? 117 ILE A CB    1 
ATOM   669   C  CG1   . ILE A  1 117 ? 1.414   15.257   80.166  1.00 50.09  ? 117 ILE A CG1   1 
ATOM   670   C  CG2   . ILE A  1 117 ? 3.470   14.632   81.498  1.00 51.76  ? 117 ILE A CG2   1 
ATOM   671   C  CD1   . ILE A  1 117 ? 2.015   15.115   78.801  1.00 48.23  ? 117 ILE A CD1   1 
ATOM   672   N  N     . ASP A  1 118 ? -0.337  17.341   82.996  1.00 54.26  ? 118 ASP A N     1 
ATOM   673   C  CA    . ASP A  1 118 ? -1.390  18.302   82.715  1.00 54.60  ? 118 ASP A CA    1 
ATOM   674   C  C     . ASP A  1 118 ? -1.570  19.303   83.848  1.00 56.68  ? 118 ASP A C     1 
ATOM   675   O  O     . ASP A  1 118 ? -2.507  20.116   83.839  1.00 57.36  ? 118 ASP A O     1 
ATOM   676   C  CB    . ASP A  1 118 ? -2.704  17.569   82.418  1.00 53.64  ? 118 ASP A CB    1 
ATOM   677   C  CG    . ASP A  1 118 ? -3.148  16.634   83.555  1.00 54.41  ? 118 ASP A CG    1 
ATOM   678   O  OD1   . ASP A  1 118 ? -2.547  16.659   84.652  1.00 53.40  ? 118 ASP A OD1   1 
ATOM   679   O  OD2   . ASP A  1 118 ? -4.128  15.871   83.342  1.00 55.54  ? 118 ASP A OD2   1 
ATOM   680   N  N     . GLY A  1 119 ? -0.667  19.235   84.822  1.00 57.59  ? 119 GLY A N     1 
ATOM   681   C  CA    . GLY A  1 119 ? -0.723  20.096   85.998  1.00 59.58  ? 119 GLY A CA    1 
ATOM   682   C  C     . GLY A  1 119 ? -1.953  19.936   86.875  1.00 60.25  ? 119 GLY A C     1 
ATOM   683   O  O     . GLY A  1 119 ? -2.332  20.864   87.566  1.00 62.22  ? 119 GLY A O     1 
ATOM   684   N  N     . LYS A  1 120 ? -2.572  18.763   86.872  1.00 59.14  ? 120 LYS A N     1 
ATOM   685   C  CA    . LYS A  1 120 ? -3.755  18.542   87.699  1.00 60.10  ? 120 LYS A CA    1 
ATOM   686   C  C     . LYS A  1 120 ? -3.518  17.662   88.930  1.00 60.89  ? 120 LYS A C     1 
ATOM   687   O  O     . LYS A  1 120 ? -4.463  17.154   89.525  1.00 61.42  ? 120 LYS A O     1 
ATOM   688   C  CB    . LYS A  1 120 ? -4.888  17.972   86.858  1.00 58.85  ? 120 LYS A CB    1 
ATOM   689   C  CG    . LYS A  1 120 ? -5.499  18.971   85.906  1.00 59.14  ? 120 LYS A CG    1 
ATOM   690   C  CD    . LYS A  1 120 ? -6.342  18.261   84.876  1.00 58.78  ? 120 LYS A CD    1 
ATOM   691   C  CE    . LYS A  1 120 ? -7.594  19.055   84.547  1.00 60.88  ? 120 LYS A CE    1 
ATOM   692   N  NZ    . LYS A  1 120 ? -8.597  18.116   83.961  1.00 62.16  ? 120 LYS A NZ    1 
ATOM   693   N  N     . GLY A  1 121 ? -2.262  17.474   89.309  1.00 61.11  ? 121 GLY A N     1 
ATOM   694   C  CA    . GLY A  1 121 ? -1.963  16.768   90.537  1.00 62.39  ? 121 GLY A CA    1 
ATOM   695   C  C     . GLY A  1 121 ? -1.607  15.325   90.296  1.00 61.44  ? 121 GLY A C     1 
ATOM   696   O  O     . GLY A  1 121 ? -1.556  14.890   89.148  1.00 59.75  ? 121 GLY A O     1 
ATOM   697   N  N     . PRO A  1 122 ? -1.345  14.568   91.379  1.00 62.61  ? 122 PRO A N     1 
ATOM   698   C  CA    . PRO A  1 122 ? -1.023  13.147   91.270  1.00 61.82  ? 122 PRO A CA    1 
ATOM   699   C  C     . PRO A  1 122 ? -2.165  12.342   90.666  1.00 60.90  ? 122 PRO A C     1 
ATOM   700   O  O     . PRO A  1 122 ? -3.313  12.791   90.684  1.00 61.34  ? 122 PRO A O     1 
ATOM   701   C  CB    . PRO A  1 122 ? -0.803  12.736   92.728  1.00 63.64  ? 122 PRO A CB    1 
ATOM   702   C  CG    . PRO A  1 122 ? -0.385  13.974   93.393  1.00 65.11  ? 122 PRO A CG    1 
ATOM   703   C  CD    . PRO A  1 122 ? -1.214  15.039   92.767  1.00 64.54  ? 122 PRO A CD    1 
ATOM   704   N  N     . ILE A  1 123 ? -1.835  11.166   90.135  1.00 60.17  ? 123 ILE A N     1 
ATOM   705   C  CA    . ILE A  1 123 ? -2.817  10.228   89.582  1.00 59.48  ? 123 ILE A CA    1 
ATOM   706   C  C     . ILE A  1 123 ? -3.104  9.104    90.572  1.00 61.03  ? 123 ILE A C     1 
ATOM   707   O  O     . ILE A  1 123 ? -2.206  8.326    90.902  1.00 61.53  ? 123 ILE A O     1 
ATOM   708   C  CB    . ILE A  1 123 ? -2.283  9.514    88.317  1.00 57.51  ? 123 ILE A CB    1 
ATOM   709   C  CG1   . ILE A  1 123 ? -1.433  10.459   87.435  1.00 56.56  ? 123 ILE A CG1   1 
ATOM   710   C  CG2   . ILE A  1 123 ? -3.431  8.809    87.585  1.00 56.43  ? 123 ILE A CG2   1 
ATOM   711   C  CD1   . ILE A  1 123 ? -2.085  10.952   86.172  1.00 53.12  ? 123 ILE A CD1   1 
ATOM   712   N  N     . ASP A  1 124 ? -4.351  8.985    91.017  1.00 61.93  ? 124 ASP A N     1 
ATOM   713   C  CA    . ASP A  1 124 ? -4.716  7.867    91.871  1.00 63.17  ? 124 ASP A CA    1 
ATOM   714   C  C     . ASP A  1 124 ? -4.883  6.549    91.102  1.00 61.77  ? 124 ASP A C     1 
ATOM   715   O  O     . ASP A  1 124 ? -5.652  6.466    90.146  1.00 60.42  ? 124 ASP A O     1 
ATOM   716   C  CB    . ASP A  1 124 ? -5.936  8.224    92.706  1.00 65.03  ? 124 ASP A CB    1 
ATOM   717   C  CG    . ASP A  1 124 ? -5.584  9.162    93.850  1.00 68.57  ? 124 ASP A CG    1 
ATOM   718   O  OD1   . ASP A  1 124 ? -4.366  9.286    94.148  1.00 71.25  ? 124 ASP A OD1   1 
ATOM   719   O  OD2   . ASP A  1 124 ? -6.503  9.766    94.454  1.00 70.59  ? 124 ASP A OD2   1 
ATOM   720   N  N     . ALA A  1 125 ? -4.145  5.524    91.527  1.00 62.10  ? 125 ALA A N     1 
ATOM   721   C  CA    . ALA A  1 125 ? -4.110  4.244    90.826  1.00 60.96  ? 125 ALA A CA    1 
ATOM   722   C  C     . ALA A  1 125 ? -4.841  3.128    91.559  1.00 62.35  ? 125 ALA A C     1 
ATOM   723   O  O     . ALA A  1 125 ? -4.653  2.930    92.759  1.00 64.39  ? 125 ALA A O     1 
ATOM   724   C  CB    . ALA A  1 125 ? -2.687  3.841    90.573  1.00 60.48  ? 125 ALA A CB    1 
ATOM   725   N  N     . ALA A  1 126 ? -5.659  2.388    90.816  1.00 61.67  ? 126 ALA A N     1 
ATOM   726   C  CA    . ALA A  1 126 ? -6.341  1.204    91.335  1.00 62.72  ? 126 ALA A CA    1 
ATOM   727   C  C     . ALA A  1 126 ? -5.310  0.155    91.711  1.00 63.47  ? 126 ALA A C     1 
ATOM   728   O  O     . ALA A  1 126 ? -5.461  -0.532   92.730  1.00 65.96  ? 126 ALA A O     1 
ATOM   729   C  CB    . ALA A  1 126 ? -7.306  0.651    90.313  1.00 61.46  ? 126 ALA A CB    1 
ATOM   730   N  N     . GLY A  1 127 ? -4.267  0.061    90.886  1.00 61.59  ? 127 GLY A N     1 
ATOM   731   C  CA    . GLY A  1 127 ? -3.127  -0.813   91.091  1.00 61.45  ? 127 GLY A CA    1 
ATOM   732   C  C     . GLY A  1 127 ? -2.209  -0.546   89.920  1.00 59.53  ? 127 GLY A C     1 
ATOM   733   O  O     . GLY A  1 127 ? -2.377  0.457    89.223  1.00 58.59  ? 127 GLY A O     1 
ATOM   734   N  N     . ARG A  1 128 ? -1.250  -1.437   89.679  1.00 59.10  ? 128 ARG A N     1 
ATOM   735   C  CA    . ARG A  1 128 ? -0.289  -1.233   88.592  1.00 57.09  ? 128 ARG A CA    1 
ATOM   736   C  C     . ARG A  1 128 ? -0.230  -2.434   87.626  1.00 55.96  ? 128 ARG A C     1 
ATOM   737   O  O     . ARG A  1 128 ? -0.195  -3.576   88.055  1.00 57.57  ? 128 ARG A O     1 
ATOM   738   C  CB    . ARG A  1 128 ? 1.090   -0.890   89.173  1.00 57.69  ? 128 ARG A CB    1 
ATOM   739   C  CG    . ARG A  1 128 ? 1.085   0.364    90.065  1.00 59.22  ? 128 ARG A CG    1 
ATOM   740   C  CD    . ARG A  1 128 ? 2.463   0.725    90.626  1.00 60.93  ? 128 ARG A CD    1 
ATOM   741   N  NE    . ARG A  1 128 ? 3.446   0.980    89.571  1.00 61.44  ? 128 ARG A NE    1 
ATOM   742   C  CZ    . ARG A  1 128 ? 3.663   2.166    88.998  1.00 60.56  ? 128 ARG A CZ    1 
ATOM   743   N  NH1   . ARG A  1 128 ? 2.961   3.242    89.366  1.00 58.64  ? 128 ARG A NH1   1 
ATOM   744   N  NH2   . ARG A  1 128 ? 4.590   2.271    88.048  1.00 58.15  ? 128 ARG A NH2   1 
ATOM   745   N  N     . SER A  1 129 ? -0.254  -2.183   86.324  1.00 53.63  ? 129 SER A N     1 
ATOM   746   C  CA    . SER A  1 129 ? -0.075  -3.251   85.356  1.00 52.45  ? 129 SER A CA    1 
ATOM   747   C  C     . SER A  1 129 ? 1.262   -3.081   84.647  1.00 51.91  ? 129 SER A C     1 
ATOM   748   O  O     . SER A  1 129 ? 1.782   -1.969   84.548  1.00 51.38  ? 129 SER A O     1 
ATOM   749   C  CB    . SER A  1 129 ? -1.186  -3.231   84.325  1.00 50.91  ? 129 SER A CB    1 
ATOM   750   O  OG    . SER A  1 129 ? -2.448  -3.370   84.932  1.00 51.48  ? 129 SER A OG    1 
ATOM   751   N  N     . ARG A  1 130 ? 1.807   -4.181   84.143  1.00 52.04  ? 130 ARG A N     1 
ATOM   752   C  CA    . ARG A  1 130 ? 3.021   -4.129   83.335  1.00 51.50  ? 130 ARG A CA    1 
ATOM   753   C  C     . ARG A  1 130 ? 2.739   -3.624   81.916  1.00 50.02  ? 130 ARG A C     1 
ATOM   754   O  O     . ARG A  1 130 ? 1.623   -3.759   81.420  1.00 49.66  ? 130 ARG A O     1 
ATOM   755   C  CB    . ARG A  1 130 ? 3.651   -5.511   83.274  1.00 51.84  ? 130 ARG A CB    1 
ATOM   756   C  CG    . ARG A  1 130 ? 4.224   -5.963   84.583  1.00 54.42  ? 130 ARG A CG    1 
ATOM   757   C  CD    . ARG A  1 130 ? 5.047   -7.190   84.361  1.00 58.48  ? 130 ARG A CD    1 
ATOM   758   N  NE    . ARG A  1 130 ? 5.738   -7.640   85.564  1.00 62.99  ? 130 ARG A NE    1 
ATOM   759   C  CZ    . ARG A  1 130 ? 6.497   -8.737   85.617  1.00 65.44  ? 130 ARG A CZ    1 
ATOM   760   N  NH1   . ARG A  1 130 ? 6.657   -9.502   84.534  1.00 63.43  ? 130 ARG A NH1   1 
ATOM   761   N  NH2   . ARG A  1 130 ? 7.095   -9.073   86.757  1.00 68.64  ? 130 ARG A NH2   1 
ATOM   762   N  N     . ALA A  1 131 ? 3.757   -3.049   81.276  1.00 49.32  ? 131 ALA A N     1 
ATOM   763   C  CA    . ALA A  1 131 ? 3.704   -2.690   79.865  1.00 47.71  ? 131 ALA A CA    1 
ATOM   764   C  C     . ALA A  1 131 ? 3.354   -3.872   78.968  1.00 47.64  ? 131 ALA A C     1 
ATOM   765   O  O     . ALA A  1 131 ? 2.560   -3.739   78.039  1.00 47.67  ? 131 ALA A O     1 
ATOM   766   C  CB    . ALA A  1 131 ? 5.005   -2.113   79.445  1.00 47.00  ? 131 ALA A CB    1 
ATOM   767   N  N     . GLN A  1 132 ? 3.931   -5.032   79.253  1.00 48.49  ? 132 GLN A N     1 
ATOM   768   C  CA    . GLN A  1 132 ? 3.781   -6.205   78.394  1.00 48.06  ? 132 GLN A CA    1 
ATOM   769   C  C     . GLN A  1 132 ? 2.958   -7.245   79.102  1.00 48.81  ? 132 GLN A C     1 
ATOM   770   O  O     . GLN A  1 132 ? 3.334   -7.718   80.174  1.00 50.40  ? 132 GLN A O     1 
ATOM   771   C  CB    . GLN A  1 132 ? 5.148   -6.796   78.058  1.00 48.16  ? 132 GLN A CB    1 
ATOM   772   C  CG    . GLN A  1 132 ? 6.140   -5.777   77.546  1.00 48.93  ? 132 GLN A CG    1 
ATOM   773   C  CD    . GLN A  1 132 ? 5.906   -5.358   76.090  1.00 49.72  ? 132 GLN A CD    1 
ATOM   774   O  OE1   . GLN A  1 132 ? 5.200   -6.040   75.317  1.00 48.97  ? 132 GLN A OE1   1 
ATOM   775   N  NE2   . GLN A  1 132 ? 6.526   -4.236   75.701  1.00 49.17  ? 132 GLN A NE2   1 
ATOM   776   N  N     . VAL A  1 133 ? 1.834   -7.597   78.496  1.00 47.99  ? 133 VAL A N     1 
ATOM   777   C  CA    . VAL A  1 133 ? 0.865   -8.488   79.102  1.00 48.57  ? 133 VAL A CA    1 
ATOM   778   C  C     . VAL A  1 133 ? 0.410   -9.497   78.049  1.00 48.85  ? 133 VAL A C     1 
ATOM   779   O  O     . VAL A  1 133 ? 0.176   -9.128   76.887  1.00 47.50  ? 133 VAL A O     1 
ATOM   780   C  CB    . VAL A  1 133 ? -0.350  -7.685   79.642  1.00 48.30  ? 133 VAL A CB    1 
ATOM   781   C  CG1   . VAL A  1 133 ? -1.415  -8.607   80.262  1.00 48.47  ? 133 VAL A CG1   1 
ATOM   782   C  CG2   . VAL A  1 133 ? 0.112   -6.647   80.642  1.00 48.03  ? 133 VAL A CG2   1 
ATOM   783   N  N     . LYS A  1 134 ? 0.298   -10.766  78.457  1.00 50.38  ? 134 LYS A N     1 
ATOM   784   C  CA    . LYS A  1 134 ? -0.255  -11.804  77.606  1.00 50.92  ? 134 LYS A CA    1 
ATOM   785   C  C     . LYS A  1 134 ? -1.612  -11.334  77.107  1.00 50.11  ? 134 LYS A C     1 
ATOM   786   O  O     . LYS A  1 134 ? -2.462  -10.940  77.896  1.00 50.35  ? 134 LYS A O     1 
ATOM   787   C  CB    . LYS A  1 134 ? -0.433  -13.106  78.387  1.00 53.07  ? 134 LYS A CB    1 
ATOM   788   C  CG    . LYS A  1 134 ? 0.842   -13.782  78.806  1.00 56.22  ? 134 LYS A CG    1 
ATOM   789   C  CD    . LYS A  1 134 ? 1.317   -14.807  77.761  1.00 61.01  ? 134 LYS A CD    1 
ATOM   790   C  CE    . LYS A  1 134 ? 2.848   -14.884  77.687  1.00 61.10  ? 134 LYS A CE    1 
ATOM   791   N  NZ    . LYS A  1 134 ? 3.449   -15.065  79.043  1.00 63.23  ? 134 LYS A NZ    1 
ATOM   792   N  N     . ALA A  1 135 ? -1.802  -11.353  75.793  1.00 49.13  ? 135 ALA A N     1 
ATOM   793   C  CA    . ALA A  1 135 ? -3.113  -11.119  75.219  1.00 48.79  ? 135 ALA A CA    1 
ATOM   794   C  C     . ALA A  1 135 ? -4.029  -12.264  75.651  1.00 50.35  ? 135 ALA A C     1 
ATOM   795   O  O     . ALA A  1 135 ? -3.548  -13.372  75.893  1.00 51.82  ? 135 ALA A O     1 
ATOM   796   C  CB    . ALA A  1 135 ? -3.023  -11.050  73.705  1.00 47.79  ? 135 ALA A CB    1 
ATOM   797   N  N     . PRO A  1 136 ? -5.338  -12.000  75.779  1.00 50.18  ? 136 PRO A N     1 
ATOM   798   C  CA    . PRO A  1 136 ? -6.256  -13.090  76.030  1.00 51.92  ? 136 PRO A CA    1 
ATOM   799   C  C     . PRO A  1 136 ? -6.068  -14.258  75.070  1.00 52.21  ? 136 PRO A C     1 
ATOM   800   O  O     . PRO A  1 136 ? -5.911  -14.061  73.863  1.00 50.87  ? 136 PRO A O     1 
ATOM   801   C  CB    . PRO A  1 136 ? -7.636  -12.451  75.804  1.00 51.98  ? 136 PRO A CB    1 
ATOM   802   C  CG    . PRO A  1 136 ? -7.444  -11.007  76.042  1.00 50.70  ? 136 PRO A CG    1 
ATOM   803   C  CD    . PRO A  1 136 ? -5.969  -10.694  76.011  1.00 49.37  ? 136 PRO A CD    1 
ATOM   804   N  N     . GLY A  1 137 ? -6.110  -15.466  75.616  1.00 54.00  ? 137 GLY A N     1 
ATOM   805   C  CA    . GLY A  1 137 ? -6.019  -16.666  74.804  1.00 55.78  ? 137 GLY A CA    1 
ATOM   806   C  C     . GLY A  1 137 ? -7.160  -16.870  73.826  1.00 56.27  ? 137 GLY A C     1 
ATOM   807   O  O     . GLY A  1 137 ? -8.053  -16.051  73.743  1.00 56.12  ? 137 GLY A O     1 
ATOM   808   N  N     . ILE A  1 138 ? -7.104  -17.970  73.080  1.00 57.97  ? 138 ILE A N     1 
ATOM   809   C  CA    . ILE A  1 138 ? -8.173  -18.424  72.196  1.00 59.03  ? 138 ILE A CA    1 
ATOM   810   C  C     . ILE A  1 138 ? -9.500  -18.588  72.907  1.00 60.60  ? 138 ILE A C     1 
ATOM   811   O  O     . ILE A  1 138 ? -10.550 -18.256  72.363  1.00 60.76  ? 138 ILE A O     1 
ATOM   812   C  CB    . ILE A  1 138 ? -7.857  -19.824  71.630  1.00 60.66  ? 138 ILE A CB    1 
ATOM   813   C  CG1   . ILE A  1 138 ? -6.951  -19.742  70.404  1.00 60.48  ? 138 ILE A CG1   1 
ATOM   814   C  CG2   . ILE A  1 138 ? -9.151  -20.561  71.263  1.00 62.70  ? 138 ILE A CG2   1 
ATOM   815   C  CD1   . ILE A  1 138 ? -7.571  -18.983  69.206  1.00 62.47  ? 138 ILE A CD1   1 
ATOM   816   N  N     . LEU A  1 139 ? -9.468  -19.134  74.113  1.00 62.21  ? 139 LEU A N     1 
ATOM   817   C  CA    . LEU A  1 139 ? -10.707 -19.592  74.712  1.00 64.14  ? 139 LEU A CA    1 
ATOM   818   C  C     . LEU A  1 139 ? -11.510 -18.536  75.459  1.00 63.82  ? 139 LEU A C     1 
ATOM   819   O  O     . LEU A  1 139 ? -12.743 -18.562  75.399  1.00 65.16  ? 139 LEU A O     1 
ATOM   820   C  CB    . LEU A  1 139 ? -10.480 -20.816  75.596  1.00 66.40  ? 139 LEU A CB    1 
ATOM   821   C  CG    . LEU A  1 139 ? -11.751 -21.635  75.777  1.00 67.84  ? 139 LEU A CG    1 
ATOM   822   C  CD1   . LEU A  1 139 ? -11.872 -22.632  74.647  1.00 68.32  ? 139 LEU A CD1   1 
ATOM   823   C  CD2   . LEU A  1 139 ? -11.716 -22.320  77.117  1.00 70.11  ? 139 LEU A CD2   1 
ATOM   824   N  N     . PRO A  1 140 ? -10.836 -17.618  76.179  1.00 62.52  ? 140 PRO A N     1 
ATOM   825   C  CA    . PRO A  1 140 ? -11.610 -16.638  76.955  1.00 62.17  ? 140 PRO A CA    1 
ATOM   826   C  C     . PRO A  1 140 ? -12.177 -15.466  76.139  1.00 60.38  ? 140 PRO A C     1 
ATOM   827   O  O     . PRO A  1 140 ? -12.099 -14.322  76.579  1.00 59.28  ? 140 PRO A O     1 
ATOM   828   C  CB    . PRO A  1 140 ? -10.590 -16.141  77.981  1.00 61.58  ? 140 PRO A CB    1 
ATOM   829   C  CG    . PRO A  1 140 ? -9.283  -16.286  77.298  1.00 60.25  ? 140 PRO A CG    1 
ATOM   830   C  CD    . PRO A  1 140 ? -9.404  -17.567  76.527  1.00 61.71  ? 140 PRO A CD    1 
ATOM   831   N  N     . ARG A  1 141 ? -12.764 -15.754  74.978  1.00 60.15  ? 141 ARG A N     1 
ATOM   832   C  CA    . ARG A  1 141 ? -13.277 -14.709  74.094  1.00 58.32  ? 141 ARG A CA    1 
ATOM   833   C  C     . ARG A  1 141 ? -14.655 -15.066  73.582  1.00 59.52  ? 141 ARG A C     1 
ATOM   834   O  O     . ARG A  1 141 ? -15.097 -16.184  73.734  1.00 61.76  ? 141 ARG A O     1 
ATOM   835   C  CB    . ARG A  1 141 ? -12.354 -14.532  72.894  1.00 56.56  ? 141 ARG A CB    1 
ATOM   836   C  CG    . ARG A  1 141 ? -11.027 -13.920  73.193  1.00 54.43  ? 141 ARG A CG    1 
ATOM   837   C  CD    . ARG A  1 141 ? -10.110 -14.103  72.009  1.00 52.92  ? 141 ARG A CD    1 
ATOM   838   N  NE    . ARG A  1 141 ? -8.786  -13.536  72.235  1.00 51.37  ? 141 ARG A NE    1 
ATOM   839   C  CZ    . ARG A  1 141 ? -8.346  -12.409  71.681  1.00 50.26  ? 141 ARG A CZ    1 
ATOM   840   N  NH1   . ARG A  1 141 ? -9.122  -11.714  70.862  1.00 49.06  ? 141 ARG A NH1   1 
ATOM   841   N  NH2   . ARG A  1 141 ? -7.119  -11.976  71.939  1.00 49.85  ? 141 ARG A NH2   1 
ATOM   842   N  N     . ARG A  1 142 ? -15.317 -14.108  72.951  1.00 58.61  ? 142 ARG A N     1 
ATOM   843   C  CA    . ARG A  1 142 ? -16.601 -14.324  72.315  1.00 59.64  ? 142 ARG A CA    1 
ATOM   844   C  C     . ARG A  1 142 ? -16.639 -13.495  71.030  1.00 57.97  ? 142 ARG A C     1 
ATOM   845   O  O     . ARG A  1 142 ? -16.027 -12.430  70.959  1.00 56.09  ? 142 ARG A O     1 
ATOM   846   C  CB    . ARG A  1 142 ? -17.706 -13.899  73.276  1.00 60.74  ? 142 ARG A CB    1 
ATOM   847   C  CG    . ARG A  1 142 ? -19.096 -14.266  72.822  1.00 64.39  ? 142 ARG A CG    1 
ATOM   848   C  CD    . ARG A  1 142 ? -19.882 -13.052  72.347  1.00 65.56  ? 142 ARG A CD    1 
ATOM   849   N  NE    . ARG A  1 142 ? -21.289 -13.376  72.117  1.00 69.28  ? 142 ARG A NE    1 
ATOM   850   C  CZ    . ARG A  1 142 ? -22.177 -13.577  73.089  1.00 74.10  ? 142 ARG A CZ    1 
ATOM   851   N  NH1   . ARG A  1 142 ? -21.804 -13.488  74.365  1.00 75.26  ? 142 ARG A NH1   1 
ATOM   852   N  NH2   . ARG A  1 142 ? -23.446 -13.871  72.798  1.00 77.44  ? 142 ARG A NH2   1 
ATOM   853   N  N     . SER A  1 143 ? -17.343 -13.976  70.012  1.00 58.82  ? 143 SER A N     1 
ATOM   854   C  CA    . SER A  1 143 ? -17.431 -13.246  68.753  1.00 58.03  ? 143 SER A CA    1 
ATOM   855   C  C     . SER A  1 143 ? -17.878 -11.797  68.941  1.00 57.18  ? 143 SER A C     1 
ATOM   856   O  O     . SER A  1 143 ? -18.786 -11.492  69.728  1.00 57.83  ? 143 SER A O     1 
ATOM   857   C  CB    . SER A  1 143 ? -18.371 -13.943  67.779  1.00 59.73  ? 143 SER A CB    1 
ATOM   858   O  OG    . SER A  1 143 ? -17.718 -15.008  67.120  1.00 61.23  ? 143 SER A OG    1 
ATOM   859   N  N     . VAL A  1 144 ? -17.223 -10.919  68.193  1.00 55.42  ? 144 VAL A N     1 
ATOM   860   C  CA    . VAL A  1 144 ? -17.543 -9.507   68.160  1.00 54.35  ? 144 VAL A CA    1 
ATOM   861   C  C     . VAL A  1 144 ? -18.996 -9.350   67.700  1.00 56.27  ? 144 VAL A C     1 
ATOM   862   O  O     . VAL A  1 144 ? -19.378 -9.863   66.641  1.00 57.31  ? 144 VAL A O     1 
ATOM   863   C  CB    . VAL A  1 144 ? -16.520 -8.783   67.242  1.00 52.44  ? 144 VAL A CB    1 
ATOM   864   C  CG1   . VAL A  1 144 ? -16.940 -7.386   66.894  1.00 51.43  ? 144 VAL A CG1   1 
ATOM   865   C  CG2   . VAL A  1 144 ? -15.160 -8.776   67.905  1.00 49.82  ? 144 VAL A CG2   1 
ATOM   866   N  N     . HIS A  1 145 ? -19.818 -8.690   68.517  1.00 57.00  ? 145 HIS A N     1 
ATOM   867   C  CA    . HIS A  1 145 ? -21.211 -8.460   68.148  1.00 58.19  ? 145 HIS A CA    1 
ATOM   868   C  C     . HIS A  1 145 ? -21.750 -7.050   68.458  1.00 58.06  ? 145 HIS A C     1 
ATOM   869   O  O     . HIS A  1 145 ? -22.467 -6.474   67.638  1.00 59.32  ? 145 HIS A O     1 
ATOM   870   C  CB    . HIS A  1 145 ? -22.135 -9.560   68.685  1.00 59.89  ? 145 HIS A CB    1 
ATOM   871   C  CG    . HIS A  1 145 ? -22.220 -9.627   70.178  1.00 60.46  ? 145 HIS A CG    1 
ATOM   872   N  ND1   . HIS A  1 145 ? -21.208 -10.140  70.959  1.00 59.74  ? 145 HIS A ND1   1 
ATOM   873   C  CD2   . HIS A  1 145 ? -23.212 -9.277   71.032  1.00 61.96  ? 145 HIS A CD2   1 
ATOM   874   C  CE1   . HIS A  1 145 ? -21.565 -10.093  72.231  1.00 60.80  ? 145 HIS A CE1   1 
ATOM   875   N  NE2   . HIS A  1 145 ? -22.776 -9.570   72.303  1.00 62.04  ? 145 HIS A NE2   1 
ATOM   876   N  N     . GLU A  1 146 ? -21.420 -6.502   69.622  1.00 56.99  ? 146 GLU A N     1 
ATOM   877   C  CA    . GLU A  1 146 ? -21.875 -5.165   70.017  1.00 56.10  ? 146 GLU A CA    1 
ATOM   878   C  C     . GLU A  1 146 ? -21.174 -4.100   69.189  1.00 54.10  ? 146 GLU A C     1 
ATOM   879   O  O     . GLU A  1 146 ? -19.968 -4.142   69.047  1.00 53.10  ? 146 GLU A O     1 
ATOM   880   C  CB    . GLU A  1 146 ? -21.556 -4.954   71.494  1.00 56.19  ? 146 GLU A CB    1 
ATOM   881   C  CG    . GLU A  1 146 ? -21.989 -6.138   72.383  1.00 58.11  ? 146 GLU A CG    1 
ATOM   882   C  CD    . GLU A  1 146 ? -21.148 -6.277   73.643  1.00 58.19  ? 146 GLU A CD    1 
ATOM   883   O  OE1   . GLU A  1 146 ? -19.909 -6.433   73.514  1.00 55.41  ? 146 GLU A OE1   1 
ATOM   884   O  OE2   . GLU A  1 146 ? -21.734 -6.252   74.756  1.00 59.70  ? 146 GLU A OE2   1 
ATOM   885   N  N     . PRO A  1 147 ? -21.915 -3.139   68.622  1.00 54.32  ? 147 PRO A N     1 
ATOM   886   C  CA    . PRO A  1 147 ? -21.254 -2.093   67.804  1.00 52.99  ? 147 PRO A CA    1 
ATOM   887   C  C     . PRO A  1 147 ? -20.436 -1.038   68.566  1.00 51.69  ? 147 PRO A C     1 
ATOM   888   O  O     . PRO A  1 147 ? -20.765 -0.678   69.689  1.00 51.88  ? 147 PRO A O     1 
ATOM   889   C  CB    . PRO A  1 147 ? -22.425 -1.399   67.108  1.00 54.08  ? 147 PRO A CB    1 
ATOM   890   C  CG    . PRO A  1 147 ? -23.585 -2.364   67.233  1.00 55.55  ? 147 PRO A CG    1 
ATOM   891   C  CD    . PRO A  1 147 ? -23.376 -3.038   68.547  1.00 55.68  ? 147 PRO A CD    1 
ATOM   892   N  N     . VAL A  1 148 ? -19.346 -0.589   67.953  1.00 50.58  ? 148 VAL A N     1 
ATOM   893   C  CA    . VAL A  1 148 ? -18.750 0.689    68.295  1.00 49.93  ? 148 VAL A CA    1 
ATOM   894   C  C     . VAL A  1 148 ? -19.332 1.681    67.286  1.00 50.75  ? 148 VAL A C     1 
ATOM   895   O  O     . VAL A  1 148 ? -18.973 1.659    66.090  1.00 50.38  ? 148 VAL A O     1 
ATOM   896   C  CB    . VAL A  1 148 ? -17.221 0.662    68.235  1.00 48.14  ? 148 VAL A CB    1 
ATOM   897   C  CG1   . VAL A  1 148 ? -16.663 2.061    68.373  1.00 46.60  ? 148 VAL A CG1   1 
ATOM   898   C  CG2   . VAL A  1 148 ? -16.670 -0.227   69.335  1.00 48.47  ? 148 VAL A CG2   1 
ATOM   899   N  N     . GLN A  1 149 ? -20.275 2.498    67.754  1.00 51.51  ? 149 GLN A N     1 
ATOM   900   C  CA    . GLN A  1 149 ? -20.957 3.430    66.883  1.00 52.65  ? 149 GLN A CA    1 
ATOM   901   C  C     . GLN A  1 149 ? -20.047 4.618    66.746  1.00 51.73  ? 149 GLN A C     1 
ATOM   902   O  O     . GLN A  1 149 ? -19.803 5.329    67.718  1.00 51.79  ? 149 GLN A O     1 
ATOM   903   C  CB    . GLN A  1 149 ? -22.285 3.871    67.486  1.00 54.28  ? 149 GLN A CB    1 
ATOM   904   C  CG    . GLN A  1 149 ? -23.473 3.030    67.104  1.00 57.76  ? 149 GLN A CG    1 
ATOM   905   C  CD    . GLN A  1 149 ? -24.528 3.009    68.216  1.00 62.13  ? 149 GLN A CD    1 
ATOM   906   O  OE1   . GLN A  1 149 ? -25.646 3.531    68.058  1.00 61.95  ? 149 GLN A OE1   1 
ATOM   907   N  NE2   . GLN A  1 149 ? -24.161 2.416    69.360  1.00 62.82  ? 149 GLN A NE2   1 
ATOM   908   N  N     . THR A  1 150 ? -19.518 4.827    65.550  1.00 51.30  ? 150 THR A N     1 
ATOM   909   C  CA    . THR A  1 150 ? -18.568 5.907    65.361  1.00 50.39  ? 150 THR A CA    1 
ATOM   910   C  C     . THR A  1 150 ? -19.274 7.238    65.214  1.00 51.13  ? 150 THR A C     1 
ATOM   911   O  O     . THR A  1 150 ? -18.704 8.256    65.563  1.00 51.34  ? 150 THR A O     1 
ATOM   912   C  CB    . THR A  1 150 ? -17.694 5.711    64.125  1.00 49.87  ? 150 THR A CB    1 
ATOM   913   O  OG1   . THR A  1 150 ? -18.537 5.615    62.968  1.00 51.98  ? 150 THR A OG1   1 
ATOM   914   C  CG2   . THR A  1 150 ? -16.835 4.472    64.258  1.00 47.69  ? 150 THR A CG2   1 
ATOM   915   N  N     . GLY A  1 151 ? -20.499 7.238    64.692  1.00 52.09  ? 151 GLY A N     1 
ATOM   916   C  CA    . GLY A  1 151 ? -21.235 8.491    64.430  1.00 52.67  ? 151 GLY A CA    1 
ATOM   917   C  C     . GLY A  1 151 ? -21.041 8.987    63.001  1.00 52.70  ? 151 GLY A C     1 
ATOM   918   O  O     . GLY A  1 151 ? -21.676 9.961    62.563  1.00 52.95  ? 151 GLY A O     1 
ATOM   919   N  N     . LEU A  1 152 ? -20.156 8.292    62.280  1.00 51.76  ? 152 LEU A N     1 
ATOM   920   C  CA    . LEU A  1 152 ? -19.781 8.653    60.918  1.00 51.58  ? 152 LEU A CA    1 
ATOM   921   C  C     . LEU A  1 152 ? -20.500 7.782    59.908  1.00 52.22  ? 152 LEU A C     1 
ATOM   922   O  O     . LEU A  1 152 ? -20.303 6.563    59.868  1.00 52.05  ? 152 LEU A O     1 
ATOM   923   C  CB    . LEU A  1 152 ? -18.275 8.516    60.734  1.00 50.19  ? 152 LEU A CB    1 
ATOM   924   C  CG    . LEU A  1 152 ? -17.383 9.511    61.461  1.00 49.10  ? 152 LEU A CG    1 
ATOM   925   C  CD1   . LEU A  1 152 ? -15.958 8.970    61.453  1.00 47.84  ? 152 LEU A CD1   1 
ATOM   926   C  CD2   . LEU A  1 152 ? -17.460 10.883   60.814  1.00 48.66  ? 152 LEU A CD2   1 
ATOM   927   N  N     . LYS A  1 153 ? -21.319 8.421    59.080  1.00 53.29  ? 153 LYS A N     1 
ATOM   928   C  CA    . LYS A  1 153 ? -22.264 7.712    58.224  1.00 54.15  ? 153 LYS A CA    1 
ATOM   929   C  C     . LYS A  1 153 ? -21.563 6.642    57.412  1.00 53.67  ? 153 LYS A C     1 
ATOM   930   O  O     . LYS A  1 153 ? -21.977 5.493    57.420  1.00 53.90  ? 153 LYS A O     1 
ATOM   931   C  CB    . LYS A  1 153 ? -23.016 8.685    57.321  1.00 55.52  ? 153 LYS A CB    1 
ATOM   932   C  CG    . LYS A  1 153 ? -23.952 9.624    58.061  1.00 55.75  ? 153 LYS A CG    1 
ATOM   933   C  CD    . LYS A  1 153 ? -24.542 10.683   57.132  1.00 57.06  ? 153 LYS A CD    1 
ATOM   934   C  CE    . LYS A  1 153 ? -23.534 11.803   56.845  1.00 56.25  ? 153 LYS A CE    1 
ATOM   935   N  NZ    . LYS A  1 153 ? -24.190 13.041   56.288  1.00 57.36  ? 153 LYS A NZ    1 
ATOM   936   N  N     . ALA A  1 154 ? -20.467 7.025    56.756  1.00 53.26  ? 154 ALA A N     1 
ATOM   937   C  CA    . ALA A  1 154 ? -19.713 6.124    55.891  1.00 52.56  ? 154 ALA A CA    1 
ATOM   938   C  C     . ALA A  1 154 ? -19.246 4.914    56.667  1.00 51.76  ? 154 ALA A C     1 
ATOM   939   O  O     . ALA A  1 154 ? -19.434 3.791    56.215  1.00 52.77  ? 154 ALA A O     1 
ATOM   940   C  CB    . ALA A  1 154 ? -18.553 6.836    55.258  1.00 51.49  ? 154 ALA A CB    1 
ATOM   941   N  N     . VAL A  1 155 ? -18.670 5.129    57.847  1.00 50.76  ? 155 VAL A N     1 
ATOM   942   C  CA    . VAL A  1 155 ? -18.147 4.018    58.646  1.00 49.89  ? 155 VAL A CA    1 
ATOM   943   C  C     . VAL A  1 155 ? -19.307 3.124    59.111  1.00 51.13  ? 155 VAL A C     1 
ATOM   944   O  O     . VAL A  1 155 ? -19.360 1.940    58.796  1.00 51.16  ? 155 VAL A O     1 
ATOM   945   C  CB    . VAL A  1 155 ? -17.277 4.519    59.838  1.00 48.38  ? 155 VAL A CB    1 
ATOM   946   C  CG1   . VAL A  1 155 ? -16.808 3.371    60.695  1.00 46.66  ? 155 VAL A CG1   1 
ATOM   947   C  CG2   . VAL A  1 155 ? -16.071 5.270    59.320  1.00 47.59  ? 155 VAL A CG2   1 
ATOM   948   N  N     . ASP A  1 156 ? -20.262 3.712    59.815  1.00 52.06  ? 156 ASP A N     1 
ATOM   949   C  CA    . ASP A  1 156 ? -21.324 2.923    60.413  1.00 53.42  ? 156 ASP A CA    1 
ATOM   950   C  C     . ASP A  1 156 ? -22.160 2.182    59.375  1.00 54.69  ? 156 ASP A C     1 
ATOM   951   O  O     . ASP A  1 156 ? -22.730 1.129    59.673  1.00 55.58  ? 156 ASP A O     1 
ATOM   952   C  CB    . ASP A  1 156 ? -22.176 3.772    61.368  1.00 53.82  ? 156 ASP A CB    1 
ATOM   953   C  CG    . ASP A  1 156 ? -21.379 4.253    62.595  1.00 54.57  ? 156 ASP A CG    1 
ATOM   954   O  OD1   . ASP A  1 156 ? -20.325 3.644    62.956  1.00 54.53  ? 156 ASP A OD1   1 
ATOM   955   O  OD2   . ASP A  1 156 ? -21.792 5.260    63.200  1.00 56.41  ? 156 ASP A OD2   1 
ATOM   956   N  N     . ALA A  1 157 ? -22.190 2.702    58.153  1.00 55.05  ? 157 ALA A N     1 
ATOM   957   C  CA    . ALA A  1 157 ? -22.994 2.091    57.105  1.00 56.46  ? 157 ALA A CA    1 
ATOM   958   C  C     . ALA A  1 157 ? -22.211 1.120    56.250  1.00 56.11  ? 157 ALA A C     1 
ATOM   959   O  O     . ALA A  1 157 ? -22.779 0.145    55.782  1.00 57.41  ? 157 ALA A O     1 
ATOM   960   C  CB    . ALA A  1 157 ? -23.668 3.139    56.236  1.00 57.69  ? 157 ALA A CB    1 
ATOM   961   N  N     . LEU A  1 158 ? -20.923 1.367    56.041  1.00 54.36  ? 158 LEU A N     1 
ATOM   962   C  CA    . LEU A  1 158 ? -20.193 0.534    55.105  1.00 54.33  ? 158 LEU A CA    1 
ATOM   963   C  C     . LEU A  1 158 ? -19.021 -0.230   55.691  1.00 53.04  ? 158 LEU A C     1 
ATOM   964   O  O     . LEU A  1 158 ? -18.572 -1.223   55.121  1.00 53.49  ? 158 LEU A O     1 
ATOM   965   C  CB    . LEU A  1 158 ? -19.722 1.354    53.914  1.00 54.55  ? 158 LEU A CB    1 
ATOM   966   C  CG    . LEU A  1 158 ? -20.782 2.114    53.127  1.00 56.70  ? 158 LEU A CG    1 
ATOM   967   C  CD1   . LEU A  1 158 ? -20.062 2.948    52.095  1.00 57.99  ? 158 LEU A CD1   1 
ATOM   968   C  CD2   . LEU A  1 158 ? -21.767 1.184    52.472  1.00 57.57  ? 158 LEU A CD2   1 
ATOM   969   N  N     . VAL A  1 159 ? -18.496 0.248    56.808  1.00 51.78  ? 159 VAL A N     1 
ATOM   970   C  CA    . VAL A  1 159 ? -17.308 -0.362   57.406  1.00 50.14  ? 159 VAL A CA    1 
ATOM   971   C  C     . VAL A  1 159 ? -17.548 -0.408   58.895  1.00 49.38  ? 159 VAL A C     1 
ATOM   972   O  O     . VAL A  1 159 ? -16.873 0.297    59.657  1.00 47.80  ? 159 VAL A O     1 
ATOM   973   C  CB    . VAL A  1 159 ? -16.025 0.451    57.168  1.00 48.73  ? 159 VAL A CB    1 
ATOM   974   C  CG1   . VAL A  1 159 ? -14.840 -0.474   57.133  1.00 48.42  ? 159 VAL A CG1   1 
ATOM   975   C  CG2   . VAL A  1 159 ? -16.098 1.241    55.888  1.00 50.03  ? 159 VAL A CG2   1 
ATOM   976   N  N     . PRO A  1 160 ? -18.537 -1.211   59.315  1.00 49.97  ? 160 PRO A N     1 
ATOM   977   C  CA    . PRO A  1 160 ? -18.936 -1.154   60.706  1.00 50.00  ? 160 PRO A CA    1 
ATOM   978   C  C     . PRO A  1 160 ? -17.866 -1.774   61.605  1.00 48.99  ? 160 PRO A C     1 
ATOM   979   O  O     . PRO A  1 160 ? -17.205 -2.715   61.199  1.00 48.78  ? 160 PRO A O     1 
ATOM   980   C  CB    . PRO A  1 160 ? -20.249 -1.936   60.724  1.00 51.52  ? 160 PRO A CB    1 
ATOM   981   C  CG    . PRO A  1 160 ? -20.147 -2.863   59.583  1.00 52.33  ? 160 PRO A CG    1 
ATOM   982   C  CD    . PRO A  1 160 ? -19.265 -2.239   58.559  1.00 50.97  ? 160 PRO A CD    1 
ATOM   983   N  N     . ILE A  1 161 ? -17.686 -1.221   62.800  1.00 48.71  ? 161 ILE A N     1 
ATOM   984   C  CA    . ILE A  1 161 ? -16.681 -1.701   63.752  1.00 48.10  ? 161 ILE A CA    1 
ATOM   985   C  C     . ILE A  1 161 ? -17.388 -2.241   64.979  1.00 48.85  ? 161 ILE A C     1 
ATOM   986   O  O     . ILE A  1 161 ? -18.324 -1.628   65.447  1.00 49.85  ? 161 ILE A O     1 
ATOM   987   C  CB    . ILE A  1 161 ? -15.753 -0.556   64.231  1.00 46.62  ? 161 ILE A CB    1 
ATOM   988   C  CG1   . ILE A  1 161 ? -15.066 0.124    63.058  1.00 46.46  ? 161 ILE A CG1   1 
ATOM   989   C  CG2   . ILE A  1 161 ? -14.720 -1.076   65.217  1.00 46.27  ? 161 ILE A CG2   1 
ATOM   990   C  CD1   . ILE A  1 161 ? -14.300 1.401    63.467  1.00 47.69  ? 161 ILE A CD1   1 
ATOM   991   N  N     . GLY A  1 162 ? -16.925 -3.358   65.522  1.00 49.22  ? 162 GLY A N     1 
ATOM   992   C  CA    . GLY A  1 162 ? -17.543 -3.930   66.721  1.00 50.26  ? 162 GLY A CA    1 
ATOM   993   C  C     . GLY A  1 162 ? -16.621 -3.961   67.924  1.00 49.74  ? 162 GLY A C     1 
ATOM   994   O  O     . GLY A  1 162 ? -15.389 -3.958   67.777  1.00 49.01  ? 162 GLY A O     1 
ATOM   995   N  N     . ARG A  1 163 ? -17.214 -3.984   69.116  1.00 49.91  ? 163 ARG A N     1 
ATOM   996   C  CA    . ARG A  1 163 ? -16.437 -3.979   70.353  1.00 49.38  ? 163 ARG A CA    1 
ATOM   997   C  C     . ARG A  1 163 ? -15.528 -5.175   70.431  1.00 48.94  ? 163 ARG A C     1 
ATOM   998   O  O     . ARG A  1 163 ? -15.991 -6.301   70.424  1.00 50.57  ? 163 ARG A O     1 
ATOM   999   C  CB    . ARG A  1 163 ? -17.345 -3.936   71.575  1.00 50.28  ? 163 ARG A CB    1 
ATOM   1000  C  CG    . ARG A  1 163 ? -18.440 -2.944   71.393  1.00 51.62  ? 163 ARG A CG    1 
ATOM   1001  C  CD    . ARG A  1 163 ? -18.912 -2.328   72.663  1.00 51.65  ? 163 ARG A CD    1 
ATOM   1002  N  NE    . ARG A  1 163 ? -19.326 -0.957   72.384  1.00 50.30  ? 163 ARG A NE    1 
ATOM   1003  C  CZ    . ARG A  1 163 ? -19.856 -0.145   73.286  1.00 51.37  ? 163 ARG A CZ    1 
ATOM   1004  N  NH1   . ARG A  1 163 ? -20.071 -0.589   74.521  1.00 51.50  ? 163 ARG A NH1   1 
ATOM   1005  N  NH2   . ARG A  1 163 ? -20.186 1.102    72.948  1.00 51.53  ? 163 ARG A NH2   1 
ATOM   1006  N  N     . GLY A  1 164 ? -14.230 -4.924   70.497  1.00 47.72  ? 164 GLY A N     1 
ATOM   1007  C  CA    . GLY A  1 164 ? -13.249 -6.004   70.539  1.00 47.36  ? 164 GLY A CA    1 
ATOM   1008  C  C     . GLY A  1 164 ? -12.388 -6.032   69.303  1.00 46.04  ? 164 GLY A C     1 
ATOM   1009  O  O     . GLY A  1 164 ? -11.257 -6.464   69.355  1.00 46.01  ? 164 GLY A O     1 
ATOM   1010  N  N     . GLN A  1 165 ? -12.928 -5.536   68.202  1.00 45.76  ? 165 GLN A N     1 
ATOM   1011  C  CA    . GLN A  1 165 ? -12.268 -5.519   66.909  1.00 45.36  ? 165 GLN A CA    1 
ATOM   1012  C  C     . GLN A  1 165 ? -11.006 -4.620   66.901  1.00 44.45  ? 165 GLN A C     1 
ATOM   1013  O  O     . GLN A  1 165 ? -10.894 -3.693   67.698  1.00 44.22  ? 165 GLN A O     1 
ATOM   1014  C  CB    . GLN A  1 165 ? -13.302 -5.048   65.880  1.00 45.42  ? 165 GLN A CB    1 
ATOM   1015  C  CG    . GLN A  1 165 ? -12.851 -4.929   64.452  1.00 44.71  ? 165 GLN A CG    1 
ATOM   1016  C  CD    . GLN A  1 165 ? -13.992 -4.642   63.521  1.00 44.30  ? 165 GLN A CD    1 
ATOM   1017  O  OE1   . GLN A  1 165 ? -15.145 -4.678   63.917  1.00 47.62  ? 165 GLN A OE1   1 
ATOM   1018  N  NE2   . GLN A  1 165 ? -13.685 -4.367   62.274  1.00 44.05  ? 165 GLN A NE2   1 
ATOM   1019  N  N     . ARG A  1 166 ? -10.049 -4.929   66.030  1.00 44.25  ? 166 ARG A N     1 
ATOM   1020  C  CA    . ARG A  1 166 ? -8.961  -4.003   65.717  1.00 44.02  ? 166 ARG A CA    1 
ATOM   1021  C  C     . ARG A  1 166 ? -9.208  -3.488   64.311  1.00 44.29  ? 166 ARG A C     1 
ATOM   1022  O  O     . ARG A  1 166 ? -9.037  -4.240   63.347  1.00 45.17  ? 166 ARG A O     1 
ATOM   1023  C  CB    . ARG A  1 166 ? -7.588  -4.697   65.728  1.00 43.33  ? 166 ARG A CB    1 
ATOM   1024  C  CG    . ARG A  1 166 ? -7.050  -5.110   67.086  1.00 44.03  ? 166 ARG A CG    1 
ATOM   1025  C  CD    . ARG A  1 166 ? -7.694  -6.386   67.609  1.00 45.99  ? 166 ARG A CD    1 
ATOM   1026  N  NE    . ARG A  1 166 ? -7.888  -7.335   66.527  1.00 46.98  ? 166 ARG A NE    1 
ATOM   1027  C  CZ    . ARG A  1 166 ? -6.937  -8.123   66.046  1.00 47.12  ? 166 ARG A CZ    1 
ATOM   1028  N  NH1   . ARG A  1 166 ? -5.729  -8.094   66.587  1.00 46.63  ? 166 ARG A NH1   1 
ATOM   1029  N  NH2   . ARG A  1 166 ? -7.194  -8.929   65.017  1.00 46.98  ? 166 ARG A NH2   1 
ATOM   1030  N  N     . GLU A  1 167 ? -9.608  -2.228   64.173  1.00 43.94  ? 167 GLU A N     1 
ATOM   1031  C  CA    . GLU A  1 167 ? -9.766  -1.670   62.840  1.00 43.98  ? 167 GLU A CA    1 
ATOM   1032  C  C     . GLU A  1 167 ? -8.760  -0.572   62.564  1.00 43.20  ? 167 GLU A C     1 
ATOM   1033  O  O     . GLU A  1 167 ? -8.678  0.416    63.303  1.00 42.80  ? 167 GLU A O     1 
ATOM   1034  C  CB    . GLU A  1 167 ? -11.163 -1.157   62.586  1.00 44.60  ? 167 GLU A CB    1 
ATOM   1035  C  CG    . GLU A  1 167 ? -11.332 -0.651   61.166  1.00 45.97  ? 167 GLU A CG    1 
ATOM   1036  C  CD    . GLU A  1 167 ? -11.872 -1.703   60.188  1.00 48.01  ? 167 GLU A CD    1 
ATOM   1037  O  OE1   . GLU A  1 167 ? -11.965 -2.897   60.550  1.00 48.65  ? 167 GLU A OE1   1 
ATOM   1038  O  OE2   . GLU A  1 167 ? -12.214 -1.323   59.043  1.00 48.41  ? 167 GLU A OE2   1 
ATOM   1039  N  N     . LEU A  1 168 ? -8.018  -0.762   61.471  1.00 42.59  ? 168 LEU A N     1 
ATOM   1040  C  CA    . LEU A  1 168 ? -6.941  0.110    61.077  1.00 41.30  ? 168 LEU A CA    1 
ATOM   1041  C  C     . LEU A  1 168 ? -7.475  1.347    60.378  1.00 41.42  ? 168 LEU A C     1 
ATOM   1042  O  O     . LEU A  1 168 ? -8.283  1.246    59.464  1.00 42.44  ? 168 LEU A O     1 
ATOM   1043  C  CB    . LEU A  1 168 ? -5.971  -0.649   60.164  1.00 41.21  ? 168 LEU A CB    1 
ATOM   1044  C  CG    . LEU A  1 168 ? -4.806  0.169    59.597  1.00 40.74  ? 168 LEU A CG    1 
ATOM   1045  C  CD1   . LEU A  1 168 ? -3.861  0.625    60.696  1.00 40.02  ? 168 LEU A CD1   1 
ATOM   1046  C  CD2   . LEU A  1 168 ? -4.068  -0.601   58.549  1.00 41.32  ? 168 LEU A CD2   1 
ATOM   1047  N  N     . ILE A  1 169 ? -7.033  2.518    60.822  1.00 40.84  ? 169 ILE A N     1 
ATOM   1048  C  CA    . ILE A  1 169 ? -7.287  3.749    60.099  1.00 41.10  ? 169 ILE A CA    1 
ATOM   1049  C  C     . ILE A  1 169 ? -5.989  4.057    59.359  1.00 41.17  ? 169 ILE A C     1 
ATOM   1050  O  O     . ILE A  1 169 ? -4.972  4.380    59.993  1.00 40.64  ? 169 ILE A O     1 
ATOM   1051  C  CB    . ILE A  1 169 ? -7.650  4.936    61.035  1.00 41.10  ? 169 ILE A CB    1 
ATOM   1052  C  CG1   . ILE A  1 169 ? -8.862  4.623    61.919  1.00 40.70  ? 169 ILE A CG1   1 
ATOM   1053  C  CG2   . ILE A  1 169 ? -7.901  6.204    60.217  1.00 41.66  ? 169 ILE A CG2   1 
ATOM   1054  C  CD1   . ILE A  1 169 ? -9.317  5.820    62.816  1.00 41.06  ? 169 ILE A CD1   1 
ATOM   1055  N  N     . ILE A  1 170 ? -6.025  3.953    58.027  1.00 41.47  ? 170 ILE A N     1 
ATOM   1056  C  CA    . ILE A  1 170 ? -4.820  4.035    57.215  1.00 41.07  ? 170 ILE A CA    1 
ATOM   1057  C  C     . ILE A  1 170 ? -4.943  5.035    56.062  1.00 42.17  ? 170 ILE A C     1 
ATOM   1058  O  O     . ILE A  1 170 ? -6.001  5.135    55.436  1.00 43.02  ? 170 ILE A O     1 
ATOM   1059  C  CB    . ILE A  1 170 ? -4.443  2.638    56.666  1.00 41.14  ? 170 ILE A CB    1 
ATOM   1060  C  CG1   . ILE A  1 170 ? -3.099  2.688    55.907  1.00 41.39  ? 170 ILE A CG1   1 
ATOM   1061  C  CG2   . ILE A  1 170 ? -5.548  2.077    55.803  1.00 40.52  ? 170 ILE A CG2   1 
ATOM   1062  C  CD1   . ILE A  1 170 ? -2.516  1.327    55.528  1.00 38.93  ? 170 ILE A CD1   1 
ATOM   1063  N  N     . GLY A  1 171 ? -3.858  5.766    55.784  1.00 41.83  ? 171 GLY A N     1 
ATOM   1064  C  CA    . GLY A  1 171 ? -3.781  6.643    54.614  1.00 42.50  ? 171 GLY A CA    1 
ATOM   1065  C  C     . GLY A  1 171 ? -2.544  7.534    54.592  1.00 42.55  ? 171 GLY A C     1 
ATOM   1066  O  O     . GLY A  1 171 ? -1.816  7.621    55.578  1.00 41.77  ? 171 GLY A O     1 
ATOM   1067  N  N     . ASP A  1 172 ? -2.309  8.198    53.457  1.00 43.02  ? 172 ASP A N     1 
ATOM   1068  C  CA    . ASP A  1 172 ? -1.280  9.225    53.360  1.00 42.57  ? 172 ASP A CA    1 
ATOM   1069  C  C     . ASP A  1 172 ? -1.484  10.339   54.389  1.00 42.36  ? 172 ASP A C     1 
ATOM   1070  O  O     . ASP A  1 172 ? -2.526  10.409   55.053  1.00 41.95  ? 172 ASP A O     1 
ATOM   1071  C  CB    . ASP A  1 172 ? -1.191  9.769    51.936  1.00 43.29  ? 172 ASP A CB    1 
ATOM   1072  C  CG    . ASP A  1 172 ? -0.510  8.782    50.984  1.00 44.74  ? 172 ASP A CG    1 
ATOM   1073  O  OD1   . ASP A  1 172 ? 0.043   7.758    51.457  1.00 44.98  ? 172 ASP A OD1   1 
ATOM   1074  O  OD2   . ASP A  1 172 ? -0.516  9.010    49.755  1.00 46.22  ? 172 ASP A OD2   1 
ATOM   1075  N  N     . ARG A  1 173 ? -0.461  11.175   54.550  1.00 42.16  ? 173 ARG A N     1 
ATOM   1076  C  CA    . ARG A  1 173 ? -0.531  12.304   55.457  1.00 41.90  ? 173 ARG A CA    1 
ATOM   1077  C  C     . ARG A  1 173 ? -1.709  13.220   55.128  1.00 43.13  ? 173 ARG A C     1 
ATOM   1078  O  O     . ARG A  1 173 ? -2.165  13.285   53.980  1.00 43.52  ? 173 ARG A O     1 
ATOM   1079  C  CB    . ARG A  1 173 ? 0.765   13.115   55.398  1.00 42.11  ? 173 ARG A CB    1 
ATOM   1080  C  CG    . ARG A  1 173 ? 1.108   13.589   54.024  1.00 42.62  ? 173 ARG A CG    1 
ATOM   1081  C  CD    . ARG A  1 173 ? 2.144   14.670   54.019  1.00 44.01  ? 173 ARG A CD    1 
ATOM   1082  N  NE    . ARG A  1 173 ? 1.741   15.673   53.034  1.00 47.53  ? 173 ARG A NE    1 
ATOM   1083  C  CZ    . ARG A  1 173 ? 2.093   15.642   51.754  1.00 48.25  ? 173 ARG A CZ    1 
ATOM   1084  N  NH1   . ARG A  1 173 ? 2.876   14.670   51.304  1.00 48.87  ? 173 ARG A NH1   1 
ATOM   1085  N  NH2   . ARG A  1 173 ? 1.668   16.579   50.927  1.00 48.16  ? 173 ARG A NH2   1 
ATOM   1086  N  N     . GLN A  1 174 ? -2.176  13.926   56.156  1.00 43.52  ? 174 GLN A N     1 
ATOM   1087  C  CA    . GLN A  1 174 ? -3.202  14.947   56.033  1.00 45.26  ? 174 GLN A CA    1 
ATOM   1088  C  C     . GLN A  1 174 ? -4.472  14.501   55.284  1.00 45.85  ? 174 GLN A C     1 
ATOM   1089  O  O     . GLN A  1 174 ? -4.983  15.238   54.447  1.00 46.93  ? 174 GLN A O     1 
ATOM   1090  C  CB    . GLN A  1 174 ? -2.601  16.188   55.387  1.00 46.74  ? 174 GLN A CB    1 
ATOM   1091  C  CG    . GLN A  1 174 ? -1.679  16.990   56.329  1.00 48.80  ? 174 GLN A CG    1 
ATOM   1092  C  CD    . GLN A  1 174 ? -0.505  17.657   55.634  1.00 49.60  ? 174 GLN A CD    1 
ATOM   1093  O  OE1   . GLN A  1 174 ? -0.286  17.510   54.427  1.00 51.03  ? 174 GLN A OE1   1 
ATOM   1094  N  NE2   . GLN A  1 174 ? 0.275   18.379   56.410  1.00 51.83  ? 174 GLN A NE2   1 
ATOM   1095  N  N     . THR A  1 175 ? -4.979  13.305   55.583  1.00 44.73  ? 175 THR A N     1 
ATOM   1096  C  CA    . THR A  1 175 ? -6.153  12.808   54.862  1.00 45.44  ? 175 THR A CA    1 
ATOM   1097  C  C     . THR A  1 175 ? -7.379  12.645   55.779  1.00 45.14  ? 175 THR A C     1 
ATOM   1098  O  O     . THR A  1 175 ? -8.450  12.256   55.344  1.00 45.52  ? 175 THR A O     1 
ATOM   1099  C  CB    . THR A  1 175 ? -5.858  11.478   54.112  1.00 45.23  ? 175 THR A CB    1 
ATOM   1100  O  OG1   . THR A  1 175 ? -5.334  10.520   55.031  1.00 44.37  ? 175 THR A OG1   1 
ATOM   1101  C  CG2   . THR A  1 175 ? -4.852  11.679   52.990  1.00 45.12  ? 175 THR A CG2   1 
ATOM   1102  N  N     . GLY A  1 176 ? -7.204  12.958   57.049  1.00 44.48  ? 176 GLY A N     1 
ATOM   1103  C  CA    . GLY A  1 176 ? -8.278  12.926   57.990  1.00 44.65  ? 176 GLY A CA    1 
ATOM   1104  C  C     . GLY A  1 176 ? -8.258  11.780   58.962  1.00 44.03  ? 176 GLY A C     1 
ATOM   1105  O  O     . GLY A  1 176 ? -9.234  11.580   59.674  1.00 45.42  ? 176 GLY A O     1 
ATOM   1106  N  N     . LYS A  1 177 ? -7.172  11.020   59.007  1.00 43.28  ? 177 LYS A N     1 
ATOM   1107  C  CA    . LYS A  1 177 ? -7.069  9.876    59.919  1.00 42.71  ? 177 LYS A CA    1 
ATOM   1108  C  C     . LYS A  1 177 ? -7.366  10.165   61.400  1.00 42.68  ? 177 LYS A C     1 
ATOM   1109  O  O     . LYS A  1 177 ? -8.174  9.479    61.987  1.00 42.66  ? 177 LYS A O     1 
ATOM   1110  C  CB    . LYS A  1 177 ? -5.726  9.179    59.778  1.00 41.95  ? 177 LYS A CB    1 
ATOM   1111  C  CG    . LYS A  1 177 ? -5.378  8.801    58.353  1.00 42.77  ? 177 LYS A CG    1 
ATOM   1112  C  CD    . LYS A  1 177 ? -4.063  7.999    58.267  1.00 40.93  ? 177 LYS A CD    1 
ATOM   1113  C  CE    . LYS A  1 177 ? -2.905  8.773    58.814  1.00 40.78  ? 177 LYS A CE    1 
ATOM   1114  N  NZ    . LYS A  1 177 ? -2.622  9.968    57.985  1.00 42.74  ? 177 LYS A NZ    1 
ATOM   1115  N  N     . THR A  1 178 ? -6.734  11.171   62.000  1.00 43.00  ? 178 THR A N     1 
ATOM   1116  C  CA    . THR A  1 178 ? -7.031  11.514   63.399  1.00 44.08  ? 178 THR A CA    1 
ATOM   1117  C  C     . THR A  1 178 ? -8.518  11.878   63.582  1.00 44.64  ? 178 THR A C     1 
ATOM   1118  O  O     . THR A  1 178 ? -9.162  11.438   64.530  1.00 44.62  ? 178 THR A O     1 
ATOM   1119  C  CB    . THR A  1 178 ? -6.121  12.636   63.917  1.00 43.70  ? 178 THR A CB    1 
ATOM   1120  O  OG1   . THR A  1 178 ? -4.785  12.160   63.893  1.00 48.96  ? 178 THR A OG1   1 
ATOM   1121  C  CG2   . THR A  1 178 ? -6.445  12.996   65.352  1.00 43.34  ? 178 THR A CG2   1 
ATOM   1122  N  N     . ALA A  1 179 ? -9.037  12.655   62.641  1.00 45.33  ? 179 ALA A N     1 
ATOM   1123  C  CA    . ALA A  1 179 ? -10.436 13.025   62.596  1.00 46.49  ? 179 ALA A CA    1 
ATOM   1124  C  C     . ALA A  1 179 ? -11.396 11.837   62.685  1.00 46.62  ? 179 ALA A C     1 
ATOM   1125  O  O     . ALA A  1 179 ? -12.391 11.904   63.407  1.00 47.82  ? 179 ALA A O     1 
ATOM   1126  C  CB    . ALA A  1 179 ? -10.716 13.835   61.355  1.00 47.35  ? 179 ALA A CB    1 
ATOM   1127  N  N     . VAL A  1 180 ? -11.122 10.756   61.966  1.00 45.91  ? 180 VAL A N     1 
ATOM   1128  C  CA    . VAL A  1 180 ? -11.999 9.585    62.066  1.00 45.95  ? 180 VAL A CA    1 
ATOM   1129  C  C     . VAL A  1 180 ? -12.006 9.061    63.502  1.00 45.67  ? 180 VAL A C     1 
ATOM   1130  O  O     . VAL A  1 180 ? -13.058 8.799    64.081  1.00 45.82  ? 180 VAL A O     1 
ATOM   1131  C  CB    . VAL A  1 180 ? -11.612 8.463    61.067  1.00 45.46  ? 180 VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1 180 ? -12.338 7.179    61.399  1.00 44.73  ? 180 VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1 180 ? -11.930 8.894    59.651  1.00 45.91  ? 180 VAL A CG2   1 
ATOM   1134  N  N     . ALA A  1 181 ? -10.814 8.932    64.076  1.00 45.49  ? 181 ALA A N     1 
ATOM   1135  C  CA    . ALA A  1 181 ? -10.661 8.449    65.446  1.00 45.24  ? 181 ALA A CA    1 
ATOM   1136  C  C     . ALA A  1 181 ? -11.376 9.371    66.393  1.00 46.09  ? 181 ALA A C     1 
ATOM   1137  O  O     . ALA A  1 181 ? -11.991 8.919    67.357  1.00 46.45  ? 181 ALA A O     1 
ATOM   1138  C  CB    . ALA A  1 181 ? -9.217  8.392    65.817  1.00 44.18  ? 181 ALA A CB    1 
ATOM   1139  N  N     . LEU A  1 182 ? -11.299 10.667   66.099  1.00 46.43  ? 182 LEU A N     1 
ATOM   1140  C  CA    . LEU A  1 182 ? -11.678 11.683   67.044  1.00 47.28  ? 182 LEU A CA    1 
ATOM   1141  C  C     . LEU A  1 182 ? -13.188 11.894   67.089  1.00 48.64  ? 182 LEU A C     1 
ATOM   1142  O  O     . LEU A  1 182 ? -13.759 12.110   68.153  1.00 48.83  ? 182 LEU A O     1 
ATOM   1143  C  CB    . LEU A  1 182 ? -10.970 12.970   66.695  1.00 47.59  ? 182 LEU A CB    1 
ATOM   1144  C  CG    . LEU A  1 182 ? -11.102 14.124   67.678  1.00 49.42  ? 182 LEU A CG    1 
ATOM   1145  C  CD1   . LEU A  1 182 ? -10.508 13.712   69.006  1.00 49.79  ? 182 LEU A CD1   1 
ATOM   1146  C  CD2   . LEU A  1 182 ? -10.378 15.339   67.108  1.00 50.37  ? 182 LEU A CD2   1 
ATOM   1147  N  N     . ASP A  1 183 ? -13.833 11.833   65.934  1.00 49.53  ? 183 ASP A N     1 
ATOM   1148  C  CA    . ASP A  1 183 ? -15.274 11.973   65.882  1.00 51.38  ? 183 ASP A CA    1 
ATOM   1149  C  C     . ASP A  1 183 ? -15.923 10.782   66.556  1.00 50.93  ? 183 ASP A C     1 
ATOM   1150  O  O     . ASP A  1 183 ? -17.009 10.910   67.149  1.00 52.26  ? 183 ASP A O     1 
ATOM   1151  C  CB    . ASP A  1 183 ? -15.751 12.103   64.443  1.00 52.65  ? 183 ASP A CB    1 
ATOM   1152  C  CG    . ASP A  1 183 ? -15.447 13.480   63.853  1.00 57.02  ? 183 ASP A CG    1 
ATOM   1153  O  OD1   . ASP A  1 183 ? -15.288 14.458   64.634  1.00 58.75  ? 183 ASP A OD1   1 
ATOM   1154  O  OD2   . ASP A  1 183 ? -15.357 13.584   62.601  1.00 61.68  ? 183 ASP A OD2   1 
ATOM   1155  N  N     . THR A  1 184 ? -15.241 9.640    66.467  1.00 48.76  ? 184 THR A N     1 
ATOM   1156  C  CA    . THR A  1 184 ? -15.613 8.412    67.145  1.00 47.75  ? 184 THR A CA    1 
ATOM   1157  C  C     . THR A  1 184 ? -15.642 8.595    68.672  1.00 47.55  ? 184 THR A C     1 
ATOM   1158  O  O     . THR A  1 184 ? -16.629 8.260    69.326  1.00 48.07  ? 184 THR A O     1 
ATOM   1159  C  CB    . THR A  1 184 ? -14.620 7.300    66.753  1.00 46.72  ? 184 THR A CB    1 
ATOM   1160  O  OG1   . THR A  1 184 ? -14.757 7.010    65.360  1.00 46.72  ? 184 THR A OG1   1 
ATOM   1161  C  CG2   . THR A  1 184 ? -14.846 6.035    67.547  1.00 46.81  ? 184 THR A CG2   1 
ATOM   1162  N  N     . ILE A  1 185 ? -14.554 9.129    69.228  1.00 46.61  ? 185 ILE A N     1 
ATOM   1163  C  CA    . ILE A  1 185 ? -14.442 9.431    70.667  1.00 46.13  ? 185 ILE A CA    1 
ATOM   1164  C  C     . ILE A  1 185 ? -15.508 10.430   71.109  1.00 47.17  ? 185 ILE A C     1 
ATOM   1165  O  O     . ILE A  1 185 ? -16.050 10.324   72.212  1.00 48.01  ? 185 ILE A O     1 
ATOM   1166  C  CB    . ILE A  1 185 ? -13.041 10.023   71.009  1.00 45.64  ? 185 ILE A CB    1 
ATOM   1167  C  CG1   . ILE A  1 185 ? -11.924 9.027    70.666  1.00 43.46  ? 185 ILE A CG1   1 
ATOM   1168  C  CG2   . ILE A  1 185 ? -12.968 10.507   72.468  1.00 45.24  ? 185 ILE A CG2   1 
ATOM   1169  C  CD1   . ILE A  1 185 ? -10.558 9.385    71.267  1.00 42.40  ? 185 ILE A CD1   1 
ATOM   1170  N  N     . LEU A  1 186 ? -15.787 11.405   70.247  1.00 47.03  ? 186 LEU A N     1 
ATOM   1171  C  CA    . LEU A  1 186 ? -16.787 12.421   70.511  1.00 47.87  ? 186 LEU A CA    1 
ATOM   1172  C  C     . LEU A  1 186 ? -18.168 11.803   70.563  1.00 49.23  ? 186 LEU A C     1 
ATOM   1173  O  O     . LEU A  1 186 ? -19.004 12.174   71.384  1.00 50.00  ? 186 LEU A O     1 
ATOM   1174  C  CB    . LEU A  1 186 ? -16.766 13.487   69.422  1.00 47.74  ? 186 LEU A CB    1 
ATOM   1175  C  CG    . LEU A  1 186 ? -15.633 14.506   69.493  1.00 46.44  ? 186 LEU A CG    1 
ATOM   1176  C  CD1   . LEU A  1 186 ? -15.822 15.630   68.488  1.00 45.19  ? 186 LEU A CD1   1 
ATOM   1177  C  CD2   . LEU A  1 186 ? -15.503 15.030   70.894  1.00 44.63  ? 186 LEU A CD2   1 
ATOM   1178  N  N     . ASN A  1 187 ? -18.407 10.850   69.677  1.00 49.34  ? 187 ASN A N     1 
ATOM   1179  C  CA    . ASN A  1 187 ? -19.711 10.244   69.589  1.00 50.59  ? 187 ASN A CA    1 
ATOM   1180  C  C     . ASN A  1 187 ? -20.094 9.431    70.814  1.00 51.09  ? 187 ASN A C     1 
ATOM   1181  O  O     . ASN A  1 187 ? -21.252 9.095    70.982  1.00 52.22  ? 187 ASN A O     1 
ATOM   1182  C  CB    . ASN A  1 187 ? -19.812 9.381    68.347  1.00 50.27  ? 187 ASN A CB    1 
ATOM   1183  C  CG    . ASN A  1 187 ? -21.237 9.078    67.982  1.00 52.85  ? 187 ASN A CG    1 
ATOM   1184  O  OD1   . ASN A  1 187 ? -22.099 9.972    67.971  1.00 54.90  ? 187 ASN A OD1   1 
ATOM   1185  N  ND2   . ASN A  1 187 ? -21.511 7.809    67.695  1.00 54.16  ? 187 ASN A ND2   1 
ATOM   1186  N  N     . GLN A  1 188 ? -19.141 9.130    71.686  1.00 50.81  ? 188 GLN A N     1 
ATOM   1187  C  CA    . GLN A  1 188 ? -19.446 8.268    72.817  1.00 51.48  ? 188 GLN A CA    1 
ATOM   1188  C  C     . GLN A  1 188 ? -20.148 8.991    73.962  1.00 53.27  ? 188 GLN A C     1 
ATOM   1189  O  O     . GLN A  1 188 ? -20.514 8.361    74.959  1.00 54.23  ? 188 GLN A O     1 
ATOM   1190  C  CB    . GLN A  1 188 ? -18.207 7.533    73.315  1.00 50.55  ? 188 GLN A CB    1 
ATOM   1191  C  CG    . GLN A  1 188 ? -17.431 6.747    72.242  1.00 49.25  ? 188 GLN A CG    1 
ATOM   1192  C  CD    . GLN A  1 188 ? -18.306 5.862    71.370  1.00 48.86  ? 188 GLN A CD    1 
ATOM   1193  O  OE1   . GLN A  1 188 ? -19.171 5.127    71.859  1.00 50.09  ? 188 GLN A OE1   1 
ATOM   1194  N  NE2   . GLN A  1 188 ? -18.065 5.914    70.067  1.00 46.77  ? 188 GLN A NE2   1 
ATOM   1195  N  N     . LYS A  1 189 ? -20.354 10.303   73.818  1.00 53.92  ? 189 LYS A N     1 
ATOM   1196  C  CA    . LYS A  1 189 ? -21.158 11.069   74.772  1.00 55.34  ? 189 LYS A CA    1 
ATOM   1197  C  C     . LYS A  1 189 ? -22.557 10.476   74.963  1.00 56.81  ? 189 LYS A C     1 
ATOM   1198  O  O     . LYS A  1 189 ? -23.177 10.670   76.009  1.00 58.36  ? 189 LYS A O     1 
ATOM   1199  C  CB    . LYS A  1 189 ? -21.322 12.501   74.296  1.00 55.62  ? 189 LYS A CB    1 
ATOM   1200  C  CG    . LYS A  1 189 ? -20.131 13.379   74.539  1.00 56.64  ? 189 LYS A CG    1 
ATOM   1201  C  CD    . LYS A  1 189 ? -20.521 14.849   74.484  1.00 58.32  ? 189 LYS A CD    1 
ATOM   1202  C  CE    . LYS A  1 189 ? -20.204 15.476   73.131  1.00 59.28  ? 189 LYS A CE    1 
ATOM   1203  N  NZ    . LYS A  1 189 ? -20.774 16.884   73.081  1.00 62.53  ? 189 LYS A NZ    1 
ATOM   1204  N  N     . ARG A  1 190 ? -23.061 9.764    73.956  1.00 56.40  ? 190 ARG A N     1 
ATOM   1205  C  CA    . ARG A  1 190 ? -24.466 9.350    73.959  1.00 57.73  ? 190 ARG A CA    1 
ATOM   1206  C  C     . ARG A  1 190 ? -24.731 8.299    75.017  1.00 58.16  ? 190 ARG A C     1 
ATOM   1207  O  O     . ARG A  1 190 ? -25.861 8.151    75.477  1.00 59.70  ? 190 ARG A O     1 
ATOM   1208  C  CB    . ARG A  1 190 ? -24.894 8.823    72.590  1.00 57.70  ? 190 ARG A CB    1 
ATOM   1209  C  CG    . ARG A  1 190 ? -24.526 9.734    71.450  1.00 57.05  ? 190 ARG A CG    1 
ATOM   1210  C  CD    . ARG A  1 190 ? -25.211 9.337    70.165  1.00 58.81  ? 190 ARG A CD    1 
ATOM   1211  N  NE    . ARG A  1 190 ? -24.678 10.130   69.066  1.00 59.16  ? 190 ARG A NE    1 
ATOM   1212  C  CZ    . ARG A  1 190 ? -25.150 11.314   68.679  1.00 60.19  ? 190 ARG A CZ    1 
ATOM   1213  N  NH1   . ARG A  1 190 ? -26.203 11.871   69.283  1.00 60.17  ? 190 ARG A NH1   1 
ATOM   1214  N  NH2   . ARG A  1 190 ? -24.552 11.943   67.675  1.00 59.36  ? 190 ARG A NH2   1 
ATOM   1215  N  N     . TRP A  1 191 ? -23.681 7.571    75.392  1.00 56.80  ? 191 TRP A N     1 
ATOM   1216  C  CA    . TRP A  1 191 ? -23.786 6.523    76.395  1.00 56.92  ? 191 TRP A CA    1 
ATOM   1217  C  C     . TRP A  1 191 ? -22.939 6.817    77.608  1.00 56.80  ? 191 TRP A C     1 
ATOM   1218  O  O     . TRP A  1 191 ? -23.359 6.498    78.718  1.00 58.49  ? 191 TRP A O     1 
ATOM   1219  C  CB    . TRP A  1 191 ? -23.451 5.156    75.808  1.00 56.09  ? 191 TRP A CB    1 
ATOM   1220  C  CG    . TRP A  1 191 ? -24.166 4.936    74.539  1.00 55.83  ? 191 TRP A CG    1 
ATOM   1221  C  CD1   . TRP A  1 191 ? -25.406 4.390    74.378  1.00 57.33  ? 191 TRP A CD1   1 
ATOM   1222  C  CD2   . TRP A  1 191 ? -23.712 5.298    73.240  1.00 54.02  ? 191 TRP A CD2   1 
ATOM   1223  N  NE1   . TRP A  1 191 ? -25.747 4.376    73.048  1.00 57.03  ? 191 TRP A NE1   1 
ATOM   1224  C  CE2   . TRP A  1 191 ? -24.725 4.930    72.327  1.00 55.15  ? 191 TRP A CE2   1 
ATOM   1225  C  CE3   . TRP A  1 191 ? -22.537 5.877    72.754  1.00 52.05  ? 191 TRP A CE3   1 
ATOM   1226  C  CZ2   . TRP A  1 191 ? -24.604 5.135    70.959  1.00 55.32  ? 191 TRP A CZ2   1 
ATOM   1227  C  CZ3   . TRP A  1 191 ? -22.410 6.078    71.394  1.00 52.41  ? 191 TRP A CZ3   1 
ATOM   1228  C  CH2   . TRP A  1 191 ? -23.438 5.707    70.508  1.00 54.95  ? 191 TRP A CH2   1 
ATOM   1229  N  N     . ASN A  1 192 ? -21.774 7.441    77.406  1.00 55.30  ? 192 ASN A N     1 
ATOM   1230  C  CA    . ASN A  1 192 ? -20.908 7.853    78.510  1.00 55.35  ? 192 ASN A CA    1 
ATOM   1231  C  C     . ASN A  1 192 ? -21.538 8.920    79.450  1.00 57.38  ? 192 ASN A C     1 
ATOM   1232  O  O     . ASN A  1 192 ? -20.959 9.245    80.481  1.00 58.12  ? 192 ASN A O     1 
ATOM   1233  C  CB    . ASN A  1 192 ? -19.541 8.329    78.001  1.00 53.48  ? 192 ASN A CB    1 
ATOM   1234  C  CG    . ASN A  1 192 ? -18.751 7.239    77.244  1.00 53.21  ? 192 ASN A CG    1 
ATOM   1235  O  OD1   . ASN A  1 192 ? -19.070 6.052    77.291  1.00 54.75  ? 192 ASN A OD1   1 
ATOM   1236  N  ND2   . ASN A  1 192 ? -17.708 7.653    76.555  1.00 51.03  ? 192 ASN A ND2   1 
ATOM   1237  N  N     . ASN A  1 193 ? -22.699 9.477    79.107  1.00 58.53  ? 193 ASN A N     1 
ATOM   1238  C  CA    . ASN A  1 193 ? -23.416 10.330   80.062  1.00 60.53  ? 193 ASN A CA    1 
ATOM   1239  C  C     . ASN A  1 193 ? -24.515 9.555    80.782  1.00 62.11  ? 193 ASN A C     1 
ATOM   1240  O  O     . ASN A  1 193 ? -25.156 10.076   81.707  1.00 63.50  ? 193 ASN A O     1 
ATOM   1241  C  CB    . ASN A  1 193 ? -23.996 11.604   79.412  1.00 61.09  ? 193 ASN A CB    1 
ATOM   1242  C  CG    . ASN A  1 193 ? -22.917 12.607   78.984  1.00 60.91  ? 193 ASN A CG    1 
ATOM   1243  O  OD1   . ASN A  1 193 ? -21.972 12.893   79.720  1.00 60.87  ? 193 ASN A OD1   1 
ATOM   1244  N  ND2   . ASN A  1 193 ? -23.079 13.162   77.792  1.00 61.69  ? 193 ASN A ND2   1 
ATOM   1245  N  N     . GLY A  1 194 ? -24.728 8.308    80.362  1.00 61.61  ? 194 GLY A N     1 
ATOM   1246  C  CA    . GLY A  1 194 ? -25.756 7.469    80.979  1.00 63.14  ? 194 GLY A CA    1 
ATOM   1247  C  C     . GLY A  1 194 ? -25.296 6.816    82.270  1.00 63.54  ? 194 GLY A C     1 
ATOM   1248  O  O     . GLY A  1 194 ? -24.242 7.162    82.805  1.00 63.01  ? 194 GLY A O     1 
ATOM   1249  N  N     . SER A  1 195 ? -26.080 5.862    82.767  1.00 64.96  ? 195 SER A N     1 
ATOM   1250  C  CA    . SER A  1 195 ? -25.702 5.110    83.973  1.00 65.98  ? 195 SER A CA    1 
ATOM   1251  C  C     . SER A  1 195 ? -25.407 3.609    83.769  1.00 65.81  ? 195 SER A C     1 
ATOM   1252  O  O     . SER A  1 195 ? -25.028 2.920    84.718  1.00 66.30  ? 195 SER A O     1 
ATOM   1253  C  CB    . SER A  1 195 ? -26.748 5.301    85.069  1.00 68.23  ? 195 SER A CB    1 
ATOM   1254  O  OG    . SER A  1 195 ? -26.462 6.463    85.815  1.00 68.79  ? 195 SER A OG    1 
ATOM   1255  N  N     . ASP A  1 196 ? -25.558 3.126    82.536  1.00 65.11  ? 196 ASP A N     1 
ATOM   1256  C  CA    . ASP A  1 196 ? -25.477 1.711    82.211  1.00 65.41  ? 196 ASP A CA    1 
ATOM   1257  C  C     . ASP A  1 196 ? -24.054 1.373    81.769  1.00 63.76  ? 196 ASP A C     1 
ATOM   1258  O  O     . ASP A  1 196 ? -23.728 1.428    80.572  1.00 63.08  ? 196 ASP A O     1 
ATOM   1259  C  CB    . ASP A  1 196 ? -26.500 1.411    81.109  1.00 65.65  ? 196 ASP A CB    1 
ATOM   1260  C  CG    . ASP A  1 196 ? -26.405 -0.005   80.552  1.00 67.80  ? 196 ASP A CG    1 
ATOM   1261  O  OD1   . ASP A  1 196 ? -25.462 -0.777   80.870  1.00 69.10  ? 196 ASP A OD1   1 
ATOM   1262  O  OD2   . ASP A  1 196 ? -27.304 -0.352   79.755  1.00 71.02  ? 196 ASP A OD2   1 
ATOM   1263  N  N     . GLU A  1 197 ? -23.201 1.000    82.723  1.00 63.61  ? 197 GLU A N     1 
ATOM   1264  C  CA    . GLU A  1 197 ? -21.783 0.752    82.423  1.00 61.60  ? 197 GLU A CA    1 
ATOM   1265  C  C     . GLU A  1 197 ? -21.542 -0.185   81.250  1.00 60.47  ? 197 GLU A C     1 
ATOM   1266  O  O     . GLU A  1 197 ? -20.471 -0.158   80.669  1.00 59.28  ? 197 GLU A O     1 
ATOM   1267  C  CB    . GLU A  1 197 ? -21.032 0.214    83.643  1.00 62.05  ? 197 GLU A CB    1 
ATOM   1268  C  CG    . GLU A  1 197 ? -20.833 1.211    84.770  1.00 63.62  ? 197 GLU A CG    1 
ATOM   1269  C  CD    . GLU A  1 197 ? -19.838 2.315    84.446  1.00 64.33  ? 197 GLU A CD    1 
ATOM   1270  O  OE1   . GLU A  1 197 ? -18.797 2.049    83.780  1.00 62.79  ? 197 GLU A OE1   1 
ATOM   1271  O  OE2   . GLU A  1 197 ? -20.099 3.460    84.886  1.00 66.13  ? 197 GLU A OE2   1 
ATOM   1272  N  N     . SER A  1 198 ? -22.510 -1.024   80.895  1.00 61.43  ? 198 SER A N     1 
ATOM   1273  C  CA    . SER A  1 198 ? -22.260 -2.018   79.845  1.00 60.58  ? 198 SER A CA    1 
ATOM   1274  C  C     . SER A  1 198 ? -22.292 -1.383   78.464  1.00 58.95  ? 198 SER A C     1 
ATOM   1275  O  O     . SER A  1 198 ? -21.775 -1.959   77.509  1.00 58.07  ? 198 SER A O     1 
ATOM   1276  C  CB    . SER A  1 198 ? -23.249 -3.178   79.916  1.00 62.29  ? 198 SER A CB    1 
ATOM   1277  O  OG    . SER A  1 198 ? -24.505 -2.786   79.396  1.00 64.53  ? 198 SER A OG    1 
ATOM   1278  N  N     . LYS A  1 199 ? -22.879 -0.190   78.371  1.00 58.56  ? 199 LYS A N     1 
ATOM   1279  C  CA    . LYS A  1 199 ? -23.000 0.517    77.100  1.00 57.26  ? 199 LYS A CA    1 
ATOM   1280  C  C     . LYS A  1 199 ? -21.955 1.601    76.886  1.00 55.51  ? 199 LYS A C     1 
ATOM   1281  O  O     . LYS A  1 199 ? -21.666 1.963    75.739  1.00 54.11  ? 199 LYS A O     1 
ATOM   1282  C  CB    . LYS A  1 199 ? -24.379 1.128    76.963  1.00 58.75  ? 199 LYS A CB    1 
ATOM   1283  C  CG    . LYS A  1 199 ? -25.470 0.117    76.815  1.00 60.65  ? 199 LYS A CG    1 
ATOM   1284  C  CD    . LYS A  1 199 ? -26.706 0.834    76.380  1.00 63.27  ? 199 LYS A CD    1 
ATOM   1285  C  CE    . LYS A  1 199 ? -27.915 -0.071   76.319  1.00 65.09  ? 199 LYS A CE    1 
ATOM   1286  N  NZ    . LYS A  1 199 ? -29.095 0.832    76.248  1.00 68.31  ? 199 LYS A NZ    1 
ATOM   1287  N  N     . LYS A  1 200 ? -21.411 2.126    77.984  1.00 55.22  ? 200 LYS A N     1 
ATOM   1288  C  CA    . LYS A  1 200 ? -20.379 3.152    77.935  1.00 53.72  ? 200 LYS A CA    1 
ATOM   1289  C  C     . LYS A  1 200 ? -19.141 2.613    77.254  1.00 52.26  ? 200 LYS A C     1 
ATOM   1290  O  O     . LYS A  1 200 ? -18.856 1.416    77.351  1.00 52.33  ? 200 LYS A O     1 
ATOM   1291  C  CB    . LYS A  1 200 ? -19.977 3.566    79.340  1.00 54.26  ? 200 LYS A CB    1 
ATOM   1292  C  CG    . LYS A  1 200 ? -20.988 4.339    80.125  1.00 56.79  ? 200 LYS A CG    1 
ATOM   1293  C  CD    . LYS A  1 200 ? -20.596 4.320    81.586  1.00 59.46  ? 200 LYS A CD    1 
ATOM   1294  C  CE    . LYS A  1 200 ? -21.244 5.446    82.382  1.00 61.24  ? 200 LYS A CE    1 
ATOM   1295  N  NZ    . LYS A  1 200 ? -20.231 5.947    83.358  1.00 63.22  ? 200 LYS A NZ    1 
ATOM   1296  N  N     . LEU A  1 201 ? -18.396 3.512    76.603  1.00 51.10  ? 201 LEU A N     1 
ATOM   1297  C  CA    . LEU A  1 201 ? -17.127 3.204    75.950  1.00 49.52  ? 201 LEU A CA    1 
ATOM   1298  C  C     . LEU A  1 201 ? -16.030 4.163    76.406  1.00 49.11  ? 201 LEU A C     1 
ATOM   1299  O  O     . LEU A  1 201 ? -15.970 5.305    75.954  1.00 49.48  ? 201 LEU A O     1 
ATOM   1300  C  CB    . LEU A  1 201 ? -17.276 3.293    74.427  1.00 48.68  ? 201 LEU A CB    1 
ATOM   1301  C  CG    . LEU A  1 201 ? -16.082 2.824    73.561  1.00 47.02  ? 201 LEU A CG    1 
ATOM   1302  C  CD1   . LEU A  1 201 ? -15.530 1.490    73.996  1.00 44.48  ? 201 LEU A CD1   1 
ATOM   1303  C  CD2   . LEU A  1 201 ? -16.465 2.745    72.095  1.00 45.43  ? 201 LEU A CD2   1 
ATOM   1304  N  N     . TYR A  1 202 ? -15.151 3.724    77.292  1.00 48.84  ? 202 TYR A N     1 
ATOM   1305  C  CA    . TYR A  1 202 ? -14.089 4.612    77.748  1.00 48.46  ? 202 TYR A CA    1 
ATOM   1306  C  C     . TYR A  1 202 ? -12.997 4.789    76.687  1.00 47.16  ? 202 TYR A C     1 
ATOM   1307  O  O     . TYR A  1 202 ? -12.718 3.870    75.926  1.00 46.67  ? 202 TYR A O     1 
ATOM   1308  C  CB    . TYR A  1 202 ? -13.538 4.112    79.072  1.00 49.01  ? 202 TYR A CB    1 
ATOM   1309  C  CG    . TYR A  1 202 ? -14.582 4.160    80.162  1.00 50.74  ? 202 TYR A CG    1 
ATOM   1310  C  CD1   . TYR A  1 202 ? -14.672 5.265    81.021  1.00 51.26  ? 202 TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A  1 202 ? -15.509 3.129    80.312  1.00 50.68  ? 202 TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A  1 202 ? -15.629 5.321    82.014  1.00 51.91  ? 202 TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A  1 202 ? -16.477 3.180    81.303  1.00 52.54  ? 202 TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A  1 202 ? -16.528 4.275    82.153  1.00 53.42  ? 202 TYR A CZ    1 
ATOM   1315  O  OH    . TYR A  1 202 ? -17.490 4.323    83.129  1.00 55.73  ? 202 TYR A OH    1 
ATOM   1316  N  N     . CYS A  1 203 ? -12.394 5.971    76.625  1.00 46.82  ? 203 CYS A N     1 
ATOM   1317  C  CA    . CYS A  1 203 ? -11.495 6.306    75.510  1.00 45.91  ? 203 CYS A CA    1 
ATOM   1318  C  C     . CYS A  1 203 ? -10.012 6.539    75.871  1.00 45.61  ? 203 CYS A C     1 
ATOM   1319  O  O     . CYS A  1 203 ? -9.691  7.320    76.775  1.00 46.57  ? 203 CYS A O     1 
ATOM   1320  C  CB    . CYS A  1 203 ? -12.062 7.490    74.727  1.00 45.79  ? 203 CYS A CB    1 
ATOM   1321  S  SG    . CYS A  1 203 ? -13.529 7.056    73.739  1.00 46.89  ? 203 CYS A SG    1 
ATOM   1322  N  N     . VAL A  1 204 ? -9.109  5.854    75.173  1.00 44.26  ? 204 VAL A N     1 
ATOM   1323  C  CA    . VAL A  1 204 ? -7.687  6.042    75.404  1.00 43.56  ? 204 VAL A CA    1 
ATOM   1324  C  C     . VAL A  1 204 ? -7.037  6.495    74.107  1.00 43.02  ? 204 VAL A C     1 
ATOM   1325  O  O     . VAL A  1 204 ? -7.155  5.807    73.097  1.00 43.10  ? 204 VAL A O     1 
ATOM   1326  C  CB    . VAL A  1 204 ? -7.052  4.744    75.865  1.00 43.16  ? 204 VAL A CB    1 
ATOM   1327  C  CG1   . VAL A  1 204 ? -5.546  4.895    76.027  1.00 42.46  ? 204 VAL A CG1   1 
ATOM   1328  C  CG2   . VAL A  1 204 ? -7.680  4.300    77.154  1.00 44.23  ? 204 VAL A CG2   1 
ATOM   1329  N  N     . TYR A  1 205 ? -6.375  7.648    74.112  1.00 42.69  ? 205 TYR A N     1 
ATOM   1330  C  CA    . TYR A  1 205 ? -5.754  8.149    72.890  1.00 42.07  ? 205 TYR A CA    1 
ATOM   1331  C  C     . TYR A  1 205 ? -4.209  8.157    73.010  1.00 41.79  ? 205 TYR A C     1 
ATOM   1332  O  O     . TYR A  1 205 ? -3.640  8.848    73.865  1.00 42.37  ? 205 TYR A O     1 
ATOM   1333  C  CB    . TYR A  1 205 ? -6.309  9.546    72.540  1.00 42.51  ? 205 TYR A CB    1 
ATOM   1334  C  CG    . TYR A  1 205 ? -5.682  10.173   71.313  1.00 42.29  ? 205 TYR A CG    1 
ATOM   1335  C  CD1   . TYR A  1 205 ? -6.200  9.926    70.040  1.00 43.76  ? 205 TYR A CD1   1 
ATOM   1336  C  CD2   . TYR A  1 205 ? -4.568  10.998   71.418  1.00 41.53  ? 205 TYR A CD2   1 
ATOM   1337  C  CE1   . TYR A  1 205 ? -5.616  10.478   68.889  1.00 42.70  ? 205 TYR A CE1   1 
ATOM   1338  C  CE2   . TYR A  1 205 ? -3.986  11.568   70.284  1.00 42.33  ? 205 TYR A CE2   1 
ATOM   1339  C  CZ    . TYR A  1 205 ? -4.516  11.296   69.024  1.00 43.15  ? 205 TYR A CZ    1 
ATOM   1340  O  OH    . TYR A  1 205 ? -3.940  11.834   67.899  1.00 44.50  ? 205 TYR A OH    1 
ATOM   1341  N  N     . VAL A  1 206 ? -3.525  7.407    72.151  1.00 40.55  ? 206 VAL A N     1 
ATOM   1342  C  CA    . VAL A  1 206 ? -2.063  7.405    72.191  1.00 40.06  ? 206 VAL A CA    1 
ATOM   1343  C  C     . VAL A  1 206 ? -1.399  8.263    71.106  1.00 39.58  ? 206 VAL A C     1 
ATOM   1344  O  O     . VAL A  1 206 ? -1.426  7.944    69.903  1.00 38.72  ? 206 VAL A O     1 
ATOM   1345  C  CB    . VAL A  1 206 ? -1.464  5.988    72.175  1.00 39.79  ? 206 VAL A CB    1 
ATOM   1346  C  CG1   . VAL A  1 206 ? -0.019  6.060    72.616  1.00 39.94  ? 206 VAL A CG1   1 
ATOM   1347  C  CG2   . VAL A  1 206 ? -2.238  5.085    73.087  1.00 39.99  ? 206 VAL A CG2   1 
ATOM   1348  N  N     . ALA A  1 207 ? -0.802  9.356    71.562  1.00 39.84  ? 207 ALA A N     1 
ATOM   1349  C  CA    . ALA A  1 207 ? -0.054  10.246   70.703  1.00 39.92  ? 207 ALA A CA    1 
ATOM   1350  C  C     . ALA A  1 207 ? 1.415   9.804    70.672  1.00 39.94  ? 207 ALA A C     1 
ATOM   1351  O  O     . ALA A  1 207 ? 2.186   10.085   71.599  1.00 40.12  ? 207 ALA A O     1 
ATOM   1352  C  CB    . ALA A  1 207 ? -0.181  11.651   71.187  1.00 40.06  ? 207 ALA A CB    1 
ATOM   1353  N  N     . VAL A  1 208 ? 1.793   9.085    69.621  1.00 39.44  ? 208 VAL A N     1 
ATOM   1354  C  CA    . VAL A  1 208 ? 3.191   8.680    69.476  1.00 39.76  ? 208 VAL A CA    1 
ATOM   1355  C  C     . VAL A  1 208 ? 3.910   9.543    68.450  1.00 40.15  ? 208 VAL A C     1 
ATOM   1356  O  O     . VAL A  1 208 ? 3.564   9.535    67.265  1.00 39.84  ? 208 VAL A O     1 
ATOM   1357  C  CB    . VAL A  1 208 ? 3.332   7.208    69.099  1.00 38.80  ? 208 VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1 208 ? 4.791   6.818    68.998  1.00 39.31  ? 208 VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1 208 ? 2.683   6.364    70.133  1.00 39.66  ? 208 VAL A CG2   1 
ATOM   1360  N  N     . GLY A  1 209 ? 4.902   10.294   68.915  1.00 40.80  ? 209 GLY A N     1 
ATOM   1361  C  CA    . GLY A  1 209 ? 5.745   11.070   68.011  1.00 41.72  ? 209 GLY A CA    1 
ATOM   1362  C  C     . GLY A  1 209 ? 5.205   12.411   67.524  1.00 42.62  ? 209 GLY A C     1 
ATOM   1363  O  O     . GLY A  1 209 ? 5.913   13.128   66.814  1.00 43.43  ? 209 GLY A O     1 
ATOM   1364  N  N     . GLN A  1 210 ? 3.970   12.751   67.904  1.00 42.28  ? 210 GLN A N     1 
ATOM   1365  C  CA    . GLN A  1 210 ? 3.348   14.033   67.569  1.00 42.53  ? 210 GLN A CA    1 
ATOM   1366  C  C     . GLN A  1 210 ? 4.005   15.203   68.283  1.00 43.60  ? 210 GLN A C     1 
ATOM   1367  O  O     . GLN A  1 210 ? 4.731   15.015   69.256  1.00 43.75  ? 210 GLN A O     1 
ATOM   1368  C  CB    . GLN A  1 210 ? 1.876   14.004   67.955  1.00 42.16  ? 210 GLN A CB    1 
ATOM   1369  C  CG    . GLN A  1 210 ? 1.127   12.959   67.248  1.00 42.62  ? 210 GLN A CG    1 
ATOM   1370  C  CD    . GLN A  1 210 ? -0.287  12.817   67.723  1.00 45.44  ? 210 GLN A CD    1 
ATOM   1371  O  OE1   . GLN A  1 210 ? -0.869  13.749   68.253  1.00 46.76  ? 210 GLN A OE1   1 
ATOM   1372  N  NE2   . GLN A  1 210 ? -0.869  11.638   67.509  1.00 46.29  ? 210 GLN A NE2   1 
ATOM   1373  N  N     . LYS A  1 211 ? 3.733   16.417   67.817  1.00 44.40  ? 211 LYS A N     1 
ATOM   1374  C  CA    . LYS A  1 211 ? 4.249   17.573   68.497  1.00 45.77  ? 211 LYS A CA    1 
ATOM   1375  C  C     . LYS A  1 211 ? 3.300   17.958   69.621  1.00 46.82  ? 211 LYS A C     1 
ATOM   1376  O  O     . LYS A  1 211 ? 2.101   17.721   69.532  1.00 46.89  ? 211 LYS A O     1 
ATOM   1377  C  CB    . LYS A  1 211 ? 4.512   18.731   67.524  1.00 47.02  ? 211 LYS A CB    1 
ATOM   1378  C  CG    . LYS A  1 211 ? 3.297   19.422   66.962  1.00 47.35  ? 211 LYS A CG    1 
ATOM   1379  C  CD    . LYS A  1 211 ? 3.664   20.601   66.058  1.00 46.50  ? 211 LYS A CD    1 
ATOM   1380  C  CE    . LYS A  1 211 ? 2.401   21.413   65.814  1.00 47.83  ? 211 LYS A CE    1 
ATOM   1381  N  NZ    . LYS A  1 211 ? 2.296   21.951   64.439  1.00 49.56  ? 211 LYS A NZ    1 
ATOM   1382  N  N     . ARG A  1 212 ? 3.848   18.565   70.669  1.00 47.93  ? 212 ARG A N     1 
ATOM   1383  C  CA    . ARG A  1 212 ? 3.122   18.857   71.880  1.00 48.39  ? 212 ARG A CA    1 
ATOM   1384  C  C     . ARG A  1 212 ? 1.960   19.794   71.670  1.00 49.66  ? 212 ARG A C     1 
ATOM   1385  O  O     . ARG A  1 212 ? 0.878   19.574   72.226  1.00 50.10  ? 212 ARG A O     1 
ATOM   1386  C  CB    . ARG A  1 212 ? 4.068   19.433   72.916  1.00 49.63  ? 212 ARG A CB    1 
ATOM   1387  C  CG    . ARG A  1 212 ? 4.827   18.359   73.648  1.00 49.22  ? 212 ARG A CG    1 
ATOM   1388  C  CD    . ARG A  1 212 ? 5.874   18.895   74.604  1.00 49.99  ? 212 ARG A CD    1 
ATOM   1389  N  NE    . ARG A  1 212 ? 6.382   17.782   75.403  1.00 49.73  ? 212 ARG A NE    1 
ATOM   1390  C  CZ    . ARG A  1 212 ? 7.593   17.705   75.935  1.00 48.78  ? 212 ARG A CZ    1 
ATOM   1391  N  NH1   . ARG A  1 212 ? 8.470   18.689   75.773  1.00 49.94  ? 212 ARG A NH1   1 
ATOM   1392  N  NH2   . ARG A  1 212 ? 7.919   16.625   76.627  1.00 48.09  ? 212 ARG A NH2   1 
ATOM   1393  N  N     . SER A  1 213 ? 2.162   20.839   70.875  1.00 50.56  ? 213 SER A N     1 
ATOM   1394  C  CA    . SER A  1 213 ? 1.076   21.768   70.598  1.00 51.48  ? 213 SER A CA    1 
ATOM   1395  C  C     . SER A  1 213 ? -0.048  21.056   69.876  1.00 50.50  ? 213 SER A C     1 
ATOM   1396  O  O     . SER A  1 213 ? -1.207  21.375   70.094  1.00 51.17  ? 213 SER A O     1 
ATOM   1397  C  CB    . SER A  1 213 ? 1.545   22.966   69.786  1.00 52.86  ? 213 SER A CB    1 
ATOM   1398  O  OG    . SER A  1 213 ? 2.089   22.557   68.544  1.00 53.89  ? 213 SER A OG    1 
ATOM   1399  N  N     . THR A  1 214 ? 0.281   20.082   69.027  1.00 49.32  ? 214 THR A N     1 
ATOM   1400  C  CA    . THR A  1 214 ? -0.765  19.224   68.433  1.00 48.35  ? 214 THR A CA    1 
ATOM   1401  C  C     . THR A  1 214 ? -1.525  18.393   69.469  1.00 47.83  ? 214 THR A C     1 
ATOM   1402  O  O     . THR A  1 214 ? -2.723  18.275   69.381  1.00 47.89  ? 214 THR A O     1 
ATOM   1403  C  CB    . THR A  1 214 ? -0.224  18.329   67.302  1.00 47.18  ? 214 THR A CB    1 
ATOM   1404  O  OG1   . THR A  1 214 ? 0.036   19.149   66.159  1.00 48.41  ? 214 THR A OG1   1 
ATOM   1405  C  CG2   . THR A  1 214 ? -1.217  17.257   66.918  1.00 44.97  ? 214 THR A CG2   1 
ATOM   1406  N  N     . VAL A  1 215 ? -0.842  17.831   70.456  1.00 47.90  ? 215 VAL A N     1 
ATOM   1407  C  CA    . VAL A  1 215 ? -1.560  17.122   71.506  1.00 48.11  ? 215 VAL A CA    1 
ATOM   1408  C  C     . VAL A  1 215 ? -2.381  18.114   72.353  1.00 49.59  ? 215 VAL A C     1 
ATOM   1409  O  O     . VAL A  1 215 ? -3.497  17.804   72.758  1.00 50.11  ? 215 VAL A O     1 
ATOM   1410  C  CB    . VAL A  1 215 ? -0.639  16.258   72.396  1.00 47.51  ? 215 VAL A CB    1 
ATOM   1411  C  CG1   . VAL A  1 215 ? -1.476  15.412   73.340  1.00 47.10  ? 215 VAL A CG1   1 
ATOM   1412  C  CG2   . VAL A  1 215 ? 0.206   15.354   71.540  1.00 46.54  ? 215 VAL A CG2   1 
ATOM   1413  N  N     . ALA A  1 216 ? -1.832  19.296   72.590  1.00 50.44  ? 216 ALA A N     1 
ATOM   1414  C  CA    . ALA A  1 216 ? -2.518  20.331   73.338  1.00 52.22  ? 216 ALA A CA    1 
ATOM   1415  C  C     . ALA A  1 216 ? -3.833  20.729   72.693  1.00 52.87  ? 216 ALA A C     1 
ATOM   1416  O  O     . ALA A  1 216 ? -4.833  20.969   73.391  1.00 53.39  ? 216 ALA A O     1 
ATOM   1417  C  CB    . ALA A  1 216 ? -1.622  21.564   73.463  1.00 53.72  ? 216 ALA A CB    1 
ATOM   1418  N  N     . GLN A  1 217 ? -3.826  20.828   71.364  1.00 52.67  ? 217 GLN A N     1 
ATOM   1419  C  CA    . GLN A  1 217 ? -4.985  21.334   70.664  1.00 53.51  ? 217 GLN A CA    1 
ATOM   1420  C  C     . GLN A  1 217 ? -6.011  20.224   70.612  1.00 52.39  ? 217 GLN A C     1 
ATOM   1421  O  O     . GLN A  1 217 ? -7.214  20.481   70.654  1.00 53.78  ? 217 GLN A O     1 
ATOM   1422  C  CB    . GLN A  1 217 ? -4.618  21.889   69.280  1.00 53.96  ? 217 GLN A CB    1 
ATOM   1423  C  CG    . GLN A  1 217 ? -5.804  22.265   68.366  1.00 56.62  ? 217 GLN A CG    1 
ATOM   1424  C  CD    . GLN A  1 217 ? -6.742  23.361   68.941  1.00 61.11  ? 217 GLN A CD    1 
ATOM   1425  O  OE1   . GLN A  1 217 ? -6.308  24.486   69.217  1.00 61.18  ? 217 GLN A OE1   1 
ATOM   1426  N  NE2   . GLN A  1 217 ? -8.046  23.026   69.094  1.00 61.74  ? 217 GLN A NE2   1 
ATOM   1427  N  N     . LEU A  1 218 ? -5.540  18.984   70.563  1.00 50.54  ? 218 LEU A N     1 
ATOM   1428  C  CA    . LEU A  1 218 ? -6.454  17.858   70.578  1.00 49.22  ? 218 LEU A CA    1 
ATOM   1429  C  C     . LEU A  1 218 ? -7.190  17.855   71.895  1.00 49.38  ? 218 LEU A C     1 
ATOM   1430  O  O     . LEU A  1 218 ? -8.410  17.725   71.919  1.00 49.73  ? 218 LEU A O     1 
ATOM   1431  C  CB    . LEU A  1 218 ? -5.740  16.518   70.380  1.00 47.76  ? 218 LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1 218 ? -6.759  15.371   70.406  1.00 47.54  ? 218 LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1 218 ? -6.944  14.844   69.020  1.00 48.25  ? 218 LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1 218 ? -6.377  14.243   71.366  1.00 46.03  ? 218 LEU A CD2   1 
ATOM   1435  N  N     . VAL A  1 219 ? -6.443  18.007   72.982  1.00 49.30  ? 219 VAL A N     1 
ATOM   1436  C  CA    . VAL A  1 219 ? -7.013  17.987   74.322  1.00 49.97  ? 219 VAL A CA    1 
ATOM   1437  C  C     . VAL A  1 219 ? -8.108  19.035   74.425  1.00 51.57  ? 219 VAL A C     1 
ATOM   1438  O  O     . VAL A  1 219 ? -9.227  18.729   74.833  1.00 52.29  ? 219 VAL A O     1 
ATOM   1439  C  CB    . VAL A  1 219 ? -5.930  18.187   75.411  1.00 50.00  ? 219 VAL A CB    1 
ATOM   1440  C  CG1   . VAL A  1 219 ? -6.539  18.577   76.753  1.00 51.50  ? 219 VAL A CG1   1 
ATOM   1441  C  CG2   . VAL A  1 219 ? -5.141  16.928   75.571  1.00 48.70  ? 219 VAL A CG2   1 
ATOM   1442  N  N     . GLN A  1 220 ? -7.787  20.254   74.004  1.00 52.71  ? 220 GLN A N     1 
ATOM   1443  C  CA    . GLN A  1 220 ? -8.716  21.375   74.037  1.00 54.47  ? 220 GLN A CA    1 
ATOM   1444  C  C     . GLN A  1 220 ? -10.017 21.040   73.298  1.00 54.07  ? 220 GLN A C     1 
ATOM   1445  O  O     . GLN A  1 220 ? -11.113 21.387   73.765  1.00 55.35  ? 220 GLN A O     1 
ATOM   1446  C  CB    . GLN A  1 220 ? -8.038  22.627   73.463  1.00 55.58  ? 220 GLN A CB    1 
ATOM   1447  C  CG    . GLN A  1 220 ? -8.903  23.879   73.417  1.00 60.07  ? 220 GLN A CG    1 
ATOM   1448  C  CD    . GLN A  1 220 ? -8.091  25.182   73.274  1.00 65.20  ? 220 GLN A CD    1 
ATOM   1449  O  OE1   . GLN A  1 220 ? -8.192  25.891   72.261  1.00 67.07  ? 220 GLN A OE1   1 
ATOM   1450  N  NE2   . GLN A  1 220 ? -7.299  25.508   74.300  1.00 66.29  ? 220 GLN A NE2   1 
ATOM   1451  N  N     . THR A  1 221 ? -9.897  20.357   72.164  1.00 52.31  ? 221 THR A N     1 
ATOM   1452  C  CA    . THR A  1 221 ? -11.063 19.951   71.390  1.00 52.24  ? 221 THR A CA    1 
ATOM   1453  C  C     . THR A  1 221 ? -11.979 19.031   72.190  1.00 51.78  ? 221 THR A C     1 
ATOM   1454  O  O     . THR A  1 221 ? -13.174 19.298   72.313  1.00 52.40  ? 221 THR A O     1 
ATOM   1455  C  CB    . THR A  1 221 ? -10.631 19.291   70.090  1.00 51.35  ? 221 THR A CB    1 
ATOM   1456  O  OG1   . THR A  1 221 ? -9.923  20.263   69.325  1.00 53.75  ? 221 THR A OG1   1 
ATOM   1457  C  CG2   . THR A  1 221 ? -11.821 18.779   69.285  1.00 50.68  ? 221 THR A CG2   1 
ATOM   1458  N  N     . LEU A  1 222 ? -11.404 17.965   72.742  1.00 50.34  ? 222 LEU A N     1 
ATOM   1459  C  CA    . LEU A  1 222 ? -12.120 17.089   73.640  1.00 49.89  ? 222 LEU A CA    1 
ATOM   1460  C  C     . LEU A  1 222 ? -12.701 17.853   74.826  1.00 51.69  ? 222 LEU A C     1 
ATOM   1461  O  O     . LEU A  1 222 ? -13.871 17.671   75.170  1.00 52.61  ? 222 LEU A O     1 
ATOM   1462  C  CB    . LEU A  1 222 ? -11.199 15.979   74.114  1.00 48.68  ? 222 LEU A CB    1 
ATOM   1463  C  CG    . LEU A  1 222 ? -10.726 15.042   73.007  1.00 46.54  ? 222 LEU A CG    1 
ATOM   1464  C  CD1   . LEU A  1 222 ? -9.656  14.110   73.524  1.00 44.68  ? 222 LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A  1 222 ? -11.893 14.275   72.423  1.00 45.43  ? 222 LEU A CD2   1 
ATOM   1466  N  N     . GLU A  1 223 ? -11.905 18.735   75.433  1.00 52.40  ? 223 GLU A N     1 
ATOM   1467  C  CA    . GLU A  1 223 ? -12.398 19.555   76.541  1.00 54.10  ? 223 GLU A CA    1 
ATOM   1468  C  C     . GLU A  1 223 ? -13.660 20.341   76.137  1.00 54.72  ? 223 GLU A C     1 
ATOM   1469  O  O     . GLU A  1 223 ? -14.643 20.318   76.853  1.00 55.16  ? 223 GLU A O     1 
ATOM   1470  C  CB    . GLU A  1 223 ? -11.286 20.455   77.121  1.00 54.85  ? 223 GLU A CB    1 
ATOM   1471  C  CG    . GLU A  1 223 ? -10.172 19.687   77.870  1.00 56.91  ? 223 GLU A CG    1 
ATOM   1472  C  CD    . GLU A  1 223 ? -9.073  20.574   78.547  1.00 63.52  ? 223 GLU A CD    1 
ATOM   1473  O  OE1   . GLU A  1 223 ? -8.797  21.732   78.104  1.00 66.02  ? 223 GLU A OE1   1 
ATOM   1474  O  OE2   . GLU A  1 223 ? -8.467  20.090   79.544  1.00 64.03  ? 223 GLU A OE2   1 
ATOM   1475  N  N     . GLN A  1 224 ? -13.630 20.988   74.973  1.00 54.94  ? 224 GLN A N     1 
ATOM   1476  C  CA    . GLN A  1 224 ? -14.741 21.825   74.492  1.00 56.87  ? 224 GLN A CA    1 
ATOM   1477  C  C     . GLN A  1 224 ? -16.024 21.046   74.219  1.00 56.45  ? 224 GLN A C     1 
ATOM   1478  O  O     . GLN A  1 224 ? -17.125 21.543   74.451  1.00 57.50  ? 224 GLN A O     1 
ATOM   1479  C  CB    . GLN A  1 224 ? -14.333 22.610   73.242  1.00 57.45  ? 224 GLN A CB    1 
ATOM   1480  C  CG    . GLN A  1 224 ? -13.404 23.807   73.551  1.00 62.80  ? 224 GLN A CG    1 
ATOM   1481  C  CD    . GLN A  1 224 ? -12.684 24.417   72.325  1.00 66.90  ? 224 GLN A CD    1 
ATOM   1482  O  OE1   . GLN A  1 224 ? -12.861 23.974   71.177  1.00 67.48  ? 224 GLN A OE1   1 
ATOM   1483  N  NE2   . GLN A  1 224 ? -11.864 25.447   72.582  1.00 68.56  ? 224 GLN A NE2   1 
ATOM   1484  N  N     . HIS A  1 225 ? -15.873 19.822   73.720  1.00 54.75  ? 225 HIS A N     1 
ATOM   1485  C  CA    . HIS A  1 225 ? -17.005 18.952   73.453  1.00 54.06  ? 225 HIS A CA    1 
ATOM   1486  C  C     . HIS A  1 225 ? -17.321 18.073   74.646  1.00 54.14  ? 225 HIS A C     1 
ATOM   1487  O  O     . HIS A  1 225 ? -18.185 17.211   74.571  1.00 54.14  ? 225 HIS A O     1 
ATOM   1488  C  CB    . HIS A  1 225 ? -16.716 18.094   72.247  1.00 52.39  ? 225 HIS A CB    1 
ATOM   1489  C  CG    . HIS A  1 225 ? -16.735 18.846   70.962  1.00 53.01  ? 225 HIS A CG    1 
ATOM   1490  N  ND1   . HIS A  1 225 ? -15.773 19.772   70.623  1.00 52.90  ? 225 HIS A ND1   1 
ATOM   1491  C  CD2   . HIS A  1 225 ? -17.603 18.811   69.925  1.00 55.18  ? 225 HIS A CD2   1 
ATOM   1492  C  CE1   . HIS A  1 225 ? -16.040 20.272   69.431  1.00 53.75  ? 225 HIS A CE1   1 
ATOM   1493  N  NE2   . HIS A  1 225 ? -17.146 19.703   68.985  1.00 56.27  ? 225 HIS A NE2   1 
ATOM   1494  N  N     . ASP A  1 226 ? -16.608 18.289   75.747  1.00 54.38  ? 226 ASP A N     1 
ATOM   1495  C  CA    . ASP A  1 226 ? -16.897 17.603   76.994  1.00 54.75  ? 226 ASP A CA    1 
ATOM   1496  C  C     . ASP A  1 226 ? -16.679 16.113   76.819  1.00 53.33  ? 226 ASP A C     1 
ATOM   1497  O  O     . ASP A  1 226 ? -17.495 15.307   77.248  1.00 54.22  ? 226 ASP A O     1 
ATOM   1498  C  CB    . ASP A  1 226 ? -18.330 17.927   77.442  1.00 56.29  ? 226 ASP A CB    1 
ATOM   1499  C  CG    . ASP A  1 226 ? -18.692 17.316   78.782  1.00 57.77  ? 226 ASP A CG    1 
ATOM   1500  O  OD1   . ASP A  1 226 ? -17.956 17.489   79.771  1.00 58.62  ? 226 ASP A OD1   1 
ATOM   1501  O  OD2   . ASP A  1 226 ? -19.754 16.671   78.853  1.00 61.66  ? 226 ASP A OD2   1 
ATOM   1502  N  N     . ALA A  1 227 ? -15.576 15.756   76.167  1.00 51.81  ? 227 ALA A N     1 
ATOM   1503  C  CA    . ALA A  1 227 ? -15.198 14.358   75.977  1.00 50.13  ? 227 ALA A CA    1 
ATOM   1504  C  C     . ALA A  1 227 ? -13.992 13.923   76.801  1.00 49.43  ? 227 ALA A C     1 
ATOM   1505  O  O     . ALA A  1 227 ? -13.750 12.715   76.892  1.00 49.02  ? 227 ALA A O     1 
ATOM   1506  C  CB    . ALA A  1 227 ? -14.967 14.050   74.502  1.00 48.82  ? 227 ALA A CB    1 
ATOM   1507  N  N     . MET A  1 228 ? -13.236 14.875   77.381  1.00 49.40  ? 228 MET A N     1 
ATOM   1508  C  CA    . MET A  1 228 ? -12.098 14.532   78.265  1.00 48.81  ? 228 MET A CA    1 
ATOM   1509  C  C     . MET A  1 228 ? -12.508 13.690   79.457  1.00 49.27  ? 228 MET A C     1 
ATOM   1510  O  O     . MET A  1 228 ? -11.711 12.899   79.939  1.00 49.25  ? 228 MET A O     1 
ATOM   1511  C  CB    . MET A  1 228 ? -11.347 15.748   78.798  1.00 49.05  ? 228 MET A CB    1 
ATOM   1512  C  CG    . MET A  1 228 ? -10.174 16.178   77.977  1.00 49.57  ? 228 MET A CG    1 
ATOM   1513  S  SD    . MET A  1 228 ? -8.934  14.914   77.646  1.00 51.27  ? 228 MET A SD    1 
ATOM   1514  C  CE    . MET A  1 228 ? -7.734  15.236   78.927  1.00 51.11  ? 228 MET A CE    1 
ATOM   1515  N  N     . LYS A  1 229 ? -13.741 13.850   79.934  1.00 50.27  ? 229 LYS A N     1 
ATOM   1516  C  CA    . LYS A  1 229 ? -14.162 13.156   81.141  1.00 50.95  ? 229 LYS A CA    1 
ATOM   1517  C  C     . LYS A  1 229 ? -14.125 11.645   81.017  1.00 50.68  ? 229 LYS A C     1 
ATOM   1518  O  O     . LYS A  1 229 ? -14.002 10.944   82.012  1.00 51.76  ? 229 LYS A O     1 
ATOM   1519  C  CB    . LYS A  1 229 ? -15.520 13.640   81.632  1.00 52.24  ? 229 LYS A CB    1 
ATOM   1520  C  CG    . LYS A  1 229 ? -16.685 13.503   80.693  1.00 52.07  ? 229 LYS A CG    1 
ATOM   1521  C  CD    . LYS A  1 229 ? -17.955 13.826   81.449  1.00 53.28  ? 229 LYS A CD    1 
ATOM   1522  C  CE    . LYS A  1 229 ? -19.153 13.930   80.542  1.00 53.15  ? 229 LYS A CE    1 
ATOM   1523  N  NZ    . LYS A  1 229 ? -20.364 14.387   81.315  1.00 53.70  ? 229 LYS A NZ    1 
ATOM   1524  N  N     . TYR A  1 230 ? -14.205 11.136   79.797  1.00 49.47  ? 230 TYR A N     1 
ATOM   1525  C  CA    . TYR A  1 230 ? -14.178 9.710    79.600  1.00 48.80  ? 230 TYR A CA    1 
ATOM   1526  C  C     . TYR A  1 230 ? -12.976 9.259    78.752  1.00 47.68  ? 230 TYR A C     1 
ATOM   1527  O  O     . TYR A  1 230 ? -12.918 8.127    78.251  1.00 46.79  ? 230 TYR A O     1 
ATOM   1528  C  CB    . TYR A  1 230 ? -15.513 9.240    79.028  1.00 49.04  ? 230 TYR A CB    1 
ATOM   1529  C  CG    . TYR A  1 230 ? -15.980 9.898    77.742  1.00 49.03  ? 230 TYR A CG    1 
ATOM   1530  C  CD1   . TYR A  1 230 ? -15.314 9.673    76.534  1.00 48.80  ? 230 TYR A CD1   1 
ATOM   1531  C  CD2   . TYR A  1 230 ? -17.126 10.695   77.718  1.00 50.17  ? 230 TYR A CD2   1 
ATOM   1532  C  CE1   . TYR A  1 230 ? -15.766 10.239   75.344  1.00 49.55  ? 230 TYR A CE1   1 
ATOM   1533  C  CE2   . TYR A  1 230 ? -17.586 11.275   76.535  1.00 50.83  ? 230 TYR A CE2   1 
ATOM   1534  C  CZ    . TYR A  1 230 ? -16.899 11.039   75.352  1.00 51.55  ? 230 TYR A CZ    1 
ATOM   1535  O  OH    . TYR A  1 230 ? -17.330 11.593   74.172  1.00 53.11  ? 230 TYR A OH    1 
ATOM   1536  N  N     . SER A  1 231 ? -12.004 10.151   78.628  1.00 47.49  ? 231 SER A N     1 
ATOM   1537  C  CA    . SER A  1 231 ? -10.833 9.880    77.829  1.00 46.58  ? 231 SER A CA    1 
ATOM   1538  C  C     . SER A  1 231 ? -9.572  9.968    78.662  1.00 46.36  ? 231 SER A C     1 
ATOM   1539  O  O     . SER A  1 231 ? -9.537  10.643   79.671  1.00 47.58  ? 231 SER A O     1 
ATOM   1540  C  CB    . SER A  1 231 ? -10.761 10.861   76.662  1.00 46.41  ? 231 SER A CB    1 
ATOM   1541  O  OG    . SER A  1 231 ? -11.967 10.829   75.918  1.00 47.79  ? 231 SER A OG    1 
ATOM   1542  N  N     . ILE A  1 232 ? -8.546  9.261    78.226  1.00 45.14  ? 232 ILE A N     1 
ATOM   1543  C  CA    . ILE A  1 232 ? -7.246  9.313    78.827  1.00 44.87  ? 232 ILE A CA    1 
ATOM   1544  C  C     . ILE A  1 232 ? -6.298  9.566    77.657  1.00 44.24  ? 232 ILE A C     1 
ATOM   1545  O  O     . ILE A  1 232 ? -6.327  8.838    76.650  1.00 43.22  ? 232 ILE A O     1 
ATOM   1546  C  CB    . ILE A  1 232 ? -6.902  7.964    79.505  1.00 44.97  ? 232 ILE A CB    1 
ATOM   1547  C  CG1   . ILE A  1 232 ? -7.793  7.714    80.721  1.00 45.70  ? 232 ILE A CG1   1 
ATOM   1548  C  CG2   . ILE A  1 232 ? -5.425  7.893    79.908  1.00 44.41  ? 232 ILE A CG2   1 
ATOM   1549  C  CD1   . ILE A  1 232 ? -7.946  6.236    81.061  1.00 44.51  ? 232 ILE A CD1   1 
ATOM   1550  N  N     . ILE A  1 233 ? -5.469  10.592   77.778  1.00 44.22  ? 233 ILE A N     1 
ATOM   1551  C  CA    . ILE A  1 233 ? -4.490  10.852   76.761  1.00 44.21  ? 233 ILE A CA    1 
ATOM   1552  C  C     . ILE A  1 233 ? -3.121  10.355   77.238  1.00 44.57  ? 233 ILE A C     1 
ATOM   1553  O  O     . ILE A  1 233 ? -2.624  10.791   78.285  1.00 45.64  ? 233 ILE A O     1 
ATOM   1554  C  CB    . ILE A  1 233 ? -4.425  12.353   76.402  1.00 45.02  ? 233 ILE A CB    1 
ATOM   1555  C  CG1   . ILE A  1 233 ? -5.829  12.933   76.202  1.00 46.05  ? 233 ILE A CG1   1 
ATOM   1556  C  CG2   . ILE A  1 233 ? -3.548  12.597   75.159  1.00 43.70  ? 233 ILE A CG2   1 
ATOM   1557  C  CD1   . ILE A  1 233 ? -6.592  12.336   75.051  1.00 46.67  ? 233 ILE A CD1   1 
ATOM   1558  N  N     . VAL A  1 234 ? -2.526  9.436    76.480  1.00 43.39  ? 234 VAL A N     1 
ATOM   1559  C  CA    . VAL A  1 234 ? -1.190  8.950    76.783  1.00 43.66  ? 234 VAL A CA    1 
ATOM   1560  C  C     . VAL A  1 234 ? -0.223  9.461    75.721  1.00 43.69  ? 234 VAL A C     1 
ATOM   1561  O  O     . VAL A  1 234 ? -0.305  9.071    74.560  1.00 43.73  ? 234 VAL A O     1 
ATOM   1562  C  CB    . VAL A  1 234 ? -1.145  7.410    76.891  1.00 43.10  ? 234 VAL A CB    1 
ATOM   1563  C  CG1   . VAL A  1 234 ? 0.287   6.913    76.999  1.00 42.65  ? 234 VAL A CG1   1 
ATOM   1564  C  CG2   . VAL A  1 234 ? -1.950  6.955    78.090  1.00 43.08  ? 234 VAL A CG2   1 
ATOM   1565  N  N     . ALA A  1 235 ? 0.697   10.324   76.127  1.00 44.37  ? 235 ALA A N     1 
ATOM   1566  C  CA    . ALA A  1 235 ? 1.471   11.112   75.185  1.00 44.28  ? 235 ALA A CA    1 
ATOM   1567  C  C     . ALA A  1 235 ? 2.970   10.808   75.223  1.00 44.44  ? 235 ALA A C     1 
ATOM   1568  O  O     . ALA A  1 235 ? 3.631   11.021   76.235  1.00 45.44  ? 235 ALA A O     1 
ATOM   1569  C  CB    . ALA A  1 235 ? 1.232   12.614   75.458  1.00 44.82  ? 235 ALA A CB    1 
ATOM   1570  N  N     . ALA A  1 236 ? 3.520   10.334   74.114  1.00 43.88  ? 236 ALA A N     1 
ATOM   1571  C  CA    . ALA A  1 236 ? 4.982   10.304   73.974  1.00 43.98  ? 236 ALA A CA    1 
ATOM   1572  C  C     . ALA A  1 236 ? 5.413   11.098   72.729  1.00 43.86  ? 236 ALA A C     1 
ATOM   1573  O  O     . ALA A  1 236 ? 5.544   10.543   71.628  1.00 43.13  ? 236 ALA A O     1 
ATOM   1574  C  CB    . ALA A  1 236 ? 5.480   8.892    73.935  1.00 43.22  ? 236 ALA A CB    1 
ATOM   1575  N  N     . THR A  1 237 ? 5.604   12.402   72.914  1.00 44.48  ? 237 THR A N     1 
ATOM   1576  C  CA    . THR A  1 237 ? 5.692   13.330   71.794  1.00 44.61  ? 237 THR A CA    1 
ATOM   1577  C  C     . THR A  1 237 ? 7.079   13.313   71.132  1.00 44.59  ? 237 THR A C     1 
ATOM   1578  O  O     . THR A  1 237 ? 7.945   12.563   71.561  1.00 44.47  ? 237 THR A O     1 
ATOM   1579  C  CB    . THR A  1 237 ? 5.269   14.750   72.225  1.00 45.88  ? 237 THR A CB    1 
ATOM   1580  O  OG1   . THR A  1 237 ? 6.112   15.212   73.283  1.00 48.09  ? 237 THR A OG1   1 
ATOM   1581  C  CG2   . THR A  1 237 ? 3.855   14.761   72.708  1.00 45.40  ? 237 THR A CG2   1 
ATOM   1582  N  N     . ALA A  1 238 ? 7.280   14.149   70.107  1.00 44.74  ? 238 ALA A N     1 
ATOM   1583  C  CA    . ALA A  1 238 ? 8.439   14.077   69.184  1.00 44.67  ? 238 ALA A CA    1 
ATOM   1584  C  C     . ALA A  1 238 ? 9.852   14.284   69.765  1.00 45.68  ? 238 ALA A C     1 
ATOM   1585  O  O     . ALA A  1 238 ? 10.847  13.885   69.155  1.00 45.82  ? 238 ALA A O     1 
ATOM   1586  C  CB    . ALA A  1 238 ? 8.224   15.029   68.008  1.00 44.82  ? 238 ALA A CB    1 
ATOM   1587  N  N     . SER A  1 239 ? 9.932   14.925   70.921  1.00 46.54  ? 239 SER A N     1 
ATOM   1588  C  CA    . SER A  1 239 ? 11.190  15.293   71.491  1.00 47.65  ? 239 SER A CA    1 
ATOM   1589  C  C     . SER A  1 239 ? 11.546  14.297   72.558  1.00 47.50  ? 239 SER A C     1 
ATOM   1590  O  O     . SER A  1 239 ? 12.614  14.375   73.149  1.00 49.48  ? 239 SER A O     1 
ATOM   1591  C  CB    . SER A  1 239 ? 11.102  16.701   72.092  1.00 49.82  ? 239 SER A CB    1 
ATOM   1592  O  OG    . SER A  1 239 ? 10.831  16.700   73.502  1.00 51.36  ? 239 SER A OG    1 
ATOM   1593  N  N     . GLU A  1 240 ? 10.661  13.353   72.812  1.00 46.24  ? 240 GLU A N     1 
ATOM   1594  C  CA    . GLU A  1 240 ? 10.864  12.417   73.900  1.00 46.48  ? 240 GLU A CA    1 
ATOM   1595  C  C     . GLU A  1 240 ? 11.702  11.224   73.465  1.00 46.13  ? 240 GLU A C     1 
ATOM   1596  O  O     . GLU A  1 240 ? 11.558  10.730   72.342  1.00 45.74  ? 240 GLU A O     1 
ATOM   1597  C  CB    . GLU A  1 240 ? 9.520   11.960   74.474  1.00 46.06  ? 240 GLU A CB    1 
ATOM   1598  C  CG    . GLU A  1 240 ? 8.669   13.107   74.986  1.00 46.78  ? 240 GLU A CG    1 
ATOM   1599  C  CD    . GLU A  1 240 ? 7.794   12.702   76.142  1.00 49.30  ? 240 GLU A CD    1 
ATOM   1600  O  OE1   . GLU A  1 240 ? 6.544   12.716   75.975  1.00 50.45  ? 240 GLU A OE1   1 
ATOM   1601  O  OE2   . GLU A  1 240 ? 8.354   12.369   77.216  1.00 49.58  ? 240 GLU A OE2   1 
ATOM   1602  N  N     . ALA A  1 241 ? 12.562  10.757   74.362  1.00 46.68  ? 241 ALA A N     1 
ATOM   1603  C  CA    . ALA A  1 241 ? 13.444  9.638    74.084  1.00 46.84  ? 241 ALA A CA    1 
ATOM   1604  C  C     . ALA A  1 241 ? 12.715  8.469    73.411  1.00 45.62  ? 241 ALA A C     1 
ATOM   1605  O  O     . ALA A  1 241 ? 11.560  8.193    73.719  1.00 45.94  ? 241 ALA A O     1 
ATOM   1606  C  CB    . ALA A  1 241 ? 14.127  9.185    75.376  1.00 48.18  ? 241 ALA A CB    1 
ATOM   1607  N  N     . ALA A  1 242 ? 13.395  7.783    72.497  1.00 45.01  ? 242 ALA A N     1 
ATOM   1608  C  CA    . ALA A  1 242 ? 12.775  6.711    71.706  1.00 43.50  ? 242 ALA A CA    1 
ATOM   1609  C  C     . ALA A  1 242 ? 12.094  5.625    72.540  1.00 43.19  ? 242 ALA A C     1 
ATOM   1610  O  O     . ALA A  1 242 ? 11.000  5.170    72.166  1.00 42.76  ? 242 ALA A O     1 
ATOM   1611  C  CB    . ALA A  1 242 ? 13.771  6.106    70.737  1.00 42.90  ? 242 ALA A CB    1 
ATOM   1612  N  N     . PRO A  1 243 ? 12.708  5.212    73.674  1.00 43.53  ? 243 PRO A N     1 
ATOM   1613  C  CA    . PRO A  1 243 ? 12.051  4.162    74.441  1.00 43.52  ? 243 PRO A CA    1 
ATOM   1614  C  C     . PRO A  1 243 ? 10.642  4.534    74.847  1.00 43.52  ? 243 PRO A C     1 
ATOM   1615  O  O     . PRO A  1 243 ? 9.753   3.682    74.818  1.00 43.91  ? 243 PRO A O     1 
ATOM   1616  C  CB    . PRO A  1 243 ? 12.928  4.032    75.683  1.00 44.62  ? 243 PRO A CB    1 
ATOM   1617  C  CG    . PRO A  1 243 ? 14.235  4.459    75.253  1.00 44.54  ? 243 PRO A CG    1 
ATOM   1618  C  CD    . PRO A  1 243 ? 14.001  5.568    74.276  1.00 44.32  ? 243 PRO A CD    1 
ATOM   1619  N  N     . LEU A  1 244 ? 10.423  5.792    75.207  1.00 43.70  ? 244 LEU A N     1 
ATOM   1620  C  CA    . LEU A  1 244 ? 9.116   6.181    75.707  1.00 43.58  ? 244 LEU A CA    1 
ATOM   1621  C  C     . LEU A  1 244 ? 8.073   6.160    74.594  1.00 42.90  ? 244 LEU A C     1 
ATOM   1622  O  O     . LEU A  1 244 ? 6.934   5.752    74.817  1.00 42.81  ? 244 LEU A O     1 
ATOM   1623  C  CB    . LEU A  1 244 ? 9.166   7.534    76.431  1.00 44.31  ? 244 LEU A CB    1 
ATOM   1624  C  CG    . LEU A  1 244 ? 10.129  7.650    77.626  1.00 44.34  ? 244 LEU A CG    1 
ATOM   1625  C  CD1   . LEU A  1 244 ? 10.404  9.115    77.925  1.00 43.32  ? 244 LEU A CD1   1 
ATOM   1626  C  CD2   . LEU A  1 244 ? 9.624   6.918    78.865  1.00 42.86  ? 244 LEU A CD2   1 
ATOM   1627  N  N     . GLN A  1 245 ? 8.467   6.559    73.389  1.00 42.54  ? 245 GLN A N     1 
ATOM   1628  C  CA    . GLN A  1 245 ? 7.578   6.421    72.243  1.00 41.56  ? 245 GLN A CA    1 
ATOM   1629  C  C     . GLN A  1 245 ? 7.334   4.943    71.979  1.00 41.67  ? 245 GLN A C     1 
ATOM   1630  O  O     . GLN A  1 245 ? 6.202   4.521    71.723  1.00 41.91  ? 245 GLN A O     1 
ATOM   1631  C  CB    . GLN A  1 245 ? 8.141   7.133    71.021  1.00 40.89  ? 245 GLN A CB    1 
ATOM   1632  C  CG    . GLN A  1 245 ? 8.450   8.602    71.286  1.00 41.94  ? 245 GLN A CG    1 
ATOM   1633  C  CD    . GLN A  1 245 ? 8.793   9.361    70.038  1.00 42.05  ? 245 GLN A CD    1 
ATOM   1634  O  OE1   . GLN A  1 245 ? 8.135   9.182    69.015  1.00 41.86  ? 245 GLN A OE1   1 
ATOM   1635  N  NE2   . GLN A  1 245 ? 9.819   10.227   70.106  1.00 41.94  ? 245 GLN A NE2   1 
ATOM   1636  N  N     . TYR A  1 246 ? 8.384   4.139    72.071  1.00 42.30  ? 246 TYR A N     1 
ATOM   1637  C  CA    . TYR A  1 246 ? 8.236   2.695    71.911  1.00 42.30  ? 246 TYR A CA    1 
ATOM   1638  C  C     . TYR A  1 246 ? 7.255   2.093    72.916  1.00 42.12  ? 246 TYR A C     1 
ATOM   1639  O  O     . TYR A  1 246 ? 6.352   1.364    72.547  1.00 41.73  ? 246 TYR A O     1 
ATOM   1640  C  CB    . TYR A  1 246 ? 9.606   2.039    72.023  1.00 43.20  ? 246 TYR A CB    1 
ATOM   1641  C  CG    . TYR A  1 246 ? 9.608   0.670    72.634  1.00 44.96  ? 246 TYR A CG    1 
ATOM   1642  C  CD1   . TYR A  1 246 ? 9.140   -0.445   71.931  1.00 45.64  ? 246 TYR A CD1   1 
ATOM   1643  C  CD2   . TYR A  1 246 ? 10.095  0.483    73.916  1.00 47.54  ? 246 TYR A CD2   1 
ATOM   1644  C  CE1   . TYR A  1 246 ? 9.153   -1.707   72.510  1.00 47.01  ? 246 TYR A CE1   1 
ATOM   1645  C  CE2   . TYR A  1 246 ? 10.123  -0.771   74.498  1.00 49.03  ? 246 TYR A CE2   1 
ATOM   1646  C  CZ    . TYR A  1 246 ? 9.659   -1.860   73.792  1.00 49.33  ? 246 TYR A CZ    1 
ATOM   1647  O  OH    . TYR A  1 246 ? 9.700   -3.098   74.405  1.00 53.05  ? 246 TYR A OH    1 
ATOM   1648  N  N     . LEU A  1 247 ? 7.440   2.422    74.183  1.00 42.82  ? 247 LEU A N     1 
ATOM   1649  C  CA    . LEU A  1 247 ? 6.603   1.923    75.263  1.00 43.25  ? 247 LEU A CA    1 
ATOM   1650  C  C     . LEU A  1 247 ? 5.169   2.443    75.299  1.00 42.97  ? 247 LEU A C     1 
ATOM   1651  O  O     . LEU A  1 247 ? 4.273   1.731    75.724  1.00 43.69  ? 247 LEU A O     1 
ATOM   1652  C  CB    . LEU A  1 247 ? 7.236   2.307    76.590  1.00 44.47  ? 247 LEU A CB    1 
ATOM   1653  C  CG    . LEU A  1 247 ? 8.429   1.532    77.095  1.00 44.89  ? 247 LEU A CG    1 
ATOM   1654  C  CD1   . LEU A  1 247 ? 9.053   2.396    78.135  1.00 45.77  ? 247 LEU A CD1   1 
ATOM   1655  C  CD2   . LEU A  1 247 ? 7.991   0.183    77.659  1.00 45.84  ? 247 LEU A CD2   1 
ATOM   1656  N  N     . ALA A  1 248 ? 4.956   3.692    74.895  1.00 42.60  ? 248 ALA A N     1 
ATOM   1657  C  CA    . ALA A  1 248 ? 3.675   4.363    75.101  1.00 42.32  ? 248 ALA A CA    1 
ATOM   1658  C  C     . ALA A  1 248 ? 2.444   3.530    74.716  1.00 41.89  ? 248 ALA A C     1 
ATOM   1659  O  O     . ALA A  1 248 ? 1.530   3.393    75.525  1.00 42.44  ? 248 ALA A O     1 
ATOM   1660  C  CB    . ALA A  1 248 ? 3.665   5.735    74.444  1.00 41.70  ? 248 ALA A CB    1 
ATOM   1661  N  N     . PRO A  1 249 ? 2.425   2.954    73.505  1.00 41.32  ? 249 PRO A N     1 
ATOM   1662  C  CA    . PRO A  1 249 ? 1.295   2.087    73.146  1.00 41.52  ? 249 PRO A CA    1 
ATOM   1663  C  C     . PRO A  1 249 ? 0.988   0.950    74.123  1.00 42.36  ? 249 PRO A C     1 
ATOM   1664  O  O     . PRO A  1 249 ? -0.169  0.766    74.464  1.00 43.28  ? 249 PRO A O     1 
ATOM   1665  C  CB    . PRO A  1 249 ? 1.719   1.510    71.795  1.00 40.85  ? 249 PRO A CB    1 
ATOM   1666  C  CG    . PRO A  1 249 ? 2.544   2.570    71.204  1.00 40.87  ? 249 PRO A CG    1 
ATOM   1667  C  CD    . PRO A  1 249 ? 3.286   3.229    72.340  1.00 40.56  ? 249 PRO A CD    1 
ATOM   1668  N  N     . PHE A  1 250 ? 1.998   0.195    74.562  1.00 42.91  ? 250 PHE A N     1 
ATOM   1669  C  CA    . PHE A  1 250 ? 1.781   -1.005   75.403  1.00 43.52  ? 250 PHE A CA    1 
ATOM   1670  C  C     . PHE A  1 250 ? 1.251   -0.547   76.717  1.00 44.40  ? 250 PHE A C     1 
ATOM   1671  O  O     . PHE A  1 250 ? 0.359   -1.144   77.304  1.00 45.48  ? 250 PHE A O     1 
ATOM   1672  C  CB    . PHE A  1 250 ? 3.092   -1.776   75.623  1.00 43.90  ? 250 PHE A CB    1 
ATOM   1673  C  CG    . PHE A  1 250 ? 3.729   -2.238   74.355  1.00 42.02  ? 250 PHE A CG    1 
ATOM   1674  C  CD1   . PHE A  1 250 ? 3.294   -3.391   73.729  1.00 41.90  ? 250 PHE A CD1   1 
ATOM   1675  C  CD2   . PHE A  1 250 ? 4.715   -1.497   73.757  1.00 40.34  ? 250 PHE A CD2   1 
ATOM   1676  C  CE1   . PHE A  1 250 ? 3.847   -3.817   72.535  1.00 39.33  ? 250 PHE A CE1   1 
ATOM   1677  C  CE2   . PHE A  1 250 ? 5.277   -1.923   72.564  1.00 41.01  ? 250 PHE A CE2   1 
ATOM   1678  C  CZ    . PHE A  1 250 ? 4.826   -3.091   71.951  1.00 39.02  ? 250 PHE A CZ    1 
ATOM   1679  N  N     . THR A  1 251 ? 1.811   0.569    77.141  1.00 44.70  ? 251 THR A N     1 
ATOM   1680  C  CA    . THR A  1 251 ? 1.491   1.233    78.381  1.00 45.54  ? 251 THR A CA    1 
ATOM   1681  C  C     . THR A  1 251 ? 0.044   1.758    78.382  1.00 45.33  ? 251 THR A C     1 
ATOM   1682  O  O     . THR A  1 251 ? -0.691  1.546    79.346  1.00 46.31  ? 251 THR A O     1 
ATOM   1683  C  CB    . THR A  1 251 ? 2.594   2.289    78.632  1.00 45.53  ? 251 THR A CB    1 
ATOM   1684  O  OG1   . THR A  1 251 ? 3.448   1.797    79.662  1.00 47.07  ? 251 THR A OG1   1 
ATOM   1685  C  CG2   . THR A  1 251 ? 2.062   3.612    79.034  1.00 46.45  ? 251 THR A CG2   1 
ATOM   1686  N  N     . ALA A  1 252 ? -0.354  2.397    77.283  1.00 44.13  ? 252 ALA A N     1 
ATOM   1687  C  CA    . ALA A  1 252 ? -1.721  2.819    77.069  1.00 44.07  ? 252 ALA A CA    1 
ATOM   1688  C  C     . ALA A  1 252 ? -2.634  1.603    77.020  1.00 44.59  ? 252 ALA A C     1 
ATOM   1689  O  O     . ALA A  1 252 ? -3.748  1.617    77.568  1.00 45.12  ? 252 ALA A O     1 
ATOM   1690  C  CB    . ALA A  1 252 ? -1.821  3.580    75.785  1.00 43.15  ? 252 ALA A CB    1 
ATOM   1691  N  N     . ALA A  1 253 ? -2.154  0.548    76.367  1.00 44.41  ? 253 ALA A N     1 
ATOM   1692  C  CA    . ALA A  1 253 ? -2.909  -0.686   76.267  1.00 45.03  ? 253 ALA A CA    1 
ATOM   1693  C  C     . ALA A  1 253 ? -3.325  -1.206   77.653  1.00 46.41  ? 253 ALA A C     1 
ATOM   1694  O  O     . ALA A  1 253 ? -4.483  -1.574   77.858  1.00 46.63  ? 253 ALA A O     1 
ATOM   1695  C  CB    . ALA A  1 253 ? -2.120  -1.737   75.492  1.00 44.58  ? 253 ALA A CB    1 
ATOM   1696  N  N     . SER A  1 254 ? -2.385  -1.217   78.598  1.00 46.92  ? 254 SER A N     1 
ATOM   1697  C  CA    . SER A  1 254 ? -2.666  -1.733   79.931  1.00 48.34  ? 254 SER A CA    1 
ATOM   1698  C  C     . SER A  1 254 ? -3.667  -0.854   80.635  1.00 49.08  ? 254 SER A C     1 
ATOM   1699  O  O     . SER A  1 254 ? -4.586  -1.353   81.292  1.00 50.41  ? 254 SER A O     1 
ATOM   1700  C  CB    . SER A  1 254 ? -1.394  -1.820   80.739  1.00 48.76  ? 254 SER A CB    1 
ATOM   1701  O  OG    . SER A  1 254 ? -0.489  -2.646   80.043  1.00 48.95  ? 254 SER A OG    1 
ATOM   1702  N  N     . ILE A  1 255 ? -3.498  0.457    80.477  1.00 48.30  ? 255 ILE A N     1 
ATOM   1703  C  CA    . ILE A  1 255 ? -4.505  1.410    80.925  1.00 48.49  ? 255 ILE A CA    1 
ATOM   1704  C  C     . ILE A  1 255 ? -5.888  1.044    80.353  1.00 48.35  ? 255 ILE A C     1 
ATOM   1705  O  O     . ILE A  1 255 ? -6.864  0.990    81.084  1.00 49.70  ? 255 ILE A O     1 
ATOM   1706  C  CB    . ILE A  1 255 ? -4.074  2.855    80.612  1.00 47.77  ? 255 ILE A CB    1 
ATOM   1707  C  CG1   . ILE A  1 255 ? -2.857  3.214    81.473  1.00 48.04  ? 255 ILE A CG1   1 
ATOM   1708  C  CG2   . ILE A  1 255 ? -5.201  3.817    80.873  1.00 48.13  ? 255 ILE A CG2   1 
ATOM   1709  C  CD1   . ILE A  1 255 ? -2.185  4.511    81.128  1.00 46.92  ? 255 ILE A CD1   1 
ATOM   1710  N  N     . GLY A  1 256 ? -5.957  0.740    79.063  1.00 47.31  ? 256 GLY A N     1 
ATOM   1711  C  CA    . GLY A  1 256 ? -7.201  0.290    78.460  1.00 47.02  ? 256 GLY A CA    1 
ATOM   1712  C  C     . GLY A  1 256 ? -7.718  -0.995   79.066  1.00 48.08  ? 256 GLY A C     1 
ATOM   1713  O  O     . GLY A  1 256 ? -8.929  -1.150   79.310  1.00 49.27  ? 256 GLY A O     1 
ATOM   1714  N  N     . GLU A  1 257 ? -6.792  -1.909   79.344  1.00 48.16  ? 257 GLU A N     1 
ATOM   1715  C  CA    . GLU A  1 257 ? -7.130  -3.251   79.812  1.00 48.70  ? 257 GLU A CA    1 
ATOM   1716  C  C     . GLU A  1 257 ? -7.811  -3.301   81.158  1.00 50.09  ? 257 GLU A C     1 
ATOM   1717  O  O     . GLU A  1 257 ? -8.513  -4.279   81.429  1.00 51.47  ? 257 GLU A O     1 
ATOM   1718  C  CB    . GLU A  1 257 ? -5.905  -4.131   79.870  1.00 48.71  ? 257 GLU A CB    1 
ATOM   1719  C  CG    . GLU A  1 257 ? -5.546  -4.769   78.578  1.00 48.27  ? 257 GLU A CG    1 
ATOM   1720  C  CD    . GLU A  1 257 ? -4.097  -5.244   78.545  1.00 50.38  ? 257 GLU A CD    1 
ATOM   1721  O  OE1   . GLU A  1 257 ? -3.347  -5.084   79.546  1.00 50.51  ? 257 GLU A OE1   1 
ATOM   1722  O  OE2   . GLU A  1 257 ? -3.703  -5.806   77.498  1.00 52.25  ? 257 GLU A OE2   1 
ATOM   1723  N  N     . TRP A  1 258 ? -7.611  -2.279   81.999  1.00 49.93  ? 258 TRP A N     1 
ATOM   1724  C  CA    . TRP A  1 258 ? -8.304  -2.233   83.290  1.00 51.20  ? 258 TRP A CA    1 
ATOM   1725  C  C     . TRP A  1 258 ? -9.801  -2.247   83.044  1.00 51.75  ? 258 TRP A C     1 
ATOM   1726  O  O     . TRP A  1 258 ? -10.559 -2.908   83.753  1.00 52.86  ? 258 TRP A O     1 
ATOM   1727  C  CB    . TRP A  1 258 ? -7.928  -1.010   84.137  1.00 51.43  ? 258 TRP A CB    1 
ATOM   1728  C  CG    . TRP A  1 258 ? -8.708  -0.979   85.433  1.00 52.68  ? 258 TRP A CG    1 
ATOM   1729  C  CD1   . TRP A  1 258 ? -8.339  -1.534   86.626  1.00 53.44  ? 258 TRP A CD1   1 
ATOM   1730  C  CD2   . TRP A  1 258 ? -10.006 -0.397   85.649  1.00 52.56  ? 258 TRP A CD2   1 
ATOM   1731  N  NE1   . TRP A  1 258 ? -9.320  -1.330   87.572  1.00 53.70  ? 258 TRP A NE1   1 
ATOM   1732  C  CE2   . TRP A  1 258 ? -10.353 -0.637   86.998  1.00 53.30  ? 258 TRP A CE2   1 
ATOM   1733  C  CE3   . TRP A  1 258 ? -10.909 0.301    84.832  1.00 51.21  ? 258 TRP A CE3   1 
ATOM   1734  C  CZ2   . TRP A  1 258 ? -11.558 -0.202   87.548  1.00 53.77  ? 258 TRP A CZ2   1 
ATOM   1735  C  CZ3   . TRP A  1 258 ? -12.111 0.728    85.383  1.00 51.86  ? 258 TRP A CZ3   1 
ATOM   1736  C  CH2   . TRP A  1 258 ? -12.421 0.477    86.730  1.00 53.20  ? 258 TRP A CH2   1 
ATOM   1737  N  N     . PHE A  1 259 ? -10.223 -1.513   82.026  1.00 50.93  ? 259 PHE A N     1 
ATOM   1738  C  CA    . PHE A  1 259 ? -11.629 -1.468   81.688  1.00 51.65  ? 259 PHE A CA    1 
ATOM   1739  C  C     . PHE A  1 259 ? -12.113 -2.848   81.214  1.00 52.54  ? 259 PHE A C     1 
ATOM   1740  O  O     . PHE A  1 259 ? -13.061 -3.404   81.778  1.00 53.80  ? 259 PHE A O     1 
ATOM   1741  C  CB    . PHE A  1 259 ? -11.884 -0.344   80.682  1.00 50.37  ? 259 PHE A CB    1 
ATOM   1742  C  CG    . PHE A  1 259 ? -11.538 1.022    81.218  1.00 49.34  ? 259 PHE A CG    1 
ATOM   1743  C  CD1   . PHE A  1 259 ? -12.474 1.755    81.949  1.00 50.02  ? 259 PHE A CD1   1 
ATOM   1744  C  CD2   . PHE A  1 259 ? -10.278 1.564    81.018  1.00 47.19  ? 259 PHE A CD2   1 
ATOM   1745  C  CE1   . PHE A  1 259 ? -12.162 3.004    82.465  1.00 48.92  ? 259 PHE A CE1   1 
ATOM   1746  C  CE2   . PHE A  1 259 ? -9.964  2.820    81.525  1.00 47.34  ? 259 PHE A CE2   1 
ATOM   1747  C  CZ    . PHE A  1 259 ? -10.912 3.540    82.257  1.00 47.91  ? 259 PHE A CZ    1 
ATOM   1748  N  N     . ARG A  1 260 ? -11.414 -3.413   80.228  1.00 51.87  ? 260 ARG A N     1 
ATOM   1749  C  CA    . ARG A  1 260 ? -11.717 -4.736   79.702  1.00 52.43  ? 260 ARG A CA    1 
ATOM   1750  C  C     . ARG A  1 260 ? -11.778 -5.791   80.790  1.00 54.53  ? 260 ARG A C     1 
ATOM   1751  O  O     . ARG A  1 260 ? -12.716 -6.579   80.818  1.00 56.30  ? 260 ARG A O     1 
ATOM   1752  C  CB    . ARG A  1 260 ? -10.670 -5.125   78.677  1.00 51.22  ? 260 ARG A CB    1 
ATOM   1753  C  CG    . ARG A  1 260 ? -10.916 -6.408   77.921  1.00 50.58  ? 260 ARG A CG    1 
ATOM   1754  C  CD    . ARG A  1 260 ? -9.618  -6.813   77.260  1.00 48.89  ? 260 ARG A CD    1 
ATOM   1755  N  NE    . ARG A  1 260 ? -8.710  -7.334   78.267  1.00 49.89  ? 260 ARG A NE    1 
ATOM   1756  C  CZ    . ARG A  1 260 ? -7.467  -7.732   78.049  1.00 50.46  ? 260 ARG A CZ    1 
ATOM   1757  N  NH1   . ARG A  1 260 ? -6.915  -7.669   76.849  1.00 50.55  ? 260 ARG A NH1   1 
ATOM   1758  N  NH2   . ARG A  1 260 ? -6.765  -8.187   79.061  1.00 53.27  ? 260 ARG A NH2   1 
ATOM   1759  N  N     . ASP A  1 261 ? -10.798 -5.810   81.693  1.00 55.14  ? 261 ASP A N     1 
ATOM   1760  C  CA    . ASP A  1 261 ? -10.753 -6.858   82.734  1.00 57.24  ? 261 ASP A CA    1 
ATOM   1761  C  C     . ASP A  1 261 ? -11.839 -6.727   83.808  1.00 58.65  ? 261 ASP A C     1 
ATOM   1762  O  O     . ASP A  1 261 ? -12.027 -7.641   84.599  1.00 60.72  ? 261 ASP A O     1 
ATOM   1763  C  CB    . ASP A  1 261 ? -9.372  -6.944   83.393  1.00 57.29  ? 261 ASP A CB    1 
ATOM   1764  C  CG    . ASP A  1 261 ? -8.267  -7.311   82.409  1.00 58.22  ? 261 ASP A CG    1 
ATOM   1765  O  OD1   . ASP A  1 261 ? -8.535  -7.477   81.191  1.00 57.49  ? 261 ASP A OD1   1 
ATOM   1766  O  OD2   . ASP A  1 261 ? -7.101  -7.435   82.856  1.00 62.02  ? 261 ASP A OD2   1 
ATOM   1767  N  N     . ASN A  1 262 ? -12.552 -5.602   83.815  1.00 58.03  ? 262 ASN A N     1 
ATOM   1768  C  CA    . ASN A  1 262 ? -13.530 -5.291   84.851  1.00 58.97  ? 262 ASN A CA    1 
ATOM   1769  C  C     . ASN A  1 262 ? -14.945 -5.048   84.333  1.00 58.95  ? 262 ASN A C     1 
ATOM   1770  O  O     . ASN A  1 262 ? -15.679 -4.224   84.880  1.00 59.95  ? 262 ASN A O     1 
ATOM   1771  C  CB    . ASN A  1 262 ? -13.061 -4.081   85.661  1.00 58.89  ? 262 ASN A CB    1 
ATOM   1772  C  CG    . ASN A  1 262 ? -11.884 -4.401   86.547  1.00 59.38  ? 262 ASN A CG    1 
ATOM   1773  O  OD1   . ASN A  1 262 ? -12.033 -5.012   87.603  1.00 61.34  ? 262 ASN A OD1   1 
ATOM   1774  N  ND2   . ASN A  1 262 ? -10.703 -3.986   86.127  1.00 58.88  ? 262 ASN A ND2   1 
ATOM   1775  N  N     . GLY A  1 263 ? -15.325 -5.771   83.286  1.00 58.12  ? 263 GLY A N     1 
ATOM   1776  C  CA    . GLY A  1 263 ? -16.691 -5.734   82.777  1.00 57.78  ? 263 GLY A CA    1 
ATOM   1777  C  C     . GLY A  1 263 ? -17.046 -4.480   82.009  1.00 56.27  ? 263 GLY A C     1 
ATOM   1778  O  O     . GLY A  1 263 ? -18.216 -4.188   81.832  1.00 57.54  ? 263 GLY A O     1 
ATOM   1779  N  N     . LYS A  1 264 ? -16.051 -3.730   81.550  1.00 54.30  ? 264 LYS A N     1 
ATOM   1780  C  CA    . LYS A  1 264 ? -16.311 -2.486   80.817  1.00 53.00  ? 264 LYS A CA    1 
ATOM   1781  C  C     . LYS A  1 264 ? -15.708 -2.504   79.414  1.00 51.12  ? 264 LYS A C     1 
ATOM   1782  O  O     . LYS A  1 264 ? -15.217 -3.530   78.955  1.00 51.09  ? 264 LYS A O     1 
ATOM   1783  C  CB    . LYS A  1 264 ? -15.818 -1.260   81.597  1.00 52.91  ? 264 LYS A CB    1 
ATOM   1784  C  CG    . LYS A  1 264 ? -15.814 -1.434   83.094  1.00 54.62  ? 264 LYS A CG    1 
ATOM   1785  C  CD    . LYS A  1 264 ? -16.033 -0.144   83.816  1.00 55.44  ? 264 LYS A CD    1 
ATOM   1786  C  CE    . LYS A  1 264 ? -16.323 -0.411   85.284  1.00 57.74  ? 264 LYS A CE    1 
ATOM   1787  N  NZ    . LYS A  1 264 ? -16.909 0.804    85.902  1.00 59.63  ? 264 LYS A NZ    1 
ATOM   1788  N  N     . HIS A  1 265 ? -15.759 -1.364   78.732  1.00 49.80  ? 265 HIS A N     1 
ATOM   1789  C  CA    . HIS A  1 265 ? -15.348 -1.287   77.342  1.00 48.31  ? 265 HIS A CA    1 
ATOM   1790  C  C     . HIS A  1 265 ? -14.502 -0.054   77.064  1.00 47.08  ? 265 HIS A C     1 
ATOM   1791  O  O     . HIS A  1 265 ? -14.976 1.072    77.210  1.00 47.50  ? 265 HIS A O     1 
ATOM   1792  C  CB    . HIS A  1 265 ? -16.571 -1.314   76.442  1.00 48.25  ? 265 HIS A CB    1 
ATOM   1793  C  CG    . HIS A  1 265 ? -17.499 -2.434   76.753  1.00 50.22  ? 265 HIS A CG    1 
ATOM   1794  N  ND1   . HIS A  1 265 ? -17.258 -3.728   76.351  1.00 52.18  ? 265 HIS A ND1   1 
ATOM   1795  C  CD2   . HIS A  1 265 ? -18.654 -2.467   77.459  1.00 51.76  ? 265 HIS A CD2   1 
ATOM   1796  C  CE1   . HIS A  1 265 ? -18.237 -4.507   76.781  1.00 53.25  ? 265 HIS A CE1   1 
ATOM   1797  N  NE2   . HIS A  1 265 ? -19.097 -3.765   77.455  1.00 52.10  ? 265 HIS A NE2   1 
ATOM   1798  N  N     . ALA A  1 266 ? -13.254 -0.278   76.665  1.00 45.78  ? 266 ALA A N     1 
ATOM   1799  C  CA    . ALA A  1 266 ? -12.335 0.810    76.368  1.00 44.98  ? 266 ALA A CA    1 
ATOM   1800  C  C     . ALA A  1 266 ? -12.044 0.821    74.882  1.00 44.36  ? 266 ALA A C     1 
ATOM   1801  O  O     . ALA A  1 266 ? -12.002 -0.238   74.242  1.00 44.93  ? 266 ALA A O     1 
ATOM   1802  C  CB    . ALA A  1 266 ? -11.043 0.684    77.178  1.00 43.77  ? 266 ALA A CB    1 
ATOM   1803  N  N     . LEU A  1 267 ? -11.867 2.014    74.329  1.00 43.88  ? 267 LEU A N     1 
ATOM   1804  C  CA    . LEU A  1 267 ? -11.406 2.162    72.963  1.00 43.29  ? 267 LEU A CA    1 
ATOM   1805  C  C     . LEU A  1 267 ? -10.031 2.802    73.020  1.00 43.30  ? 267 LEU A C     1 
ATOM   1806  O  O     . LEU A  1 267 ? -9.813  3.780    73.757  1.00 44.47  ? 267 LEU A O     1 
ATOM   1807  C  CB    . LEU A  1 267 ? -12.363 3.035    72.177  1.00 42.98  ? 267 LEU A CB    1 
ATOM   1808  C  CG    . LEU A  1 267 ? -12.014 3.507    70.773  1.00 42.36  ? 267 LEU A CG    1 
ATOM   1809  C  CD1   . LEU A  1 267 ? -12.259 2.439    69.726  1.00 41.01  ? 267 LEU A CD1   1 
ATOM   1810  C  CD2   . LEU A  1 267 ? -12.829 4.763    70.453  1.00 42.38  ? 267 LEU A CD2   1 
ATOM   1811  N  N     . ILE A  1 268 ? -9.097  2.236    72.271  1.00 42.51  ? 268 ILE A N     1 
ATOM   1812  C  CA    . ILE A  1 268 ? -7.750  2.745    72.246  1.00 41.94  ? 268 ILE A CA    1 
ATOM   1813  C  C     . ILE A  1 268 ? -7.391  3.133    70.825  1.00 41.63  ? 268 ILE A C     1 
ATOM   1814  O  O     . ILE A  1 268 ? -7.568  2.335    69.901  1.00 41.93  ? 268 ILE A O     1 
ATOM   1815  C  CB    . ILE A  1 268 ? -6.736  1.721    72.856  1.00 42.30  ? 268 ILE A CB    1 
ATOM   1816  C  CG1   . ILE A  1 268 ? -5.386  2.387    73.110  1.00 41.80  ? 268 ILE A CG1   1 
ATOM   1817  C  CG2   . ILE A  1 268 ? -6.606  0.413    72.013  1.00 40.92  ? 268 ILE A CG2   1 
ATOM   1818  C  CD1   . ILE A  1 268 ? -4.617  1.724    74.202  1.00 43.03  ? 268 ILE A CD1   1 
ATOM   1819  N  N     . VAL A  1 269 ? -6.925  4.368    70.654  1.00 41.14  ? 269 VAL A N     1 
ATOM   1820  C  CA    . VAL A  1 269 ? -6.466  4.874    69.364  1.00 40.26  ? 269 VAL A CA    1 
ATOM   1821  C  C     . VAL A  1 269 ? -4.935  5.007    69.396  1.00 40.05  ? 269 VAL A C     1 
ATOM   1822  O  O     . VAL A  1 269 ? -4.406  5.663    70.283  1.00 40.54  ? 269 VAL A O     1 
ATOM   1823  C  CB    . VAL A  1 269 ? -7.060  6.265    69.084  1.00 40.45  ? 269 VAL A CB    1 
ATOM   1824  C  CG1   . VAL A  1 269 ? -6.494  6.839    67.785  1.00 39.71  ? 269 VAL A CG1   1 
ATOM   1825  C  CG2   . VAL A  1 269 ? -8.569  6.230    69.070  1.00 39.53  ? 269 VAL A CG2   1 
ATOM   1826  N  N     . TYR A  1 270 ? -4.217  4.380    68.465  1.00 39.72  ? 270 TYR A N     1 
ATOM   1827  C  CA    . TYR A  1 270 ? -2.743  4.460    68.486  1.00 39.54  ? 270 TYR A CA    1 
ATOM   1828  C  C     . TYR A  1 270 ? -2.294  5.289    67.317  1.00 39.98  ? 270 TYR A C     1 
ATOM   1829  O  O     . TYR A  1 270 ? -2.107  4.746    66.203  1.00 39.58  ? 270 TYR A O     1 
ATOM   1830  C  CB    . TYR A  1 270 ? -2.069  3.107    68.336  1.00 38.77  ? 270 TYR A CB    1 
ATOM   1831  C  CG    . TYR A  1 270 ? -2.444  2.066    69.342  1.00 39.64  ? 270 TYR A CG    1 
ATOM   1832  C  CD1   . TYR A  1 270 ? -2.042  2.182    70.663  1.00 39.32  ? 270 TYR A CD1   1 
ATOM   1833  C  CD2   . TYR A  1 270 ? -3.179  0.923    68.958  1.00 40.40  ? 270 TYR A CD2   1 
ATOM   1834  C  CE1   . TYR A  1 270 ? -2.363  1.213    71.584  1.00 40.08  ? 270 TYR A CE1   1 
ATOM   1835  C  CE2   . TYR A  1 270 ? -3.508  -0.058   69.878  1.00 39.57  ? 270 TYR A CE2   1 
ATOM   1836  C  CZ    . TYR A  1 270 ? -3.096  0.102    71.192  1.00 40.78  ? 270 TYR A CZ    1 
ATOM   1837  O  OH    . TYR A  1 270 ? -3.402  -0.847   72.130  1.00 43.01  ? 270 TYR A OH    1 
ATOM   1838  N  N     . ASP A  1 271 ? -2.095  6.582    67.590  1.00 40.29  ? 271 ASP A N     1 
ATOM   1839  C  CA    . ASP A  1 271 ? -1.887  7.593    66.580  1.00 40.59  ? 271 ASP A CA    1 
ATOM   1840  C  C     . ASP A  1 271 ? -0.460  8.102    66.743  1.00 41.05  ? 271 ASP A C     1 
ATOM   1841  O  O     . ASP A  1 271 ? -0.229  9.126    67.416  1.00 41.85  ? 271 ASP A O     1 
ATOM   1842  C  CB    . ASP A  1 271 ? -2.892  8.732    66.809  1.00 41.27  ? 271 ASP A CB    1 
ATOM   1843  C  CG    . ASP A  1 271 ? -3.181  9.555    65.549  1.00 42.04  ? 271 ASP A CG    1 
ATOM   1844  O  OD1   . ASP A  1 271 ? -2.563  9.305    64.490  1.00 44.26  ? 271 ASP A OD1   1 
ATOM   1845  O  OD2   . ASP A  1 271 ? -4.032  10.466   65.618  1.00 39.93  ? 271 ASP A OD2   1 
ATOM   1846  N  N     . ASP A  1 272 ? 0.514   7.415    66.143  1.00 40.37  ? 272 ASP A N     1 
ATOM   1847  C  CA    . ASP A  1 272 ? 0.280   6.324    65.247  1.00 40.53  ? 272 ASP A CA    1 
ATOM   1848  C  C     . ASP A  1 272 ? 1.416   5.298    65.274  1.00 40.17  ? 272 ASP A C     1 
ATOM   1849  O  O     . ASP A  1 272 ? 2.455   5.511    65.891  1.00 40.36  ? 272 ASP A O     1 
ATOM   1850  C  CB    . ASP A  1 272 ? 0.010   6.837    63.832  1.00 41.06  ? 272 ASP A CB    1 
ATOM   1851  C  CG    . ASP A  1 272 ? 1.193   7.547    63.233  1.00 43.40  ? 272 ASP A CG    1 
ATOM   1852  O  OD1   . ASP A  1 272 ? 2.298   6.969    63.291  1.00 43.86  ? 272 ASP A OD1   1 
ATOM   1853  O  OD2   . ASP A  1 272 ? 1.006   8.671    62.687  1.00 46.35  ? 272 ASP A OD2   1 
ATOM   1854  N  N     . LEU A  1 273 ? 1.195   4.174    64.605  1.00 39.74  ? 273 LEU A N     1 
ATOM   1855  C  CA    . LEU A  1 273 ? 2.067   3.033    64.744  1.00 39.43  ? 273 LEU A CA    1 
ATOM   1856  C  C     . LEU A  1 273 ? 3.272   3.127    63.792  1.00 39.88  ? 273 LEU A C     1 
ATOM   1857  O  O     . LEU A  1 273 ? 4.293   2.446    63.970  1.00 40.55  ? 273 LEU A O     1 
ATOM   1858  C  CB    . LEU A  1 273 ? 1.262   1.741    64.549  1.00 38.91  ? 273 LEU A CB    1 
ATOM   1859  C  CG    . LEU A  1 273 ? 0.375   1.308    65.714  1.00 37.25  ? 273 LEU A CG    1 
ATOM   1860  C  CD1   . LEU A  1 273 ? -0.134  -0.075   65.449  1.00 34.69  ? 273 LEU A CD1   1 
ATOM   1861  C  CD2   . LEU A  1 273 ? 1.111   1.348    67.059  1.00 36.44  ? 273 LEU A CD2   1 
ATOM   1862  N  N     . SER A  1 274 ? 3.146   3.987    62.791  1.00 39.89  ? 274 SER A N     1 
ATOM   1863  C  CA    . SER A  1 274 ? 4.233   4.295    61.897  1.00 40.01  ? 274 SER A CA    1 
ATOM   1864  C  C     . SER A  1 274 ? 5.378   4.877    62.713  1.00 40.19  ? 274 SER A C     1 
ATOM   1865  O  O     . SER A  1 274 ? 6.503   4.364    62.702  1.00 40.61  ? 274 SER A O     1 
ATOM   1866  C  CB    . SER A  1 274 ? 3.752   5.308    60.883  1.00 40.41  ? 274 SER A CB    1 
ATOM   1867  O  OG    . SER A  1 274 ? 2.670   4.777    60.148  1.00 41.17  ? 274 SER A OG    1 
ATOM   1868  N  N     . LYS A  1 275 ? 5.061   5.917    63.463  1.00 39.81  ? 275 LYS A N     1 
ATOM   1869  C  CA    . LYS A  1 275 ? 5.998   6.550    64.329  1.00 39.96  ? 275 LYS A CA    1 
ATOM   1870  C  C     . LYS A  1 275 ? 6.531   5.655    65.441  1.00 40.11  ? 275 LYS A C     1 
ATOM   1871  O  O     . LYS A  1 275 ? 7.712   5.725    65.747  1.00 40.65  ? 275 LYS A O     1 
ATOM   1872  C  CB    . LYS A  1 275 ? 5.391   7.827    64.875  1.00 40.56  ? 275 LYS A CB    1 
ATOM   1873  C  CG    . LYS A  1 275 ? 5.327   8.942    63.835  1.00 41.49  ? 275 LYS A CG    1 
ATOM   1874  C  CD    . LYS A  1 275 ? 4.501   10.113   64.307  1.00 45.03  ? 275 LYS A CD    1 
ATOM   1875  C  CE    . LYS A  1 275 ? 4.479   11.255   63.276  1.00 47.15  ? 275 LYS A CE    1 
ATOM   1876  N  NZ    . LYS A  1 275 ? 3.549   10.929   62.124  1.00 50.00  ? 275 LYS A NZ    1 
ATOM   1877  N  N     . GLN A  1 276 ? 5.702   4.795    66.023  1.00 39.96  ? 276 GLN A N     1 
ATOM   1878  C  CA    . GLN A  1 276 ? 6.214   3.814    67.002  1.00 40.26  ? 276 GLN A CA    1 
ATOM   1879  C  C     . GLN A  1 276 ? 7.216   2.831    66.393  1.00 40.30  ? 276 GLN A C     1 
ATOM   1880  O  O     . GLN A  1 276 ? 8.231   2.504    67.019  1.00 41.13  ? 276 GLN A O     1 
ATOM   1881  C  CB    . GLN A  1 276 ? 5.094   3.023    67.695  1.00 40.00  ? 276 GLN A CB    1 
ATOM   1882  C  CG    . GLN A  1 276 ? 5.583   2.251    68.929  1.00 40.67  ? 276 GLN A CG    1 
ATOM   1883  C  CD    . GLN A  1 276 ? 4.861   0.914    69.126  1.00 42.02  ? 276 GLN A CD    1 
ATOM   1884  O  OE1   . GLN A  1 276 ? 4.145   0.458    68.235  1.00 44.49  ? 276 GLN A OE1   1 
ATOM   1885  N  NE2   . GLN A  1 276 ? 5.039   0.287    70.299  1.00 39.82  ? 276 GLN A NE2   1 
ATOM   1886  N  N     . ALA A  1 277 ? 6.941   2.341    65.187  1.00 39.88  ? 277 ALA A N     1 
ATOM   1887  C  CA    . ALA A  1 277 ? 7.911   1.468    64.506  1.00 39.78  ? 277 ALA A CA    1 
ATOM   1888  C  C     . ALA A  1 277 ? 9.251   2.182    64.227  1.00 39.96  ? 277 ALA A C     1 
ATOM   1889  O  O     . ALA A  1 277 ? 10.312  1.576    64.270  1.00 40.62  ? 277 ALA A O     1 
ATOM   1890  C  CB    . ALA A  1 277 ? 7.329   0.922    63.253  1.00 39.45  ? 277 ALA A CB    1 
ATOM   1891  N  N     . VAL A  1 278 ? 9.190   3.480    63.964  1.00 39.96  ? 278 VAL A N     1 
ATOM   1892  C  CA    . VAL A  1 278 ? 10.402  4.286    63.772  1.00 40.19  ? 278 VAL A CA    1 
ATOM   1893  C  C     . VAL A  1 278 ? 11.236  4.341    65.048  1.00 40.67  ? 278 VAL A C     1 
ATOM   1894  O  O     . VAL A  1 278 ? 12.442  4.108    64.999  1.00 41.91  ? 278 VAL A O     1 
ATOM   1895  C  CB    . VAL A  1 278 ? 10.081  5.694    63.157  1.00 40.00  ? 278 VAL A CB    1 
ATOM   1896  C  CG1   . VAL A  1 278 ? 11.183  6.658    63.396  1.00 38.81  ? 278 VAL A CG1   1 
ATOM   1897  C  CG2   . VAL A  1 278 ? 9.805   5.552    61.653  1.00 39.00  ? 278 VAL A CG2   1 
ATOM   1898  N  N     . ALA A  1 279 ? 10.579  4.594    66.179  1.00 40.66  ? 279 ALA A N     1 
ATOM   1899  C  CA    . ALA A  1 279 ? 11.218  4.616    67.499  1.00 41.21  ? 279 ALA A CA    1 
ATOM   1900  C  C     . ALA A  1 279 ? 11.917  3.286    67.821  1.00 41.78  ? 279 ALA A C     1 
ATOM   1901  O  O     . ALA A  1 279 ? 13.078  3.265    68.237  1.00 42.43  ? 279 ALA A O     1 
ATOM   1902  C  CB    . ALA A  1 279 ? 10.185  4.941    68.567  1.00 40.49  ? 279 ALA A CB    1 
ATOM   1903  N  N     . TYR A  1 280 ? 11.217  2.174    67.608  1.00 41.38  ? 280 TYR A N     1 
ATOM   1904  C  CA    . TYR A  1 280 ? 11.785  0.882    67.928  1.00 41.74  ? 280 TYR A CA    1 
ATOM   1905  C  C     . TYR A  1 280 ? 12.968  0.592    67.027  1.00 42.33  ? 280 TYR A C     1 
ATOM   1906  O  O     . TYR A  1 280 ? 13.928  -0.066   67.456  1.00 43.80  ? 280 TYR A O     1 
ATOM   1907  C  CB    . TYR A  1 280 ? 10.747  -0.223   67.793  1.00 41.35  ? 280 TYR A CB    1 
ATOM   1908  C  CG    . TYR A  1 280 ? 11.191  -1.544   68.372  1.00 41.09  ? 280 TYR A CG    1 
ATOM   1909  C  CD1   . TYR A  1 280 ? 11.354  -1.710   69.747  1.00 41.41  ? 280 TYR A CD1   1 
ATOM   1910  C  CD2   . TYR A  1 280 ? 11.418  -2.632   67.550  1.00 41.66  ? 280 TYR A CD2   1 
ATOM   1911  C  CE1   . TYR A  1 280 ? 11.744  -2.931   70.291  1.00 42.27  ? 280 TYR A CE1   1 
ATOM   1912  C  CE2   . TYR A  1 280 ? 11.808  -3.856   68.073  1.00 43.13  ? 280 TYR A CE2   1 
ATOM   1913  C  CZ    . TYR A  1 280 ? 11.973  -3.999   69.444  1.00 43.56  ? 280 TYR A CZ    1 
ATOM   1914  O  OH    . TYR A  1 280 ? 12.378  -5.214   69.934  1.00 43.83  ? 280 TYR A OH    1 
ATOM   1915  N  N     . ARG A  1 281 ? 12.907  1.081    65.785  1.00 41.34  ? 281 ARG A N     1 
ATOM   1916  C  CA    . ARG A  1 281 ? 14.001  0.895    64.858  1.00 41.03  ? 281 ARG A CA    1 
ATOM   1917  C  C     . ARG A  1 281 ? 15.227  1.668    65.330  1.00 41.87  ? 281 ARG A C     1 
ATOM   1918  O  O     . ARG A  1 281 ? 16.356  1.202    65.202  1.00 42.54  ? 281 ARG A O     1 
ATOM   1919  C  CB    . ARG A  1 281 ? 13.607  1.311    63.447  1.00 40.68  ? 281 ARG A CB    1 
ATOM   1920  C  CG    . ARG A  1 281 ? 14.700  0.995    62.420  1.00 41.01  ? 281 ARG A CG    1 
ATOM   1921  C  CD    . ARG A  1 281 ? 14.354  1.388    61.012  1.00 40.75  ? 281 ARG A CD    1 
ATOM   1922  N  NE    . ARG A  1 281 ? 13.910  2.774    60.956  1.00 42.22  ? 281 ARG A NE    1 
ATOM   1923  C  CZ    . ARG A  1 281 ? 13.352  3.342    59.895  1.00 42.51  ? 281 ARG A CZ    1 
ATOM   1924  N  NH1   . ARG A  1 281 ? 13.178  2.658    58.770  1.00 43.61  ? 281 ARG A NH1   1 
ATOM   1925  N  NH2   . ARG A  1 281 ? 12.972  4.603    59.961  1.00 43.04  ? 281 ARG A NH2   1 
ATOM   1926  N  N     . GLN A  1 282 ? 15.012  2.853    65.882  1.00 41.75  ? 282 GLN A N     1 
ATOM   1927  C  CA    . GLN A  1 282 ? 16.121  3.594    66.441  1.00 42.51  ? 282 GLN A CA    1 
ATOM   1928  C  C     . GLN A  1 282 ? 16.855  2.778    67.504  1.00 43.29  ? 282 GLN A C     1 
ATOM   1929  O  O     . GLN A  1 282 ? 18.084  2.597    67.403  1.00 43.81  ? 282 GLN A O     1 
ATOM   1930  C  CB    . GLN A  1 282 ? 15.641  4.910    67.031  1.00 42.63  ? 282 GLN A CB    1 
ATOM   1931  C  CG    . GLN A  1 282 ? 16.769  5.783    67.461  1.00 43.75  ? 282 GLN A CG    1 
ATOM   1932  C  CD    . GLN A  1 282 ? 16.312  7.107    67.961  1.00 44.52  ? 282 GLN A CD    1 
ATOM   1933  O  OE1   . GLN A  1 282 ? 15.555  7.795    67.299  1.00 46.25  ? 282 GLN A OE1   1 
ATOM   1934  N  NE2   . GLN A  1 282 ? 16.786  7.491    69.127  1.00 46.65  ? 282 GLN A NE2   1 
ATOM   1935  N  N     . LEU A  1 283 ? 16.111  2.315    68.520  1.00 42.87  ? 283 LEU A N     1 
ATOM   1936  C  CA    . LEU A  1 283 ? 16.670  1.479    69.592  1.00 43.67  ? 283 LEU A CA    1 
ATOM   1937  C  C     . LEU A  1 283 ? 17.443  0.296    69.019  1.00 43.91  ? 283 LEU A C     1 
ATOM   1938  O  O     . LEU A  1 283 ? 18.597  0.076    69.394  1.00 45.26  ? 283 LEU A O     1 
ATOM   1939  C  CB    . LEU A  1 283 ? 15.578  0.945    70.544  1.00 43.61  ? 283 LEU A CB    1 
ATOM   1940  C  CG    . LEU A  1 283 ? 14.598  1.966    71.116  1.00 44.33  ? 283 LEU A CG    1 
ATOM   1941  C  CD1   . LEU A  1 283 ? 13.416  1.324    71.874  1.00 42.72  ? 283 LEU A CD1   1 
ATOM   1942  C  CD2   . LEU A  1 283 ? 15.352  2.991    71.969  1.00 45.29  ? 283 LEU A CD2   1 
ATOM   1943  N  N     . SER A  1 284 ? 16.817  -0.459   68.115  1.00 42.63  ? 284 SER A N     1 
ATOM   1944  C  CA    . SER A  1 284 ? 17.427  -1.685   67.623  1.00 42.99  ? 284 SER A CA    1 
ATOM   1945  C  C     . SER A  1 284 ? 18.695  -1.450   66.831  1.00 43.34  ? 284 SER A C     1 
ATOM   1946  O  O     . SER A  1 284 ? 19.670  -2.175   67.008  1.00 44.74  ? 284 SER A O     1 
ATOM   1947  C  CB    . SER A  1 284 ? 16.446  -2.490   66.795  1.00 42.72  ? 284 SER A CB    1 
ATOM   1948  O  OG    . SER A  1 284 ? 15.264  -2.708   67.537  1.00 43.34  ? 284 SER A OG    1 
ATOM   1949  N  N     . LEU A  1 285 ? 18.692  -0.444   65.964  1.00 42.60  ? 285 LEU A N     1 
ATOM   1950  C  CA    . LEU A  1 285 ? 19.883  -0.099   65.202  1.00 43.17  ? 285 LEU A CA    1 
ATOM   1951  C  C     . LEU A  1 285 ? 21.028  0.359    66.123  1.00 44.44  ? 285 LEU A C     1 
ATOM   1952  O  O     . LEU A  1 285 ? 22.215  0.024    65.906  1.00 44.96  ? 285 LEU A O     1 
ATOM   1953  C  CB    . LEU A  1 285 ? 19.560  0.967    64.153  1.00 42.71  ? 285 LEU A CB    1 
ATOM   1954  C  CG    . LEU A  1 285 ? 18.622  0.529    63.028  1.00 42.23  ? 285 LEU A CG    1 
ATOM   1955  C  CD1   . LEU A  1 285 ? 18.127  1.704    62.184  1.00 41.00  ? 285 LEU A CD1   1 
ATOM   1956  C  CD2   . LEU A  1 285 ? 19.304  -0.500   62.167  1.00 43.15  ? 285 LEU A CD2   1 
ATOM   1957  N  N     . LEU A  1 286 ? 20.670  1.112    67.160  1.00 44.31  ? 286 LEU A N     1 
ATOM   1958  C  CA    . LEU A  1 286 ? 21.680  1.600    68.082  1.00 45.46  ? 286 LEU A CA    1 
ATOM   1959  C  C     . LEU A  1 286 ? 22.146  0.553    69.078  1.00 46.09  ? 286 LEU A C     1 
ATOM   1960  O  O     . LEU A  1 286 ? 23.257  0.675    69.598  1.00 47.76  ? 286 LEU A O     1 
ATOM   1961  C  CB    . LEU A  1 286 ? 21.240  2.889    68.775  1.00 45.46  ? 286 LEU A CB    1 
ATOM   1962  C  CG    . LEU A  1 286 ? 21.073  4.069    67.821  1.00 44.89  ? 286 LEU A CG    1 
ATOM   1963  C  CD1   . LEU A  1 286 ? 20.073  5.028    68.419  1.00 45.75  ? 286 LEU A CD1   1 
ATOM   1964  C  CD2   . LEU A  1 286 ? 22.392  4.756    67.497  1.00 43.61  ? 286 LEU A CD2   1 
ATOM   1965  N  N     . LEU A  1 287 ? 21.329  -0.475   69.324  1.00 44.99  ? 287 LEU A N     1 
ATOM   1966  C  CA    . LEU A  1 287 ? 21.772  -1.656   70.082  1.00 45.52  ? 287 LEU A CA    1 
ATOM   1967  C  C     . LEU A  1 287 ? 22.483  -2.684   69.196  1.00 46.22  ? 287 LEU A C     1 
ATOM   1968  O  O     . LEU A  1 287 ? 22.926  -3.750   69.657  1.00 46.54  ? 287 LEU A O     1 
ATOM   1969  C  CB    . LEU A  1 287 ? 20.600  -2.311   70.787  1.00 44.76  ? 287 LEU A CB    1 
ATOM   1970  C  CG    . LEU A  1 287 ? 20.029  -1.546   71.968  1.00 44.38  ? 287 LEU A CG    1 
ATOM   1971  C  CD1   . LEU A  1 287 ? 18.603  -2.034   72.249  1.00 41.97  ? 287 LEU A CD1   1 
ATOM   1972  C  CD2   . LEU A  1 287 ? 20.941  -1.699   73.154  1.00 43.17  ? 287 LEU A CD2   1 
ATOM   1973  N  N     . ARG A  1 288 ? 22.575  -2.348   67.914  1.00 46.17  ? 288 ARG A N     1 
ATOM   1974  C  CA    . ARG A  1 288 ? 23.264  -3.159   66.919  1.00 47.16  ? 288 ARG A CA    1 
ATOM   1975  C  C     . ARG A  1 288 ? 22.675  -4.537   66.695  1.00 46.92  ? 288 ARG A C     1 
ATOM   1976  O  O     . ARG A  1 288 ? 23.397  -5.463   66.316  1.00 48.31  ? 288 ARG A O     1 
ATOM   1977  C  CB    . ARG A  1 288 ? 24.739  -3.288   67.232  1.00 48.44  ? 288 ARG A CB    1 
ATOM   1978  C  CG    . ARG A  1 288 ? 25.483  -2.021   67.055  1.00 50.70  ? 288 ARG A CG    1 
ATOM   1979  C  CD    . ARG A  1 288 ? 26.862  -2.215   67.577  1.00 58.00  ? 288 ARG A CD    1 
ATOM   1980  N  NE    . ARG A  1 288 ? 27.691  -1.041   67.368  1.00 64.06  ? 288 ARG A NE    1 
ATOM   1981  C  CZ    . ARG A  1 288 ? 28.043  -0.574   66.174  1.00 66.30  ? 288 ARG A CZ    1 
ATOM   1982  N  NH1   . ARG A  1 288 ? 27.613  -1.174   65.060  1.00 64.92  ? 288 ARG A NH1   1 
ATOM   1983  N  NH2   . ARG A  1 288 ? 28.823  0.505    66.106  1.00 67.86  ? 288 ARG A NH2   1 
ATOM   1984  N  N     . ARG A  1 289 ? 21.375  -4.666   66.911  1.00 45.22  ? 289 ARG A N     1 
ATOM   1985  C  CA    . ARG A  1 289 ? 20.658  -5.859   66.517  1.00 44.80  ? 289 ARG A CA    1 
ATOM   1986  C  C     . ARG A  1 289 ? 20.624  -5.860   65.000  1.00 44.61  ? 289 ARG A C     1 
ATOM   1987  O  O     . ARG A  1 289 ? 20.749  -4.793   64.404  1.00 44.57  ? 289 ARG A O     1 
ATOM   1988  C  CB    . ARG A  1 289 ? 19.243  -5.825   67.083  1.00 43.60  ? 289 ARG A CB    1 
ATOM   1989  C  CG    . ARG A  1 289 ? 19.249  -5.564   68.549  1.00 42.53  ? 289 ARG A CG    1 
ATOM   1990  C  CD    . ARG A  1 289 ? 17.956  -5.861   69.130  1.00 42.28  ? 289 ARG A CD    1 
ATOM   1991  N  NE    . ARG A  1 289 ? 18.038  -5.828   70.582  1.00 44.06  ? 289 ARG A NE    1 
ATOM   1992  C  CZ    . ARG A  1 289 ? 16.989  -5.965   71.388  1.00 42.09  ? 289 ARG A CZ    1 
ATOM   1993  N  NH1   . ARG A  1 289 ? 15.786  -6.155   70.873  1.00 40.02  ? 289 ARG A NH1   1 
ATOM   1994  N  NH2   . ARG A  1 289 ? 17.150  -5.917   72.705  1.00 41.86  ? 289 ARG A NH2   1 
ATOM   1995  N  N     . PRO A  1 290 ? 20.459  -7.043   64.368  1.00 44.56  ? 290 PRO A N     1 
ATOM   1996  C  CA    . PRO A  1 290 ? 20.513  -7.107   62.908  1.00 44.69  ? 290 PRO A CA    1 
ATOM   1997  C  C     . PRO A  1 290 ? 19.368  -6.362   62.221  1.00 44.12  ? 290 PRO A C     1 
ATOM   1998  O  O     . PRO A  1 290 ? 18.219  -6.466   62.646  1.00 44.17  ? 290 PRO A O     1 
ATOM   1999  C  CB    . PRO A  1 290 ? 20.435  -8.607   62.608  1.00 45.27  ? 290 PRO A CB    1 
ATOM   2000  C  CG    . PRO A  1 290 ? 20.701  -9.282   63.877  1.00 45.36  ? 290 PRO A CG    1 
ATOM   2001  C  CD    . PRO A  1 290 ? 20.292  -8.374   64.967  1.00 44.69  ? 290 PRO A CD    1 
ATOM   2002  N  N     . PRO A  1 291 ? 19.680  -5.592   61.170  1.00 44.42  ? 291 PRO A N     1 
ATOM   2003  C  CA    . PRO A  1 291 ? 18.613  -4.921   60.431  1.00 43.67  ? 291 PRO A CA    1 
ATOM   2004  C  C     . PRO A  1 291 ? 18.044  -5.737   59.266  1.00 43.81  ? 291 PRO A C     1 
ATOM   2005  O  O     . PRO A  1 291 ? 18.727  -6.522   58.655  1.00 45.17  ? 291 PRO A O     1 
ATOM   2006  C  CB    . PRO A  1 291 ? 19.313  -3.684   59.888  1.00 43.85  ? 291 PRO A CB    1 
ATOM   2007  C  CG    . PRO A  1 291 ? 20.730  -4.121   59.690  1.00 44.55  ? 291 PRO A CG    1 
ATOM   2008  C  CD    . PRO A  1 291 ? 21.018  -5.128   60.757  1.00 44.89  ? 291 PRO A CD    1 
ATOM   2009  N  N     . GLY A  1 292 ? 16.785  -5.519   58.949  1.00 43.81  ? 292 GLY A N     1 
ATOM   2010  C  CA    . GLY A  1 292 ? 16.189  -6.092   57.745  1.00 43.93  ? 292 GLY A CA    1 
ATOM   2011  C  C     . GLY A  1 292 ? 15.534  -5.071   56.838  1.00 43.21  ? 292 GLY A C     1 
ATOM   2012  O  O     . GLY A  1 292 ? 16.060  -3.974   56.614  1.00 43.82  ? 292 GLY A O     1 
ATOM   2013  N  N     . ARG A  1 293 ? 14.386  -5.431   56.300  1.00 42.60  ? 293 ARG A N     1 
ATOM   2014  C  CA    . ARG A  1 293 ? 13.761  -4.602   55.282  1.00 42.67  ? 293 ARG A CA    1 
ATOM   2015  C  C     . ARG A  1 293 ? 13.504  -3.207   55.850  1.00 41.92  ? 293 ARG A C     1 
ATOM   2016  O  O     . ARG A  1 293 ? 13.076  -3.079   57.012  1.00 41.51  ? 293 ARG A O     1 
ATOM   2017  C  CB    . ARG A  1 293 ? 12.487  -5.265   54.763  1.00 42.71  ? 293 ARG A CB    1 
ATOM   2018  C  CG    . ARG A  1 293 ? 11.738  -4.460   53.757  1.00 42.42  ? 293 ARG A CG    1 
ATOM   2019  C  CD    . ARG A  1 293 ? 10.735  -5.305   53.036  1.00 42.53  ? 293 ARG A CD    1 
ATOM   2020  N  NE    . ARG A  1 293 ? 9.868   -4.472   52.212  1.00 42.84  ? 293 ARG A NE    1 
ATOM   2021  C  CZ    . ARG A  1 293 ? 8.607   -4.763   51.933  1.00 42.85  ? 293 ARG A CZ    1 
ATOM   2022  N  NH1   . ARG A  1 293 ? 8.061   -5.870   52.424  1.00 42.30  ? 293 ARG A NH1   1 
ATOM   2023  N  NH2   . ARG A  1 293 ? 7.888   -3.939   51.182  1.00 42.72  ? 293 ARG A NH2   1 
ATOM   2024  N  N     . GLU A  1 294 ? 13.826  -2.180   55.049  1.00 41.65  ? 294 GLU A N     1 
ATOM   2025  C  CA    . GLU A  1 294 ? 13.741  -0.769   55.462  1.00 40.58  ? 294 GLU A CA    1 
ATOM   2026  C  C     . GLU A  1 294 ? 14.503  -0.540   56.753  1.00 39.74  ? 294 GLU A C     1 
ATOM   2027  O  O     . GLU A  1 294 ? 14.266  0.414    57.451  1.00 38.96  ? 294 GLU A O     1 
ATOM   2028  C  CB    . GLU A  1 294 ? 12.274  -0.324   55.583  1.00 40.07  ? 294 GLU A CB    1 
ATOM   2029  C  CG    . GLU A  1 294 ? 11.510  -0.440   54.285  1.00 42.29  ? 294 GLU A CG    1 
ATOM   2030  C  CD    . GLU A  1 294 ? 10.004  -0.277   54.430  1.00 45.44  ? 294 GLU A CD    1 
ATOM   2031  O  OE1   . GLU A  1 294 ? 9.562   0.472    55.314  1.00 46.28  ? 294 GLU A OE1   1 
ATOM   2032  O  OE2   . GLU A  1 294 ? 9.250   -0.882   53.632  1.00 46.51  ? 294 GLU A OE2   1 
ATOM   2033  N  N     . ALA A  1 295 ? 15.434  -1.443   57.049  1.00 40.83  ? 295 ALA A N     1 
ATOM   2034  C  CA    . ALA A  1 295 ? 16.306  -1.389   58.245  1.00 41.58  ? 295 ALA A CA    1 
ATOM   2035  C  C     . ALA A  1 295 ? 15.614  -1.728   59.579  1.00 41.67  ? 295 ALA A C     1 
ATOM   2036  O  O     . ALA A  1 295 ? 16.204  -1.508   60.647  1.00 41.80  ? 295 ALA A O     1 
ATOM   2037  C  CB    . ALA A  1 295 ? 17.022  -0.060   58.344  1.00 41.53  ? 295 ALA A CB    1 
ATOM   2038  N  N     . TYR A  1 296 ? 14.387  -2.271   59.504  1.00 41.38  ? 296 TYR A N     1 
ATOM   2039  C  CA    . TYR A  1 296 ? 13.666  -2.756   60.669  1.00 40.81  ? 296 TYR A CA    1 
ATOM   2040  C  C     . TYR A  1 296 ? 14.252  -4.046   61.214  1.00 41.69  ? 296 TYR A C     1 
ATOM   2041  O  O     . TYR A  1 296 ? 14.819  -4.840   60.465  1.00 42.05  ? 296 TYR A O     1 
ATOM   2042  C  CB    . TYR A  1 296 ? 12.188  -2.949   60.352  1.00 40.15  ? 296 TYR A CB    1 
ATOM   2043  C  CG    . TYR A  1 296 ? 11.463  -1.644   60.255  1.00 39.40  ? 296 TYR A CG    1 
ATOM   2044  C  CD1   . TYR A  1 296 ? 11.101  -0.945   61.399  1.00 38.08  ? 296 TYR A CD1   1 
ATOM   2045  C  CD2   . TYR A  1 296 ? 11.161  -1.089   59.009  1.00 38.90  ? 296 TYR A CD2   1 
ATOM   2046  C  CE1   . TYR A  1 296 ? 10.456  0.268    61.297  1.00 39.84  ? 296 TYR A CE1   1 
ATOM   2047  C  CE2   . TYR A  1 296 ? 10.514  0.106    58.898  1.00 37.93  ? 296 TYR A CE2   1 
ATOM   2048  C  CZ    . TYR A  1 296 ? 10.164  0.786    60.037  1.00 40.09  ? 296 TYR A CZ    1 
ATOM   2049  O  OH    . TYR A  1 296 ? 9.516   1.998    59.928  1.00 43.14  ? 296 TYR A OH    1 
ATOM   2050  N  N     . PRO A  1 297 ? 14.135  -4.243   62.535  1.00 42.07  ? 297 PRO A N     1 
ATOM   2051  C  CA    . PRO A  1 297 ? 14.559  -5.454   63.206  1.00 42.98  ? 297 PRO A CA    1 
ATOM   2052  C  C     . PRO A  1 297 ? 13.548  -6.536   62.939  1.00 43.54  ? 297 PRO A C     1 
ATOM   2053  O  O     . PRO A  1 297 ? 12.371  -6.247   62.765  1.00 43.13  ? 297 PRO A O     1 
ATOM   2054  C  CB    . PRO A  1 297 ? 14.471  -5.063   64.676  1.00 42.82  ? 297 PRO A CB    1 
ATOM   2055  C  CG    . PRO A  1 297 ? 13.344  -4.058   64.700  1.00 41.86  ? 297 PRO A CG    1 
ATOM   2056  C  CD    . PRO A  1 297 ? 13.673  -3.233   63.503  1.00 41.66  ? 297 PRO A CD    1 
ATOM   2057  N  N     . GLY A  1 298 ? 14.014  -7.779   62.939  1.00 45.02  ? 298 GLY A N     1 
ATOM   2058  C  CA    . GLY A  1 298 ? 13.178  -8.953   62.710  1.00 45.21  ? 298 GLY A CA    1 
ATOM   2059  C  C     . GLY A  1 298 ? 12.058  -9.150   63.707  1.00 45.16  ? 298 GLY A C     1 
ATOM   2060  O  O     . GLY A  1 298 ? 11.297  -10.120  63.624  1.00 46.16  ? 298 GLY A O     1 
ATOM   2061  N  N     . ASP A  1 299 ? 11.923  -8.251   64.664  1.00 44.40  ? 299 ASP A N     1 
ATOM   2062  C  CA    . ASP A  1 299 ? 10.848  -8.450   65.609  1.00 44.08  ? 299 ASP A CA    1 
ATOM   2063  C  C     . ASP A  1 299 ? 9.910   -7.261   65.649  1.00 42.24  ? 299 ASP A C     1 
ATOM   2064  O  O     . ASP A  1 299 ? 9.209   -7.054   66.627  1.00 42.06  ? 299 ASP A O     1 
ATOM   2065  C  CB    . ASP A  1 299 ? 11.390  -8.830   66.978  1.00 44.80  ? 299 ASP A CB    1 
ATOM   2066  C  CG    . ASP A  1 299 ? 12.148  -7.705   67.621  1.00 47.24  ? 299 ASP A CG    1 
ATOM   2067  O  OD1   . ASP A  1 299 ? 12.637  -6.825   66.882  1.00 48.17  ? 299 ASP A OD1   1 
ATOM   2068  O  OD2   . ASP A  1 299 ? 12.257  -7.687   68.873  1.00 50.94  ? 299 ASP A OD2   1 
ATOM   2069  N  N     . VAL A  1 300 ? 9.864   -6.510   64.553  1.00 41.21  ? 300 VAL A N     1 
ATOM   2070  C  CA    . VAL A  1 300 ? 8.933   -5.394   64.475  1.00 39.87  ? 300 VAL A CA    1 
ATOM   2071  C  C     . VAL A  1 300 ? 7.513   -5.837   64.152  1.00 39.92  ? 300 VAL A C     1 
ATOM   2072  O  O     . VAL A  1 300 ? 6.576   -5.081   64.364  1.00 40.48  ? 300 VAL A O     1 
ATOM   2073  C  CB    . VAL A  1 300 ? 9.419   -4.218   63.561  1.00 39.04  ? 300 VAL A CB    1 
ATOM   2074  C  CG1   . VAL A  1 300 ? 9.444   -4.592   62.078  1.00 37.81  ? 300 VAL A CG1   1 
ATOM   2075  C  CG2   . VAL A  1 300 ? 8.561   -2.986   63.807  1.00 37.70  ? 300 VAL A CG2   1 
ATOM   2076  N  N     . PHE A  1 301 ? 7.344   -7.043   63.632  1.00 40.33  ? 301 PHE A N     1 
ATOM   2077  C  CA    . PHE A  1 301 ? 5.998   -7.555   63.379  1.00 40.64  ? 301 PHE A CA    1 
ATOM   2078  C  C     . PHE A  1 301 ? 5.424   -7.993   64.722  1.00 41.04  ? 301 PHE A C     1 
ATOM   2079  O  O     . PHE A  1 301 ? 4.275   -7.707   65.038  1.00 40.84  ? 301 PHE A O     1 
ATOM   2080  C  CB    . PHE A  1 301 ? 6.016   -8.698   62.350  1.00 41.10  ? 301 PHE A CB    1 
ATOM   2081  C  CG    . PHE A  1 301 ? 4.685   -9.346   62.140  1.00 42.02  ? 301 PHE A CG    1 
ATOM   2082  C  CD1   . PHE A  1 301 ? 3.856   -8.940   61.099  1.00 41.02  ? 301 PHE A CD1   1 
ATOM   2083  C  CD2   . PHE A  1 301 ? 4.243   -10.365  62.990  1.00 42.29  ? 301 PHE A CD2   1 
ATOM   2084  C  CE1   . PHE A  1 301 ? 2.606   -9.528   60.914  1.00 38.97  ? 301 PHE A CE1   1 
ATOM   2085  C  CE2   . PHE A  1 301 ? 2.995   -10.953  62.807  1.00 41.21  ? 301 PHE A CE2   1 
ATOM   2086  C  CZ    . PHE A  1 301 ? 2.179   -10.529  61.766  1.00 39.88  ? 301 PHE A CZ    1 
ATOM   2087  N  N     . TYR A  1 302 ? 6.283   -8.651   65.504  1.00 42.01  ? 302 TYR A N     1 
ATOM   2088  C  CA    . TYR A  1 302 ? 5.999   -9.171   66.838  1.00 42.48  ? 302 TYR A CA    1 
ATOM   2089  C  C     . TYR A  1 302 ? 5.658   -8.041   67.792  1.00 41.97  ? 302 TYR A C     1 
ATOM   2090  O  O     . TYR A  1 302 ? 4.766   -8.175   68.590  1.00 42.37  ? 302 TYR A O     1 
ATOM   2091  C  CB    . TYR A  1 302 ? 7.222   -9.931   67.320  1.00 43.01  ? 302 TYR A CB    1 
ATOM   2092  C  CG    . TYR A  1 302 ? 7.158   -10.569  68.693  1.00 44.41  ? 302 TYR A CG    1 
ATOM   2093  C  CD1   . TYR A  1 302 ? 5.968   -11.043  69.238  1.00 45.30  ? 302 TYR A CD1   1 
ATOM   2094  C  CD2   . TYR A  1 302 ? 8.327   -10.759  69.426  1.00 45.19  ? 302 TYR A CD2   1 
ATOM   2095  C  CE1   . TYR A  1 302 ? 5.954   -11.654  70.504  1.00 46.49  ? 302 TYR A CE1   1 
ATOM   2096  C  CE2   . TYR A  1 302 ? 8.316   -11.363  70.677  1.00 46.02  ? 302 TYR A CE2   1 
ATOM   2097  C  CZ    . TYR A  1 302 ? 7.144   -11.802  71.212  1.00 46.35  ? 302 TYR A CZ    1 
ATOM   2098  O  OH    . TYR A  1 302 ? 7.187   -12.393  72.455  1.00 47.47  ? 302 TYR A OH    1 
ATOM   2099  N  N     . LEU A  1 303 ? 6.360   -6.924   67.695  1.00 41.30  ? 303 LEU A N     1 
ATOM   2100  C  CA    . LEU A  1 303 ? 5.994   -5.740   68.454  1.00 40.98  ? 303 LEU A CA    1 
ATOM   2101  C  C     . LEU A  1 303 ? 4.489   -5.372   68.283  1.00 40.80  ? 303 LEU A C     1 
ATOM   2102  O  O     . LEU A  1 303 ? 3.748   -5.177   69.249  1.00 40.53  ? 303 LEU A O     1 
ATOM   2103  C  CB    . LEU A  1 303 ? 6.878   -4.582   68.005  1.00 40.20  ? 303 LEU A CB    1 
ATOM   2104  C  CG    . LEU A  1 303 ? 6.874   -3.306   68.840  1.00 40.34  ? 303 LEU A CG    1 
ATOM   2105  C  CD1   . LEU A  1 303 ? 8.089   -3.291   69.711  1.00 41.12  ? 303 LEU A CD1   1 
ATOM   2106  C  CD2   . LEU A  1 303 ? 6.873   -2.073   67.947  1.00 40.27  ? 303 LEU A CD2   1 
ATOM   2107  N  N     . HIS A  1 304 ? 4.040   -5.284   67.042  1.00 40.57  ? 304 HIS A N     1 
ATOM   2108  C  CA    . HIS A  1 304 ? 2.720   -4.774   66.798  1.00 40.05  ? 304 HIS A CA    1 
ATOM   2109  C  C     . HIS A  1 304 ? 1.666   -5.840   67.027  1.00 41.00  ? 304 HIS A C     1 
ATOM   2110  O  O     . HIS A  1 304 ? 0.585   -5.531   67.503  1.00 41.30  ? 304 HIS A O     1 
ATOM   2111  C  CB    . HIS A  1 304 ? 2.637   -4.179   65.399  1.00 39.40  ? 304 HIS A CB    1 
ATOM   2112  C  CG    . HIS A  1 304 ? 3.142   -2.776   65.318  1.00 38.38  ? 304 HIS A CG    1 
ATOM   2113  N  ND1   . HIS A  1 304 ? 3.573   -2.206   64.142  1.00 39.20  ? 304 HIS A ND1   1 
ATOM   2114  C  CD2   . HIS A  1 304 ? 3.291   -1.824   66.271  1.00 37.58  ? 304 HIS A CD2   1 
ATOM   2115  C  CE1   . HIS A  1 304 ? 3.948   -0.957   64.369  1.00 37.64  ? 304 HIS A CE1   1 
ATOM   2116  N  NE2   . HIS A  1 304 ? 3.785   -0.700   65.653  1.00 36.23  ? 304 HIS A NE2   1 
ATOM   2117  N  N     . SER A  1 305 ? 1.973   -7.100   66.721  1.00 41.41  ? 305 SER A N     1 
ATOM   2118  C  CA    . SER A  1 305 ? 0.978   -8.138   66.917  1.00 42.14  ? 305 SER A CA    1 
ATOM   2119  C  C     . SER A  1 305 ? 0.805   -8.406   68.407  1.00 42.79  ? 305 SER A C     1 
ATOM   2120  O  O     . SER A  1 305 ? -0.309  -8.488   68.885  1.00 43.64  ? 305 SER A O     1 
ATOM   2121  C  CB    . SER A  1 305 ? 1.310   -9.405   66.135  1.00 42.88  ? 305 SER A CB    1 
ATOM   2122  O  OG    . SER A  1 305 ? 2.244   -10.218  66.822  1.00 43.96  ? 305 SER A OG    1 
ATOM   2123  N  N     . ARG A  1 306 ? 1.913   -8.534   69.128  1.00 42.88  ? 306 ARG A N     1 
ATOM   2124  C  CA    . ARG A  1 306 ? 1.931   -8.559   70.583  1.00 43.45  ? 306 ARG A CA    1 
ATOM   2125  C  C     . ARG A  1 306 ? 1.010   -7.466   71.108  1.00 43.06  ? 306 ARG A C     1 
ATOM   2126  O  O     . ARG A  1 306 ? 0.191   -7.700   71.998  1.00 43.95  ? 306 ARG A O     1 
ATOM   2127  C  CB    . ARG A  1 306 ? 3.337   -8.231   71.068  1.00 43.50  ? 306 ARG A CB    1 
ATOM   2128  C  CG    . ARG A  1 306 ? 3.935   -9.129   72.123  1.00 45.47  ? 306 ARG A CG    1 
ATOM   2129  C  CD    . ARG A  1 306 ? 5.187   -8.456   72.743  1.00 47.36  ? 306 ARG A CD    1 
ATOM   2130  N  NE    . ARG A  1 306 ? 6.248   -8.175   71.769  1.00 47.73  ? 306 ARG A NE    1 
ATOM   2131  C  CZ    . ARG A  1 306 ? 7.162   -7.212   71.894  1.00 48.67  ? 306 ARG A CZ    1 
ATOM   2132  N  NH1   . ARG A  1 306 ? 7.178   -6.409   72.952  1.00 49.31  ? 306 ARG A NH1   1 
ATOM   2133  N  NH2   . ARG A  1 306 ? 8.076   -7.048   70.953  1.00 49.83  ? 306 ARG A NH2   1 
ATOM   2134  N  N     . LEU A  1 307 ? 1.154   -6.270   70.549  1.00 41.92  ? 307 LEU A N     1 
ATOM   2135  C  CA    . LEU A  1 307 ? 0.388   -5.108   70.995  1.00 41.64  ? 307 LEU A CA    1 
ATOM   2136  C  C     . LEU A  1 307 ? -1.081  -5.191   70.659  1.00 41.69  ? 307 LEU A C     1 
ATOM   2137  O  O     . LEU A  1 307 ? -1.908  -4.832   71.474  1.00 42.26  ? 307 LEU A O     1 
ATOM   2138  C  CB    . LEU A  1 307 ? 0.948   -3.814   70.392  1.00 40.81  ? 307 LEU A CB    1 
ATOM   2139  C  CG    . LEU A  1 307 ? 0.092   -2.554   70.404  1.00 39.10  ? 307 LEU A CG    1 
ATOM   2140  C  CD1   . LEU A  1 307 ? -0.234  -2.158   71.808  1.00 41.07  ? 307 LEU A CD1   1 
ATOM   2141  C  CD2   . LEU A  1 307 ? 0.864   -1.464   69.739  1.00 37.95  ? 307 LEU A CD2   1 
ATOM   2142  N  N     . LEU A  1 308 ? -1.387  -5.664   69.458  1.00 41.32  ? 308 LEU A N     1 
ATOM   2143  C  CA    . LEU A  1 308 ? -2.708  -5.504   68.918  1.00 40.96  ? 308 LEU A CA    1 
ATOM   2144  C  C     . LEU A  1 308 ? -3.640  -6.648   69.249  1.00 42.56  ? 308 LEU A C     1 
ATOM   2145  O  O     . LEU A  1 308 ? -4.841  -6.484   69.178  1.00 42.80  ? 308 LEU A O     1 
ATOM   2146  C  CB    . LEU A  1 308 ? -2.639  -5.259   67.420  1.00 39.75  ? 308 LEU A CB    1 
ATOM   2147  C  CG    . LEU A  1 308 ? -2.283  -3.832   67.014  1.00 37.43  ? 308 LEU A CG    1 
ATOM   2148  C  CD1   . LEU A  1 308 ? -1.851  -3.813   65.563  1.00 37.82  ? 308 LEU A CD1   1 
ATOM   2149  C  CD2   . LEU A  1 308 ? -3.407  -2.884   67.217  1.00 35.33  ? 308 LEU A CD2   1 
ATOM   2150  N  N     . GLU A  1 309 ? -3.093  -7.800   69.615  1.00 44.40  ? 309 GLU A N     1 
ATOM   2151  C  CA    . GLU A  1 309 ? -3.912  -8.963   69.979  1.00 46.82  ? 309 GLU A CA    1 
ATOM   2152  C  C     . GLU A  1 309 ? -4.494  -8.781   71.369  1.00 47.57  ? 309 GLU A C     1 
ATOM   2153  O  O     . GLU A  1 309 ? -5.373  -9.533   71.804  1.00 49.02  ? 309 GLU A O     1 
ATOM   2154  C  CB    . GLU A  1 309 ? -3.091  -10.238  69.913  1.00 47.81  ? 309 GLU A CB    1 
ATOM   2155  C  CG    . GLU A  1 309 ? -2.654  -10.585  68.489  1.00 50.55  ? 309 GLU A CG    1 
ATOM   2156  C  CD    . GLU A  1 309 ? -3.711  -11.369  67.722  1.00 54.66  ? 309 GLU A CD    1 
ATOM   2157  O  OE1   . GLU A  1 309 ? -4.116  -12.429  68.240  1.00 54.94  ? 309 GLU A OE1   1 
ATOM   2158  O  OE2   . GLU A  1 309 ? -4.122  -10.929  66.608  1.00 56.21  ? 309 GLU A OE2   1 
ATOM   2159  N  N     . ARG A  1 310 ? -4.008  -7.754   72.054  1.00 46.94  ? 310 ARG A N     1 
ATOM   2160  C  CA    . ARG A  1 310 ? -4.528  -7.408   73.355  1.00 47.25  ? 310 ARG A CA    1 
ATOM   2161  C  C     . ARG A  1 310 ? -5.926  -6.802   73.301  1.00 47.19  ? 310 ARG A C     1 
ATOM   2162  O  O     . ARG A  1 310 ? -6.621  -6.814   74.306  1.00 48.58  ? 310 ARG A O     1 
ATOM   2163  C  CB    . ARG A  1 310 ? -3.545  -6.519   74.098  1.00 46.44  ? 310 ARG A CB    1 
ATOM   2164  C  CG    . ARG A  1 310 ? -2.342  -7.292   74.514  1.00 46.04  ? 310 ARG A CG    1 
ATOM   2165  C  CD    . ARG A  1 310 ? -1.207  -6.404   74.868  1.00 46.69  ? 310 ARG A CD    1 
ATOM   2166  N  NE    . ARG A  1 310 ? -1.419  -5.706   76.133  1.00 47.98  ? 310 ARG A NE    1 
ATOM   2167  C  CZ    . ARG A  1 310 ? -0.531  -4.896   76.705  1.00 47.88  ? 310 ARG A CZ    1 
ATOM   2168  N  NH1   . ARG A  1 310 ? 0.663   -4.680   76.139  1.00 47.73  ? 310 ARG A NH1   1 
ATOM   2169  N  NH2   . ARG A  1 310 ? -0.827  -4.313   77.857  1.00 47.46  ? 310 ARG A NH2   1 
ATOM   2170  N  N     . ALA A  1 311 ? -6.338  -6.288   72.143  1.00 46.10  ? 311 ALA A N     1 
ATOM   2171  C  CA    . ALA A  1 311 ? -7.707  -5.804   71.959  1.00 46.08  ? 311 ALA A CA    1 
ATOM   2172  C  C     . ALA A  1 311 ? -8.513  -7.065   71.786  1.00 47.16  ? 311 ALA A C     1 
ATOM   2173  O  O     . ALA A  1 311 ? -8.076  -7.946   71.043  1.00 47.70  ? 311 ALA A O     1 
ATOM   2174  C  CB    . ALA A  1 311 ? -7.822  -4.940   70.732  1.00 44.89  ? 311 ALA A CB    1 
ATOM   2175  N  N     . ALA A  1 312 ? -9.651  -7.175   72.476  1.00 47.40  ? 312 ALA A N     1 
ATOM   2176  C  CA    . ALA A  1 312 ? -10.342 -8.455   72.571  1.00 48.65  ? 312 ALA A CA    1 
ATOM   2177  C  C     . ALA A  1 312 ? -11.750 -8.338   73.132  1.00 49.65  ? 312 ALA A C     1 
ATOM   2178  O  O     . ALA A  1 312 ? -12.028 -7.438   73.927  1.00 49.90  ? 312 ALA A O     1 
ATOM   2179  C  CB    . ALA A  1 312 ? -9.530  -9.415   73.430  1.00 49.30  ? 312 ALA A CB    1 
ATOM   2180  N  N     . LYS A  1 313 ? -12.631 -9.253   72.734  1.00 50.16  ? 313 LYS A N     1 
ATOM   2181  C  CA    . LYS A  1 313 ? -13.962 -9.301   73.310  1.00 51.18  ? 313 LYS A CA    1 
ATOM   2182  C  C     . LYS A  1 313 ? -14.086 -10.523  74.217  1.00 52.76  ? 313 LYS A C     1 
ATOM   2183  O  O     . LYS A  1 313 ? -14.232 -11.638  73.746  1.00 53.63  ? 313 LYS A O     1 
ATOM   2184  C  CB    . LYS A  1 313 ? -15.042 -9.251   72.227  1.00 51.33  ? 313 LYS A CB    1 
ATOM   2185  C  CG    . LYS A  1 313 ? -16.465 -9.593   72.695  1.00 53.24  ? 313 LYS A CG    1 
ATOM   2186  C  CD    . LYS A  1 313 ? -16.852 -8.879   73.972  1.00 52.28  ? 313 LYS A CD    1 
ATOM   2187  C  CE    . LYS A  1 313 ? -18.287 -9.139   74.326  1.00 53.82  ? 313 LYS A CE    1 
ATOM   2188  N  NZ    . LYS A  1 313 ? -18.686 -8.246   75.441  1.00 54.04  ? 313 LYS A NZ    1 
ATOM   2189  N  N     . LEU A  1 314 ? -14.042 -10.277  75.525  1.00 53.36  ? 314 LEU A N     1 
ATOM   2190  C  CA    . LEU A  1 314 ? -13.930 -11.316  76.536  1.00 54.82  ? 314 LEU A CA    1 
ATOM   2191  C  C     . LEU A  1 314 ? -15.206 -12.122  76.708  1.00 57.28  ? 314 LEU A C     1 
ATOM   2192  O  O     . LEU A  1 314 ? -16.302 -11.606  76.530  1.00 57.50  ? 314 LEU A O     1 
ATOM   2193  C  CB    . LEU A  1 314 ? -13.526 -10.699  77.875  1.00 54.46  ? 314 LEU A CB    1 
ATOM   2194  C  CG    . LEU A  1 314 ? -12.108 -10.142  78.013  1.00 51.86  ? 314 LEU A CG    1 
ATOM   2195  C  CD1   . LEU A  1 314 ? -11.866 -9.688   79.450  1.00 50.98  ? 314 LEU A CD1   1 
ATOM   2196  C  CD2   . LEU A  1 314 ? -11.050 -11.156  77.580  1.00 49.24  ? 314 LEU A CD2   1 
ATOM   2197  N  N     . SER A  1 315 ? -15.052 -13.393  77.065  1.00 59.51  ? 315 SER A N     1 
ATOM   2198  C  CA    . SER A  1 315 ? -16.196 -14.293  77.277  1.00 62.66  ? 315 SER A CA    1 
ATOM   2199  C  C     . SER A  1 315 ? -17.073 -13.895  78.469  1.00 64.22  ? 315 SER A C     1 
ATOM   2200  O  O     . SER A  1 315 ? -16.695 -13.051  79.277  1.00 63.77  ? 315 SER A O     1 
ATOM   2201  C  CB    . SER A  1 315 ? -15.700 -15.716  77.467  1.00 63.95  ? 315 SER A CB    1 
ATOM   2202  O  OG    . SER A  1 315 ? -14.723 -15.743  78.488  1.00 64.84  ? 315 SER A OG    1 
ATOM   2203  N  N     . GLU A  1 316 ? -18.251 -14.499  78.568  1.00 66.83  ? 316 GLU A N     1 
ATOM   2204  C  CA    . GLU A  1 316 ? -19.157 -14.215  79.681  1.00 69.11  ? 316 GLU A CA    1 
ATOM   2205  C  C     . GLU A  1 316 ? -18.546 -14.636  81.015  1.00 70.28  ? 316 GLU A C     1 
ATOM   2206  O  O     . GLU A  1 316 ? -18.652 -13.921  82.012  1.00 70.06  ? 316 GLU A O     1 
ATOM   2207  C  CB    . GLU A  1 316 ? -20.507 -14.898  79.478  1.00 71.32  ? 316 GLU A CB    1 
ATOM   2208  C  CG    . GLU A  1 316 ? -21.436 -14.174  78.521  1.00 72.61  ? 316 GLU A CG    1 
ATOM   2209  C  CD    . GLU A  1 316 ? -22.893 -14.345  78.912  1.00 78.80  ? 316 GLU A CD    1 
ATOM   2210  O  OE1   . GLU A  1 316 ? -23.288 -15.473  79.320  1.00 81.77  ? 316 GLU A OE1   1 
ATOM   2211  O  OE2   . GLU A  1 316 ? -23.648 -13.343  78.826  1.00 80.63  ? 316 GLU A OE2   1 
ATOM   2212  N  N     . LYS A  1 317 ? -17.887 -15.792  81.019  1.00 71.85  ? 317 LYS A N     1 
ATOM   2213  C  CA    . LYS A  1 317 ? -17.159 -16.248  82.198  1.00 73.27  ? 317 LYS A CA    1 
ATOM   2214  C  C     . LYS A  1 317 ? -16.212 -15.151  82.678  1.00 71.43  ? 317 LYS A C     1 
ATOM   2215  O  O     . LYS A  1 317 ? -16.189 -14.813  83.863  1.00 72.23  ? 317 LYS A O     1 
ATOM   2216  C  CB    . LYS A  1 317 ? -16.379 -17.527  81.903  1.00 73.93  ? 317 LYS A CB    1 
ATOM   2217  C  CG    . LYS A  1 317 ? -15.610 -18.059  83.110  1.00 76.71  ? 317 LYS A CG    1 
ATOM   2218  C  CD    . LYS A  1 317 ? -15.133 -19.494  82.889  1.00 80.63  ? 317 LYS A CD    1 
ATOM   2219  C  CE    . LYS A  1 317 ? -14.214 -19.970  84.014  1.00 82.43  ? 317 LYS A CE    1 
ATOM   2220  N  NZ    . LYS A  1 317 ? -13.814 -21.406  83.848  1.00 84.83  ? 317 LYS A NZ    1 
ATOM   2221  N  N     . GLU A  1 318 ? -15.462 -14.581  81.740  1.00 68.99  ? 318 GLU A N     1 
ATOM   2222  C  CA    . GLU A  1 318 ? -14.412 -13.631  82.067  1.00 67.37  ? 318 GLU A CA    1 
ATOM   2223  C  C     . GLU A  1 318 ? -14.891 -12.174  82.223  1.00 65.66  ? 318 GLU A C     1 
ATOM   2224  O  O     . GLU A  1 318 ? -14.064 -11.262  82.341  1.00 64.48  ? 318 GLU A O     1 
ATOM   2225  C  CB    . GLU A  1 318 ? -13.312 -13.717  81.013  1.00 66.03  ? 318 GLU A CB    1 
ATOM   2226  C  CG    . GLU A  1 318 ? -11.909 -13.482  81.553  1.00 68.31  ? 318 GLU A CG    1 
ATOM   2227  C  CD    . GLU A  1 318 ? -11.378 -14.667  82.341  1.00 73.80  ? 318 GLU A CD    1 
ATOM   2228  O  OE1   . GLU A  1 318 ? -11.335 -15.791  81.779  1.00 75.94  ? 318 GLU A OE1   1 
ATOM   2229  O  OE2   . GLU A  1 318 ? -11.003 -14.473  83.523  1.00 75.85  ? 318 GLU A OE2   1 
ATOM   2230  N  N     . GLY A  1 319 ? -16.208 -11.950  82.217  1.00 65.45  ? 319 GLY A N     1 
ATOM   2231  C  CA    . GLY A  1 319 ? -16.758 -10.624  82.517  1.00 63.54  ? 319 GLY A CA    1 
ATOM   2232  C  C     . GLY A  1 319 ? -17.338 -9.802   81.378  1.00 61.46  ? 319 GLY A C     1 
ATOM   2233  O  O     . GLY A  1 319 ? -17.873 -8.721   81.615  1.00 61.05  ? 319 GLY A O     1 
ATOM   2234  N  N     . SER A  1 320 ? -17.233 -10.306  80.149  1.00 60.07  ? 320 SER A N     1 
ATOM   2235  C  CA    . SER A  1 320 ? -17.735 -9.622   78.939  1.00 58.24  ? 320 SER A CA    1 
ATOM   2236  C  C     . SER A  1 320 ? -17.041 -8.304   78.594  1.00 56.03  ? 320 SER A C     1 
ATOM   2237  O  O     . SER A  1 320 ? -17.482 -7.581   77.694  1.00 54.87  ? 320 SER A O     1 
ATOM   2238  C  CB    . SER A  1 320 ? -19.252 -9.430   78.989  1.00 59.18  ? 320 SER A CB    1 
ATOM   2239  O  OG    . SER A  1 320 ? -19.907 -10.680  79.055  1.00 61.29  ? 320 SER A OG    1 
ATOM   2240  N  N     . GLY A  1 321 ? -15.945 -7.992   79.280  1.00 55.24  ? 321 GLY A N     1 
ATOM   2241  C  CA    . GLY A  1 321 ? -15.213 -6.769   78.975  1.00 53.79  ? 321 GLY A CA    1 
ATOM   2242  C  C     . GLY A  1 321 ? -14.687 -6.751   77.550  1.00 52.64  ? 321 GLY A C     1 
ATOM   2243  O  O     . GLY A  1 321 ? -14.538 -7.808   76.918  1.00 52.76  ? 321 GLY A O     1 
ATOM   2244  N  N     . SER A  1 322 ? -14.408 -5.561   77.026  1.00 51.35  ? 322 SER A N     1 
ATOM   2245  C  CA    . SER A  1 322 ? -13.788 -5.476   75.704  1.00 50.52  ? 322 SER A CA    1 
ATOM   2246  C  C     . SER A  1 322 ? -12.772 -4.346   75.556  1.00 48.64  ? 322 SER A C     1 
ATOM   2247  O  O     . SER A  1 322 ? -12.846 -3.336   76.247  1.00 48.93  ? 322 SER A O     1 
ATOM   2248  C  CB    . SER A  1 322 ? -14.858 -5.375   74.618  1.00 50.79  ? 322 SER A CB    1 
ATOM   2249  O  OG    . SER A  1 322 ? -15.409 -4.075   74.586  1.00 53.03  ? 322 SER A OG    1 
ATOM   2250  N  N     . LEU A  1 323 ? -11.805 -4.534   74.673  1.00 47.30  ? 323 LEU A N     1 
ATOM   2251  C  CA    . LEU A  1 323 ? -10.935 -3.443   74.249  1.00 45.92  ? 323 LEU A CA    1 
ATOM   2252  C  C     . LEU A  1 323 ? -10.898 -3.463   72.727  1.00 45.20  ? 323 LEU A C     1 
ATOM   2253  O  O     . LEU A  1 323 ? -10.753 -4.511   72.125  1.00 45.67  ? 323 LEU A O     1 
ATOM   2254  C  CB    . LEU A  1 323 ? -9.547  -3.580   74.857  1.00 45.52  ? 323 LEU A CB    1 
ATOM   2255  C  CG    . LEU A  1 323 ? -8.385  -2.681   74.385  1.00 44.54  ? 323 LEU A CG    1 
ATOM   2256  C  CD1   . LEU A  1 323 ? -8.564  -1.191   74.783  1.00 42.65  ? 323 LEU A CD1   1 
ATOM   2257  C  CD2   . LEU A  1 323 ? -7.052  -3.245   74.893  1.00 41.49  ? 323 LEU A CD2   1 
ATOM   2258  N  N     . THR A  1 324 ? -11.094 -2.303   72.125  1.00 44.72  ? 324 THR A N     1 
ATOM   2259  C  CA    . THR A  1 324 ? -11.282 -2.161   70.690  1.00 44.52  ? 324 THR A CA    1 
ATOM   2260  C  C     . THR A  1 324 ? -10.157 -1.240   70.299  1.00 43.91  ? 324 THR A C     1 
ATOM   2261  O  O     . THR A  1 324 ? -9.913  -0.253   70.995  1.00 44.06  ? 324 THR A O     1 
ATOM   2262  C  CB    . THR A  1 324 ? -12.593 -1.371   70.377  1.00 45.10  ? 324 THR A CB    1 
ATOM   2263  O  OG1   . THR A  1 324 ? -13.743 -1.990   70.990  1.00 45.63  ? 324 THR A OG1   1 
ATOM   2264  C  CG2   . THR A  1 324 ? -12.804 -1.218   68.880  1.00 44.42  ? 324 THR A CG2   1 
ATOM   2265  N  N     . ALA A  1 325 ? -9.455  -1.540   69.215  1.00 43.61  ? 325 ALA A N     1 
ATOM   2266  C  CA    . ALA A  1 325 ? -8.312  -0.707   68.848  1.00 42.97  ? 325 ALA A CA    1 
ATOM   2267  C  C     . ALA A  1 325 ? -8.480  -0.054   67.492  1.00 43.07  ? 325 ALA A C     1 
ATOM   2268  O  O     . ALA A  1 325 ? -8.857  -0.709   66.516  1.00 43.76  ? 325 ALA A O     1 
ATOM   2269  C  CB    . ALA A  1 325 ? -7.039  -1.514   68.873  1.00 42.65  ? 325 ALA A CB    1 
ATOM   2270  N  N     . LEU A  1 326 ? -8.205  1.245    67.442  1.00 42.90  ? 326 LEU A N     1 
ATOM   2271  C  CA    . LEU A  1 326 ? -8.008  1.945    66.170  1.00 42.59  ? 326 LEU A CA    1 
ATOM   2272  C  C     . LEU A  1 326 ? -6.541  2.298    65.965  1.00 42.06  ? 326 LEU A C     1 
ATOM   2273  O  O     . LEU A  1 326 ? -6.107  3.399    66.307  1.00 41.98  ? 326 LEU A O     1 
ATOM   2274  C  CB    . LEU A  1 326 ? -8.860  3.199    66.087  1.00 42.45  ? 326 LEU A CB    1 
ATOM   2275  C  CG    . LEU A  1 326 ? -10.373 3.026    66.233  1.00 42.86  ? 326 LEU A CG    1 
ATOM   2276  C  CD1   . LEU A  1 326 ? -11.053 4.297    65.713  1.00 40.92  ? 326 LEU A CD1   1 
ATOM   2277  C  CD2   . LEU A  1 326 ? -10.908 1.766    65.536  1.00 41.94  ? 326 LEU A CD2   1 
ATOM   2278  N  N     . PRO A  1 327 ? -5.752  1.356    65.436  1.00 41.67  ? 327 PRO A N     1 
ATOM   2279  C  CA    . PRO A  1 327 ? -4.397  1.793    65.181  1.00 41.31  ? 327 PRO A CA    1 
ATOM   2280  C  C     . PRO A  1 327 ? -4.405  2.695    63.955  1.00 41.58  ? 327 PRO A C     1 
ATOM   2281  O  O     . PRO A  1 327 ? -5.249  2.518    63.072  1.00 41.92  ? 327 PRO A O     1 
ATOM   2282  C  CB    . PRO A  1 327 ? -3.645  0.485    64.913  1.00 40.68  ? 327 PRO A CB    1 
ATOM   2283  C  CG    . PRO A  1 327 ? -4.660  -0.433   64.369  1.00 41.20  ? 327 PRO A CG    1 
ATOM   2284  C  CD    . PRO A  1 327 ? -5.957  -0.058   65.083  1.00 42.13  ? 327 PRO A CD    1 
ATOM   2285  N  N     . VAL A  1 328 ? -3.499  3.672    63.929  1.00 41.57  ? 328 VAL A N     1 
ATOM   2286  C  CA    . VAL A  1 328 ? -3.300  4.502    62.750  1.00 41.52  ? 328 VAL A CA    1 
ATOM   2287  C  C     . VAL A  1 328 ? -1.978  4.130    62.110  1.00 41.33  ? 328 VAL A C     1 
ATOM   2288  O  O     . VAL A  1 328 ? -1.019  3.793    62.801  1.00 40.99  ? 328 VAL A O     1 
ATOM   2289  C  CB    . VAL A  1 328 ? -3.331  5.992    63.099  1.00 41.71  ? 328 VAL A CB    1 
ATOM   2290  C  CG1   . VAL A  1 328 ? -3.303  6.859    61.836  1.00 41.33  ? 328 VAL A CG1   1 
ATOM   2291  C  CG2   . VAL A  1 328 ? -4.566  6.281    63.905  1.00 41.90  ? 328 VAL A CG2   1 
ATOM   2292  N  N     . ILE A  1 329 ? -1.957  4.156    60.784  1.00 41.70  ? 329 ILE A N     1 
ATOM   2293  C  CA    . ILE A  1 329 ? -0.746  3.947    60.009  1.00 41.60  ? 329 ILE A CA    1 
ATOM   2294  C  C     . ILE A  1 329 ? -0.723  5.029    58.934  1.00 42.28  ? 329 ILE A C     1 
ATOM   2295  O  O     . ILE A  1 329 ? -1.733  5.295    58.306  1.00 43.68  ? 329 ILE A O     1 
ATOM   2296  C  CB    . ILE A  1 329 ? -0.726  2.503    59.402  1.00 41.77  ? 329 ILE A CB    1 
ATOM   2297  C  CG1   . ILE A  1 329 ? -0.196  1.490    60.433  1.00 41.02  ? 329 ILE A CG1   1 
ATOM   2298  C  CG2   . ILE A  1 329 ? 0.041   2.422    58.055  1.00 40.94  ? 329 ILE A CG2   1 
ATOM   2299  C  CD1   . ILE A  1 329 ? 1.221   1.759    60.956  1.00 39.99  ? 329 ILE A CD1   1 
ATOM   2300  N  N     . GLU A  1 330 ? 0.408   5.689    58.755  1.00 41.99  ? 330 GLU A N     1 
ATOM   2301  C  CA    . GLU A  1 330 ? 0.571   6.585    57.637  1.00 41.91  ? 330 GLU A CA    1 
ATOM   2302  C  C     . GLU A  1 330 ? 1.355   5.859    56.564  1.00 41.86  ? 330 GLU A C     1 
ATOM   2303  O  O     . GLU A  1 330 ? 2.447   5.336    56.826  1.00 41.30  ? 330 GLU A O     1 
ATOM   2304  C  CB    . GLU A  1 330 ? 1.340   7.814    58.065  1.00 41.97  ? 330 GLU A CB    1 
ATOM   2305  C  CG    . GLU A  1 330 ? 1.847   8.695    56.938  1.00 43.17  ? 330 GLU A CG    1 
ATOM   2306  C  CD    . GLU A  1 330 ? 2.292   10.028   57.487  1.00 46.93  ? 330 GLU A CD    1 
ATOM   2307  O  OE1   . GLU A  1 330 ? 3.511   10.333   57.454  1.00 44.59  ? 330 GLU A OE1   1 
ATOM   2308  O  OE2   . GLU A  1 330 ? 1.392   10.755   58.000  1.00 50.50  ? 330 GLU A OE2   1 
ATOM   2309  N  N     . THR A  1 331 ? 0.786   5.844    55.365  1.00 41.93  ? 331 THR A N     1 
ATOM   2310  C  CA    . THR A  1 331 ? 1.445   5.363    54.180  1.00 42.03  ? 331 THR A CA    1 
ATOM   2311  C  C     . THR A  1 331 ? 2.162   6.514    53.479  1.00 42.91  ? 331 THR A C     1 
ATOM   2312  O  O     . THR A  1 331 ? 1.927   7.690    53.773  1.00 43.06  ? 331 THR A O     1 
ATOM   2313  C  CB    . THR A  1 331 ? 0.412   4.817    53.214  1.00 42.81  ? 331 THR A CB    1 
ATOM   2314  O  OG1   . THR A  1 331 ? -0.639  5.777    53.089  1.00 43.93  ? 331 THR A OG1   1 
ATOM   2315  C  CG2   . THR A  1 331 ? -0.164  3.522    53.722  1.00 41.67  ? 331 THR A CG2   1 
ATOM   2316  N  N     . GLN A  1 332 ? 3.039   6.157    52.547  1.00 43.42  ? 332 GLN A N     1 
ATOM   2317  C  CA    . GLN A  1 332 ? 3.783   7.104    51.736  1.00 44.41  ? 332 GLN A CA    1 
ATOM   2318  C  C     . GLN A  1 332 ? 3.445   6.828    50.277  1.00 45.85  ? 332 GLN A C     1 
ATOM   2319  O  O     . GLN A  1 332 ? 3.792   5.770    49.745  1.00 46.45  ? 332 GLN A O     1 
ATOM   2320  C  CB    . GLN A  1 332 ? 5.293   6.921    51.942  1.00 43.98  ? 332 GLN A CB    1 
ATOM   2321  C  CG    . GLN A  1 332 ? 5.773   7.006    53.374  1.00 42.73  ? 332 GLN A CG    1 
ATOM   2322  C  CD    . GLN A  1 332 ? 5.402   8.307    54.062  1.00 43.95  ? 332 GLN A CD    1 
ATOM   2323  O  OE1   . GLN A  1 332 ? 5.539   9.403    53.500  1.00 46.01  ? 332 GLN A OE1   1 
ATOM   2324  N  NE2   . GLN A  1 332 ? 4.939   8.193    55.297  1.00 43.13  ? 332 GLN A NE2   1 
ATOM   2325  N  N     . GLY A  1 333 ? 2.763   7.764    49.625  1.00 46.72  ? 333 GLY A N     1 
ATOM   2326  C  CA    . GLY A  1 333 ? 2.326   7.549    48.253  1.00 47.82  ? 333 GLY A CA    1 
ATOM   2327  C  C     . GLY A  1 333 ? 1.310   6.424    48.110  1.00 47.87  ? 333 GLY A C     1 
ATOM   2328  O  O     . GLY A  1 333 ? 1.191   5.817    47.046  1.00 48.55  ? 333 GLY A O     1 
ATOM   2329  N  N     . GLY A  1 334 ? 0.565   6.157    49.180  1.00 47.07  ? 334 GLY A N     1 
ATOM   2330  C  CA    . GLY A  1 334 ? -0.462  5.124    49.163  1.00 47.25  ? 334 GLY A CA    1 
ATOM   2331  C  C     . GLY A  1 334 ? 0.072   3.704    49.000  1.00 47.33  ? 334 GLY A C     1 
ATOM   2332  O  O     . GLY A  1 334 ? -0.658  2.821    48.546  1.00 47.96  ? 334 GLY A O     1 
ATOM   2333  N  N     . ASP A  1 335 ? 1.332   3.481    49.383  1.00 46.66  ? 335 ASP A N     1 
ATOM   2334  C  CA    . ASP A  1 335 ? 1.993   2.179    49.224  1.00 46.56  ? 335 ASP A CA    1 
ATOM   2335  C  C     . ASP A  1 335 ? 1.814   1.279    50.448  1.00 45.28  ? 335 ASP A C     1 
ATOM   2336  O  O     . ASP A  1 335 ? 2.644   1.269    51.362  1.00 44.55  ? 335 ASP A O     1 
ATOM   2337  C  CB    . ASP A  1 335 ? 3.479   2.383    48.896  1.00 46.74  ? 335 ASP A CB    1 
ATOM   2338  C  CG    . ASP A  1 335 ? 4.291   1.083    48.909  1.00 46.81  ? 335 ASP A CG    1 
ATOM   2339  O  OD1   . ASP A  1 335 ? 3.763   -0.004   48.625  1.00 47.59  ? 335 ASP A OD1   1 
ATOM   2340  O  OD2   . ASP A  1 335 ? 5.497   1.159    49.191  1.00 48.90  ? 335 ASP A OD2   1 
ATOM   2341  N  N     . VAL A  1 336 ? 0.718   0.528    50.425  1.00 45.35  ? 336 VAL A N     1 
ATOM   2342  C  CA    . VAL A  1 336 ? 0.331   -0.426   51.468  1.00 44.35  ? 336 VAL A CA    1 
ATOM   2343  C  C     . VAL A  1 336 ? 1.170   -1.707   51.446  1.00 45.06  ? 336 VAL A C     1 
ATOM   2344  O  O     . VAL A  1 336 ? 0.926   -2.643   52.217  1.00 45.22  ? 336 VAL A O     1 
ATOM   2345  C  CB    . VAL A  1 336 ? -1.168  -0.819   51.341  1.00 44.26  ? 336 VAL A CB    1 
ATOM   2346  C  CG1   . VAL A  1 336 ? -2.045  0.352    51.743  1.00 44.47  ? 336 VAL A CG1   1 
ATOM   2347  C  CG2   . VAL A  1 336 ? -1.489  -1.268   49.963  1.00 42.48  ? 336 VAL A CG2   1 
ATOM   2348  N  N     . SER A  1 337 ? 2.147   -1.763   50.545  1.00 45.77  ? 337 SER A N     1 
ATOM   2349  C  CA    . SER A  1 337 ? 3.052   -2.898   50.503  1.00 45.29  ? 337 SER A CA    1 
ATOM   2350  C  C     . SER A  1 337 ? 4.333   -2.570   51.174  1.00 44.61  ? 337 SER A C     1 
ATOM   2351  O  O     . SER A  1 337 ? 5.256   -3.371   51.143  1.00 45.25  ? 337 SER A O     1 
ATOM   2352  C  CB    . SER A  1 337 ? 3.293   -3.333   49.084  1.00 46.07  ? 337 SER A CB    1 
ATOM   2353  O  OG    . SER A  1 337 ? 2.166   -4.082   48.699  1.00 47.73  ? 337 SER A OG    1 
ATOM   2354  N  N     . ALA A  1 338 ? 4.390   -1.380   51.777  1.00 44.19  ? 338 ALA A N     1 
ATOM   2355  C  CA    . ALA A  1 338 ? 5.558   -0.961   52.552  1.00 43.42  ? 338 ALA A CA    1 
ATOM   2356  C  C     . ALA A  1 338 ? 5.675   -1.910   53.727  1.00 42.64  ? 338 ALA A C     1 
ATOM   2357  O  O     . ALA A  1 338 ? 4.734   -2.628   54.043  1.00 42.55  ? 338 ALA A O     1 
ATOM   2358  C  CB    . ALA A  1 338 ? 5.410   0.455    53.029  1.00 43.01  ? 338 ALA A CB    1 
ATOM   2359  N  N     . TYR A  1 339 ? 6.829   -1.936   54.370  1.00 42.33  ? 339 TYR A N     1 
ATOM   2360  C  CA    . TYR A  1 339 ? 7.017   -2.927   55.413  1.00 41.70  ? 339 TYR A CA    1 
ATOM   2361  C  C     . TYR A  1 339 ? 6.034   -2.764   56.594  1.00 40.64  ? 339 TYR A C     1 
ATOM   2362  O  O     . TYR A  1 339 ? 5.335   -3.711   56.950  1.00 40.51  ? 339 TYR A O     1 
ATOM   2363  C  CB    . TYR A  1 339 ? 8.475   -3.048   55.860  1.00 41.30  ? 339 TYR A CB    1 
ATOM   2364  C  CG    . TYR A  1 339 ? 8.673   -4.239   56.750  1.00 41.54  ? 339 TYR A CG    1 
ATOM   2365  C  CD1   . TYR A  1 339 ? 8.384   -5.528   56.298  1.00 40.79  ? 339 TYR A CD1   1 
ATOM   2366  C  CD2   . TYR A  1 339 ? 9.127   -4.088   58.058  1.00 41.82  ? 339 TYR A CD2   1 
ATOM   2367  C  CE1   . TYR A  1 339 ? 8.545   -6.636   57.118  1.00 39.69  ? 339 TYR A CE1   1 
ATOM   2368  C  CE2   . TYR A  1 339 ? 9.293   -5.201   58.889  1.00 41.51  ? 339 TYR A CE2   1 
ATOM   2369  C  CZ    . TYR A  1 339 ? 8.996   -6.469   58.409  1.00 40.51  ? 339 TYR A CZ    1 
ATOM   2370  O  OH    . TYR A  1 339 ? 9.151   -7.566   59.236  1.00 41.24  ? 339 TYR A OH    1 
ATOM   2371  N  N     . ILE A  1 340 ? 5.929   -1.567   57.162  1.00 39.59  ? 340 ILE A N     1 
ATOM   2372  C  CA    . ILE A  1 340 ? 5.065   -1.448   58.325  1.00 38.58  ? 340 ILE A CA    1 
ATOM   2373  C  C     . ILE A  1 340 ? 3.547   -1.533   58.014  1.00 39.23  ? 340 ILE A C     1 
ATOM   2374  O  O     . ILE A  1 340 ? 2.823   -2.217   58.749  1.00 39.71  ? 340 ILE A O     1 
ATOM   2375  C  CB    . ILE A  1 340 ? 5.444   -0.279   59.258  1.00 37.43  ? 340 ILE A CB    1 
ATOM   2376  C  CG1   . ILE A  1 340 ? 6.933   -0.339   59.649  1.00 36.27  ? 340 ILE A CG1   1 
ATOM   2377  C  CG2   . ILE A  1 340 ? 4.577   -0.282   60.504  1.00 36.32  ? 340 ILE A CG2   1 
ATOM   2378  C  CD1   . ILE A  1 340 ? 7.408   -1.587   60.360  1.00 31.31  ? 340 ILE A CD1   1 
ATOM   2379  N  N     . PRO A  1 341 ? 3.058   -0.875   56.931  1.00 39.36  ? 341 PRO A N     1 
ATOM   2380  C  CA    . PRO A  1 341 ? 1.638   -1.044   56.635  1.00 39.54  ? 341 PRO A CA    1 
ATOM   2381  C  C     . PRO A  1 341 ? 1.269   -2.516   56.385  1.00 40.44  ? 341 PRO A C     1 
ATOM   2382  O  O     . PRO A  1 341 ? 0.209   -2.982   56.835  1.00 41.02  ? 341 PRO A O     1 
ATOM   2383  C  CB    . PRO A  1 341 ? 1.452   -0.195   55.377  1.00 40.02  ? 341 PRO A CB    1 
ATOM   2384  C  CG    . PRO A  1 341 ? 2.506   0.842    55.491  1.00 38.46  ? 341 PRO A CG    1 
ATOM   2385  C  CD    . PRO A  1 341 ? 3.668   0.131    56.044  1.00 39.10  ? 341 PRO A CD    1 
ATOM   2386  N  N     . THR A  1 342 ? 2.145   -3.240   55.696  1.00 40.56  ? 342 THR A N     1 
ATOM   2387  C  CA    . THR A  1 342 ? 1.957   -4.667   55.470  1.00 41.31  ? 342 THR A CA    1 
ATOM   2388  C  C     . THR A  1 342 ? 1.712   -5.392   56.802  1.00 41.17  ? 342 THR A C     1 
ATOM   2389  O  O     . THR A  1 342 ? 0.684   -6.081   56.980  1.00 41.74  ? 342 THR A O     1 
ATOM   2390  C  CB    . THR A  1 342 ? 3.191   -5.263   54.771  1.00 41.77  ? 342 THR A CB    1 
ATOM   2391  O  OG1   . THR A  1 342 ? 3.248   -4.785   53.422  1.00 42.24  ? 342 THR A OG1   1 
ATOM   2392  C  CG2   . THR A  1 342 ? 3.170   -6.781   54.786  1.00 42.02  ? 342 THR A CG2   1 
ATOM   2393  N  N     . ASN A  1 343 ? 2.658   -5.224   57.728  1.00 40.16  ? 343 ASN A N     1 
ATOM   2394  C  CA    . ASN A  1 343 ? 2.577   -5.851   59.017  1.00 39.47  ? 343 ASN A CA    1 
ATOM   2395  C  C     . ASN A  1 343 ? 1.199   -5.541   59.609  1.00 39.75  ? 343 ASN A C     1 
ATOM   2396  O  O     . ASN A  1 343 ? 0.442   -6.461   59.987  1.00 40.70  ? 343 ASN A O     1 
ATOM   2397  C  CB    . ASN A  1 343 ? 3.743   -5.403   59.913  1.00 38.58  ? 343 ASN A CB    1 
ATOM   2398  C  CG    . ASN A  1 343 ? 5.119   -5.945   59.436  1.00 39.37  ? 343 ASN A CG    1 
ATOM   2399  O  OD1   . ASN A  1 343 ? 5.239   -6.578   58.389  1.00 40.86  ? 343 ASN A OD1   1 
ATOM   2400  N  ND2   . ASN A  1 343 ? 6.149   -5.687   60.217  1.00 38.04  ? 343 ASN A ND2   1 
ATOM   2401  N  N     . VAL A  1 344 ? 0.822   -4.268   59.602  1.00 38.74  ? 344 VAL A N     1 
ATOM   2402  C  CA    . VAL A  1 344 ? -0.349  -3.876   60.361  1.00 38.50  ? 344 VAL A CA    1 
ATOM   2403  C  C     . VAL A  1 344 ? -1.676  -4.223   59.659  1.00 39.80  ? 344 VAL A C     1 
ATOM   2404  O  O     . VAL A  1 344 ? -2.645  -4.603   60.324  1.00 39.88  ? 344 VAL A O     1 
ATOM   2405  C  CB    . VAL A  1 344 ? -0.253  -2.404   60.803  1.00 38.11  ? 344 VAL A CB    1 
ATOM   2406  C  CG1   . VAL A  1 344 ? -1.403  -2.021   61.755  1.00 34.38  ? 344 VAL A CG1   1 
ATOM   2407  C  CG2   . VAL A  1 344 ? 1.149   -2.165   61.462  1.00 36.88  ? 344 VAL A CG2   1 
ATOM   2408  N  N     . ILE A  1 345 ? -1.699  -4.122   58.328  1.00 40.35  ? 345 ILE A N     1 
ATOM   2409  C  CA    . ILE A  1 345 ? -2.860  -4.510   57.543  1.00 41.19  ? 345 ILE A CA    1 
ATOM   2410  C  C     . ILE A  1 345 ? -3.237  -5.957   57.852  1.00 42.69  ? 345 ILE A C     1 
ATOM   2411  O  O     . ILE A  1 345 ? -4.416  -6.262   58.056  1.00 43.90  ? 345 ILE A O     1 
ATOM   2412  C  CB    . ILE A  1 345 ? -2.630  -4.305   56.017  1.00 41.45  ? 345 ILE A CB    1 
ATOM   2413  C  CG1   . ILE A  1 345 ? -2.818  -2.830   55.640  1.00 41.48  ? 345 ILE A CG1   1 
ATOM   2414  C  CG2   . ILE A  1 345 ? -3.576  -5.156   55.196  1.00 39.83  ? 345 ILE A CG2   1 
ATOM   2415  C  CD1   . ILE A  1 345 ? -2.009  -2.384   54.417  1.00 39.53  ? 345 ILE A CD1   1 
ATOM   2416  N  N     . SER A  1 346 ? -2.235  -6.830   57.928  1.00 43.33  ? 346 SER A N     1 
ATOM   2417  C  CA    . SER A  1 346 ? -2.462  -8.259   58.096  1.00 44.69  ? 346 SER A CA    1 
ATOM   2418  C  C     . SER A  1 346 ? -2.744  -8.650   59.538  1.00 44.84  ? 346 SER A C     1 
ATOM   2419  O  O     . SER A  1 346 ? -3.414  -9.637   59.779  1.00 46.12  ? 346 SER A O     1 
ATOM   2420  C  CB    . SER A  1 346 ? -1.261  -9.055   57.588  1.00 45.34  ? 346 SER A CB    1 
ATOM   2421  O  OG    . SER A  1 346 ? -0.202  -9.016   58.527  1.00 45.02  ? 346 SER A OG    1 
ATOM   2422  N  N     . ILE A  1 347 ? -2.195  -7.910   60.495  1.00 44.31  ? 347 ILE A N     1 
ATOM   2423  C  CA    . ILE A  1 347 ? -2.488  -8.144   61.910  1.00 44.18  ? 347 ILE A CA    1 
ATOM   2424  C  C     . ILE A  1 347 ? -3.956  -7.842   62.228  1.00 44.87  ? 347 ILE A C     1 
ATOM   2425  O  O     . ILE A  1 347 ? -4.607  -8.594   62.959  1.00 46.35  ? 347 ILE A O     1 
ATOM   2426  C  CB    . ILE A  1 347 ? -1.558  -7.310   62.816  1.00 42.95  ? 347 ILE A CB    1 
ATOM   2427  C  CG1   . ILE A  1 347 ? -0.124  -7.855   62.716  1.00 43.23  ? 347 ILE A CG1   1 
ATOM   2428  C  CG2   . ILE A  1 347 ? -2.054  -7.300   64.240  1.00 41.11  ? 347 ILE A CG2   1 
ATOM   2429  C  CD1   . ILE A  1 347 ? 0.992   -6.839   63.052  1.00 40.88  ? 347 ILE A CD1   1 
ATOM   2430  N  N     . THR A  1 348 ? -4.476  -6.762   61.657  1.00 44.52  ? 348 THR A N     1 
ATOM   2431  C  CA    . THR A  1 348 ? -5.801  -6.235   62.033  1.00 45.10  ? 348 THR A CA    1 
ATOM   2432  C  C     . THR A  1 348 ? -6.990  -6.938   61.343  1.00 46.00  ? 348 THR A C     1 
ATOM   2433  O  O     . THR A  1 348 ? -6.806  -7.941   60.671  1.00 47.25  ? 348 THR A O     1 
ATOM   2434  C  CB    . THR A  1 348 ? -5.850  -4.717   61.815  1.00 44.21  ? 348 THR A CB    1 
ATOM   2435  O  OG1   . THR A  1 348 ? -5.165  -4.407   60.599  1.00 44.62  ? 348 THR A OG1   1 
ATOM   2436  C  CG2   . THR A  1 348 ? -5.135  -4.010   62.947  1.00 43.36  ? 348 THR A CG2   1 
ATOM   2437  N  N     . ASP A  1 349 ? -8.189  -6.403   61.523  1.00 46.08  ? 349 ASP A N     1 
ATOM   2438  C  CA    . ASP A  1 349 ? -9.425  -7.024   61.068  1.00 47.15  ? 349 ASP A CA    1 
ATOM   2439  C  C     . ASP A  1 349 ? -10.050 -6.252   59.920  1.00 47.37  ? 349 ASP A C     1 
ATOM   2440  O  O     . ASP A  1 349 ? -11.169 -6.549   59.514  1.00 48.67  ? 349 ASP A O     1 
ATOM   2441  C  CB    . ASP A  1 349 ? -10.435 -7.075   62.220  1.00 47.67  ? 349 ASP A CB    1 
ATOM   2442  C  CG    . ASP A  1 349 ? -10.009 -8.012   63.319  1.00 48.30  ? 349 ASP A CG    1 
ATOM   2443  O  OD1   . ASP A  1 349 ? -9.691  -9.155   62.989  1.00 50.53  ? 349 ASP A OD1   1 
ATOM   2444  O  OD2   . ASP A  1 349 ? -9.983  -7.624   64.507  1.00 48.18  ? 349 ASP A OD2   1 
ATOM   2445  N  N     . GLY A  1 350 ? -9.340  -5.255   59.404  1.00 46.30  ? 350 GLY A N     1 
ATOM   2446  C  CA    . GLY A  1 350 ? -9.884  -4.432   58.335  1.00 45.89  ? 350 GLY A CA    1 
ATOM   2447  C  C     . GLY A  1 350 ? -9.277  -3.056   58.302  1.00 44.70  ? 350 GLY A C     1 
ATOM   2448  O  O     . GLY A  1 350 ? -8.558  -2.656   59.210  1.00 43.48  ? 350 GLY A O     1 
ATOM   2449  N  N     . GLN A  1 351 ? -9.603  -2.339   57.237  1.00 45.28  ? 351 GLN A N     1 
ATOM   2450  C  CA    . GLN A  1 351 ? -8.985  -1.076   56.892  1.00 44.92  ? 351 GLN A CA    1 
ATOM   2451  C  C     . GLN A  1 351 ? -10.092 -0.041   56.662  1.00 45.20  ? 351 GLN A C     1 
ATOM   2452  O  O     . GLN A  1 351 ? -11.057 -0.309   55.954  1.00 45.44  ? 351 GLN A O     1 
ATOM   2453  C  CB    . GLN A  1 351 ? -8.159  -1.231   55.589  1.00 45.14  ? 351 GLN A CB    1 
ATOM   2454  C  CG    . GLN A  1 351 ? -6.946  -2.130   55.653  1.00 46.34  ? 351 GLN A CG    1 
ATOM   2455  C  CD    . GLN A  1 351 ? -7.284  -3.644   55.711  1.00 51.12  ? 351 GLN A CD    1 
ATOM   2456  O  OE1   . GLN A  1 351 ? -7.939  -4.183   54.807  1.00 53.34  ? 351 GLN A OE1   1 
ATOM   2457  N  NE2   . GLN A  1 351 ? -6.807  -4.337   56.772  1.00 50.31  ? 351 GLN A NE2   1 
ATOM   2458  N  N     . ILE A  1 352 ? -9.953  1.133    57.272  1.00 44.93  ? 352 ILE A N     1 
ATOM   2459  C  CA    . ILE A  1 352 ? -10.635 2.331    56.786  1.00 45.49  ? 352 ILE A CA    1 
ATOM   2460  C  C     . ILE A  1 352 ? -9.575  3.125    56.027  1.00 45.67  ? 352 ILE A C     1 
ATOM   2461  O  O     . ILE A  1 352 ? -8.649  3.671    56.646  1.00 45.16  ? 352 ILE A O     1 
ATOM   2462  C  CB    . ILE A  1 352 ? -11.230 3.192    57.918  1.00 44.97  ? 352 ILE A CB    1 
ATOM   2463  C  CG1   . ILE A  1 352 ? -12.401 2.472    58.588  1.00 45.49  ? 352 ILE A CG1   1 
ATOM   2464  C  CG2   . ILE A  1 352 ? -11.709 4.528    57.367  1.00 45.17  ? 352 ILE A CG2   1 
ATOM   2465  C  CD1   . ILE A  1 352 ? -12.880 3.122    59.866  1.00 44.90  ? 352 ILE A CD1   1 
ATOM   2466  N  N     . PHE A  1 353 ? -9.709  3.165    54.698  1.00 46.51  ? 353 PHE A N     1 
ATOM   2467  C  CA    . PHE A  1 353 ? -8.717  3.789    53.813  1.00 46.45  ? 353 PHE A CA    1 
ATOM   2468  C  C     . PHE A  1 353 ? -9.010  5.228    53.375  1.00 46.81  ? 353 PHE A C     1 
ATOM   2469  O  O     . PHE A  1 353 ? -9.898  5.446    52.569  1.00 48.11  ? 353 PHE A O     1 
ATOM   2470  C  CB    . PHE A  1 353 ? -8.532  2.958    52.551  1.00 47.02  ? 353 PHE A CB    1 
ATOM   2471  C  CG    . PHE A  1 353 ? -7.194  3.150    51.923  1.00 48.69  ? 353 PHE A CG    1 
ATOM   2472  C  CD1   . PHE A  1 353 ? -6.853  4.364    51.311  1.00 49.78  ? 353 PHE A CD1   1 
ATOM   2473  C  CD2   . PHE A  1 353 ? -6.239  2.136    51.981  1.00 50.12  ? 353 PHE A CD2   1 
ATOM   2474  C  CE1   . PHE A  1 353 ? -5.585  4.558    50.743  1.00 50.40  ? 353 PHE A CE1   1 
ATOM   2475  C  CE2   . PHE A  1 353 ? -4.963  2.322    51.421  1.00 50.51  ? 353 PHE A CE2   1 
ATOM   2476  C  CZ    . PHE A  1 353 ? -4.638  3.541    50.802  1.00 50.51  ? 353 PHE A CZ    1 
ATOM   2477  N  N     . LEU A  1 354 ? -8.216  6.193    53.832  1.00 46.07  ? 354 LEU A N     1 
ATOM   2478  C  CA    . LEU A  1 354 ? -8.433  7.596    53.460  1.00 46.66  ? 354 LEU A CA    1 
ATOM   2479  C  C     . LEU A  1 354 ? -7.593  8.065    52.274  1.00 47.36  ? 354 LEU A C     1 
ATOM   2480  O  O     . LEU A  1 354 ? -6.512  7.555    52.047  1.00 47.33  ? 354 LEU A O     1 
ATOM   2481  C  CB    . LEU A  1 354 ? -8.280  8.493    54.682  1.00 46.15  ? 354 LEU A CB    1 
ATOM   2482  C  CG    . LEU A  1 354 ? -9.412  8.153    55.683  1.00 46.26  ? 354 LEU A CG    1 
ATOM   2483  C  CD1   . LEU A  1 354 ? -8.863  7.408    56.881  1.00 45.67  ? 354 LEU A CD1   1 
ATOM   2484  C  CD2   . LEU A  1 354 ? -10.180 9.348    56.154  1.00 44.68  ? 354 LEU A CD2   1 
ATOM   2485  N  N     . GLU A  1 355 ? -8.090  9.020    51.499  1.00 48.89  ? 355 GLU A N     1 
ATOM   2486  C  CA    . GLU A  1 355 ? -7.399  9.433    50.264  1.00 50.38  ? 355 GLU A CA    1 
ATOM   2487  C  C     . GLU A  1 355 ? -7.461  10.926   49.956  1.00 51.35  ? 355 GLU A C     1 
ATOM   2488  O  O     . GLU A  1 355 ? -8.553  11.500   49.883  1.00 52.37  ? 355 GLU A O     1 
ATOM   2489  C  CB    . GLU A  1 355 ? -8.022  8.740    49.064  1.00 51.95  ? 355 GLU A CB    1 
ATOM   2490  C  CG    . GLU A  1 355 ? -7.598  7.331    48.815  1.00 53.45  ? 355 GLU A CG    1 
ATOM   2491  C  CD    . GLU A  1 355 ? -8.162  6.837    47.504  1.00 58.75  ? 355 GLU A CD    1 
ATOM   2492  O  OE1   . GLU A  1 355 ? -8.725  7.665    46.744  1.00 60.42  ? 355 GLU A OE1   1 
ATOM   2493  O  OE2   . GLU A  1 355 ? -8.040  5.623    47.223  1.00 61.44  ? 355 GLU A OE2   1 
ATOM   2494  N  N     . ALA A  1 356 ? -6.304  11.538   49.710  1.00 51.07  ? 356 ALA A N     1 
ATOM   2495  C  CA    . ALA A  1 356 ? -6.239  12.950   49.320  1.00 51.85  ? 356 ALA A CA    1 
ATOM   2496  C  C     . ALA A  1 356 ? -7.173  13.292   48.154  1.00 53.83  ? 356 ALA A C     1 
ATOM   2497  O  O     . ALA A  1 356 ? -7.868  14.303   48.176  1.00 54.79  ? 356 ALA A O     1 
ATOM   2498  C  CB    . ALA A  1 356 ? -4.814  13.333   48.972  1.00 51.55  ? 356 ALA A CB    1 
ATOM   2499  N  N     . GLU A  1 357 ? -7.168  12.454   47.127  1.00 54.64  ? 357 GLU A N     1 
ATOM   2500  C  CA    . GLU A  1 357 ? -7.987  12.676   45.945  1.00 56.82  ? 357 GLU A CA    1 
ATOM   2501  C  C     . GLU A  1 357 ? -9.408  12.997   46.328  1.00 57.28  ? 357 GLU A C     1 
ATOM   2502  O  O     . GLU A  1 357 ? -9.930  14.056   45.996  1.00 59.07  ? 357 GLU A O     1 
ATOM   2503  C  CB    . GLU A  1 357 ? -8.004  11.407   45.122  1.00 57.42  ? 357 GLU A CB    1 
ATOM   2504  C  CG    . GLU A  1 357 ? -6.878  11.303   44.173  1.00 59.47  ? 357 GLU A CG    1 
ATOM   2505  C  CD    . GLU A  1 357 ? -7.290  11.718   42.804  1.00 64.13  ? 357 GLU A CD    1 
ATOM   2506  O  OE1   . GLU A  1 357 ? -8.527  11.703   42.536  1.00 66.36  ? 357 GLU A OE1   1 
ATOM   2507  O  OE2   . GLU A  1 357 ? -6.380  12.044   42.002  1.00 65.70  ? 357 GLU A OE2   1 
ATOM   2508  N  N     . LEU A  1 358 ? -10.031 12.059   47.030  1.00 56.23  ? 358 LEU A N     1 
ATOM   2509  C  CA    . LEU A  1 358 ? -11.397 12.212   47.486  1.00 56.49  ? 358 LEU A CA    1 
ATOM   2510  C  C     . LEU A  1 358 ? -11.473 13.481   48.302  1.00 56.34  ? 358 LEU A C     1 
ATOM   2511  O  O     . LEU A  1 358 ? -12.299 14.336   48.036  1.00 57.89  ? 358 LEU A O     1 
ATOM   2512  C  CB    . LEU A  1 358 ? -11.845 10.992   48.314  1.00 55.32  ? 358 LEU A CB    1 
ATOM   2513  C  CG    . LEU A  1 358 ? -12.006 9.632    47.617  1.00 54.86  ? 358 LEU A CG    1 
ATOM   2514  C  CD1   . LEU A  1 358 ? -12.178 8.542    48.641  1.00 53.24  ? 358 LEU A CD1   1 
ATOM   2515  C  CD2   . LEU A  1 358 ? -13.182 9.647    46.681  1.00 56.67  ? 358 LEU A CD2   1 
ATOM   2516  N  N     . PHE A  1 359 ? -10.573 13.617   49.264  1.00 55.01  ? 359 PHE A N     1 
ATOM   2517  C  CA    . PHE A  1 359 ? -10.531 14.793   50.106  1.00 55.41  ? 359 PHE A CA    1 
ATOM   2518  C  C     . PHE A  1 359 ? -10.633 16.084   49.308  1.00 57.19  ? 359 PHE A C     1 
ATOM   2519  O  O     . PHE A  1 359 ? -11.478 16.912   49.601  1.00 58.33  ? 359 PHE A O     1 
ATOM   2520  C  CB    . PHE A  1 359 ? -9.269  14.802   50.945  1.00 54.14  ? 359 PHE A CB    1 
ATOM   2521  C  CG    . PHE A  1 359 ? -9.302  15.786   52.065  1.00 55.60  ? 359 PHE A CG    1 
ATOM   2522  C  CD1   . PHE A  1 359 ? -9.034  17.133   51.832  1.00 58.73  ? 359 PHE A CD1   1 
ATOM   2523  C  CD2   . PHE A  1 359 ? -9.590  15.371   53.356  1.00 55.33  ? 359 PHE A CD2   1 
ATOM   2524  C  CE1   . PHE A  1 359 ? -9.055  18.054   52.867  1.00 59.83  ? 359 PHE A CE1   1 
ATOM   2525  C  CE2   . PHE A  1 359 ? -9.625  16.285   54.399  1.00 57.37  ? 359 PHE A CE2   1 
ATOM   2526  C  CZ    . PHE A  1 359 ? -9.356  17.635   54.151  1.00 59.32  ? 359 PHE A CZ    1 
ATOM   2527  N  N     . TYR A  1 360 ? -9.802  16.249   48.287  1.00 58.01  ? 360 TYR A N     1 
ATOM   2528  C  CA    . TYR A  1 360 ? -9.815  17.490   47.517  1.00 59.80  ? 360 TYR A CA    1 
ATOM   2529  C  C     . TYR A  1 360 ? -11.127 17.707   46.773  1.00 61.38  ? 360 TYR A C     1 
ATOM   2530  O  O     . TYR A  1 360 ? -11.523 18.854   46.549  1.00 62.87  ? 360 TYR A O     1 
ATOM   2531  C  CB    . TYR A  1 360 ? -8.635  17.580   46.545  1.00 60.39  ? 360 TYR A CB    1 
ATOM   2532  C  CG    . TYR A  1 360 ? -7.256  17.320   47.130  1.00 59.29  ? 360 TYR A CG    1 
ATOM   2533  C  CD1   . TYR A  1 360 ? -6.850  17.882   48.351  1.00 58.26  ? 360 TYR A CD1   1 
ATOM   2534  C  CD2   . TYR A  1 360 ? -6.333  16.541   46.421  1.00 59.69  ? 360 TYR A CD2   1 
ATOM   2535  C  CE1   . TYR A  1 360 ? -5.568  17.638   48.860  1.00 56.89  ? 360 TYR A CE1   1 
ATOM   2536  C  CE2   . TYR A  1 360 ? -5.052  16.307   46.900  1.00 58.20  ? 360 TYR A CE2   1 
ATOM   2537  C  CZ    . TYR A  1 360 ? -4.668  16.848   48.119  1.00 58.01  ? 360 TYR A CZ    1 
ATOM   2538  O  OH    . TYR A  1 360 ? -3.382  16.574   48.578  1.00 58.01  ? 360 TYR A OH    1 
ATOM   2539  N  N     . LYS A  1 361 ? -11.791 16.607   46.405  1.00 61.48  ? 361 LYS A N     1 
ATOM   2540  C  CA    . LYS A  1 361 ? -13.119 16.639   45.731  1.00 63.30  ? 361 LYS A CA    1 
ATOM   2541  C  C     . LYS A  1 361 ? -14.233 17.024   46.687  1.00 63.07  ? 361 LYS A C     1 
ATOM   2542  O  O     . LYS A  1 361 ? -15.382 17.152   46.281  1.00 64.89  ? 361 LYS A O     1 
ATOM   2543  C  CB    . LYS A  1 361 ? -13.489 15.280   45.119  1.00 63.23  ? 361 LYS A CB    1 
ATOM   2544  C  CG    . LYS A  1 361 ? -12.689 14.854   43.899  1.00 64.83  ? 361 LYS A CG    1 
ATOM   2545  C  CD    . LYS A  1 361 ? -13.431 13.753   43.149  1.00 67.29  ? 361 LYS A CD    1 
ATOM   2546  C  CE    . LYS A  1 361 ? -12.730 13.352   41.855  1.00 69.02  ? 361 LYS A CE    1 
ATOM   2547  N  NZ    . LYS A  1 361 ? -11.921 12.117   42.020  1.00 67.75  ? 361 LYS A NZ    1 
ATOM   2548  N  N     . GLY A  1 362 ? -13.897 17.181   47.958  1.00 61.33  ? 362 GLY A N     1 
ATOM   2549  C  CA    . GLY A  1 362 ? -14.868 17.597   48.935  1.00 61.53  ? 362 GLY A CA    1 
ATOM   2550  C  C     . GLY A  1 362 ? -15.527 16.434   49.634  1.00 60.62  ? 362 GLY A C     1 
ATOM   2551  O  O     . GLY A  1 362 ? -16.295 16.637   50.571  1.00 61.25  ? 362 GLY A O     1 
ATOM   2552  N  N     . ILE A  1 363 ? -15.244 15.211   49.192  1.00 59.58  ? 363 ILE A N     1 
ATOM   2553  C  CA    . ILE A  1 363 ? -15.756 14.035   49.889  1.00 57.80  ? 363 ILE A CA    1 
ATOM   2554  C  C     . ILE A  1 363 ? -14.994 13.929   51.197  1.00 55.68  ? 363 ILE A C     1 
ATOM   2555  O  O     . ILE A  1 363 ? -13.818 13.558   51.194  1.00 54.94  ? 363 ILE A O     1 
ATOM   2556  C  CB    . ILE A  1 363 ? -15.600 12.759   49.040  1.00 57.68  ? 363 ILE A CB    1 
ATOM   2557  C  CG1   . ILE A  1 363 ? -16.612 12.774   47.892  1.00 59.56  ? 363 ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A  1 363 ? -15.799 11.511   49.892  1.00 56.11  ? 363 ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A  1 363 ? -16.143 12.089   46.645  1.00 59.73  ? 363 ILE A CD1   1 
ATOM   2560  N  N     . ARG A  1 364 ? -15.641 14.304   52.301  1.00 54.82  ? 364 ARG A N     1 
ATOM   2561  C  CA    . ARG A  1 364 ? -15.027 14.214   53.627  1.00 53.09  ? 364 ARG A CA    1 
ATOM   2562  C  C     . ARG A  1 364 ? -16.042 13.641   54.592  1.00 52.60  ? 364 ARG A C     1 
ATOM   2563  O  O     . ARG A  1 364 ? -17.201 14.050   54.559  1.00 53.72  ? 364 ARG A O     1 
ATOM   2564  C  CB    . ARG A  1 364 ? -14.553 15.588   54.125  1.00 53.51  ? 364 ARG A CB    1 
ATOM   2565  C  CG    . ARG A  1 364 ? -13.359 16.196   53.379  1.00 55.10  ? 364 ARG A CG    1 
ATOM   2566  C  CD    . ARG A  1 364 ? -13.526 17.706   53.152  1.00 58.95  ? 364 ARG A CD    1 
ATOM   2567  N  NE    . ARG A  1 364 ? -12.333 18.351   52.567  1.00 61.25  ? 364 ARG A NE    1 
ATOM   2568  C  CZ    . ARG A  1 364 ? -12.328 19.560   51.993  1.00 63.49  ? 364 ARG A CZ    1 
ATOM   2569  N  NH1   . ARG A  1 364 ? -13.437 20.287   51.911  1.00 66.53  ? 364 ARG A NH1   1 
ATOM   2570  N  NH2   . ARG A  1 364 ? -11.213 20.054   51.488  1.00 63.61  ? 364 ARG A NH2   1 
ATOM   2571  N  N     . PRO A  1 365 ? -15.642 12.660   55.431  1.00 51.10  ? 365 PRO A N     1 
ATOM   2572  C  CA    . PRO A  1 365 ? -14.368 11.947   55.476  1.00 49.89  ? 365 PRO A CA    1 
ATOM   2573  C  C     . PRO A  1 365 ? -13.974 11.393   54.125  1.00 50.52  ? 365 PRO A C     1 
ATOM   2574  O  O     . PRO A  1 365 ? -14.821 11.011   53.348  1.00 51.52  ? 365 PRO A O     1 
ATOM   2575  C  CB    . PRO A  1 365 ? -14.636 10.802   56.456  1.00 48.73  ? 365 PRO A CB    1 
ATOM   2576  C  CG    . PRO A  1 365 ? -16.100 10.838   56.731  1.00 49.02  ? 365 PRO A CG    1 
ATOM   2577  C  CD    . PRO A  1 365 ? -16.528 12.210   56.516  1.00 50.63  ? 365 PRO A CD    1 
ATOM   2578  N  N     . ALA A  1 366 ? -12.685 11.373   53.835  1.00 50.87  ? 366 ALA A N     1 
ATOM   2579  C  CA    . ALA A  1 366 ? -12.244 10.928   52.521  1.00 51.80  ? 366 ALA A CA    1 
ATOM   2580  C  C     . ALA A  1 366 ? -12.068 9.418    52.501  1.00 51.18  ? 366 ALA A C     1 
ATOM   2581  O  O     . ALA A  1 366 ? -10.994 8.931    52.185  1.00 51.20  ? 366 ALA A O     1 
ATOM   2582  C  CB    . ALA A  1 366 ? -10.968 11.630   52.132  1.00 51.38  ? 366 ALA A CB    1 
ATOM   2583  N  N     . ILE A  1 367 ? -13.121 8.687    52.858  1.00 51.23  ? 367 ILE A N     1 
ATOM   2584  C  CA    . ILE A  1 367 ? -13.062 7.235    52.895  1.00 50.59  ? 367 ILE A CA    1 
ATOM   2585  C  C     . ILE A  1 367 ? -13.287 6.665    51.506  1.00 52.07  ? 367 ILE A C     1 
ATOM   2586  O  O     . ILE A  1 367 ? -14.289 6.953    50.846  1.00 53.83  ? 367 ILE A O     1 
ATOM   2587  C  CB    . ILE A  1 367 ? -14.079 6.629    53.882  1.00 50.40  ? 367 ILE A CB    1 
ATOM   2588  C  CG1   . ILE A  1 367 ? -13.818 7.146    55.294  1.00 49.37  ? 367 ILE A CG1   1 
ATOM   2589  C  CG2   . ILE A  1 367 ? -14.013 5.097    53.866  1.00 49.41  ? 367 ILE A CG2   1 
ATOM   2590  C  CD1   . ILE A  1 367 ? -14.992 6.954    56.231  1.00 50.73  ? 367 ILE A CD1   1 
ATOM   2591  N  N     . ASN A  1 368 ? -12.330 5.856    51.073  1.00 51.75  ? 368 ASN A N     1 
ATOM   2592  C  CA    . ASN A  1 368 ? -12.427 5.090    49.847  1.00 52.74  ? 368 ASN A CA    1 
ATOM   2593  C  C     . ASN A  1 368 ? -13.198 3.822    50.144  1.00 53.06  ? 368 ASN A C     1 
ATOM   2594  O  O     . ASN A  1 368 ? -12.623 2.837    50.606  1.00 52.26  ? 368 ASN A O     1 
ATOM   2595  C  CB    . ASN A  1 368 ? -11.026 4.745    49.351  1.00 52.05  ? 368 ASN A CB    1 
ATOM   2596  C  CG    . ASN A  1 368 ? -11.031 4.008    48.034  1.00 53.69  ? 368 ASN A CG    1 
ATOM   2597  O  OD1   . ASN A  1 368 ? -11.785 3.058    47.830  1.00 55.06  ? 368 ASN A OD1   1 
ATOM   2598  N  ND2   . ASN A  1 368 ? -10.171 4.439    47.127  1.00 54.87  ? 368 ASN A ND2   1 
ATOM   2599  N  N     . VAL A  1 369 ? -14.504 3.858    49.897  1.00 54.66  ? 369 VAL A N     1 
ATOM   2600  C  CA    . VAL A  1 369 ? -15.364 2.697    50.118  1.00 55.36  ? 369 VAL A CA    1 
ATOM   2601  C  C     . VAL A  1 369 ? -14.769 1.376    49.585  1.00 55.52  ? 369 VAL A C     1 
ATOM   2602  O  O     . VAL A  1 369 ? -14.621 0.411    50.333  1.00 55.01  ? 369 VAL A O     1 
ATOM   2603  C  CB    . VAL A  1 369 ? -16.726 2.906    49.479  1.00 57.27  ? 369 VAL A CB    1 
ATOM   2604  C  CG1   . VAL A  1 369 ? -17.558 1.644    49.624  1.00 58.04  ? 369 VAL A CG1   1 
ATOM   2605  C  CG2   . VAL A  1 369 ? -17.418 4.110    50.103  1.00 57.17  ? 369 VAL A CG2   1 
ATOM   2606  N  N     . GLY A  1 370 ? -14.417 1.346    48.303  1.00 56.30  ? 370 GLY A N     1 
ATOM   2607  C  CA    . GLY A  1 370 ? -13.964 0.123    47.663  1.00 56.89  ? 370 GLY A CA    1 
ATOM   2608  C  C     . GLY A  1 370 ? -12.660 -0.448   48.191  1.00 55.85  ? 370 GLY A C     1 
ATOM   2609  O  O     . GLY A  1 370 ? -12.235 -1.512   47.758  1.00 56.57  ? 370 GLY A O     1 
ATOM   2610  N  N     . LEU A  1 371 ? -12.009 0.255    49.111  1.00 54.52  ? 371 LEU A N     1 
ATOM   2611  C  CA    . LEU A  1 371 ? -10.745 -0.212   49.664  1.00 53.44  ? 371 LEU A CA    1 
ATOM   2612  C  C     . LEU A  1 371 ? -10.868 -0.429   51.156  1.00 52.65  ? 371 LEU A C     1 
ATOM   2613  O  O     . LEU A  1 371 ? -9.910  -0.834   51.813  1.00 52.37  ? 371 LEU A O     1 
ATOM   2614  C  CB    . LEU A  1 371 ? -9.616  0.790    49.402  1.00 52.58  ? 371 LEU A CB    1 
ATOM   2615  C  CG    . LEU A  1 371 ? -9.013  0.851    47.998  1.00 54.06  ? 371 LEU A CG    1 
ATOM   2616  C  CD1   . LEU A  1 371 ? -7.870  1.860    47.925  1.00 51.71  ? 371 LEU A CD1   1 
ATOM   2617  C  CD2   . LEU A  1 371 ? -8.561  -0.528   47.519  1.00 53.54  ? 371 LEU A CD2   1 
ATOM   2618  N  N     . SER A  1 372 ? -12.032 -0.123   51.700  1.00 52.93  ? 372 SER A N     1 
ATOM   2619  C  CA    . SER A  1 372 ? -12.234 -0.233   53.122  1.00 52.13  ? 372 SER A CA    1 
ATOM   2620  C  C     . SER A  1 372 ? -13.023 -1.503   53.394  1.00 52.87  ? 372 SER A C     1 
ATOM   2621  O  O     . SER A  1 372 ? -13.772 -1.947   52.543  1.00 55.09  ? 372 SER A O     1 
ATOM   2622  C  CB    . SER A  1 372 ? -12.933 1.023    53.628  1.00 52.09  ? 372 SER A CB    1 
ATOM   2623  O  OG    . SER A  1 372 ? -12.110 2.164    53.352  1.00 51.19  ? 372 SER A OG    1 
ATOM   2624  N  N     . VAL A  1 373 ? -12.811 -2.121   54.549  1.00 51.83  ? 373 VAL A N     1 
ATOM   2625  C  CA    . VAL A  1 373 ? -13.461 -3.386   54.895  1.00 51.99  ? 373 VAL A CA    1 
ATOM   2626  C  C     . VAL A  1 373 ? -13.451 -3.557   56.389  1.00 51.16  ? 373 VAL A C     1 
ATOM   2627  O  O     . VAL A  1 373 ? -12.623 -2.978   57.095  1.00 49.64  ? 373 VAL A O     1 
ATOM   2628  C  CB    . VAL A  1 373 ? -12.748 -4.638   54.304  1.00 52.15  ? 373 VAL A CB    1 
ATOM   2629  C  CG1   . VAL A  1 373 ? -13.245 -4.951   52.913  1.00 53.98  ? 373 VAL A CG1   1 
ATOM   2630  C  CG2   . VAL A  1 373 ? -11.233 -4.473   54.320  1.00 50.78  ? 373 VAL A CG2   1 
ATOM   2631  N  N     . SER A  1 374 ? -14.380 -4.370   56.868  1.00 52.06  ? 374 SER A N     1 
ATOM   2632  C  CA    . SER A  1 374 ? -14.364 -4.785   58.247  1.00 51.34  ? 374 SER A CA    1 
ATOM   2633  C  C     . SER A  1 374 ? -14.712 -6.247   58.242  1.00 52.23  ? 374 SER A C     1 
ATOM   2634  O  O     . SER A  1 374 ? -15.850 -6.598   58.038  1.00 53.72  ? 374 SER A O     1 
ATOM   2635  C  CB    . SER A  1 374 ? -15.369 -3.991   59.050  1.00 50.86  ? 374 SER A CB    1 
ATOM   2636  O  OG    . SER A  1 374 ? -15.472 -4.567   60.327  1.00 51.36  ? 374 SER A OG    1 
ATOM   2637  N  N     . ARG A  1 375 ? -13.727 -7.107   58.437  1.00 52.27  ? 375 ARG A N     1 
ATOM   2638  C  CA    . ARG A  1 375 ? -13.955 -8.534   58.238  1.00 54.15  ? 375 ARG A CA    1 
ATOM   2639  C  C     . ARG A  1 375 ? -15.088 -8.999   59.130  1.00 54.92  ? 375 ARG A C     1 
ATOM   2640  O  O     . ARG A  1 375 ? -15.899 -9.837   58.712  1.00 56.87  ? 375 ARG A O     1 
ATOM   2641  C  CB    . ARG A  1 375 ? -12.670 -9.365   58.409  1.00 54.08  ? 375 ARG A CB    1 
ATOM   2642  C  CG    . ARG A  1 375 ? -11.791 -9.358   57.147  1.00 56.04  ? 375 ARG A CG    1 
ATOM   2643  C  CD    . ARG A  1 375 ? -10.301 -9.406   57.436  1.00 59.19  ? 375 ARG A CD    1 
ATOM   2644  N  NE    . ARG A  1 375 ? -9.554  -8.776   56.344  1.00 63.26  ? 375 ARG A NE    1 
ATOM   2645  C  CZ    . ARG A  1 375 ? -8.584  -7.869   56.499  1.00 64.86  ? 375 ARG A CZ    1 
ATOM   2646  N  NH1   . ARG A  1 375 ? -8.196  -7.488   57.715  1.00 64.54  ? 375 ARG A NH1   1 
ATOM   2647  N  NH2   . ARG A  1 375 ? -7.975  -7.353   55.433  1.00 65.66  ? 375 ARG A NH2   1 
ATOM   2648  N  N     . VAL A  1 376 ? -15.171 -8.421   60.329  1.00 53.59  ? 376 VAL A N     1 
ATOM   2649  C  CA    . VAL A  1 376 ? -16.296 -8.670   61.218  1.00 54.06  ? 376 VAL A CA    1 
ATOM   2650  C  C     . VAL A  1 376 ? -17.599 -8.419   60.483  1.00 55.58  ? 376 VAL A C     1 
ATOM   2651  O  O     . VAL A  1 376 ? -18.477 -9.274   60.484  1.00 57.40  ? 376 VAL A O     1 
ATOM   2652  C  CB    . VAL A  1 376 ? -16.234 -7.814   62.498  1.00 53.06  ? 376 VAL A CB    1 
ATOM   2653  C  CG1   . VAL A  1 376 ? -17.606 -7.731   63.158  1.00 53.61  ? 376 VAL A CG1   1 
ATOM   2654  C  CG2   . VAL A  1 376 ? -15.213 -8.398   63.467  1.00 51.86  ? 376 VAL A CG2   1 
ATOM   2655  N  N     . GLY A  1 377 ? -17.710 -7.249   59.854  1.00 55.42  ? 377 GLY A N     1 
ATOM   2656  C  CA    . GLY A  1 377 ? -18.904 -6.847   59.091  1.00 56.48  ? 377 GLY A CA    1 
ATOM   2657  C  C     . GLY A  1 377 ? -20.183 -6.679   59.887  1.00 57.38  ? 377 GLY A C     1 
ATOM   2658  O  O     . GLY A  1 377 ? -20.195 -6.081   60.964  1.00 56.87  ? 377 GLY A O     1 
ATOM   2659  N  N     . SER A  1 378 ? -21.256 -7.230   59.332  1.00 59.26  ? 378 SER A N     1 
ATOM   2660  C  CA    . SER A  1 378 ? -22.631 -7.051   59.815  1.00 60.66  ? 378 SER A CA    1 
ATOM   2661  C  C     . SER A  1 378 ? -22.795 -7.364   61.274  1.00 60.28  ? 378 SER A C     1 
ATOM   2662  O  O     . SER A  1 378 ? -23.638 -6.773   61.932  1.00 61.08  ? 378 SER A O     1 
ATOM   2663  C  CB    . SER A  1 378 ? -23.581 -7.997   59.071  1.00 63.05  ? 378 SER A CB    1 
ATOM   2664  O  OG    . SER A  1 378 ? -23.949 -7.497   57.804  1.00 64.73  ? 378 SER A OG    1 
ATOM   2665  N  N     . ALA A  1 379 ? -22.022 -8.328   61.763  1.00 59.47  ? 379 ALA A N     1 
ATOM   2666  C  CA    . ALA A  1 379 ? -22.205 -8.834   63.105  1.00 59.37  ? 379 ALA A CA    1 
ATOM   2667  C  C     . ALA A  1 379 ? -22.092 -7.725   64.112  1.00 58.40  ? 379 ALA A C     1 
ATOM   2668  O  O     . ALA A  1 379 ? -22.519 -7.888   65.242  1.00 59.83  ? 379 ALA A O     1 
ATOM   2669  C  CB    . ALA A  1 379 ? -21.201 -9.910   63.405  1.00 58.90  ? 379 ALA A CB    1 
ATOM   2670  N  N     . ALA A  1 380 ? -21.558 -6.584   63.681  1.00 56.91  ? 380 ALA A N     1 
ATOM   2671  C  CA    . ALA A  1 380 ? -21.235 -5.465   64.559  1.00 55.58  ? 380 ALA A CA    1 
ATOM   2672  C  C     . ALA A  1 380 ? -21.999 -4.166   64.225  1.00 55.80  ? 380 ALA A C     1 
ATOM   2673  O  O     . ALA A  1 380 ? -21.579 -3.059   64.611  1.00 55.54  ? 380 ALA A O     1 
ATOM   2674  C  CB    . ALA A  1 380 ? -19.765 -5.210   64.480  1.00 53.58  ? 380 ALA A CB    1 
ATOM   2675  N  N     . GLN A  1 381 ? -23.098 -4.287   63.501  1.00 56.25  ? 381 GLN A N     1 
ATOM   2676  C  CA    . GLN A  1 381 ? -23.760 -3.132   62.961  1.00 56.03  ? 381 GLN A CA    1 
ATOM   2677  C  C     . GLN A  1 381 ? -25.105 -3.134   63.627  1.00 58.02  ? 381 GLN A C     1 
ATOM   2678  O  O     . GLN A  1 381 ? -25.643 -4.218   63.883  1.00 59.83  ? 381 GLN A O     1 
ATOM   2679  C  CB    . GLN A  1 381 ? -23.889 -3.309   61.453  1.00 56.22  ? 381 GLN A CB    1 
ATOM   2680  C  CG    . GLN A  1 381 ? -24.484 -2.145   60.692  1.00 56.49  ? 381 GLN A CG    1 
ATOM   2681  C  CD    . GLN A  1 381 ? -24.259 -2.239   59.188  1.00 57.09  ? 381 GLN A CD    1 
ATOM   2682  O  OE1   . GLN A  1 381 ? -24.469 -3.292   58.572  1.00 59.31  ? 381 GLN A OE1   1 
ATOM   2683  N  NE2   . GLN A  1 381 ? -23.823 -1.136   58.589  1.00 56.04  ? 381 GLN A NE2   1 
ATOM   2684  N  N     . VAL A  1 382 ? -25.662 -1.961   63.932  1.00 57.92  ? 382 VAL A N     1 
ATOM   2685  C  CA    . VAL A  1 382 ? -27.048 -1.934   64.418  1.00 59.98  ? 382 VAL A CA    1 
ATOM   2686  C  C     . VAL A  1 382 ? -27.906 -2.535   63.311  1.00 61.20  ? 382 VAL A C     1 
ATOM   2687  O  O     . VAL A  1 382 ? -27.647 -2.290   62.135  1.00 60.60  ? 382 VAL A O     1 
ATOM   2688  C  CB    . VAL A  1 382 ? -27.561 -0.499   64.801  1.00 60.32  ? 382 VAL A CB    1 
ATOM   2689  C  CG1   . VAL A  1 382 ? -28.960 -0.572   65.454  1.00 62.12  ? 382 VAL A CG1   1 
ATOM   2690  C  CG2   . VAL A  1 382 ? -26.574 0.215    65.721  1.00 58.29  ? 382 VAL A CG2   1 
ATOM   2691  N  N     . LYS A  1 383 ? -28.908 -3.330   63.671  1.00 64.16  ? 383 LYS A N     1 
ATOM   2692  C  CA    . LYS A  1 383 ? -29.687 -4.021   62.640  1.00 65.41  ? 383 LYS A CA    1 
ATOM   2693  C  C     . LYS A  1 383 ? -30.377 -3.042   61.695  1.00 64.39  ? 383 LYS A C     1 
ATOM   2694  O  O     . LYS A  1 383 ? -30.480 -3.302   60.503  1.00 64.54  ? 383 LYS A O     1 
ATOM   2695  C  CB    . LYS A  1 383 ? -30.700 -5.002   63.233  1.00 67.81  ? 383 LYS A CB    1 
ATOM   2696  C  CG    . LYS A  1 383 ? -31.086 -6.105   62.241  1.00 70.54  ? 383 LYS A CG    1 
ATOM   2697  C  CD    . LYS A  1 383 ? -32.125 -7.070   62.795  1.00 74.02  ? 383 LYS A CD    1 
ATOM   2698  C  CE    . LYS A  1 383 ? -32.250 -8.309   61.915  1.00 76.34  ? 383 LYS A CE    1 
ATOM   2699  N  NZ    . LYS A  1 383 ? -33.268 -9.265   62.463  1.00 78.89  ? 383 LYS A NZ    1 
ATOM   2700  N  N     . ALA A  1 384 ? -30.818 -1.907   62.233  1.00 63.56  ? 384 ALA A N     1 
ATOM   2701  C  CA    . ALA A  1 384 ? -31.559 -0.917   61.454  1.00 62.91  ? 384 ALA A CA    1 
ATOM   2702  C  C     . ALA A  1 384 ? -30.714 -0.409   60.309  1.00 61.31  ? 384 ALA A C     1 
ATOM   2703  O  O     . ALA A  1 384 ? -31.162 -0.352   59.159  1.00 61.38  ? 384 ALA A O     1 
ATOM   2704  C  CB    . ALA A  1 384 ? -32.000 0.246    62.342  1.00 62.64  ? 384 ALA A CB    1 
ATOM   2705  N  N     . LEU A  1 385 ? -29.477 -0.049   60.638  1.00 59.94  ? 385 LEU A N     1 
ATOM   2706  C  CA    . LEU A  1 385 ? -28.549 0.463    59.657  1.00 58.66  ? 385 LEU A CA    1 
ATOM   2707  C  C     . LEU A  1 385 ? -28.222 -0.607   58.634  1.00 59.52  ? 385 LEU A C     1 
ATOM   2708  O  O     . LEU A  1 385 ? -28.170 -0.319   57.451  1.00 59.66  ? 385 LEU A O     1 
ATOM   2709  C  CB    . LEU A  1 385 ? -27.300 1.001    60.333  1.00 57.63  ? 385 LEU A CB    1 
ATOM   2710  C  CG    . LEU A  1 385 ? -26.474 2.014    59.530  1.00 57.38  ? 385 LEU A CG    1 
ATOM   2711  C  CD1   . LEU A  1 385 ? -27.345 3.013    58.760  1.00 57.38  ? 385 LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A  1 385 ? -25.539 2.729    60.475  1.00 56.97  ? 385 LEU A CD2   1 
ATOM   2713  N  N     . LYS A  1 386 ? -28.050 -1.846   59.087  1.00 60.56  ? 386 LYS A N     1 
ATOM   2714  C  CA    . LYS A  1 386 ? -27.875 -2.980   58.184  1.00 62.05  ? 386 LYS A CA    1 
ATOM   2715  C  C     . LYS A  1 386 ? -29.056 -3.150   57.215  1.00 63.83  ? 386 LYS A C     1 
ATOM   2716  O  O     . LYS A  1 386 ? -28.874 -3.570   56.069  1.00 64.78  ? 386 LYS A O     1 
ATOM   2717  C  CB    . LYS A  1 386 ? -27.650 -4.268   58.983  1.00 63.21  ? 386 LYS A CB    1 
ATOM   2718  C  CG    . LYS A  1 386 ? -27.674 -5.534   58.147  1.00 64.41  ? 386 LYS A CG    1 
ATOM   2719  C  CD    . LYS A  1 386 ? -27.351 -6.763   58.961  1.00 65.67  ? 386 LYS A CD    1 
ATOM   2720  C  CE    . LYS A  1 386 ? -27.214 -7.964   58.033  1.00 68.62  ? 386 LYS A CE    1 
ATOM   2721  N  NZ    . LYS A  1 386 ? -26.434 -9.079   58.634  1.00 70.97  ? 386 LYS A NZ    1 
ATOM   2722  N  N     . GLN A  1 387 ? -30.263 -2.824   57.675  1.00 64.70  ? 387 GLN A N     1 
ATOM   2723  C  CA    . GLN A  1 387 ? -31.448 -3.004   56.850  1.00 66.66  ? 387 GLN A CA    1 
ATOM   2724  C  C     . GLN A  1 387 ? -31.478 -2.000   55.720  1.00 66.57  ? 387 GLN A C     1 
ATOM   2725  O  O     . GLN A  1 387 ? -31.809 -2.346   54.597  1.00 68.33  ? 387 GLN A O     1 
ATOM   2726  C  CB    . GLN A  1 387 ? -32.729 -2.911   57.672  1.00 67.43  ? 387 GLN A CB    1 
ATOM   2727  C  CG    . GLN A  1 387 ? -32.941 -4.055   58.643  1.00 68.92  ? 387 GLN A CG    1 
ATOM   2728  C  CD    . GLN A  1 387 ? -34.234 -3.911   59.433  1.00 70.56  ? 387 GLN A CD    1 
ATOM   2729  O  OE1   . GLN A  1 387 ? -34.223 -3.802   60.663  1.00 71.14  ? 387 GLN A OE1   1 
ATOM   2730  N  NE2   . GLN A  1 387 ? -35.352 -3.900   58.728  1.00 71.40  ? 387 GLN A NE2   1 
ATOM   2731  N  N     . VAL A  1 388 ? -31.125 -0.759   56.009  1.00 65.49  ? 388 VAL A N     1 
ATOM   2732  C  CA    . VAL A  1 388 ? -31.214 0.279    54.992  1.00 65.90  ? 388 VAL A CA    1 
ATOM   2733  C  C     . VAL A  1 388 ? -29.964 0.316    54.132  1.00 65.97  ? 388 VAL A C     1 
ATOM   2734  O  O     . VAL A  1 388 ? -30.010 0.749    52.985  1.00 66.85  ? 388 VAL A O     1 
ATOM   2735  C  CB    . VAL A  1 388 ? -31.506 1.666    55.602  1.00 64.80  ? 388 VAL A CB    1 
ATOM   2736  C  CG1   . VAL A  1 388 ? -32.945 1.718    56.140  1.00 65.76  ? 388 VAL A CG1   1 
ATOM   2737  C  CG2   . VAL A  1 388 ? -30.500 2.002    56.697  1.00 63.10  ? 388 VAL A CG2   1 
ATOM   2738  N  N     . ALA A  1 389 ? -28.854 -0.155   54.691  1.00 65.99  ? 389 ALA A N     1 
ATOM   2739  C  CA    . ALA A  1 389 ? -27.552 -0.058   54.040  1.00 66.06  ? 389 ALA A CA    1 
ATOM   2740  C  C     . ALA A  1 389 ? -27.304 -1.251   53.147  1.00 68.66  ? 389 ALA A C     1 
ATOM   2741  O  O     . ALA A  1 389 ? -26.384 -1.232   52.326  1.00 69.75  ? 389 ALA A O     1 
ATOM   2742  C  CB    . ALA A  1 389 ? -26.459 0.038    55.066  1.00 64.37  ? 389 ALA A CB    1 
ATOM   2743  N  N     . GLY A  1 390 ? -28.103 -2.303   53.306  1.00 70.42  ? 390 GLY A N     1 
ATOM   2744  C  CA    . GLY A  1 390 ? -27.869 -3.522   52.548  1.00 72.62  ? 390 GLY A CA    1 
ATOM   2745  C  C     . GLY A  1 390 ? -27.382 -3.166   51.159  1.00 73.54  ? 390 GLY A C     1 
ATOM   2746  O  O     . GLY A  1 390 ? -26.298 -3.552   50.742  1.00 74.24  ? 390 GLY A O     1 
ATOM   2747  N  N     . SER A  1 391 ? -28.179 -2.370   50.468  1.00 74.06  ? 391 SER A N     1 
ATOM   2748  C  CA    . SER A  1 391 ? -27.965 -2.107   49.059  1.00 75.97  ? 391 SER A CA    1 
ATOM   2749  C  C     . SER A  1 391 ? -26.957 -0.999   48.822  1.00 74.52  ? 391 SER A C     1 
ATOM   2750  O  O     . SER A  1 391 ? -26.384 -0.908   47.737  1.00 76.11  ? 391 SER A O     1 
ATOM   2751  C  CB    . SER A  1 391 ? -29.295 -1.729   48.416  1.00 77.51  ? 391 SER A CB    1 
ATOM   2752  O  OG    . SER A  1 391 ? -29.909 -0.695   49.167  1.00 76.99  ? 391 SER A OG    1 
ATOM   2753  N  N     . LEU A  1 392 ? -26.759 -0.144   49.823  1.00 71.92  ? 392 LEU A N     1 
ATOM   2754  C  CA    . LEU A  1 392 ? -25.764 0.935    49.729  1.00 70.29  ? 392 LEU A CA    1 
ATOM   2755  C  C     . LEU A  1 392 ? -24.428 0.383    49.302  1.00 71.43  ? 392 LEU A C     1 
ATOM   2756  O  O     . LEU A  1 392 ? -23.793 0.888    48.369  1.00 72.48  ? 392 LEU A O     1 
ATOM   2757  C  CB    . LEU A  1 392 ? -25.600 1.640    51.063  1.00 67.52  ? 392 LEU A CB    1 
ATOM   2758  C  CG    . LEU A  1 392 ? -24.695 2.850    50.963  1.00 65.83  ? 392 LEU A CG    1 
ATOM   2759  C  CD1   . LEU A  1 392 ? -25.036 3.647    49.717  1.00 66.69  ? 392 LEU A CD1   1 
ATOM   2760  C  CD2   . LEU A  1 392 ? -24.833 3.683    52.216  1.00 62.89  ? 392 LEU A CD2   1 
ATOM   2761  N  N     . LYS A  1 393 ? -24.008 -0.661   50.004  1.00 71.77  ? 393 LYS A N     1 
ATOM   2762  C  CA    . LYS A  1 393 ? -22.844 -1.430   49.618  1.00 73.87  ? 393 LYS A CA    1 
ATOM   2763  C  C     . LYS A  1 393 ? -22.851 -1.647   48.092  1.00 76.32  ? 393 LYS A C     1 
ATOM   2764  O  O     . LYS A  1 393 ? -21.820 -1.459   47.429  1.00 77.43  ? 393 LYS A O     1 
ATOM   2765  C  CB    . LYS A  1 393 ? -22.852 -2.774   50.360  1.00 74.64  ? 393 LYS A CB    1 
ATOM   2766  C  CG    . LYS A  1 393 ? -21.516 -3.514   50.327  1.00 77.62  ? 393 LYS A CG    1 
ATOM   2767  C  CD    . LYS A  1 393 ? -21.707 -4.999   49.971  1.00 82.21  ? 393 LYS A CD    1 
ATOM   2768  C  CE    . LYS A  1 393 ? -20.377 -5.753   49.974  1.00 84.07  ? 393 LYS A CE    1 
ATOM   2769  N  NZ    . LYS A  1 393 ? -19.736 -5.714   51.322  1.00 83.54  ? 393 LYS A NZ    1 
ATOM   2770  N  N     . LEU A  1 394 ? -24.032 -2.005   47.563  1.00 77.19  ? 394 LEU A N     1 
ATOM   2771  C  CA    . LEU A  1 394 ? -24.253 -2.361   46.140  1.00 79.92  ? 394 LEU A CA    1 
ATOM   2772  C  C     . LEU A  1 394 ? -24.208 -1.202   45.131  1.00 80.06  ? 394 LEU A C     1 
ATOM   2773  O  O     . LEU A  1 394 ? -23.366 -1.210   44.217  1.00 81.79  ? 394 LEU A O     1 
ATOM   2774  C  CB    . LEU A  1 394 ? -25.587 -3.120   45.960  1.00 81.36  ? 394 LEU A CB    1 
ATOM   2775  C  CG    . LEU A  1 394 ? -25.669 -4.637   45.715  1.00 84.62  ? 394 LEU A CG    1 
ATOM   2776  C  CD1   . LEU A  1 394 ? -27.111 -5.036   45.359  1.00 86.52  ? 394 LEU A CD1   1 
ATOM   2777  C  CD2   . LEU A  1 394 ? -24.704 -5.123   44.619  1.00 87.65  ? 394 LEU A CD2   1 
ATOM   2778  N  N     . PHE A  1 395 ? -25.126 -0.237   45.278  1.00 78.06  ? 395 PHE A N     1 
ATOM   2779  C  CA    . PHE A  1 395 ? -25.206 0.888    44.347  1.00 78.47  ? 395 PHE A CA    1 
ATOM   2780  C  C     . PHE A  1 395 ? -23.824 1.536    44.210  1.00 78.23  ? 395 PHE A C     1 
ATOM   2781  O  O     . PHE A  1 395 ? -23.331 1.715    43.090  1.00 80.92  ? 395 PHE A O     1 
ATOM   2782  C  CB    . PHE A  1 395 ? -26.240 1.941    44.771  1.00 76.91  ? 395 PHE A CB    1 
ATOM   2783  C  CG    . PHE A  1 395 ? -27.640 1.399    45.044  1.00 77.16  ? 395 PHE A CG    1 
ATOM   2784  C  CD1   . PHE A  1 395 ? -28.320 0.621    44.106  1.00 79.71  ? 395 PHE A CD1   1 
ATOM   2785  C  CD2   . PHE A  1 395 ? -28.298 1.729    46.230  1.00 74.12  ? 395 PHE A CD2   1 
ATOM   2786  C  CE1   . PHE A  1 395 ? -29.606 0.155    44.367  1.00 78.99  ? 395 PHE A CE1   1 
ATOM   2787  C  CE2   . PHE A  1 395 ? -29.575 1.274    46.489  1.00 74.03  ? 395 PHE A CE2   1 
ATOM   2788  C  CZ    . PHE A  1 395 ? -30.231 0.486    45.557  1.00 77.11  ? 395 PHE A CZ    1 
ATOM   2789  N  N     . LEU A  1 396 ? -23.185 1.846    45.344  1.00 75.39  ? 396 LEU A N     1 
ATOM   2790  C  CA    . LEU A  1 396 ? -21.846 2.473    45.339  1.00 74.71  ? 396 LEU A CA    1 
ATOM   2791  C  C     . LEU A  1 396 ? -20.792 1.619    44.655  1.00 77.35  ? 396 LEU A C     1 
ATOM   2792  O  O     . LEU A  1 396 ? -19.947 2.141    43.928  1.00 78.90  ? 396 LEU A O     1 
ATOM   2793  C  CB    . LEU A  1 396 ? -21.393 2.853    46.747  1.00 71.37  ? 396 LEU A CB    1 
ATOM   2794  C  CG    . LEU A  1 396 ? -22.034 4.127    47.290  1.00 68.21  ? 396 LEU A CG    1 
ATOM   2795  C  CD1   . LEU A  1 396 ? -21.635 4.328    48.734  1.00 65.19  ? 396 LEU A CD1   1 
ATOM   2796  C  CD2   . LEU A  1 396 ? -21.672 5.350    46.445  1.00 67.01  ? 396 LEU A CD2   1 
ATOM   2797  N  N     . ALA A  1 397 ? -20.857 0.307    44.882  1.00 78.28  ? 397 ALA A N     1 
ATOM   2798  C  CA    . ALA A  1 397 ? -19.995 -0.652   44.188  1.00 81.32  ? 397 ALA A CA    1 
ATOM   2799  C  C     . ALA A  1 397 ? -20.165 -0.515   42.678  1.00 84.52  ? 397 ALA A C     1 
ATOM   2800  O  O     . ALA A  1 397 ? -19.184 -0.387   41.939  1.00 86.46  ? 397 ALA A O     1 
ATOM   2801  C  CB    . ALA A  1 397 ? -20.322 -2.075   44.634  1.00 81.75  ? 397 ALA A CB    1 
ATOM   2802  N  N     . GLN A  1 398 ? -21.431 -0.517   42.247  1.00 85.06  ? 398 GLN A N     1 
ATOM   2803  C  CA    . GLN A  1 398 ? -21.804 -0.431   40.834  1.00 88.53  ? 398 GLN A CA    1 
ATOM   2804  C  C     . GLN A  1 398 ? -21.553 0.957    40.261  1.00 88.75  ? 398 GLN A C     1 
ATOM   2805  O  O     . GLN A  1 398 ? -21.368 1.117    39.046  1.00 91.78  ? 398 GLN A O     1 
ATOM   2806  C  CB    . GLN A  1 398 ? -23.272 -0.819   40.650  1.00 88.98  ? 398 GLN A CB    1 
ATOM   2807  C  CG    . GLN A  1 398 ? -23.527 -2.326   40.666  1.00 91.15  ? 398 GLN A CG    1 
ATOM   2808  C  CD    . GLN A  1 398 ? -25.007 -2.672   40.607  1.00 92.17  ? 398 GLN A CD    1 
ATOM   2809  O  OE1   . GLN A  1 398 ? -25.867 -1.834   40.887  1.00 90.24  ? 398 GLN A OE1   1 
ATOM   2810  N  NE2   . GLN A  1 398 ? -25.309 -3.913   40.238  1.00 95.23  ? 398 GLN A NE2   1 
ATOM   2811  N  N     . TYR A  1 399 ? -21.552 1.944    41.155  1.00 85.54  ? 399 TYR A N     1 
ATOM   2812  C  CA    . TYR A  1 399 ? -21.213 3.319    40.825  1.00 85.57  ? 399 TYR A CA    1 
ATOM   2813  C  C     . TYR A  1 399 ? -19.759 3.483    40.359  1.00 87.96  ? 399 TYR A C     1 
ATOM   2814  O  O     . TYR A  1 399 ? -19.510 3.865    39.207  1.00 90.99  ? 399 TYR A O     1 
ATOM   2815  C  CB    . TYR A  1 399 ? -21.483 4.220    42.025  1.00 81.53  ? 399 TYR A CB    1 
ATOM   2816  C  CG    . TYR A  1 399 ? -21.330 5.668    41.693  1.00 80.83  ? 399 TYR A CG    1 
ATOM   2817  C  CD1   . TYR A  1 399 ? -21.923 6.189    40.550  1.00 82.32  ? 399 TYR A CD1   1 
ATOM   2818  C  CD2   . TYR A  1 399 ? -20.599 6.524    42.513  1.00 78.00  ? 399 TYR A CD2   1 
ATOM   2819  C  CE1   . TYR A  1 399 ? -21.795 7.513    40.222  1.00 82.39  ? 399 TYR A CE1   1 
ATOM   2820  C  CE2   . TYR A  1 399 ? -20.465 7.867    42.193  1.00 78.11  ? 399 TYR A CE2   1 
ATOM   2821  C  CZ    . TYR A  1 399 ? -21.069 8.350    41.038  1.00 80.30  ? 399 TYR A CZ    1 
ATOM   2822  O  OH    . TYR A  1 399 ? -20.965 9.671    40.683  1.00 80.80  ? 399 TYR A OH    1 
ATOM   2823  N  N     . ARG A  1 400 ? -18.816 3.183    41.260  1.00 87.01  ? 400 ARG A N     1 
ATOM   2824  C  CA    . ARG A  1 400 ? -17.362 3.304    41.008  1.00 89.28  ? 400 ARG A CA    1 
ATOM   2825  C  C     . ARG A  1 400 ? -16.881 2.361    39.892  1.00 93.65  ? 400 ARG A C     1 
ATOM   2826  O  O     . ARG A  1 400 ? -15.706 2.392    39.503  1.00 96.23  ? 400 ARG A O     1 
ATOM   2827  C  CB    . ARG A  1 400 ? -16.538 3.036    42.290  1.00 87.01  ? 400 ARG A CB    1 
ATOM   2828  C  CG    . ARG A  1 400 ? -17.188 3.483    43.629  1.00 83.63  ? 400 ARG A CG    1 
ATOM   2829  C  CD    . ARG A  1 400 ? -16.514 2.868    44.880  1.00 81.70  ? 400 ARG A CD    1 
ATOM   2830  N  NE    . ARG A  1 400 ? -16.316 1.413    44.794  1.00 83.61  ? 400 ARG A NE    1 
ATOM   2831  C  CZ    . ARG A  1 400 ? -16.926 0.509    45.562  1.00 81.80  ? 400 ARG A CZ    1 
ATOM   2832  N  NH1   . ARG A  1 400 ? -17.788 0.897    46.497  1.00 78.10  ? 400 ARG A NH1   1 
ATOM   2833  N  NH2   . ARG A  1 400 ? -16.671 -0.787   45.396  1.00 82.50  ? 400 ARG A NH2   1 
ATOM   2834  N  N     . GLU A  1 401 ? -17.781 1.509    39.399  1.00 94.95  ? 401 GLU A N     1 
ATOM   2835  C  CA    . GLU A  1 401 ? -17.480 0.643    38.255  1.00 99.56  ? 401 GLU A CA    1 
ATOM   2836  C  C     . GLU A  1 401 ? -17.794 1.348    36.944  1.00 102.21 ? 401 GLU A C     1 
ATOM   2837  O  O     . GLU A  1 401 ? -17.149 1.103    35.931  1.00 106.20 ? 401 GLU A O     1 
ATOM   2838  C  CB    . GLU A  1 401 ? -18.297 -0.649   38.311  1.00 100.19 ? 401 GLU A CB    1 
ATOM   2839  C  CG    . GLU A  1 401 ? -17.804 -1.696   39.289  1.00 99.95  ? 401 GLU A CG    1 
ATOM   2840  C  CD    . GLU A  1 401 ? -18.723 -2.905   39.327  1.00 101.68 ? 401 GLU A CD    1 
ATOM   2841  O  OE1   . GLU A  1 401 ? -18.861 -3.584   38.281  1.00 106.19 ? 401 GLU A OE1   1 
ATOM   2842  O  OE2   . GLU A  1 401 ? -19.307 -3.169   40.403  1.00 99.01  ? 401 GLU A OE2   1 
ATOM   2843  N  N     . VAL A  1 402 ? -18.803 2.212    36.983  1.00 100.24 ? 402 VAL A N     1 
ATOM   2844  C  CA    . VAL A  1 402 ? -19.323 2.877    35.800  1.00 102.75 ? 402 VAL A CA    1 
ATOM   2845  C  C     . VAL A  1 402 ? -18.857 4.335    35.821  1.00 102.00 ? 402 VAL A C     1 
ATOM   2846  O  O     . VAL A  1 402 ? -19.171 5.109    34.917  1.00 104.19 ? 402 VAL A O     1 
ATOM   2847  C  CB    . VAL A  1 402 ? -20.886 2.724    35.730  1.00 102.07 ? 402 VAL A CB    1 
ATOM   2848  C  CG1   . VAL A  1 402 ? -21.509 3.524    34.580  1.00 105.01 ? 402 VAL A CG1   1 
ATOM   2849  C  CG2   . VAL A  1 402 ? -21.272 1.245    35.605  1.00 103.21 ? 402 VAL A CG2   1 
ATOM   2850  N  N     . ALA A  1 403 ? -18.078 4.684    36.850  1.00 99.12  ? 403 ALA A N     1 
ATOM   2851  C  CA    . ALA A  1 403 ? -17.559 6.050    37.049  1.00 98.29  ? 403 ALA A CA    1 
ATOM   2852  C  C     . ALA A  1 403 ? -17.025 6.734    35.769  1.00 102.60 ? 403 ALA A C     1 
ATOM   2853  O  O     . ALA A  1 403 ? -17.542 7.780    35.366  1.00 103.23 ? 403 ALA A O     1 
ATOM   2854  C  CB    . ALA A  1 403 ? -16.506 6.070    38.163  1.00 95.91  ? 403 ALA A CB    1 
ATOM   2855  N  N     . ALA A  1 404 ? -16.024 6.139    35.121  1.00 105.80 ? 404 ALA A N     1 
ATOM   2856  C  CA    . ALA A  1 404 ? -15.452 6.709    33.895  1.00 110.42 ? 404 ALA A CA    1 
ATOM   2857  C  C     . ALA A  1 404 ? -16.494 7.071    32.828  1.00 112.80 ? 404 ALA A C     1 
ATOM   2858  O  O     . ALA A  1 404 ? -16.163 7.686    31.813  1.00 116.90 ? 404 ALA A O     1 
ATOM   2859  C  CB    . ALA A  1 404 ? -14.400 5.782    33.314  1.00 114.29 ? 404 ALA A CB    1 
ATOM   2860  N  N     . SER A  1 405 ? -17.743 6.679    33.057  1.00 110.69 ? 405 SER A N     1 
ATOM   2861  C  CA    . SER A  1 405 ? -18.840 7.049    32.170  1.00 112.80 ? 405 SER A CA    1 
ATOM   2862  C  C     . SER A  1 405 ? -19.346 8.457    32.460  1.00 110.96 ? 405 SER A C     1 
ATOM   2863  O  O     . SER A  1 405 ? -19.971 9.073    31.588  1.00 113.72 ? 405 SER A O     1 
ATOM   2864  C  CB    . SER A  1 405 ? -20.009 6.056    32.268  1.00 111.82 ? 405 SER A CB    1 
ATOM   2865  O  OG    . SER A  1 405 ? -19.770 4.877    31.521  1.00 115.40 ? 405 SER A OG    1 
ATOM   2866  N  N     . ALA A  1 406 ? -19.085 8.959    33.673  1.00 106.52 ? 406 ALA A N     1 
ATOM   2867  C  CA    . ALA A  1 406 ? -19.574 10.284   34.103  1.00 104.52 ? 406 ALA A CA    1 
ATOM   2868  C  C     . ALA A  1 406 ? -19.172 11.425   33.152  1.00 108.27 ? 406 ALA A C     1 
ATOM   2869  O  O     . ALA A  1 406 ? -19.433 12.603   33.428  1.00 107.43 ? 406 ALA A O     1 
ATOM   2870  C  CB    . ALA A  1 406 ? -19.138 10.588   35.529  1.00 99.97  ? 406 ALA A CB    1 
ATOM   2871  N  N     . GLN A  1 407 ? -18.536 11.053   32.039  1.00 112.54 ? 407 GLN A N     1 
ATOM   2872  C  CA    . GLN A  1 407 ? -18.207 11.963   30.956  1.00 116.95 ? 407 GLN A CA    1 
ATOM   2873  C  C     . GLN A  1 407 ? -18.554 11.311   29.621  1.00 121.80 ? 407 GLN A C     1 
ATOM   2874  O  O     . GLN A  1 407 ? -19.537 10.579   29.511  1.00 121.25 ? 407 GLN A O     1 
ATOM   2875  C  CB    . GLN A  1 407 ? -16.721 12.325   30.984  1.00 118.45 ? 407 GLN A CB    1 
ATOM   2876  C  CG    . GLN A  1 407 ? -16.261 13.082   32.239  1.00 114.24 ? 407 GLN A CG    1 
ATOM   2877  C  CD    . GLN A  1 407 ? -15.714 12.177   33.338  1.00 110.31 ? 407 GLN A CD    1 
ATOM   2878  O  OE1   . GLN A  1 407 ? -16.014 10.984   33.392  1.00 110.01 ? 407 GLN A OE1   1 
ATOM   2879  N  NE2   . GLN A  1 407 ? -14.910 12.751   34.227  1.00 107.88 ? 407 GLN A NE2   1 
ATOM   2880  N  N     . SER A  1 410 ? -23.359 12.361   28.126  1.00 122.72 ? 410 SER A N     1 
ATOM   2881  C  CA    . SER A  1 410 ? -24.087 12.453   26.866  1.00 127.99 ? 410 SER A CA    1 
ATOM   2882  C  C     . SER A  1 410 ? -24.908 11.187   26.604  1.00 128.65 ? 410 SER A C     1 
ATOM   2883  O  O     . SER A  1 410 ? -25.962 10.990   27.213  1.00 125.96 ? 410 SER A O     1 
ATOM   2884  C  CB    . SER A  1 410 ? -23.130 12.749   25.702  1.00 133.28 ? 410 SER A CB    1 
ATOM   2885  N  N     . ASP A  1 411 ? -24.415 10.331   25.711  1.00 132.55 ? 411 ASP A N     1 
ATOM   2886  C  CA    . ASP A  1 411 ? -25.157 9.148    25.277  1.00 134.32 ? 411 ASP A CA    1 
ATOM   2887  C  C     . ASP A  1 411 ? -24.953 7.957    26.203  1.00 130.43 ? 411 ASP A C     1 
ATOM   2888  O  O     . ASP A  1 411 ? -23.913 7.296    26.171  1.00 130.96 ? 411 ASP A O     1 
ATOM   2889  C  CB    . ASP A  1 411 ? -24.797 8.774    23.837  1.00 140.92 ? 411 ASP A CB    1 
ATOM   2890  C  CG    . ASP A  1 411 ? -25.178 9.854    22.837  1.00 145.69 ? 411 ASP A CG    1 
ATOM   2891  O  OD1   . ASP A  1 411 ? -24.745 11.016   23.008  1.00 145.61 ? 411 ASP A OD1   1 
ATOM   2892  O  OD2   . ASP A  1 411 ? -25.901 9.537    21.870  1.00 150.01 ? 411 ASP A OD2   1 
ATOM   2893  N  N     . LEU A  1 412 ? -25.965 7.713    27.032  1.00 126.89 ? 412 LEU A N     1 
ATOM   2894  C  CA    . LEU A  1 412 ? -26.009 6.601    27.972  1.00 123.25 ? 412 LEU A CA    1 
ATOM   2895  C  C     . LEU A  1 412 ? -27.479 6.291    28.156  1.00 122.83 ? 412 LEU A C     1 
ATOM   2896  O  O     . LEU A  1 412 ? -28.282 7.210    28.335  1.00 122.08 ? 412 LEU A O     1 
ATOM   2897  C  CB    . LEU A  1 412 ? -25.440 7.014    29.328  1.00 117.76 ? 412 LEU A CB    1 
ATOM   2898  C  CG    . LEU A  1 412 ? -24.256 7.980    29.397  1.00 117.47 ? 412 LEU A CG    1 
ATOM   2899  C  CD1   . LEU A  1 412 ? -24.605 9.165    30.282  1.00 114.05 ? 412 LEU A CD1   1 
ATOM   2900  C  CD2   . LEU A  1 412 ? -22.978 7.281    29.860  1.00 116.00 ? 412 LEU A CD2   1 
ATOM   2901  N  N     . ASP A  1 413 ? -27.840 5.010    28.119  1.00 123.74 ? 413 ASP A N     1 
ATOM   2902  C  CA    . ASP A  1 413 ? -29.237 4.591    28.318  1.00 123.69 ? 413 ASP A CA    1 
ATOM   2903  C  C     . ASP A  1 413 ? -29.752 4.970    29.703  1.00 118.47 ? 413 ASP A C     1 
ATOM   2904  O  O     . ASP A  1 413 ? -28.962 5.202    30.629  1.00 114.64 ? 413 ASP A O     1 
ATOM   2905  C  CB    . ASP A  1 413 ? -29.409 3.082    28.095  1.00 125.38 ? 413 ASP A CB    1 
ATOM   2906  C  CG    . ASP A  1 413 ? -29.841 2.734    26.671  1.00 131.94 ? 413 ASP A CG    1 
ATOM   2907  O  OD1   . ASP A  1 413 ? -29.579 3.522    25.733  1.00 135.95 ? 413 ASP A OD1   1 
ATOM   2908  O  OD2   . ASP A  1 413 ? -30.447 1.653    26.488  1.00 133.98 ? 413 ASP A OD2   1 
ATOM   2909  N  N     . ALA A  1 414 ? -31.081 5.024    29.826  1.00 118.72 ? 414 ALA A N     1 
ATOM   2910  C  CA    . ALA A  1 414 ? -31.766 5.384    31.075  1.00 114.50 ? 414 ALA A CA    1 
ATOM   2911  C  C     . ALA A  1 414 ? -31.361 4.509    32.273  1.00 110.32 ? 414 ALA A C     1 
ATOM   2912  O  O     . ALA A  1 414 ? -31.551 4.901    33.428  1.00 106.31 ? 414 ALA A O     1 
ATOM   2913  C  CB    . ALA A  1 414 ? -33.282 5.364    30.873  1.00 116.42 ? 414 ALA A CB    1 
ATOM   2914  N  N     . SER A  1 415 ? -30.810 3.329    31.982  1.00 111.53 ? 415 SER A N     1 
ATOM   2915  C  CA    . SER A  1 415 ? -30.223 2.454    32.992  1.00 108.17 ? 415 SER A CA    1 
ATOM   2916  C  C     . SER A  1 415 ? -29.022 3.128    33.655  1.00 104.97 ? 415 SER A C     1 
ATOM   2917  O  O     . SER A  1 415 ? -28.990 3.301    34.873  1.00 100.86 ? 415 SER A O     1 
ATOM   2918  C  CB    . SER A  1 415 ? -29.805 1.122    32.357  1.00 111.13 ? 415 SER A CB    1 
ATOM   2919  O  OG    . SER A  1 415 ? -28.884 0.420    33.178  1.00 108.63 ? 415 SER A OG    1 
ATOM   2920  N  N     . THR A  1 416 ? -28.044 3.512    32.837  1.00 107.22 ? 416 THR A N     1 
ATOM   2921  C  CA    . THR A  1 416 ? -26.815 4.137    33.323  1.00 104.82 ? 416 THR A CA    1 
ATOM   2922  C  C     . THR A  1 416 ? -27.034 5.549    33.874  1.00 102.29 ? 416 THR A C     1 
ATOM   2923  O  O     . THR A  1 416 ? -26.458 5.903    34.906  1.00 98.57  ? 416 THR A O     1 
ATOM   2924  C  CB    . THR A  1 416 ? -25.685 4.127    32.252  1.00 108.64 ? 416 THR A CB    1 
ATOM   2925  O  OG1   . THR A  1 416 ? -26.252 4.163    30.930  1.00 113.28 ? 416 THR A OG1   1 
ATOM   2926  C  CG2   . THR A  1 416 ? -24.822 2.875    32.399  1.00 108.85 ? 416 THR A CG2   1 
ATOM   2927  N  N     . LYS A  1 417 ? -27.866 6.348    33.199  1.00 104.43 ? 417 LYS A N     1 
ATOM   2928  C  CA    . LYS A  1 417 ? -28.196 7.693    33.692  1.00 102.63 ? 417 LYS A CA    1 
ATOM   2929  C  C     . LYS A  1 417 ? -28.685 7.607    35.139  1.00 98.04  ? 417 LYS A C     1 
ATOM   2930  O  O     . LYS A  1 417 ? -28.242 8.371    36.000  1.00 95.25  ? 417 LYS A O     1 
ATOM   2931  C  CB    . LYS A  1 417 ? -29.238 8.392    32.802  1.00 106.00 ? 417 LYS A CB    1 
ATOM   2932  C  CG    . LYS A  1 417 ? -29.479 9.866    33.177  1.00 105.06 ? 417 LYS A CG    1 
ATOM   2933  C  CD    . LYS A  1 417 ? -30.810 10.411   32.659  1.00 107.64 ? 417 LYS A CD    1 
ATOM   2934  C  CE    . LYS A  1 417 ? -30.640 11.283   31.417  1.00 112.80 ? 417 LYS A CE    1 
ATOM   2935  N  NZ    . LYS A  1 417 ? -31.950 11.709   30.809  1.00 116.04 ? 417 LYS A NZ    1 
ATOM   2936  N  N     . GLN A  1 418 ? -29.580 6.652    35.388  1.00 97.67  ? 418 GLN A N     1 
ATOM   2937  C  CA    . GLN A  1 418 ? -30.072 6.337    36.728  1.00 93.82  ? 418 GLN A CA    1 
ATOM   2938  C  C     . GLN A  1 418 ? -28.951 5.955    37.700  1.00 90.27  ? 418 GLN A C     1 
ATOM   2939  O  O     . GLN A  1 418 ? -28.779 6.611    38.720  1.00 87.09  ? 418 GLN A O     1 
ATOM   2940  C  CB    . GLN A  1 418 ? -31.130 5.230    36.650  1.00 95.16  ? 418 GLN A CB    1 
ATOM   2941  C  CG    . GLN A  1 418 ? -31.472 4.548    37.971  1.00 92.21  ? 418 GLN A CG    1 
ATOM   2942  C  CD    . GLN A  1 418 ? -31.984 5.510    39.023  1.00 89.78  ? 418 GLN A CD    1 
ATOM   2943  O  OE1   . GLN A  1 418 ? -32.837 6.359    38.748  1.00 90.87  ? 418 GLN A OE1   1 
ATOM   2944  N  NE2   . GLN A  1 418 ? -31.466 5.377    40.242  1.00 86.41  ? 418 GLN A NE2   1 
ATOM   2945  N  N     . THR A  1 419 ? -28.195 4.907    37.373  1.00 91.21  ? 419 THR A N     1 
ATOM   2946  C  CA    . THR A  1 419 ? -27.083 4.445    38.212  1.00 88.62  ? 419 THR A CA    1 
ATOM   2947  C  C     . THR A  1 419 ? -26.224 5.622    38.632  1.00 86.84  ? 419 THR A C     1 
ATOM   2948  O  O     . THR A  1 419 ? -25.839 5.730    39.800  1.00 83.95  ? 419 THR A O     1 
ATOM   2949  C  CB    . THR A  1 419 ? -26.172 3.424    37.491  1.00 90.99  ? 419 THR A CB    1 
ATOM   2950  O  OG1   . THR A  1 419 ? -26.962 2.528    36.696  1.00 94.11  ? 419 THR A OG1   1 
ATOM   2951  C  CG2   . THR A  1 419 ? -25.362 2.623    38.501  1.00 88.40  ? 419 THR A CG2   1 
ATOM   2952  N  N     . LEU A  1 420 ? -25.947 6.509    37.677  1.00 89.08  ? 420 LEU A N     1 
ATOM   2953  C  CA    . LEU A  1 420 ? -25.134 7.700    37.922  1.00 87.95  ? 420 LEU A CA    1 
ATOM   2954  C  C     . LEU A  1 420 ? -25.816 8.723    38.825  1.00 85.26  ? 420 LEU A C     1 
ATOM   2955  O  O     . LEU A  1 420 ? -25.185 9.243    39.745  1.00 82.65  ? 420 LEU A O     1 
ATOM   2956  C  CB    . LEU A  1 420 ? -24.696 8.339    36.601  1.00 91.90  ? 420 LEU A CB    1 
ATOM   2957  C  CG    . LEU A  1 420 ? -23.270 7.985    36.161  1.00 93.32  ? 420 LEU A CG    1 
ATOM   2958  C  CD1   . LEU A  1 420 ? -23.189 7.568    34.689  1.00 97.70  ? 420 LEU A CD1   1 
ATOM   2959  C  CD2   . LEU A  1 420 ? -22.351 9.150    36.458  1.00 92.76  ? 420 LEU A CD2   1 
ATOM   2960  N  N     . VAL A  1 421 ? -27.095 8.996    38.567  1.00 85.94  ? 421 VAL A N     1 
ATOM   2961  C  CA    . VAL A  1 421 ? -27.884 9.895    39.414  1.00 83.88  ? 421 VAL A CA    1 
ATOM   2962  C  C     . VAL A  1 421 ? -27.843 9.457    40.883  1.00 80.19  ? 421 VAL A C     1 
ATOM   2963  O  O     . VAL A  1 421 ? -27.500 10.247   41.775  1.00 77.90  ? 421 VAL A O     1 
ATOM   2964  C  CB    . VAL A  1 421 ? -29.352 9.989    38.928  1.00 85.80  ? 421 VAL A CB    1 
ATOM   2965  C  CG1   . VAL A  1 421 ? -30.248 10.581   40.006  1.00 83.84  ? 421 VAL A CG1   1 
ATOM   2966  C  CG2   . VAL A  1 421 ? -29.445 10.816   37.654  1.00 89.26  ? 421 VAL A CG2   1 
ATOM   2967  N  N     . ARG A  1 422 ? -28.179 8.188    41.112  1.00 79.90  ? 422 ARG A N     1 
ATOM   2968  C  CA    . ARG A  1 422 ? -28.249 7.600    42.445  1.00 77.02  ? 422 ARG A CA    1 
ATOM   2969  C  C     . ARG A  1 422 ? -26.937 7.801    43.198  1.00 74.97  ? 422 ARG A C     1 
ATOM   2970  O  O     . ARG A  1 422 ? -26.903 8.479    44.230  1.00 72.80  ? 422 ARG A O     1 
ATOM   2971  C  CB    . ARG A  1 422 ? -28.603 6.105    42.331  1.00 77.83  ? 422 ARG A CB    1 
ATOM   2972  C  CG    . ARG A  1 422 ? -28.929 5.372    43.638  1.00 75.07  ? 422 ARG A CG    1 
ATOM   2973  C  CD    . ARG A  1 422 ? -30.015 6.066    44.442  1.00 73.96  ? 422 ARG A CD    1 
ATOM   2974  N  NE    . ARG A  1 422 ? -31.222 6.274    43.654  1.00 76.90  ? 422 ARG A NE    1 
ATOM   2975  C  CZ    . ARG A  1 422 ? -32.155 5.348    43.465  1.00 79.18  ? 422 ARG A CZ    1 
ATOM   2976  N  NH1   . ARG A  1 422 ? -32.023 4.145    44.012  1.00 78.83  ? 422 ARG A NH1   1 
ATOM   2977  N  NH2   . ARG A  1 422 ? -33.223 5.623    42.729  1.00 81.50  ? 422 ARG A NH2   1 
ATOM   2978  N  N     . GLY A  1 423 ? -25.867 7.227    42.645  1.00 75.96  ? 423 GLY A N     1 
ATOM   2979  C  CA    . GLY A  1 423 ? -24.536 7.226    43.247  1.00 74.34  ? 423 GLY A CA    1 
ATOM   2980  C  C     . GLY A  1 423 ? -23.984 8.581    43.634  1.00 73.34  ? 423 GLY A C     1 
ATOM   2981  O  O     . GLY A  1 423 ? -23.491 8.740    44.742  1.00 71.49  ? 423 GLY A O     1 
ATOM   2982  N  N     . GLU A  1 424 ? -24.054 9.554    42.727  1.00 75.15  ? 424 GLU A N     1 
ATOM   2983  C  CA    . GLU A  1 424 ? -23.730 10.944   43.054  1.00 74.41  ? 424 GLU A CA    1 
ATOM   2984  C  C     . GLU A  1 424 ? -24.346 11.356   44.395  1.00 71.31  ? 424 GLU A C     1 
ATOM   2985  O  O     . GLU A  1 424 ? -23.685 11.932   45.250  1.00 69.97  ? 424 GLU A O     1 
ATOM   2986  C  CB    . GLU A  1 424 ? -24.253 11.883   41.967  1.00 77.21  ? 424 GLU A CB    1 
ATOM   2987  C  CG    . GLU A  1 424 ? -23.375 11.989   40.729  1.00 81.72  ? 424 GLU A CG    1 
ATOM   2988  C  CD    . GLU A  1 424 ? -24.008 12.825   39.615  1.00 86.52  ? 424 GLU A CD    1 
ATOM   2989  O  OE1   . GLU A  1 424 ? -25.220 13.145   39.703  1.00 87.21  ? 424 GLU A OE1   1 
ATOM   2990  O  OE2   . GLU A  1 424 ? -23.288 13.154   38.645  1.00 89.62  ? 424 GLU A OE2   1 
ATOM   2991  N  N     . ARG A  1 425 ? -25.618 11.040   44.575  1.00 70.66  ? 425 ARG A N     1 
ATOM   2992  C  CA    . ARG A  1 425 ? -26.349 11.505   45.732  1.00 68.26  ? 425 ARG A CA    1 
ATOM   2993  C  C     . ARG A  1 425 ? -25.990 10.716   46.970  1.00 65.55  ? 425 ARG A C     1 
ATOM   2994  O  O     . ARG A  1 425 ? -25.820 11.291   48.049  1.00 63.60  ? 425 ARG A O     1 
ATOM   2995  C  CB    . ARG A  1 425 ? -27.849 11.466   45.452  1.00 69.56  ? 425 ARG A CB    1 
ATOM   2996  C  CG    . ARG A  1 425 ? -28.280 12.611   44.583  1.00 71.43  ? 425 ARG A CG    1 
ATOM   2997  C  CD    . ARG A  1 425 ? -29.561 12.347   43.822  1.00 73.11  ? 425 ARG A CD    1 
ATOM   2998  N  NE    . ARG A  1 425 ? -29.915 13.555   43.089  1.00 74.78  ? 425 ARG A NE    1 
ATOM   2999  C  CZ    . ARG A  1 425 ? -29.346 13.923   41.946  1.00 76.90  ? 425 ARG A CZ    1 
ATOM   3000  N  NH1   . ARG A  1 425 ? -28.418 13.163   41.383  1.00 77.47  ? 425 ARG A NH1   1 
ATOM   3001  N  NH2   . ARG A  1 425 ? -29.705 15.054   41.364  1.00 79.31  ? 425 ARG A NH2   1 
ATOM   3002  N  N     . LEU A  1 426 ? -25.859 9.403    46.815  1.00 65.41  ? 426 LEU A N     1 
ATOM   3003  C  CA    . LEU A  1 426 ? -25.433 8.573    47.925  1.00 63.72  ? 426 LEU A CA    1 
ATOM   3004  C  C     . LEU A  1 426 ? -24.011 8.947    48.379  1.00 63.09  ? 426 LEU A C     1 
ATOM   3005  O  O     . LEU A  1 426 ? -23.726 8.971    49.574  1.00 61.42  ? 426 LEU A O     1 
ATOM   3006  C  CB    . LEU A  1 426 ? -25.558 7.096    47.576  1.00 64.30  ? 426 LEU A CB    1 
ATOM   3007  C  CG    . LEU A  1 426 ? -26.988 6.533    47.568  1.00 65.17  ? 426 LEU A CG    1 
ATOM   3008  C  CD1   . LEU A  1 426 ? -27.043 5.231    46.770  1.00 66.11  ? 426 LEU A CD1   1 
ATOM   3009  C  CD2   . LEU A  1 426 ? -27.543 6.332    48.984  1.00 62.13  ? 426 LEU A CD2   1 
ATOM   3010  N  N     . THR A  1 427 ? -23.140 9.276    47.429  1.00 64.73  ? 427 THR A N     1 
ATOM   3011  C  CA    . THR A  1 427 ? -21.818 9.794    47.748  1.00 64.80  ? 427 THR A CA    1 
ATOM   3012  C  C     . THR A  1 427 ? -21.952 11.072   48.581  1.00 63.94  ? 427 THR A C     1 
ATOM   3013  O  O     . THR A  1 427 ? -21.401 11.169   49.680  1.00 62.80  ? 427 THR A O     1 
ATOM   3014  C  CB    . THR A  1 427 ? -20.991 10.054   46.470  1.00 67.17  ? 427 THR A CB    1 
ATOM   3015  O  OG1   . THR A  1 427 ? -20.563 8.801    45.932  1.00 68.43  ? 427 THR A OG1   1 
ATOM   3016  C  CG2   . THR A  1 427 ? -19.771 10.894   46.761  1.00 67.06  ? 427 THR A CG2   1 
ATOM   3017  N  N     . GLN A  1 428 ? -22.704 12.036   48.065  1.00 64.90  ? 428 GLN A N     1 
ATOM   3018  C  CA    . GLN A  1 428 ? -22.913 13.288   48.757  1.00 64.24  ? 428 GLN A CA    1 
ATOM   3019  C  C     . GLN A  1 428 ? -23.461 13.041   50.176  1.00 62.00  ? 428 GLN A C     1 
ATOM   3020  O  O     . GLN A  1 428 ? -23.006 13.673   51.120  1.00 61.00  ? 428 GLN A O     1 
ATOM   3021  C  CB    . GLN A  1 428 ? -23.821 14.202   47.917  1.00 66.10  ? 428 GLN A CB    1 
ATOM   3022  C  CG    . GLN A  1 428 ? -23.714 15.710   48.209  1.00 67.76  ? 428 GLN A CG    1 
ATOM   3023  C  CD    . GLN A  1 428 ? -22.366 16.347   47.799  1.00 70.96  ? 428 GLN A CD    1 
ATOM   3024  O  OE1   . GLN A  1 428 ? -21.615 15.815   46.962  1.00 72.05  ? 428 GLN A OE1   1 
ATOM   3025  N  NE2   . GLN A  1 428 ? -22.066 17.499   48.397  1.00 70.72  ? 428 GLN A NE2   1 
ATOM   3026  N  N     . LEU A  1 429 ? -24.403 12.105   50.338  1.00 61.59  ? 429 LEU A N     1 
ATOM   3027  C  CA    . LEU A  1 429 ? -24.973 11.824   51.668  1.00 59.98  ? 429 LEU A CA    1 
ATOM   3028  C  C     . LEU A  1 429 ? -23.899 11.388   52.646  1.00 58.64  ? 429 LEU A C     1 
ATOM   3029  O  O     . LEU A  1 429 ? -24.077 11.510   53.854  1.00 58.07  ? 429 LEU A O     1 
ATOM   3030  C  CB    . LEU A  1 429 ? -26.023 10.715   51.638  1.00 59.89  ? 429 LEU A CB    1 
ATOM   3031  C  CG    . LEU A  1 429 ? -27.497 10.905   51.281  1.00 61.74  ? 429 LEU A CG    1 
ATOM   3032  C  CD1   . LEU A  1 429 ? -28.216 9.590    51.569  1.00 61.61  ? 429 LEU A CD1   1 
ATOM   3033  C  CD2   . LEU A  1 429 ? -28.183 12.067   52.011  1.00 61.39  ? 429 LEU A CD2   1 
ATOM   3034  N  N     . LEU A  1 430 ? -22.797 10.855   52.134  1.00 58.52  ? 430 LEU A N     1 
ATOM   3035  C  CA    . LEU A  1 430 ? -21.779 10.317   53.019  1.00 57.09  ? 430 LEU A CA    1 
ATOM   3036  C  C     . LEU A  1 430 ? -20.781 11.362   53.490  1.00 56.76  ? 430 LEU A C     1 
ATOM   3037  O  O     . LEU A  1 430 ? -20.032 11.098   54.439  1.00 56.32  ? 430 LEU A O     1 
ATOM   3038  C  CB    . LEU A  1 430 ? -21.078 9.102    52.401  1.00 57.76  ? 430 LEU A CB    1 
ATOM   3039  C  CG    . LEU A  1 430 ? -21.932 7.854    52.129  1.00 57.70  ? 430 LEU A CG    1 
ATOM   3040  C  CD1   . LEU A  1 430 ? -21.075 6.737    51.561  1.00 57.73  ? 430 LEU A CD1   1 
ATOM   3041  C  CD2   . LEU A  1 430 ? -22.719 7.365    53.367  1.00 56.02  ? 430 LEU A CD2   1 
ATOM   3042  N  N     . LYS A  1 431 ? -20.775 12.535   52.841  1.00 57.26  ? 431 LYS A N     1 
ATOM   3043  C  CA    . LYS A  1 431 ? -20.033 13.697   53.331  1.00 57.08  ? 431 LYS A CA    1 
ATOM   3044  C  C     . LYS A  1 431 ? -20.599 14.036   54.690  1.00 55.70  ? 431 LYS A C     1 
ATOM   3045  O  O     . LYS A  1 431 ? -21.763 13.780   54.959  1.00 55.56  ? 431 LYS A O     1 
ATOM   3046  C  CB    . LYS A  1 431 ? -20.189 14.922   52.429  1.00 58.38  ? 431 LYS A CB    1 
ATOM   3047  C  CG    . LYS A  1 431 ? -19.922 14.685   50.971  1.00 60.89  ? 431 LYS A CG    1 
ATOM   3048  C  CD    . LYS A  1 431 ? -19.786 15.976   50.187  1.00 63.76  ? 431 LYS A CD    1 
ATOM   3049  C  CE    . LYS A  1 431 ? -19.101 15.684   48.847  1.00 67.67  ? 431 LYS A CE    1 
ATOM   3050  N  NZ    . LYS A  1 431 ? -19.029 16.869   47.936  1.00 71.05  ? 431 LYS A NZ    1 
ATOM   3051  N  N     . GLN A  1 432 ? -19.773 14.609   55.545  1.00 55.22  ? 432 GLN A N     1 
ATOM   3052  C  CA    . GLN A  1 432 ? -20.169 14.936   56.889  1.00 54.10  ? 432 GLN A CA    1 
ATOM   3053  C  C     . GLN A  1 432 ? -19.175 15.984   57.399  1.00 55.14  ? 432 GLN A C     1 
ATOM   3054  O  O     . GLN A  1 432 ? -17.998 15.965   57.022  1.00 55.88  ? 432 GLN A O     1 
ATOM   3055  C  CB    . GLN A  1 432 ? -20.143 13.669   57.732  1.00 52.66  ? 432 GLN A CB    1 
ATOM   3056  C  CG    . GLN A  1 432 ? -20.753 13.813   59.091  1.00 52.14  ? 432 GLN A CG    1 
ATOM   3057  C  CD    . GLN A  1 432 ? -20.778 12.515   59.868  1.00 52.28  ? 432 GLN A CD    1 
ATOM   3058  O  OE1   . GLN A  1 432 ? -20.494 11.441   59.332  1.00 53.02  ? 432 GLN A OE1   1 
ATOM   3059  N  NE2   . GLN A  1 432 ? -21.120 12.607   61.147  1.00 51.86  ? 432 GLN A NE2   1 
ATOM   3060  N  N     . ASN A  1 433 ? -19.640 16.923   58.213  1.00 55.54  ? 433 ASN A N     1 
ATOM   3061  C  CA    . ASN A  1 433 ? -18.733 17.929   58.765  1.00 56.94  ? 433 ASN A CA    1 
ATOM   3062  C  C     . ASN A  1 433 ? -17.882 17.290   59.842  1.00 56.98  ? 433 ASN A C     1 
ATOM   3063  O  O     . ASN A  1 433 ? -18.246 16.244   60.370  1.00 56.83  ? 433 ASN A O     1 
ATOM   3064  C  CB    . ASN A  1 433 ? -19.495 19.087   59.404  1.00 57.26  ? 433 ASN A CB    1 
ATOM   3065  C  CG    . ASN A  1 433 ? -20.197 19.972   58.402  1.00 57.37  ? 433 ASN A CG    1 
ATOM   3066  O  OD1   . ASN A  1 433 ? -19.729 20.213   57.286  1.00 56.00  ? 433 ASN A OD1   1 
ATOM   3067  N  ND2   . ASN A  1 433 ? -21.332 20.493   58.822  1.00 58.71  ? 433 ASN A ND2   1 
ATOM   3068  N  N     . GLN A  1 434 ? -16.758 17.914   60.183  1.00 58.18  ? 434 GLN A N     1 
ATOM   3069  C  CA    . GLN A  1 434 ? -15.963 17.429   61.298  1.00 58.26  ? 434 GLN A CA    1 
ATOM   3070  C  C     . GLN A  1 434 ? -16.657 17.748   62.622  1.00 58.10  ? 434 GLN A C     1 
ATOM   3071  O  O     . GLN A  1 434 ? -17.459 18.680   62.705  1.00 58.81  ? 434 GLN A O     1 
ATOM   3072  C  CB    . GLN A  1 434 ? -14.568 18.025   61.271  1.00 59.69  ? 434 GLN A CB    1 
ATOM   3073  C  CG    . GLN A  1 434 ? -13.534 17.153   61.959  1.00 60.16  ? 434 GLN A CG    1 
ATOM   3074  C  CD    . GLN A  1 434 ? -12.157 17.734   61.857  1.00 62.72  ? 434 GLN A CD    1 
ATOM   3075  O  OE1   . GLN A  1 434 ? -11.972 18.795   61.268  1.00 64.67  ? 434 GLN A OE1   1 
ATOM   3076  N  NE2   . GLN A  1 434 ? -11.175 17.055   62.434  1.00 64.43  ? 434 GLN A NE2   1 
ATOM   3077  N  N     . TYR A  1 435 ? -16.356 16.958   63.647  1.00 57.73  ? 435 TYR A N     1 
ATOM   3078  C  CA    . TYR A  1 435 ? -16.907 17.163   64.996  1.00 57.62  ? 435 TYR A CA    1 
ATOM   3079  C  C     . TYR A  1 435 ? -18.416 17.048   65.082  1.00 56.89  ? 435 TYR A C     1 
ATOM   3080  O  O     . TYR A  1 435 ? -19.009 17.548   66.014  1.00 57.94  ? 435 TYR A O     1 
ATOM   3081  C  CB    . TYR A  1 435 ? -16.460 18.505   65.579  1.00 58.52  ? 435 TYR A CB    1 
ATOM   3082  C  CG    . TYR A  1 435 ? -14.980 18.766   65.415  1.00 59.08  ? 435 TYR A CG    1 
ATOM   3083  C  CD1   . TYR A  1 435 ? -14.033 17.930   66.011  1.00 58.37  ? 435 TYR A CD1   1 
ATOM   3084  C  CD2   . TYR A  1 435 ? -14.526 19.844   64.658  1.00 58.82  ? 435 TYR A CD2   1 
ATOM   3085  C  CE1   . TYR A  1 435 ? -12.684 18.166   65.859  1.00 59.52  ? 435 TYR A CE1   1 
ATOM   3086  C  CE2   . TYR A  1 435 ? -13.183 20.090   64.504  1.00 59.31  ? 435 TYR A CE2   1 
ATOM   3087  C  CZ    . TYR A  1 435 ? -12.271 19.252   65.103  1.00 60.47  ? 435 TYR A CZ    1 
ATOM   3088  O  OH    . TYR A  1 435 ? -10.938 19.506   64.950  1.00 62.92  ? 435 TYR A OH    1 
ATOM   3089  N  N     . SER A  1 436 ? -19.038 16.373   64.127  1.00 55.95  ? 436 SER A N     1 
ATOM   3090  C  CA    . SER A  1 436 ? -20.484 16.283   64.125  1.00 55.45  ? 436 SER A CA    1 
ATOM   3091  C  C     . SER A  1 436 ? -20.942 14.843   63.943  1.00 54.59  ? 436 SER A C     1 
ATOM   3092  O  O     . SER A  1 436 ? -21.555 14.508   62.931  1.00 54.49  ? 436 SER A O     1 
ATOM   3093  C  CB    . SER A  1 436 ? -21.033 17.143   63.005  1.00 55.86  ? 436 SER A CB    1 
ATOM   3094  O  OG    . SER A  1 436 ? -20.200 18.256   62.801  1.00 56.91  ? 436 SER A OG    1 
ATOM   3095  N  N     . PRO A  1 437 ? -20.644 13.971   64.915  1.00 54.35  ? 437 PRO A N     1 
ATOM   3096  C  CA    . PRO A  1 437 ? -21.089 12.614   64.701  1.00 53.79  ? 437 PRO A CA    1 
ATOM   3097  C  C     . PRO A  1 437 ? -22.616 12.476   64.884  1.00 54.07  ? 437 PRO A C     1 
ATOM   3098  O  O     . PRO A  1 437 ? -23.200 13.150   65.733  1.00 54.29  ? 437 PRO A O     1 
ATOM   3099  C  CB    . PRO A  1 437 ? -20.321 11.840   65.759  1.00 54.11  ? 437 PRO A CB    1 
ATOM   3100  C  CG    . PRO A  1 437 ? -20.155 12.811   66.854  1.00 54.90  ? 437 PRO A CG    1 
ATOM   3101  C  CD    . PRO A  1 437 ? -19.940 14.124   66.196  1.00 55.04  ? 437 PRO A CD    1 
ATOM   3102  N  N     . LEU A  1 438 ? -23.223 11.607   64.074  1.00 53.61  ? 438 LEU A N     1 
ATOM   3103  C  CA    . LEU A  1 438 ? -24.654 11.389   64.062  1.00 54.15  ? 438 LEU A CA    1 
ATOM   3104  C  C     . LEU A  1 438 ? -25.092 10.176   64.871  1.00 54.65  ? 438 LEU A C     1 
ATOM   3105  O  O     . LEU A  1 438 ? -24.424 9.143    64.874  1.00 54.72  ? 438 LEU A O     1 
ATOM   3106  C  CB    . LEU A  1 438 ? -25.144 11.224   62.628  1.00 53.85  ? 438 LEU A CB    1 
ATOM   3107  C  CG    . LEU A  1 438 ? -25.380 12.494   61.813  1.00 54.41  ? 438 LEU A CG    1 
ATOM   3108  C  CD1   . LEU A  1 438 ? -25.861 12.132   60.425  1.00 54.86  ? 438 LEU A CD1   1 
ATOM   3109  C  CD2   . LEU A  1 438 ? -26.377 13.426   62.480  1.00 54.67  ? 438 LEU A CD2   1 
ATOM   3110  N  N     . ALA A  1 439 ? -26.225 10.314   65.557  1.00 55.60  ? 439 ALA A N     1 
ATOM   3111  C  CA    . ALA A  1 439 ? -26.865 9.194    66.218  1.00 56.37  ? 439 ALA A CA    1 
ATOM   3112  C  C     . ALA A  1 439 ? -27.333 8.217    65.147  1.00 56.37  ? 439 ALA A C     1 
ATOM   3113  O  O     . ALA A  1 439 ? -27.520 8.605    63.983  1.00 55.91  ? 439 ALA A O     1 
ATOM   3114  C  CB    . ALA A  1 439 ? -28.036 9.668    67.034  1.00 57.92  ? 439 ALA A CB    1 
ATOM   3115  N  N     . THR A  1 440 ? -27.514 6.955    65.537  1.00 56.91  ? 440 THR A N     1 
ATOM   3116  C  CA    . THR A  1 440 ? -27.945 5.926    64.604  1.00 57.00  ? 440 THR A CA    1 
ATOM   3117  C  C     . THR A  1 440 ? -29.303 6.281    64.013  1.00 57.89  ? 440 THR A C     1 
ATOM   3118  O  O     . THR A  1 440 ? -29.487 6.195    62.806  1.00 57.79  ? 440 THR A O     1 
ATOM   3119  C  CB    . THR A  1 440 ? -27.940 4.536    65.248  1.00 57.86  ? 440 THR A CB    1 
ATOM   3120  O  OG1   . THR A  1 440 ? -26.595 4.183    65.599  1.00 57.27  ? 440 THR A OG1   1 
ATOM   3121  C  CG2   . THR A  1 440 ? -28.446 3.504    64.282  1.00 58.90  ? 440 THR A CG2   1 
ATOM   3122  N  N     . GLU A  1 441 ? -30.232 6.726    64.856  1.00 59.45  ? 441 GLU A N     1 
ATOM   3123  C  CA    . GLU A  1 441 ? -31.577 7.099    64.409  1.00 60.77  ? 441 GLU A CA    1 
ATOM   3124  C  C     . GLU A  1 441 ? -31.565 8.332    63.488  1.00 60.28  ? 441 GLU A C     1 
ATOM   3125  O  O     . GLU A  1 441 ? -32.511 8.590    62.761  1.00 60.98  ? 441 GLU A O     1 
ATOM   3126  C  CB    . GLU A  1 441 ? -32.516 7.286    65.609  1.00 62.60  ? 441 GLU A CB    1 
ATOM   3127  C  CG    . GLU A  1 441 ? -32.221 8.489    66.501  1.00 64.15  ? 441 GLU A CG    1 
ATOM   3128  C  CD    . GLU A  1 441 ? -31.187 8.218    67.600  1.00 67.04  ? 441 GLU A CD    1 
ATOM   3129  O  OE1   . GLU A  1 441 ? -30.447 7.207    67.501  1.00 67.85  ? 441 GLU A OE1   1 
ATOM   3130  O  OE2   . GLU A  1 441 ? -31.105 9.029    68.565  1.00 67.71  ? 441 GLU A OE2   1 
ATOM   3131  N  N     . GLU A  1 442 ? -30.479 9.092    63.512  1.00 59.32  ? 442 GLU A N     1 
ATOM   3132  C  CA    . GLU A  1 442 ? -30.337 10.218   62.593  1.00 59.09  ? 442 GLU A CA    1 
ATOM   3133  C  C     . GLU A  1 442 ? -29.762 9.710    61.262  1.00 57.64  ? 442 GLU A C     1 
ATOM   3134  O  O     . GLU A  1 442 ? -30.174 10.146   60.189  1.00 58.03  ? 442 GLU A O     1 
ATOM   3135  C  CB    . GLU A  1 442 ? -29.495 11.350   63.231  1.00 58.87  ? 442 GLU A CB    1 
ATOM   3136  C  CG    . GLU A  1 442 ? -30.350 12.391   64.010  1.00 62.50  ? 442 GLU A CG    1 
ATOM   3137  C  CD    . GLU A  1 442 ? -29.604 13.167   65.125  1.00 66.34  ? 442 GLU A CD    1 
ATOM   3138  O  OE1   . GLU A  1 442 ? -28.409 13.523   64.957  1.00 67.44  ? 442 GLU A OE1   1 
ATOM   3139  O  OE2   . GLU A  1 442 ? -30.234 13.440   66.181  1.00 68.33  ? 442 GLU A OE2   1 
ATOM   3140  N  N     . GLN A  1 443 ? -28.847 8.747    61.354  1.00 56.33  ? 443 GLN A N     1 
ATOM   3141  C  CA    . GLN A  1 443 ? -28.219 8.108    60.193  1.00 55.07  ? 443 GLN A CA    1 
ATOM   3142  C  C     . GLN A  1 443 ? -29.181 7.308    59.310  1.00 55.54  ? 443 GLN A C     1 
ATOM   3143  O  O     . GLN A  1 443 ? -29.195 7.509    58.094  1.00 55.44  ? 443 GLN A O     1 
ATOM   3144  C  CB    . GLN A  1 443 ? -27.082 7.185    60.635  1.00 54.35  ? 443 GLN A CB    1 
ATOM   3145  C  CG    . GLN A  1 443 ? -25.852 7.866    61.169  1.00 53.52  ? 443 GLN A CG    1 
ATOM   3146  C  CD    . GLN A  1 443 ? -24.732 6.868    61.437  1.00 53.97  ? 443 GLN A CD    1 
ATOM   3147  O  OE1   . GLN A  1 443 ? -24.335 6.112    60.552  1.00 54.39  ? 443 GLN A OE1   1 
ATOM   3148  N  NE2   . GLN A  1 443 ? -24.227 6.857    62.662  1.00 53.48  ? 443 GLN A NE2   1 
ATOM   3149  N  N     . VAL A  1 444 ? -29.963 6.399    59.904  1.00 55.87  ? 444 VAL A N     1 
ATOM   3150  C  CA    . VAL A  1 444 ? -30.786 5.471    59.095  1.00 56.96  ? 444 VAL A CA    1 
ATOM   3151  C  C     . VAL A  1 444 ? -31.836 6.164    58.208  1.00 57.89  ? 444 VAL A C     1 
ATOM   3152  O  O     . VAL A  1 444 ? -31.982 5.799    57.047  1.00 58.24  ? 444 VAL A O     1 
ATOM   3153  C  CB    . VAL A  1 444 ? -31.435 4.269    59.889  1.00 58.00  ? 444 VAL A CB    1 
ATOM   3154  C  CG1   . VAL A  1 444 ? -30.804 4.069    61.258  1.00 57.13  ? 444 VAL A CG1   1 
ATOM   3155  C  CG2   . VAL A  1 444 ? -32.946 4.417    60.003  1.00 59.21  ? 444 VAL A CG2   1 
ATOM   3156  N  N     . PRO A  1 445 ? -32.561 7.161    58.744  1.00 58.43  ? 445 PRO A N     1 
ATOM   3157  C  CA    . PRO A  1 445 ? -33.493 7.811    57.828  1.00 60.13  ? 445 PRO A CA    1 
ATOM   3158  C  C     . PRO A  1 445 ? -32.800 8.527    56.679  1.00 59.94  ? 445 PRO A C     1 
ATOM   3159  O  O     . PRO A  1 445 ? -33.343 8.548    55.579  1.00 61.28  ? 445 PRO A O     1 
ATOM   3160  C  CB    . PRO A  1 445 ? -34.258 8.804    58.706  1.00 60.71  ? 445 PRO A CB    1 
ATOM   3161  C  CG    . PRO A  1 445 ? -33.666 8.732    60.036  1.00 59.59  ? 445 PRO A CG    1 
ATOM   3162  C  CD    . PRO A  1 445 ? -32.776 7.559    60.142  1.00 58.34  ? 445 PRO A CD    1 
ATOM   3163  N  N     . LEU A  1 446 ? -31.618 9.099    56.920  1.00 58.95  ? 446 LEU A N     1 
ATOM   3164  C  CA    . LEU A  1 446 ? -30.871 9.767    55.841  1.00 59.12  ? 446 LEU A CA    1 
ATOM   3165  C  C     . LEU A  1 446 ? -30.442 8.753    54.806  1.00 59.52  ? 446 LEU A C     1 
ATOM   3166  O  O     . LEU A  1 446 ? -30.710 8.930    53.617  1.00 61.20  ? 446 LEU A O     1 
ATOM   3167  C  CB    . LEU A  1 446 ? -29.668 10.557   56.349  1.00 57.38  ? 446 LEU A CB    1 
ATOM   3168  C  CG    . LEU A  1 446 ? -30.001 11.716   57.295  1.00 58.24  ? 446 LEU A CG    1 
ATOM   3169  C  CD1   . LEU A  1 446 ? -28.711 12.303   57.838  1.00 56.23  ? 446 LEU A CD1   1 
ATOM   3170  C  CD2   . LEU A  1 446 ? -30.904 12.815   56.663  1.00 59.25  ? 446 LEU A CD2   1 
ATOM   3171  N  N     . ILE A  1 447 ? -29.824 7.672    55.263  1.00 58.66  ? 447 ILE A N     1 
ATOM   3172  C  CA    . ILE A  1 447 ? -29.446 6.596    54.370  1.00 59.14  ? 447 ILE A CA    1 
ATOM   3173  C  C     . ILE A  1 447 ? -30.671 6.023    53.645  1.00 61.25  ? 447 ILE A C     1 
ATOM   3174  O  O     . ILE A  1 447 ? -30.623 5.827    52.429  1.00 62.77  ? 447 ILE A O     1 
ATOM   3175  C  CB    . ILE A  1 447 ? -28.560 5.560    55.091  1.00 58.35  ? 447 ILE A CB    1 
ATOM   3176  C  CG1   . ILE A  1 447 ? -27.114 6.097    55.128  1.00 57.70  ? 447 ILE A CG1   1 
ATOM   3177  C  CG2   . ILE A  1 447 ? -28.587 4.209    54.384  1.00 58.91  ? 447 ILE A CG2   1 
ATOM   3178  C  CD1   . ILE A  1 447 ? -26.481 6.168    56.521  1.00 56.58  ? 447 ILE A CD1   1 
ATOM   3179  N  N     . TYR A  1 448 ? -31.772 5.804    54.365  1.00 61.77  ? 448 TYR A N     1 
ATOM   3180  C  CA    . TYR A  1 448 ? -32.992 5.274    53.750  1.00 63.71  ? 448 TYR A CA    1 
ATOM   3181  C  C     . TYR A  1 448 ? -33.480 6.129    52.571  1.00 64.97  ? 448 TYR A C     1 
ATOM   3182  O  O     . TYR A  1 448 ? -33.760 5.605    51.491  1.00 66.40  ? 448 TYR A O     1 
ATOM   3183  C  CB    . TYR A  1 448 ? -34.112 5.107    54.793  1.00 64.63  ? 448 TYR A CB    1 
ATOM   3184  C  CG    . TYR A  1 448 ? -35.447 4.689    54.218  1.00 66.78  ? 448 TYR A CG    1 
ATOM   3185  C  CD1   . TYR A  1 448 ? -35.776 3.345    54.080  1.00 68.25  ? 448 TYR A CD1   1 
ATOM   3186  C  CD2   . TYR A  1 448 ? -36.385 5.641    53.812  1.00 68.78  ? 448 TYR A CD2   1 
ATOM   3187  C  CE1   . TYR A  1 448 ? -37.018 2.955    53.549  1.00 71.16  ? 448 TYR A CE1   1 
ATOM   3188  C  CE2   . TYR A  1 448 ? -37.633 5.261    53.279  1.00 71.18  ? 448 TYR A CE2   1 
ATOM   3189  C  CZ    . TYR A  1 448 ? -37.937 3.918    53.151  1.00 71.77  ? 448 TYR A CZ    1 
ATOM   3190  O  OH    . TYR A  1 448 ? -39.140 3.535    52.613  1.00 73.56  ? 448 TYR A OH    1 
ATOM   3191  N  N     . ALA A  1 449 ? -33.590 7.437    52.784  1.00 64.46  ? 449 ALA A N     1 
ATOM   3192  C  CA    . ALA A  1 449 ? -34.075 8.330    51.746  1.00 65.90  ? 449 ALA A CA    1 
ATOM   3193  C  C     . ALA A  1 449 ? -33.290 8.092    50.463  1.00 66.45  ? 449 ALA A C     1 
ATOM   3194  O  O     . ALA A  1 449 ? -33.877 7.810    49.423  1.00 68.82  ? 449 ALA A O     1 
ATOM   3195  C  CB    . ALA A  1 449 ? -33.967 9.771    52.188  1.00 65.34  ? 449 ALA A CB    1 
ATOM   3196  N  N     . GLY A  1 450 ? -31.963 8.166    50.557  1.00 64.77  ? 450 GLY A N     1 
ATOM   3197  C  CA    . GLY A  1 450 ? -31.081 7.929    49.419  1.00 65.08  ? 450 GLY A CA    1 
ATOM   3198  C  C     . GLY A  1 450 ? -31.242 6.557    48.801  1.00 66.08  ? 450 GLY A C     1 
ATOM   3199  O  O     . GLY A  1 450 ? -31.663 6.430    47.651  1.00 68.20  ? 450 GLY A O     1 
ATOM   3200  N  N     . VAL A  1 451 ? -30.918 5.535    49.581  1.00 64.85  ? 451 VAL A N     1 
ATOM   3201  C  CA    . VAL A  1 451 ? -30.982 4.142    49.149  1.00 66.13  ? 451 VAL A CA    1 
ATOM   3202  C  C     . VAL A  1 451 ? -32.227 3.838    48.313  1.00 68.85  ? 451 VAL A C     1 
ATOM   3203  O  O     . VAL A  1 451 ? -32.147 3.074    47.352  1.00 70.92  ? 451 VAL A O     1 
ATOM   3204  C  CB    . VAL A  1 451 ? -30.843 3.191    50.374  1.00 64.73  ? 451 VAL A CB    1 
ATOM   3205  C  CG1   . VAL A  1 451 ? -31.551 1.867    50.168  1.00 66.09  ? 451 VAL A CG1   1 
ATOM   3206  C  CG2   . VAL A  1 451 ? -29.371 2.974    50.689  1.00 64.09  ? 451 VAL A CG2   1 
ATOM   3207  N  N     . ASN A  1 452 ? -33.350 4.472    48.663  1.00 69.34  ? 452 ASN A N     1 
ATOM   3208  C  CA    . ASN A  1 452 ? -34.655 4.216    48.034  1.00 72.04  ? 452 ASN A CA    1 
ATOM   3209  C  C     . ASN A  1 452 ? -35.140 5.201    46.946  1.00 74.08  ? 452 ASN A C     1 
ATOM   3210  O  O     . ASN A  1 452 ? -36.241 5.055    46.420  1.00 76.65  ? 452 ASN A O     1 
ATOM   3211  C  CB    . ASN A  1 452 ? -35.730 4.022    49.109  1.00 71.88  ? 452 ASN A CB    1 
ATOM   3212  C  CG    . ASN A  1 452 ? -35.622 2.678    49.790  1.00 71.43  ? 452 ASN A CG    1 
ATOM   3213  O  OD1   . ASN A  1 452 ? -35.894 1.643    49.190  1.00 73.67  ? 452 ASN A OD1   1 
ATOM   3214  N  ND2   . ASN A  1 452 ? -35.215 2.684    51.045  1.00 69.48  ? 452 ASN A ND2   1 
ATOM   3215  N  N     . GLY A  1 453 ? -34.320 6.187    46.603  1.00 73.31  ? 453 GLY A N     1 
ATOM   3216  C  CA    . GLY A  1 453 ? -34.611 7.050    45.469  1.00 75.35  ? 453 GLY A CA    1 
ATOM   3217  C  C     . GLY A  1 453 ? -35.354 8.334    45.769  1.00 75.91  ? 453 GLY A C     1 
ATOM   3218  O  O     . GLY A  1 453 ? -35.738 9.047    44.847  1.00 78.37  ? 453 GLY A O     1 
ATOM   3219  N  N     . HIS A  1 454 ? -35.555 8.643    47.047  1.00 74.23  ? 454 HIS A N     1 
ATOM   3220  C  CA    . HIS A  1 454 ? -36.211 9.896    47.435  1.00 74.89  ? 454 HIS A CA    1 
ATOM   3221  C  C     . HIS A  1 454 ? -35.355 11.151   47.182  1.00 74.60  ? 454 HIS A C     1 
ATOM   3222  O  O     . HIS A  1 454 ? -35.842 12.284   47.307  1.00 75.75  ? 454 HIS A O     1 
ATOM   3223  C  CB    . HIS A  1 454 ? -36.689 9.827    48.883  1.00 73.13  ? 454 HIS A CB    1 
ATOM   3224  C  CG    . HIS A  1 454 ? -37.830 8.881    49.088  1.00 74.85  ? 454 HIS A CG    1 
ATOM   3225  N  ND1   . HIS A  1 454 ? -37.649 7.569    49.467  1.00 74.24  ? 454 HIS A ND1   1 
ATOM   3226  C  CD2   . HIS A  1 454 ? -39.168 9.050    48.951  1.00 77.03  ? 454 HIS A CD2   1 
ATOM   3227  C  CE1   . HIS A  1 454 ? -38.824 6.972    49.564  1.00 74.33  ? 454 HIS A CE1   1 
ATOM   3228  N  NE2   . HIS A  1 454 ? -39.761 7.849    49.256  1.00 76.45  ? 454 HIS A NE2   1 
ATOM   3229  N  N     . LEU A  1 455 ? -34.096 10.951   46.794  1.00 73.59  ? 455 LEU A N     1 
ATOM   3230  C  CA    . LEU A  1 455 ? -33.199 12.078   46.523  1.00 73.39  ? 455 LEU A CA    1 
ATOM   3231  C  C     . LEU A  1 455 ? -32.925 12.342   45.045  1.00 75.80  ? 455 LEU A C     1 
ATOM   3232  O  O     . LEU A  1 455 ? -32.406 13.404   44.687  1.00 76.23  ? 455 LEU A O     1 
ATOM   3233  C  CB    . LEU A  1 455 ? -31.898 11.919   47.305  1.00 70.59  ? 455 LEU A CB    1 
ATOM   3234  C  CG    . LEU A  1 455 ? -32.221 11.875   48.794  1.00 68.74  ? 455 LEU A CG    1 
ATOM   3235  C  CD1   . LEU A  1 455 ? -30.981 11.685   49.610  1.00 67.91  ? 455 LEU A CD1   1 
ATOM   3236  C  CD2   . LEU A  1 455 ? -32.907 13.149   49.182  1.00 69.77  ? 455 LEU A CD2   1 
ATOM   3237  N  N     . ASP A  1 456 ? -33.296 11.382   44.199  1.00 77.59  ? 456 ASP A N     1 
ATOM   3238  C  CA    . ASP A  1 456 ? -33.106 11.483   42.745  1.00 80.63  ? 456 ASP A CA    1 
ATOM   3239  C  C     . ASP A  1 456 ? -33.462 12.854   42.157  1.00 82.93  ? 456 ASP A C     1 
ATOM   3240  O  O     . ASP A  1 456 ? -32.686 13.425   41.392  1.00 84.03  ? 456 ASP A O     1 
ATOM   3241  C  CB    . ASP A  1 456 ? -33.901 10.388   42.016  1.00 82.83  ? 456 ASP A CB    1 
ATOM   3242  C  CG    . ASP A  1 456 ? -33.258 9.015    42.120  1.00 81.54  ? 456 ASP A CG    1 
ATOM   3243  O  OD1   . ASP A  1 456 ? -32.443 8.778    43.044  1.00 78.22  ? 456 ASP A OD1   1 
ATOM   3244  O  OD2   . ASP A  1 456 ? -33.588 8.164    41.268  1.00 83.84  ? 456 ASP A OD2   1 
ATOM   3245  N  N     . GLY A  1 457 ? -34.631 13.377   42.521  1.00 84.06  ? 457 GLY A N     1 
ATOM   3246  C  CA    . GLY A  1 457 ? -35.133 14.610   41.922  1.00 86.96  ? 457 GLY A CA    1 
ATOM   3247  C  C     . GLY A  1 457 ? -34.610 15.889   42.547  1.00 85.99  ? 457 GLY A C     1 
ATOM   3248  O  O     . GLY A  1 457 ? -35.161 16.961   42.308  1.00 88.46  ? 457 GLY A O     1 
ATOM   3249  N  N     . ILE A  1 458 ? -33.548 15.788   43.340  1.00 82.78  ? 458 ILE A N     1 
ATOM   3250  C  CA    . ILE A  1 458 ? -33.062 16.918   44.114  1.00 81.63  ? 458 ILE A CA    1 
ATOM   3251  C  C     . ILE A  1 458 ? -31.670 17.320   43.636  1.00 81.80  ? 458 ILE A C     1 
ATOM   3252  O  O     . ILE A  1 458 ? -30.721 16.514   43.691  1.00 80.19  ? 458 ILE A O     1 
ATOM   3253  C  CB    . ILE A  1 458 ? -33.031 16.577   45.618  1.00 78.38  ? 458 ILE A CB    1 
ATOM   3254  C  CG1   . ILE A  1 458 ? -34.434 16.250   46.112  1.00 79.12  ? 458 ILE A CG1   1 
ATOM   3255  C  CG2   . ILE A  1 458 ? -32.428 17.727   46.434  1.00 77.43  ? 458 ILE A CG2   1 
ATOM   3256  C  CD1   . ILE A  1 458 ? -34.469 15.580   47.454  1.00 77.15  ? 458 ILE A CD1   1 
ATOM   3257  N  N     . GLU A  1 459 ? -31.537 18.565   43.179  1.00 83.86  ? 459 GLU A N     1 
ATOM   3258  C  CA    . GLU A  1 459 ? -30.267 19.011   42.606  1.00 84.51  ? 459 GLU A CA    1 
ATOM   3259  C  C     . GLU A  1 459 ? -29.107 18.797   43.572  1.00 81.25  ? 459 GLU A C     1 
ATOM   3260  O  O     . GLU A  1 459 ? -29.224 19.026   44.783  1.00 79.25  ? 459 GLU A O     1 
ATOM   3261  C  CB    . GLU A  1 459 ? -30.322 20.448   42.070  1.00 87.49  ? 459 GLU A CB    1 
ATOM   3262  C  CG    . GLU A  1 459 ? -30.638 21.529   43.092  1.00 87.57  ? 459 GLU A CG    1 
ATOM   3263  C  CD    . GLU A  1 459 ? -30.303 22.923   42.583  1.00 90.95  ? 459 GLU A CD    1 
ATOM   3264  O  OE1   . GLU A  1 459 ? -29.119 23.154   42.231  1.00 90.80  ? 459 GLU A OE1   1 
ATOM   3265  O  OE2   . GLU A  1 459 ? -31.220 23.781   42.544  1.00 92.97  ? 459 GLU A OE2   1 
ATOM   3266  N  N     . LEU A  1 460 ? -27.988 18.354   43.009  1.00 81.23  ? 460 LEU A N     1 
ATOM   3267  C  CA    . LEU A  1 460 ? -26.893 17.768   43.779  1.00 78.10  ? 460 LEU A CA    1 
ATOM   3268  C  C     . LEU A  1 460 ? -26.319 18.687   44.840  1.00 76.38  ? 460 LEU A C     1 
ATOM   3269  O  O     . LEU A  1 460 ? -25.774 18.216   45.828  1.00 73.80  ? 460 LEU A O     1 
ATOM   3270  C  CB    . LEU A  1 460 ? -25.796 17.253   42.839  1.00 79.19  ? 460 LEU A CB    1 
ATOM   3271  C  CG    . LEU A  1 460 ? -24.739 16.253   43.328  1.00 76.99  ? 460 LEU A CG    1 
ATOM   3272  C  CD1   . LEU A  1 460 ? -25.315 15.026   44.023  1.00 74.18  ? 460 LEU A CD1   1 
ATOM   3273  C  CD2   . LEU A  1 460 ? -23.895 15.826   42.149  1.00 79.94  ? 460 LEU A CD2   1 
ATOM   3274  N  N     . SER A  1 461 ? -26.462 19.995   44.653  1.00 78.21  ? 461 SER A N     1 
ATOM   3275  C  CA    . SER A  1 461 ? -25.881 20.949   45.594  1.00 77.35  ? 461 SER A CA    1 
ATOM   3276  C  C     . SER A  1 461 ? -26.716 21.082   46.856  1.00 75.49  ? 461 SER A C     1 
ATOM   3277  O  O     . SER A  1 461 ? -26.251 21.615   47.862  1.00 74.23  ? 461 SER A O     1 
ATOM   3278  C  CB    . SER A  1 461 ? -25.669 22.321   44.943  1.00 80.18  ? 461 SER A CB    1 
ATOM   3279  O  OG    . SER A  1 461 ? -26.898 22.923   44.589  1.00 82.78  ? 461 SER A OG    1 
ATOM   3280  N  N     . ARG A  1 462 ? -27.945 20.584   46.807  1.00 75.77  ? 462 ARG A N     1 
ATOM   3281  C  CA    . ARG A  1 462 ? -28.868 20.796   47.913  1.00 74.87  ? 462 ARG A CA    1 
ATOM   3282  C  C     . ARG A  1 462 ? -29.033 19.581   48.824  1.00 72.30  ? 462 ARG A C     1 
ATOM   3283  O  O     . ARG A  1 462 ? -29.890 19.589   49.711  1.00 71.99  ? 462 ARG A O     1 
ATOM   3284  C  CB    . ARG A  1 462 ? -30.220 21.323   47.404  1.00 77.34  ? 462 ARG A CB    1 
ATOM   3285  C  CG    . ARG A  1 462 ? -30.101 22.636   46.610  1.00 80.53  ? 462 ARG A CG    1 
ATOM   3286  C  CD    . ARG A  1 462 ? -31.361 23.516   46.656  1.00 82.86  ? 462 ARG A CD    1 
ATOM   3287  N  NE    . ARG A  1 462 ? -32.526 22.853   46.077  1.00 84.65  ? 462 ARG A NE    1 
ATOM   3288  C  CZ    . ARG A  1 462 ? -33.647 22.566   46.736  1.00 84.78  ? 462 ARG A CZ    1 
ATOM   3289  N  NH1   . ARG A  1 462 ? -33.796 22.897   48.016  1.00 83.54  ? 462 ARG A NH1   1 
ATOM   3290  N  NH2   . ARG A  1 462 ? -34.634 21.958   46.099  1.00 86.81  ? 462 ARG A NH2   1 
ATOM   3291  N  N     . ILE A  1 463 ? -28.204 18.550   48.628  1.00 70.81  ? 463 ILE A N     1 
ATOM   3292  C  CA    . ILE A  1 463 ? -28.294 17.347   49.467  1.00 68.41  ? 463 ILE A CA    1 
ATOM   3293  C  C     . ILE A  1 463 ? -27.924 17.631   50.920  1.00 66.72  ? 463 ILE A C     1 
ATOM   3294  O  O     . ILE A  1 463 ? -28.527 17.067   51.829  1.00 66.00  ? 463 ILE A O     1 
ATOM   3295  C  CB    . ILE A  1 463 ? -27.475 16.151   48.926  1.00 67.59  ? 463 ILE A CB    1 
ATOM   3296  C  CG1   . ILE A  1 463 ? -27.938 15.754   47.514  1.00 69.75  ? 463 ILE A CG1   1 
ATOM   3297  C  CG2   . ILE A  1 463 ? -27.584 14.958   49.863  1.00 64.81  ? 463 ILE A CG2   1 
ATOM   3298  C  CD1   . ILE A  1 463 ? -29.392 15.264   47.405  1.00 70.37  ? 463 ILE A CD1   1 
ATOM   3299  N  N     . GLY A  1 464 ? -26.950 18.516   51.130  1.00 66.77  ? 464 GLY A N     1 
ATOM   3300  C  CA    . GLY A  1 464 ? -26.567 18.955   52.468  1.00 65.48  ? 464 GLY A CA    1 
ATOM   3301  C  C     . GLY A  1 464 ? -27.727 19.581   53.224  1.00 66.56  ? 464 GLY A C     1 
ATOM   3302  O  O     . GLY A  1 464 ? -28.172 19.032   54.232  1.00 65.88  ? 464 GLY A O     1 
ATOM   3303  N  N     . GLU A  1 465 ? -28.236 20.714   52.733  1.00 68.63  ? 465 GLU A N     1 
ATOM   3304  C  CA    . GLU A  1 465 ? -29.338 21.414   53.406  1.00 69.86  ? 465 GLU A CA    1 
ATOM   3305  C  C     . GLU A  1 465 ? -30.569 20.528   53.527  1.00 69.84  ? 465 GLU A C     1 
ATOM   3306  O  O     . GLU A  1 465 ? -31.386 20.708   54.434  1.00 70.08  ? 465 GLU A O     1 
ATOM   3307  C  CB    . GLU A  1 465 ? -29.685 22.743   52.721  1.00 72.57  ? 465 GLU A CB    1 
ATOM   3308  C  CG    . GLU A  1 465 ? -29.889 22.650   51.214  1.00 75.39  ? 465 GLU A CG    1 
ATOM   3309  C  CD    . GLU A  1 465 ? -31.018 23.543   50.691  1.00 80.21  ? 465 GLU A CD    1 
ATOM   3310  O  OE1   . GLU A  1 465 ? -31.417 24.516   51.376  1.00 82.22  ? 465 GLU A OE1   1 
ATOM   3311  O  OE2   . GLU A  1 465 ? -31.516 23.267   49.579  1.00 82.05  ? 465 GLU A OE2   1 
ATOM   3312  N  N     . PHE A  1 466 ? -30.685 19.561   52.618  1.00 69.88  ? 466 PHE A N     1 
ATOM   3313  C  CA    . PHE A  1 466 ? -31.747 18.565   52.701  1.00 70.08  ? 466 PHE A CA    1 
ATOM   3314  C  C     . PHE A  1 466 ? -31.588 17.754   53.986  1.00 68.19  ? 466 PHE A C     1 
ATOM   3315  O  O     . PHE A  1 466 ? -32.544 17.595   54.752  1.00 68.41  ? 466 PHE A O     1 
ATOM   3316  C  CB    . PHE A  1 466 ? -31.744 17.633   51.485  1.00 70.21  ? 466 PHE A CB    1 
ATOM   3317  C  CG    . PHE A  1 466 ? -32.707 16.483   51.610  1.00 70.48  ? 466 PHE A CG    1 
ATOM   3318  C  CD1   . PHE A  1 466 ? -32.319 15.288   52.222  1.00 68.90  ? 466 PHE A CD1   1 
ATOM   3319  C  CD2   . PHE A  1 466 ? -34.011 16.597   51.135  1.00 71.94  ? 466 PHE A CD2   1 
ATOM   3320  C  CE1   . PHE A  1 466 ? -33.228 14.226   52.352  1.00 69.53  ? 466 PHE A CE1   1 
ATOM   3321  C  CE2   . PHE A  1 466 ? -34.913 15.548   51.251  1.00 71.74  ? 466 PHE A CE2   1 
ATOM   3322  C  CZ    . PHE A  1 466 ? -34.529 14.362   51.862  1.00 70.42  ? 466 PHE A CZ    1 
ATOM   3323  N  N     . GLU A  1 467 ? -30.369 17.261   54.215  1.00 66.32  ? 467 GLU A N     1 
ATOM   3324  C  CA    . GLU A  1 467 ? -30.063 16.431   55.374  1.00 64.96  ? 467 GLU A CA    1 
ATOM   3325  C  C     . GLU A  1 467 ? -30.436 17.154   56.666  1.00 64.81  ? 467 GLU A C     1 
ATOM   3326  O  O     . GLU A  1 467 ? -31.153 16.616   57.516  1.00 64.83  ? 467 GLU A O     1 
ATOM   3327  C  CB    . GLU A  1 467 ? -28.590 16.026   55.349  1.00 63.61  ? 467 GLU A CB    1 
ATOM   3328  C  CG    . GLU A  1 467 ? -27.979 15.693   56.708  1.00 65.32  ? 467 GLU A CG    1 
ATOM   3329  C  CD    . GLU A  1 467 ? -26.764 14.780   56.591  1.00 69.23  ? 467 GLU A CD    1 
ATOM   3330  O  OE1   . GLU A  1 467 ? -26.570 14.204   55.485  1.00 71.03  ? 467 GLU A OE1   1 
ATOM   3331  O  OE2   . GLU A  1 467 ? -26.011 14.628   57.599  1.00 69.61  ? 467 GLU A OE2   1 
ATOM   3332  N  N     . SER A  1 468 ? -29.978 18.393   56.765  1.00 65.00  ? 468 SER A N     1 
ATOM   3333  C  CA    . SER A  1 468 ? -30.209 19.241   57.910  1.00 65.61  ? 468 SER A CA    1 
ATOM   3334  C  C     . SER A  1 468 ? -31.707 19.487   58.169  1.00 67.62  ? 468 SER A C     1 
ATOM   3335  O  O     . SER A  1 468 ? -32.227 19.192   59.257  1.00 67.73  ? 468 SER A O     1 
ATOM   3336  C  CB    . SER A  1 468 ? -29.494 20.561   57.659  1.00 66.37  ? 468 SER A CB    1 
ATOM   3337  O  OG    . SER A  1 468 ? -29.271 21.230   58.879  1.00 67.88  ? 468 SER A OG    1 
ATOM   3338  N  N     . SER A  1 469 ? -32.382 20.036   57.157  1.00 69.25  ? 469 SER A N     1 
ATOM   3339  C  CA    . SER A  1 469 ? -33.814 20.287   57.192  1.00 71.05  ? 469 SER A CA    1 
ATOM   3340  C  C     . SER A  1 469 ? -34.592 19.012   57.491  1.00 70.76  ? 469 SER A C     1 
ATOM   3341  O  O     . SER A  1 469 ? -35.478 19.006   58.353  1.00 72.20  ? 469 SER A O     1 
ATOM   3342  C  CB    . SER A  1 469 ? -34.283 20.858   55.857  1.00 72.96  ? 469 SER A CB    1 
ATOM   3343  O  OG    . SER A  1 469 ? -33.735 22.137   55.627  1.00 73.35  ? 469 SER A OG    1 
ATOM   3344  N  N     . PHE A  1 470 ? -34.257 17.934   56.784  1.00 69.10  ? 470 PHE A N     1 
ATOM   3345  C  CA    . PHE A  1 470 ? -35.005 16.688   56.918  1.00 68.75  ? 470 PHE A CA    1 
ATOM   3346  C  C     . PHE A  1 470 ? -34.919 16.153   58.331  1.00 67.51  ? 470 PHE A C     1 
ATOM   3347  O  O     . PHE A  1 470 ? -35.924 15.738   58.890  1.00 68.78  ? 470 PHE A O     1 
ATOM   3348  C  CB    . PHE A  1 470 ? -34.541 15.633   55.903  1.00 67.81  ? 470 PHE A CB    1 
ATOM   3349  C  CG    . PHE A  1 470 ? -35.303 14.335   55.979  1.00 67.39  ? 470 PHE A CG    1 
ATOM   3350  C  CD1   . PHE A  1 470 ? -36.694 14.329   56.106  1.00 68.65  ? 470 PHE A CD1   1 
ATOM   3351  C  CD2   . PHE A  1 470 ? -34.632 13.121   55.911  1.00 64.29  ? 470 PHE A CD2   1 
ATOM   3352  C  CE1   . PHE A  1 470 ? -37.393 13.134   56.176  1.00 68.58  ? 470 PHE A CE1   1 
ATOM   3353  C  CE2   . PHE A  1 470 ? -35.321 11.920   55.981  1.00 64.35  ? 470 PHE A CE2   1 
ATOM   3354  C  CZ    . PHE A  1 470 ? -36.703 11.924   56.112  1.00 66.83  ? 470 PHE A CZ    1 
ATOM   3355  N  N     . LEU A  1 471 ? -33.722 16.185   58.906  1.00 65.36  ? 471 LEU A N     1 
ATOM   3356  C  CA    . LEU A  1 471 ? -33.536 15.774   60.293  1.00 64.52  ? 471 LEU A CA    1 
ATOM   3357  C  C     . LEU A  1 471 ? -34.400 16.577   61.251  1.00 66.41  ? 471 LEU A C     1 
ATOM   3358  O  O     . LEU A  1 471 ? -35.162 15.990   62.020  1.00 67.35  ? 471 LEU A O     1 
ATOM   3359  C  CB    . LEU A  1 471 ? -32.061 15.833   60.712  1.00 62.57  ? 471 LEU A CB    1 
ATOM   3360  C  CG    . LEU A  1 471 ? -31.139 14.740   60.164  1.00 60.25  ? 471 LEU A CG    1 
ATOM   3361  C  CD1   . LEU A  1 471 ? -29.761 14.922   60.772  1.00 58.60  ? 471 LEU A CD1   1 
ATOM   3362  C  CD2   . LEU A  1 471 ? -31.694 13.317   60.408  1.00 58.48  ? 471 LEU A CD2   1 
ATOM   3363  N  N     . SER A  1 472 ? -34.308 17.906   61.189  1.00 67.34  ? 472 SER A N     1 
ATOM   3364  C  CA    . SER A  1 472 ? -35.122 18.763   62.067  1.00 70.01  ? 472 SER A CA    1 
ATOM   3365  C  C     . SER A  1 472 ? -36.624 18.565   61.873  1.00 72.22  ? 472 SER A C     1 
ATOM   3366  O  O     . SER A  1 472 ? -37.385 18.633   62.838  1.00 74.08  ? 472 SER A O     1 
ATOM   3367  C  CB    . SER A  1 472 ? -34.754 20.241   61.934  1.00 71.05  ? 472 SER A CB    1 
ATOM   3368  O  OG    . SER A  1 472 ? -34.327 20.523   60.619  1.00 72.00  ? 472 SER A OG    1 
ATOM   3369  N  N     . TYR A  1 473 ? -37.041 18.296   60.639  1.00 72.27  ? 473 TYR A N     1 
ATOM   3370  C  CA    . TYR A  1 473 ? -38.448 18.024   60.354  1.00 74.79  ? 473 TYR A CA    1 
ATOM   3371  C  C     . TYR A  1 473 ? -38.912 16.734   61.029  1.00 74.56  ? 473 TYR A C     1 
ATOM   3372  O  O     . TYR A  1 473 ? -40.022 16.686   61.579  1.00 77.12  ? 473 TYR A O     1 
ATOM   3373  C  CB    . TYR A  1 473 ? -38.700 17.987   58.847  1.00 75.17  ? 473 TYR A CB    1 
ATOM   3374  C  CG    . TYR A  1 473 ? -39.980 17.290   58.424  1.00 77.91  ? 473 TYR A CG    1 
ATOM   3375  C  CD1   . TYR A  1 473 ? -41.215 17.964   58.433  1.00 82.03  ? 473 TYR A CD1   1 
ATOM   3376  C  CD2   . TYR A  1 473 ? -39.958 15.960   57.989  1.00 76.25  ? 473 TYR A CD2   1 
ATOM   3377  C  CE1   . TYR A  1 473 ? -42.395 17.317   58.030  1.00 83.45  ? 473 TYR A CE1   1 
ATOM   3378  C  CE2   . TYR A  1 473 ? -41.123 15.308   57.593  1.00 78.41  ? 473 TYR A CE2   1 
ATOM   3379  C  CZ    . TYR A  1 473 ? -42.335 15.987   57.612  1.00 82.39  ? 473 TYR A CZ    1 
ATOM   3380  O  OH    . TYR A  1 473 ? -43.475 15.325   57.204  1.00 84.49  ? 473 TYR A OH    1 
ATOM   3381  N  N     . LEU A  1 474 ? -38.062 15.703   60.989  1.00 71.53  ? 474 LEU A N     1 
ATOM   3382  C  CA    . LEU A  1 474 ? -38.351 14.429   61.647  1.00 71.01  ? 474 LEU A CA    1 
ATOM   3383  C  C     . LEU A  1 474 ? -38.402 14.599   63.157  1.00 71.95  ? 474 LEU A C     1 
ATOM   3384  O  O     . LEU A  1 474 ? -39.136 13.892   63.848  1.00 73.04  ? 474 LEU A O     1 
ATOM   3385  C  CB    . LEU A  1 474 ? -37.290 13.391   61.305  1.00 68.02  ? 474 LEU A CB    1 
ATOM   3386  C  CG    . LEU A  1 474 ? -37.203 12.802   59.900  1.00 66.61  ? 474 LEU A CG    1 
ATOM   3387  C  CD1   . LEU A  1 474 ? -36.025 11.831   59.821  1.00 61.99  ? 474 LEU A CD1   1 
ATOM   3388  C  CD2   . LEU A  1 474 ? -38.499 12.120   59.519  1.00 67.60  ? 474 LEU A CD2   1 
ATOM   3389  N  N     . LYS A  1 475 ? -37.603 15.537   63.658  1.00 71.52  ? 475 LYS A N     1 
ATOM   3390  C  CA    . LYS A  1 475 ? -37.530 15.808   65.088  1.00 72.66  ? 475 LYS A CA    1 
ATOM   3391  C  C     . LYS A  1 475 ? -38.751 16.538   65.647  1.00 76.36  ? 475 LYS A C     1 
ATOM   3392  O  O     . LYS A  1 475 ? -39.085 16.352   66.811  1.00 78.04  ? 475 LYS A O     1 
ATOM   3393  C  CB    . LYS A  1 475 ? -36.253 16.570   65.428  1.00 70.81  ? 475 LYS A CB    1 
ATOM   3394  C  CG    . LYS A  1 475 ? -35.015 15.701   65.407  1.00 68.07  ? 475 LYS A CG    1 
ATOM   3395  C  CD    . LYS A  1 475 ? -33.748 16.505   65.627  1.00 66.23  ? 475 LYS A CD    1 
ATOM   3396  C  CE    . LYS A  1 475 ? -32.559 15.698   65.209  1.00 64.38  ? 475 LYS A CE    1 
ATOM   3397  N  NZ    . LYS A  1 475 ? -31.324 16.111   65.935  1.00 65.77  ? 475 LYS A NZ    1 
ATOM   3398  N  N     . SER A  1 476 ? -39.406 17.366   64.835  1.00 78.18  ? 476 SER A N     1 
ATOM   3399  C  CA    . SER A  1 476 ? -40.590 18.096   65.298  1.00 82.25  ? 476 SER A CA    1 
ATOM   3400  C  C     . SER A  1 476 ? -41.854 17.261   65.084  1.00 85.04  ? 476 SER A C     1 
ATOM   3401  O  O     . SER A  1 476 ? -42.750 17.230   65.932  1.00 88.00  ? 476 SER A O     1 
ATOM   3402  C  CB    . SER A  1 476 ? -40.757 19.436   64.569  1.00 83.43  ? 476 SER A CB    1 
ATOM   3403  O  OG    . SER A  1 476 ? -39.738 19.686   63.628  1.00 79.61  ? 476 SER A OG    1 
ATOM   3404  N  N     . ASN A  1 477 ? -41.901 16.583   63.939  1.00 84.27  ? 477 ASN A N     1 
ATOM   3405  C  CA    . ASN A  1 477 ? -43.104 15.924   63.465  1.00 86.98  ? 477 ASN A CA    1 
ATOM   3406  C  C     . ASN A  1 477 ? -43.129 14.420   63.691  1.00 86.32  ? 477 ASN A C     1 
ATOM   3407  O  O     . ASN A  1 477 ? -44.200 13.819   63.701  1.00 89.20  ? 477 ASN A O     1 
ATOM   3408  C  CB    . ASN A  1 477 ? -43.310 16.208   61.972  1.00 87.12  ? 477 ASN A CB    1 
ATOM   3409  C  CG    . ASN A  1 477 ? -43.628 17.670   61.683  1.00 89.40  ? 477 ASN A CG    1 
ATOM   3410  O  OD1   . ASN A  1 477 ? -44.778 18.020   61.384  1.00 93.63  ? 477 ASN A OD1   1 
ATOM   3411  N  ND2   . ASN A  1 477 ? -42.613 18.529   61.763  1.00 86.83  ? 477 ASN A ND2   1 
ATOM   3412  N  N     . HIS A  1 478 ? -41.967 13.805   63.864  1.00 83.19  ? 478 HIS A N     1 
ATOM   3413  C  CA    . HIS A  1 478 ? -41.902 12.348   63.866  1.00 82.76  ? 478 HIS A CA    1 
ATOM   3414  C  C     . HIS A  1 478 ? -40.973 11.748   64.920  1.00 81.19  ? 478 HIS A C     1 
ATOM   3415  O  O     . HIS A  1 478 ? -40.484 10.626   64.753  1.00 79.31  ? 478 HIS A O     1 
ATOM   3416  C  CB    . HIS A  1 478 ? -41.498 11.842   62.475  1.00 81.06  ? 478 HIS A CB    1 
ATOM   3417  C  CG    . HIS A  1 478 ? -42.399 12.306   61.374  1.00 83.23  ? 478 HIS A CG    1 
ATOM   3418  N  ND1   . HIS A  1 478 ? -43.710 11.893   61.261  1.00 86.25  ? 478 HIS A ND1   1 
ATOM   3419  C  CD2   . HIS A  1 478 ? -42.174 13.140   60.330  1.00 82.97  ? 478 HIS A CD2   1 
ATOM   3420  C  CE1   . HIS A  1 478 ? -44.256 12.457   60.197  1.00 88.18  ? 478 HIS A CE1   1 
ATOM   3421  N  NE2   . HIS A  1 478 ? -43.344 13.217   59.615  1.00 86.85  ? 478 HIS A NE2   1 
ATOM   3422  N  N     . ASN A  1 479 ? -40.734 12.498   65.997  1.00 82.25  ? 479 ASN A N     1 
ATOM   3423  C  CA    . ASN A  1 479 ? -39.944 12.031   67.144  1.00 81.57  ? 479 ASN A CA    1 
ATOM   3424  C  C     . ASN A  1 479 ? -40.239 10.579   67.515  1.00 81.84  ? 479 ASN A C     1 
ATOM   3425  O  O     . ASN A  1 479 ? -39.400 9.920    68.124  1.00 80.33  ? 479 ASN A O     1 
ATOM   3426  C  CB    . ASN A  1 479 ? -40.173 12.927   68.366  1.00 84.10  ? 479 ASN A CB    1 
ATOM   3427  C  CG    . ASN A  1 479 ? -41.677 13.095   68.712  1.00 91.27  ? 479 ASN A CG    1 
ATOM   3428  O  OD1   . ASN A  1 479 ? -42.441 13.747   67.973  1.00 94.73  ? 479 ASN A OD1   1 
ATOM   3429  N  ND2   . ASN A  1 479 ? -42.097 12.517   69.848  1.00 95.58  ? 479 ASN A ND2   1 
ATOM   3430  N  N     . GLU A  1 480 ? -41.426 10.091   67.142  1.00 83.96  ? 480 GLU A N     1 
ATOM   3431  C  CA    . GLU A  1 480 ? -41.822 8.705    67.408  1.00 85.05  ? 480 GLU A CA    1 
ATOM   3432  C  C     . GLU A  1 480 ? -41.006 7.721    66.580  1.00 81.76  ? 480 GLU A C     1 
ATOM   3433  O  O     . GLU A  1 480 ? -40.611 6.669    67.085  1.00 81.49  ? 480 GLU A O     1 
ATOM   3434  C  CB    . GLU A  1 480 ? -43.307 8.454    67.127  1.00 88.86  ? 480 GLU A CB    1 
ATOM   3435  C  CG    . GLU A  1 480 ? -44.172 9.696    66.952  1.00 93.39  ? 480 GLU A CG    1 
ATOM   3436  C  CD    . GLU A  1 480 ? -44.281 10.166   65.495  1.00 94.66  ? 480 GLU A CD    1 
ATOM   3437  O  OE1   . GLU A  1 480 ? -44.094 9.348    64.556  1.00 92.83  ? 480 GLU A OE1   1 
ATOM   3438  O  OE2   . GLU A  1 480 ? -44.582 11.366   65.298  1.00 96.95  ? 480 GLU A OE2   1 
ATOM   3439  N  N     . LEU A  1 481 ? -40.769 8.047    65.309  1.00 79.52  ? 481 LEU A N     1 
ATOM   3440  C  CA    . LEU A  1 481 ? -40.010 7.148    64.438  1.00 76.78  ? 481 LEU A CA    1 
ATOM   3441  C  C     . LEU A  1 481 ? -38.579 7.050    64.944  1.00 73.55  ? 481 LEU A C     1 
ATOM   3442  O  O     . LEU A  1 481 ? -38.048 5.955    65.098  1.00 72.81  ? 481 LEU A O     1 
ATOM   3443  C  CB    . LEU A  1 481 ? -40.030 7.597    62.970  1.00 76.13  ? 481 LEU A CB    1 
ATOM   3444  C  CG    . LEU A  1 481 ? -41.293 8.163    62.296  1.00 79.04  ? 481 LEU A CG    1 
ATOM   3445  C  CD1   . LEU A  1 481 ? -41.036 8.315    60.794  1.00 78.58  ? 481 LEU A CD1   1 
ATOM   3446  C  CD2   . LEU A  1 481 ? -42.579 7.351    62.546  1.00 82.03  ? 481 LEU A CD2   1 
ATOM   3447  N  N     . LEU A  1 482 ? -37.981 8.204    65.231  1.00 71.92  ? 482 LEU A N     1 
ATOM   3448  C  CA    . LEU A  1 482 ? -36.620 8.277    65.749  1.00 69.15  ? 482 LEU A CA    1 
ATOM   3449  C  C     . LEU A  1 482 ? -36.494 7.540    67.074  1.00 70.06  ? 482 LEU A C     1 
ATOM   3450  O  O     . LEU A  1 482 ? -35.551 6.781    67.274  1.00 69.08  ? 482 LEU A O     1 
ATOM   3451  C  CB    . LEU A  1 482 ? -36.143 9.734    65.870  1.00 68.00  ? 482 LEU A CB    1 
ATOM   3452  C  CG    . LEU A  1 482 ? -36.163 10.551   64.569  1.00 66.42  ? 482 LEU A CG    1 
ATOM   3453  C  CD1   . LEU A  1 482 ? -35.657 11.962   64.747  1.00 64.98  ? 482 LEU A CD1   1 
ATOM   3454  C  CD2   . LEU A  1 482 ? -35.385 9.855    63.477  1.00 63.76  ? 482 LEU A CD2   1 
ATOM   3455  N  N     . THR A  1 483 ? -37.454 7.722    67.967  1.00 72.64  ? 483 THR A N     1 
ATOM   3456  C  CA    . THR A  1 483 ? -37.369 7.051    69.249  1.00 74.14  ? 483 THR A CA    1 
ATOM   3457  C  C     . THR A  1 483 ? -37.422 5.532    69.100  1.00 74.55  ? 483 THR A C     1 
ATOM   3458  O  O     . THR A  1 483 ? -36.710 4.815    69.801  1.00 74.35  ? 483 THR A O     1 
ATOM   3459  C  CB    . THR A  1 483 ? -38.416 7.591    70.233  1.00 77.53  ? 483 THR A CB    1 
ATOM   3460  O  OG1   . THR A  1 483 ? -37.964 8.865    70.705  1.00 77.50  ? 483 THR A OG1   1 
ATOM   3461  C  CG2   . THR A  1 483 ? -38.613 6.653    71.423  1.00 79.10  ? 483 THR A CG2   1 
ATOM   3462  N  N     . GLU A  1 484 ? -38.234 5.043    68.170  1.00 75.36  ? 484 GLU A N     1 
ATOM   3463  C  CA    . GLU A  1 484 ? -38.307 3.612    67.941  1.00 76.06  ? 484 GLU A CA    1 
ATOM   3464  C  C     . GLU A  1 484 ? -37.003 3.071    67.374  1.00 73.22  ? 484 GLU A C     1 
ATOM   3465  O  O     . GLU A  1 484 ? -36.486 2.062    67.863  1.00 73.65  ? 484 GLU A O     1 
ATOM   3466  C  CB    . GLU A  1 484 ? -39.462 3.251    67.029  1.00 77.88  ? 484 GLU A CB    1 
ATOM   3467  C  CG    . GLU A  1 484 ? -39.765 1.771    67.101  1.00 81.69  ? 484 GLU A CG    1 
ATOM   3468  C  CD    . GLU A  1 484 ? -41.191 1.425    66.721  1.00 87.30  ? 484 GLU A CD    1 
ATOM   3469  O  OE1   . GLU A  1 484 ? -41.803 2.190    65.944  1.00 89.29  ? 484 GLU A OE1   1 
ATOM   3470  O  OE2   . GLU A  1 484 ? -41.693 0.379    67.193  1.00 90.52  ? 484 GLU A OE2   1 
ATOM   3471  N  N     . ILE A  1 485 ? -36.463 3.751    66.361  1.00 70.66  ? 485 ILE A N     1 
ATOM   3472  C  CA    . ILE A  1 485 ? -35.219 3.324    65.735  1.00 67.63  ? 485 ILE A CA    1 
ATOM   3473  C  C     . ILE A  1 485 ? -34.148 3.167    66.793  1.00 66.73  ? 485 ILE A C     1 
ATOM   3474  O  O     . ILE A  1 485 ? -33.503 2.129    66.885  1.00 66.33  ? 485 ILE A O     1 
ATOM   3475  C  CB    . ILE A  1 485 ? -34.756 4.292    64.631  1.00 65.65  ? 485 ILE A CB    1 
ATOM   3476  C  CG1   . ILE A  1 485 ? -35.918 4.577    63.677  1.00 66.51  ? 485 ILE A CG1   1 
ATOM   3477  C  CG2   . ILE A  1 485 ? -33.576 3.692    63.881  1.00 63.55  ? 485 ILE A CG2   1 
ATOM   3478  C  CD1   . ILE A  1 485 ? -35.562 5.318    62.412  1.00 64.40  ? 485 ILE A CD1   1 
ATOM   3479  N  N     . ARG A  1 486 ? -33.998 4.198    67.612  1.00 66.81  ? 486 ARG A N     1 
ATOM   3480  C  CA    . ARG A  1 486 ? -33.021 4.209    68.689  1.00 66.53  ? 486 ARG A CA    1 
ATOM   3481  C  C     . ARG A  1 486 ? -33.286 3.126    69.743  1.00 68.91  ? 486 ARG A C     1 
ATOM   3482  O  O     . ARG A  1 486 ? -32.364 2.442    70.181  1.00 68.48  ? 486 ARG A O     1 
ATOM   3483  C  CB    . ARG A  1 486 ? -32.999 5.590    69.342  1.00 66.47  ? 486 ARG A CB    1 
ATOM   3484  C  CG    . ARG A  1 486 ? -32.119 5.663    70.557  1.00 66.30  ? 486 ARG A CG    1 
ATOM   3485  C  CD    . ARG A  1 486 ? -32.110 7.037    71.147  1.00 66.60  ? 486 ARG A CD    1 
ATOM   3486  N  NE    . ARG A  1 486 ? -33.156 7.193    72.141  1.00 69.70  ? 486 ARG A NE    1 
ATOM   3487  C  CZ    . ARG A  1 486 ? -34.040 8.182    72.148  1.00 71.43  ? 486 ARG A CZ    1 
ATOM   3488  N  NH1   . ARG A  1 486 ? -33.994 9.117    71.202  1.00 69.75  ? 486 ARG A NH1   1 
ATOM   3489  N  NH2   . ARG A  1 486 ? -34.963 8.235    73.110  1.00 73.74  ? 486 ARG A NH2   1 
ATOM   3490  N  N     . GLU A  1 487 ? -34.547 2.976    70.140  1.00 71.68  ? 487 GLU A N     1 
ATOM   3491  C  CA    . GLU A  1 487 ? -34.895 2.141    71.285  1.00 74.59  ? 487 GLU A CA    1 
ATOM   3492  C  C     . GLU A  1 487 ? -35.053 0.676    70.934  1.00 75.38  ? 487 GLU A C     1 
ATOM   3493  O  O     . GLU A  1 487 ? -34.952 -0.180   71.805  1.00 77.11  ? 487 GLU A O     1 
ATOM   3494  C  CB    . GLU A  1 487 ? -36.142 2.681    72.001  1.00 77.53  ? 487 GLU A CB    1 
ATOM   3495  C  CG    . GLU A  1 487 ? -35.821 3.831    72.984  1.00 79.16  ? 487 GLU A CG    1 
ATOM   3496  C  CD    . GLU A  1 487 ? -37.039 4.412    73.724  1.00 83.84  ? 487 GLU A CD    1 
ATOM   3497  O  OE1   . GLU A  1 487 ? -38.203 4.044    73.410  1.00 85.58  ? 487 GLU A OE1   1 
ATOM   3498  O  OE2   . GLU A  1 487 ? -36.818 5.253    74.630  1.00 85.00  ? 487 GLU A OE2   1 
ATOM   3499  N  N     . LYS A  1 488 ? -35.291 0.387    69.660  1.00 74.52  ? 488 LYS A N     1 
ATOM   3500  C  CA    . LYS A  1 488 ? -35.493 -0.995   69.219  1.00 75.65  ? 488 LYS A CA    1 
ATOM   3501  C  C     . LYS A  1 488 ? -34.352 -1.535   68.357  1.00 73.66  ? 488 LYS A C     1 
ATOM   3502  O  O     . LYS A  1 488 ? -34.162 -2.744   68.276  1.00 75.03  ? 488 LYS A O     1 
ATOM   3503  C  CB    . LYS A  1 488 ? -36.840 -1.160   68.514  1.00 77.09  ? 488 LYS A CB    1 
ATOM   3504  C  CG    . LYS A  1 488 ? -38.018 -0.947   69.447  1.00 80.22  ? 488 LYS A CG    1 
ATOM   3505  C  CD    . LYS A  1 488 ? -39.321 -1.419   68.848  1.00 82.24  ? 488 LYS A CD    1 
ATOM   3506  C  CE    . LYS A  1 488 ? -40.434 -1.357   69.881  1.00 85.65  ? 488 LYS A CE    1 
ATOM   3507  N  NZ    . LYS A  1 488 ? -41.638 -2.086   69.402  1.00 88.25  ? 488 LYS A NZ    1 
ATOM   3508  N  N     . GLY A  1 489 ? -33.596 -0.649   67.713  1.00 70.97  ? 489 GLY A N     1 
ATOM   3509  C  CA    . GLY A  1 489 ? -32.469 -1.068   66.894  1.00 69.08  ? 489 GLY A CA    1 
ATOM   3510  C  C     . GLY A  1 489 ? -32.800 -1.764   65.582  1.00 69.44  ? 489 GLY A C     1 
ATOM   3511  O  O     . GLY A  1 489 ? -31.903 -2.005   64.771  1.00 68.51  ? 489 GLY A O     1 
ATOM   3512  N  N     . GLU A  1 490 ? -34.068 -2.110   65.367  1.00 71.22  ? 490 GLU A N     1 
ATOM   3513  C  CA    . GLU A  1 490 ? -34.491 -2.702   64.100  1.00 71.72  ? 490 GLU A CA    1 
ATOM   3514  C  C     . GLU A  1 490 ? -35.610 -1.861   63.509  1.00 72.08  ? 490 GLU A C     1 
ATOM   3515  O  O     . GLU A  1 490 ? -36.200 -1.025   64.194  1.00 72.66  ? 490 GLU A O     1 
ATOM   3516  C  CB    . GLU A  1 490 ? -35.014 -4.140   64.268  1.00 74.47  ? 490 GLU A CB    1 
ATOM   3517  C  CG    . GLU A  1 490 ? -34.338 -5.021   65.312  1.00 76.17  ? 490 GLU A CG    1 
ATOM   3518  C  CD    . GLU A  1 490 ? -35.042 -6.369   65.464  1.00 80.19  ? 490 GLU A CD    1 
ATOM   3519  O  OE1   . GLU A  1 490 ? -36.237 -6.376   65.827  1.00 81.63  ? 490 GLU A OE1   1 
ATOM   3520  O  OE2   . GLU A  1 490 ? -34.400 -7.421   65.225  1.00 81.52  ? 490 GLU A OE2   1 
ATOM   3521  N  N     . LEU A  1 491 ? -35.916 -2.103   62.242  1.00 71.93  ? 491 LEU A N     1 
ATOM   3522  C  CA    . LEU A  1 491 ? -37.051 -1.468   61.615  1.00 72.64  ? 491 LEU A CA    1 
ATOM   3523  C  C     . LEU A  1 491 ? -38.049 -2.529   61.195  1.00 75.33  ? 491 LEU A C     1 
ATOM   3524  O  O     . LEU A  1 491 ? -37.748 -3.408   60.389  1.00 75.59  ? 491 LEU A O     1 
ATOM   3525  C  CB    . LEU A  1 491 ? -36.612 -0.640   60.410  1.00 71.08  ? 491 LEU A CB    1 
ATOM   3526  C  CG    . LEU A  1 491 ? -35.519 0.413    60.600  1.00 68.35  ? 491 LEU A CG    1 
ATOM   3527  C  CD1   . LEU A  1 491 ? -35.351 1.197    59.319  1.00 67.41  ? 491 LEU A CD1   1 
ATOM   3528  C  CD2   . LEU A  1 491 ? -35.839 1.345    61.754  1.00 68.28  ? 491 LEU A CD2   1 
ATOM   3529  N  N     . SER A  1 492 ? -39.238 -2.448   61.770  1.00 77.54  ? 492 SER A N     1 
ATOM   3530  C  CA    . SER A  1 492 ? -40.336 -3.304   61.390  1.00 80.15  ? 492 SER A CA    1 
ATOM   3531  C  C     . SER A  1 492 ? -40.934 -2.726   60.131  1.00 80.63  ? 492 SER A C     1 
ATOM   3532  O  O     . SER A  1 492 ? -40.624 -1.596   59.738  1.00 78.77  ? 492 SER A O     1 
ATOM   3533  C  CB    . SER A  1 492 ? -41.367 -3.329   62.500  1.00 82.81  ? 492 SER A CB    1 
ATOM   3534  O  OG    . SER A  1 492 ? -40.718 -3.531   63.738  1.00 81.67  ? 492 SER A OG    1 
ATOM   3535  N  N     . LYS A  1 493 ? -41.792 -3.508   59.497  1.00 83.19  ? 493 LYS A N     1 
ATOM   3536  C  CA    . LYS A  1 493 ? -42.416 -3.111   58.250  1.00 84.26  ? 493 LYS A CA    1 
ATOM   3537  C  C     . LYS A  1 493 ? -43.328 -1.911   58.494  1.00 84.92  ? 493 LYS A C     1 
ATOM   3538  O  O     . LYS A  1 493 ? -43.593 -1.111   57.591  1.00 84.70  ? 493 LYS A O     1 
ATOM   3539  C  CB    . LYS A  1 493 ? -43.156 -4.314   57.684  1.00 87.84  ? 493 LYS A CB    1 
ATOM   3540  C  CG    . LYS A  1 493 ? -42.305 -5.590   57.819  1.00 88.55  ? 493 LYS A CG    1 
ATOM   3541  C  CD    . LYS A  1 493 ? -42.912 -6.803   57.135  1.00 93.80  ? 493 LYS A CD    1 
ATOM   3542  C  CE    . LYS A  1 493 ? -41.825 -7.841   56.856  1.00 93.39  ? 493 LYS A CE    1 
ATOM   3543  N  NZ    . LYS A  1 493 ? -42.372 -9.030   56.139  1.00 97.27  ? 493 LYS A NZ    1 
ATOM   3544  N  N     . GLU A  1 494 ? -43.771 -1.785   59.743  1.00 85.72  ? 494 GLU A N     1 
ATOM   3545  C  CA    . GLU A  1 494 ? -44.529 -0.632   60.199  1.00 86.60  ? 494 GLU A CA    1 
ATOM   3546  C  C     . GLU A  1 494 ? -43.609 0.585    60.314  1.00 83.24  ? 494 GLU A C     1 
ATOM   3547  O  O     . GLU A  1 494 ? -43.960 1.662    59.848  1.00 83.47  ? 494 GLU A O     1 
ATOM   3548  C  CB    . GLU A  1 494 ? -45.224 -0.924   61.534  1.00 89.12  ? 494 GLU A CB    1 
ATOM   3549  C  CG    . GLU A  1 494 ? -46.351 -1.960   61.464  1.00 93.03  ? 494 GLU A CG    1 
ATOM   3550  C  CD    . GLU A  1 494 ? -45.892 -3.413   61.654  1.00 93.80  ? 494 GLU A CD    1 
ATOM   3551  O  OE1   . GLU A  1 494 ? -44.764 -3.661   62.143  1.00 92.32  ? 494 GLU A OE1   1 
ATOM   3552  O  OE2   . GLU A  1 494 ? -46.678 -4.321   61.319  1.00 96.56  ? 494 GLU A OE2   1 
ATOM   3553  N  N     . LEU A  1 495 ? -42.436 0.411    60.923  1.00 80.29  ? 495 LEU A N     1 
ATOM   3554  C  CA    . LEU A  1 495 ? -41.419 1.470    60.935  1.00 77.21  ? 495 LEU A CA    1 
ATOM   3555  C  C     . LEU A  1 495 ? -41.004 1.883    59.520  1.00 75.54  ? 495 LEU A C     1 
ATOM   3556  O  O     . LEU A  1 495 ? -40.931 3.075    59.221  1.00 74.85  ? 495 LEU A O     1 
ATOM   3557  C  CB    . LEU A  1 495 ? -40.179 1.033    61.713  1.00 75.12  ? 495 LEU A CB    1 
ATOM   3558  C  CG    . LEU A  1 495 ? -40.100 1.372    63.195  1.00 75.75  ? 495 LEU A CG    1 
ATOM   3559  C  CD1   . LEU A  1 495 ? -39.717 0.129    63.994  1.00 76.74  ? 495 LEU A CD1   1 
ATOM   3560  C  CD2   . LEU A  1 495 ? -39.104 2.499    63.398  1.00 73.26  ? 495 LEU A CD2   1 
ATOM   3561  N  N     . LEU A  1 496 ? -40.739 0.895    58.658  1.00 74.91  ? 496 LEU A N     1 
ATOM   3562  C  CA    . LEU A  1 496 ? -40.326 1.154    57.279  1.00 73.22  ? 496 LEU A CA    1 
ATOM   3563  C  C     . LEU A  1 496 ? -41.361 1.971    56.544  1.00 74.94  ? 496 LEU A C     1 
ATOM   3564  O  O     . LEU A  1 496 ? -41.042 2.992    55.937  1.00 73.47  ? 496 LEU A O     1 
ATOM   3565  C  CB    . LEU A  1 496 ? -40.069 -0.148   56.520  1.00 73.77  ? 496 LEU A CB    1 
ATOM   3566  C  CG    . LEU A  1 496 ? -38.758 -0.910   56.718  1.00 71.30  ? 496 LEU A CG    1 
ATOM   3567  C  CD1   . LEU A  1 496 ? -38.665 -2.035   55.703  1.00 71.21  ? 496 LEU A CD1   1 
ATOM   3568  C  CD2   . LEU A  1 496 ? -37.537 0.022    56.620  1.00 68.81  ? 496 LEU A CD2   1 
ATOM   3569  N  N     . ALA A  1 497 ? -42.609 1.508    56.619  1.00 78.29  ? 497 ALA A N     1 
ATOM   3570  C  CA    . ALA A  1 497 ? -43.750 2.180    56.004  1.00 80.60  ? 497 ALA A CA    1 
ATOM   3571  C  C     . ALA A  1 497 ? -43.898 3.600    56.540  1.00 80.17  ? 497 ALA A C     1 
ATOM   3572  O  O     . ALA A  1 497 ? -44.143 4.536    55.774  1.00 80.54  ? 497 ALA A O     1 
ATOM   3573  C  CB    . ALA A  1 497 ? -44.988 1.396    56.250  1.00 84.08  ? 497 ALA A CB    1 
ATOM   3574  N  N     . SER A  1 498 ? -43.733 3.749    57.855  1.00 79.58  ? 498 SER A N     1 
ATOM   3575  C  CA    . SER A  1 498 ? -43.780 5.053    58.510  1.00 79.43  ? 498 SER A CA    1 
ATOM   3576  C  C     . SER A  1 498 ? -42.688 5.947    57.966  1.00 76.70  ? 498 SER A C     1 
ATOM   3577  O  O     . SER A  1 498 ? -42.921 7.112    57.641  1.00 77.35  ? 498 SER A O     1 
ATOM   3578  C  CB    . SER A  1 498 ? -43.638 4.909    60.023  1.00 79.11  ? 498 SER A CB    1 
ATOM   3579  O  OG    . SER A  1 498 ? -44.898 4.685    60.635  1.00 82.12  ? 498 SER A OG    1 
ATOM   3580  N  N     . LEU A  1 499 ? -41.500 5.376    57.839  1.00 74.27  ? 499 LEU A N     1 
ATOM   3581  C  CA    . LEU A  1 499 ? -40.363 6.092    57.307  1.00 71.91  ? 499 LEU A CA    1 
ATOM   3582  C  C     . LEU A  1 499 ? -40.599 6.525    55.866  1.00 72.78  ? 499 LEU A C     1 
ATOM   3583  O  O     . LEU A  1 499 ? -40.281 7.661    55.490  1.00 71.99  ? 499 LEU A O     1 
ATOM   3584  C  CB    . LEU A  1 499 ? -39.112 5.230    57.414  1.00 69.58  ? 499 LEU A CB    1 
ATOM   3585  C  CG    . LEU A  1 499 ? -37.793 5.982    57.263  1.00 67.94  ? 499 LEU A CG    1 
ATOM   3586  C  CD1   . LEU A  1 499 ? -37.759 7.195    58.190  1.00 68.48  ? 499 LEU A CD1   1 
ATOM   3587  C  CD2   . LEU A  1 499 ? -36.627 5.047    57.537  1.00 66.70  ? 499 LEU A CD2   1 
ATOM   3588  N  N     . LYS A  1 500 ? -41.172 5.618    55.073  1.00 74.66  ? 500 LYS A N     1 
ATOM   3589  C  CA    . LYS A  1 500 ? -41.450 5.888    53.666  1.00 76.08  ? 500 LYS A CA    1 
ATOM   3590  C  C     . LYS A  1 500 ? -42.346 7.113    53.547  1.00 78.22  ? 500 LYS A C     1 
ATOM   3591  O  O     . LYS A  1 500 ? -41.989 8.071    52.863  1.00 77.71  ? 500 LYS A O     1 
ATOM   3592  C  CB    . LYS A  1 500 ? -42.079 4.669    52.994  1.00 78.16  ? 500 LYS A CB    1 
ATOM   3593  C  CG    . LYS A  1 500 ? -42.094 4.713    51.477  1.00 79.96  ? 500 LYS A CG    1 
ATOM   3594  C  CD    . LYS A  1 500 ? -42.798 3.479    50.917  1.00 84.26  ? 500 LYS A CD    1 
ATOM   3595  C  CE    . LYS A  1 500 ? -42.715 3.401    49.401  1.00 86.74  ? 500 LYS A CE    1 
ATOM   3596  N  NZ    . LYS A  1 500 ? -43.319 4.596    48.740  1.00 89.46  ? 500 LYS A NZ    1 
ATOM   3597  N  N     . SER A  1 501 ? -43.483 7.083    54.250  1.00 80.77  ? 501 SER A N     1 
ATOM   3598  C  CA    . SER A  1 501 ? -44.440 8.187    54.261  1.00 83.33  ? 501 SER A CA    1 
ATOM   3599  C  C     . SER A  1 501 ? -43.779 9.494    54.675  1.00 81.52  ? 501 SER A C     1 
ATOM   3600  O  O     . SER A  1 501 ? -43.761 10.455   53.904  1.00 82.03  ? 501 SER A O     1 
ATOM   3601  C  CB    . SER A  1 501 ? -45.618 7.865    55.185  1.00 86.27  ? 501 SER A CB    1 
ATOM   3602  O  OG    . SER A  1 501 ? -46.232 9.043    55.694  1.00 88.04  ? 501 SER A OG    1 
ATOM   3603  N  N     . ALA A  1 502 ? -43.215 9.519    55.877  1.00 79.48  ? 502 ALA A N     1 
ATOM   3604  C  CA    . ALA A  1 502 ? -42.610 10.734   56.390  1.00 78.54  ? 502 ALA A CA    1 
ATOM   3605  C  C     . ALA A  1 502 ? -41.563 11.329   55.435  1.00 77.19  ? 502 ALA A C     1 
ATOM   3606  O  O     . ALA A  1 502 ? -41.427 12.553   55.365  1.00 77.77  ? 502 ALA A O     1 
ATOM   3607  C  CB    . ALA A  1 502 ? -42.033 10.501   57.767  1.00 76.48  ? 502 ALA A CB    1 
ATOM   3608  N  N     . THR A  1 503 ? -40.845 10.478   54.693  1.00 76.03  ? 503 THR A N     1 
ATOM   3609  C  CA    . THR A  1 503 ? -39.858 10.953   53.714  1.00 75.03  ? 503 THR A CA    1 
ATOM   3610  C  C     . THR A  1 503 ? -40.517 11.708   52.553  1.00 77.99  ? 503 THR A C     1 
ATOM   3611  O  O     . THR A  1 503 ? -40.294 12.909   52.386  1.00 78.28  ? 503 THR A O     1 
ATOM   3612  C  CB    . THR A  1 503 ? -38.977 9.811    53.146  1.00 73.39  ? 503 THR A CB    1 
ATOM   3613  O  OG1   . THR A  1 503 ? -38.440 9.028    54.216  1.00 71.90  ? 503 THR A OG1   1 
ATOM   3614  C  CG2   . THR A  1 503 ? -37.832 10.380   52.328  1.00 71.04  ? 503 THR A CG2   1 
ATOM   3615  N  N     . GLU A  1 504 ? -41.320 10.990   51.764  1.00 80.60  ? 504 GLU A N     1 
ATOM   3616  C  CA    . GLU A  1 504 ? -42.044 11.553   50.610  1.00 84.00  ? 504 GLU A CA    1 
ATOM   3617  C  C     . GLU A  1 504 ? -42.737 12.831   51.022  1.00 86.09  ? 504 GLU A C     1 
ATOM   3618  O  O     . GLU A  1 504 ? -42.644 13.849   50.327  1.00 87.51  ? 504 GLU A O     1 
ATOM   3619  C  CB    . GLU A  1 504 ? -43.085 10.563   50.065  1.00 86.44  ? 504 GLU A CB    1 
ATOM   3620  C  CG    . GLU A  1 504 ? -42.710 9.116    50.288  1.00 85.13  ? 504 GLU A CG    1 
ATOM   3621  C  CD    . GLU A  1 504 ? -43.343 8.166    49.312  1.00 88.41  ? 504 GLU A CD    1 
ATOM   3622  O  OE1   . GLU A  1 504 ? -44.562 8.297    49.044  1.00 93.71  ? 504 GLU A OE1   1 
ATOM   3623  O  OE2   . GLU A  1 504 ? -42.622 7.264    48.824  1.00 86.49  ? 504 GLU A OE2   1 
ATOM   3624  N  N     . SER A  1 505 ? -43.418 12.760   52.166  1.00 86.81  ? 505 SER A N     1 
ATOM   3625  C  CA    . SER A  1 505 ? -44.046 13.911   52.802  1.00 88.73  ? 505 SER A CA    1 
ATOM   3626  C  C     . SER A  1 505 ? -43.123 15.119   52.749  1.00 87.10  ? 505 SER A C     1 
ATOM   3627  O  O     . SER A  1 505 ? -43.510 16.183   52.259  1.00 89.29  ? 505 SER A O     1 
ATOM   3628  C  CB    . SER A  1 505 ? -44.368 13.584   54.259  1.00 88.51  ? 505 SER A CB    1 
ATOM   3629  O  OG    . SER A  1 505 ? -45.489 14.318   54.706  1.00 92.45  ? 505 SER A OG    1 
ATOM   3630  N  N     . PHE A  1 506 ? -41.896 14.932   53.235  1.00 83.39  ? 506 PHE A N     1 
ATOM   3631  C  CA    . PHE A  1 506 ? -40.907 16.000   53.270  1.00 81.73  ? 506 PHE A CA    1 
ATOM   3632  C  C     . PHE A  1 506 ? -40.366 16.355   51.881  1.00 82.24  ? 506 PHE A C     1 
ATOM   3633  O  O     . PHE A  1 506 ? -40.252 17.541   51.546  1.00 83.31  ? 506 PHE A O     1 
ATOM   3634  C  CB    . PHE A  1 506 ? -39.776 15.661   54.240  1.00 77.88  ? 506 PHE A CB    1 
ATOM   3635  C  CG    . PHE A  1 506 ? -38.753 16.755   54.387  1.00 76.05  ? 506 PHE A CG    1 
ATOM   3636  C  CD1   . PHE A  1 506 ? -39.006 17.860   55.190  1.00 76.36  ? 506 PHE A CD1   1 
ATOM   3637  C  CD2   . PHE A  1 506 ? -37.524 16.678   53.723  1.00 73.54  ? 506 PHE A CD2   1 
ATOM   3638  C  CE1   . PHE A  1 506 ? -38.048 18.878   55.328  1.00 75.52  ? 506 PHE A CE1   1 
ATOM   3639  C  CE2   . PHE A  1 506 ? -36.565 17.689   53.852  1.00 71.70  ? 506 PHE A CE2   1 
ATOM   3640  C  CZ    . PHE A  1 506 ? -36.825 18.789   54.649  1.00 72.51  ? 506 PHE A CZ    1 
ATOM   3641  N  N     . VAL A  1 507 ? -40.053 15.341   51.073  1.00 81.80  ? 507 VAL A N     1 
ATOM   3642  C  CA    . VAL A  1 507 ? -39.481 15.581   49.744  1.00 82.61  ? 507 VAL A CA    1 
ATOM   3643  C  C     . VAL A  1 507 ? -40.419 16.414   48.880  1.00 86.69  ? 507 VAL A C     1 
ATOM   3644  O  O     . VAL A  1 507 ? -39.981 17.367   48.239  1.00 87.58  ? 507 VAL A O     1 
ATOM   3645  C  CB    . VAL A  1 507 ? -39.052 14.278   49.020  1.00 81.85  ? 507 VAL A CB    1 
ATOM   3646  C  CG1   . VAL A  1 507 ? -38.699 14.556   47.546  1.00 83.36  ? 507 VAL A CG1   1 
ATOM   3647  C  CG2   . VAL A  1 507 ? -37.863 13.630   49.738  1.00 77.91  ? 507 VAL A CG2   1 
ATOM   3648  N  N     . ALA A  1 508 ? -41.701 16.053   48.880  1.00 89.78  ? 508 ALA A N     1 
ATOM   3649  C  CA    . ALA A  1 508 ? -42.741 16.860   48.245  1.00 94.47  ? 508 ALA A CA    1 
ATOM   3650  C  C     . ALA A  1 508 ? -42.707 18.298   48.780  1.00 95.64  ? 508 ALA A C     1 
ATOM   3651  O  O     . ALA A  1 508 ? -42.616 19.262   48.008  1.00 97.61  ? 508 ALA A O     1 
ATOM   3652  C  CB    . ALA A  1 508 ? -44.120 16.231   48.469  1.00 97.02  ? 508 ALA A CB    1 
ATOM   3653  N  N     . THR A  1 509 ? -42.767 18.425   50.106  1.00 94.87  ? 509 THR A N     1 
ATOM   3654  C  CA    . THR A  1 509 ? -42.687 19.716   50.784  1.00 95.73  ? 509 THR A CA    1 
ATOM   3655  C  C     . THR A  1 509 ? -41.274 20.285   50.664  1.00 93.29  ? 509 THR A C     1 
ATOM   3656  O  O     . THR A  1 509 ? -41.101 21.489   50.501  1.00 95.06  ? 509 THR A O     1 
ATOM   3657  C  CB    . THR A  1 509 ? -43.086 19.590   52.278  1.00 95.25  ? 509 THR A CB    1 
ATOM   3658  O  OG1   . THR A  1 509 ? -43.931 20.683   52.640  1.00 98.62  ? 509 THR A OG1   1 
ATOM   3659  C  CG2   . THR A  1 509 ? -41.854 19.548   53.211  1.00 91.18  ? 509 THR A CG2   1 
ATOM   3660  N  N     . ALA B  1 25  ? 45.183  -37.642  70.173  1.00 89.47  ? 25  ALA B N     1 
ATOM   3661  C  CA    . ALA B  1 25  ? 44.516  -37.160  68.928  1.00 84.66  ? 25  ALA B CA    1 
ATOM   3662  C  C     . ALA B  1 25  ? 45.474  -36.383  68.016  1.00 83.16  ? 25  ALA B C     1 
ATOM   3663  O  O     . ALA B  1 25  ? 45.810  -35.226  68.300  1.00 83.08  ? 25  ALA B O     1 
ATOM   3664  C  CB    . ALA B  1 25  ? 43.282  -36.310  69.270  1.00 82.18  ? 25  ALA B CB    1 
ATOM   3665  N  N     . ASN B  1 26  ? 45.930  -37.043  66.943  1.00 82.44  ? 26  ASN B N     1 
ATOM   3666  C  CA    . ASN B  1 26  ? 46.619  -36.389  65.821  1.00 80.21  ? 26  ASN B CA    1 
ATOM   3667  C  C     . ASN B  1 26  ? 45.798  -35.178  65.361  1.00 75.85  ? 26  ASN B C     1 
ATOM   3668  O  O     . ASN B  1 26  ? 44.639  -35.335  64.961  1.00 73.36  ? 26  ASN B O     1 
ATOM   3669  C  CB    . ASN B  1 26  ? 46.783  -37.380  64.651  1.00 79.85  ? 26  ASN B CB    1 
ATOM   3670  C  CG    . ASN B  1 26  ? 48.166  -38.064  64.624  1.00 85.38  ? 26  ASN B CG    1 
ATOM   3671  O  OD1   . ASN B  1 26  ? 49.103  -37.564  63.988  1.00 87.03  ? 26  ASN B OD1   1 
ATOM   3672  N  ND2   . ASN B  1 26  ? 48.286  -39.222  65.291  1.00 89.64  ? 26  ASN B ND2   1 
ATOM   3673  N  N     . LEU B  1 27  ? 46.365  -33.973  65.458  1.00 74.79  ? 27  LEU B N     1 
ATOM   3674  C  CA    . LEU B  1 27  ? 45.684  -32.787  64.924  1.00 70.46  ? 27  LEU B CA    1 
ATOM   3675  C  C     . LEU B  1 27  ? 46.064  -32.595  63.459  1.00 68.06  ? 27  LEU B C     1 
ATOM   3676  O  O     . LEU B  1 27  ? 45.612  -31.662  62.799  1.00 65.84  ? 27  LEU B O     1 
ATOM   3677  C  CB    . LEU B  1 27  ? 45.972  -31.531  65.756  1.00 71.32  ? 27  LEU B CB    1 
ATOM   3678  C  CG    . LEU B  1 27  ? 45.239  -31.421  67.100  1.00 72.39  ? 27  LEU B CG    1 
ATOM   3679  C  CD1   . LEU B  1 27  ? 45.968  -30.478  68.066  1.00 74.92  ? 27  LEU B CD1   1 
ATOM   3680  C  CD2   . LEU B  1 27  ? 43.787  -31.012  66.939  1.00 68.21  ? 27  LEU B CD2   1 
ATOM   3681  N  N     . ASN B  1 28  ? 46.884  -33.499  62.944  1.00 68.81  ? 28  ASN B N     1 
ATOM   3682  C  CA    . ASN B  1 28  ? 47.218  -33.478  61.535  1.00 66.84  ? 28  ASN B CA    1 
ATOM   3683  C  C     . ASN B  1 28  ? 46.142  -34.149  60.673  1.00 64.38  ? 28  ASN B C     1 
ATOM   3684  O  O     . ASN B  1 28  ? 45.742  -33.619  59.628  1.00 62.07  ? 28  ASN B O     1 
ATOM   3685  C  CB    . ASN B  1 28  ? 48.599  -34.089  61.331  1.00 69.54  ? 28  ASN B CB    1 
ATOM   3686  C  CG    . ASN B  1 28  ? 49.688  -33.263  61.996  1.00 71.88  ? 28  ASN B CG    1 
ATOM   3687  O  OD1   . ASN B  1 28  ? 49.851  -32.085  61.692  1.00 71.11  ? 28  ASN B OD1   1 
ATOM   3688  N  ND2   . ASN B  1 28  ? 50.420  -33.870  62.924  1.00 75.52  ? 28  ASN B ND2   1 
ATOM   3689  N  N     . GLU B  1 29  ? 45.654  -35.298  61.134  1.00 64.85  ? 29  GLU B N     1 
ATOM   3690  C  CA    . GLU B  1 29  ? 44.704  -36.100  60.369  1.00 62.91  ? 29  GLU B CA    1 
ATOM   3691  C  C     . GLU B  1 29  ? 43.266  -35.927  60.836  1.00 61.09  ? 29  GLU B C     1 
ATOM   3692  O  O     . GLU B  1 29  ? 42.333  -36.499  60.262  1.00 60.00  ? 29  GLU B O     1 
ATOM   3693  C  CB    . GLU B  1 29  ? 45.094  -37.574  60.471  1.00 65.31  ? 29  GLU B CB    1 
ATOM   3694  C  CG    . GLU B  1 29  ? 46.414  -37.901  59.814  1.00 66.93  ? 29  GLU B CG    1 
ATOM   3695  C  CD    . GLU B  1 29  ? 46.431  -37.546  58.341  1.00 65.60  ? 29  GLU B CD    1 
ATOM   3696  O  OE1   . GLU B  1 29  ? 45.433  -37.838  57.631  1.00 64.74  ? 29  GLU B OE1   1 
ATOM   3697  O  OE2   . GLU B  1 29  ? 47.448  -36.972  57.898  1.00 66.40  ? 29  GLU B OE2   1 
ATOM   3698  N  N     . THR B  1 30  ? 43.098  -35.107  61.866  1.00 60.93  ? 30  THR B N     1 
ATOM   3699  C  CA    . THR B  1 30  ? 41.930  -35.150  62.729  1.00 60.19  ? 30  THR B CA    1 
ATOM   3700  C  C     . THR B  1 30  ? 41.604  -33.738  63.179  1.00 58.56  ? 30  THR B C     1 
ATOM   3701  O  O     . THR B  1 30  ? 42.456  -32.867  63.163  1.00 59.29  ? 30  THR B O     1 
ATOM   3702  C  CB    . THR B  1 30  ? 42.259  -36.049  63.929  1.00 63.37  ? 30  THR B CB    1 
ATOM   3703  O  OG1   . THR B  1 30  ? 41.929  -37.401  63.608  1.00 64.44  ? 30  THR B OG1   1 
ATOM   3704  C  CG2   . THR B  1 30  ? 41.524  -35.623  65.197  1.00 65.09  ? 30  THR B CG2   1 
ATOM   3705  N  N     . GLY B  1 31  ? 40.374  -33.487  63.567  1.00 56.93  ? 31  GLY B N     1 
ATOM   3706  C  CA    . GLY B  1 31  ? 40.039  -32.142  63.978  1.00 55.88  ? 31  GLY B CA    1 
ATOM   3707  C  C     . GLY B  1 31  ? 39.061  -32.144  65.117  1.00 56.27  ? 31  GLY B C     1 
ATOM   3708  O  O     . GLY B  1 31  ? 38.444  -33.161  65.391  1.00 57.19  ? 31  GLY B O     1 
ATOM   3709  N  N     . ARG B  1 32  ? 38.935  -31.005  65.786  1.00 56.03  ? 32  ARG B N     1 
ATOM   3710  C  CA    . ARG B  1 32  ? 37.902  -30.808  66.788  1.00 56.21  ? 32  ARG B CA    1 
ATOM   3711  C  C     . ARG B  1 32  ? 37.013  -29.627  66.407  1.00 53.53  ? 32  ARG B C     1 
ATOM   3712  O  O     . ARG B  1 32  ? 37.501  -28.567  66.027  1.00 52.65  ? 32  ARG B O     1 
ATOM   3713  C  CB    . ARG B  1 32  ? 38.532  -30.595  68.154  1.00 59.38  ? 32  ARG B CB    1 
ATOM   3714  C  CG    . ARG B  1 32  ? 38.900  -31.867  68.878  1.00 63.41  ? 32  ARG B CG    1 
ATOM   3715  C  CD    . ARG B  1 32  ? 38.031  -32.051  70.116  1.00 68.30  ? 32  ARG B CD    1 
ATOM   3716  N  NE    . ARG B  1 32  ? 38.461  -33.180  70.945  1.00 73.64  ? 32  ARG B NE    1 
ATOM   3717  C  CZ    . ARG B  1 32  ? 37.978  -34.419  70.855  1.00 75.09  ? 32  ARG B CZ    1 
ATOM   3718  N  NH1   . ARG B  1 32  ? 37.037  -34.713  69.965  1.00 72.80  ? 32  ARG B NH1   1 
ATOM   3719  N  NH2   . ARG B  1 32  ? 38.435  -35.371  71.660  1.00 78.68  ? 32  ARG B NH2   1 
ATOM   3720  N  N     . VAL B  1 33  ? 35.704  -29.822  66.507  1.00 52.34  ? 33  VAL B N     1 
ATOM   3721  C  CA    . VAL B  1 33  ? 34.743  -28.776  66.168  1.00 50.34  ? 33  VAL B CA    1 
ATOM   3722  C  C     . VAL B  1 33  ? 34.726  -27.627  67.184  1.00 51.12  ? 33  VAL B C     1 
ATOM   3723  O  O     . VAL B  1 33  ? 34.581  -27.834  68.392  1.00 52.34  ? 33  VAL B O     1 
ATOM   3724  C  CB    . VAL B  1 33  ? 33.321  -29.340  65.973  1.00 49.79  ? 33  VAL B CB    1 
ATOM   3725  C  CG1   . VAL B  1 33  ? 32.390  -28.261  65.448  1.00 48.34  ? 33  VAL B CG1   1 
ATOM   3726  C  CG2   . VAL B  1 33  ? 33.338  -30.523  65.003  1.00 49.04  ? 33  VAL B CG2   1 
ATOM   3727  N  N     . LEU B  1 34  ? 34.893  -26.415  66.660  1.00 50.06  ? 34  LEU B N     1 
ATOM   3728  C  CA    . LEU B  1 34  ? 34.898  -25.215  67.459  1.00 50.94  ? 34  LEU B CA    1 
ATOM   3729  C  C     . LEU B  1 34  ? 33.508  -24.635  67.576  1.00 51.03  ? 34  LEU B C     1 
ATOM   3730  O  O     . LEU B  1 34  ? 33.144  -24.083  68.615  1.00 53.14  ? 34  LEU B O     1 
ATOM   3731  C  CB    . LEU B  1 34  ? 35.828  -24.186  66.850  1.00 50.15  ? 34  LEU B CB    1 
ATOM   3732  C  CG    . LEU B  1 34  ? 37.315  -24.499  66.985  1.00 51.03  ? 34  LEU B CG    1 
ATOM   3733  C  CD1   . LEU B  1 34  ? 38.128  -23.457  66.245  1.00 50.41  ? 34  LEU B CD1   1 
ATOM   3734  C  CD2   . LEU B  1 34  ? 37.754  -24.581  68.445  1.00 52.45  ? 34  LEU B CD2   1 
ATOM   3735  N  N     . ALA B  1 35  ? 32.723  -24.790  66.516  1.00 49.59  ? 35  ALA B N     1 
ATOM   3736  C  CA    . ALA B  1 35  ? 31.447  -24.100  66.375  1.00 49.32  ? 35  ALA B CA    1 
ATOM   3737  C  C     . ALA B  1 35  ? 30.720  -24.597  65.128  1.00 48.04  ? 35  ALA B C     1 
ATOM   3738  O  O     . ALA B  1 35  ? 31.348  -25.015  64.161  1.00 47.07  ? 35  ALA B O     1 
ATOM   3739  C  CB    . ALA B  1 35  ? 31.683  -22.613  66.283  1.00 49.25  ? 35  ALA B CB    1 
ATOM   3740  N  N     . VAL B  1 36  ? 29.396  -24.577  65.162  1.00 48.65  ? 36  VAL B N     1 
ATOM   3741  C  CA    . VAL B  1 36  ? 28.618  -24.908  63.977  1.00 48.38  ? 36  VAL B CA    1 
ATOM   3742  C  C     . VAL B  1 36  ? 27.327  -24.112  63.944  1.00 49.03  ? 36  VAL B C     1 
ATOM   3743  O  O     . VAL B  1 36  ? 26.625  -23.997  64.948  1.00 50.41  ? 36  VAL B O     1 
ATOM   3744  C  CB    . VAL B  1 36  ? 28.314  -26.421  63.860  1.00 48.68  ? 36  VAL B CB    1 
ATOM   3745  C  CG1   . VAL B  1 36  ? 27.917  -27.019  65.213  1.00 50.46  ? 36  VAL B CG1   1 
ATOM   3746  C  CG2   . VAL B  1 36  ? 27.222  -26.685  62.804  1.00 48.46  ? 36  VAL B CG2   1 
ATOM   3747  N  N     . GLY B  1 37  ? 27.032  -23.563  62.772  1.00 48.57  ? 37  GLY B N     1 
ATOM   3748  C  CA    . GLY B  1 37  ? 25.843  -22.765  62.550  1.00 48.99  ? 37  GLY B CA    1 
ATOM   3749  C  C     . GLY B  1 37  ? 25.838  -22.366  61.099  1.00 48.68  ? 37  GLY B C     1 
ATOM   3750  O  O     . GLY B  1 37  ? 26.883  -22.337  60.470  1.00 48.04  ? 37  GLY B O     1 
ATOM   3751  N  N     . ASP B  1 38  ? 24.658  -22.070  60.563  1.00 49.76  ? 38  ASP B N     1 
ATOM   3752  C  CA    . ASP B  1 38  ? 24.518  -21.593  59.182  1.00 50.08  ? 38  ASP B CA    1 
ATOM   3753  C  C     . ASP B  1 38  ? 25.140  -22.522  58.110  1.00 49.32  ? 38  ASP B C     1 
ATOM   3754  O  O     . ASP B  1 38  ? 25.584  -22.046  57.063  1.00 50.26  ? 38  ASP B O     1 
ATOM   3755  C  CB    . ASP B  1 38  ? 25.055  -20.160  59.070  1.00 50.51  ? 38  ASP B CB    1 
ATOM   3756  C  CG    . ASP B  1 38  ? 24.278  -19.164  59.947  1.00 52.57  ? 38  ASP B CG    1 
ATOM   3757  O  OD1   . ASP B  1 38  ? 23.324  -19.582  60.647  1.00 53.49  ? 38  ASP B OD1   1 
ATOM   3758  O  OD2   . ASP B  1 38  ? 24.611  -17.951  59.933  1.00 53.11  ? 38  ASP B OD2   1 
ATOM   3759  N  N     . GLY B  1 39  ? 25.180  -23.831  58.372  1.00 48.00  ? 39  GLY B N     1 
ATOM   3760  C  CA    . GLY B  1 39  ? 25.662  -24.794  57.393  1.00 47.23  ? 39  GLY B CA    1 
ATOM   3761  C  C     . GLY B  1 39  ? 27.168  -24.917  57.332  1.00 46.71  ? 39  GLY B C     1 
ATOM   3762  O  O     . GLY B  1 39  ? 27.696  -25.716  56.557  1.00 46.51  ? 39  GLY B O     1 
ATOM   3763  N  N     . ILE B  1 40  ? 27.853  -24.117  58.151  1.00 46.48  ? 40  ILE B N     1 
ATOM   3764  C  CA    . ILE B  1 40  ? 29.300  -24.162  58.302  1.00 45.83  ? 40  ILE B CA    1 
ATOM   3765  C  C     . ILE B  1 40  ? 29.678  -24.741  59.650  1.00 45.71  ? 40  ILE B C     1 
ATOM   3766  O  O     . ILE B  1 40  ? 29.053  -24.430  60.663  1.00 46.71  ? 40  ILE B O     1 
ATOM   3767  C  CB    . ILE B  1 40  ? 29.903  -22.747  58.222  1.00 46.54  ? 40  ILE B CB    1 
ATOM   3768  C  CG1   . ILE B  1 40  ? 29.444  -22.057  56.940  1.00 48.46  ? 40  ILE B CG1   1 
ATOM   3769  C  CG2   . ILE B  1 40  ? 31.441  -22.786  58.277  1.00 45.14  ? 40  ILE B CG2   1 
ATOM   3770  C  CD1   . ILE B  1 40  ? 29.697  -22.898  55.699  1.00 50.55  ? 40  ILE B CD1   1 
ATOM   3771  N  N     . ALA B  1 41  ? 30.704  -25.583  59.670  1.00 45.40  ? 41  ALA B N     1 
ATOM   3772  C  CA    . ALA B  1 41  ? 31.354  -25.955  60.923  1.00 45.61  ? 41  ALA B CA    1 
ATOM   3773  C  C     . ALA B  1 41  ? 32.720  -25.309  60.940  1.00 45.79  ? 41  ALA B C     1 
ATOM   3774  O  O     . ALA B  1 41  ? 33.439  -25.363  59.943  1.00 46.48  ? 41  ALA B O     1 
ATOM   3775  C  CB    . ALA B  1 41  ? 31.471  -27.448  61.032  1.00 45.46  ? 41  ALA B CB    1 
ATOM   3776  N  N     . ARG B  1 42  ? 33.085  -24.669  62.040  1.00 46.53  ? 42  ARG B N     1 
ATOM   3777  C  CA    . ARG B  1 42  ? 34.481  -24.228  62.202  1.00 47.19  ? 42  ARG B CA    1 
ATOM   3778  C  C     . ARG B  1 42  ? 35.281  -25.268  62.960  1.00 47.51  ? 42  ARG B C     1 
ATOM   3779  O  O     . ARG B  1 42  ? 34.888  -25.700  64.045  1.00 48.52  ? 42  ARG B O     1 
ATOM   3780  C  CB    . ARG B  1 42  ? 34.567  -22.858  62.868  1.00 48.39  ? 42  ARG B CB    1 
ATOM   3781  C  CG    . ARG B  1 42  ? 34.350  -21.702  61.879  1.00 48.84  ? 42  ARG B CG    1 
ATOM   3782  C  CD    . ARG B  1 42  ? 34.211  -20.372  62.554  1.00 49.50  ? 42  ARG B CD    1 
ATOM   3783  N  NE    . ARG B  1 42  ? 34.733  -20.388  63.916  1.00 50.87  ? 42  ARG B NE    1 
ATOM   3784  C  CZ    . ARG B  1 42  ? 34.021  -20.028  64.970  1.00 51.66  ? 42  ARG B CZ    1 
ATOM   3785  N  NH1   . ARG B  1 42  ? 32.777  -19.612  64.810  1.00 53.36  ? 42  ARG B NH1   1 
ATOM   3786  N  NH2   . ARG B  1 42  ? 34.549  -20.065  66.173  1.00 53.77  ? 42  ARG B NH2   1 
ATOM   3787  N  N     . VAL B  1 43  ? 36.386  -25.695  62.370  1.00 47.09  ? 43  VAL B N     1 
ATOM   3788  C  CA    . VAL B  1 43  ? 37.129  -26.830  62.907  1.00 47.94  ? 43  VAL B CA    1 
ATOM   3789  C  C     . VAL B  1 43  ? 38.585  -26.501  63.172  1.00 48.96  ? 43  VAL B C     1 
ATOM   3790  O  O     . VAL B  1 43  ? 39.233  -25.849  62.371  1.00 48.84  ? 43  VAL B O     1 
ATOM   3791  C  CB    . VAL B  1 43  ? 37.006  -28.069  61.986  1.00 47.33  ? 43  VAL B CB    1 
ATOM   3792  C  CG1   . VAL B  1 43  ? 37.993  -29.170  62.389  1.00 48.17  ? 43  VAL B CG1   1 
ATOM   3793  C  CG2   . VAL B  1 43  ? 35.571  -28.589  62.014  1.00 46.82  ? 43  VAL B CG2   1 
ATOM   3794  N  N     . PHE B  1 44  ? 39.070  -26.968  64.314  1.00 50.68  ? 44  PHE B N     1 
ATOM   3795  C  CA    . PHE B  1 44  ? 40.447  -26.780  64.755  1.00 52.93  ? 44  PHE B CA    1 
ATOM   3796  C  C     . PHE B  1 44  ? 41.285  -28.030  64.448  1.00 53.45  ? 44  PHE B C     1 
ATOM   3797  O  O     . PHE B  1 44  ? 40.833  -29.147  64.665  1.00 53.46  ? 44  PHE B O     1 
ATOM   3798  C  CB    . PHE B  1 44  ? 40.464  -26.461  66.265  1.00 55.11  ? 44  PHE B CB    1 
ATOM   3799  C  CG    . PHE B  1 44  ? 41.844  -26.311  66.854  1.00 57.90  ? 44  PHE B CG    1 
ATOM   3800  C  CD1   . PHE B  1 44  ? 42.593  -25.151  66.639  1.00 58.48  ? 44  PHE B CD1   1 
ATOM   3801  C  CD2   . PHE B  1 44  ? 42.391  -27.326  67.652  1.00 60.56  ? 44  PHE B CD2   1 
ATOM   3802  C  CE1   . PHE B  1 44  ? 43.877  -25.012  67.200  1.00 60.91  ? 44  PHE B CE1   1 
ATOM   3803  C  CE2   . PHE B  1 44  ? 43.675  -27.193  68.217  1.00 61.93  ? 44  PHE B CE2   1 
ATOM   3804  C  CZ    . PHE B  1 44  ? 44.413  -26.037  67.990  1.00 61.83  ? 44  PHE B CZ    1 
ATOM   3805  N  N     . GLY B  1 45  ? 42.500  -27.834  63.950  1.00 54.07  ? 45  GLY B N     1 
ATOM   3806  C  CA    . GLY B  1 45  ? 43.350  -28.957  63.578  1.00 55.35  ? 45  GLY B CA    1 
ATOM   3807  C  C     . GLY B  1 45  ? 43.233  -29.282  62.106  1.00 53.89  ? 45  GLY B C     1 
ATOM   3808  O  O     . GLY B  1 45  ? 43.179  -28.375  61.272  1.00 52.65  ? 45  GLY B O     1 
ATOM   3809  N  N     . LEU B  1 46  ? 43.172  -30.572  61.789  1.00 54.30  ? 46  LEU B N     1 
ATOM   3810  C  CA    . LEU B  1 46  ? 43.237  -31.039  60.413  1.00 53.91  ? 46  LEU B CA    1 
ATOM   3811  C  C     . LEU B  1 46  ? 44.334  -30.276  59.666  1.00 55.02  ? 46  LEU B C     1 
ATOM   3812  O  O     . LEU B  1 46  ? 44.061  -29.603  58.663  1.00 54.43  ? 46  LEU B O     1 
ATOM   3813  C  CB    . LEU B  1 46  ? 41.899  -30.839  59.694  1.00 51.90  ? 46  LEU B CB    1 
ATOM   3814  C  CG    . LEU B  1 46  ? 40.549  -31.309  60.245  1.00 50.93  ? 46  LEU B CG    1 
ATOM   3815  C  CD1   . LEU B  1 46  ? 39.431  -30.721  59.386  1.00 46.61  ? 46  LEU B CD1   1 
ATOM   3816  C  CD2   . LEU B  1 46  ? 40.485  -32.826  60.261  1.00 51.06  ? 46  LEU B CD2   1 
ATOM   3817  N  N     . ASN B  1 47  ? 45.569  -30.372  60.157  1.00 57.20  ? 47  ASN B N     1 
ATOM   3818  C  CA    . ASN B  1 47  ? 46.649  -29.560  59.636  1.00 57.93  ? 47  ASN B CA    1 
ATOM   3819  C  C     . ASN B  1 47  ? 47.140  -30.035  58.293  1.00 58.28  ? 47  ASN B C     1 
ATOM   3820  O  O     . ASN B  1 47  ? 47.764  -29.286  57.558  1.00 59.15  ? 47  ASN B O     1 
ATOM   3821  C  CB    . ASN B  1 47  ? 47.802  -29.535  60.620  1.00 60.60  ? 47  ASN B CB    1 
ATOM   3822  C  CG    . ASN B  1 47  ? 47.433  -28.880  61.922  1.00 61.01  ? 47  ASN B CG    1 
ATOM   3823  O  OD1   . ASN B  1 47  ? 46.803  -27.820  61.955  1.00 57.72  ? 47  ASN B OD1   1 
ATOM   3824  N  ND2   . ASN B  1 47  ? 47.840  -29.506  63.017  1.00 64.27  ? 47  ASN B ND2   1 
ATOM   3825  N  N     . ASN B  1 48  ? 46.875  -31.290  57.970  1.00 58.41  ? 48  ASN B N     1 
ATOM   3826  C  CA    . ASN B  1 48  ? 47.376  -31.848  56.731  1.00 58.75  ? 48  ASN B CA    1 
ATOM   3827  C  C     . ASN B  1 48  ? 46.323  -31.796  55.648  1.00 57.01  ? 48  ASN B C     1 
ATOM   3828  O  O     . ASN B  1 48  ? 46.603  -32.135  54.497  1.00 57.87  ? 48  ASN B O     1 
ATOM   3829  C  CB    . ASN B  1 48  ? 47.833  -33.284  56.939  1.00 60.56  ? 48  ASN B CB    1 
ATOM   3830  C  CG    . ASN B  1 48  ? 49.286  -33.383  57.325  1.00 62.87  ? 48  ASN B CG    1 
ATOM   3831  O  OD1   . ASN B  1 48  ? 49.962  -32.379  57.528  1.00 63.54  ? 48  ASN B OD1   1 
ATOM   3832  N  ND2   . ASN B  1 48  ? 49.783  -34.607  57.413  1.00 65.01  ? 48  ASN B ND2   1 
ATOM   3833  N  N     . ILE B  1 49  ? 45.115  -31.362  56.017  1.00 54.79  ? 49  ILE B N     1 
ATOM   3834  C  CA    . ILE B  1 49  ? 44.013  -31.282  55.076  1.00 52.47  ? 49  ILE B CA    1 
ATOM   3835  C  C     . ILE B  1 49  ? 44.358  -30.440  53.865  1.00 52.67  ? 49  ILE B C     1 
ATOM   3836  O  O     . ILE B  1 49  ? 45.123  -29.475  53.949  1.00 53.62  ? 49  ILE B O     1 
ATOM   3837  C  CB    . ILE B  1 49  ? 42.699  -30.750  55.730  1.00 50.89  ? 49  ILE B CB    1 
ATOM   3838  C  CG1   . ILE B  1 49  ? 41.479  -31.333  54.991  1.00 49.43  ? 49  ILE B CG1   1 
ATOM   3839  C  CG2   . ILE B  1 49  ? 42.673  -29.221  55.790  1.00 48.73  ? 49  ILE B CG2   1 
ATOM   3840  C  CD1   . ILE B  1 49  ? 40.158  -31.161  55.699  1.00 46.08  ? 49  ILE B CD1   1 
ATOM   3841  N  N     . GLN B  1 50  ? 43.777  -30.847  52.746  1.00 52.33  ? 50  GLN B N     1 
ATOM   3842  C  CA    . GLN B  1 50  ? 43.778  -30.112  51.501  1.00 52.33  ? 50  GLN B CA    1 
ATOM   3843  C  C     . GLN B  1 50  ? 42.544  -29.232  51.422  1.00 50.96  ? 50  GLN B C     1 
ATOM   3844  O  O     . GLN B  1 50  ? 41.495  -29.550  51.991  1.00 49.35  ? 50  GLN B O     1 
ATOM   3845  C  CB    . GLN B  1 50  ? 43.728  -31.101  50.339  1.00 53.13  ? 50  GLN B CB    1 
ATOM   3846  C  CG    . GLN B  1 50  ? 44.922  -32.032  50.272  1.00 55.29  ? 50  GLN B CG    1 
ATOM   3847  C  CD    . GLN B  1 50  ? 44.726  -33.163  49.292  1.00 55.21  ? 50  GLN B CD    1 
ATOM   3848  O  OE1   . GLN B  1 50  ? 43.995  -34.115  49.561  1.00 55.83  ? 50  GLN B OE1   1 
ATOM   3849  N  NE2   . GLN B  1 50  ? 45.380  -33.069  48.154  1.00 55.41  ? 50  GLN B NE2   1 
ATOM   3850  N  N     . ALA B  1 51  ? 42.679  -28.129  50.690  1.00 51.60  ? 51  ALA B N     1 
ATOM   3851  C  CA    . ALA B  1 51  ? 41.548  -27.309  50.291  1.00 50.67  ? 51  ALA B CA    1 
ATOM   3852  C  C     . ALA B  1 51  ? 40.602  -28.162  49.427  1.00 50.48  ? 51  ALA B C     1 
ATOM   3853  O  O     . ALA B  1 51  ? 41.059  -28.884  48.537  1.00 51.28  ? 51  ALA B O     1 
ATOM   3854  C  CB    . ALA B  1 51  ? 42.039  -26.092  49.536  1.00 51.85  ? 51  ALA B CB    1 
ATOM   3855  N  N     . GLU B  1 52  ? 39.298  -28.078  49.725  1.00 49.32  ? 52  GLU B N     1 
ATOM   3856  C  CA    . GLU B  1 52  ? 38.228  -28.892  49.108  1.00 49.13  ? 52  GLU B CA    1 
ATOM   3857  C  C     . GLU B  1 52  ? 38.323  -30.408  49.344  1.00 48.82  ? 52  GLU B C     1 
ATOM   3858  O  O     . GLU B  1 52  ? 37.828  -31.201  48.547  1.00 49.56  ? 52  GLU B O     1 
ATOM   3859  C  CB    . GLU B  1 52  ? 38.091  -28.575  47.618  1.00 51.00  ? 52  GLU B CB    1 
ATOM   3860  C  CG    . GLU B  1 52  ? 37.693  -27.152  47.349  1.00 52.31  ? 52  GLU B CG    1 
ATOM   3861  C  CD    . GLU B  1 52  ? 38.091  -26.676  45.969  1.00 56.15  ? 52  GLU B CD    1 
ATOM   3862  O  OE1   . GLU B  1 52  ? 37.548  -27.208  44.961  1.00 58.05  ? 52  GLU B OE1   1 
ATOM   3863  O  OE2   . GLU B  1 52  ? 38.937  -25.745  45.905  1.00 57.57  ? 52  GLU B OE2   1 
ATOM   3864  N  N     . GLU B  1 53  ? 38.952  -30.814  50.437  1.00 48.09  ? 53  GLU B N     1 
ATOM   3865  C  CA    . GLU B  1 53  ? 38.936  -32.216  50.810  1.00 48.37  ? 53  GLU B CA    1 
ATOM   3866  C  C     . GLU B  1 53  ? 37.635  -32.533  51.528  1.00 47.80  ? 53  GLU B C     1 
ATOM   3867  O  O     . GLU B  1 53  ? 37.089  -31.712  52.275  1.00 46.72  ? 53  GLU B O     1 
ATOM   3868  C  CB    . GLU B  1 53  ? 40.113  -32.552  51.712  1.00 48.83  ? 53  GLU B CB    1 
ATOM   3869  C  CG    . GLU B  1 53  ? 40.218  -34.017  52.111  1.00 49.46  ? 53  GLU B CG    1 
ATOM   3870  C  CD    . GLU B  1 53  ? 41.536  -34.331  52.798  1.00 53.04  ? 53  GLU B CD    1 
ATOM   3871  O  OE1   . GLU B  1 53  ? 42.614  -33.880  52.314  1.00 54.99  ? 53  GLU B OE1   1 
ATOM   3872  O  OE2   . GLU B  1 53  ? 41.499  -35.043  53.823  1.00 54.39  ? 53  GLU B OE2   1 
ATOM   3873  N  N     . LEU B  1 54  ? 37.136  -33.732  51.294  1.00 48.52  ? 54  LEU B N     1 
ATOM   3874  C  CA    . LEU B  1 54  ? 35.927  -34.158  51.935  1.00 48.32  ? 54  LEU B CA    1 
ATOM   3875  C  C     . LEU B  1 54  ? 36.299  -34.595  53.344  1.00 48.23  ? 54  LEU B C     1 
ATOM   3876  O  O     . LEU B  1 54  ? 37.362  -35.178  53.541  1.00 49.25  ? 54  LEU B O     1 
ATOM   3877  C  CB    . LEU B  1 54  ? 35.302  -35.295  51.132  1.00 49.56  ? 54  LEU B CB    1 
ATOM   3878  C  CG    . LEU B  1 54  ? 33.809  -35.535  51.349  1.00 50.20  ? 54  LEU B CG    1 
ATOM   3879  C  CD1   . LEU B  1 54  ? 32.974  -34.660  50.418  1.00 49.91  ? 54  LEU B CD1   1 
ATOM   3880  C  CD2   . LEU B  1 54  ? 33.472  -37.017  51.162  1.00 52.38  ? 54  LEU B CD2   1 
ATOM   3881  N  N     . VAL B  1 55  ? 35.462  -34.280  54.329  1.00 47.42  ? 55  VAL B N     1 
ATOM   3882  C  CA    . VAL B  1 55  ? 35.716  -34.763  55.684  1.00 47.86  ? 55  VAL B CA    1 
ATOM   3883  C  C     . VAL B  1 55  ? 34.549  -35.535  56.256  1.00 48.50  ? 55  VAL B C     1 
ATOM   3884  O  O     . VAL B  1 55  ? 33.438  -35.489  55.734  1.00 48.18  ? 55  VAL B O     1 
ATOM   3885  C  CB    . VAL B  1 55  ? 36.139  -33.647  56.667  1.00 47.26  ? 55  VAL B CB    1 
ATOM   3886  C  CG1   . VAL B  1 55  ? 37.256  -32.831  56.070  1.00 47.87  ? 55  VAL B CG1   1 
ATOM   3887  C  CG2   . VAL B  1 55  ? 34.971  -32.760  57.047  1.00 46.05  ? 55  VAL B CG2   1 
ATOM   3888  N  N     . GLU B  1 56  ? 34.816  -36.258  57.335  1.00 49.81  ? 56  GLU B N     1 
ATOM   3889  C  CA    . GLU B  1 56  ? 33.771  -36.997  58.013  1.00 50.73  ? 56  GLU B CA    1 
ATOM   3890  C  C     . GLU B  1 56  ? 33.652  -36.610  59.463  1.00 50.48  ? 56  GLU B C     1 
ATOM   3891  O  O     . GLU B  1 56  ? 34.651  -36.594  60.174  1.00 51.58  ? 56  GLU B O     1 
ATOM   3892  C  CB    . GLU B  1 56  ? 34.041  -38.485  57.934  1.00 52.80  ? 56  GLU B CB    1 
ATOM   3893  C  CG    . GLU B  1 56  ? 32.897  -39.286  58.497  1.00 56.03  ? 56  GLU B CG    1 
ATOM   3894  C  CD    . GLU B  1 56  ? 32.767  -40.641  57.856  1.00 61.64  ? 56  GLU B CD    1 
ATOM   3895  O  OE1   . GLU B  1 56  ? 33.687  -41.057  57.105  1.00 63.80  ? 56  GLU B OE1   1 
ATOM   3896  O  OE2   . GLU B  1 56  ? 31.735  -41.299  58.110  1.00 65.27  ? 56  GLU B OE2   1 
ATOM   3897  N  N     . PHE B  1 57  ? 32.419  -36.333  59.888  1.00 49.61  ? 57  PHE B N     1 
ATOM   3898  C  CA    . PHE B  1 57  ? 32.091  -36.003  61.272  1.00 49.62  ? 57  PHE B CA    1 
ATOM   3899  C  C     . PHE B  1 57  ? 31.649  -37.270  62.011  1.00 51.62  ? 57  PHE B C     1 
ATOM   3900  O  O     . PHE B  1 57  ? 31.348  -38.275  61.381  1.00 51.89  ? 57  PHE B O     1 
ATOM   3901  C  CB    . PHE B  1 57  ? 31.000  -34.914  61.296  1.00 48.28  ? 57  PHE B CB    1 
ATOM   3902  C  CG    . PHE B  1 57  ? 31.448  -33.596  60.717  1.00 46.41  ? 57  PHE B CG    1 
ATOM   3903  C  CD1   . PHE B  1 57  ? 32.019  -32.621  61.534  1.00 45.78  ? 57  PHE B CD1   1 
ATOM   3904  C  CD2   . PHE B  1 57  ? 31.337  -33.338  59.351  1.00 44.50  ? 57  PHE B CD2   1 
ATOM   3905  C  CE1   . PHE B  1 57  ? 32.459  -31.410  61.004  1.00 43.99  ? 57  PHE B CE1   1 
ATOM   3906  C  CE2   . PHE B  1 57  ? 31.772  -32.128  58.814  1.00 42.61  ? 57  PHE B CE2   1 
ATOM   3907  C  CZ    . PHE B  1 57  ? 32.336  -31.162  59.642  1.00 42.62  ? 57  PHE B CZ    1 
ATOM   3908  N  N     . SER B  1 58  ? 31.613  -37.223  63.341  1.00 53.33  ? 58  SER B N     1 
ATOM   3909  C  CA    . SER B  1 58  ? 31.176  -38.368  64.155  1.00 56.27  ? 58  SER B CA    1 
ATOM   3910  C  C     . SER B  1 58  ? 29.885  -39.021  63.685  1.00 56.58  ? 58  SER B C     1 
ATOM   3911  O  O     . SER B  1 58  ? 29.773  -40.246  63.669  1.00 58.94  ? 58  SER B O     1 
ATOM   3912  C  CB    . SER B  1 58  ? 30.957  -37.945  65.601  1.00 57.88  ? 58  SER B CB    1 
ATOM   3913  O  OG    . SER B  1 58  ? 32.154  -37.475  66.169  1.00 60.27  ? 58  SER B OG    1 
ATOM   3914  N  N     . SER B  1 59  ? 28.895  -38.211  63.337  1.00 54.86  ? 59  SER B N     1 
ATOM   3915  C  CA    . SER B  1 59  ? 27.581  -38.736  63.040  1.00 55.49  ? 59  SER B CA    1 
ATOM   3916  C  C     . SER B  1 59  ? 27.554  -39.438  61.693  1.00 55.36  ? 59  SER B C     1 
ATOM   3917  O  O     . SER B  1 59  ? 26.569  -40.096  61.352  1.00 56.88  ? 59  SER B O     1 
ATOM   3918  C  CB    . SER B  1 59  ? 26.566  -37.614  63.055  1.00 54.30  ? 59  SER B CB    1 
ATOM   3919  O  OG    . SER B  1 59  ? 27.030  -36.554  62.251  1.00 52.99  ? 59  SER B OG    1 
ATOM   3920  N  N     . GLY B  1 60  ? 28.635  -39.302  60.932  1.00 53.95  ? 60  GLY B N     1 
ATOM   3921  C  CA    . GLY B  1 60  ? 28.742  -39.947  59.635  1.00 53.53  ? 60  GLY B CA    1 
ATOM   3922  C  C     . GLY B  1 60  ? 28.443  -38.983  58.514  1.00 51.66  ? 60  GLY B C     1 
ATOM   3923  O  O     . GLY B  1 60  ? 28.593  -39.335  57.342  1.00 51.66  ? 60  GLY B O     1 
ATOM   3924  N  N     . VAL B  1 61  ? 28.028  -37.769  58.888  1.00 50.33  ? 61  VAL B N     1 
ATOM   3925  C  CA    . VAL B  1 61  ? 27.760  -36.682  57.946  1.00 49.29  ? 61  VAL B CA    1 
ATOM   3926  C  C     . VAL B  1 61  ? 29.066  -36.179  57.333  1.00 48.25  ? 61  VAL B C     1 
ATOM   3927  O  O     . VAL B  1 61  ? 30.098  -36.132  57.990  1.00 48.05  ? 61  VAL B O     1 
ATOM   3928  C  CB    . VAL B  1 61  ? 26.985  -35.514  58.623  1.00 48.88  ? 61  VAL B CB    1 
ATOM   3929  C  CG1   . VAL B  1 61  ? 27.896  -34.699  59.541  1.00 48.54  ? 61  VAL B CG1   1 
ATOM   3930  C  CG2   . VAL B  1 61  ? 26.319  -34.615  57.589  1.00 48.04  ? 61  VAL B CG2   1 
ATOM   3931  N  N     . LYS B  1 62  ? 29.013  -35.821  56.061  1.00 47.99  ? 62  LYS B N     1 
ATOM   3932  C  CA    . LYS B  1 62  ? 30.209  -35.423  55.352  1.00 47.31  ? 62  LYS B CA    1 
ATOM   3933  C  C     . LYS B  1 62  ? 30.285  -33.919  55.135  1.00 45.79  ? 62  LYS B C     1 
ATOM   3934  O  O     . LYS B  1 62  ? 29.300  -33.213  55.265  1.00 45.55  ? 62  LYS B O     1 
ATOM   3935  C  CB    . LYS B  1 62  ? 30.335  -36.227  54.061  1.00 48.40  ? 62  LYS B CB    1 
ATOM   3936  C  CG    . LYS B  1 62  ? 31.052  -37.492  54.346  1.00 51.11  ? 62  LYS B CG    1 
ATOM   3937  C  CD    . LYS B  1 62  ? 30.907  -38.564  53.325  1.00 55.81  ? 62  LYS B CD    1 
ATOM   3938  C  CE    . LYS B  1 62  ? 31.634  -39.825  53.839  1.00 59.05  ? 62  LYS B CE    1 
ATOM   3939  N  NZ    . LYS B  1 62  ? 30.824  -40.534  54.906  1.00 60.51  ? 62  LYS B NZ    1 
ATOM   3940  N  N     . GLY B  1 63  ? 31.473  -33.429  54.843  1.00 45.37  ? 63  GLY B N     1 
ATOM   3941  C  CA    . GLY B  1 63  ? 31.678  -32.003  54.707  1.00 45.05  ? 63  GLY B CA    1 
ATOM   3942  C  C     . GLY B  1 63  ? 32.747  -31.737  53.681  1.00 45.60  ? 63  GLY B C     1 
ATOM   3943  O  O     . GLY B  1 63  ? 33.359  -32.682  53.181  1.00 46.31  ? 63  GLY B O     1 
ATOM   3944  N  N     . MET B  1 64  ? 32.960  -30.462  53.360  1.00 45.37  ? 64  MET B N     1 
ATOM   3945  C  CA    . MET B  1 64  ? 33.993  -30.079  52.416  1.00 46.03  ? 64  MET B CA    1 
ATOM   3946  C  C     . MET B  1 64  ? 34.803  -28.949  52.978  1.00 45.36  ? 64  MET B C     1 
ATOM   3947  O  O     . MET B  1 64  ? 34.274  -27.904  53.289  1.00 45.03  ? 64  MET B O     1 
ATOM   3948  C  CB    . MET B  1 64  ? 33.405  -29.645  51.079  1.00 47.32  ? 64  MET B CB    1 
ATOM   3949  C  CG    . MET B  1 64  ? 34.483  -29.248  50.090  1.00 50.23  ? 64  MET B CG    1 
ATOM   3950  S  SD    . MET B  1 64  ? 33.926  -28.415  48.596  1.00 56.44  ? 64  MET B SD    1 
ATOM   3951  C  CE    . MET B  1 64  ? 34.054  -26.715  49.122  1.00 57.52  ? 64  MET B CE    1 
ATOM   3952  N  N     . ALA B  1 65  ? 36.102  -29.171  53.095  1.00 45.73  ? 65  ALA B N     1 
ATOM   3953  C  CA    . ALA B  1 65  ? 37.018  -28.153  53.557  1.00 45.63  ? 65  ALA B CA    1 
ATOM   3954  C  C     . ALA B  1 65  ? 37.015  -27.001  52.569  1.00 46.70  ? 65  ALA B C     1 
ATOM   3955  O  O     . ALA B  1 65  ? 37.611  -27.096  51.490  1.00 47.93  ? 65  ALA B O     1 
ATOM   3956  C  CB    . ALA B  1 65  ? 38.390  -28.731  53.685  1.00 45.87  ? 65  ALA B CB    1 
ATOM   3957  N  N     . LEU B  1 66  ? 36.352  -25.909  52.932  1.00 46.66  ? 66  LEU B N     1 
ATOM   3958  C  CA    . LEU B  1 66  ? 36.214  -24.795  52.005  1.00 47.86  ? 66  LEU B CA    1 
ATOM   3959  C  C     . LEU B  1 66  ? 37.274  -23.730  52.213  1.00 48.88  ? 66  LEU B C     1 
ATOM   3960  O  O     . LEU B  1 66  ? 37.938  -23.301  51.271  1.00 50.52  ? 66  LEU B O     1 
ATOM   3961  C  CB    . LEU B  1 66  ? 34.814  -24.198  52.054  1.00 47.61  ? 66  LEU B CB    1 
ATOM   3962  C  CG    . LEU B  1 66  ? 34.684  -22.996  51.136  1.00 49.97  ? 66  LEU B CG    1 
ATOM   3963  C  CD1   . LEU B  1 66  ? 34.669  -23.442  49.682  1.00 51.72  ? 66  LEU B CD1   1 
ATOM   3964  C  CD2   . LEU B  1 66  ? 33.468  -22.105  51.483  1.00 50.92  ? 66  LEU B CD2   1 
ATOM   3965  N  N     . ASN B  1 67  ? 37.442  -23.284  53.440  1.00 48.98  ? 67  ASN B N     1 
ATOM   3966  C  CA    . ASN B  1 67  ? 38.449  -22.272  53.688  1.00 50.35  ? 67  ASN B CA    1 
ATOM   3967  C  C     . ASN B  1 67  ? 39.421  -22.663  54.800  1.00 49.75  ? 67  ASN B C     1 
ATOM   3968  O  O     . ASN B  1 67  ? 39.024  -22.852  55.956  1.00 49.02  ? 67  ASN B O     1 
ATOM   3969  C  CB    . ASN B  1 67  ? 37.790  -20.898  53.886  1.00 51.69  ? 67  ASN B CB    1 
ATOM   3970  C  CG    . ASN B  1 67  ? 37.360  -20.637  55.318  1.00 53.83  ? 67  ASN B CG    1 
ATOM   3971  O  OD1   . ASN B  1 67  ? 38.190  -20.653  56.240  1.00 55.52  ? 67  ASN B OD1   1 
ATOM   3972  N  ND2   . ASN B  1 67  ? 36.059  -20.350  55.512  1.00 56.07  ? 67  ASN B ND2   1 
ATOM   3973  N  N     . LEU B  1 68  ? 40.684  -22.843  54.419  1.00 50.38  ? 68  LEU B N     1 
ATOM   3974  C  CA    . LEU B  1 68  ? 41.742  -23.189  55.359  1.00 50.43  ? 68  LEU B CA    1 
ATOM   3975  C  C     . LEU B  1 68  ? 42.325  -21.902  55.846  1.00 51.08  ? 68  LEU B C     1 
ATOM   3976  O  O     . LEU B  1 68  ? 42.770  -21.108  55.039  1.00 52.18  ? 68  LEU B O     1 
ATOM   3977  C  CB    . LEU B  1 68  ? 42.857  -23.986  54.686  1.00 51.33  ? 68  LEU B CB    1 
ATOM   3978  C  CG    . LEU B  1 68  ? 42.639  -25.029  53.601  1.00 50.78  ? 68  LEU B CG    1 
ATOM   3979  C  CD1   . LEU B  1 68  ? 44.004  -25.535  53.159  1.00 52.62  ? 68  LEU B CD1   1 
ATOM   3980  C  CD2   . LEU B  1 68  ? 41.813  -26.158  54.097  1.00 49.63  ? 68  LEU B CD2   1 
ATOM   3981  N  N     . GLU B  1 69  ? 42.324  -21.702  57.155  1.00 51.11  ? 69  GLU B N     1 
ATOM   3982  C  CA    . GLU B  1 69  ? 42.832  -20.463  57.761  1.00 53.16  ? 69  GLU B CA    1 
ATOM   3983  C  C     . GLU B  1 69  ? 43.879  -20.776  58.818  1.00 53.85  ? 69  GLU B C     1 
ATOM   3984  O  O     . GLU B  1 69  ? 43.925  -21.904  59.316  1.00 53.57  ? 69  GLU B O     1 
ATOM   3985  C  CB    . GLU B  1 69  ? 41.704  -19.706  58.443  1.00 53.05  ? 69  GLU B CB    1 
ATOM   3986  C  CG    . GLU B  1 69  ? 40.668  -19.098  57.530  1.00 55.19  ? 69  GLU B CG    1 
ATOM   3987  C  CD    . GLU B  1 69  ? 39.450  -18.595  58.318  1.00 59.08  ? 69  GLU B CD    1 
ATOM   3988  O  OE1   . GLU B  1 69  ? 39.634  -18.084  59.452  1.00 59.65  ? 69  GLU B OE1   1 
ATOM   3989  O  OE2   . GLU B  1 69  ? 38.305  -18.703  57.803  1.00 60.68  ? 69  GLU B OE2   1 
ATOM   3990  N  N     . PRO B  1 70  ? 44.721  -19.789  59.180  1.00 55.39  ? 70  PRO B N     1 
ATOM   3991  C  CA    . PRO B  1 70  ? 45.560  -20.068  60.339  1.00 56.97  ? 70  PRO B CA    1 
ATOM   3992  C  C     . PRO B  1 70  ? 44.689  -20.481  61.524  1.00 56.62  ? 70  PRO B C     1 
ATOM   3993  O  O     . PRO B  1 70  ? 43.727  -19.785  61.869  1.00 56.46  ? 70  PRO B O     1 
ATOM   3994  C  CB    . PRO B  1 70  ? 46.260  -18.735  60.609  1.00 58.64  ? 70  PRO B CB    1 
ATOM   3995  C  CG    . PRO B  1 70  ? 45.689  -17.767  59.649  1.00 58.06  ? 70  PRO B CG    1 
ATOM   3996  C  CD    . PRO B  1 70  ? 45.082  -18.516  58.543  1.00 56.41  ? 70  PRO B CD    1 
ATOM   3997  N  N     . GLY B  1 71  ? 44.980  -21.644  62.087  1.00 57.08  ? 71  GLY B N     1 
ATOM   3998  C  CA    . GLY B  1 71  ? 44.312  -22.102  63.295  1.00 57.96  ? 71  GLY B CA    1 
ATOM   3999  C  C     . GLY B  1 71  ? 42.896  -22.652  63.206  1.00 56.31  ? 71  GLY B C     1 
ATOM   4000  O  O     . GLY B  1 71  ? 42.332  -23.047  64.229  1.00 56.80  ? 71  GLY B O     1 
ATOM   4001  N  N     . GLN B  1 72  ? 42.304  -22.670  62.013  1.00 54.79  ? 72  GLN B N     1 
ATOM   4002  C  CA    . GLN B  1 72  ? 41.042  -23.385  61.819  1.00 53.49  ? 72  GLN B CA    1 
ATOM   4003  C  C     . GLN B  1 72  ? 40.693  -23.655  60.352  1.00 52.07  ? 72  GLN B C     1 
ATOM   4004  O  O     . GLN B  1 72  ? 41.252  -23.025  59.447  1.00 52.67  ? 72  GLN B O     1 
ATOM   4005  C  CB    . GLN B  1 72  ? 39.893  -22.655  62.511  1.00 53.36  ? 72  GLN B CB    1 
ATOM   4006  C  CG    . GLN B  1 72  ? 39.647  -21.247  61.985  1.00 55.24  ? 72  GLN B CG    1 
ATOM   4007  C  CD    . GLN B  1 72  ? 38.395  -20.625  62.556  1.00 55.76  ? 72  GLN B CD    1 
ATOM   4008  O  OE1   . GLN B  1 72  ? 37.928  -21.011  63.621  1.00 58.23  ? 72  GLN B OE1   1 
ATOM   4009  N  NE2   . GLN B  1 72  ? 37.846  -19.658  61.849  1.00 55.83  ? 72  GLN B NE2   1 
ATOM   4010  N  N     . VAL B  1 73  ? 39.774  -24.596  60.125  1.00 50.59  ? 73  VAL B N     1 
ATOM   4011  C  CA    . VAL B  1 73  ? 39.245  -24.850  58.785  1.00 49.44  ? 73  VAL B CA    1 
ATOM   4012  C  C     . VAL B  1 73  ? 37.755  -24.622  58.816  1.00 48.64  ? 73  VAL B C     1 
ATOM   4013  O  O     . VAL B  1 73  ? 37.107  -24.983  59.786  1.00 48.95  ? 73  VAL B O     1 
ATOM   4014  C  CB    . VAL B  1 73  ? 39.481  -26.313  58.330  1.00 49.31  ? 73  VAL B CB    1 
ATOM   4015  C  CG1   . VAL B  1 73  ? 39.057  -26.510  56.882  1.00 47.21  ? 73  VAL B CG1   1 
ATOM   4016  C  CG2   . VAL B  1 73  ? 40.927  -26.716  58.525  1.00 50.13  ? 73  VAL B CG2   1 
ATOM   4017  N  N     . GLY B  1 74  ? 37.209  -24.017  57.763  1.00 48.62  ? 74  GLY B N     1 
ATOM   4018  C  CA    . GLY B  1 74  ? 35.758  -23.844  57.627  1.00 47.71  ? 74  GLY B CA    1 
ATOM   4019  C  C     . GLY B  1 74  ? 35.215  -24.926  56.716  1.00 47.61  ? 74  GLY B C     1 
ATOM   4020  O  O     . GLY B  1 74  ? 35.618  -25.045  55.540  1.00 47.75  ? 74  GLY B O     1 
ATOM   4021  N  N     . ILE B  1 75  ? 34.317  -25.742  57.265  1.00 47.06  ? 75  ILE B N     1 
ATOM   4022  C  CA    . ILE B  1 75  ? 33.768  -26.872  56.529  1.00 46.46  ? 75  ILE B CA    1 
ATOM   4023  C  C     . ILE B  1 75  ? 32.290  -26.671  56.237  1.00 46.38  ? 75  ILE B C     1 
ATOM   4024  O  O     . ILE B  1 75  ? 31.496  -26.469  57.151  1.00 46.46  ? 75  ILE B O     1 
ATOM   4025  C  CB    . ILE B  1 75  ? 34.020  -28.181  57.284  1.00 46.41  ? 75  ILE B CB    1 
ATOM   4026  C  CG1   . ILE B  1 75  ? 35.522  -28.470  57.277  1.00 47.97  ? 75  ILE B CG1   1 
ATOM   4027  C  CG2   . ILE B  1 75  ? 33.284  -29.352  56.628  1.00 45.96  ? 75  ILE B CG2   1 
ATOM   4028  C  CD1   . ILE B  1 75  ? 36.036  -29.088  58.524  1.00 49.88  ? 75  ILE B CD1   1 
ATOM   4029  N  N     . VAL B  1 76  ? 31.948  -26.708  54.950  1.00 46.52  ? 76  VAL B N     1 
ATOM   4030  C  CA    . VAL B  1 76  ? 30.562  -26.709  54.477  1.00 46.72  ? 76  VAL B CA    1 
ATOM   4031  C  C     . VAL B  1 76  ? 29.953  -28.115  54.642  1.00 46.64  ? 76  VAL B C     1 
ATOM   4032  O  O     . VAL B  1 76  ? 30.536  -29.102  54.176  1.00 47.32  ? 76  VAL B O     1 
ATOM   4033  C  CB    . VAL B  1 76  ? 30.508  -26.316  52.985  1.00 47.46  ? 76  VAL B CB    1 
ATOM   4034  C  CG1   . VAL B  1 76  ? 29.104  -26.293  52.523  1.00 48.90  ? 76  VAL B CG1   1 
ATOM   4035  C  CG2   . VAL B  1 76  ? 31.129  -24.952  52.751  1.00 47.73  ? 76  VAL B CG2   1 
ATOM   4036  N  N     . LEU B  1 77  ? 28.790  -28.217  55.282  1.00 46.38  ? 77  LEU B N     1 
ATOM   4037  C  CA    . LEU B  1 77  ? 28.181  -29.524  55.577  1.00 46.30  ? 77  LEU B CA    1 
ATOM   4038  C  C     . LEU B  1 77  ? 27.308  -30.070  54.462  1.00 47.08  ? 77  LEU B C     1 
ATOM   4039  O  O     . LEU B  1 77  ? 26.619  -29.310  53.810  1.00 48.07  ? 77  LEU B O     1 
ATOM   4040  C  CB    . LEU B  1 77  ? 27.334  -29.427  56.840  1.00 46.18  ? 77  LEU B CB    1 
ATOM   4041  C  CG    . LEU B  1 77  ? 28.030  -28.873  58.082  1.00 46.29  ? 77  LEU B CG    1 
ATOM   4042  C  CD1   . LEU B  1 77  ? 27.102  -28.945  59.273  1.00 46.79  ? 77  LEU B CD1   1 
ATOM   4043  C  CD2   . LEU B  1 77  ? 29.341  -29.590  58.379  1.00 45.43  ? 77  LEU B CD2   1 
ATOM   4044  N  N     . PHE B  1 78  ? 27.307  -31.385  54.264  1.00 47.27  ? 78  PHE B N     1 
ATOM   4045  C  CA    . PHE B  1 78  ? 26.352  -32.000  53.342  1.00 48.57  ? 78  PHE B CA    1 
ATOM   4046  C  C     . PHE B  1 78  ? 25.143  -32.623  54.069  1.00 49.14  ? 78  PHE B C     1 
ATOM   4047  O  O     . PHE B  1 78  ? 24.628  -33.680  53.690  1.00 50.31  ? 78  PHE B O     1 
ATOM   4048  C  CB    . PHE B  1 78  ? 27.033  -33.005  52.411  1.00 49.40  ? 78  PHE B CB    1 
ATOM   4049  C  CG    . PHE B  1 78  ? 28.099  -32.402  51.539  1.00 49.88  ? 78  PHE B CG    1 
ATOM   4050  C  CD1   . PHE B  1 78  ? 27.763  -31.594  50.462  1.00 51.56  ? 78  PHE B CD1   1 
ATOM   4051  C  CD2   . PHE B  1 78  ? 29.444  -32.652  51.789  1.00 48.27  ? 78  PHE B CD2   1 
ATOM   4052  C  CE1   . PHE B  1 78  ? 28.766  -31.037  49.650  1.00 52.50  ? 78  PHE B CE1   1 
ATOM   4053  C  CE2   . PHE B  1 78  ? 30.440  -32.096  50.989  1.00 48.67  ? 78  PHE B CE2   1 
ATOM   4054  C  CZ    . PHE B  1 78  ? 30.108  -31.292  49.921  1.00 49.57  ? 78  PHE B CZ    1 
ATOM   4055  N  N     . GLY B  1 79  ? 24.689  -31.947  55.111  1.00 48.26  ? 79  GLY B N     1 
ATOM   4056  C  CA    . GLY B  1 79  ? 23.470  -32.325  55.772  1.00 49.05  ? 79  GLY B CA    1 
ATOM   4057  C  C     . GLY B  1 79  ? 23.048  -31.244  56.732  1.00 48.73  ? 79  GLY B C     1 
ATOM   4058  O  O     . GLY B  1 79  ? 23.621  -30.156  56.740  1.00 48.33  ? 79  GLY B O     1 
ATOM   4059  N  N     . SER B  1 80  ? 22.040  -31.559  57.538  1.00 49.46  ? 80  SER B N     1 
ATOM   4060  C  CA    . SER B  1 80  ? 21.515  -30.689  58.562  1.00 49.70  ? 80  SER B CA    1 
ATOM   4061  C  C     . SER B  1 80  ? 22.599  -30.325  59.573  1.00 48.90  ? 80  SER B C     1 
ATOM   4062  O  O     . SER B  1 80  ? 23.539  -31.089  59.781  1.00 48.77  ? 80  SER B O     1 
ATOM   4063  C  CB    . SER B  1 80  ? 20.371  -31.410  59.257  1.00 51.22  ? 80  SER B CB    1 
ATOM   4064  O  OG    . SER B  1 80  ? 19.783  -30.614  60.273  1.00 53.13  ? 80  SER B OG    1 
ATOM   4065  N  N     . ASP B  1 81  ? 22.477  -29.153  60.192  1.00 49.02  ? 81  ASP B N     1 
ATOM   4066  C  CA    . ASP B  1 81  ? 23.425  -28.728  61.210  1.00 48.40  ? 81  ASP B CA    1 
ATOM   4067  C  C     . ASP B  1 81  ? 23.220  -29.534  62.452  1.00 48.78  ? 81  ASP B C     1 
ATOM   4068  O  O     . ASP B  1 81  ? 24.098  -29.598  63.266  1.00 49.23  ? 81  ASP B O     1 
ATOM   4069  C  CB    . ASP B  1 81  ? 23.230  -27.263  61.587  1.00 49.36  ? 81  ASP B CB    1 
ATOM   4070  C  CG    . ASP B  1 81  ? 23.647  -26.292  60.487  1.00 51.34  ? 81  ASP B CG    1 
ATOM   4071  O  OD1   . ASP B  1 81  ? 24.210  -26.717  59.445  1.00 54.41  ? 81  ASP B OD1   1 
ATOM   4072  O  OD2   . ASP B  1 81  ? 23.399  -25.079  60.674  1.00 53.83  ? 81  ASP B OD2   1 
ATOM   4073  N  N     . ARG B  1 82  ? 22.053  -30.135  62.620  1.00 49.96  ? 82  ARG B N     1 
ATOM   4074  C  CA    . ARG B  1 82  ? 21.793  -30.940  63.807  1.00 51.24  ? 82  ARG B CA    1 
ATOM   4075  C  C     . ARG B  1 82  ? 22.836  -32.043  63.965  1.00 50.99  ? 82  ARG B C     1 
ATOM   4076  O  O     . ARG B  1 82  ? 23.205  -32.416  65.073  1.00 52.01  ? 82  ARG B O     1 
ATOM   4077  C  CB    . ARG B  1 82  ? 20.395  -31.542  63.765  1.00 52.56  ? 82  ARG B CB    1 
ATOM   4078  C  CG    . ARG B  1 82  ? 20.115  -32.472  64.907  1.00 53.85  ? 82  ARG B CG    1 
ATOM   4079  C  CD    . ARG B  1 82  ? 18.644  -32.700  65.062  1.00 57.58  ? 82  ARG B CD    1 
ATOM   4080  N  NE    . ARG B  1 82  ? 18.379  -33.510  66.244  1.00 61.96  ? 82  ARG B NE    1 
ATOM   4081  C  CZ    . ARG B  1 82  ? 18.262  -33.027  67.480  1.00 64.26  ? 82  ARG B CZ    1 
ATOM   4082  N  NH1   . ARG B  1 82  ? 18.379  -31.722  67.721  1.00 63.65  ? 82  ARG B NH1   1 
ATOM   4083  N  NH2   . ARG B  1 82  ? 18.016  -33.857  68.483  1.00 67.15  ? 82  ARG B NH2   1 
ATOM   4084  N  N     . LEU B  1 83  ? 23.327  -32.532  62.840  1.00 49.96  ? 83  LEU B N     1 
ATOM   4085  C  CA    . LEU B  1 83  ? 24.198  -33.685  62.830  1.00 50.39  ? 83  LEU B CA    1 
ATOM   4086  C  C     . LEU B  1 83  ? 25.658  -33.373  63.155  1.00 49.69  ? 83  LEU B C     1 
ATOM   4087  O  O     . LEU B  1 83  ? 26.523  -34.197  62.870  1.00 50.46  ? 83  LEU B O     1 
ATOM   4088  C  CB    . LEU B  1 83  ? 24.100  -34.395  61.472  1.00 50.07  ? 83  LEU B CB    1 
ATOM   4089  C  CG    . LEU B  1 83  ? 22.748  -35.039  61.149  1.00 51.33  ? 83  LEU B CG    1 
ATOM   4090  C  CD1   . LEU B  1 83  ? 22.644  -35.393  59.676  1.00 50.49  ? 83  LEU B CD1   1 
ATOM   4091  C  CD2   . LEU B  1 83  ? 22.498  -36.261  62.031  1.00 52.18  ? 83  LEU B CD2   1 
ATOM   4092  N  N     . VAL B  1 84  ? 25.937  -32.206  63.737  1.00 48.67  ? 84  VAL B N     1 
ATOM   4093  C  CA    . VAL B  1 84  ? 27.303  -31.840  64.125  1.00 48.41  ? 84  VAL B CA    1 
ATOM   4094  C  C     . VAL B  1 84  ? 27.299  -30.981  65.400  1.00 49.72  ? 84  VAL B C     1 
ATOM   4095  O  O     . VAL B  1 84  ? 26.582  -29.982  65.471  1.00 49.87  ? 84  VAL B O     1 
ATOM   4096  C  CB    . VAL B  1 84  ? 28.057  -31.070  62.997  1.00 46.46  ? 84  VAL B CB    1 
ATOM   4097  C  CG1   . VAL B  1 84  ? 29.477  -30.821  63.394  1.00 45.66  ? 84  VAL B CG1   1 
ATOM   4098  C  CG2   . VAL B  1 84  ? 28.047  -31.830  61.707  1.00 45.85  ? 84  VAL B CG2   1 
ATOM   4099  N  N     . LYS B  1 85  ? 28.101  -31.352  66.398  1.00 51.08  ? 85  LYS B N     1 
ATOM   4100  C  CA    . LYS B  1 85  ? 28.179  -30.568  67.633  1.00 52.27  ? 85  LYS B CA    1 
ATOM   4101  C  C     . LYS B  1 85  ? 29.578  -30.033  67.892  1.00 53.10  ? 85  LYS B C     1 
ATOM   4102  O  O     . LYS B  1 85  ? 30.555  -30.498  67.300  1.00 53.05  ? 85  LYS B O     1 
ATOM   4103  C  CB    . LYS B  1 85  ? 27.771  -31.407  68.834  1.00 54.31  ? 85  LYS B CB    1 
ATOM   4104  C  CG    . LYS B  1 85  ? 26.409  -31.995  68.774  1.00 53.43  ? 85  LYS B CG    1 
ATOM   4105  C  CD    . LYS B  1 85  ? 26.053  -32.530  70.122  1.00 55.81  ? 85  LYS B CD    1 
ATOM   4106  C  CE    . LYS B  1 85  ? 25.067  -33.661  70.004  1.00 57.76  ? 85  LYS B CE    1 
ATOM   4107  N  NZ    . LYS B  1 85  ? 24.843  -34.294  71.329  1.00 61.11  ? 85  LYS B NZ    1 
ATOM   4108  N  N     . GLU B  1 86  ? 29.671  -29.075  68.810  1.00 54.56  ? 86  GLU B N     1 
ATOM   4109  C  CA    . GLU B  1 86  ? 30.954  -28.542  69.265  1.00 55.45  ? 86  GLU B CA    1 
ATOM   4110  C  C     . GLU B  1 86  ? 31.670  -29.571  70.131  1.00 57.62  ? 86  GLU B C     1 
ATOM   4111  O  O     . GLU B  1 86  ? 31.075  -30.137  71.045  1.00 59.66  ? 86  GLU B O     1 
ATOM   4112  C  CB    . GLU B  1 86  ? 30.725  -27.271  70.081  1.00 56.45  ? 86  GLU B CB    1 
ATOM   4113  C  CG    . GLU B  1 86  ? 31.908  -26.337  70.135  1.00 57.25  ? 86  GLU B CG    1 
ATOM   4114  C  CD    . GLU B  1 86  ? 31.816  -25.327  71.264  1.00 60.73  ? 86  GLU B CD    1 
ATOM   4115  O  OE1   . GLU B  1 86  ? 30.818  -24.570  71.321  1.00 61.47  ? 86  GLU B OE1   1 
ATOM   4116  O  OE2   . GLU B  1 86  ? 32.749  -25.286  72.095  1.00 62.81  ? 86  GLU B OE2   1 
ATOM   4117  N  N     . GLY B  1 87  ? 32.945  -29.804  69.837  1.00 57.68  ? 87  GLY B N     1 
ATOM   4118  C  CA    . GLY B  1 87  ? 33.781  -30.677  70.648  1.00 60.15  ? 87  GLY B CA    1 
ATOM   4119  C  C     . GLY B  1 87  ? 34.016  -31.995  69.963  1.00 60.06  ? 87  GLY B C     1 
ATOM   4120  O  O     . GLY B  1 87  ? 34.882  -32.768  70.360  1.00 62.31  ? 87  GLY B O     1 
ATOM   4121  N  N     . GLU B  1 88  ? 33.247  -32.238  68.912  1.00 58.15  ? 88  GLU B N     1 
ATOM   4122  C  CA    . GLU B  1 88  ? 33.288  -33.491  68.185  1.00 58.28  ? 88  GLU B CA    1 
ATOM   4123  C  C     . GLU B  1 88  ? 34.540  -33.640  67.334  1.00 57.70  ? 88  GLU B C     1 
ATOM   4124  O  O     . GLU B  1 88  ? 35.147  -32.649  66.913  1.00 56.50  ? 88  GLU B O     1 
ATOM   4125  C  CB    . GLU B  1 88  ? 32.059  -33.604  67.298  1.00 56.46  ? 88  GLU B CB    1 
ATOM   4126  C  CG    . GLU B  1 88  ? 30.821  -34.077  68.017  1.00 58.99  ? 88  GLU B CG    1 
ATOM   4127  C  CD    . GLU B  1 88  ? 29.625  -34.123  67.092  1.00 60.59  ? 88  GLU B CD    1 
ATOM   4128  O  OE1   . GLU B  1 88  ? 29.807  -33.855  65.875  1.00 59.21  ? 88  GLU B OE1   1 
ATOM   4129  O  OE2   . GLU B  1 88  ? 28.502  -34.419  67.573  1.00 62.61  ? 88  GLU B OE2   1 
ATOM   4130  N  N     . LEU B  1 89  ? 34.905  -34.894  67.080  1.00 58.77  ? 89  LEU B N     1 
ATOM   4131  C  CA    . LEU B  1 89  ? 36.038  -35.226  66.246  1.00 58.46  ? 89  LEU B CA    1 
ATOM   4132  C  C     . LEU B  1 89  ? 35.643  -35.191  64.782  1.00 56.12  ? 89  LEU B C     1 
ATOM   4133  O  O     . LEU B  1 89  ? 34.519  -35.564  64.432  1.00 55.68  ? 89  LEU B O     1 
ATOM   4134  C  CB    . LEU B  1 89  ? 36.550  -36.614  66.607  1.00 61.02  ? 89  LEU B CB    1 
ATOM   4135  C  CG    . LEU B  1 89  ? 37.955  -37.006  66.152  1.00 62.11  ? 89  LEU B CG    1 
ATOM   4136  C  CD1   . LEU B  1 89  ? 38.988  -36.484  67.149  1.00 64.99  ? 89  LEU B CD1   1 
ATOM   4137  C  CD2   . LEU B  1 89  ? 38.058  -38.523  66.006  1.00 63.56  ? 89  LEU B CD2   1 
ATOM   4138  N  N     . VAL B  1 90  ? 36.569  -34.729  63.938  1.00 55.23  ? 90  VAL B N     1 
ATOM   4139  C  CA    . VAL B  1 90  ? 36.420  -34.756  62.484  1.00 53.44  ? 90  VAL B CA    1 
ATOM   4140  C  C     . VAL B  1 90  ? 37.605  -35.480  61.887  1.00 54.37  ? 90  VAL B C     1 
ATOM   4141  O  O     . VAL B  1 90  ? 38.750  -35.163  62.201  1.00 55.73  ? 90  VAL B O     1 
ATOM   4142  C  CB    . VAL B  1 90  ? 36.445  -33.363  61.882  1.00 51.69  ? 90  VAL B CB    1 
ATOM   4143  C  CG1   . VAL B  1 90  ? 35.645  -33.343  60.604  1.00 51.15  ? 90  VAL B CG1   1 
ATOM   4144  C  CG2   . VAL B  1 90  ? 35.906  -32.341  62.858  1.00 52.21  ? 90  VAL B CG2   1 
ATOM   4145  N  N     . LYS B  1 91  ? 37.335  -36.452  61.024  1.00 54.44  ? 91  LYS B N     1 
ATOM   4146  C  CA    . LYS B  1 91  ? 38.395  -37.214  60.365  1.00 55.50  ? 91  LYS B CA    1 
ATOM   4147  C  C     . LYS B  1 91  ? 38.655  -36.713  58.928  1.00 53.47  ? 91  LYS B C     1 
ATOM   4148  O  O     . LYS B  1 91  ? 37.721  -36.491  58.163  1.00 52.01  ? 91  LYS B O     1 
ATOM   4149  C  CB    . LYS B  1 91  ? 38.055  -38.711  60.375  1.00 57.32  ? 91  LYS B CB    1 
ATOM   4150  C  CG    . LYS B  1 91  ? 38.305  -39.407  61.719  1.00 61.67  ? 91  LYS B CG    1 
ATOM   4151  C  CD    . LYS B  1 91  ? 37.146  -40.347  62.132  1.00 66.89  ? 91  LYS B CD    1 
ATOM   4152  C  CE    . LYS B  1 91  ? 35.861  -39.547  62.587  1.00 67.19  ? 91  LYS B CE    1 
ATOM   4153  N  NZ    . LYS B  1 91  ? 34.620  -40.396  62.701  1.00 68.30  ? 91  LYS B NZ    1 
ATOM   4154  N  N     . ARG B  1 92  ? 39.923  -36.507  58.582  1.00 53.54  ? 92  ARG B N     1 
ATOM   4155  C  CA    . ARG B  1 92  ? 40.309  -36.367  57.193  1.00 52.97  ? 92  ARG B CA    1 
ATOM   4156  C  C     . ARG B  1 92  ? 39.862  -37.582  56.395  1.00 53.77  ? 92  ARG B C     1 
ATOM   4157  O  O     . ARG B  1 92  ? 39.695  -38.681  56.931  1.00 55.38  ? 92  ARG B O     1 
ATOM   4158  C  CB    . ARG B  1 92  ? 41.821  -36.284  57.061  1.00 54.09  ? 92  ARG B CB    1 
ATOM   4159  C  CG    . ARG B  1 92  ? 42.379  -34.915  57.168  1.00 53.66  ? 92  ARG B CG    1 
ATOM   4160  C  CD    . ARG B  1 92  ? 43.803  -34.941  56.703  1.00 54.89  ? 92  ARG B CD    1 
ATOM   4161  N  NE    . ARG B  1 92  ? 43.875  -34.942  55.246  1.00 54.16  ? 92  ARG B NE    1 
ATOM   4162  C  CZ    . ARG B  1 92  ? 44.959  -35.261  54.551  1.00 53.37  ? 92  ARG B CZ    1 
ATOM   4163  N  NH1   . ARG B  1 92  ? 46.073  -35.617  55.176  1.00 53.50  ? 92  ARG B NH1   1 
ATOM   4164  N  NH2   . ARG B  1 92  ? 44.919  -35.226  53.229  1.00 52.56  ? 92  ARG B NH2   1 
ATOM   4165  N  N     . THR B  1 93  ? 39.724  -37.384  55.097  1.00 53.16  ? 93  THR B N     1 
ATOM   4166  C  CA    . THR B  1 93  ? 39.337  -38.444  54.184  1.00 53.84  ? 93  THR B CA    1 
ATOM   4167  C  C     . THR B  1 93  ? 40.433  -38.786  53.165  1.00 55.08  ? 93  THR B C     1 
ATOM   4168  O  O     . THR B  1 93  ? 40.453  -39.891  52.625  1.00 56.86  ? 93  THR B O     1 
ATOM   4169  C  CB    . THR B  1 93  ? 38.018  -38.052  53.491  1.00 52.70  ? 93  THR B CB    1 
ATOM   4170  O  OG1   . THR B  1 93  ? 36.946  -38.774  54.103  1.00 53.19  ? 93  THR B OG1   1 
ATOM   4171  C  CG2   . THR B  1 93  ? 38.039  -38.320  51.993  1.00 52.60  ? 93  THR B CG2   1 
ATOM   4172  N  N     . GLY B  1 94  ? 41.339  -37.839  52.920  1.00 54.58  ? 94  GLY B N     1 
ATOM   4173  C  CA    . GLY B  1 94  ? 42.317  -37.940  51.834  1.00 55.59  ? 94  GLY B CA    1 
ATOM   4174  C  C     . GLY B  1 94  ? 41.871  -37.399  50.480  1.00 55.08  ? 94  GLY B C     1 
ATOM   4175  O  O     . GLY B  1 94  ? 42.697  -36.979  49.680  1.00 55.74  ? 94  GLY B O     1 
ATOM   4176  N  N     . ASN B  1 95  ? 40.561  -37.375  50.237  1.00 54.28  ? 95  ASN B N     1 
ATOM   4177  C  CA    . ASN B  1 95  ? 40.017  -37.138  48.898  1.00 54.36  ? 95  ASN B CA    1 
ATOM   4178  C  C     . ASN B  1 95  ? 39.333  -35.803  48.679  1.00 53.04  ? 95  ASN B C     1 
ATOM   4179  O  O     . ASN B  1 95  ? 38.398  -35.460  49.398  1.00 51.43  ? 95  ASN B O     1 
ATOM   4180  C  CB    . ASN B  1 95  ? 39.031  -38.249  48.537  1.00 55.13  ? 95  ASN B CB    1 
ATOM   4181  C  CG    . ASN B  1 95  ? 39.627  -39.614  48.686  1.00 56.46  ? 95  ASN B CG    1 
ATOM   4182  O  OD1   . ASN B  1 95  ? 40.718  -39.884  48.180  1.00 60.36  ? 95  ASN B OD1   1 
ATOM   4183  N  ND2   . ASN B  1 95  ? 38.933  -40.485  49.388  1.00 55.76  ? 95  ASN B ND2   1 
ATOM   4184  N  N     . ILE B  1 96  ? 39.797  -35.064  47.667  1.00 54.12  ? 96  ILE B N     1 
ATOM   4185  C  CA    . ILE B  1 96  ? 39.050  -33.928  47.125  1.00 53.91  ? 96  ILE B CA    1 
ATOM   4186  C  C     . ILE B  1 96  ? 37.656  -34.455  46.759  1.00 54.13  ? 96  ILE B C     1 
ATOM   4187  O  O     . ILE B  1 96  ? 37.518  -35.623  46.367  1.00 55.43  ? 96  ILE B O     1 
ATOM   4188  C  CB    . ILE B  1 96  ? 39.739  -33.304  45.866  1.00 55.62  ? 96  ILE B CB    1 
ATOM   4189  C  CG1   . ILE B  1 96  ? 41.221  -32.996  46.112  1.00 56.34  ? 96  ILE B CG1   1 
ATOM   4190  C  CG2   . ILE B  1 96  ? 39.022  -32.029  45.394  1.00 56.25  ? 96  ILE B CG2   1 
ATOM   4191  C  CD1   . ILE B  1 96  ? 41.512  -32.159  47.337  1.00 55.81  ? 96  ILE B CD1   1 
ATOM   4192  N  N     . VAL B  1 97  ? 36.631  -33.617  46.903  1.00 52.98  ? 97  VAL B N     1 
ATOM   4193  C  CA    . VAL B  1 97  ? 35.272  -34.032  46.579  1.00 53.66  ? 97  VAL B CA    1 
ATOM   4194  C  C     . VAL B  1 97  ? 35.213  -34.749  45.226  1.00 56.60  ? 97  VAL B C     1 
ATOM   4195  O  O     . VAL B  1 97  ? 35.575  -34.177  44.190  1.00 57.64  ? 97  VAL B O     1 
ATOM   4196  C  CB    . VAL B  1 97  ? 34.311  -32.857  46.588  1.00 52.85  ? 97  VAL B CB    1 
ATOM   4197  C  CG1   . VAL B  1 97  ? 32.898  -33.337  46.418  1.00 52.76  ? 97  VAL B CG1   1 
ATOM   4198  C  CG2   . VAL B  1 97  ? 34.449  -32.111  47.881  1.00 51.43  ? 97  VAL B CG2   1 
ATOM   4199  N  N     . ASP B  1 98  ? 34.776  -36.011  45.272  1.00 46.85  ? 98  ASP B N     1 
ATOM   4200  C  CA    . ASP B  1 98  ? 34.705  -36.885  44.099  1.00 47.63  ? 98  ASP B CA    1 
ATOM   4201  C  C     . ASP B  1 98  ? 33.459  -37.802  44.117  1.00 47.11  ? 98  ASP B C     1 
ATOM   4202  O  O     . ASP B  1 98  ? 32.682  -37.788  45.070  1.00 45.79  ? 98  ASP B O     1 
ATOM   4203  C  CB    . ASP B  1 98  ? 35.976  -37.719  43.998  1.00 49.41  ? 98  ASP B CB    1 
ATOM   4204  C  CG    . ASP B  1 98  ? 36.122  -38.729  45.145  1.00 52.24  ? 98  ASP B CG    1 
ATOM   4205  O  OD1   . ASP B  1 98  ? 35.281  -38.705  46.083  1.00 50.33  ? 98  ASP B OD1   1 
ATOM   4206  O  OD2   . ASP B  1 98  ? 37.089  -39.556  45.094  1.00 55.69  ? 98  ASP B OD2   1 
ATOM   4207  N  N     . VAL B  1 99  ? 33.298  -38.587  43.050  1.00 47.47  ? 99  VAL B N     1 
ATOM   4208  C  CA    . VAL B  1 99  ? 32.199  -39.546  42.913  1.00 47.30  ? 99  VAL B CA    1 
ATOM   4209  C  C     . VAL B  1 99  ? 32.543  -40.784  42.115  1.00 48.34  ? 99  VAL B C     1 
ATOM   4210  O  O     . VAL B  1 99  ? 33.455  -40.760  41.285  1.00 49.65  ? 99  VAL B O     1 
ATOM   4211  C  CB    . VAL B  1 99  ? 31.000  -38.971  42.164  1.00 45.94  ? 99  VAL B CB    1 
ATOM   4212  C  CG1   . VAL B  1 99  ? 30.039  -38.403  43.120  1.00 45.81  ? 99  VAL B CG1   1 
ATOM   4213  C  CG2   . VAL B  1 99  ? 31.442  -37.986  41.088  1.00 45.53  ? 99  VAL B CG2   1 
ATOM   4214  N  N     . PRO B  1 100 ? 31.763  -41.858  42.321  1.00 48.14  ? 100 PRO B N     1 
ATOM   4215  C  CA    . PRO B  1 100 ? 31.866  -43.050  41.513  1.00 49.01  ? 100 PRO B CA    1 
ATOM   4216  C  C     . PRO B  1 100 ? 31.493  -42.724  40.092  1.00 48.21  ? 100 PRO B C     1 
ATOM   4217  O  O     . PRO B  1 100 ? 30.645  -41.876  39.858  1.00 46.84  ? 100 PRO B O     1 
ATOM   4218  C  CB    . PRO B  1 100 ? 30.803  -43.974  42.090  1.00 49.08  ? 100 PRO B CB    1 
ATOM   4219  C  CG    . PRO B  1 100 ? 30.301  -43.350  43.268  1.00 48.66  ? 100 PRO B CG    1 
ATOM   4220  C  CD    . PRO B  1 100 ? 30.696  -41.950  43.324  1.00 47.46  ? 100 PRO B CD    1 
ATOM   4221  N  N     . VAL B  1 101 ? 32.135  -43.393  39.152  1.00 49.15  ? 101 VAL B N     1 
ATOM   4222  C  CA    . VAL B  1 101 ? 31.814  -43.221  37.748  1.00 49.03  ? 101 VAL B CA    1 
ATOM   4223  C  C     . VAL B  1 101 ? 31.886  -44.574  37.069  1.00 50.63  ? 101 VAL B C     1 
ATOM   4224  O  O     . VAL B  1 101 ? 32.454  -45.539  37.610  1.00 51.43  ? 101 VAL B O     1 
ATOM   4225  C  CB    . VAL B  1 101 ? 32.752  -42.193  37.028  1.00 49.11  ? 101 VAL B CB    1 
ATOM   4226  C  CG1   . VAL B  1 101 ? 32.477  -40.776  37.506  1.00 47.95  ? 101 VAL B CG1   1 
ATOM   4227  C  CG2   . VAL B  1 101 ? 34.210  -42.529  37.220  1.00 49.25  ? 101 VAL B CG2   1 
ATOM   4228  N  N     . GLY B  1 102 ? 31.293  -44.643  35.887  1.00 50.93  ? 102 GLY B N     1 
ATOM   4229  C  CA    . GLY B  1 102 ? 31.396  -45.837  35.065  1.00 52.61  ? 102 GLY B CA    1 
ATOM   4230  C  C     . GLY B  1 102 ? 30.046  -46.352  34.635  1.00 52.50  ? 102 GLY B C     1 
ATOM   4231  O  O     . GLY B  1 102 ? 29.021  -45.926  35.161  1.00 51.11  ? 102 GLY B O     1 
ATOM   4232  N  N     . PRO B  1 103 ? 30.045  -47.293  33.682  1.00 54.33  ? 103 PRO B N     1 
ATOM   4233  C  CA    . PRO B  1 103 ? 28.826  -47.880  33.140  1.00 54.86  ? 103 PRO B CA    1 
ATOM   4234  C  C     . PRO B  1 103 ? 28.015  -48.630  34.202  1.00 55.03  ? 103 PRO B C     1 
ATOM   4235  O  O     . PRO B  1 103 ? 26.827  -48.854  33.996  1.00 55.40  ? 103 PRO B O     1 
ATOM   4236  C  CB    . PRO B  1 103 ? 29.356  -48.851  32.091  1.00 56.62  ? 103 PRO B CB    1 
ATOM   4237  C  CG    . PRO B  1 103 ? 30.705  -49.214  32.576  1.00 57.20  ? 103 PRO B CG    1 
ATOM   4238  C  CD    . PRO B  1 103 ? 31.249  -47.980  33.182  1.00 55.99  ? 103 PRO B CD    1 
ATOM   4239  N  N     . GLY B  1 104 ? 28.652  -49.013  35.312  1.00 54.81  ? 104 GLY B N     1 
ATOM   4240  C  CA    . GLY B  1 104 ? 27.944  -49.615  36.442  1.00 54.84  ? 104 GLY B CA    1 
ATOM   4241  C  C     . GLY B  1 104 ? 26.898  -48.744  37.155  1.00 53.26  ? 104 GLY B C     1 
ATOM   4242  O  O     . GLY B  1 104 ? 26.071  -49.272  37.890  1.00 53.49  ? 104 GLY B O     1 
ATOM   4243  N  N     . LEU B  1 105 ? 26.933  -47.423  36.964  1.00 51.40  ? 105 LEU B N     1 
ATOM   4244  C  CA    . LEU B  1 105 ? 25.890  -46.545  37.508  1.00 50.07  ? 105 LEU B CA    1 
ATOM   4245  C  C     . LEU B  1 105 ? 24.606  -46.570  36.676  1.00 50.17  ? 105 LEU B C     1 
ATOM   4246  O  O     . LEU B  1 105 ? 23.578  -46.066  37.111  1.00 49.33  ? 105 LEU B O     1 
ATOM   4247  C  CB    . LEU B  1 105 ? 26.371  -45.089  37.623  1.00 48.50  ? 105 LEU B CB    1 
ATOM   4248  C  CG    . LEU B  1 105 ? 27.313  -44.644  38.742  1.00 48.31  ? 105 LEU B CG    1 
ATOM   4249  C  CD1   . LEU B  1 105 ? 28.735  -45.165  38.518  1.00 49.98  ? 105 LEU B CD1   1 
ATOM   4250  C  CD2   . LEU B  1 105 ? 27.341  -43.166  38.817  1.00 45.36  ? 105 LEU B CD2   1 
ATOM   4251  N  N     . LEU B  1 106 ? 24.675  -47.111  35.465  1.00 51.37  ? 106 LEU B N     1 
ATOM   4252  C  CA    . LEU B  1 106 ? 23.503  -47.187  34.591  1.00 51.87  ? 106 LEU B CA    1 
ATOM   4253  C  C     . LEU B  1 106 ? 22.332  -47.905  35.273  1.00 52.48  ? 106 LEU B C     1 
ATOM   4254  O  O     . LEU B  1 106 ? 22.521  -48.938  35.912  1.00 53.73  ? 106 LEU B O     1 
ATOM   4255  C  CB    . LEU B  1 106 ? 23.867  -47.870  33.276  1.00 53.13  ? 106 LEU B CB    1 
ATOM   4256  C  CG    . LEU B  1 106 ? 24.155  -47.143  31.953  1.00 52.78  ? 106 LEU B CG    1 
ATOM   4257  C  CD1   . LEU B  1 106 ? 24.303  -45.635  32.009  1.00 50.30  ? 106 LEU B CD1   1 
ATOM   4258  C  CD2   . LEU B  1 106 ? 25.372  -47.779  31.304  1.00 53.65  ? 106 LEU B CD2   1 
ATOM   4259  N  N     . GLY B  1 107 ? 21.134  -47.331  35.163  1.00 51.95  ? 107 GLY B N     1 
ATOM   4260  C  CA    . GLY B  1 107 ? 19.941  -47.874  35.817  1.00 52.12  ? 107 GLY B CA    1 
ATOM   4261  C  C     . GLY B  1 107 ? 19.816  -47.486  37.280  1.00 50.81  ? 107 GLY B C     1 
ATOM   4262  O  O     . GLY B  1 107 ? 18.866  -47.877  37.953  1.00 51.63  ? 107 GLY B O     1 
ATOM   4263  N  N     . ARG B  1 108 ? 20.763  -46.701  37.776  1.00 48.99  ? 108 ARG B N     1 
ATOM   4264  C  CA    . ARG B  1 108 ? 20.843  -46.434  39.199  1.00 47.95  ? 108 ARG B CA    1 
ATOM   4265  C  C     . ARG B  1 108 ? 20.356  -45.040  39.519  1.00 46.15  ? 108 ARG B C     1 
ATOM   4266  O  O     . ARG B  1 108 ? 20.437  -44.162  38.671  1.00 45.68  ? 108 ARG B O     1 
ATOM   4267  C  CB    . ARG B  1 108 ? 22.279  -46.643  39.703  1.00 47.67  ? 108 ARG B CB    1 
ATOM   4268  C  CG    . ARG B  1 108 ? 22.818  -48.087  39.570  1.00 48.74  ? 108 ARG B CG    1 
ATOM   4269  C  CD    . ARG B  1 108 ? 21.920  -49.163  40.238  1.00 49.71  ? 108 ARG B CD    1 
ATOM   4270  N  NE    . ARG B  1 108 ? 21.640  -48.903  41.649  1.00 48.97  ? 108 ARG B NE    1 
ATOM   4271  C  CZ    . ARG B  1 108 ? 22.358  -49.370  42.669  1.00 50.15  ? 108 ARG B CZ    1 
ATOM   4272  N  NH1   . ARG B  1 108 ? 23.422  -50.128  42.461  1.00 51.36  ? 108 ARG B NH1   1 
ATOM   4273  N  NH2   . ARG B  1 108 ? 22.015  -49.062  43.912  1.00 50.42  ? 108 ARG B NH2   1 
ATOM   4274  N  N     . VAL B  1 109 ? 19.827  -44.845  40.727  1.00 45.63  ? 109 VAL B N     1 
ATOM   4275  C  CA    . VAL B  1 109 ? 19.498  -43.501  41.223  1.00 44.12  ? 109 VAL B CA    1 
ATOM   4276  C  C     . VAL B  1 109 ? 20.392  -43.181  42.418  1.00 43.67  ? 109 VAL B C     1 
ATOM   4277  O  O     . VAL B  1 109 ? 20.458  -43.959  43.366  1.00 44.27  ? 109 VAL B O     1 
ATOM   4278  C  CB    . VAL B  1 109 ? 18.009  -43.340  41.621  1.00 44.38  ? 109 VAL B CB    1 
ATOM   4279  C  CG1   . VAL B  1 109 ? 17.672  -41.869  41.831  1.00 41.78  ? 109 VAL B CG1   1 
ATOM   4280  C  CG2   . VAL B  1 109 ? 17.074  -43.954  40.570  1.00 44.88  ? 109 VAL B CG2   1 
ATOM   4281  N  N     . VAL B  1 110 ? 21.094  -42.048  42.355  1.00 42.78  ? 110 VAL B N     1 
ATOM   4282  C  CA    . VAL B  1 110 ? 22.048  -41.656  43.400  1.00 42.77  ? 110 VAL B CA    1 
ATOM   4283  C  C     . VAL B  1 110 ? 21.847  -40.225  43.892  1.00 42.11  ? 110 VAL B C     1 
ATOM   4284  O  O     . VAL B  1 110 ? 21.188  -39.431  43.230  1.00 42.23  ? 110 VAL B O     1 
ATOM   4285  C  CB    . VAL B  1 110 ? 23.511  -41.752  42.926  1.00 42.71  ? 110 VAL B CB    1 
ATOM   4286  C  CG1   . VAL B  1 110 ? 23.886  -43.177  42.569  1.00 43.42  ? 110 VAL B CG1   1 
ATOM   4287  C  CG2   . VAL B  1 110 ? 23.757  -40.796  41.768  1.00 42.10  ? 110 VAL B CG2   1 
ATOM   4288  N  N     . ASP B  1 111 ? 22.440  -39.906  45.045  1.00 41.98  ? 111 ASP B N     1 
ATOM   4289  C  CA    . ASP B  1 111 ? 22.508  -38.544  45.542  1.00 40.96  ? 111 ASP B CA    1 
ATOM   4290  C  C     . ASP B  1 111 ? 23.764  -37.822  45.024  1.00 40.71  ? 111 ASP B C     1 
ATOM   4291  O  O     . ASP B  1 111 ? 24.570  -38.415  44.320  1.00 41.57  ? 111 ASP B O     1 
ATOM   4292  C  CB    . ASP B  1 111 ? 22.393  -38.519  47.070  1.00 41.04  ? 111 ASP B CB    1 
ATOM   4293  C  CG    . ASP B  1 111 ? 23.667  -38.958  47.805  1.00 43.59  ? 111 ASP B CG    1 
ATOM   4294  O  OD1   . ASP B  1 111 ? 24.767  -39.141  47.228  1.00 43.67  ? 111 ASP B OD1   1 
ATOM   4295  O  OD2   . ASP B  1 111 ? 23.562  -39.113  49.038  1.00 48.13  ? 111 ASP B OD2   1 
ATOM   4296  N  N     . ALA B  1 112 ? 23.939  -36.555  45.383  1.00 40.01  ? 112 ALA B N     1 
ATOM   4297  C  CA    . ALA B  1 112 ? 24.966  -35.722  44.786  1.00 39.81  ? 112 ALA B CA    1 
ATOM   4298  C  C     . ALA B  1 112 ? 26.363  -36.228  45.057  1.00 41.05  ? 112 ALA B C     1 
ATOM   4299  O  O     . ALA B  1 112 ? 27.294  -35.961  44.292  1.00 41.43  ? 112 ALA B O     1 
ATOM   4300  C  CB    . ALA B  1 112 ? 24.837  -34.315  45.267  1.00 39.21  ? 112 ALA B CB    1 
ATOM   4301  N  N     . LEU B  1 113 ? 26.522  -36.957  46.153  1.00 41.94  ? 113 LEU B N     1 
ATOM   4302  C  CA    . LEU B  1 113 ? 27.827  -37.526  46.469  1.00 42.56  ? 113 LEU B CA    1 
ATOM   4303  C  C     . LEU B  1 113 ? 28.042  -38.895  45.851  1.00 43.41  ? 113 LEU B C     1 
ATOM   4304  O  O     . LEU B  1 113 ? 29.032  -39.531  46.138  1.00 44.84  ? 113 LEU B O     1 
ATOM   4305  C  CB    . LEU B  1 113 ? 28.037  -37.550  47.990  1.00 42.68  ? 113 LEU B CB    1 
ATOM   4306  C  CG    . LEU B  1 113 ? 28.418  -36.172  48.556  1.00 41.15  ? 113 LEU B CG    1 
ATOM   4307  C  CD1   . LEU B  1 113 ? 28.396  -36.160  50.059  1.00 38.19  ? 113 LEU B CD1   1 
ATOM   4308  C  CD2   . LEU B  1 113 ? 29.803  -35.676  47.995  1.00 41.20  ? 113 LEU B CD2   1 
ATOM   4309  N  N     . GLY B  1 114 ? 27.121  -39.342  45.002  1.00 43.42  ? 114 GLY B N     1 
ATOM   4310  C  CA    . GLY B  1 114 ? 27.188  -40.678  44.402  1.00 44.75  ? 114 GLY B CA    1 
ATOM   4311  C  C     . GLY B  1 114 ? 26.569  -41.843  45.170  1.00 46.01  ? 114 GLY B C     1 
ATOM   4312  O  O     . GLY B  1 114 ? 26.617  -42.980  44.695  1.00 47.88  ? 114 GLY B O     1 
ATOM   4313  N  N     . ASN B  1 115 ? 26.001  -41.587  46.350  1.00 45.64  ? 115 ASN B N     1 
ATOM   4314  C  CA    . ASN B  1 115 ? 25.400  -42.636  47.187  1.00 46.32  ? 115 ASN B CA    1 
ATOM   4315  C  C     . ASN B  1 115 ? 24.067  -43.104  46.632  1.00 46.11  ? 115 ASN B C     1 
ATOM   4316  O  O     . ASN B  1 115 ? 23.184  -42.287  46.396  1.00 44.86  ? 115 ASN B O     1 
ATOM   4317  C  CB    . ASN B  1 115 ? 25.170  -42.118  48.611  1.00 46.56  ? 115 ASN B CB    1 
ATOM   4318  C  CG    . ASN B  1 115 ? 26.471  -41.840  49.366  1.00 47.97  ? 115 ASN B CG    1 
ATOM   4319  O  OD1   . ASN B  1 115 ? 27.179  -42.761  49.771  1.00 49.88  ? 115 ASN B OD1   1 
ATOM   4320  N  ND2   . ASN B  1 115 ? 26.768  -40.563  49.581  1.00 48.37  ? 115 ASN B ND2   1 
ATOM   4321  N  N     . PRO B  1 116 ? 23.893  -44.425  46.440  1.00 47.19  ? 116 PRO B N     1 
ATOM   4322  C  CA    . PRO B  1 116 ? 22.605  -44.912  45.914  1.00 47.33  ? 116 PRO B CA    1 
ATOM   4323  C  C     . PRO B  1 116 ? 21.426  -44.573  46.820  1.00 46.87  ? 116 PRO B C     1 
ATOM   4324  O  O     . PRO B  1 116 ? 21.518  -44.721  48.034  1.00 47.40  ? 116 PRO B O     1 
ATOM   4325  C  CB    . PRO B  1 116 ? 22.792  -46.433  45.844  1.00 48.82  ? 116 PRO B CB    1 
ATOM   4326  C  CG    . PRO B  1 116 ? 23.892  -46.733  46.757  1.00 49.67  ? 116 PRO B CG    1 
ATOM   4327  C  CD    . PRO B  1 116 ? 24.790  -45.529  46.806  1.00 48.54  ? 116 PRO B CD    1 
ATOM   4328  N  N     . ILE B  1 117 ? 20.333  -44.117  46.225  1.00 46.02  ? 117 ILE B N     1 
ATOM   4329  C  CA    . ILE B  1 117 ? 19.101  -43.869  46.967  1.00 45.44  ? 117 ILE B CA    1 
ATOM   4330  C  C     . ILE B  1 117 ? 17.928  -44.729  46.467  1.00 46.88  ? 117 ILE B C     1 
ATOM   4331  O  O     . ILE B  1 117 ? 16.770  -44.477  46.823  1.00 47.34  ? 117 ILE B O     1 
ATOM   4332  C  CB    . ILE B  1 117 ? 18.694  -42.366  46.925  1.00 43.82  ? 117 ILE B CB    1 
ATOM   4333  C  CG1   . ILE B  1 117 ? 18.484  -41.916  45.484  1.00 42.98  ? 117 ILE B CG1   1 
ATOM   4334  C  CG2   . ILE B  1 117 ? 19.716  -41.489  47.658  1.00 41.29  ? 117 ILE B CG2   1 
ATOM   4335  C  CD1   . ILE B  1 117 ? 17.870  -40.588  45.356  1.00 42.69  ? 117 ILE B CD1   1 
ATOM   4336  N  N     . ASP B  1 118 ? 18.215  -45.748  45.660  1.00 47.68  ? 118 ASP B N     1 
ATOM   4337  C  CA    . ASP B  1 118 ? 17.155  -46.489  44.991  1.00 48.92  ? 118 ASP B CA    1 
ATOM   4338  C  C     . ASP B  1 118 ? 16.849  -47.842  45.605  1.00 51.14  ? 118 ASP B C     1 
ATOM   4339  O  O     . ASP B  1 118 ? 16.108  -48.628  45.019  1.00 52.80  ? 118 ASP B O     1 
ATOM   4340  C  CB    . ASP B  1 118 ? 17.471  -46.649  43.513  1.00 48.59  ? 118 ASP B CB    1 
ATOM   4341  C  CG    . ASP B  1 118 ? 18.757  -47.381  43.274  1.00 49.58  ? 118 ASP B CG    1 
ATOM   4342  O  OD1   . ASP B  1 118 ? 19.410  -47.780  44.261  1.00 49.17  ? 118 ASP B OD1   1 
ATOM   4343  O  OD2   . ASP B  1 118 ? 19.117  -47.558  42.086  1.00 50.91  ? 118 ASP B OD2   1 
ATOM   4344  N  N     . GLY B  1 119 ? 17.420  -48.110  46.778  1.00 51.70  ? 119 GLY B N     1 
ATOM   4345  C  CA    . GLY B  1 119 ? 17.197  -49.366  47.500  1.00 53.74  ? 119 GLY B CA    1 
ATOM   4346  C  C     . GLY B  1 119 ? 17.995  -50.543  46.969  1.00 55.14  ? 119 GLY B C     1 
ATOM   4347  O  O     . GLY B  1 119 ? 17.805  -51.672  47.409  1.00 57.11  ? 119 GLY B O     1 
ATOM   4348  N  N     . LYS B  1 120 ? 18.917  -50.283  46.050  1.00 54.40  ? 120 LYS B N     1 
ATOM   4349  C  CA    . LYS B  1 120 ? 19.535  -51.367  45.290  1.00 55.94  ? 120 LYS B CA    1 
ATOM   4350  C  C     . LYS B  1 120 ? 20.986  -51.759  45.624  1.00 56.07  ? 120 LYS B C     1 
ATOM   4351  O  O     . LYS B  1 120 ? 21.525  -52.683  45.031  1.00 57.29  ? 120 LYS B O     1 
ATOM   4352  C  CB    . LYS B  1 120 ? 19.326  -51.141  43.788  1.00 55.58  ? 120 LYS B CB    1 
ATOM   4353  C  CG    . LYS B  1 120 ? 17.892  -51.391  43.400  1.00 57.22  ? 120 LYS B CG    1 
ATOM   4354  C  CD    . LYS B  1 120 ? 17.543  -50.939  42.006  1.00 57.78  ? 120 LYS B CD    1 
ATOM   4355  C  CE    . LYS B  1 120 ? 16.020  -50.823  41.893  1.00 59.25  ? 120 LYS B CE    1 
ATOM   4356  N  NZ    . LYS B  1 120 ? 15.517  -50.953  40.495  1.00 61.02  ? 120 LYS B NZ    1 
ATOM   4357  N  N     . GLY B  1 121 ? 21.602  -51.079  46.582  1.00 55.20  ? 121 GLY B N     1 
ATOM   4358  C  CA    . GLY B  1 121 ? 22.908  -51.500  47.084  1.00 55.99  ? 121 GLY B CA    1 
ATOM   4359  C  C     . GLY B  1 121 ? 24.112  -50.772  46.508  1.00 54.89  ? 121 GLY B C     1 
ATOM   4360  O  O     . GLY B  1 121 ? 23.971  -49.967  45.594  1.00 53.40  ? 121 GLY B O     1 
ATOM   4361  N  N     . PRO B  1 122 ? 25.314  -51.069  47.038  1.00 55.88  ? 122 PRO B N     1 
ATOM   4362  C  CA    . PRO B  1 122 ? 26.553  -50.437  46.580  1.00 55.41  ? 122 PRO B CA    1 
ATOM   4363  C  C     . PRO B  1 122 ? 26.627  -50.266  45.065  1.00 55.31  ? 122 PRO B C     1 
ATOM   4364  O  O     . PRO B  1 122 ? 26.235  -51.167  44.320  1.00 56.49  ? 122 PRO B O     1 
ATOM   4365  C  CB    . PRO B  1 122 ? 27.631  -51.405  47.075  1.00 56.96  ? 122 PRO B CB    1 
ATOM   4366  C  CG    . PRO B  1 122 ? 27.065  -51.915  48.340  1.00 57.87  ? 122 PRO B CG    1 
ATOM   4367  C  CD    . PRO B  1 122 ? 25.581  -52.062  48.099  1.00 57.45  ? 122 PRO B CD    1 
ATOM   4368  N  N     . ILE B  1 123 ? 27.097  -49.094  44.637  1.00 54.32  ? 123 ILE B N     1 
ATOM   4369  C  CA    . ILE B  1 123 ? 27.332  -48.772  43.225  1.00 54.14  ? 123 ILE B CA    1 
ATOM   4370  C  C     . ILE B  1 123 ? 28.555  -49.543  42.718  1.00 56.18  ? 123 ILE B C     1 
ATOM   4371  O  O     . ILE B  1 123 ? 29.484  -49.821  43.479  1.00 57.01  ? 123 ILE B O     1 
ATOM   4372  C  CB    . ILE B  1 123 ? 27.555  -47.250  43.068  1.00 51.95  ? 123 ILE B CB    1 
ATOM   4373  C  CG1   . ILE B  1 123 ? 26.287  -46.466  43.456  1.00 51.23  ? 123 ILE B CG1   1 
ATOM   4374  C  CG2   . ILE B  1 123 ? 27.987  -46.897  41.677  1.00 51.86  ? 123 ILE B CG2   1 
ATOM   4375  C  CD1   . ILE B  1 123 ? 25.089  -46.589  42.484  1.00 49.83  ? 123 ILE B CD1   1 
ATOM   4376  N  N     . ASP B  1 124 ? 28.543  -49.914  41.443  1.00 57.64  ? 124 ASP B N     1 
ATOM   4377  C  CA    . ASP B  1 124 ? 29.648  -50.685  40.841  1.00 60.18  ? 124 ASP B CA    1 
ATOM   4378  C  C     . ASP B  1 124 ? 30.537  -49.751  40.010  1.00 58.84  ? 124 ASP B C     1 
ATOM   4379  O  O     . ASP B  1 124 ? 30.320  -49.587  38.805  1.00 58.85  ? 124 ASP B O     1 
ATOM   4380  C  CB    . ASP B  1 124 ? 29.089  -51.857  40.001  1.00 62.60  ? 124 ASP B CB    1 
ATOM   4381  C  CG    . ASP B  1 124 ? 30.167  -52.591  39.198  1.00 68.14  ? 124 ASP B CG    1 
ATOM   4382  O  OD1   . ASP B  1 124 ? 31.263  -52.862  39.748  1.00 73.41  ? 124 ASP B OD1   1 
ATOM   4383  O  OD2   . ASP B  1 124 ? 29.918  -52.920  38.006  1.00 73.06  ? 124 ASP B OD2   1 
ATOM   4384  N  N     . ALA B  1 125 ? 31.520  -49.132  40.674  1.00 57.73  ? 125 ALA B N     1 
ATOM   4385  C  CA    . ALA B  1 125 ? 32.337  -48.061  40.090  1.00 56.10  ? 125 ALA B CA    1 
ATOM   4386  C  C     . ALA B  1 125 ? 33.553  -48.554  39.303  1.00 57.80  ? 125 ALA B C     1 
ATOM   4387  O  O     . ALA B  1 125 ? 34.366  -49.339  39.803  1.00 59.15  ? 125 ALA B O     1 
ATOM   4388  C  CB    . ALA B  1 125 ? 32.787  -47.114  41.163  1.00 54.69  ? 125 ALA B CB    1 
ATOM   4389  N  N     . ALA B  1 126 ? 33.683  -48.071  38.069  1.00 57.56  ? 126 ALA B N     1 
ATOM   4390  C  CA    . ALA B  1 126 ? 34.905  -48.262  37.296  1.00 58.72  ? 126 ALA B CA    1 
ATOM   4391  C  C     . ALA B  1 126 ? 36.043  -47.500  37.954  1.00 58.82  ? 126 ALA B C     1 
ATOM   4392  O  O     . ALA B  1 126 ? 37.205  -47.821  37.739  1.00 61.14  ? 126 ALA B O     1 
ATOM   4393  C  CB    . ALA B  1 126 ? 34.716  -47.782  35.883  1.00 58.26  ? 126 ALA B CB    1 
ATOM   4394  N  N     . GLY B  1 127 ? 35.701  -46.484  38.747  1.00 57.05  ? 127 GLY B N     1 
ATOM   4395  C  CA    . GLY B  1 127 ? 36.670  -45.639  39.444  1.00 56.58  ? 127 GLY B CA    1 
ATOM   4396  C  C     . GLY B  1 127 ? 36.001  -44.384  39.962  1.00 54.50  ? 127 GLY B C     1 
ATOM   4397  O  O     . GLY B  1 127 ? 34.775  -44.300  39.997  1.00 53.58  ? 127 GLY B O     1 
ATOM   4398  N  N     . ARG B  1 128 ? 36.797  -43.398  40.371  1.00 54.13  ? 128 ARG B N     1 
ATOM   4399  C  CA    . ARG B  1 128 ? 36.255  -42.169  40.995  1.00 51.76  ? 128 ARG B CA    1 
ATOM   4400  C  C     . ARG B  1 128 ? 36.766  -40.950  40.252  1.00 51.33  ? 128 ARG B C     1 
ATOM   4401  O  O     . ARG B  1 128 ? 37.921  -40.896  39.874  1.00 52.46  ? 128 ARG B O     1 
ATOM   4402  C  CB    . ARG B  1 128 ? 36.618  -42.065  42.491  1.00 51.29  ? 128 ARG B CB    1 
ATOM   4403  C  CG    . ARG B  1 128 ? 36.182  -43.261  43.311  1.00 51.60  ? 128 ARG B CG    1 
ATOM   4404  C  CD    . ARG B  1 128 ? 36.394  -43.102  44.819  1.00 52.14  ? 128 ARG B CD    1 
ATOM   4405  N  NE    . ARG B  1 128 ? 35.553  -42.063  45.413  1.00 51.78  ? 128 ARG B NE    1 
ATOM   4406  C  CZ    . ARG B  1 128 ? 34.246  -42.173  45.657  1.00 51.25  ? 128 ARG B CZ    1 
ATOM   4407  N  NH1   . ARG B  1 128 ? 33.584  -43.279  45.363  1.00 51.78  ? 128 ARG B NH1   1 
ATOM   4408  N  NH2   . ARG B  1 128 ? 33.590  -41.159  46.188  1.00 51.48  ? 128 ARG B NH2   1 
ATOM   4409  N  N     . SER B  1 129 ? 35.890  -39.988  40.016  1.00 50.11  ? 129 SER B N     1 
ATOM   4410  C  CA    . SER B  1 129 ? 36.288  -38.743  39.382  1.00 50.21  ? 129 SER B CA    1 
ATOM   4411  C  C     . SER B  1 129 ? 35.991  -37.619  40.349  1.00 49.52  ? 129 SER B C     1 
ATOM   4412  O  O     . SER B  1 129 ? 35.023  -37.680  41.121  1.00 48.87  ? 129 SER B O     1 
ATOM   4413  C  CB    . SER B  1 129 ? 35.498  -38.497  38.089  1.00 49.79  ? 129 SER B CB    1 
ATOM   4414  O  OG    . SER B  1 129 ? 35.844  -39.404  37.050  1.00 49.75  ? 129 SER B OG    1 
ATOM   4415  N  N     . ARG B  1 130 ? 36.807  -36.577  40.312  1.00 49.89  ? 130 ARG B N     1 
ATOM   4416  C  CA    . ARG B  1 130 ? 36.464  -35.371  41.066  1.00 48.42  ? 130 ARG B CA    1 
ATOM   4417  C  C     . ARG B  1 130 ? 35.151  -34.755  40.606  1.00 46.97  ? 130 ARG B C     1 
ATOM   4418  O  O     . ARG B  1 130 ? 34.712  -34.991  39.482  1.00 47.32  ? 130 ARG B O     1 
ATOM   4419  C  CB    . ARG B  1 130 ? 37.583  -34.364  40.980  1.00 48.71  ? 130 ARG B CB    1 
ATOM   4420  C  CG    . ARG B  1 130 ? 38.777  -34.844  41.716  1.00 49.19  ? 130 ARG B CG    1 
ATOM   4421  C  CD    . ARG B  1 130 ? 39.774  -33.789  41.689  1.00 50.46  ? 130 ARG B CD    1 
ATOM   4422  N  NE    . ARG B  1 130 ? 40.905  -34.136  42.517  1.00 53.02  ? 130 ARG B NE    1 
ATOM   4423  C  CZ    . ARG B  1 130 ? 42.100  -33.577  42.389  1.00 55.21  ? 130 ARG B CZ    1 
ATOM   4424  N  NH1   . ARG B  1 130 ? 42.318  -32.664  41.442  1.00 53.11  ? 130 ARG B NH1   1 
ATOM   4425  N  NH2   . ARG B  1 130 ? 43.078  -33.951  43.202  1.00 58.38  ? 130 ARG B NH2   1 
ATOM   4426  N  N     . ALA B  1 131 ? 34.511  -34.007  41.505  1.00 46.07  ? 131 ALA B N     1 
ATOM   4427  C  CA    . ALA B  1 131 ? 33.326  -33.218  41.183  1.00 44.25  ? 131 ALA B CA    1 
ATOM   4428  C  C     . ALA B  1 131 ? 33.731  -32.104  40.211  1.00 44.56  ? 131 ALA B C     1 
ATOM   4429  O  O     . ALA B  1 131 ? 33.087  -31.924  39.184  1.00 44.49  ? 131 ALA B O     1 
ATOM   4430  C  CB    . ALA B  1 131 ? 32.723  -32.631  42.446  1.00 42.76  ? 131 ALA B CB    1 
ATOM   4431  N  N     . GLN B  1 132 ? 34.813  -31.386  40.534  1.00 44.93  ? 132 GLN B N     1 
ATOM   4432  C  CA    . GLN B  1 132 ? 35.293  -30.288  39.709  1.00 45.05  ? 132 GLN B CA    1 
ATOM   4433  C  C     . GLN B  1 132 ? 36.420  -30.731  38.789  1.00 46.66  ? 132 GLN B C     1 
ATOM   4434  O  O     . GLN B  1 132 ? 37.566  -30.917  39.210  1.00 48.04  ? 132 GLN B O     1 
ATOM   4435  C  CB    . GLN B  1 132 ? 35.742  -29.106  40.570  1.00 44.67  ? 132 GLN B CB    1 
ATOM   4436  C  CG    . GLN B  1 132 ? 34.698  -28.624  41.529  1.00 44.00  ? 132 GLN B CG    1 
ATOM   4437  C  CD    . GLN B  1 132 ? 33.544  -27.850  40.889  1.00 44.20  ? 132 GLN B CD    1 
ATOM   4438  O  OE1   . GLN B  1 132 ? 33.666  -27.265  39.806  1.00 44.45  ? 132 GLN B OE1   1 
ATOM   4439  N  NE2   . GLN B  1 132 ? 32.420  -27.815  41.593  1.00 44.46  ? 132 GLN B NE2   1 
ATOM   4440  N  N     . VAL B  1 133 ? 36.090  -30.891  37.519  1.00 47.02  ? 133 VAL B N     1 
ATOM   4441  C  CA    . VAL B  1 133 ? 37.069  -31.338  36.536  1.00 49.09  ? 133 VAL B CA    1 
ATOM   4442  C  C     . VAL B  1 133 ? 37.235  -30.241  35.501  1.00 49.81  ? 133 VAL B C     1 
ATOM   4443  O  O     . VAL B  1 133 ? 36.253  -29.638  35.092  1.00 49.34  ? 133 VAL B O     1 
ATOM   4444  C  CB    . VAL B  1 133 ? 36.605  -32.649  35.853  1.00 49.10  ? 133 VAL B CB    1 
ATOM   4445  C  CG1   . VAL B  1 133 ? 37.505  -32.994  34.691  1.00 50.38  ? 133 VAL B CG1   1 
ATOM   4446  C  CG2   . VAL B  1 133 ? 36.555  -33.788  36.865  1.00 48.91  ? 133 VAL B CG2   1 
ATOM   4447  N  N     . LYS B  1 134 ? 38.458  -29.966  35.065  1.00 51.80  ? 134 LYS B N     1 
ATOM   4448  C  CA    . LYS B  1 134 ? 38.622  -28.865  34.123  1.00 52.78  ? 134 LYS B CA    1 
ATOM   4449  C  C     . LYS B  1 134 ? 38.076  -29.236  32.776  1.00 52.37  ? 134 LYS B C     1 
ATOM   4450  O  O     . LYS B  1 134 ? 38.102  -30.400  32.394  1.00 52.74  ? 134 LYS B O     1 
ATOM   4451  C  CB    . LYS B  1 134 ? 40.060  -28.336  34.004  1.00 54.97  ? 134 LYS B CB    1 
ATOM   4452  C  CG    . LYS B  1 134 ? 40.031  -26.778  33.894  1.00 57.97  ? 134 LYS B CG    1 
ATOM   4453  C  CD    . LYS B  1 134 ? 41.413  -26.084  33.945  1.00 61.86  ? 134 LYS B CD    1 
ATOM   4454  C  CE    . LYS B  1 134 ? 41.297  -24.772  34.723  1.00 61.94  ? 134 LYS B CE    1 
ATOM   4455  N  NZ    . LYS B  1 134 ? 42.569  -23.999  34.756  1.00 64.18  ? 134 LYS B NZ    1 
ATOM   4456  N  N     . ALA B  1 135 ? 37.551  -28.231  32.085  1.00 51.90  ? 135 ALA B N     1 
ATOM   4457  C  CA    . ALA B  1 135 ? 36.977  -28.402  30.761  1.00 51.89  ? 135 ALA B CA    1 
ATOM   4458  C  C     . ALA B  1 135 ? 38.036  -28.812  29.735  1.00 53.60  ? 135 ALA B C     1 
ATOM   4459  O  O     . ALA B  1 135 ? 39.205  -28.398  29.832  1.00 54.66  ? 135 ALA B O     1 
ATOM   4460  C  CB    . ALA B  1 135 ? 36.291  -27.114  30.322  1.00 51.60  ? 135 ALA B CB    1 
ATOM   4461  N  N     . PRO B  1 136 ? 37.632  -29.635  28.755  1.00 53.82  ? 136 PRO B N     1 
ATOM   4462  C  CA    . PRO B  1 136 ? 38.427  -29.861  27.547  1.00 55.74  ? 136 PRO B CA    1 
ATOM   4463  C  C     . PRO B  1 136 ? 38.901  -28.526  26.970  1.00 57.05  ? 136 PRO B C     1 
ATOM   4464  O  O     . PRO B  1 136 ? 38.098  -27.600  26.808  1.00 55.96  ? 136 PRO B O     1 
ATOM   4465  C  CB    . PRO B  1 136 ? 37.423  -30.503  26.598  1.00 55.37  ? 136 PRO B CB    1 
ATOM   4466  C  CG    . PRO B  1 136 ? 36.474  -31.228  27.491  1.00 54.07  ? 136 PRO B CG    1 
ATOM   4467  C  CD    . PRO B  1 136 ? 36.427  -30.487  28.799  1.00 52.51  ? 136 PRO B CD    1 
ATOM   4468  N  N     . GLY B  1 137 ? 40.194  -28.424  26.674  1.00 59.29  ? 137 GLY B N     1 
ATOM   4469  C  CA    . GLY B  1 137 ? 40.767  -27.182  26.161  1.00 60.98  ? 137 GLY B CA    1 
ATOM   4470  C  C     . GLY B  1 137 ? 40.351  -26.802  24.741  1.00 62.72  ? 137 GLY B C     1 
ATOM   4471  O  O     . GLY B  1 137 ? 39.332  -27.281  24.210  1.00 61.39  ? 137 GLY B O     1 
ATOM   4472  N  N     . ILE B  1 138 ? 41.150  -25.927  24.130  1.00 65.16  ? 138 ILE B N     1 
ATOM   4473  C  CA    . ILE B  1 138 ? 40.859  -25.427  22.795  1.00 67.51  ? 138 ILE B CA    1 
ATOM   4474  C  C     . ILE B  1 138 ? 41.128  -26.520  21.760  1.00 69.51  ? 138 ILE B C     1 
ATOM   4475  O  O     . ILE B  1 138 ? 40.383  -26.676  20.783  1.00 70.34  ? 138 ILE B O     1 
ATOM   4476  C  CB    . ILE B  1 138 ? 41.659  -24.133  22.477  1.00 69.56  ? 138 ILE B CB    1 
ATOM   4477  C  CG1   . ILE B  1 138 ? 41.011  -22.914  23.154  1.00 69.23  ? 138 ILE B CG1   1 
ATOM   4478  C  CG2   . ILE B  1 138 ? 41.735  -23.878  20.974  1.00 71.73  ? 138 ILE B CG2   1 
ATOM   4479  C  CD1   . ILE B  1 138 ? 41.403  -22.693  24.632  1.00 69.82  ? 138 ILE B CD1   1 
ATOM   4480  N  N     . LEU B  1 139 ? 42.173  -27.300  22.006  1.00 70.50  ? 139 LEU B N     1 
ATOM   4481  C  CA    . LEU B  1 139 ? 42.633  -28.287  21.040  1.00 72.10  ? 139 LEU B CA    1 
ATOM   4482  C  C     . LEU B  1 139 ? 41.785  -29.568  20.944  1.00 70.95  ? 139 LEU B C     1 
ATOM   4483  O  O     . LEU B  1 139 ? 41.382  -29.925  19.844  1.00 72.24  ? 139 LEU B O     1 
ATOM   4484  C  CB    . LEU B  1 139 ? 44.100  -28.605  21.294  1.00 73.71  ? 139 LEU B CB    1 
ATOM   4485  C  CG    . LEU B  1 139 ? 45.039  -28.696  20.110  1.00 76.46  ? 139 LEU B CG    1 
ATOM   4486  C  CD1   . LEU B  1 139 ? 44.759  -27.622  19.074  1.00 77.09  ? 139 LEU B CD1   1 
ATOM   4487  C  CD2   . LEU B  1 139 ? 46.421  -28.552  20.672  1.00 78.10  ? 139 LEU B CD2   1 
ATOM   4488  N  N     . PRO B  1 140 ? 41.504  -30.257  22.080  1.00 69.06  ? 140 PRO B N     1 
ATOM   4489  C  CA    . PRO B  1 140 ? 40.828  -31.582  22.017  1.00 68.19  ? 140 PRO B CA    1 
ATOM   4490  C  C     . PRO B  1 140 ? 39.357  -31.584  21.551  1.00 66.70  ? 140 PRO B C     1 
ATOM   4491  O  O     . PRO B  1 140 ? 38.638  -32.545  21.811  1.00 66.07  ? 140 PRO B O     1 
ATOM   4492  C  CB    . PRO B  1 140 ? 40.895  -32.095  23.478  1.00 66.47  ? 140 PRO B CB    1 
ATOM   4493  C  CG    . PRO B  1 140 ? 41.769  -31.134  24.236  1.00 66.51  ? 140 PRO B CG    1 
ATOM   4494  C  CD    . PRO B  1 140 ? 41.724  -29.834  23.482  1.00 67.60  ? 140 PRO B CD    1 
ATOM   4495  N  N     . ARG B  1 141 ? 38.914  -30.527  20.878  1.00 66.53  ? 141 ARG B N     1 
ATOM   4496  C  CA    . ARG B  1 141 ? 37.513  -30.399  20.479  1.00 64.77  ? 141 ARG B CA    1 
ATOM   4497  C  C     . ARG B  1 141 ? 37.337  -30.388  18.964  1.00 66.72  ? 141 ARG B C     1 
ATOM   4498  O  O     . ARG B  1 141 ? 38.240  -29.998  18.230  1.00 68.63  ? 141 ARG B O     1 
ATOM   4499  C  CB    . ARG B  1 141 ? 36.927  -29.104  21.033  1.00 63.16  ? 141 ARG B CB    1 
ATOM   4500  C  CG    . ARG B  1 141 ? 36.806  -29.017  22.540  1.00 60.31  ? 141 ARG B CG    1 
ATOM   4501  C  CD    . ARG B  1 141 ? 35.926  -27.833  22.894  1.00 57.50  ? 141 ARG B CD    1 
ATOM   4502  N  NE    . ARG B  1 141 ? 36.091  -27.453  24.280  1.00 55.56  ? 141 ARG B NE    1 
ATOM   4503  C  CZ    . ARG B  1 141 ? 35.121  -27.431  25.183  1.00 52.57  ? 141 ARG B CZ    1 
ATOM   4504  N  NH1   . ARG B  1 141 ? 33.874  -27.742  24.860  1.00 53.27  ? 141 ARG B NH1   1 
ATOM   4505  N  NH2   . ARG B  1 141 ? 35.400  -27.073  26.419  1.00 50.81  ? 141 ARG B NH2   1 
ATOM   4506  N  N     . ARG B  1 142 ? 36.157  -30.794  18.508  1.00 66.05  ? 142 ARG B N     1 
ATOM   4507  C  CA    . ARG B  1 142 ? 35.782  -30.711  17.097  1.00 68.10  ? 142 ARG B CA    1 
ATOM   4508  C  C     . ARG B  1 142 ? 34.333  -30.218  17.013  1.00 66.73  ? 142 ARG B C     1 
ATOM   4509  O  O     . ARG B  1 142 ? 33.529  -30.516  17.895  1.00 64.57  ? 142 ARG B O     1 
ATOM   4510  C  CB    . ARG B  1 142 ? 35.937  -32.088  16.432  1.00 69.59  ? 142 ARG B CB    1 
ATOM   4511  C  CG    . ARG B  1 142 ? 35.437  -32.177  15.012  1.00 72.32  ? 142 ARG B CG    1 
ATOM   4512  C  CD    . ARG B  1 142 ? 34.965  -33.588  14.678  1.00 75.47  ? 142 ARG B CD    1 
ATOM   4513  N  NE    . ARG B  1 142 ? 34.977  -33.875  13.234  1.00 78.80  ? 142 ARG B NE    1 
ATOM   4514  C  CZ    . ARG B  1 142 ? 34.112  -33.373  12.355  1.00 80.30  ? 142 ARG B CZ    1 
ATOM   4515  N  NH1   . ARG B  1 142 ? 33.155  -32.533  12.744  1.00 78.28  ? 142 ARG B NH1   1 
ATOM   4516  N  NH2   . ARG B  1 142 ? 34.212  -33.699  11.073  1.00 84.88  ? 142 ARG B NH2   1 
ATOM   4517  N  N     . SER B  1 143 ? 33.996  -29.460  15.971  1.00 67.98  ? 143 SER B N     1 
ATOM   4518  C  CA    . SER B  1 143 ? 32.626  -28.971  15.823  1.00 67.29  ? 143 SER B CA    1 
ATOM   4519  C  C     . SER B  1 143 ? 31.618  -30.119  15.800  1.00 66.75  ? 143 SER B C     1 
ATOM   4520  O  O     . SER B  1 143 ? 31.903  -31.200  15.283  1.00 68.27  ? 143 SER B O     1 
ATOM   4521  C  CB    . SER B  1 143 ? 32.477  -28.100  14.577  1.00 69.55  ? 143 SER B CB    1 
ATOM   4522  O  OG    . SER B  1 143 ? 33.001  -28.753  13.439  1.00 72.13  ? 143 SER B OG    1 
ATOM   4523  N  N     . VAL B  1 144 ? 30.451  -29.875  16.383  1.00 65.02  ? 144 VAL B N     1 
ATOM   4524  C  CA    . VAL B  1 144 ? 29.391  -30.866  16.468  1.00 64.60  ? 144 VAL B CA    1 
ATOM   4525  C  C     . VAL B  1 144 ? 28.813  -31.119  15.092  1.00 66.93  ? 144 VAL B C     1 
ATOM   4526  O  O     . VAL B  1 144 ? 28.554  -30.187  14.346  1.00 68.45  ? 144 VAL B O     1 
ATOM   4527  C  CB    . VAL B  1 144 ? 28.253  -30.433  17.439  1.00 62.57  ? 144 VAL B CB    1 
ATOM   4528  C  CG1   . VAL B  1 144 ? 28.822  -29.955  18.754  1.00 60.55  ? 144 VAL B CG1   1 
ATOM   4529  C  CG2   . VAL B  1 144 ? 27.374  -29.345  16.825  1.00 63.47  ? 144 VAL B CG2   1 
ATOM   4530  N  N     . HIS B  1 145 ? 28.615  -32.382  14.754  1.00 67.85  ? 145 HIS B N     1 
ATOM   4531  C  CA    . HIS B  1 145 ? 28.092  -32.728  13.445  1.00 70.46  ? 145 HIS B CA    1 
ATOM   4532  C  C     . HIS B  1 145 ? 27.173  -33.937  13.537  1.00 70.31  ? 145 HIS B C     1 
ATOM   4533  O  O     . HIS B  1 145 ? 26.533  -34.303  12.560  1.00 72.17  ? 145 HIS B O     1 
ATOM   4534  C  CB    . HIS B  1 145 ? 29.237  -33.035  12.494  1.00 73.05  ? 145 HIS B CB    1 
ATOM   4535  C  CG    . HIS B  1 145 ? 29.980  -34.284  12.849  1.00 73.49  ? 145 HIS B CG    1 
ATOM   4536  N  ND1   . HIS B  1 145 ? 31.016  -34.299  13.758  1.00 72.51  ? 145 HIS B ND1   1 
ATOM   4537  C  CD2   . HIS B  1 145 ? 29.824  -35.563  12.434  1.00 74.55  ? 145 HIS B CD2   1 
ATOM   4538  C  CE1   . HIS B  1 145 ? 31.475  -35.532  13.880  1.00 72.47  ? 145 HIS B CE1   1 
ATOM   4539  N  NE2   . HIS B  1 145 ? 30.768  -36.317  13.089  1.00 74.14  ? 145 HIS B NE2   1 
ATOM   4540  N  N     . GLU B  1 146 ? 27.105  -34.548  14.718  1.00 68.24  ? 146 GLU B N     1 
ATOM   4541  C  CA    . GLU B  1 146 ? 26.278  -35.734  14.921  1.00 67.63  ? 146 GLU B CA    1 
ATOM   4542  C  C     . GLU B  1 146 ? 24.981  -35.327  15.592  1.00 65.97  ? 146 GLU B C     1 
ATOM   4543  O  O     . GLU B  1 146 ? 25.006  -34.640  16.602  1.00 63.89  ? 146 GLU B O     1 
ATOM   4544  C  CB    . GLU B  1 146 ? 27.023  -36.759  15.761  1.00 66.43  ? 146 GLU B CB    1 
ATOM   4545  C  CG    . GLU B  1 146 ? 28.290  -37.267  15.107  1.00 68.12  ? 146 GLU B CG    1 
ATOM   4546  C  CD    . GLU B  1 146 ? 29.189  -37.994  16.077  1.00 68.10  ? 146 GLU B CD    1 
ATOM   4547  O  OE1   . GLU B  1 146 ? 29.616  -37.374  17.070  1.00 66.61  ? 146 GLU B OE1   1 
ATOM   4548  O  OE2   . GLU B  1 146 ? 29.468  -39.195  15.852  1.00 70.96  ? 146 GLU B OE2   1 
ATOM   4549  N  N     . PRO B  1 147 ? 23.836  -35.729  15.019  1.00 67.22  ? 147 PRO B N     1 
ATOM   4550  C  CA    . PRO B  1 147 ? 22.536  -35.349  15.583  1.00 66.15  ? 147 PRO B CA    1 
ATOM   4551  C  C     . PRO B  1 147 ? 22.242  -35.928  16.967  1.00 64.16  ? 147 PRO B C     1 
ATOM   4552  O  O     . PRO B  1 147 ? 22.552  -37.094  17.242  1.00 64.30  ? 147 PRO B O     1 
ATOM   4553  C  CB    . PRO B  1 147 ? 21.541  -35.932  14.579  1.00 68.53  ? 147 PRO B CB    1 
ATOM   4554  C  CG    . PRO B  1 147 ? 22.292  -36.967  13.818  1.00 70.03  ? 147 PRO B CG    1 
ATOM   4555  C  CD    . PRO B  1 147 ? 23.695  -36.499  13.770  1.00 69.67  ? 147 PRO B CD    1 
ATOM   4556  N  N     . VAL B  1 148 ? 21.661  -35.110  17.838  1.00 62.49  ? 148 VAL B N     1 
ATOM   4557  C  CA    . VAL B  1 148 ? 20.933  -35.640  18.978  1.00 61.03  ? 148 VAL B CA    1 
ATOM   4558  C  C     . VAL B  1 148 ? 19.464  -35.582  18.593  1.00 62.36  ? 148 VAL B C     1 
ATOM   4559  O  O     . VAL B  1 148 ? 18.888  -34.497  18.587  1.00 62.38  ? 148 VAL B O     1 
ATOM   4560  C  CB    . VAL B  1 148 ? 21.174  -34.837  20.263  1.00 58.45  ? 148 VAL B CB    1 
ATOM   4561  C  CG1   . VAL B  1 148 ? 20.198  -35.276  21.364  1.00 57.35  ? 148 VAL B CG1   1 
ATOM   4562  C  CG2   . VAL B  1 148 ? 22.604  -35.022  20.744  1.00 57.54  ? 148 VAL B CG2   1 
ATOM   4563  N  N     . GLN B  1 149 ? 18.873  -36.736  18.256  1.00 63.81  ? 149 GLN B N     1 
ATOM   4564  C  CA    . GLN B  1 149 ? 17.468  -36.809  17.824  1.00 65.48  ? 149 GLN B CA    1 
ATOM   4565  C  C     . GLN B  1 149 ? 16.486  -36.731  18.980  1.00 63.67  ? 149 GLN B C     1 
ATOM   4566  O  O     . GLN B  1 149 ? 16.455  -37.613  19.834  1.00 62.70  ? 149 GLN B O     1 
ATOM   4567  C  CB    . GLN B  1 149 ? 17.198  -38.088  17.024  1.00 68.18  ? 149 GLN B CB    1 
ATOM   4568  C  CG    . GLN B  1 149 ? 17.710  -38.072  15.586  1.00 72.55  ? 149 GLN B CG    1 
ATOM   4569  C  CD    . GLN B  1 149 ? 17.557  -36.711  14.933  1.00 76.11  ? 149 GLN B CD    1 
ATOM   4570  O  OE1   . GLN B  1 149 ? 16.498  -36.366  14.386  1.00 78.92  ? 149 GLN B OE1   1 
ATOM   4571  N  NE2   . GLN B  1 149 ? 18.621  -35.920  14.996  1.00 76.39  ? 149 GLN B NE2   1 
ATOM   4572  N  N     . THR B  1 150 ? 15.669  -35.686  19.004  1.00 63.31  ? 150 THR B N     1 
ATOM   4573  C  CA    . THR B  1 150 ? 14.763  -35.496  20.135  1.00 61.92  ? 150 THR B CA    1 
ATOM   4574  C  C     . THR B  1 150 ? 13.458  -36.250  19.943  1.00 63.54  ? 150 THR B C     1 
ATOM   4575  O  O     . THR B  1 150 ? 12.840  -36.702  20.912  1.00 62.63  ? 150 THR B O     1 
ATOM   4576  C  CB    . THR B  1 150 ? 14.472  -34.005  20.423  1.00 60.94  ? 150 THR B CB    1 
ATOM   4577  O  OG1   . THR B  1 150 ? 13.583  -33.479  19.429  1.00 63.01  ? 150 THR B OG1   1 
ATOM   4578  C  CG2   . THR B  1 150 ? 15.756  -33.214  20.428  1.00 59.57  ? 150 THR B CG2   1 
ATOM   4579  N  N     . GLY B  1 151 ? 13.051  -36.382  18.684  1.00 65.95  ? 151 GLY B N     1 
ATOM   4580  C  CA    . GLY B  1 151 ? 11.779  -37.003  18.339  1.00 68.15  ? 151 GLY B CA    1 
ATOM   4581  C  C     . GLY B  1 151 ? 10.653  -36.000  18.441  1.00 68.84  ? 151 GLY B C     1 
ATOM   4582  O  O     . GLY B  1 151 ? 9.488   -36.360  18.333  1.00 70.73  ? 151 GLY B O     1 
ATOM   4583  N  N     . LEU B  1 152 ? 11.013  -34.739  18.673  1.00 67.60  ? 152 LEU B N     1 
ATOM   4584  C  CA    . LEU B  1 152 ? 10.065  -33.645  18.712  1.00 68.06  ? 152 LEU B CA    1 
ATOM   4585  C  C     . LEU B  1 152 ? 10.114  -32.896  17.394  1.00 70.11  ? 152 LEU B C     1 
ATOM   4586  O  O     . LEU B  1 152 ? 11.157  -32.342  17.019  1.00 69.46  ? 152 LEU B O     1 
ATOM   4587  C  CB    . LEU B  1 152 ? 10.421  -32.694  19.838  1.00 65.51  ? 152 LEU B CB    1 
ATOM   4588  C  CG    . LEU B  1 152 ? 10.192  -33.203  21.247  1.00 63.96  ? 152 LEU B CG    1 
ATOM   4589  C  CD1   . LEU B  1 152 ? 11.040  -32.379  22.205  1.00 61.47  ? 152 LEU B CD1   1 
ATOM   4590  C  CD2   . LEU B  1 152 ? 8.709   -33.116  21.591  1.00 65.00  ? 152 LEU B CD2   1 
ATOM   4591  N  N     . LYS B  1 153 ? 8.984   -32.876  16.697  1.00 72.62  ? 153 LYS B N     1 
ATOM   4592  C  CA    . LYS B  1 153 ? 8.899   -32.241  15.386  1.00 75.00  ? 153 LYS B CA    1 
ATOM   4593  C  C     . LYS B  1 153 ? 9.484   -30.838  15.362  1.00 73.90  ? 153 LYS B C     1 
ATOM   4594  O  O     . LYS B  1 153 ? 10.227  -30.495  14.446  1.00 74.81  ? 153 LYS B O     1 
ATOM   4595  C  CB    . LYS B  1 153 ? 7.456   -32.209  14.891  1.00 77.81  ? 153 LYS B CB    1 
ATOM   4596  C  CG    . LYS B  1 153 ? 7.044   -33.420  14.077  1.00 80.22  ? 153 LYS B CG    1 
ATOM   4597  C  CD    . LYS B  1 153 ? 5.544   -33.425  13.852  1.00 83.19  ? 153 LYS B CD    1 
ATOM   4598  C  CE    . LYS B  1 153 ? 4.789   -33.467  15.181  1.00 82.15  ? 153 LYS B CE    1 
ATOM   4599  N  NZ    . LYS B  1 153 ? 3.311   -33.369  14.996  1.00 84.78  ? 153 LYS B NZ    1 
ATOM   4600  N  N     . ALA B  1 154 ? 9.157   -30.035  16.370  1.00 72.01  ? 154 ALA B N     1 
ATOM   4601  C  CA    . ALA B  1 154 ? 9.546   -28.628  16.361  1.00 71.40  ? 154 ALA B CA    1 
ATOM   4602  C  C     . ALA B  1 154 ? 11.032  -28.433  16.635  1.00 69.27  ? 154 ALA B C     1 
ATOM   4603  O  O     . ALA B  1 154 ? 11.663  -27.527  16.099  1.00 69.42  ? 154 ALA B O     1 
ATOM   4604  C  CB    . ALA B  1 154 ? 8.702   -27.838  17.341  1.00 70.23  ? 154 ALA B CB    1 
ATOM   4605  N  N     . VAL B  1 155 ? 11.593  -29.298  17.466  1.00 67.73  ? 155 VAL B N     1 
ATOM   4606  C  CA    . VAL B  1 155 ? 12.983  -29.140  17.891  1.00 65.94  ? 155 VAL B CA    1 
ATOM   4607  C  C     . VAL B  1 155 ? 13.930  -29.649  16.817  1.00 67.31  ? 155 VAL B C     1 
ATOM   4608  O  O     . VAL B  1 155 ? 14.938  -29.001  16.522  1.00 66.92  ? 155 VAL B O     1 
ATOM   4609  C  CB    . VAL B  1 155 ? 13.280  -29.873  19.222  1.00 63.16  ? 155 VAL B CB    1 
ATOM   4610  C  CG1   . VAL B  1 155 ? 14.746  -29.783  19.561  1.00 61.27  ? 155 VAL B CG1   1 
ATOM   4611  C  CG2   . VAL B  1 155 ? 12.467  -29.288  20.330  1.00 62.18  ? 155 VAL B CG2   1 
ATOM   4612  N  N     . ASP B  1 156 ? 13.598  -30.810  16.250  1.00 68.76  ? 156 ASP B N     1 
ATOM   4613  C  CA    . ASP B  1 156 ? 14.448  -31.459  15.265  1.00 70.26  ? 156 ASP B CA    1 
ATOM   4614  C  C     . ASP B  1 156 ? 14.462  -30.684  13.970  1.00 72.65  ? 156 ASP B C     1 
ATOM   4615  O  O     . ASP B  1 156 ? 15.457  -30.693  13.257  1.00 73.55  ? 156 ASP B O     1 
ATOM   4616  C  CB    . ASP B  1 156 ? 13.985  -32.894  15.004  1.00 71.57  ? 156 ASP B CB    1 
ATOM   4617  C  CG    . ASP B  1 156 ? 14.436  -33.868  16.087  1.00 69.76  ? 156 ASP B CG    1 
ATOM   4618  O  OD1   . ASP B  1 156 ? 15.164  -33.450  17.034  1.00 66.85  ? 156 ASP B OD1   1 
ATOM   4619  O  OD2   . ASP B  1 156 ? 14.058  -35.057  15.974  1.00 69.47  ? 156 ASP B OD2   1 
ATOM   4620  N  N     . ALA B  1 157 ? 13.355  -30.009  13.680  1.00 74.16  ? 157 ALA B N     1 
ATOM   4621  C  CA    . ALA B  1 157 ? 13.208  -29.290  12.428  1.00 77.08  ? 157 ALA B CA    1 
ATOM   4622  C  C     . ALA B  1 157 ? 13.759  -27.881  12.527  1.00 76.70  ? 157 ALA B C     1 
ATOM   4623  O  O     . ALA B  1 157 ? 14.288  -27.349  11.544  1.00 78.62  ? 157 ALA B O     1 
ATOM   4624  C  CB    . ALA B  1 157 ? 11.763  -29.255  12.011  1.00 79.15  ? 157 ALA B CB    1 
ATOM   4625  N  N     . LEU B  1 158 ? 13.649  -27.284  13.714  1.00 74.48  ? 158 LEU B N     1 
ATOM   4626  C  CA    . LEU B  1 158 ? 13.901  -25.852  13.868  1.00 74.14  ? 158 LEU B CA    1 
ATOM   4627  C  C     . LEU B  1 158 ? 14.976  -25.447  14.888  1.00 71.52  ? 158 LEU B C     1 
ATOM   4628  O  O     . LEU B  1 158 ? 15.549  -24.360  14.790  1.00 71.77  ? 158 LEU B O     1 
ATOM   4629  C  CB    . LEU B  1 158 ? 12.590  -25.130  14.169  1.00 74.72  ? 158 LEU B CB    1 
ATOM   4630  C  CG    . LEU B  1 158 ? 11.451  -25.288  13.158  1.00 78.02  ? 158 LEU B CG    1 
ATOM   4631  C  CD1   . LEU B  1 158 ? 10.196  -24.608  13.684  1.00 78.78  ? 158 LEU B CD1   1 
ATOM   4632  C  CD2   . LEU B  1 158 ? 11.841  -24.734  11.791  1.00 80.34  ? 158 LEU B CD2   1 
ATOM   4633  N  N     . VAL B  1 159 ? 15.242  -26.295  15.871  1.00 69.34  ? 159 VAL B N     1 
ATOM   4634  C  CA    . VAL B  1 159 ? 16.356  -26.040  16.785  1.00 67.18  ? 159 VAL B CA    1 
ATOM   4635  C  C     . VAL B  1 159 ? 17.201  -27.306  16.968  1.00 66.17  ? 159 VAL B C     1 
ATOM   4636  O  O     . VAL B  1 159 ? 17.339  -27.810  18.097  1.00 63.90  ? 159 VAL B O     1 
ATOM   4637  C  CB    . VAL B  1 159 ? 15.883  -25.453  18.145  1.00 65.21  ? 159 VAL B CB    1 
ATOM   4638  C  CG1   . VAL B  1 159 ? 16.106  -23.982  18.174  1.00 65.88  ? 159 VAL B CG1   1 
ATOM   4639  C  CG2   . VAL B  1 159 ? 14.408  -25.714  18.374  1.00 66.49  ? 159 VAL B CG2   1 
ATOM   4640  N  N     . PRO B  1 160 ? 17.750  -27.839  15.845  1.00 67.71  ? 160 PRO B N     1 
ATOM   4641  C  CA    . PRO B  1 160 ? 18.482  -29.095  15.871  1.00 67.07  ? 160 PRO B CA    1 
ATOM   4642  C  C     . PRO B  1 160 ? 19.682  -29.036  16.803  1.00 64.71  ? 160 PRO B C     1 
ATOM   4643  O  O     . PRO B  1 160 ? 20.463  -28.079  16.762  1.00 64.46  ? 160 PRO B O     1 
ATOM   4644  C  CB    . PRO B  1 160 ? 18.922  -29.287  14.415  1.00 69.63  ? 160 PRO B CB    1 
ATOM   4645  C  CG    . PRO B  1 160 ? 18.858  -27.948  13.811  1.00 71.05  ? 160 PRO B CG    1 
ATOM   4646  C  CD    . PRO B  1 160 ? 17.702  -27.288  14.479  1.00 70.43  ? 160 PRO B CD    1 
ATOM   4647  N  N     . ILE B  1 161 ? 19.790  -30.068  17.636  1.00 62.86  ? 161 ILE B N     1 
ATOM   4648  C  CA    . ILE B  1 161 ? 20.804  -30.171  18.653  1.00 60.75  ? 161 ILE B CA    1 
ATOM   4649  C  C     . ILE B  1 161 ? 21.829  -31.178  18.160  1.00 61.36  ? 161 ILE B C     1 
ATOM   4650  O  O     . ILE B  1 161 ? 21.459  -32.241  17.685  1.00 62.86  ? 161 ILE B O     1 
ATOM   4651  C  CB    . ILE B  1 161 ? 20.179  -30.662  19.984  1.00 59.02  ? 161 ILE B CB    1 
ATOM   4652  C  CG1   . ILE B  1 161 ? 18.982  -29.783  20.379  1.00 58.86  ? 161 ILE B CG1   1 
ATOM   4653  C  CG2   . ILE B  1 161 ? 21.221  -30.692  21.114  1.00 57.38  ? 161 ILE B CG2   1 
ATOM   4654  C  CD1   . ILE B  1 161 ? 18.059  -30.404  21.419  1.00 56.34  ? 161 ILE B CD1   1 
ATOM   4655  N  N     . GLY B  1 162 ? 23.111  -30.845  18.267  1.00 60.69  ? 162 GLY B N     1 
ATOM   4656  C  CA    . GLY B  1 162 ? 24.183  -31.750  17.867  1.00 61.25  ? 162 GLY B CA    1 
ATOM   4657  C  C     . GLY B  1 162 ? 24.938  -32.313  19.055  1.00 59.31  ? 162 GLY B C     1 
ATOM   4658  O  O     . GLY B  1 162 ? 25.005  -31.673  20.087  1.00 57.88  ? 162 GLY B O     1 
ATOM   4659  N  N     . ARG B  1 163 ? 25.504  -33.512  18.911  1.00 59.86  ? 163 ARG B N     1 
ATOM   4660  C  CA    . ARG B  1 163 ? 26.235  -34.170  19.993  1.00 58.34  ? 163 ARG B CA    1 
ATOM   4661  C  C     . ARG B  1 163 ? 27.461  -33.378  20.419  1.00 58.00  ? 163 ARG B C     1 
ATOM   4662  O  O     . ARG B  1 163 ? 28.419  -33.237  19.665  1.00 59.43  ? 163 ARG B O     1 
ATOM   4663  C  CB    . ARG B  1 163 ? 26.625  -35.600  19.614  1.00 59.56  ? 163 ARG B CB    1 
ATOM   4664  C  CG    . ARG B  1 163 ? 25.430  -36.509  19.355  1.00 59.84  ? 163 ARG B CG    1 
ATOM   4665  C  CD    . ARG B  1 163 ? 25.747  -37.992  19.244  1.00 58.38  ? 163 ARG B CD    1 
ATOM   4666  N  NE    . ARG B  1 163 ? 24.480  -38.714  19.201  1.00 58.80  ? 163 ARG B NE    1 
ATOM   4667  C  CZ    . ARG B  1 163 ? 24.313  -40.009  19.450  1.00 58.91  ? 163 ARG B CZ    1 
ATOM   4668  N  NH1   . ARG B  1 163 ? 25.345  -40.785  19.750  1.00 59.21  ? 163 ARG B NH1   1 
ATOM   4669  N  NH2   . ARG B  1 163 ? 23.094  -40.528  19.397  1.00 58.72  ? 163 ARG B NH2   1 
ATOM   4670  N  N     . GLY B  1 164 ? 27.408  -32.853  21.641  1.00 56.40  ? 164 GLY B N     1 
ATOM   4671  C  CA    . GLY B  1 164 ? 28.485  -32.038  22.190  1.00 56.02  ? 164 GLY B CA    1 
ATOM   4672  C  C     . GLY B  1 164 ? 28.025  -30.628  22.493  1.00 55.40  ? 164 GLY B C     1 
ATOM   4673  O  O     . GLY B  1 164 ? 28.676  -29.902  23.242  1.00 54.82  ? 164 GLY B O     1 
ATOM   4674  N  N     . GLN B  1 165 ? 26.890  -30.256  21.911  1.00 55.86  ? 165 GLN B N     1 
ATOM   4675  C  CA    . GLN B  1 165 ? 26.285  -28.954  22.083  1.00 55.34  ? 165 GLN B CA    1 
ATOM   4676  C  C     . GLN B  1 165 ? 25.789  -28.740  23.511  1.00 53.68  ? 165 GLN B C     1 
ATOM   4677  O  O     . GLN B  1 165 ? 25.724  -29.672  24.332  1.00 52.70  ? 165 GLN B O     1 
ATOM   4678  C  CB    . GLN B  1 165 ? 25.110  -28.827  21.127  1.00 56.44  ? 165 GLN B CB    1 
ATOM   4679  C  CG    . GLN B  1 165 ? 24.461  -27.463  21.083  1.00 57.30  ? 165 GLN B CG    1 
ATOM   4680  C  CD    . GLN B  1 165 ? 23.513  -27.318  19.907  1.00 59.99  ? 165 GLN B CD    1 
ATOM   4681  O  OE1   . GLN B  1 165 ? 23.229  -28.292  19.210  1.00 61.97  ? 165 GLN B OE1   1 
ATOM   4682  N  NE2   . GLN B  1 165 ? 23.028  -26.098  19.672  1.00 59.94  ? 165 GLN B NE2   1 
ATOM   4683  N  N     . ARG B  1 166 ? 25.462  -27.485  23.799  1.00 53.25  ? 166 ARG B N     1 
ATOM   4684  C  CA    . ARG B  1 166 ? 24.743  -27.115  24.993  1.00 51.51  ? 166 ARG B CA    1 
ATOM   4685  C  C     . ARG B  1 166 ? 23.569  -26.283  24.504  1.00 52.36  ? 166 ARG B C     1 
ATOM   4686  O  O     . ARG B  1 166 ? 23.737  -25.364  23.690  1.00 53.99  ? 166 ARG B O     1 
ATOM   4687  C  CB    . ARG B  1 166 ? 25.682  -26.363  25.922  1.00 50.50  ? 166 ARG B CB    1 
ATOM   4688  C  CG    . ARG B  1 166 ? 26.857  -27.265  26.283  1.00 50.63  ? 166 ARG B CG    1 
ATOM   4689  C  CD    . ARG B  1 166 ? 28.210  -26.605  26.394  1.00 49.61  ? 166 ARG B CD    1 
ATOM   4690  N  NE    . ARG B  1 166 ? 28.442  -25.538  25.451  1.00 49.72  ? 166 ARG B NE    1 
ATOM   4691  C  CZ    . ARG B  1 166 ? 29.111  -24.442  25.781  1.00 51.78  ? 166 ARG B CZ    1 
ATOM   4692  N  NH1   . ARG B  1 166 ? 29.580  -24.318  27.018  1.00 51.18  ? 166 ARG B NH1   1 
ATOM   4693  N  NH2   . ARG B  1 166 ? 29.307  -23.464  24.900  1.00 52.99  ? 166 ARG B NH2   1 
ATOM   4694  N  N     . GLU B  1 167 ? 22.374  -26.657  24.941  1.00 51.54  ? 167 GLU B N     1 
ATOM   4695  C  CA    . GLU B  1 167 ? 21.143  -26.006  24.513  1.00 51.96  ? 167 GLU B CA    1 
ATOM   4696  C  C     . GLU B  1 167 ? 20.268  -25.837  25.740  1.00 50.30  ? 167 GLU B C     1 
ATOM   4697  O  O     . GLU B  1 167 ? 19.973  -26.802  26.435  1.00 49.91  ? 167 GLU B O     1 
ATOM   4698  C  CB    . GLU B  1 167 ? 20.436  -26.848  23.451  1.00 53.61  ? 167 GLU B CB    1 
ATOM   4699  C  CG    . GLU B  1 167 ? 19.172  -26.234  22.843  1.00 55.39  ? 167 GLU B CG    1 
ATOM   4700  C  CD    . GLU B  1 167 ? 19.441  -25.082  21.872  1.00 57.86  ? 167 GLU B CD    1 
ATOM   4701  O  OE1   . GLU B  1 167 ? 20.612  -24.688  21.669  1.00 57.38  ? 167 GLU B OE1   1 
ATOM   4702  O  OE2   . GLU B  1 167 ? 18.457  -24.558  21.310  1.00 60.04  ? 167 GLU B OE2   1 
ATOM   4703  N  N     . LEU B  1 168 ? 19.888  -24.598  26.010  1.00 49.55  ? 168 LEU B N     1 
ATOM   4704  C  CA    . LEU B  1 168 ? 19.145  -24.248  27.193  1.00 47.94  ? 168 LEU B CA    1 
ATOM   4705  C  C     . LEU B  1 168 ? 17.674  -24.505  26.961  1.00 48.60  ? 168 LEU B C     1 
ATOM   4706  O  O     . LEU B  1 168 ? 17.130  -24.106  25.948  1.00 50.76  ? 168 LEU B O     1 
ATOM   4707  C  CB    . LEU B  1 168 ? 19.372  -22.763  27.498  1.00 47.77  ? 168 LEU B CB    1 
ATOM   4708  C  CG    . LEU B  1 168 ? 18.601  -22.130  28.660  1.00 46.43  ? 168 LEU B CG    1 
ATOM   4709  C  CD1   . LEU B  1 168 ? 18.870  -22.834  29.971  1.00 44.56  ? 168 LEU B CD1   1 
ATOM   4710  C  CD2   . LEU B  1 168 ? 18.939  -20.673  28.763  1.00 45.20  ? 168 LEU B CD2   1 
ATOM   4711  N  N     . ILE B  1 169 ? 17.017  -25.177  27.886  1.00 47.47  ? 169 ILE B N     1 
ATOM   4712  C  CA    . ILE B  1 169 ? 15.571  -25.194  27.859  1.00 47.88  ? 169 ILE B CA    1 
ATOM   4713  C  C     . ILE B  1 169 ? 15.126  -24.148  28.873  1.00 47.38  ? 169 ILE B C     1 
ATOM   4714  O  O     . ILE B  1 169 ? 15.405  -24.293  30.062  1.00 46.14  ? 169 ILE B O     1 
ATOM   4715  C  CB    . ILE B  1 169 ? 15.013  -26.568  28.213  1.00 47.61  ? 169 ILE B CB    1 
ATOM   4716  C  CG1   . ILE B  1 169 ? 15.528  -27.620  27.227  1.00 47.11  ? 169 ILE B CG1   1 
ATOM   4717  C  CG2   . ILE B  1 169 ? 13.500  -26.525  28.237  1.00 48.42  ? 169 ILE B CG2   1 
ATOM   4718  C  CD1   . ILE B  1 169 ? 15.134  -29.008  27.585  1.00 44.77  ? 169 ILE B CD1   1 
ATOM   4719  N  N     . ILE B  1 170 ? 14.467  -23.090  28.401  1.00 48.28  ? 170 ILE B N     1 
ATOM   4720  C  CA    . ILE B  1 170 ? 14.086  -21.975  29.265  1.00 47.88  ? 170 ILE B CA    1 
ATOM   4721  C  C     . ILE B  1 170 ? 12.616  -21.542  29.110  1.00 49.70  ? 170 ILE B C     1 
ATOM   4722  O  O     . ILE B  1 170 ? 12.070  -21.554  28.008  1.00 51.49  ? 170 ILE B O     1 
ATOM   4723  C  CB    . ILE B  1 170 ? 15.050  -20.750  29.095  1.00 47.74  ? 170 ILE B CB    1 
ATOM   4724  C  CG1   . ILE B  1 170 ? 14.667  -19.623  30.064  1.00 46.54  ? 170 ILE B CG1   1 
ATOM   4725  C  CG2   . ILE B  1 170 ? 15.098  -20.270  27.644  1.00 48.24  ? 170 ILE B CG2   1 
ATOM   4726  C  CD1   . ILE B  1 170 ? 15.498  -18.363  29.932  1.00 47.44  ? 170 ILE B CD1   1 
ATOM   4727  N  N     . GLY B  1 171 ? 11.996  -21.150  30.223  1.00 49.08  ? 171 GLY B N     1 
ATOM   4728  C  CA    . GLY B  1 171 ? 10.630  -20.639  30.218  1.00 50.47  ? 171 GLY B CA    1 
ATOM   4729  C  C     . GLY B  1 171 ? 10.038  -20.592  31.609  1.00 49.82  ? 171 GLY B C     1 
ATOM   4730  O  O     . GLY B  1 171 ? 10.673  -20.997  32.577  1.00 48.09  ? 171 GLY B O     1 
ATOM   4731  N  N     . ASP B  1 172 ? 8.813   -20.098  31.716  1.00 51.54  ? 172 ASP B N     1 
ATOM   4732  C  CA    . ASP B  1 172 ? 8.153   -20.011  33.012  1.00 51.67  ? 172 ASP B CA    1 
ATOM   4733  C  C     . ASP B  1 172 ? 7.846   -21.366  33.660  1.00 51.24  ? 172 ASP B C     1 
ATOM   4734  O  O     . ASP B  1 172 ? 8.151   -22.420  33.118  1.00 51.02  ? 172 ASP B O     1 
ATOM   4735  C  CB    . ASP B  1 172 ? 6.872   -19.195  32.897  1.00 53.52  ? 172 ASP B CB    1 
ATOM   4736  C  CG    . ASP B  1 172 ? 7.129   -17.702  32.805  1.00 55.49  ? 172 ASP B CG    1 
ATOM   4737  O  OD1   . ASP B  1 172 ? 8.310   -17.268  32.920  1.00 54.35  ? 172 ASP B OD1   1 
ATOM   4738  O  OD2   . ASP B  1 172 ? 6.126   -16.961  32.618  1.00 58.28  ? 172 ASP B OD2   1 
ATOM   4739  N  N     . ARG B  1 173 ? 7.256   -21.299  34.849  1.00 51.41  ? 173 ARG B N     1 
ATOM   4740  C  CA    . ARG B  1 173 ? 6.729   -22.442  35.562  1.00 51.21  ? 173 ARG B CA    1 
ATOM   4741  C  C     . ARG B  1 173 ? 5.730   -23.124  34.668  1.00 52.58  ? 173 ARG B C     1 
ATOM   4742  O  O     . ARG B  1 173 ? 5.019   -22.458  33.914  1.00 54.24  ? 173 ARG B O     1 
ATOM   4743  C  CB    . ARG B  1 173 ? 6.005   -21.959  36.812  1.00 51.54  ? 173 ARG B CB    1 
ATOM   4744  C  CG    . ARG B  1 173 ? 6.111   -22.907  37.969  1.00 53.32  ? 173 ARG B CG    1 
ATOM   4745  C  CD    . ARG B  1 173 ? 5.211   -22.489  39.132  1.00 57.52  ? 173 ARG B CD    1 
ATOM   4746  N  NE    . ARG B  1 173 ? 4.384   -23.631  39.515  1.00 60.26  ? 173 ARG B NE    1 
ATOM   4747  C  CZ    . ARG B  1 173 ? 3.103   -23.749  39.196  1.00 63.13  ? 173 ARG B CZ    1 
ATOM   4748  N  NH1   . ARG B  1 173 ? 2.498   -22.770  38.534  1.00 64.93  ? 173 ARG B NH1   1 
ATOM   4749  N  NH2   . ARG B  1 173 ? 2.424   -24.831  39.550  1.00 64.83  ? 173 ARG B NH2   1 
ATOM   4750  N  N     . GLN B  1 174 ? 5.687   -24.449  34.758  1.00 52.07  ? 174 GLN B N     1 
ATOM   4751  C  CA    . GLN B  1 174 ? 4.699   -25.282  34.070  1.00 53.47  ? 174 GLN B CA    1 
ATOM   4752  C  C     . GLN B  1 174 ? 4.477   -24.936  32.582  1.00 54.91  ? 174 GLN B C     1 
ATOM   4753  O  O     . GLN B  1 174 ? 3.350   -24.674  32.145  1.00 57.38  ? 174 GLN B O     1 
ATOM   4754  C  CB    . GLN B  1 174 ? 3.398   -25.296  34.864  1.00 54.62  ? 174 GLN B CB    1 
ATOM   4755  C  CG    . GLN B  1 174 ? 3.488   -26.070  36.167  1.00 54.41  ? 174 GLN B CG    1 
ATOM   4756  C  CD    . GLN B  1 174 ? 3.375   -27.594  35.977  1.00 56.81  ? 174 GLN B CD    1 
ATOM   4757  O  OE1   . GLN B  1 174 ? 2.499   -28.090  35.249  1.00 59.22  ? 174 GLN B OE1   1 
ATOM   4758  N  NE2   . GLN B  1 174 ? 4.246   -28.341  36.656  1.00 54.32  ? 174 GLN B NE2   1 
ATOM   4759  N  N     . THR B  1 175 ? 5.565   -24.947  31.818  1.00 53.64  ? 175 THR B N     1 
ATOM   4760  C  CA    . THR B  1 175 ? 5.531   -24.692  30.382  1.00 54.92  ? 175 THR B CA    1 
ATOM   4761  C  C     . THR B  1 175 ? 6.082   -25.846  29.500  1.00 55.35  ? 175 THR B C     1 
ATOM   4762  O  O     . THR B  1 175 ? 6.202   -25.700  28.280  1.00 56.43  ? 175 THR B O     1 
ATOM   4763  C  CB    . THR B  1 175 ? 6.234   -23.370  30.024  1.00 54.51  ? 175 THR B CB    1 
ATOM   4764  O  OG1   . THR B  1 175 ? 7.542   -23.329  30.612  1.00 51.71  ? 175 THR B OG1   1 
ATOM   4765  C  CG2   . THR B  1 175 ? 5.428   -22.207  30.522  1.00 55.22  ? 175 THR B CG2   1 
ATOM   4766  N  N     . GLY B  1 176 ? 6.401   -26.984  30.115  1.00 54.37  ? 176 GLY B N     1 
ATOM   4767  C  CA    . GLY B  1 176 ? 6.788   -28.177  29.375  1.00 54.86  ? 176 GLY B CA    1 
ATOM   4768  C  C     . GLY B  1 176 ? 8.284   -28.362  29.256  1.00 53.46  ? 176 GLY B C     1 
ATOM   4769  O  O     . GLY B  1 176 ? 8.754   -29.154  28.445  1.00 54.28  ? 176 GLY B O     1 
ATOM   4770  N  N     . LYS B  1 177 ? 9.045   -27.631  30.056  1.00 51.77  ? 177 LYS B N     1 
ATOM   4771  C  CA    . LYS B  1 177 ? 10.496  -27.719  29.994  1.00 50.27  ? 177 LYS B CA    1 
ATOM   4772  C  C     . LYS B  1 177 ? 10.983  -29.157  30.182  1.00 50.09  ? 177 LYS B C     1 
ATOM   4773  O  O     . LYS B  1 177 ? 11.775  -29.663  29.382  1.00 50.25  ? 177 LYS B O     1 
ATOM   4774  C  CB    . LYS B  1 177 ? 11.142  -26.774  31.019  1.00 48.41  ? 177 LYS B CB    1 
ATOM   4775  C  CG    . LYS B  1 177 ? 10.834  -25.285  30.773  1.00 47.95  ? 177 LYS B CG    1 
ATOM   4776  C  CD    . LYS B  1 177 ? 11.612  -24.363  31.693  1.00 44.18  ? 177 LYS B CD    1 
ATOM   4777  C  CE    . LYS B  1 177 ? 11.300  -24.612  33.141  1.00 40.71  ? 177 LYS B CE    1 
ATOM   4778  N  NZ    . LYS B  1 177 ? 9.912   -24.273  33.385  1.00 42.50  ? 177 LYS B NZ    1 
ATOM   4779  N  N     . THR B  1 178 ? 10.491  -29.817  31.226  1.00 49.85  ? 178 THR B N     1 
ATOM   4780  C  CA    . THR B  1 178 ? 10.968  -31.145  31.578  1.00 50.11  ? 178 THR B CA    1 
ATOM   4781  C  C     . THR B  1 178 ? 10.541  -32.142  30.509  1.00 51.02  ? 178 THR B C     1 
ATOM   4782  O  O     . THR B  1 178 ? 11.336  -32.977  30.084  1.00 50.67  ? 178 THR B O     1 
ATOM   4783  C  CB    . THR B  1 178 ? 10.509  -31.544  32.998  1.00 49.34  ? 178 THR B CB    1 
ATOM   4784  O  OG1   . THR B  1 178 ? 11.176  -30.705  33.937  1.00 54.56  ? 178 THR B OG1   1 
ATOM   4785  C  CG2   . THR B  1 178 ? 10.873  -32.977  33.333  1.00 49.53  ? 178 THR B CG2   1 
ATOM   4786  N  N     . ALA B  1 179 ? 9.292   -32.005  30.067  1.00 52.35  ? 179 ALA B N     1 
ATOM   4787  C  CA    . ALA B  1 179 ? 8.728   -32.788  28.979  1.00 54.10  ? 179 ALA B CA    1 
ATOM   4788  C  C     . ALA B  1 179 ? 9.647   -32.850  27.766  1.00 54.33  ? 179 ALA B C     1 
ATOM   4789  O  O     . ALA B  1 179 ? 9.907   -33.934  27.248  1.00 55.65  ? 179 ALA B O     1 
ATOM   4790  C  CB    . ALA B  1 179 ? 7.376   -32.247  28.591  1.00 55.53  ? 179 ALA B CB    1 
ATOM   4791  N  N     . VAL B  1 180 ? 10.145  -31.699  27.332  1.00 53.75  ? 180 VAL B N     1 
ATOM   4792  C  CA    . VAL B  1 180 ? 11.050  -31.615  26.181  1.00 54.40  ? 180 VAL B CA    1 
ATOM   4793  C  C     . VAL B  1 180 ? 12.326  -32.450  26.375  1.00 53.73  ? 180 VAL B C     1 
ATOM   4794  O  O     . VAL B  1 180 ? 12.773  -33.144  25.456  1.00 54.91  ? 180 VAL B O     1 
ATOM   4795  C  CB    . VAL B  1 180 ? 11.391  -30.134  25.827  1.00 54.03  ? 180 VAL B CB    1 
ATOM   4796  C  CG1   . VAL B  1 180 ? 12.644  -30.036  24.967  1.00 53.12  ? 180 VAL B CG1   1 
ATOM   4797  C  CG2   . VAL B  1 180 ? 10.204  -29.453  25.158  1.00 54.97  ? 180 VAL B CG2   1 
ATOM   4798  N  N     . ALA B  1 181 ? 12.901  -32.391  27.571  1.00 52.21  ? 181 ALA B N     1 
ATOM   4799  C  CA    . ALA B  1 181 ? 14.098  -33.179  27.878  1.00 51.54  ? 181 ALA B CA    1 
ATOM   4800  C  C     . ALA B  1 181 ? 13.766  -34.659  28.025  1.00 52.39  ? 181 ALA B C     1 
ATOM   4801  O  O     . ALA B  1 181 ? 14.545  -35.523  27.617  1.00 53.30  ? 181 ALA B O     1 
ATOM   4802  C  CB    . ALA B  1 181 ? 14.780  -32.662  29.139  1.00 49.41  ? 181 ALA B CB    1 
ATOM   4803  N  N     . LEU B  1 182 ? 12.608  -34.948  28.602  1.00 52.55  ? 182 LEU B N     1 
ATOM   4804  C  CA    . LEU B  1 182 ? 12.231  -36.318  28.888  1.00 53.24  ? 182 LEU B CA    1 
ATOM   4805  C  C     . LEU B  1 182 ? 11.812  -37.076  27.630  1.00 55.59  ? 182 LEU B C     1 
ATOM   4806  O  O     . LEU B  1 182 ? 12.027  -38.281  27.523  1.00 56.27  ? 182 LEU B O     1 
ATOM   4807  C  CB    . LEU B  1 182 ? 11.121  -36.355  29.947  1.00 53.03  ? 182 LEU B CB    1 
ATOM   4808  C  CG    . LEU B  1 182 ? 10.653  -37.728  30.417  1.00 53.02  ? 182 LEU B CG    1 
ATOM   4809  C  CD1   . LEU B  1 182 ? 11.781  -38.454  31.134  1.00 50.35  ? 182 LEU B CD1   1 
ATOM   4810  C  CD2   . LEU B  1 182 ? 9.426   -37.568  31.283  1.00 53.40  ? 182 LEU B CD2   1 
ATOM   4811  N  N     . ASP B  1 183 ? 11.199  -36.375  26.684  1.00 57.16  ? 183 ASP B N     1 
ATOM   4812  C  CA    . ASP B  1 183 ? 10.894  -36.982  25.397  1.00 59.52  ? 183 ASP B CA    1 
ATOM   4813  C  C     . ASP B  1 183 ? 12.209  -37.350  24.693  1.00 58.65  ? 183 ASP B C     1 
ATOM   4814  O  O     . ASP B  1 183 ? 12.352  -38.438  24.148  1.00 59.59  ? 183 ASP B O     1 
ATOM   4815  C  CB    . ASP B  1 183 ? 9.980   -36.068  24.562  1.00 61.67  ? 183 ASP B CB    1 
ATOM   4816  C  CG    . ASP B  1 183 ? 8.471   -36.266  24.891  1.00 65.91  ? 183 ASP B CG    1 
ATOM   4817  O  OD1   . ASP B  1 183 ? 8.137   -36.496  26.084  1.00 66.61  ? 183 ASP B OD1   1 
ATOM   4818  O  OD2   . ASP B  1 183 ? 7.613   -36.199  23.957  1.00 70.52  ? 183 ASP B OD2   1 
ATOM   4819  N  N     . THR B  1 184 ? 13.189  -36.462  24.774  1.00 56.82  ? 184 THR B N     1 
ATOM   4820  C  CA    . THR B  1 184 ? 14.516  -36.727  24.229  1.00 56.65  ? 184 THR B CA    1 
ATOM   4821  C  C     . THR B  1 184 ? 15.157  -38.011  24.767  1.00 56.55  ? 184 THR B C     1 
ATOM   4822  O  O     . THR B  1 184 ? 15.722  -38.793  24.004  1.00 57.82  ? 184 THR B O     1 
ATOM   4823  C  CB    . THR B  1 184 ? 15.454  -35.558  24.486  1.00 54.88  ? 184 THR B CB    1 
ATOM   4824  O  OG1   . THR B  1 184 ? 14.816  -34.347  24.069  1.00 55.09  ? 184 THR B OG1   1 
ATOM   4825  C  CG2   . THR B  1 184 ? 16.736  -35.743  23.719  1.00 54.50  ? 184 THR B CG2   1 
ATOM   4826  N  N     . ILE B  1 185 ? 15.077  -38.216  26.079  1.00 55.36  ? 185 ILE B N     1 
ATOM   4827  C  CA    . ILE B  1 185 ? 15.575  -39.443  26.708  1.00 55.02  ? 185 ILE B CA    1 
ATOM   4828  C  C     . ILE B  1 185 ? 14.749  -40.649  26.259  1.00 57.19  ? 185 ILE B C     1 
ATOM   4829  O  O     . ILE B  1 185 ? 15.317  -41.658  25.840  1.00 58.60  ? 185 ILE B O     1 
ATOM   4830  C  CB    . ILE B  1 185 ? 15.571  -39.340  28.258  1.00 53.28  ? 185 ILE B CB    1 
ATOM   4831  C  CG1   . ILE B  1 185 ? 16.618  -38.330  28.741  1.00 50.97  ? 185 ILE B CG1   1 
ATOM   4832  C  CG2   . ILE B  1 185 ? 15.800  -40.706  28.905  1.00 52.83  ? 185 ILE B CG2   1 
ATOM   4833  C  CD1   . ILE B  1 185 ? 16.264  -37.698  30.074  1.00 48.85  ? 185 ILE B CD1   1 
ATOM   4834  N  N     . LEU B  1 186 ? 13.423  -40.549  26.333  1.00 57.74  ? 186 LEU B N     1 
ATOM   4835  C  CA    . LEU B  1 186 ? 12.571  -41.641  25.887  1.00 59.91  ? 186 LEU B CA    1 
ATOM   4836  C  C     . LEU B  1 186 ? 12.856  -41.996  24.439  1.00 62.25  ? 186 LEU B C     1 
ATOM   4837  O  O     . LEU B  1 186 ? 12.694  -43.151  24.027  1.00 64.10  ? 186 LEU B O     1 
ATOM   4838  C  CB    . LEU B  1 186 ? 11.093  -41.301  26.058  1.00 60.61  ? 186 LEU B CB    1 
ATOM   4839  C  CG    . LEU B  1 186 ? 10.519  -41.236  27.476  1.00 59.31  ? 186 LEU B CG    1 
ATOM   4840  C  CD1   . LEU B  1 186 ? 9.006   -41.254  27.428  1.00 60.80  ? 186 LEU B CD1   1 
ATOM   4841  C  CD2   . LEU B  1 186 ? 11.018  -42.375  28.350  1.00 58.66  ? 186 LEU B CD2   1 
ATOM   4842  N  N     . ASN B  1 187 ? 13.300  -41.008  23.665  1.00 62.57  ? 187 ASN B N     1 
ATOM   4843  C  CA    . ASN B  1 187 ? 13.507  -41.234  22.238  1.00 64.97  ? 187 ASN B CA    1 
ATOM   4844  C  C     . ASN B  1 187 ? 14.726  -42.065  21.920  1.00 65.44  ? 187 ASN B C     1 
ATOM   4845  O  O     . ASN B  1 187 ? 14.782  -42.692  20.864  1.00 67.53  ? 187 ASN B O     1 
ATOM   4846  C  CB    . ASN B  1 187 ? 13.584  -39.934  21.451  1.00 65.10  ? 187 ASN B CB    1 
ATOM   4847  C  CG    . ASN B  1 187 ? 13.370  -40.156  19.969  1.00 67.48  ? 187 ASN B CG    1 
ATOM   4848  O  OD1   . ASN B  1 187 ? 12.366  -40.734  19.568  1.00 68.66  ? 187 ASN B OD1   1 
ATOM   4849  N  ND2   . ASN B  1 187 ? 14.318  -39.711  19.149  1.00 67.88  ? 187 ASN B ND2   1 
ATOM   4850  N  N     . GLN B  1 188 ? 15.702  -42.056  22.824  1.00 63.80  ? 188 GLN B N     1 
ATOM   4851  C  CA    . GLN B  1 188 ? 16.954  -42.770  22.590  1.00 64.33  ? 188 GLN B CA    1 
ATOM   4852  C  C     . GLN B  1 188 ? 16.756  -44.285  22.523  1.00 66.30  ? 188 GLN B C     1 
ATOM   4853  O  O     . GLN B  1 188 ? 17.579  -44.999  21.927  1.00 67.23  ? 188 GLN B O     1 
ATOM   4854  C  CB    . GLN B  1 188 ? 18.003  -42.391  23.624  1.00 61.73  ? 188 GLN B CB    1 
ATOM   4855  C  CG    . GLN B  1 188 ? 18.225  -40.879  23.742  1.00 61.07  ? 188 GLN B CG    1 
ATOM   4856  C  CD    . GLN B  1 188 ? 18.457  -40.197  22.406  1.00 62.59  ? 188 GLN B CD    1 
ATOM   4857  O  OE1   . GLN B  1 188 ? 19.473  -40.426  21.740  1.00 62.75  ? 188 GLN B OE1   1 
ATOM   4858  N  NE2   . GLN B  1 188 ? 17.512  -39.350  22.007  1.00 62.81  ? 188 GLN B NE2   1 
ATOM   4859  N  N     . LYS B  1 189 ? 15.645  -44.761  23.092  1.00 66.80  ? 189 LYS B N     1 
ATOM   4860  C  CA    . LYS B  1 189 ? 15.300  -46.174  23.031  1.00 68.88  ? 189 LYS B CA    1 
ATOM   4861  C  C     . LYS B  1 189 ? 15.484  -46.719  21.621  1.00 71.02  ? 189 LYS B C     1 
ATOM   4862  O  O     . LYS B  1 189 ? 15.687  -47.921  21.440  1.00 72.68  ? 189 LYS B O     1 
ATOM   4863  C  CB    . LYS B  1 189 ? 13.868  -46.421  23.526  1.00 70.05  ? 189 LYS B CB    1 
ATOM   4864  C  CG    . LYS B  1 189 ? 13.525  -47.917  23.693  1.00 73.00  ? 189 LYS B CG    1 
ATOM   4865  C  CD    . LYS B  1 189 ? 12.448  -48.185  24.752  1.00 74.74  ? 189 LYS B CD    1 
ATOM   4866  C  CE    . LYS B  1 189 ? 11.032  -48.035  24.192  1.00 78.16  ? 189 LYS B CE    1 
ATOM   4867  N  NZ    . LYS B  1 189 ? 10.115  -49.100  24.720  1.00 80.77  ? 189 LYS B NZ    1 
ATOM   4868  N  N     . ARG B  1 190 ? 15.437  -45.819  20.636  1.00 71.27  ? 190 ARG B N     1 
ATOM   4869  C  CA    . ARG B  1 190 ? 15.575  -46.177  19.222  1.00 73.15  ? 190 ARG B CA    1 
ATOM   4870  C  C     . ARG B  1 190 ? 16.942  -46.784  18.894  1.00 73.34  ? 190 ARG B C     1 
ATOM   4871  O  O     . ARG B  1 190 ? 17.005  -47.784  18.203  1.00 75.66  ? 190 ARG B O     1 
ATOM   4872  C  CB    . ARG B  1 190 ? 15.251  -44.981  18.316  1.00 73.36  ? 190 ARG B CB    1 
ATOM   4873  C  CG    . ARG B  1 190 ? 13.817  -44.465  18.476  1.00 73.06  ? 190 ARG B CG    1 
ATOM   4874  C  CD    . ARG B  1 190 ? 13.327  -43.621  17.289  1.00 74.34  ? 190 ARG B CD    1 
ATOM   4875  N  NE    . ARG B  1 190 ? 11.935  -43.947  16.946  1.00 75.84  ? 190 ARG B NE    1 
ATOM   4876  C  CZ    . ARG B  1 190 ? 10.870  -43.232  17.302  1.00 74.63  ? 190 ARG B CZ    1 
ATOM   4877  N  NH1   . ARG B  1 190 ? 11.015  -42.122  17.998  1.00 73.07  ? 190 ARG B NH1   1 
ATOM   4878  N  NH2   . ARG B  1 190 ? 9.653   -43.622  16.956  1.00 76.58  ? 190 ARG B NH2   1 
ATOM   4879  N  N     . TRP B  1 191 ? 18.020  -46.213  19.428  1.00 71.29  ? 191 TRP B N     1 
ATOM   4880  C  CA    . TRP B  1 191 ? 19.387  -46.684  19.126  1.00 71.81  ? 191 TRP B CA    1 
ATOM   4881  C  C     . TRP B  1 191 ? 20.093  -47.444  20.237  1.00 70.84  ? 191 TRP B C     1 
ATOM   4882  O  O     . TRP B  1 191 ? 21.063  -48.151  19.988  1.00 71.62  ? 191 TRP B O     1 
ATOM   4883  C  CB    . TRP B  1 191 ? 20.268  -45.511  18.695  1.00 70.93  ? 191 TRP B CB    1 
ATOM   4884  C  CG    . TRP B  1 191 ? 19.655  -44.803  17.574  1.00 72.31  ? 191 TRP B CG    1 
ATOM   4885  C  CD1   . TRP B  1 191 ? 19.738  -45.140  16.270  1.00 74.48  ? 191 TRP B CD1   1 
ATOM   4886  C  CD2   . TRP B  1 191 ? 18.797  -43.663  17.650  1.00 71.61  ? 191 TRP B CD2   1 
ATOM   4887  N  NE1   . TRP B  1 191 ? 18.999  -44.274  15.515  1.00 76.45  ? 191 TRP B NE1   1 
ATOM   4888  C  CE2   . TRP B  1 191 ? 18.411  -43.353  16.338  1.00 73.29  ? 191 TRP B CE2   1 
ATOM   4889  C  CE3   . TRP B  1 191 ? 18.327  -42.866  18.703  1.00 70.11  ? 191 TRP B CE3   1 
ATOM   4890  C  CZ2   . TRP B  1 191 ? 17.577  -42.282  16.035  1.00 73.57  ? 191 TRP B CZ2   1 
ATOM   4891  C  CZ3   . TRP B  1 191 ? 17.493  -41.799  18.404  1.00 69.90  ? 191 TRP B CZ3   1 
ATOM   4892  C  CH2   . TRP B  1 191 ? 17.126  -41.520  17.079  1.00 71.96  ? 191 TRP B CH2   1 
ATOM   4893  N  N     . ASN B  1 192 ? 19.623  -47.286  21.465  1.00 69.50  ? 192 ASN B N     1 
ATOM   4894  C  CA    . ASN B  1 192 ? 20.300  -47.887  22.603  1.00 68.77  ? 192 ASN B CA    1 
ATOM   4895  C  C     . ASN B  1 192 ? 19.964  -49.345  22.747  1.00 71.02  ? 192 ASN B C     1 
ATOM   4896  O  O     . ASN B  1 192 ? 20.458  -49.997  23.660  1.00 70.75  ? 192 ASN B O     1 
ATOM   4897  C  CB    . ASN B  1 192 ? 19.987  -47.120  23.892  1.00 66.28  ? 192 ASN B CB    1 
ATOM   4898  C  CG    . ASN B  1 192 ? 20.553  -45.704  23.881  1.00 63.89  ? 192 ASN B CG    1 
ATOM   4899  O  OD1   . ASN B  1 192 ? 21.395  -45.363  23.045  1.00 63.21  ? 192 ASN B OD1   1 
ATOM   4900  N  ND2   . ASN B  1 192 ? 20.089  -44.876  24.804  1.00 60.75  ? 192 ASN B ND2   1 
ATOM   4901  N  N     . ASN B  1 193 ? 19.114  -49.836  21.839  1.00 74.04  ? 193 ASN B N     1 
ATOM   4902  C  CA    . ASN B  1 193 ? 18.782  -51.264  21.686  1.00 76.66  ? 193 ASN B CA    1 
ATOM   4903  C  C     . ASN B  1 193 ? 19.562  -51.914  20.542  1.00 79.08  ? 193 ASN B C     1 
ATOM   4904  O  O     . ASN B  1 193 ? 19.613  -53.135  20.444  1.00 81.45  ? 193 ASN B O     1 
ATOM   4905  C  CB    . ASN B  1 193 ? 17.276  -51.460  21.437  1.00 78.08  ? 193 ASN B CB    1 
ATOM   4906  C  CG    . ASN B  1 193 ? 16.427  -51.243  22.686  1.00 77.27  ? 193 ASN B CG    1 
ATOM   4907  O  OD1   . ASN B  1 193 ? 16.937  -50.944  23.771  1.00 76.44  ? 193 ASN B OD1   1 
ATOM   4908  N  ND2   . ASN B  1 193 ? 15.116  -51.394  22.533  1.00 78.67  ? 193 ASN B ND2   1 
ATOM   4909  N  N     . GLY B  1 194 ? 20.143  -51.100  19.662  1.00 79.17  ? 194 GLY B N     1 
ATOM   4910  C  CA    . GLY B  1 194 ? 21.011  -51.603  18.599  1.00 81.38  ? 194 GLY B CA    1 
ATOM   4911  C  C     . GLY B  1 194 ? 22.359  -52.003  19.172  1.00 81.13  ? 194 GLY B C     1 
ATOM   4912  O  O     . GLY B  1 194 ? 22.548  -51.977  20.399  1.00 79.27  ? 194 GLY B O     1 
ATOM   4913  N  N     . SER B  1 195 ? 23.292  -52.367  18.289  1.00 83.15  ? 195 SER B N     1 
ATOM   4914  C  CA    . SER B  1 195 ? 24.638  -52.812  18.681  1.00 83.52  ? 195 SER B CA    1 
ATOM   4915  C  C     . SER B  1 195 ? 25.670  -51.701  18.469  1.00 82.61  ? 195 SER B C     1 
ATOM   4916  O  O     . SER B  1 195 ? 26.486  -51.410  19.362  1.00 81.07  ? 195 SER B O     1 
ATOM   4917  C  CB    . SER B  1 195 ? 25.044  -54.045  17.879  1.00 86.81  ? 195 SER B CB    1 
ATOM   4918  O  OG    . SER B  1 195 ? 23.948  -54.934  17.687  1.00 89.09  ? 195 SER B OG    1 
ATOM   4919  N  N     . ASP B  1 196 ? 25.617  -51.084  17.284  1.00 83.97  ? 196 ASP B N     1 
ATOM   4920  C  CA    . ASP B  1 196 ? 26.476  -49.945  16.914  1.00 83.08  ? 196 ASP B CA    1 
ATOM   4921  C  C     . ASP B  1 196 ? 26.602  -48.898  18.036  1.00 79.75  ? 196 ASP B C     1 
ATOM   4922  O  O     . ASP B  1 196 ? 25.746  -48.018  18.217  1.00 78.23  ? 196 ASP B O     1 
ATOM   4923  C  CB    . ASP B  1 196 ? 26.007  -49.316  15.589  1.00 84.47  ? 196 ASP B CB    1 
ATOM   4924  C  CG    . ASP B  1 196 ? 26.784  -48.050  15.219  1.00 85.17  ? 196 ASP B CG    1 
ATOM   4925  O  OD1   . ASP B  1 196 ? 27.762  -47.684  15.919  1.00 85.27  ? 196 ASP B OD1   1 
ATOM   4926  O  OD2   . ASP B  1 196 ? 26.406  -47.400  14.220  1.00 88.08  ? 196 ASP B OD2   1 
ATOM   4927  N  N     . GLU B  1 197 ? 27.705  -49.004  18.768  1.00 78.76  ? 197 GLU B N     1 
ATOM   4928  C  CA    . GLU B  1 197 ? 27.959  -48.170  19.949  1.00 75.93  ? 197 GLU B CA    1 
ATOM   4929  C  C     . GLU B  1 197 ? 28.063  -46.660  19.708  1.00 73.82  ? 197 GLU B C     1 
ATOM   4930  O  O     . GLU B  1 197 ? 27.977  -45.887  20.657  1.00 71.10  ? 197 GLU B O     1 
ATOM   4931  C  CB    . GLU B  1 197 ? 29.237  -48.662  20.653  1.00 76.57  ? 197 GLU B CB    1 
ATOM   4932  C  CG    . GLU B  1 197 ? 29.078  -49.963  21.449  1.00 78.18  ? 197 GLU B CG    1 
ATOM   4933  C  CD    . GLU B  1 197 ? 28.259  -49.753  22.720  1.00 77.70  ? 197 GLU B CD    1 
ATOM   4934  O  OE1   . GLU B  1 197 ? 28.515  -48.769  23.457  1.00 73.61  ? 197 GLU B OE1   1 
ATOM   4935  O  OE2   . GLU B  1 197 ? 27.350  -50.576  22.972  1.00 80.30  ? 197 GLU B OE2   1 
ATOM   4936  N  N     . SER B  1 198 ? 28.274  -46.244  18.458  1.00 74.74  ? 198 SER B N     1 
ATOM   4937  C  CA    . SER B  1 198 ? 28.520  -44.829  18.159  1.00 73.36  ? 198 SER B CA    1 
ATOM   4938  C  C     . SER B  1 198 ? 27.220  -44.024  18.065  1.00 72.01  ? 198 SER B C     1 
ATOM   4939  O  O     . SER B  1 198 ? 27.215  -42.812  18.275  1.00 70.28  ? 198 SER B O     1 
ATOM   4940  C  CB    . SER B  1 198 ? 29.335  -44.677  16.868  1.00 75.44  ? 198 SER B CB    1 
ATOM   4941  O  OG    . SER B  1 198 ? 28.493  -44.679  15.725  1.00 77.06  ? 198 SER B OG    1 
ATOM   4942  N  N     . LYS B  1 199 ? 26.133  -44.718  17.732  1.00 73.01  ? 199 LYS B N     1 
ATOM   4943  C  CA    . LYS B  1 199 ? 24.811  -44.119  17.541  1.00 72.56  ? 199 LYS B CA    1 
ATOM   4944  C  C     . LYS B  1 199 ? 24.065  -43.989  18.870  1.00 70.06  ? 199 LYS B C     1 
ATOM   4945  O  O     . LYS B  1 199 ? 23.062  -43.270  18.964  1.00 69.14  ? 199 LYS B O     1 
ATOM   4946  C  CB    . LYS B  1 199 ? 23.985  -44.979  16.574  1.00 75.46  ? 199 LYS B CB    1 
ATOM   4947  C  CG    . LYS B  1 199 ? 24.373  -44.875  15.078  1.00 78.89  ? 199 LYS B CG    1 
ATOM   4948  C  CD    . LYS B  1 199 ? 23.879  -43.556  14.479  1.00 80.45  ? 199 LYS B CD    1 
ATOM   4949  C  CE    . LYS B  1 199 ? 23.579  -43.674  12.989  1.00 84.09  ? 199 LYS B CE    1 
ATOM   4950  N  NZ    . LYS B  1 199 ? 22.896  -42.433  12.505  1.00 84.22  ? 199 LYS B NZ    1 
ATOM   4951  N  N     . LYS B  1 200 ? 24.573  -44.691  19.888  1.00 68.83  ? 200 LYS B N     1 
ATOM   4952  C  CA    . LYS B  1 200 ? 23.985  -44.741  21.224  1.00 66.47  ? 200 LYS B CA    1 
ATOM   4953  C  C     . LYS B  1 200 ? 24.224  -43.462  22.001  1.00 64.17  ? 200 LYS B C     1 
ATOM   4954  O  O     . LYS B  1 200 ? 25.238  -42.784  21.802  1.00 63.95  ? 200 LYS B O     1 
ATOM   4955  C  CB    . LYS B  1 200 ? 24.566  -45.906  22.014  1.00 66.51  ? 200 LYS B CB    1 
ATOM   4956  C  CG    . LYS B  1 200 ? 24.179  -47.286  21.504  1.00 69.23  ? 200 LYS B CG    1 
ATOM   4957  C  CD    . LYS B  1 200 ? 24.391  -48.313  22.593  1.00 70.02  ? 200 LYS B CD    1 
ATOM   4958  C  CE    . LYS B  1 200 ? 23.932  -49.689  22.157  1.00 73.91  ? 200 LYS B CE    1 
ATOM   4959  N  NZ    . LYS B  1 200 ? 24.224  -50.689  23.232  1.00 74.43  ? 200 LYS B NZ    1 
ATOM   4960  N  N     . LEU B  1 201 ? 23.293  -43.142  22.896  1.00 62.46  ? 201 LEU B N     1 
ATOM   4961  C  CA    . LEU B  1 201 ? 23.398  -41.948  23.722  1.00 60.22  ? 201 LEU B CA    1 
ATOM   4962  C  C     . LEU B  1 201 ? 22.905  -42.208  25.149  1.00 58.79  ? 201 LEU B C     1 
ATOM   4963  O  O     . LEU B  1 201 ? 21.689  -42.239  25.392  1.00 58.80  ? 201 LEU B O     1 
ATOM   4964  C  CB    . LEU B  1 201 ? 22.629  -40.785  23.073  1.00 60.10  ? 201 LEU B CB    1 
ATOM   4965  C  CG    . LEU B  1 201 ? 22.719  -39.405  23.741  1.00 57.57  ? 201 LEU B CG    1 
ATOM   4966  C  CD1   . LEU B  1 201 ? 24.128  -38.920  23.715  1.00 57.03  ? 201 LEU B CD1   1 
ATOM   4967  C  CD2   . LEU B  1 201 ? 21.814  -38.376  23.069  1.00 57.07  ? 201 LEU B CD2   1 
ATOM   4968  N  N     . TYR B  1 202 ? 23.843  -42.392  26.084  1.00 57.50  ? 202 TYR B N     1 
ATOM   4969  C  CA    . TYR B  1 202 ? 23.496  -42.618  27.501  1.00 56.00  ? 202 TYR B CA    1 
ATOM   4970  C  C     . TYR B  1 202 ? 23.064  -41.309  28.160  1.00 54.09  ? 202 TYR B C     1 
ATOM   4971  O  O     . TYR B  1 202 ? 23.499  -40.240  27.742  1.00 53.63  ? 202 TYR B O     1 
ATOM   4972  C  CB    . TYR B  1 202 ? 24.640  -43.316  28.261  1.00 55.72  ? 202 TYR B CB    1 
ATOM   4973  C  CG    . TYR B  1 202 ? 25.119  -44.602  27.563  1.00 59.06  ? 202 TYR B CG    1 
ATOM   4974  C  CD1   . TYR B  1 202 ? 26.186  -44.566  26.661  1.00 59.50  ? 202 TYR B CD1   1 
ATOM   4975  C  CD2   . TYR B  1 202 ? 24.479  -45.843  27.776  1.00 58.88  ? 202 TYR B CD2   1 
ATOM   4976  C  CE1   . TYR B  1 202 ? 26.610  -45.703  26.007  1.00 60.37  ? 202 TYR B CE1   1 
ATOM   4977  C  CE2   . TYR B  1 202 ? 24.906  -46.978  27.125  1.00 58.86  ? 202 TYR B CE2   1 
ATOM   4978  C  CZ    . TYR B  1 202 ? 25.974  -46.895  26.242  1.00 61.97  ? 202 TYR B CZ    1 
ATOM   4979  O  OH    . TYR B  1 202 ? 26.444  -48.004  25.562  1.00 67.05  ? 202 TYR B OH    1 
ATOM   4980  N  N     . CYS B  1 203 ? 22.195  -41.397  29.171  1.00 53.19  ? 203 CYS B N     1 
ATOM   4981  C  CA    . CYS B  1 203 ? 21.505  -40.224  29.715  1.00 51.47  ? 203 CYS B CA    1 
ATOM   4982  C  C     . CYS B  1 203 ? 21.690  -40.024  31.204  1.00 49.88  ? 203 CYS B C     1 
ATOM   4983  O  O     . CYS B  1 203 ? 21.516  -40.938  31.993  1.00 50.48  ? 203 CYS B O     1 
ATOM   4984  C  CB    . CYS B  1 203 ? 20.015  -40.294  29.385  1.00 51.96  ? 203 CYS B CB    1 
ATOM   4985  S  SG    . CYS B  1 203 ? 19.723  -40.402  27.598  1.00 54.24  ? 203 CYS B SG    1 
ATOM   4986  N  N     . VAL B  1 204 ? 22.047  -38.807  31.578  1.00 48.50  ? 204 VAL B N     1 
ATOM   4987  C  CA    . VAL B  1 204 ? 22.199  -38.432  32.977  1.00 46.65  ? 204 VAL B CA    1 
ATOM   4988  C  C     . VAL B  1 204 ? 21.187  -37.325  33.235  1.00 45.75  ? 204 VAL B C     1 
ATOM   4989  O  O     . VAL B  1 204 ? 21.222  -36.268  32.595  1.00 45.27  ? 204 VAL B O     1 
ATOM   4990  C  CB    . VAL B  1 204 ? 23.626  -37.915  33.278  1.00 46.05  ? 204 VAL B CB    1 
ATOM   4991  C  CG1   . VAL B  1 204 ? 23.798  -37.667  34.773  1.00 44.71  ? 204 VAL B CG1   1 
ATOM   4992  C  CG2   . VAL B  1 204 ? 24.690  -38.906  32.765  1.00 46.35  ? 204 VAL B CG2   1 
ATOM   4993  N  N     . TYR B  1 205 ? 20.259  -37.587  34.143  1.00 45.14  ? 205 TYR B N     1 
ATOM   4994  C  CA    . TYR B  1 205 ? 19.230  -36.620  34.440  1.00 44.51  ? 205 TYR B CA    1 
ATOM   4995  C  C     . TYR B  1 205 ? 19.528  -36.109  35.835  1.00 43.78  ? 205 TYR B C     1 
ATOM   4996  O  O     . TYR B  1 205 ? 19.666  -36.904  36.779  1.00 44.49  ? 205 TYR B O     1 
ATOM   4997  C  CB    . TYR B  1 205 ? 17.822  -37.243  34.324  1.00 45.16  ? 205 TYR B CB    1 
ATOM   4998  C  CG    . TYR B  1 205 ? 16.698  -36.298  34.706  1.00 43.40  ? 205 TYR B CG    1 
ATOM   4999  C  CD1   . TYR B  1 205 ? 16.150  -35.401  33.785  1.00 42.70  ? 205 TYR B CD1   1 
ATOM   5000  C  CD2   . TYR B  1 205 ? 16.197  -36.297  35.989  1.00 43.34  ? 205 TYR B CD2   1 
ATOM   5001  C  CE1   . TYR B  1 205 ? 15.126  -34.527  34.145  1.00 43.21  ? 205 TYR B CE1   1 
ATOM   5002  C  CE2   . TYR B  1 205 ? 15.184  -35.432  36.372  1.00 44.27  ? 205 TYR B CE2   1 
ATOM   5003  C  CZ    . TYR B  1 205 ? 14.645  -34.550  35.454  1.00 44.27  ? 205 TYR B CZ    1 
ATOM   5004  O  OH    . TYR B  1 205 ? 13.652  -33.699  35.893  1.00 43.88  ? 205 TYR B OH    1 
ATOM   5005  N  N     . VAL B  1 206 ? 19.671  -34.795  35.977  1.00 42.75  ? 206 VAL B N     1 
ATOM   5006  C  CA    . VAL B  1 206 ? 19.949  -34.243  37.296  1.00 41.30  ? 206 VAL B CA    1 
ATOM   5007  C  C     . VAL B  1 206 ? 18.770  -33.482  37.810  1.00 40.90  ? 206 VAL B C     1 
ATOM   5008  O  O     . VAL B  1 206 ? 18.341  -32.512  37.210  1.00 40.86  ? 206 VAL B O     1 
ATOM   5009  C  CB    . VAL B  1 206 ? 21.145  -33.295  37.308  1.00 40.66  ? 206 VAL B CB    1 
ATOM   5010  C  CG1   . VAL B  1 206 ? 21.636  -33.114  38.757  1.00 39.91  ? 206 VAL B CG1   1 
ATOM   5011  C  CG2   . VAL B  1 206 ? 22.238  -33.807  36.401  1.00 40.05  ? 206 VAL B CG2   1 
ATOM   5012  N  N     . ALA B  1 207 ? 18.260  -33.929  38.943  1.00 41.30  ? 207 ALA B N     1 
ATOM   5013  C  CA    . ALA B  1 207 ? 17.204  -33.223  39.647  1.00 41.11  ? 207 ALA B CA    1 
ATOM   5014  C  C     . ALA B  1 207 ? 17.829  -32.429  40.771  1.00 40.39  ? 207 ALA B C     1 
ATOM   5015  O  O     . ALA B  1 207 ? 18.459  -32.998  41.666  1.00 40.18  ? 207 ALA B O     1 
ATOM   5016  C  CB    . ALA B  1 207 ? 16.173  -34.206  40.185  1.00 41.73  ? 207 ALA B CB    1 
ATOM   5017  N  N     . VAL B  1 208 ? 17.677  -31.111  40.710  1.00 40.42  ? 208 VAL B N     1 
ATOM   5018  C  CA    . VAL B  1 208 ? 18.220  -30.229  41.726  1.00 39.90  ? 208 VAL B CA    1 
ATOM   5019  C  C     . VAL B  1 208 ? 17.058  -29.409  42.247  1.00 40.75  ? 208 VAL B C     1 
ATOM   5020  O  O     . VAL B  1 208 ? 16.476  -28.655  41.488  1.00 41.95  ? 208 VAL B O     1 
ATOM   5021  C  CB    . VAL B  1 208 ? 19.286  -29.281  41.113  1.00 39.54  ? 208 VAL B CB    1 
ATOM   5022  C  CG1   . VAL B  1 208 ? 19.851  -28.338  42.156  1.00 38.88  ? 208 VAL B CG1   1 
ATOM   5023  C  CG2   . VAL B  1 208 ? 20.422  -30.077  40.456  1.00 38.85  ? 208 VAL B CG2   1 
ATOM   5024  N  N     . GLY B  1 209 ? 16.695  -29.554  43.523  1.00 41.10  ? 209 GLY B N     1 
ATOM   5025  C  CA    . GLY B  1 209 ? 15.672  -28.701  44.128  1.00 40.53  ? 209 GLY B CA    1 
ATOM   5026  C  C     . GLY B  1 209 ? 14.237  -29.137  43.908  1.00 42.18  ? 209 GLY B C     1 
ATOM   5027  O  O     . GLY B  1 209 ? 13.310  -28.540  44.450  1.00 43.61  ? 209 GLY B O     1 
ATOM   5028  N  N     . GLN B  1 210 ? 14.029  -30.177  43.111  1.00 42.76  ? 210 GLN B N     1 
ATOM   5029  C  CA    . GLN B  1 210 ? 12.689  -30.720  42.854  1.00 43.46  ? 210 GLN B CA    1 
ATOM   5030  C  C     . GLN B  1 210 ? 12.157  -31.510  44.033  1.00 43.84  ? 210 GLN B C     1 
ATOM   5031  O  O     . GLN B  1 210 ? 12.887  -31.818  44.953  1.00 43.00  ? 210 GLN B O     1 
ATOM   5032  C  CB    . GLN B  1 210 ? 12.706  -31.637  41.637  1.00 43.95  ? 210 GLN B CB    1 
ATOM   5033  C  CG    . GLN B  1 210 ? 13.100  -30.956  40.346  1.00 43.91  ? 210 GLN B CG    1 
ATOM   5034  C  CD    . GLN B  1 210 ? 13.353  -31.956  39.257  1.00 45.20  ? 210 GLN B CD    1 
ATOM   5035  O  OE1   . GLN B  1 210 ? 12.602  -32.920  39.062  1.00 45.93  ? 210 GLN B OE1   1 
ATOM   5036  N  NE2   . GLN B  1 210 ? 14.418  -31.737  38.529  1.00 47.65  ? 210 GLN B NE2   1 
ATOM   5037  N  N     . LYS B  1 211 ? 10.865  -31.820  43.990  1.00 45.34  ? 211 LYS B N     1 
ATOM   5038  C  CA    . LYS B  1 211 ? 10.226  -32.642  44.995  1.00 46.24  ? 211 LYS B CA    1 
ATOM   5039  C  C     . LYS B  1 211 ? 10.664  -34.100  44.822  1.00 46.51  ? 211 LYS B C     1 
ATOM   5040  O  O     . LYS B  1 211 ? 10.712  -34.613  43.712  1.00 46.79  ? 211 LYS B O     1 
ATOM   5041  C  CB    . LYS B  1 211 ? 8.705   -32.572  44.826  1.00 48.23  ? 211 LYS B CB    1 
ATOM   5042  C  CG    . LYS B  1 211 ? 8.050   -31.227  45.076  1.00 48.15  ? 211 LYS B CG    1 
ATOM   5043  C  CD    . LYS B  1 211 ? 6.691   -31.154  44.379  1.00 48.46  ? 211 LYS B CD    1 
ATOM   5044  C  CE    . LYS B  1 211 ? 5.579   -31.613  45.281  1.00 51.70  ? 211 LYS B CE    1 
ATOM   5045  N  NZ    . LYS B  1 211 ? 4.193   -31.476  44.680  1.00 53.86  ? 211 LYS B NZ    1 
ATOM   5046  N  N     . ARG B  1 212 ? 10.961  -34.771  45.923  1.00 46.71  ? 212 ARG B N     1 
ATOM   5047  C  CA    . ARG B  1 212 ? 11.254  -36.201  45.901  1.00 47.28  ? 212 ARG B CA    1 
ATOM   5048  C  C     . ARG B  1 212 ? 10.229  -36.970  45.043  1.00 49.04  ? 212 ARG B C     1 
ATOM   5049  O  O     . ARG B  1 212 ? 10.612  -37.710  44.130  1.00 49.89  ? 212 ARG B O     1 
ATOM   5050  C  CB    . ARG B  1 212 ? 11.290  -36.719  47.338  1.00 47.55  ? 212 ARG B CB    1 
ATOM   5051  C  CG    . ARG B  1 212 ? 11.963  -38.044  47.544  1.00 47.52  ? 212 ARG B CG    1 
ATOM   5052  C  CD    . ARG B  1 212 ? 12.491  -38.152  48.989  1.00 45.76  ? 212 ARG B CD    1 
ATOM   5053  N  NE    . ARG B  1 212 ? 13.855  -37.638  49.089  1.00 44.12  ? 212 ARG B NE    1 
ATOM   5054  C  CZ    . ARG B  1 212 ? 14.574  -37.572  50.208  1.00 44.99  ? 212 ARG B CZ    1 
ATOM   5055  N  NH1   . ARG B  1 212 ? 14.081  -37.988  51.376  1.00 46.49  ? 212 ARG B NH1   1 
ATOM   5056  N  NH2   . ARG B  1 212 ? 15.803  -37.068  50.158  1.00 44.33  ? 212 ARG B NH2   1 
ATOM   5057  N  N     . SER B  1 213 ? 8.935   -36.764  45.302  1.00 50.15  ? 213 SER B N     1 
ATOM   5058  C  CA    . SER B  1 213 ? 7.863   -37.434  44.547  1.00 51.45  ? 213 SER B CA    1 
ATOM   5059  C  C     . SER B  1 213 ? 7.896   -37.157  43.037  1.00 51.28  ? 213 SER B C     1 
ATOM   5060  O  O     . SER B  1 213 ? 7.552   -38.031  42.262  1.00 52.70  ? 213 SER B O     1 
ATOM   5061  C  CB    . SER B  1 213 ? 6.491   -37.060  45.099  1.00 52.67  ? 213 SER B CB    1 
ATOM   5062  O  OG    . SER B  1 213 ? 6.282   -35.654  45.019  1.00 52.66  ? 213 SER B OG    1 
ATOM   5063  N  N     . THR B  1 214 ? 8.294   -35.955  42.615  1.00 49.65  ? 214 THR B N     1 
ATOM   5064  C  CA    . THR B  1 214 ? 8.385   -35.674  41.188  1.00 49.43  ? 214 THR B CA    1 
ATOM   5065  C  C     . THR B  1 214 ? 9.377   -36.642  40.585  1.00 49.39  ? 214 THR B C     1 
ATOM   5066  O  O     . THR B  1 214 ? 9.122   -37.247  39.542  1.00 50.55  ? 214 THR B O     1 
ATOM   5067  C  CB    . THR B  1 214 ? 8.851   -34.239  40.893  1.00 48.13  ? 214 THR B CB    1 
ATOM   5068  O  OG1   . THR B  1 214 ? 7.962   -33.312  41.521  1.00 48.98  ? 214 THR B OG1   1 
ATOM   5069  C  CG2   . THR B  1 214 ? 8.884   -33.955  39.382  1.00 47.43  ? 214 THR B CG2   1 
ATOM   5070  N  N     . VAL B  1 215 ? 10.499  -36.798  41.278  1.00 48.25  ? 215 VAL B N     1 
ATOM   5071  C  CA    . VAL B  1 215 ? 11.639  -37.560  40.780  1.00 47.66  ? 215 VAL B CA    1 
ATOM   5072  C  C     . VAL B  1 215 ? 11.344  -39.056  40.840  1.00 49.34  ? 215 VAL B C     1 
ATOM   5073  O  O     . VAL B  1 215 ? 11.608  -39.783  39.874  1.00 49.77  ? 215 VAL B O     1 
ATOM   5074  C  CB    . VAL B  1 215 ? 12.915  -37.215  41.568  1.00 45.73  ? 215 VAL B CB    1 
ATOM   5075  C  CG1   . VAL B  1 215 ? 14.108  -38.009  41.064  1.00 45.61  ? 215 VAL B CG1   1 
ATOM   5076  C  CG2   . VAL B  1 215 ? 13.178  -35.768  41.453  1.00 43.22  ? 215 VAL B CG2   1 
ATOM   5077  N  N     . ALA B  1 216 ? 10.794  -39.513  41.964  1.00 50.18  ? 216 ALA B N     1 
ATOM   5078  C  CA    . ALA B  1 216 ? 10.307  -40.892  42.051  1.00 52.40  ? 216 ALA B CA    1 
ATOM   5079  C  C     . ALA B  1 216 ? 9.372   -41.206  40.865  1.00 54.38  ? 216 ALA B C     1 
ATOM   5080  O  O     . ALA B  1 216 ? 9.613   -42.155  40.102  1.00 55.64  ? 216 ALA B O     1 
ATOM   5081  C  CB    . ALA B  1 216 ? 9.611   -41.133  43.367  1.00 53.04  ? 216 ALA B CB    1 
ATOM   5082  N  N     . GLN B  1 217 ? 8.348   -40.373  40.685  1.00 55.03  ? 217 GLN B N     1 
ATOM   5083  C  CA    . GLN B  1 217 ? 7.401   -40.522  39.574  1.00 56.89  ? 217 GLN B CA    1 
ATOM   5084  C  C     . GLN B  1 217 ? 8.074   -40.463  38.216  1.00 56.53  ? 217 GLN B C     1 
ATOM   5085  O  O     . GLN B  1 217 ? 7.719   -41.217  37.320  1.00 58.36  ? 217 GLN B O     1 
ATOM   5086  C  CB    . GLN B  1 217 ? 6.282   -39.482  39.665  1.00 57.54  ? 217 GLN B CB    1 
ATOM   5087  C  CG    . GLN B  1 217 ? 5.358   -39.700  40.874  1.00 58.29  ? 217 GLN B CG    1 
ATOM   5088  C  CD    . GLN B  1 217 ? 4.328   -38.613  41.033  1.00 58.45  ? 217 GLN B CD    1 
ATOM   5089  O  OE1   . GLN B  1 217 ? 4.269   -37.676  40.240  1.00 58.07  ? 217 GLN B OE1   1 
ATOM   5090  N  NE2   . GLN B  1 217 ? 3.501   -38.732  42.066  1.00 59.41  ? 217 GLN B NE2   1 
ATOM   5091  N  N     . LEU B  1 218 ? 9.052   -39.577  38.070  1.00 54.61  ? 218 LEU B N     1 
ATOM   5092  C  CA    . LEU B  1 218 ? 9.801   -39.503  36.833  1.00 54.30  ? 218 LEU B CA    1 
ATOM   5093  C  C     . LEU B  1 218 ? 10.518  -40.826  36.572  1.00 55.13  ? 218 LEU B C     1 
ATOM   5094  O  O     . LEU B  1 218 ? 10.481  -41.356  35.456  1.00 56.77  ? 218 LEU B O     1 
ATOM   5095  C  CB    . LEU B  1 218 ? 10.801  -38.362  36.870  1.00 52.02  ? 218 LEU B CB    1 
ATOM   5096  C  CG    . LEU B  1 218 ? 11.619  -38.277  35.590  1.00 52.08  ? 218 LEU B CG    1 
ATOM   5097  C  CD1   . LEU B  1 218 ? 10.878  -37.487  34.553  1.00 53.76  ? 218 LEU B CD1   1 
ATOM   5098  C  CD2   . LEU B  1 218 ? 12.893  -37.589  35.898  1.00 51.27  ? 218 LEU B CD2   1 
ATOM   5099  N  N     . VAL B  1 219 ? 11.148  -41.379  37.601  1.00 54.20  ? 219 VAL B N     1 
ATOM   5100  C  CA    . VAL B  1 219 ? 11.913  -42.600  37.419  1.00 54.42  ? 219 VAL B CA    1 
ATOM   5101  C  C     . VAL B  1 219 ? 11.005  -43.752  37.012  1.00 56.64  ? 219 VAL B C     1 
ATOM   5102  O  O     . VAL B  1 219 ? 11.389  -44.592  36.215  1.00 57.68  ? 219 VAL B O     1 
ATOM   5103  C  CB    . VAL B  1 219 ? 12.744  -42.937  38.669  1.00 53.60  ? 219 VAL B CB    1 
ATOM   5104  C  CG1   . VAL B  1 219 ? 13.185  -44.370  38.648  1.00 54.30  ? 219 VAL B CG1   1 
ATOM   5105  C  CG2   . VAL B  1 219 ? 13.963  -42.029  38.738  1.00 51.68  ? 219 VAL B CG2   1 
ATOM   5106  N  N     . GLN B  1 220 ? 9.785   -43.770  37.537  1.00 57.87  ? 220 GLN B N     1 
ATOM   5107  C  CA    . GLN B  1 220 ? 8.813   -44.819  37.202  1.00 60.08  ? 220 GLN B CA    1 
ATOM   5108  C  C     . GLN B  1 220 ? 8.365   -44.671  35.756  1.00 61.00  ? 220 GLN B C     1 
ATOM   5109  O  O     . GLN B  1 220 ? 8.167   -45.661  35.057  1.00 63.18  ? 220 GLN B O     1 
ATOM   5110  C  CB    . GLN B  1 220 ? 7.616   -44.790  38.166  1.00 61.05  ? 220 GLN B CB    1 
ATOM   5111  C  CG    . GLN B  1 220 ? 6.564   -45.866  37.950  1.00 64.87  ? 220 GLN B CG    1 
ATOM   5112  C  CD    . GLN B  1 220 ? 7.054   -47.274  38.276  1.00 67.68  ? 220 GLN B CD    1 
ATOM   5113  O  OE1   . GLN B  1 220 ? 7.980   -47.449  39.072  1.00 69.01  ? 220 GLN B OE1   1 
ATOM   5114  N  NE2   . GLN B  1 220 ? 6.435   -48.281  37.660  1.00 67.97  ? 220 GLN B NE2   1 
ATOM   5115  N  N     . THR B  1 221 ? 8.227   -43.435  35.294  1.00 59.81  ? 221 THR B N     1 
ATOM   5116  C  CA    . THR B  1 221 ? 7.916   -43.223  33.895  1.00 60.73  ? 221 THR B CA    1 
ATOM   5117  C  C     . THR B  1 221 ? 9.027   -43.843  33.055  1.00 60.69  ? 221 THR B C     1 
ATOM   5118  O  O     . THR B  1 221 ? 8.755   -44.739  32.258  1.00 62.49  ? 221 THR B O     1 
ATOM   5119  C  CB    . THR B  1 221 ? 7.698   -41.751  33.588  1.00 59.68  ? 221 THR B CB    1 
ATOM   5120  O  OG1   . THR B  1 221 ? 6.803   -41.226  34.564  1.00 60.25  ? 221 THR B OG1   1 
ATOM   5121  C  CG2   . THR B  1 221 ? 7.076   -41.564  32.222  1.00 60.71  ? 221 THR B CG2   1 
ATOM   5122  N  N     . LEU B  1 222 ? 10.268  -43.399  33.277  1.00 58.81  ? 222 LEU B N     1 
ATOM   5123  C  CA    . LEU B  1 222 ? 11.454  -43.979  32.629  1.00 58.99  ? 222 LEU B CA    1 
ATOM   5124  C  C     . LEU B  1 222 ? 11.479  -45.519  32.659  1.00 60.76  ? 222 LEU B C     1 
ATOM   5125  O  O     . LEU B  1 222 ? 11.709  -46.159  31.633  1.00 62.33  ? 222 LEU B O     1 
ATOM   5126  C  CB    . LEU B  1 222 ? 12.746  -43.422  33.241  1.00 56.77  ? 222 LEU B CB    1 
ATOM   5127  C  CG    . LEU B  1 222 ? 13.058  -41.930  33.101  1.00 55.59  ? 222 LEU B CG    1 
ATOM   5128  C  CD1   . LEU B  1 222 ? 14.240  -41.573  33.974  1.00 54.05  ? 222 LEU B CD1   1 
ATOM   5129  C  CD2   . LEU B  1 222 ? 13.347  -41.542  31.664  1.00 56.12  ? 222 LEU B CD2   1 
ATOM   5130  N  N     . GLU B  1 223 ? 11.233  -46.116  33.818  1.00 61.00  ? 223 GLU B N     1 
ATOM   5131  C  CA    . GLU B  1 223 ? 11.149  -47.573  33.901  1.00 63.22  ? 223 GLU B CA    1 
ATOM   5132  C  C     . GLU B  1 223 ? 10.068  -48.138  32.968  1.00 65.48  ? 223 GLU B C     1 
ATOM   5133  O  O     . GLU B  1 223 ? 10.319  -49.082  32.230  1.00 66.72  ? 223 GLU B O     1 
ATOM   5134  C  CB    . GLU B  1 223 ? 10.931  -48.031  35.347  1.00 63.26  ? 223 GLU B CB    1 
ATOM   5135  C  CG    . GLU B  1 223 ? 10.857  -49.551  35.522  1.00 67.21  ? 223 GLU B CG    1 
ATOM   5136  C  CD    . GLU B  1 223 ? 12.155  -50.260  35.152  1.00 69.46  ? 223 GLU B CD    1 
ATOM   5137  O  OE1   . GLU B  1 223 ? 13.243  -49.661  35.348  1.00 68.76  ? 223 GLU B OE1   1 
ATOM   5138  O  OE2   . GLU B  1 223 ? 12.082  -51.416  34.670  1.00 72.00  ? 223 GLU B OE2   1 
ATOM   5139  N  N     . GLN B  1 224 ? 8.885   -47.533  32.981  1.00 66.20  ? 224 GLN B N     1 
ATOM   5140  C  CA    . GLN B  1 224 ? 7.766   -47.992  32.153  1.00 69.18  ? 224 GLN B CA    1 
ATOM   5141  C  C     . GLN B  1 224 ? 7.981   -47.942  30.653  1.00 70.21  ? 224 GLN B C     1 
ATOM   5142  O  O     . GLN B  1 224 ? 7.338   -48.684  29.910  1.00 72.86  ? 224 GLN B O     1 
ATOM   5143  C  CB    . GLN B  1 224 ? 6.526   -47.193  32.466  1.00 69.52  ? 224 GLN B CB    1 
ATOM   5144  C  CG    . GLN B  1 224 ? 5.779   -47.733  33.621  1.00 71.63  ? 224 GLN B CG    1 
ATOM   5145  C  CD    . GLN B  1 224 ? 4.801   -46.741  34.137  1.00 73.41  ? 224 GLN B CD    1 
ATOM   5146  O  OE1   . GLN B  1 224 ? 4.073   -46.105  33.365  1.00 75.56  ? 224 GLN B OE1   1 
ATOM   5147  N  NE2   . GLN B  1 224 ? 4.779   -46.574  35.453  1.00 73.13  ? 224 GLN B NE2   1 
ATOM   5148  N  N     . HIS B  1 225 ? 8.842   -47.036  30.212  1.00 68.63  ? 225 HIS B N     1 
ATOM   5149  C  CA    . HIS B  1 225 ? 9.149   -46.894  28.801  1.00 69.78  ? 225 HIS B CA    1 
ATOM   5150  C  C     . HIS B  1 225 ? 10.477  -47.586  28.525  1.00 69.48  ? 225 HIS B C     1 
ATOM   5151  O  O     . HIS B  1 225 ? 11.009  -47.499  27.418  1.00 70.24  ? 225 HIS B O     1 
ATOM   5152  C  CB    . HIS B  1 225 ? 9.240   -45.412  28.411  1.00 68.59  ? 225 HIS B CB    1 
ATOM   5153  C  CG    . HIS B  1 225 ? 7.913   -44.734  28.232  1.00 69.87  ? 225 HIS B CG    1 
ATOM   5154  N  ND1   . HIS B  1 225 ? 7.180   -44.234  29.288  1.00 69.26  ? 225 HIS B ND1   1 
ATOM   5155  C  CD2   . HIS B  1 225 ? 7.207   -44.443  27.114  1.00 71.29  ? 225 HIS B CD2   1 
ATOM   5156  C  CE1   . HIS B  1 225 ? 6.071   -43.679  28.830  1.00 70.09  ? 225 HIS B CE1   1 
ATOM   5157  N  NE2   . HIS B  1 225 ? 6.065   -43.792  27.514  1.00 71.61  ? 225 HIS B NE2   1 
ATOM   5158  N  N     . ASP B  1 226 ? 11.013  -48.257  29.545  1.00 68.56  ? 226 ASP B N     1 
ATOM   5159  C  CA    . ASP B  1 226 ? 12.245  -49.039  29.422  1.00 68.41  ? 226 ASP B CA    1 
ATOM   5160  C  C     . ASP B  1 226 ? 13.439  -48.171  29.047  1.00 66.33  ? 226 ASP B C     1 
ATOM   5161  O  O     . ASP B  1 226 ? 14.319  -48.598  28.295  1.00 66.87  ? 226 ASP B O     1 
ATOM   5162  C  CB    . ASP B  1 226 ? 12.061  -50.172  28.402  1.00 71.42  ? 226 ASP B CB    1 
ATOM   5163  C  CG    . ASP B  1 226 ? 12.986  -51.345  28.653  1.00 73.07  ? 226 ASP B CG    1 
ATOM   5164  O  OD1   . ASP B  1 226 ? 13.696  -51.351  29.681  1.00 74.41  ? 226 ASP B OD1   1 
ATOM   5165  O  OD2   . ASP B  1 226 ? 13.006  -52.269  27.820  1.00 75.77  ? 226 ASP B OD2   1 
ATOM   5166  N  N     . ALA B  1 227 ? 13.456  -46.947  29.571  1.00 64.06  ? 227 ALA B N     1 
ATOM   5167  C  CA    . ALA B  1 227 ? 14.524  -45.982  29.294  1.00 62.14  ? 227 ALA B CA    1 
ATOM   5168  C  C     . ALA B  1 227 ? 15.568  -46.009  30.379  1.00 60.22  ? 227 ALA B C     1 
ATOM   5169  O  O     . ALA B  1 227 ? 16.680  -45.539  30.210  1.00 59.60  ? 227 ALA B O     1 
ATOM   5170  C  CB    . ALA B  1 227 ? 13.958  -44.586  29.175  1.00 61.01  ? 227 ALA B CB    1 
ATOM   5171  N  N     . MET B  1 228 ? 15.189  -46.565  31.509  1.00 60.16  ? 228 MET B N     1 
ATOM   5172  C  CA    . MET B  1 228 ? 15.988  -46.518  32.711  1.00 58.48  ? 228 MET B CA    1 
ATOM   5173  C  C     . MET B  1 228 ? 17.332  -47.250  32.588  1.00 58.58  ? 228 MET B C     1 
ATOM   5174  O  O     . MET B  1 228 ? 18.308  -46.853  33.196  1.00 57.77  ? 228 MET B O     1 
ATOM   5175  C  CB    . MET B  1 228 ? 15.153  -47.110  33.830  1.00 58.83  ? 228 MET B CB    1 
ATOM   5176  C  CG    . MET B  1 228 ? 15.715  -46.913  35.183  1.00 58.63  ? 228 MET B CG    1 
ATOM   5177  S  SD    . MET B  1 228 ? 15.995  -45.189  35.630  1.00 58.59  ? 228 MET B SD    1 
ATOM   5178  C  CE    . MET B  1 228 ? 16.316  -45.521  37.362  1.00 57.05  ? 228 MET B CE    1 
ATOM   5179  N  N     . LYS B  1 229 ? 17.382  -48.306  31.789  1.00 60.24  ? 229 LYS B N     1 
ATOM   5180  C  CA    . LYS B  1 229 ? 18.584  -49.116  31.654  1.00 60.31  ? 229 LYS B CA    1 
ATOM   5181  C  C     . LYS B  1 229 ? 19.750  -48.387  30.976  1.00 59.13  ? 229 LYS B C     1 
ATOM   5182  O  O     . LYS B  1 229 ? 20.889  -48.860  31.053  1.00 59.74  ? 229 LYS B O     1 
ATOM   5183  C  CB    . LYS B  1 229 ? 18.267  -50.425  30.914  1.00 62.74  ? 229 LYS B CB    1 
ATOM   5184  C  CG    . LYS B  1 229 ? 17.912  -50.263  29.433  1.00 63.98  ? 229 LYS B CG    1 
ATOM   5185  C  CD    . LYS B  1 229 ? 17.107  -51.458  28.913  1.00 67.66  ? 229 LYS B CD    1 
ATOM   5186  C  CE    . LYS B  1 229 ? 16.983  -51.430  27.386  1.00 70.16  ? 229 LYS B CE    1 
ATOM   5187  N  NZ    . LYS B  1 229 ? 16.609  -52.753  26.792  1.00 72.16  ? 229 LYS B NZ    1 
ATOM   5188  N  N     . TYR B  1 230 ? 19.469  -47.276  30.292  1.00 57.74  ? 230 TYR B N     1 
ATOM   5189  C  CA    . TYR B  1 230 ? 20.523  -46.459  29.661  1.00 56.53  ? 230 TYR B CA    1 
ATOM   5190  C  C     . TYR B  1 230 ? 20.638  -45.066  30.292  1.00 54.55  ? 230 TYR B C     1 
ATOM   5191  O  O     . TYR B  1 230 ? 21.299  -44.170  29.741  1.00 53.94  ? 230 TYR B O     1 
ATOM   5192  C  CB    . TYR B  1 230 ? 20.348  -46.349  28.136  1.00 57.06  ? 230 TYR B CB    1 
ATOM   5193  C  CG    . TYR B  1 230 ? 19.030  -45.772  27.666  1.00 56.87  ? 230 TYR B CG    1 
ATOM   5194  C  CD1   . TYR B  1 230 ? 18.730  -44.411  27.816  1.00 56.05  ? 230 TYR B CD1   1 
ATOM   5195  C  CD2   . TYR B  1 230 ? 18.088  -46.580  27.040  1.00 59.11  ? 230 TYR B CD2   1 
ATOM   5196  C  CE1   . TYR B  1 230 ? 17.512  -43.878  27.371  1.00 56.39  ? 230 TYR B CE1   1 
ATOM   5197  C  CE2   . TYR B  1 230 ? 16.871  -46.071  26.584  1.00 59.59  ? 230 TYR B CE2   1 
ATOM   5198  C  CZ    . TYR B  1 230 ? 16.587  -44.726  26.752  1.00 59.59  ? 230 TYR B CZ    1 
ATOM   5199  O  OH    . TYR B  1 230 ? 15.381  -44.239  26.303  1.00 60.64  ? 230 TYR B OH    1 
ATOM   5200  N  N     . SER B  1 231 ? 19.992  -44.884  31.442  1.00 53.44  ? 231 SER B N     1 
ATOM   5201  C  CA    . SER B  1 231 ? 20.015  -43.579  32.107  1.00 51.66  ? 231 SER B CA    1 
ATOM   5202  C  C     . SER B  1 231 ? 20.371  -43.613  33.597  1.00 50.01  ? 231 SER B C     1 
ATOM   5203  O  O     . SER B  1 231 ? 20.179  -44.628  34.272  1.00 50.19  ? 231 SER B O     1 
ATOM   5204  C  CB    . SER B  1 231 ? 18.728  -42.777  31.845  1.00 51.41  ? 231 SER B CB    1 
ATOM   5205  O  OG    . SER B  1 231 ? 17.594  -43.614  31.812  1.00 53.84  ? 231 SER B OG    1 
ATOM   5206  N  N     . ILE B  1 232 ? 20.925  -42.496  34.066  1.00 48.31  ? 232 ILE B N     1 
ATOM   5207  C  CA    . ILE B  1 232 ? 21.397  -42.330  35.436  1.00 47.43  ? 232 ILE B CA    1 
ATOM   5208  C  C     . ILE B  1 232 ? 20.697  -41.138  36.073  1.00 46.35  ? 232 ILE B C     1 
ATOM   5209  O  O     . ILE B  1 232 ? 20.611  -40.057  35.474  1.00 45.96  ? 232 ILE B O     1 
ATOM   5210  C  CB    . ILE B  1 232 ? 22.933  -42.093  35.485  1.00 46.96  ? 232 ILE B CB    1 
ATOM   5211  C  CG1   . ILE B  1 232 ? 23.646  -43.126  34.606  1.00 48.20  ? 232 ILE B CG1   1 
ATOM   5212  C  CG2   . ILE B  1 232 ? 23.449  -42.102  36.944  1.00 44.94  ? 232 ILE B CG2   1 
ATOM   5213  C  CD1   . ILE B  1 232 ? 25.118  -42.873  34.405  1.00 48.30  ? 232 ILE B CD1   1 
ATOM   5214  N  N     . ILE B  1 233 ? 20.193  -41.335  37.281  1.00 46.06  ? 233 ILE B N     1 
ATOM   5215  C  CA    . ILE B  1 233 ? 19.533  -40.246  37.980  1.00 45.50  ? 233 ILE B CA    1 
ATOM   5216  C  C     . ILE B  1 233 ? 20.390  -39.753  39.145  1.00 44.63  ? 233 ILE B C     1 
ATOM   5217  O  O     . ILE B  1 233 ? 20.900  -40.550  39.934  1.00 45.46  ? 233 ILE B O     1 
ATOM   5218  C  CB    . ILE B  1 233 ? 18.116  -40.630  38.463  1.00 45.90  ? 233 ILE B CB    1 
ATOM   5219  C  CG1   . ILE B  1 233 ? 17.348  -41.394  37.377  1.00 47.25  ? 233 ILE B CG1   1 
ATOM   5220  C  CG2   . ILE B  1 233 ? 17.349  -39.388  38.890  1.00 45.19  ? 233 ILE B CG2   1 
ATOM   5221  C  CD1   . ILE B  1 233 ? 17.286  -40.713  36.022  1.00 46.63  ? 233 ILE B CD1   1 
ATOM   5222  N  N     . VAL B  1 234 ? 20.565  -38.441  39.223  1.00 43.40  ? 234 VAL B N     1 
ATOM   5223  C  CA    . VAL B  1 234 ? 21.314  -37.822  40.300  1.00 42.43  ? 234 VAL B CA    1 
ATOM   5224  C  C     . VAL B  1 234 ? 20.377  -36.813  40.942  1.00 42.01  ? 234 VAL B C     1 
ATOM   5225  O  O     . VAL B  1 234 ? 19.967  -35.837  40.305  1.00 42.15  ? 234 VAL B O     1 
ATOM   5226  C  CB    . VAL B  1 234 ? 22.613  -37.145  39.780  1.00 41.69  ? 234 VAL B CB    1 
ATOM   5227  C  CG1   . VAL B  1 234 ? 23.323  -36.357  40.890  1.00 40.53  ? 234 VAL B CG1   1 
ATOM   5228  C  CG2   . VAL B  1 234 ? 23.547  -38.187  39.233  1.00 42.08  ? 234 VAL B CG2   1 
ATOM   5229  N  N     . ALA B  1 235 ? 20.007  -37.050  42.189  1.00 41.76  ? 235 ALA B N     1 
ATOM   5230  C  CA    . ALA B  1 235 ? 18.970  -36.232  42.780  1.00 41.59  ? 235 ALA B CA    1 
ATOM   5231  C  C     . ALA B  1 235 ? 19.450  -35.531  44.030  1.00 41.01  ? 235 ALA B C     1 
ATOM   5232  O  O     . ALA B  1 235 ? 20.060  -36.150  44.905  1.00 41.91  ? 235 ALA B O     1 
ATOM   5233  C  CB    . ALA B  1 235 ? 17.718  -37.068  43.057  1.00 42.31  ? 235 ALA B CB    1 
ATOM   5234  N  N     . ALA B  1 236 ? 19.195  -34.231  44.089  1.00 40.06  ? 236 ALA B N     1 
ATOM   5235  C  CA    . ALA B  1 236 ? 19.405  -33.444  45.287  1.00 39.59  ? 236 ALA B CA    1 
ATOM   5236  C  C     . ALA B  1 236 ? 18.137  -32.666  45.437  1.00 39.56  ? 236 ALA B C     1 
ATOM   5237  O  O     . ALA B  1 236 ? 17.952  -31.632  44.798  1.00 39.26  ? 236 ALA B O     1 
ATOM   5238  C  CB    . ALA B  1 236 ? 20.589  -32.497  45.127  1.00 39.16  ? 236 ALA B CB    1 
ATOM   5239  N  N     . THR B  1 237 ? 17.240  -33.166  46.265  1.00 39.94  ? 237 THR B N     1 
ATOM   5240  C  CA    . THR B  1 237 ? 15.888  -32.668  46.195  1.00 40.11  ? 237 THR B CA    1 
ATOM   5241  C  C     . THR B  1 237 ? 15.639  -31.539  47.191  1.00 39.74  ? 237 THR B C     1 
ATOM   5242  O  O     . THR B  1 237 ? 16.547  -31.148  47.918  1.00 38.99  ? 237 THR B O     1 
ATOM   5243  C  CB    . THR B  1 237 ? 14.903  -33.798  46.337  1.00 41.22  ? 237 THR B CB    1 
ATOM   5244  O  OG1   . THR B  1 237 ? 15.374  -34.682  47.356  1.00 43.00  ? 237 THR B OG1   1 
ATOM   5245  C  CG2   . THR B  1 237 ? 14.802  -34.558  45.013  1.00 41.29  ? 237 THR B CG2   1 
ATOM   5246  N  N     . ALA B  1 238 ? 14.404  -31.031  47.201  1.00 40.07  ? 238 ALA B N     1 
ATOM   5247  C  CA    . ALA B  1 238 ? 14.004  -29.825  47.926  1.00 39.76  ? 238 ALA B CA    1 
ATOM   5248  C  C     . ALA B  1 238 ? 14.396  -29.683  49.426  1.00 39.74  ? 238 ALA B C     1 
ATOM   5249  O  O     . ALA B  1 238 ? 14.731  -28.601  49.872  1.00 39.62  ? 238 ALA B O     1 
ATOM   5250  C  CB    . ALA B  1 238 ? 12.515  -29.587  47.729  1.00 40.17  ? 238 ALA B CB    1 
ATOM   5251  N  N     . SER B  1 239 ? 14.353  -30.753  50.200  1.00 40.33  ? 239 SER B N     1 
ATOM   5252  C  CA    . SER B  1 239 ? 14.606  -30.612  51.627  1.00 40.68  ? 239 SER B CA    1 
ATOM   5253  C  C     . SER B  1 239 ? 16.076  -30.856  51.978  1.00 40.36  ? 239 SER B C     1 
ATOM   5254  O  O     . SER B  1 239 ? 16.486  -30.715  53.141  1.00 40.55  ? 239 SER B O     1 
ATOM   5255  C  CB    . SER B  1 239 ? 13.686  -31.525  52.439  1.00 41.72  ? 239 SER B CB    1 
ATOM   5256  O  OG    . SER B  1 239 ? 14.017  -32.885  52.243  1.00 42.60  ? 239 SER B OG    1 
ATOM   5257  N  N     . GLU B  1 240 ? 16.872  -31.198  50.974  1.00 39.12  ? 240 GLU B N     1 
ATOM   5258  C  CA    . GLU B  1 240 ? 18.276  -31.419  51.216  1.00 39.06  ? 240 GLU B CA    1 
ATOM   5259  C  C     . GLU B  1 240 ? 19.095  -30.148  51.340  1.00 38.05  ? 240 GLU B C     1 
ATOM   5260  O  O     . GLU B  1 240 ? 18.640  -29.072  50.977  1.00 37.16  ? 240 GLU B O     1 
ATOM   5261  C  CB    . GLU B  1 240 ? 18.846  -32.335  50.171  1.00 39.19  ? 240 GLU B CB    1 
ATOM   5262  C  CG    . GLU B  1 240 ? 18.120  -33.629  50.200  1.00 42.20  ? 240 GLU B CG    1 
ATOM   5263  C  CD    . GLU B  1 240 ? 18.787  -34.632  49.357  1.00 45.82  ? 240 GLU B CD    1 
ATOM   5264  O  OE1   . GLU B  1 240 ? 19.849  -35.153  49.811  1.00 45.64  ? 240 GLU B OE1   1 
ATOM   5265  O  OE2   . GLU B  1 240 ? 18.246  -34.871  48.241  1.00 47.53  ? 240 GLU B OE2   1 
ATOM   5266  N  N     . ALA B  1 241 ? 20.298  -30.306  51.888  1.00 38.12  ? 241 ALA B N     1 
ATOM   5267  C  CA    . ALA B  1 241 ? 21.153  -29.204  52.301  1.00 37.78  ? 241 ALA B CA    1 
ATOM   5268  C  C     . ALA B  1 241 ? 21.653  -28.460  51.079  1.00 37.42  ? 241 ALA B C     1 
ATOM   5269  O  O     . ALA B  1 241 ? 21.995  -29.089  50.081  1.00 37.44  ? 241 ALA B O     1 
ATOM   5270  C  CB    . ALA B  1 241 ? 22.298  -29.738  53.103  1.00 37.95  ? 241 ALA B CB    1 
ATOM   5271  N  N     . ALA B  1 242 ? 21.697  -27.129  51.145  1.00 37.48  ? 242 ALA B N     1 
ATOM   5272  C  CA    . ALA B  1 242 ? 22.048  -26.340  49.967  1.00 37.23  ? 242 ALA B CA    1 
ATOM   5273  C  C     . ALA B  1 242 ? 23.293  -26.883  49.270  1.00 37.51  ? 242 ALA B C     1 
ATOM   5274  O  O     . ALA B  1 242 ? 23.274  -27.041  48.057  1.00 37.89  ? 242 ALA B O     1 
ATOM   5275  C  CB    . ALA B  1 242 ? 22.194  -24.869  50.289  1.00 37.05  ? 242 ALA B CB    1 
ATOM   5276  N  N     . PRO B  1 243 ? 24.366  -27.208  50.022  1.00 38.03  ? 243 PRO B N     1 
ATOM   5277  C  CA    . PRO B  1 243 ? 25.549  -27.703  49.281  1.00 38.31  ? 243 PRO B CA    1 
ATOM   5278  C  C     . PRO B  1 243 ? 25.348  -28.987  48.454  1.00 38.40  ? 243 PRO B C     1 
ATOM   5279  O  O     . PRO B  1 243 ? 26.021  -29.154  47.436  1.00 38.63  ? 243 PRO B O     1 
ATOM   5280  C  CB    . PRO B  1 243 ? 26.608  -27.900  50.371  1.00 38.61  ? 243 PRO B CB    1 
ATOM   5281  C  CG    . PRO B  1 243 ? 26.117  -27.028  51.505  1.00 39.48  ? 243 PRO B CG    1 
ATOM   5282  C  CD    . PRO B  1 243 ? 24.636  -27.078  51.464  1.00 38.38  ? 243 PRO B CD    1 
ATOM   5283  N  N     . LEU B  1 244 ? 24.434  -29.867  48.861  1.00 38.53  ? 244 LEU B N     1 
ATOM   5284  C  CA    . LEU B  1 244 ? 24.150  -31.058  48.080  1.00 38.93  ? 244 LEU B CA    1 
ATOM   5285  C  C     . LEU B  1 244 ? 23.484  -30.685  46.764  1.00 39.47  ? 244 LEU B C     1 
ATOM   5286  O  O     . LEU B  1 244 ? 23.730  -31.314  45.731  1.00 40.50  ? 244 LEU B O     1 
ATOM   5287  C  CB    . LEU B  1 244 ? 23.258  -32.006  48.849  1.00 39.13  ? 244 LEU B CB    1 
ATOM   5288  C  CG    . LEU B  1 244 ? 23.963  -32.838  49.905  1.00 39.31  ? 244 LEU B CG    1 
ATOM   5289  C  CD1   . LEU B  1 244 ? 22.953  -33.543  50.733  1.00 34.88  ? 244 LEU B CD1   1 
ATOM   5290  C  CD2   . LEU B  1 244 ? 24.924  -33.811  49.217  1.00 38.82  ? 244 LEU B CD2   1 
ATOM   5291  N  N     . GLN B  1 245 ? 22.655  -29.647  46.796  1.00 39.17  ? 245 GLN B N     1 
ATOM   5292  C  CA    . GLN B  1 245 ? 22.035  -29.129  45.588  1.00 38.82  ? 245 GLN B CA    1 
ATOM   5293  C  C     . GLN B  1 245 ? 23.028  -28.383  44.708  1.00 38.99  ? 245 GLN B C     1 
ATOM   5294  O  O     . GLN B  1 245 ? 23.000  -28.534  43.485  1.00 39.24  ? 245 GLN B O     1 
ATOM   5295  C  CB    . GLN B  1 245 ? 20.845  -28.249  45.933  1.00 38.23  ? 245 GLN B CB    1 
ATOM   5296  C  CG    . GLN B  1 245 ? 19.666  -29.052  46.454  1.00 38.60  ? 245 GLN B CG    1 
ATOM   5297  C  CD    . GLN B  1 245 ? 18.591  -28.175  47.024  1.00 37.91  ? 245 GLN B CD    1 
ATOM   5298  O  OE1   . GLN B  1 245 ? 17.997  -27.362  46.314  1.00 39.92  ? 245 GLN B OE1   1 
ATOM   5299  N  NE2   . GLN B  1 245 ? 18.354  -28.302  48.306  1.00 35.59  ? 245 GLN B NE2   1 
ATOM   5300  N  N     . TYR B  1 246 ? 23.882  -27.569  45.331  1.00 39.14  ? 246 TYR B N     1 
ATOM   5301  C  CA    . TYR B  1 246 ? 24.964  -26.888  44.645  1.00 39.67  ? 246 TYR B CA    1 
ATOM   5302  C  C     . TYR B  1 246 ? 25.815  -27.932  43.914  1.00 39.91  ? 246 TYR B C     1 
ATOM   5303  O  O     . TYR B  1 246 ? 26.183  -27.752  42.765  1.00 39.53  ? 246 TYR B O     1 
ATOM   5304  C  CB    . TYR B  1 246 ? 25.812  -26.096  45.663  1.00 40.53  ? 246 TYR B CB    1 
ATOM   5305  C  CG    . TYR B  1 246 ? 27.310  -26.050  45.361  1.00 42.37  ? 246 TYR B CG    1 
ATOM   5306  C  CD1   . TYR B  1 246 ? 27.857  -25.040  44.565  1.00 44.34  ? 246 TYR B CD1   1 
ATOM   5307  C  CD2   . TYR B  1 246 ? 28.172  -27.020  45.859  1.00 44.40  ? 246 TYR B CD2   1 
ATOM   5308  C  CE1   . TYR B  1 246 ? 29.238  -24.996  44.272  1.00 46.26  ? 246 TYR B CE1   1 
ATOM   5309  C  CE2   . TYR B  1 246 ? 29.560  -26.998  45.557  1.00 46.95  ? 246 TYR B CE2   1 
ATOM   5310  C  CZ    . TYR B  1 246 ? 30.083  -25.977  44.772  1.00 47.53  ? 246 TYR B CZ    1 
ATOM   5311  O  OH    . TYR B  1 246 ? 31.440  -25.939  44.479  1.00 49.46  ? 246 TYR B OH    1 
ATOM   5312  N  N     . LEU B  1 247 ? 26.083  -29.046  44.580  1.00 40.08  ? 247 LEU B N     1 
ATOM   5313  C  CA    . LEU B  1 247 ? 27.072  -29.991  44.086  1.00 41.09  ? 247 LEU B CA    1 
ATOM   5314  C  C     . LEU B  1 247 ? 26.585  -30.920  42.976  1.00 41.32  ? 247 LEU B C     1 
ATOM   5315  O  O     . LEU B  1 247 ? 27.361  -31.248  42.057  1.00 42.35  ? 247 LEU B O     1 
ATOM   5316  C  CB    . LEU B  1 247 ? 27.633  -30.816  45.249  1.00 41.62  ? 247 LEU B CB    1 
ATOM   5317  C  CG    . LEU B  1 247 ? 28.767  -31.782  44.924  1.00 43.19  ? 247 LEU B CG    1 
ATOM   5318  C  CD1   . LEU B  1 247 ? 30.067  -31.046  44.652  1.00 41.80  ? 247 LEU B CD1   1 
ATOM   5319  C  CD2   . LEU B  1 247 ? 28.904  -32.817  46.073  1.00 45.15  ? 247 LEU B CD2   1 
ATOM   5320  N  N     . ALA B  1 248 ? 25.322  -31.345  43.070  1.00 40.65  ? 248 ALA B N     1 
ATOM   5321  C  CA    . ALA B  1 248 ? 24.761  -32.379  42.200  1.00 40.35  ? 248 ALA B CA    1 
ATOM   5322  C  C     . ALA B  1 248 ? 25.122  -32.254  40.708  1.00 40.63  ? 248 ALA B C     1 
ATOM   5323  O  O     . ALA B  1 248 ? 25.670  -33.199  40.131  1.00 41.53  ? 248 ALA B O     1 
ATOM   5324  C  CB    . ALA B  1 248 ? 23.284  -32.461  42.387  1.00 40.31  ? 248 ALA B CB    1 
ATOM   5325  N  N     . PRO B  1 249 ? 24.851  -31.089  40.083  1.00 39.76  ? 249 PRO B N     1 
ATOM   5326  C  CA    . PRO B  1 249 ? 25.248  -30.996  38.688  1.00 39.97  ? 249 PRO B CA    1 
ATOM   5327  C  C     . PRO B  1 249 ? 26.724  -31.300  38.451  1.00 40.82  ? 249 PRO B C     1 
ATOM   5328  O  O     . PRO B  1 249 ? 27.063  -31.818  37.382  1.00 41.88  ? 249 PRO B O     1 
ATOM   5329  C  CB    . PRO B  1 249 ? 24.945  -29.533  38.330  1.00 39.46  ? 249 PRO B CB    1 
ATOM   5330  C  CG    . PRO B  1 249 ? 23.854  -29.146  39.226  1.00 38.68  ? 249 PRO B CG    1 
ATOM   5331  C  CD    . PRO B  1 249 ? 24.078  -29.907  40.512  1.00 38.88  ? 249 PRO B CD    1 
ATOM   5332  N  N     . PHE B  1 250 ? 27.605  -30.987  39.401  1.00 40.72  ? 250 PHE B N     1 
ATOM   5333  C  CA    . PHE B  1 250 ? 29.051  -31.205  39.150  1.00 41.88  ? 250 PHE B CA    1 
ATOM   5334  C  C     . PHE B  1 250 ? 29.419  -32.690  39.193  1.00 42.33  ? 250 PHE B C     1 
ATOM   5335  O  O     . PHE B  1 250 ? 30.099  -33.201  38.288  1.00 42.85  ? 250 PHE B O     1 
ATOM   5336  C  CB    . PHE B  1 250 ? 29.935  -30.391  40.108  1.00 42.42  ? 250 PHE B CB    1 
ATOM   5337  C  CG    . PHE B  1 250 ? 29.803  -28.898  39.934  1.00 42.56  ? 250 PHE B CG    1 
ATOM   5338  C  CD1   . PHE B  1 250 ? 30.343  -28.266  38.829  1.00 42.79  ? 250 PHE B CD1   1 
ATOM   5339  C  CD2   . PHE B  1 250 ? 29.131  -28.137  40.870  1.00 41.88  ? 250 PHE B CD2   1 
ATOM   5340  C  CE1   . PHE B  1 250 ? 30.223  -26.911  38.667  1.00 43.03  ? 250 PHE B CE1   1 
ATOM   5341  C  CE2   . PHE B  1 250 ? 28.999  -26.778  40.707  1.00 42.48  ? 250 PHE B CE2   1 
ATOM   5342  C  CZ    . PHE B  1 250 ? 29.553  -26.163  39.609  1.00 42.90  ? 250 PHE B CZ    1 
ATOM   5343  N  N     . THR B  1 251 ? 28.936  -33.386  40.224  1.00 41.39  ? 251 THR B N     1 
ATOM   5344  C  CA    . THR B  1 251 ? 29.109  -34.823  40.280  1.00 42.19  ? 251 THR B CA    1 
ATOM   5345  C  C     . THR B  1 251 ? 28.376  -35.557  39.129  1.00 42.72  ? 251 THR B C     1 
ATOM   5346  O  O     . THR B  1 251 ? 28.855  -36.600  38.651  1.00 43.58  ? 251 THR B O     1 
ATOM   5347  C  CB    . THR B  1 251 ? 28.753  -35.410  41.657  1.00 41.82  ? 251 THR B CB    1 
ATOM   5348  O  OG1   . THR B  1 251 ? 27.480  -34.914  42.083  1.00 42.85  ? 251 THR B OG1   1 
ATOM   5349  C  CG2   . THR B  1 251 ? 29.784  -35.005  42.671  1.00 41.64  ? 251 THR B CG2   1 
ATOM   5350  N  N     . ALA B  1 252 ? 27.246  -35.016  38.669  1.00 41.85  ? 252 ALA B N     1 
ATOM   5351  C  CA    . ALA B  1 252 ? 26.597  -35.569  37.477  1.00 42.41  ? 252 ALA B CA    1 
ATOM   5352  C  C     . ALA B  1 252 ? 27.390  -35.373  36.168  1.00 43.44  ? 252 ALA B C     1 
ATOM   5353  O  O     . ALA B  1 252 ? 27.299  -36.201  35.267  1.00 44.52  ? 252 ALA B O     1 
ATOM   5354  C  CB    . ALA B  1 252 ? 25.196  -35.071  37.334  1.00 41.42  ? 252 ALA B CB    1 
ATOM   5355  N  N     . ALA B  1 253 ? 28.181  -34.309  36.062  1.00 43.25  ? 253 ALA B N     1 
ATOM   5356  C  CA    . ALA B  1 253 ? 28.996  -34.121  34.856  1.00 44.15  ? 253 ALA B CA    1 
ATOM   5357  C  C     . ALA B  1 253 ? 30.185  -35.093  34.753  1.00 45.44  ? 253 ALA B C     1 
ATOM   5358  O  O     . ALA B  1 253 ? 30.595  -35.451  33.652  1.00 46.72  ? 253 ALA B O     1 
ATOM   5359  C  CB    . ALA B  1 253 ? 29.462  -32.673  34.725  1.00 43.79  ? 253 ALA B CB    1 
ATOM   5360  N  N     . SER B  1 254 ? 30.734  -35.519  35.888  1.00 45.39  ? 254 SER B N     1 
ATOM   5361  C  CA    . SER B  1 254 ? 31.844  -36.469  35.897  1.00 46.24  ? 254 SER B CA    1 
ATOM   5362  C  C     . SER B  1 254 ? 31.321  -37.842  35.554  1.00 46.97  ? 254 SER B C     1 
ATOM   5363  O  O     . SER B  1 254 ? 32.015  -38.649  34.901  1.00 49.07  ? 254 SER B O     1 
ATOM   5364  C  CB    . SER B  1 254 ? 32.484  -36.527  37.262  1.00 45.89  ? 254 SER B CB    1 
ATOM   5365  O  OG    . SER B  1 254 ? 32.449  -35.253  37.865  1.00 47.30  ? 254 SER B OG    1 
ATOM   5366  N  N     . ILE B  1 255 ? 30.096  -38.109  35.993  1.00 45.68  ? 255 ILE B N     1 
ATOM   5367  C  CA    . ILE B  1 255 ? 29.405  -39.335  35.637  1.00 46.13  ? 255 ILE B CA    1 
ATOM   5368  C  C     . ILE B  1 255 ? 29.165  -39.313  34.128  1.00 47.13  ? 255 ILE B C     1 
ATOM   5369  O  O     . ILE B  1 255 ? 29.372  -40.309  33.447  1.00 48.64  ? 255 ILE B O     1 
ATOM   5370  C  CB    . ILE B  1 255 ? 28.069  -39.486  36.419  1.00 45.07  ? 255 ILE B CB    1 
ATOM   5371  C  CG1   . ILE B  1 255 ? 28.366  -39.782  37.894  1.00 44.71  ? 255 ILE B CG1   1 
ATOM   5372  C  CG2   . ILE B  1 255 ? 27.177  -40.571  35.797  1.00 44.66  ? 255 ILE B CG2   1 
ATOM   5373  C  CD1   . ILE B  1 255 ? 27.153  -39.826  38.804  1.00 43.01  ? 255 ILE B CD1   1 
ATOM   5374  N  N     . GLY B  1 256 ? 28.754  -38.151  33.624  1.00 46.58  ? 256 GLY B N     1 
ATOM   5375  C  CA    . GLY B  1 256 ? 28.501  -37.947  32.215  1.00 47.07  ? 256 GLY B CA    1 
ATOM   5376  C  C     . GLY B  1 256 ? 29.795  -38.004  31.458  1.00 48.27  ? 256 GLY B C     1 
ATOM   5377  O  O     . GLY B  1 256 ? 29.843  -38.553  30.367  1.00 49.36  ? 256 GLY B O     1 
ATOM   5378  N  N     . GLU B  1 257 ? 30.852  -37.470  32.062  1.00 48.34  ? 257 GLU B N     1 
ATOM   5379  C  CA    . GLU B  1 257 ? 32.158  -37.371  31.403  1.00 50.23  ? 257 GLU B CA    1 
ATOM   5380  C  C     . GLU B  1 257 ? 32.813  -38.718  31.092  1.00 51.75  ? 257 GLU B C     1 
ATOM   5381  O  O     . GLU B  1 257 ? 33.591  -38.815  30.139  1.00 52.45  ? 257 GLU B O     1 
ATOM   5382  C  CB    . GLU B  1 257 ? 33.118  -36.532  32.233  1.00 49.90  ? 257 GLU B CB    1 
ATOM   5383  C  CG    . GLU B  1 257 ? 33.072  -35.052  31.957  1.00 50.75  ? 257 GLU B CG    1 
ATOM   5384  C  CD    . GLU B  1 257 ? 33.734  -34.254  33.073  1.00 52.87  ? 257 GLU B CD    1 
ATOM   5385  O  OE1   . GLU B  1 257 ? 34.407  -34.869  33.937  1.00 54.89  ? 257 GLU B OE1   1 
ATOM   5386  O  OE2   . GLU B  1 257 ? 33.587  -33.015  33.091  1.00 52.00  ? 257 GLU B OE2   1 
ATOM   5387  N  N     . TRP B  1 258 ? 32.508  -39.736  31.908  1.00 51.64  ? 258 TRP B N     1 
ATOM   5388  C  CA    . TRP B  1 258 ? 33.092  -41.067  31.726  1.00 53.12  ? 258 TRP B CA    1 
ATOM   5389  C  C     . TRP B  1 258 ? 32.789  -41.555  30.317  1.00 54.68  ? 258 TRP B C     1 
ATOM   5390  O  O     . TRP B  1 258 ? 33.670  -42.056  29.591  1.00 56.26  ? 258 TRP B O     1 
ATOM   5391  C  CB    . TRP B  1 258 ? 32.579  -42.081  32.762  1.00 52.74  ? 258 TRP B CB    1 
ATOM   5392  C  CG    . TRP B  1 258 ? 33.267  -43.376  32.608  1.00 54.11  ? 258 TRP B CG    1 
ATOM   5393  C  CD1   . TRP B  1 258 ? 34.424  -43.754  33.212  1.00 56.43  ? 258 TRP B CD1   1 
ATOM   5394  C  CD2   . TRP B  1 258 ? 32.892  -44.455  31.741  1.00 55.02  ? 258 TRP B CD2   1 
ATOM   5395  N  NE1   . TRP B  1 258 ? 34.801  -45.010  32.781  1.00 58.48  ? 258 TRP B NE1   1 
ATOM   5396  C  CE2   . TRP B  1 258 ? 33.878  -45.465  31.878  1.00 56.81  ? 258 TRP B CE2   1 
ATOM   5397  C  CE3   . TRP B  1 258 ? 31.821  -44.671  30.865  1.00 54.40  ? 258 TRP B CE3   1 
ATOM   5398  C  CZ2   . TRP B  1 258 ? 33.827  -46.671  31.176  1.00 56.05  ? 258 TRP B CZ2   1 
ATOM   5399  C  CZ3   . TRP B  1 258 ? 31.769  -45.878  30.165  1.00 56.47  ? 258 TRP B CZ3   1 
ATOM   5400  C  CH2   . TRP B  1 258 ? 32.773  -46.856  30.322  1.00 56.72  ? 258 TRP B CH2   1 
ATOM   5401  N  N     . PHE B  1 259 ? 31.531  -41.402  29.927  1.00 54.22  ? 259 PHE B N     1 
ATOM   5402  C  CA    . PHE B  1 259 ? 31.138  -41.798  28.589  1.00 55.54  ? 259 PHE B CA    1 
ATOM   5403  C  C     . PHE B  1 259 ? 31.933  -41.000  27.561  1.00 56.36  ? 259 PHE B C     1 
ATOM   5404  O  O     . PHE B  1 259 ? 32.556  -41.589  26.671  1.00 58.22  ? 259 PHE B O     1 
ATOM   5405  C  CB    . PHE B  1 259 ? 29.622  -41.688  28.406  1.00 54.86  ? 259 PHE B CB    1 
ATOM   5406  C  CG    . PHE B  1 259 ? 28.838  -42.542  29.373  1.00 53.62  ? 259 PHE B CG    1 
ATOM   5407  C  CD1   . PHE B  1 259 ? 28.717  -43.917  29.170  1.00 53.56  ? 259 PHE B CD1   1 
ATOM   5408  C  CD2   . PHE B  1 259 ? 28.228  -41.972  30.489  1.00 50.82  ? 259 PHE B CD2   1 
ATOM   5409  C  CE1   . PHE B  1 259 ? 27.997  -44.715  30.066  1.00 53.51  ? 259 PHE B CE1   1 
ATOM   5410  C  CE2   . PHE B  1 259 ? 27.497  -42.766  31.395  1.00 50.44  ? 259 PHE B CE2   1 
ATOM   5411  C  CZ    . PHE B  1 259 ? 27.385  -44.138  31.183  1.00 51.05  ? 259 PHE B CZ    1 
ATOM   5412  N  N     . ARG B  1 260 ? 31.955  -39.678  27.728  1.00 55.10  ? 260 ARG B N     1 
ATOM   5413  C  CA    . ARG B  1 260 ? 32.734  -38.787  26.859  1.00 56.14  ? 260 ARG B CA    1 
ATOM   5414  C  C     . ARG B  1 260 ? 34.205  -39.243  26.656  1.00 57.69  ? 260 ARG B C     1 
ATOM   5415  O  O     . ARG B  1 260 ? 34.694  -39.259  25.528  1.00 59.85  ? 260 ARG B O     1 
ATOM   5416  C  CB    . ARG B  1 260 ? 32.686  -37.353  27.409  1.00 54.71  ? 260 ARG B CB    1 
ATOM   5417  C  CG    . ARG B  1 260 ? 33.212  -36.275  26.460  1.00 55.60  ? 260 ARG B CG    1 
ATOM   5418  C  CD    . ARG B  1 260 ? 33.523  -34.977  27.193  1.00 54.09  ? 260 ARG B CD    1 
ATOM   5419  N  NE    . ARG B  1 260 ? 34.593  -35.157  28.164  1.00 55.75  ? 260 ARG B NE    1 
ATOM   5420  C  CZ    . ARG B  1 260 ? 34.956  -34.260  29.084  1.00 58.24  ? 260 ARG B CZ    1 
ATOM   5421  N  NH1   . ARG B  1 260 ? 34.341  -33.080  29.189  1.00 57.56  ? 260 ARG B NH1   1 
ATOM   5422  N  NH2   . ARG B  1 260 ? 35.941  -34.553  29.927  1.00 59.76  ? 260 ARG B NH2   1 
ATOM   5423  N  N     . ASP B  1 261 ? 34.886  -39.628  27.737  1.00 57.08  ? 261 ASP B N     1 
ATOM   5424  C  CA    . ASP B  1 261 ? 36.325  -39.922  27.711  1.00 58.67  ? 261 ASP B CA    1 
ATOM   5425  C  C     . ASP B  1 261 ? 36.654  -41.337  27.217  1.00 60.46  ? 261 ASP B C     1 
ATOM   5426  O  O     . ASP B  1 261 ? 37.825  -41.693  27.050  1.00 61.82  ? 261 ASP B O     1 
ATOM   5427  C  CB    . ASP B  1 261 ? 36.934  -39.720  29.104  1.00 57.94  ? 261 ASP B CB    1 
ATOM   5428  C  CG    . ASP B  1 261 ? 36.792  -38.290  29.612  1.00 57.42  ? 261 ASP B CG    1 
ATOM   5429  O  OD1   . ASP B  1 261 ? 36.653  -37.383  28.763  1.00 59.91  ? 261 ASP B OD1   1 
ATOM   5430  O  OD2   . ASP B  1 261 ? 36.829  -38.067  30.850  1.00 54.79  ? 261 ASP B OD2   1 
ATOM   5431  N  N     . ASN B  1 262 ? 35.608  -42.128  26.991  1.00 60.12  ? 262 ASN B N     1 
ATOM   5432  C  CA    . ASN B  1 262 ? 35.725  -43.540  26.640  1.00 61.18  ? 262 ASN B CA    1 
ATOM   5433  C  C     . ASN B  1 262 ? 35.001  -43.836  25.330  1.00 61.95  ? 262 ASN B C     1 
ATOM   5434  O  O     . ASN B  1 262 ? 34.412  -44.901  25.154  1.00 62.29  ? 262 ASN B O     1 
ATOM   5435  C  CB    . ASN B  1 262 ? 35.187  -44.412  27.785  1.00 60.25  ? 262 ASN B CB    1 
ATOM   5436  C  CG    . ASN B  1 262 ? 36.097  -44.401  29.006  1.00 59.52  ? 262 ASN B CG    1 
ATOM   5437  O  OD1   . ASN B  1 262 ? 37.176  -45.004  28.990  1.00 60.67  ? 262 ASN B OD1   1 
ATOM   5438  N  ND2   . ASN B  1 262 ? 35.669  -43.717  30.070  1.00 55.87  ? 262 ASN B ND2   1 
ATOM   5439  N  N     . GLY B  1 263 ? 35.047  -42.858  24.430  1.00 62.12  ? 263 GLY B N     1 
ATOM   5440  C  CA    . GLY B  1 263 ? 34.558  -42.993  23.064  1.00 63.62  ? 263 GLY B CA    1 
ATOM   5441  C  C     . GLY B  1 263 ? 33.072  -43.236  22.904  1.00 63.27  ? 263 GLY B C     1 
ATOM   5442  O  O     . GLY B  1 263 ? 32.655  -43.815  21.901  1.00 65.11  ? 263 GLY B O     1 
ATOM   5443  N  N     . LYS B  1 264 ? 32.281  -42.810  23.891  1.00 61.33  ? 264 LYS B N     1 
ATOM   5444  C  CA    . LYS B  1 264 ? 30.822  -42.976  23.882  1.00 60.82  ? 264 LYS B CA    1 
ATOM   5445  C  C     . LYS B  1 264 ? 30.167  -41.629  24.106  1.00 59.04  ? 264 LYS B C     1 
ATOM   5446  O  O     . LYS B  1 264 ? 30.879  -40.634  24.255  1.00 58.76  ? 264 LYS B O     1 
ATOM   5447  C  CB    . LYS B  1 264 ? 30.394  -43.947  24.963  1.00 60.21  ? 264 LYS B CB    1 
ATOM   5448  C  CG    . LYS B  1 264 ? 30.985  -45.308  24.777  1.00 63.14  ? 264 LYS B CG    1 
ATOM   5449  C  CD    . LYS B  1 264 ? 30.761  -46.197  25.977  1.00 64.16  ? 264 LYS B CD    1 
ATOM   5450  C  CE    . LYS B  1 264 ? 31.191  -47.584  25.601  1.00 68.14  ? 264 LYS B CE    1 
ATOM   5451  N  NZ    . LYS B  1 264 ? 32.024  -48.126  26.683  1.00 71.35  ? 264 LYS B NZ    1 
ATOM   5452  N  N     . HIS B  1 265 ? 28.830  -41.591  24.131  1.00 58.08  ? 265 HIS B N     1 
ATOM   5453  C  CA    . HIS B  1 265 ? 28.081  -40.317  24.156  1.00 56.37  ? 265 HIS B CA    1 
ATOM   5454  C  C     . HIS B  1 265 ? 27.042  -40.269  25.254  1.00 54.86  ? 265 HIS B C     1 
ATOM   5455  O  O     . HIS B  1 265 ? 26.323  -41.249  25.487  1.00 55.84  ? 265 HIS B O     1 
ATOM   5456  C  CB    . HIS B  1 265 ? 27.408  -40.067  22.816  1.00 57.57  ? 265 HIS B CB    1 
ATOM   5457  C  CG    . HIS B  1 265 ? 28.352  -40.117  21.662  1.00 59.45  ? 265 HIS B CG    1 
ATOM   5458  N  ND1   . HIS B  1 265 ? 29.081  -39.024  21.252  1.00 59.51  ? 265 HIS B ND1   1 
ATOM   5459  C  CD2   . HIS B  1 265 ? 28.722  -41.141  20.858  1.00 61.03  ? 265 HIS B CD2   1 
ATOM   5460  C  CE1   . HIS B  1 265 ? 29.848  -39.368  20.232  1.00 62.10  ? 265 HIS B CE1   1 
ATOM   5461  N  NE2   . HIS B  1 265 ? 29.641  -40.646  19.967  1.00 62.74  ? 265 HIS B NE2   1 
ATOM   5462  N  N     . ALA B  1 266 ? 26.960  -39.132  25.938  1.00 52.78  ? 266 ALA B N     1 
ATOM   5463  C  CA    . ALA B  1 266 ? 26.043  -39.000  27.062  1.00 50.73  ? 266 ALA B CA    1 
ATOM   5464  C  C     . ALA B  1 266 ? 25.286  -37.698  27.003  1.00 49.55  ? 266 ALA B C     1 
ATOM   5465  O  O     . ALA B  1 266 ? 25.836  -36.681  26.662  1.00 49.98  ? 266 ALA B O     1 
ATOM   5466  C  CB    . ALA B  1 266 ? 26.788  -39.116  28.375  1.00 49.43  ? 266 ALA B CB    1 
ATOM   5467  N  N     . LEU B  1 267 ? 24.012  -37.740  27.331  1.00 49.06  ? 267 LEU B N     1 
ATOM   5468  C  CA    . LEU B  1 267 ? 23.199  -36.545  27.400  1.00 48.16  ? 267 LEU B CA    1 
ATOM   5469  C  C     . LEU B  1 267 ? 22.939  -36.218  28.862  1.00 46.75  ? 267 LEU B C     1 
ATOM   5470  O  O     . LEU B  1 267 ? 22.559  -37.077  29.655  1.00 46.20  ? 267 LEU B O     1 
ATOM   5471  C  CB    . LEU B  1 267 ? 21.887  -36.765  26.651  1.00 49.02  ? 267 LEU B CB    1 
ATOM   5472  C  CG    . LEU B  1 267 ? 20.774  -35.721  26.655  1.00 48.31  ? 267 LEU B CG    1 
ATOM   5473  C  CD1   . LEU B  1 267 ? 21.242  -34.399  26.123  1.00 48.41  ? 267 LEU B CD1   1 
ATOM   5474  C  CD2   . LEU B  1 267 ? 19.634  -36.227  25.813  1.00 48.81  ? 267 LEU B CD2   1 
ATOM   5475  N  N     . ILE B  1 268 ? 23.163  -34.969  29.222  1.00 46.23  ? 268 ILE B N     1 
ATOM   5476  C  CA    . ILE B  1 268 ? 22.938  -34.550  30.589  1.00 45.10  ? 268 ILE B CA    1 
ATOM   5477  C  C     . ILE B  1 268 ? 21.931  -33.413  30.672  1.00 44.36  ? 268 ILE B C     1 
ATOM   5478  O  O     . ILE B  1 268 ? 22.108  -32.368  30.067  1.00 44.80  ? 268 ILE B O     1 
ATOM   5479  C  CB    . ILE B  1 268 ? 24.266  -34.240  31.313  1.00 44.50  ? 268 ILE B CB    1 
ATOM   5480  C  CG1   . ILE B  1 268 ? 24.014  -34.040  32.798  1.00 43.56  ? 268 ILE B CG1   1 
ATOM   5481  C  CG2   . ILE B  1 268 ? 25.015  -33.048  30.679  1.00 44.87  ? 268 ILE B CG2   1 
ATOM   5482  C  CD1   . ILE B  1 268 ? 25.209  -34.407  33.610  1.00 45.53  ? 268 ILE B CD1   1 
ATOM   5483  N  N     . VAL B  1 269 ? 20.856  -33.663  31.398  1.00 44.08  ? 269 VAL B N     1 
ATOM   5484  C  CA    . VAL B  1 269 ? 19.824  -32.672  31.682  1.00 43.76  ? 269 VAL B CA    1 
ATOM   5485  C  C     . VAL B  1 269 ? 20.072  -32.128  33.079  1.00 42.81  ? 269 VAL B C     1 
ATOM   5486  O  O     . VAL B  1 269 ? 20.127  -32.890  34.058  1.00 42.31  ? 269 VAL B O     1 
ATOM   5487  C  CB    . VAL B  1 269 ? 18.430  -33.324  31.685  1.00 44.17  ? 269 VAL B CB    1 
ATOM   5488  C  CG1   . VAL B  1 269 ? 17.351  -32.296  31.916  1.00 43.32  ? 269 VAL B CG1   1 
ATOM   5489  C  CG2   . VAL B  1 269 ? 18.209  -34.072  30.405  1.00 45.15  ? 269 VAL B CG2   1 
ATOM   5490  N  N     . TYR B  1 270 ? 20.227  -30.815  33.172  1.00 42.77  ? 270 TYR B N     1 
ATOM   5491  C  CA    . TYR B  1 270 ? 20.314  -30.147  34.465  1.00 41.70  ? 270 TYR B CA    1 
ATOM   5492  C  C     . TYR B  1 270 ? 18.958  -29.524  34.863  1.00 41.77  ? 270 TYR B C     1 
ATOM   5493  O  O     . TYR B  1 270 ? 18.667  -28.390  34.517  1.00 41.71  ? 270 TYR B O     1 
ATOM   5494  C  CB    . TYR B  1 270 ? 21.396  -29.092  34.405  1.00 40.74  ? 270 TYR B CB    1 
ATOM   5495  C  CG    . TYR B  1 270 ? 22.767  -29.624  34.137  1.00 41.15  ? 270 TYR B CG    1 
ATOM   5496  C  CD1   . TYR B  1 270 ? 23.377  -30.510  35.007  1.00 41.15  ? 270 TYR B CD1   1 
ATOM   5497  C  CD2   . TYR B  1 270 ? 23.480  -29.210  33.013  1.00 43.70  ? 270 TYR B CD2   1 
ATOM   5498  C  CE1   . TYR B  1 270 ? 24.671  -30.990  34.761  1.00 41.02  ? 270 TYR B CE1   1 
ATOM   5499  C  CE2   . TYR B  1 270 ? 24.758  -29.674  32.753  1.00 43.78  ? 270 TYR B CE2   1 
ATOM   5500  C  CZ    . TYR B  1 270 ? 25.353  -30.561  33.637  1.00 43.27  ? 270 TYR B CZ    1 
ATOM   5501  O  OH    . TYR B  1 270 ? 26.628  -31.014  33.362  1.00 44.40  ? 270 TYR B OH    1 
ATOM   5502  N  N     . ASP B  1 271 ? 18.136  -30.276  35.585  1.00 42.35  ? 271 ASP B N     1 
ATOM   5503  C  CA    . ASP B  1 271 ? 16.767  -29.837  35.921  1.00 43.52  ? 271 ASP B CA    1 
ATOM   5504  C  C     . ASP B  1 271 ? 16.614  -29.448  37.397  1.00 42.60  ? 271 ASP B C     1 
ATOM   5505  O  O     . ASP B  1 271 ? 16.505  -30.336  38.247  1.00 42.34  ? 271 ASP B O     1 
ATOM   5506  C  CB    . ASP B  1 271 ? 15.785  -30.966  35.613  1.00 44.77  ? 271 ASP B CB    1 
ATOM   5507  C  CG    . ASP B  1 271 ? 14.476  -30.464  35.016  1.00 48.87  ? 271 ASP B CG    1 
ATOM   5508  O  OD1   . ASP B  1 271 ? 14.117  -29.271  35.227  1.00 51.63  ? 271 ASP B OD1   1 
ATOM   5509  O  OD2   . ASP B  1 271 ? 13.795  -31.269  34.331  1.00 50.67  ? 271 ASP B OD2   1 
ATOM   5510  N  N     . ASP B  1 272 ? 16.674  -28.156  37.738  1.00 42.37  ? 272 ASP B N     1 
ATOM   5511  C  CA    . ASP B  1 272 ? 17.082  -27.076  36.842  1.00 42.66  ? 272 ASP B CA    1 
ATOM   5512  C  C     . ASP B  1 272 ? 18.180  -26.220  37.469  1.00 41.58  ? 272 ASP B C     1 
ATOM   5513  O  O     . ASP B  1 272 ? 18.424  -26.285  38.667  1.00 41.59  ? 272 ASP B O     1 
ATOM   5514  C  CB    . ASP B  1 272 ? 15.881  -26.208  36.468  1.00 43.81  ? 272 ASP B CB    1 
ATOM   5515  C  CG    . ASP B  1 272 ? 15.150  -25.638  37.687  1.00 45.23  ? 272 ASP B CG    1 
ATOM   5516  O  OD1   . ASP B  1 272 ? 15.781  -24.848  38.432  1.00 46.02  ? 272 ASP B OD1   1 
ATOM   5517  O  OD2   . ASP B  1 272 ? 13.941  -25.956  37.880  1.00 45.72  ? 272 ASP B OD2   1 
ATOM   5518  N  N     . LEU B  1 273 ? 18.818  -25.396  36.662  1.00 41.49  ? 273 LEU B N     1 
ATOM   5519  C  CA    . LEU B  1 273 ? 19.939  -24.603  37.104  1.00 40.98  ? 273 LEU B CA    1 
ATOM   5520  C  C     . LEU B  1 273 ? 19.513  -23.415  37.961  1.00 41.12  ? 273 LEU B C     1 
ATOM   5521  O  O     . LEU B  1 273 ? 20.270  -22.963  38.835  1.00 41.15  ? 273 LEU B O     1 
ATOM   5522  C  CB    . LEU B  1 273 ? 20.770  -24.154  35.890  1.00 41.81  ? 273 LEU B CB    1 
ATOM   5523  C  CG    . LEU B  1 273 ? 21.625  -25.248  35.204  1.00 41.84  ? 273 LEU B CG    1 
ATOM   5524  C  CD1   . LEU B  1 273 ? 22.729  -24.619  34.375  1.00 43.14  ? 273 LEU B CD1   1 
ATOM   5525  C  CD2   . LEU B  1 273 ? 22.270  -26.234  36.188  1.00 40.30  ? 273 LEU B CD2   1 
ATOM   5526  N  N     . SER B  1 274 ? 18.301  -22.915  37.715  1.00 41.34  ? 274 SER B N     1 
ATOM   5527  C  CA    . SER B  1 274 ? 17.693  -21.877  38.544  1.00 40.76  ? 274 SER B CA    1 
ATOM   5528  C  C     . SER B  1 274 ? 17.740  -22.239  40.001  1.00 39.95  ? 274 SER B C     1 
ATOM   5529  O  O     . SER B  1 274 ? 18.119  -21.413  40.832  1.00 39.98  ? 274 SER B O     1 
ATOM   5530  C  CB    . SER B  1 274 ? 16.248  -21.698  38.160  1.00 41.51  ? 274 SER B CB    1 
ATOM   5531  O  OG    . SER B  1 274 ? 16.156  -20.875  37.020  1.00 44.45  ? 274 SER B OG    1 
ATOM   5532  N  N     . LYS B  1 275 ? 17.351  -23.479  40.306  1.00 39.23  ? 275 LYS B N     1 
ATOM   5533  C  CA    . LYS B  1 275 ? 17.372  -23.976  41.669  1.00 38.09  ? 275 LYS B CA    1 
ATOM   5534  C  C     . LYS B  1 275 ? 18.794  -24.232  42.171  1.00 37.55  ? 275 LYS B C     1 
ATOM   5535  O  O     . LYS B  1 275 ? 19.062  -24.058  43.366  1.00 36.91  ? 275 LYS B O     1 
ATOM   5536  C  CB    . LYS B  1 275 ? 16.503  -25.206  41.804  1.00 37.79  ? 275 LYS B CB    1 
ATOM   5537  C  CG    . LYS B  1 275 ? 15.041  -24.892  41.783  1.00 36.92  ? 275 LYS B CG    1 
ATOM   5538  C  CD    . LYS B  1 275 ? 14.231  -26.149  41.596  1.00 36.31  ? 275 LYS B CD    1 
ATOM   5539  C  CE    . LYS B  1 275 ? 12.770  -25.865  41.781  1.00 37.14  ? 275 LYS B CE    1 
ATOM   5540  N  NZ    . LYS B  1 275 ? 12.254  -25.127  40.645  1.00 40.28  ? 275 LYS B NZ    1 
ATOM   5541  N  N     . GLN B  1 276 ? 19.712  -24.606  41.271  1.00 37.39  ? 276 GLN B N     1 
ATOM   5542  C  CA    . GLN B  1 276 ? 21.122  -24.772  41.698  1.00 37.02  ? 276 GLN B CA    1 
ATOM   5543  C  C     . GLN B  1 276 ? 21.629  -23.409  42.142  1.00 36.94  ? 276 GLN B C     1 
ATOM   5544  O  O     . GLN B  1 276 ? 22.181  -23.269  43.233  1.00 36.67  ? 276 GLN B O     1 
ATOM   5545  C  CB    . GLN B  1 276 ? 22.029  -25.369  40.612  1.00 36.84  ? 276 GLN B CB    1 
ATOM   5546  C  CG    . GLN B  1 276 ? 23.443  -25.734  41.102  1.00 36.25  ? 276 GLN B CG    1 
ATOM   5547  C  CD    . GLN B  1 276 ? 24.511  -25.517  40.036  1.00 37.86  ? 276 GLN B CD    1 
ATOM   5548  O  OE1   . GLN B  1 276 ? 24.246  -24.905  39.016  1.00 40.89  ? 276 GLN B OE1   1 
ATOM   5549  N  NE2   . GLN B  1 276 ? 25.718  -26.010  40.269  1.00 38.24  ? 276 GLN B NE2   1 
ATOM   5550  N  N     . ALA B  1 277 ? 21.370  -22.397  41.313  1.00 37.15  ? 277 ALA B N     1 
ATOM   5551  C  CA    . ALA B  1 277 ? 21.812  -21.047  41.611  1.00 36.78  ? 277 ALA B CA    1 
ATOM   5552  C  C     . ALA B  1 277 ? 21.243  -20.565  42.928  1.00 36.18  ? 277 ALA B C     1 
ATOM   5553  O  O     . ALA B  1 277 ? 21.958  -19.936  43.680  1.00 37.15  ? 277 ALA B O     1 
ATOM   5554  C  CB    . ALA B  1 277 ? 21.485  -20.085  40.477  1.00 36.94  ? 277 ALA B CB    1 
ATOM   5555  N  N     . VAL B  1 278 ? 19.984  -20.877  43.218  1.00 35.70  ? 278 VAL B N     1 
ATOM   5556  C  CA    . VAL B  1 278 ? 19.341  -20.435  44.462  1.00 35.41  ? 278 VAL B CA    1 
ATOM   5557  C  C     . VAL B  1 278 ? 20.064  -21.047  45.672  1.00 35.38  ? 278 VAL B C     1 
ATOM   5558  O  O     . VAL B  1 278 ? 20.360  -20.349  46.642  1.00 35.43  ? 278 VAL B O     1 
ATOM   5559  C  CB    . VAL B  1 278 ? 17.785  -20.747  44.468  1.00 35.38  ? 278 VAL B CB    1 
ATOM   5560  C  CG1   . VAL B  1 278 ? 17.217  -20.805  45.850  1.00 31.59  ? 278 VAL B CG1   1 
ATOM   5561  C  CG2   . VAL B  1 278 ? 17.059  -19.706  43.676  1.00 36.44  ? 278 VAL B CG2   1 
ATOM   5562  N  N     . ALA B  1 279 ? 20.360  -22.345  45.589  1.00 35.00  ? 279 ALA B N     1 
ATOM   5563  C  CA    . ALA B  1 279 ? 21.092  -23.028  46.633  1.00 35.01  ? 279 ALA B CA    1 
ATOM   5564  C  C     . ALA B  1 279 ? 22.470  -22.411  46.806  1.00 35.20  ? 279 ALA B C     1 
ATOM   5565  O  O     . ALA B  1 279 ? 22.935  -22.211  47.914  1.00 36.24  ? 279 ALA B O     1 
ATOM   5566  C  CB    . ALA B  1 279 ? 21.210  -24.510  46.329  1.00 34.74  ? 279 ALA B CB    1 
ATOM   5567  N  N     . TYR B  1 280 ? 23.122  -22.093  45.710  1.00 34.95  ? 280 TYR B N     1 
ATOM   5568  C  CA    . TYR B  1 280 ? 24.409  -21.494  45.812  1.00 35.34  ? 280 TYR B CA    1 
ATOM   5569  C  C     . TYR B  1 280 ? 24.287  -20.155  46.498  1.00 35.33  ? 280 TYR B C     1 
ATOM   5570  O  O     . TYR B  1 280 ? 25.165  -19.766  47.264  1.00 36.00  ? 280 TYR B O     1 
ATOM   5571  C  CB    . TYR B  1 280 ? 25.043  -21.332  44.431  1.00 36.27  ? 280 TYR B CB    1 
ATOM   5572  C  CG    . TYR B  1 280 ? 26.513  -21.006  44.506  1.00 37.44  ? 280 TYR B CG    1 
ATOM   5573  C  CD1   . TYR B  1 280 ? 27.416  -21.881  45.103  1.00 37.97  ? 280 TYR B CD1   1 
ATOM   5574  C  CD2   . TYR B  1 280 ? 26.994  -19.821  44.010  1.00 38.84  ? 280 TYR B CD2   1 
ATOM   5575  C  CE1   . TYR B  1 280 ? 28.752  -21.577  45.193  1.00 36.45  ? 280 TYR B CE1   1 
ATOM   5576  C  CE2   . TYR B  1 280 ? 28.326  -19.519  44.091  1.00 39.41  ? 280 TYR B CE2   1 
ATOM   5577  C  CZ    . TYR B  1 280 ? 29.190  -20.393  44.688  1.00 37.67  ? 280 TYR B CZ    1 
ATOM   5578  O  OH    . TYR B  1 280 ? 30.506  -20.060  44.749  1.00 39.57  ? 280 TYR B OH    1 
ATOM   5579  N  N     . ARG B  1 281 ? 23.204  -19.442  46.239  1.00 34.69  ? 281 ARG B N     1 
ATOM   5580  C  CA    . ARG B  1 281 ? 23.048  -18.146  46.863  1.00 35.18  ? 281 ARG B CA    1 
ATOM   5581  C  C     . ARG B  1 281 ? 22.894  -18.288  48.392  1.00 35.44  ? 281 ARG B C     1 
ATOM   5582  O  O     . ARG B  1 281 ? 23.431  -17.481  49.156  1.00 35.83  ? 281 ARG B O     1 
ATOM   5583  C  CB    . ARG B  1 281 ? 21.904  -17.357  46.231  1.00 35.02  ? 281 ARG B CB    1 
ATOM   5584  C  CG    . ARG B  1 281 ? 21.617  -16.078  46.962  1.00 36.17  ? 281 ARG B CG    1 
ATOM   5585  C  CD    . ARG B  1 281 ? 20.558  -15.279  46.316  1.00 36.62  ? 281 ARG B CD    1 
ATOM   5586  N  NE    . ARG B  1 281 ? 19.299  -16.000  46.288  1.00 37.43  ? 281 ARG B NE    1 
ATOM   5587  C  CZ    . ARG B  1 281 ? 18.201  -15.539  45.716  1.00 37.42  ? 281 ARG B CZ    1 
ATOM   5588  N  NH1   . ARG B  1 281 ? 18.205  -14.340  45.148  1.00 39.97  ? 281 ARG B NH1   1 
ATOM   5589  N  NH2   . ARG B  1 281 ? 17.103  -16.269  45.727  1.00 37.28  ? 281 ARG B NH2   1 
ATOM   5590  N  N     . GLN B  1 282 ? 22.194  -19.343  48.817  1.00 35.25  ? 282 GLN B N     1 
ATOM   5591  C  CA    . GLN B  1 282 ? 21.973  -19.617  50.226  1.00 35.80  ? 282 GLN B CA    1 
ATOM   5592  C  C     . GLN B  1 282 ? 23.296  -19.776  50.954  1.00 36.73  ? 282 GLN B C     1 
ATOM   5593  O  O     . GLN B  1 282 ? 23.483  -19.249  52.047  1.00 37.34  ? 282 GLN B O     1 
ATOM   5594  C  CB    . GLN B  1 282 ? 21.129  -20.872  50.408  1.00 34.94  ? 282 GLN B CB    1 
ATOM   5595  C  CG    . GLN B  1 282 ? 21.107  -21.365  51.842  1.00 35.44  ? 282 GLN B CG    1 
ATOM   5596  C  CD    . GLN B  1 282 ? 20.215  -22.564  52.041  1.00 36.67  ? 282 GLN B CD    1 
ATOM   5597  O  OE1   . GLN B  1 282 ? 19.118  -22.627  51.496  1.00 38.63  ? 282 GLN B OE1   1 
ATOM   5598  N  NE2   . GLN B  1 282 ? 20.672  -23.518  52.831  1.00 35.00  ? 282 GLN B NE2   1 
ATOM   5599  N  N     . LEU B  1 283 ? 24.199  -20.517  50.317  1.00 36.93  ? 283 LEU B N     1 
ATOM   5600  C  CA    . LEU B  1 283 ? 25.472  -20.866  50.863  1.00 37.70  ? 283 LEU B CA    1 
ATOM   5601  C  C     . LEU B  1 283 ? 26.361  -19.616  50.958  1.00 38.66  ? 283 LEU B C     1 
ATOM   5602  O  O     . LEU B  1 283 ? 26.948  -19.340  52.009  1.00 39.20  ? 283 LEU B O     1 
ATOM   5603  C  CB    . LEU B  1 283 ? 26.085  -21.909  49.945  1.00 37.65  ? 283 LEU B CB    1 
ATOM   5604  C  CG    . LEU B  1 283 ? 27.000  -23.038  50.416  1.00 39.22  ? 283 LEU B CG    1 
ATOM   5605  C  CD1   . LEU B  1 283 ? 27.950  -23.476  49.264  1.00 38.66  ? 283 LEU B CD1   1 
ATOM   5606  C  CD2   . LEU B  1 283 ? 27.788  -22.667  51.700  1.00 40.48  ? 283 LEU B CD2   1 
ATOM   5607  N  N     . SER B  1 284 ? 26.434  -18.849  49.873  1.00 38.80  ? 284 SER B N     1 
ATOM   5608  C  CA    . SER B  1 284 ? 27.204  -17.603  49.852  1.00 40.07  ? 284 SER B CA    1 
ATOM   5609  C  C     . SER B  1 284 ? 26.772  -16.558  50.879  1.00 40.71  ? 284 SER B C     1 
ATOM   5610  O  O     . SER B  1 284 ? 27.627  -15.906  51.484  1.00 41.83  ? 284 SER B O     1 
ATOM   5611  C  CB    . SER B  1 284 ? 27.165  -16.992  48.470  1.00 40.00  ? 284 SER B CB    1 
ATOM   5612  O  OG    . SER B  1 284 ? 27.439  -18.007  47.511  1.00 42.73  ? 284 SER B OG    1 
ATOM   5613  N  N     . LEU B  1 285 ? 25.462  -16.382  51.080  1.00 40.01  ? 285 LEU B N     1 
ATOM   5614  C  CA    . LEU B  1 285 ? 25.001  -15.373  52.029  1.00 40.21  ? 285 LEU B CA    1 
ATOM   5615  C  C     . LEU B  1 285 ? 25.258  -15.793  53.462  1.00 40.67  ? 285 LEU B C     1 
ATOM   5616  O  O     . LEU B  1 285 ? 25.619  -14.975  54.303  1.00 41.94  ? 285 LEU B O     1 
ATOM   5617  C  CB    . LEU B  1 285 ? 23.531  -15.033  51.828  1.00 39.63  ? 285 LEU B CB    1 
ATOM   5618  C  CG    . LEU B  1 285 ? 23.154  -14.356  50.513  1.00 39.37  ? 285 LEU B CG    1 
ATOM   5619  C  CD1   . LEU B  1 285 ? 21.641  -14.292  50.412  1.00 37.64  ? 285 LEU B CD1   1 
ATOM   5620  C  CD2   . LEU B  1 285 ? 23.787  -12.985  50.358  1.00 38.57  ? 285 LEU B CD2   1 
ATOM   5621  N  N     . LEU B  1 286 ? 25.067  -17.072  53.748  1.00 40.13  ? 286 LEU B N     1 
ATOM   5622  C  CA    . LEU B  1 286 ? 25.440  -17.597  55.047  1.00 40.50  ? 286 LEU B CA    1 
ATOM   5623  C  C     . LEU B  1 286 ? 26.959  -17.560  55.239  1.00 41.81  ? 286 LEU B C     1 
ATOM   5624  O  O     . LEU B  1 286 ? 27.433  -17.393  56.369  1.00 43.65  ? 286 LEU B O     1 
ATOM   5625  C  CB    . LEU B  1 286 ? 24.901  -19.000  55.249  1.00 39.16  ? 286 LEU B CB    1 
ATOM   5626  C  CG    . LEU B  1 286 ? 23.390  -19.185  55.212  1.00 37.97  ? 286 LEU B CG    1 
ATOM   5627  C  CD1   . LEU B  1 286 ? 23.128  -20.671  55.190  1.00 37.41  ? 286 LEU B CD1   1 
ATOM   5628  C  CD2   . LEU B  1 286 ? 22.639  -18.525  56.358  1.00 36.95  ? 286 LEU B CD2   1 
ATOM   5629  N  N     . LEU B  1 287 ? 27.715  -17.701  54.149  1.00 41.49  ? 287 LEU B N     1 
ATOM   5630  C  CA    . LEU B  1 287 ? 29.167  -17.516  54.186  1.00 42.49  ? 287 LEU B CA    1 
ATOM   5631  C  C     . LEU B  1 287 ? 29.551  -16.052  54.245  1.00 43.66  ? 287 LEU B C     1 
ATOM   5632  O  O     . LEU B  1 287 ? 30.732  -15.715  54.338  1.00 44.85  ? 287 LEU B O     1 
ATOM   5633  C  CB    . LEU B  1 287 ? 29.852  -18.183  52.989  1.00 42.19  ? 287 LEU B CB    1 
ATOM   5634  C  CG    . LEU B  1 287 ? 30.095  -19.687  53.119  1.00 41.25  ? 287 LEU B CG    1 
ATOM   5635  C  CD1   . LEU B  1 287 ? 30.352  -20.237  51.783  1.00 39.64  ? 287 LEU B CD1   1 
ATOM   5636  C  CD2   . LEU B  1 287 ? 31.259  -19.989  54.041  1.00 42.76  ? 287 LEU B CD2   1 
ATOM   5637  N  N     . ARG B  1 288 ? 28.541  -15.190  54.213  1.00 43.73  ? 288 ARG B N     1 
ATOM   5638  C  CA    . ARG B  1 288 ? 28.714  -13.740  54.353  1.00 44.83  ? 288 ARG B CA    1 
ATOM   5639  C  C     . ARG B  1 288 ? 29.419  -13.059  53.205  1.00 45.42  ? 288 ARG B C     1 
ATOM   5640  O  O     . ARG B  1 288 ? 29.927  -11.963  53.355  1.00 46.83  ? 288 ARG B O     1 
ATOM   5641  C  CB    . ARG B  1 288 ? 29.405  -13.402  55.646  1.00 46.10  ? 288 ARG B CB    1 
ATOM   5642  C  CG    . ARG B  1 288 ? 28.723  -13.987  56.786  1.00 44.74  ? 288 ARG B CG    1 
ATOM   5643  C  CD    . ARG B  1 288 ? 28.932  -13.144  57.972  1.00 47.78  ? 288 ARG B CD    1 
ATOM   5644  N  NE    . ARG B  1 288 ? 27.710  -13.242  58.737  1.00 50.23  ? 288 ARG B NE    1 
ATOM   5645  C  CZ    . ARG B  1 288 ? 26.984  -12.213  59.135  1.00 50.76  ? 288 ARG B CZ    1 
ATOM   5646  N  NH1   . ARG B  1 288 ? 27.385  -10.963  58.889  1.00 52.28  ? 288 ARG B NH1   1 
ATOM   5647  N  NH2   . ARG B  1 288 ? 25.864  -12.453  59.794  1.00 50.12  ? 288 ARG B NH2   1 
ATOM   5648  N  N     . ARG B  1 289 ? 29.423  -13.720  52.058  1.00 45.14  ? 289 ARG B N     1 
ATOM   5649  C  CA    . ARG B  1 289 ? 29.860  -13.138  50.812  1.00 45.92  ? 289 ARG B CA    1 
ATOM   5650  C  C     . ARG B  1 289 ? 28.853  -12.050  50.435  1.00 46.39  ? 289 ARG B C     1 
ATOM   5651  O  O     . ARG B  1 289 ? 27.645  -12.263  50.562  1.00 45.27  ? 289 ARG B O     1 
ATOM   5652  C  CB    . ARG B  1 289 ? 29.891  -14.214  49.718  1.00 44.95  ? 289 ARG B CB    1 
ATOM   5653  C  CG    . ARG B  1 289 ? 30.564  -15.528  50.106  1.00 45.68  ? 289 ARG B CG    1 
ATOM   5654  C  CD    . ARG B  1 289 ? 31.933  -15.702  49.495  1.00 49.11  ? 289 ARG B CD    1 
ATOM   5655  N  NE    . ARG B  1 289 ? 32.888  -16.050  50.548  1.00 56.19  ? 289 ARG B NE    1 
ATOM   5656  C  CZ    . ARG B  1 289 ? 33.526  -17.219  50.682  1.00 57.17  ? 289 ARG B CZ    1 
ATOM   5657  N  NH1   . ARG B  1 289 ? 33.354  -18.216  49.811  1.00 56.09  ? 289 ARG B NH1   1 
ATOM   5658  N  NH2   . ARG B  1 289 ? 34.355  -17.376  51.705  1.00 57.52  ? 289 ARG B NH2   1 
ATOM   5659  N  N     . PRO B  1 290 ? 29.348  -10.899  49.924  1.00 47.95  ? 290 PRO B N     1 
ATOM   5660  C  CA    . PRO B  1 290 ? 28.551  -9.731   49.527  1.00 48.46  ? 290 PRO B CA    1 
ATOM   5661  C  C     . PRO B  1 290 ? 27.492  -10.049  48.463  1.00 47.45  ? 290 PRO B C     1 
ATOM   5662  O  O     . PRO B  1 290 ? 27.849  -10.508  47.359  1.00 47.58  ? 290 PRO B O     1 
ATOM   5663  C  CB    . PRO B  1 290 ? 29.589  -8.803   48.876  1.00 49.90  ? 290 PRO B CB    1 
ATOM   5664  C  CG    . PRO B  1 290 ? 30.900  -9.361   49.220  1.00 50.47  ? 290 PRO B CG    1 
ATOM   5665  C  CD    . PRO B  1 290 ? 30.709  -10.813  49.373  1.00 48.55  ? 290 PRO B CD    1 
ATOM   5666  N  N     . PRO B  1 291 ? 26.210  -9.785   48.771  1.00 46.53  ? 291 PRO B N     1 
ATOM   5667  C  CA    . PRO B  1 291 ? 25.145  -9.894   47.783  1.00 45.44  ? 291 PRO B CA    1 
ATOM   5668  C  C     . PRO B  1 291 ? 25.311  -8.885   46.642  1.00 46.15  ? 291 PRO B C     1 
ATOM   5669  O  O     . PRO B  1 291 ? 25.498  -7.686   46.880  1.00 47.32  ? 291 PRO B O     1 
ATOM   5670  C  CB    . PRO B  1 291 ? 23.882  -9.566   48.594  1.00 45.66  ? 291 PRO B CB    1 
ATOM   5671  C  CG    . PRO B  1 291 ? 24.370  -8.816   49.802  1.00 46.66  ? 291 PRO B CG    1 
ATOM   5672  C  CD    . PRO B  1 291 ? 25.685  -9.453   50.107  1.00 46.94  ? 291 PRO B CD    1 
ATOM   5673  N  N     . GLY B  1 292 ? 25.260  -9.383   45.412  1.00 45.23  ? 292 GLY B N     1 
ATOM   5674  C  CA    . GLY B  1 292 ? 25.190  -8.531   44.243  1.00 45.57  ? 292 GLY B CA    1 
ATOM   5675  C  C     . GLY B  1 292 ? 23.769  -8.410   43.721  1.00 45.16  ? 292 GLY B C     1 
ATOM   5676  O  O     . GLY B  1 292 ? 22.802  -8.349   44.491  1.00 44.87  ? 292 GLY B O     1 
ATOM   5677  N  N     . ARG B  1 293 ? 23.668  -8.364   42.401  1.00 45.16  ? 293 ARG B N     1 
ATOM   5678  C  CA    . ARG B  1 293 ? 22.430  -8.281   41.678  1.00 45.45  ? 293 ARG B CA    1 
ATOM   5679  C  C     . ARG B  1 293 ? 21.531  -9.430   42.084  1.00 44.36  ? 293 ARG B C     1 
ATOM   5680  O  O     . ARG B  1 293 ? 21.973  -10.577  42.142  1.00 43.41  ? 293 ARG B O     1 
ATOM   5681  C  CB    . ARG B  1 293 ? 22.765  -8.411   40.198  1.00 46.27  ? 293 ARG B CB    1 
ATOM   5682  C  CG    . ARG B  1 293 ? 21.733  -7.918   39.248  1.00 47.13  ? 293 ARG B CG    1 
ATOM   5683  C  CD    . ARG B  1 293 ? 22.307  -7.987   37.865  1.00 48.25  ? 293 ARG B CD    1 
ATOM   5684  N  NE    . ARG B  1 293 ? 22.893  -6.728   37.424  1.00 48.49  ? 293 ARG B NE    1 
ATOM   5685  C  CZ    . ARG B  1 293 ? 22.178  -5.723   36.944  1.00 49.59  ? 293 ARG B CZ    1 
ATOM   5686  N  NH1   . ARG B  1 293 ? 20.867  -5.851   36.888  1.00 49.80  ? 293 ARG B NH1   1 
ATOM   5687  N  NH2   . ARG B  1 293 ? 22.761  -4.594   36.540  1.00 51.22  ? 293 ARG B NH2   1 
ATOM   5688  N  N     . GLU B  1 294 ? 20.270  -9.113   42.355  1.00 44.77  ? 294 GLU B N     1 
ATOM   5689  C  CA    . GLU B  1 294 ? 19.256  -10.076  42.790  1.00 43.92  ? 294 GLU B CA    1 
ATOM   5690  C  C     . GLU B  1 294 ? 19.731  -10.938  43.947  1.00 42.91  ? 294 GLU B C     1 
ATOM   5691  O  O     . GLU B  1 294 ? 19.170  -12.013  44.209  1.00 42.36  ? 294 GLU B O     1 
ATOM   5692  C  CB    . GLU B  1 294 ? 18.763  -10.928  41.622  1.00 44.00  ? 294 GLU B CB    1 
ATOM   5693  C  CG    . GLU B  1 294 ? 18.109  -10.124  40.504  1.00 46.77  ? 294 GLU B CG    1 
ATOM   5694  C  CD    . GLU B  1 294 ? 17.567  -10.995  39.369  1.00 49.44  ? 294 GLU B CD    1 
ATOM   5695  O  OE1   . GLU B  1 294 ? 16.914  -12.020  39.686  1.00 48.38  ? 294 GLU B OE1   1 
ATOM   5696  O  OE2   . GLU B  1 294 ? 17.783  -10.642  38.169  1.00 51.18  ? 294 GLU B OE2   1 
ATOM   5697  N  N     . ALA B  1 295 ? 20.763  -10.439  44.637  1.00 43.15  ? 295 ALA B N     1 
ATOM   5698  C  CA    . ALA B  1 295 ? 21.364  -11.044  45.847  1.00 42.33  ? 295 ALA B CA    1 
ATOM   5699  C  C     . ALA B  1 295 ? 22.307  -12.212  45.601  1.00 41.30  ? 295 ALA B C     1 
ATOM   5700  O  O     . ALA B  1 295 ? 22.785  -12.825  46.557  1.00 40.73  ? 295 ALA B O     1 
ATOM   5701  C  CB    . ALA B  1 295 ? 20.302  -11.410  46.896  1.00 41.83  ? 295 ALA B CB    1 
ATOM   5702  N  N     . TYR B  1 296 ? 22.589  -12.502  44.332  1.00 41.31  ? 296 TYR B N     1 
ATOM   5703  C  CA    . TYR B  1 296 ? 23.513  -13.569  43.979  1.00 41.00  ? 296 TYR B CA    1 
ATOM   5704  C  C     . TYR B  1 296 ? 24.943  -13.089  44.131  1.00 41.87  ? 296 TYR B C     1 
ATOM   5705  O  O     . TYR B  1 296 ? 25.201  -11.906  43.952  1.00 42.99  ? 296 TYR B O     1 
ATOM   5706  C  CB    . TYR B  1 296 ? 23.279  -14.031  42.553  1.00 40.79  ? 296 TYR B CB    1 
ATOM   5707  C  CG    . TYR B  1 296 ? 21.951  -14.701  42.357  1.00 41.53  ? 296 TYR B CG    1 
ATOM   5708  C  CD1   . TYR B  1 296 ? 21.762  -16.042  42.672  1.00 41.14  ? 296 TYR B CD1   1 
ATOM   5709  C  CD2   . TYR B  1 296 ? 20.880  -13.995  41.856  1.00 43.05  ? 296 TYR B CD2   1 
ATOM   5710  C  CE1   . TYR B  1 296 ? 20.541  -16.636  42.490  1.00 40.39  ? 296 TYR B CE1   1 
ATOM   5711  C  CE2   . TYR B  1 296 ? 19.668  -14.580  41.684  1.00 43.22  ? 296 TYR B CE2   1 
ATOM   5712  C  CZ    . TYR B  1 296 ? 19.500  -15.899  41.993  1.00 42.09  ? 296 TYR B CZ    1 
ATOM   5713  O  OH    . TYR B  1 296 ? 18.256  -16.464  41.791  1.00 45.24  ? 296 TYR B OH    1 
ATOM   5714  N  N     . PRO B  1 297 ? 25.882  -14.011  44.444  1.00 41.89  ? 297 PRO B N     1 
ATOM   5715  C  CA    . PRO B  1 297 ? 27.287  -13.673  44.621  1.00 42.47  ? 297 PRO B CA    1 
ATOM   5716  C  C     . PRO B  1 297 ? 27.841  -13.329  43.285  1.00 43.61  ? 297 PRO B C     1 
ATOM   5717  O  O     . PRO B  1 297 ? 27.184  -13.580  42.279  1.00 43.91  ? 297 PRO B O     1 
ATOM   5718  C  CB    . PRO B  1 297 ? 27.906  -14.993  45.057  1.00 41.91  ? 297 PRO B CB    1 
ATOM   5719  C  CG    . PRO B  1 297 ? 27.047  -16.029  44.436  1.00 40.32  ? 297 PRO B CG    1 
ATOM   5720  C  CD    . PRO B  1 297 ? 25.666  -15.473  44.532  1.00 41.08  ? 297 PRO B CD    1 
ATOM   5721  N  N     . GLY B  1 298 ? 29.050  -12.789  43.262  1.00 45.04  ? 298 GLY B N     1 
ATOM   5722  C  CA    . GLY B  1 298 ? 29.703  -12.424  42.020  1.00 45.48  ? 298 GLY B CA    1 
ATOM   5723  C  C     . GLY B  1 298 ? 29.995  -13.645  41.196  1.00 45.20  ? 298 GLY B C     1 
ATOM   5724  O  O     . GLY B  1 298 ? 29.987  -13.564  39.972  1.00 45.96  ? 298 GLY B O     1 
ATOM   5725  N  N     . ASP B  1 299 ? 30.233  -14.784  41.852  1.00 44.56  ? 299 ASP B N     1 
ATOM   5726  C  CA    . ASP B  1 299 ? 30.651  -15.986  41.122  1.00 44.56  ? 299 ASP B CA    1 
ATOM   5727  C  C     . ASP B  1 299 ? 29.529  -16.882  40.646  1.00 43.46  ? 299 ASP B C     1 
ATOM   5728  O  O     . ASP B  1 299 ? 29.789  -17.990  40.199  1.00 44.03  ? 299 ASP B O     1 
ATOM   5729  C  CB    . ASP B  1 299 ? 31.739  -16.788  41.860  1.00 44.58  ? 299 ASP B CB    1 
ATOM   5730  C  CG    . ASP B  1 299 ? 31.291  -17.321  43.224  1.00 45.11  ? 299 ASP B CG    1 
ATOM   5731  O  OD1   . ASP B  1 299 ? 30.148  -17.058  43.657  1.00 44.84  ? 299 ASP B OD1   1 
ATOM   5732  O  OD2   . ASP B  1 299 ? 32.113  -18.016  43.876  1.00 45.80  ? 299 ASP B OD2   1 
ATOM   5733  N  N     . VAL B  1 300 ? 28.294  -16.406  40.691  1.00 43.00  ? 300 VAL B N     1 
ATOM   5734  C  CA    . VAL B  1 300 ? 27.170  -17.224  40.244  1.00 42.09  ? 300 VAL B CA    1 
ATOM   5735  C  C     . VAL B  1 300 ? 27.213  -17.497  38.743  1.00 42.46  ? 300 VAL B C     1 
ATOM   5736  O  O     . VAL B  1 300 ? 26.549  -18.410  38.256  1.00 42.51  ? 300 VAL B O     1 
ATOM   5737  C  CB    . VAL B  1 300 ? 25.799  -16.616  40.611  1.00 41.77  ? 300 VAL B CB    1 
ATOM   5738  C  CG1   . VAL B  1 300 ? 25.422  -15.500  39.645  1.00 42.56  ? 300 VAL B CG1   1 
ATOM   5739  C  CG2   . VAL B  1 300 ? 24.742  -17.687  40.593  1.00 40.55  ? 300 VAL B CG2   1 
ATOM   5740  N  N     . PHE B  1 301 ? 27.964  -16.702  37.996  1.00 43.43  ? 301 PHE B N     1 
ATOM   5741  C  CA    . PHE B  1 301 ? 28.114  -16.988  36.559  1.00 43.85  ? 301 PHE B CA    1 
ATOM   5742  C  C     . PHE B  1 301 ? 29.119  -18.119  36.352  1.00 43.74  ? 301 PHE B C     1 
ATOM   5743  O  O     . PHE B  1 301 ? 28.872  -19.033  35.567  1.00 43.26  ? 301 PHE B O     1 
ATOM   5744  C  CB    . PHE B  1 301 ? 28.548  -15.748  35.792  1.00 45.01  ? 301 PHE B CB    1 
ATOM   5745  C  CG    . PHE B  1 301 ? 29.073  -16.041  34.432  1.00 45.26  ? 301 PHE B CG    1 
ATOM   5746  C  CD1   . PHE B  1 301 ? 28.210  -16.367  33.399  1.00 45.30  ? 301 PHE B CD1   1 
ATOM   5747  C  CD2   . PHE B  1 301 ? 30.434  -15.979  34.180  1.00 45.85  ? 301 PHE B CD2   1 
ATOM   5748  C  CE1   . PHE B  1 301 ? 28.687  -16.630  32.126  1.00 46.85  ? 301 PHE B CE1   1 
ATOM   5749  C  CE2   . PHE B  1 301 ? 30.929  -16.246  32.917  1.00 47.84  ? 301 PHE B CE2   1 
ATOM   5750  C  CZ    . PHE B  1 301 ? 30.049  -16.572  31.881  1.00 48.58  ? 301 PHE B CZ    1 
ATOM   5751  N  N     . TYR B  1 302 ? 30.237  -18.031  37.086  1.00 44.04  ? 302 TYR B N     1 
ATOM   5752  C  CA    . TYR B  1 302 ? 31.303  -19.008  37.069  1.00 44.01  ? 302 TYR B CA    1 
ATOM   5753  C  C     . TYR B  1 302 ? 30.735  -20.316  37.541  1.00 43.19  ? 302 TYR B C     1 
ATOM   5754  O  O     . TYR B  1 302 ? 31.220  -21.384  37.156  1.00 43.32  ? 302 TYR B O     1 
ATOM   5755  C  CB    . TYR B  1 302 ? 32.458  -18.564  37.970  1.00 44.65  ? 302 TYR B CB    1 
ATOM   5756  C  CG    . TYR B  1 302 ? 33.652  -19.500  37.938  1.00 45.64  ? 302 TYR B CG    1 
ATOM   5757  C  CD1   . TYR B  1 302 ? 34.282  -19.810  36.733  1.00 48.41  ? 302 TYR B CD1   1 
ATOM   5758  C  CD2   . TYR B  1 302 ? 34.154  -20.068  39.101  1.00 44.54  ? 302 TYR B CD2   1 
ATOM   5759  C  CE1   . TYR B  1 302 ? 35.363  -20.665  36.693  1.00 49.47  ? 302 TYR B CE1   1 
ATOM   5760  C  CE2   . TYR B  1 302 ? 35.237  -20.932  39.076  1.00 45.28  ? 302 TYR B CE2   1 
ATOM   5761  C  CZ    . TYR B  1 302 ? 35.840  -21.228  37.874  1.00 48.75  ? 302 TYR B CZ    1 
ATOM   5762  O  OH    . TYR B  1 302 ? 36.927  -22.097  37.806  1.00 51.27  ? 302 TYR B OH    1 
ATOM   5763  N  N     . LEU B  1 303 ? 29.680  -20.235  38.356  1.00 42.47  ? 303 LEU B N     1 
ATOM   5764  C  CA    . LEU B  1 303 ? 29.002  -21.436  38.828  1.00 41.93  ? 303 LEU B CA    1 
ATOM   5765  C  C     . LEU B  1 303 ? 28.561  -22.267  37.648  1.00 42.36  ? 303 LEU B C     1 
ATOM   5766  O  O     . LEU B  1 303 ? 28.912  -23.442  37.536  1.00 42.60  ? 303 LEU B O     1 
ATOM   5767  C  CB    . LEU B  1 303 ? 27.782  -21.100  39.670  1.00 41.02  ? 303 LEU B CB    1 
ATOM   5768  C  CG    . LEU B  1 303 ? 27.092  -22.330  40.264  1.00 39.89  ? 303 LEU B CG    1 
ATOM   5769  C  CD1   . LEU B  1 303 ? 27.945  -23.001  41.297  1.00 37.98  ? 303 LEU B CD1   1 
ATOM   5770  C  CD2   . LEU B  1 303 ? 25.733  -21.946  40.835  1.00 39.87  ? 303 LEU B CD2   1 
ATOM   5771  N  N     . HIS B  1 304 ? 27.787  -21.638  36.768  1.00 42.83  ? 304 HIS B N     1 
ATOM   5772  C  CA    . HIS B  1 304 ? 27.267  -22.310  35.591  1.00 42.68  ? 304 HIS B CA    1 
ATOM   5773  C  C     . HIS B  1 304 ? 28.308  -22.543  34.516  1.00 44.07  ? 304 HIS B C     1 
ATOM   5774  O  O     . HIS B  1 304 ? 28.321  -23.619  33.897  1.00 44.96  ? 304 HIS B O     1 
ATOM   5775  C  CB    . HIS B  1 304 ? 26.037  -21.588  35.068  1.00 41.95  ? 304 HIS B CB    1 
ATOM   5776  C  CG    . HIS B  1 304 ? 24.877  -21.709  35.994  1.00 40.76  ? 304 HIS B CG    1 
ATOM   5777  N  ND1   . HIS B  1 304 ? 23.875  -20.769  36.075  1.00 40.04  ? 304 HIS B ND1   1 
ATOM   5778  C  CD2   . HIS B  1 304 ? 24.590  -22.651  36.924  1.00 38.38  ? 304 HIS B CD2   1 
ATOM   5779  C  CE1   . HIS B  1 304 ? 23.009  -21.136  37.006  1.00 39.08  ? 304 HIS B CE1   1 
ATOM   5780  N  NE2   . HIS B  1 304 ? 23.415  -22.279  37.527  1.00 38.34  ? 304 HIS B NE2   1 
ATOM   5781  N  N     . SER B  1 305 ? 29.192  -21.560  34.324  1.00 44.44  ? 305 SER B N     1 
ATOM   5782  C  CA    . SER B  1 305 ? 30.052  -21.534  33.154  1.00 45.31  ? 305 SER B CA    1 
ATOM   5783  C  C     . SER B  1 305 ? 31.041  -22.675  33.220  1.00 45.70  ? 305 SER B C     1 
ATOM   5784  O  O     . SER B  1 305 ? 31.210  -23.405  32.257  1.00 46.48  ? 305 SER B O     1 
ATOM   5785  C  CB    . SER B  1 305 ? 30.762  -20.189  33.001  1.00 46.09  ? 305 SER B CB    1 
ATOM   5786  O  OG    . SER B  1 305 ? 31.783  -20.043  33.960  1.00 44.79  ? 305 SER B OG    1 
ATOM   5787  N  N     . ARG B  1 306 ? 31.666  -22.854  34.375  1.00 45.54  ? 306 ARG B N     1 
ATOM   5788  C  CA    . ARG B  1 306 ? 32.578  -23.966  34.552  1.00 45.88  ? 306 ARG B CA    1 
ATOM   5789  C  C     . ARG B  1 306 ? 31.826  -25.288  34.400  1.00 45.51  ? 306 ARG B C     1 
ATOM   5790  O  O     . ARG B  1 306 ? 32.282  -26.166  33.671  1.00 46.61  ? 306 ARG B O     1 
ATOM   5791  C  CB    . ARG B  1 306 ? 33.373  -23.854  35.869  1.00 45.86  ? 306 ARG B CB    1 
ATOM   5792  C  CG    . ARG B  1 306 ? 32.680  -24.260  37.165  1.00 44.11  ? 306 ARG B CG    1 
ATOM   5793  C  CD    . ARG B  1 306 ? 33.682  -24.205  38.306  1.00 45.22  ? 306 ARG B CD    1 
ATOM   5794  N  NE    . ARG B  1 306 ? 33.095  -24.498  39.613  1.00 46.62  ? 306 ARG B NE    1 
ATOM   5795  C  CZ    . ARG B  1 306 ? 32.492  -23.595  40.395  1.00 47.09  ? 306 ARG B CZ    1 
ATOM   5796  N  NH1   . ARG B  1 306 ? 32.383  -22.334  40.001  1.00 46.56  ? 306 ARG B NH1   1 
ATOM   5797  N  NH2   . ARG B  1 306 ? 31.987  -23.953  41.582  1.00 47.60  ? 306 ARG B NH2   1 
ATOM   5798  N  N     . LEU B  1 307 ? 30.660  -25.417  35.041  1.00 44.54  ? 307 LEU B N     1 
ATOM   5799  C  CA    . LEU B  1 307 ? 29.814  -26.614  34.853  1.00 43.92  ? 307 LEU B CA    1 
ATOM   5800  C  C     . LEU B  1 307 ? 29.626  -26.916  33.380  1.00 44.50  ? 307 LEU B C     1 
ATOM   5801  O  O     . LEU B  1 307 ? 30.023  -27.976  32.929  1.00 44.92  ? 307 LEU B O     1 
ATOM   5802  C  CB    . LEU B  1 307 ? 28.429  -26.477  35.510  1.00 42.96  ? 307 LEU B CB    1 
ATOM   5803  C  CG    . LEU B  1 307 ? 27.476  -27.634  35.197  1.00 41.41  ? 307 LEU B CG    1 
ATOM   5804  C  CD1   . LEU B  1 307 ? 27.786  -28.843  36.064  1.00 41.35  ? 307 LEU B CD1   1 
ATOM   5805  C  CD2   . LEU B  1 307 ? 26.053  -27.192  35.376  1.00 40.40  ? 307 LEU B CD2   1 
ATOM   5806  N  N     . LEU B  1 308 ? 29.036  -25.969  32.647  1.00 44.54  ? 308 LEU B N     1 
ATOM   5807  C  CA    . LEU B  1 308 ? 28.631  -26.200  31.254  1.00 45.32  ? 308 LEU B CA    1 
ATOM   5808  C  C     . LEU B  1 308 ? 29.764  -26.285  30.251  1.00 46.49  ? 308 LEU B C     1 
ATOM   5809  O  O     . LEU B  1 308 ? 29.618  -26.898  29.211  1.00 47.65  ? 308 LEU B O     1 
ATOM   5810  C  CB    . LEU B  1 308 ? 27.604  -25.175  30.801  1.00 45.42  ? 308 LEU B CB    1 
ATOM   5811  C  CG    . LEU B  1 308 ? 26.243  -25.328  31.464  1.00 44.61  ? 308 LEU B CG    1 
ATOM   5812  C  CD1   . LEU B  1 308 ? 25.439  -24.035  31.344  1.00 44.77  ? 308 LEU B CD1   1 
ATOM   5813  C  CD2   . LEU B  1 308 ? 25.485  -26.515  30.878  1.00 45.30  ? 308 LEU B CD2   1 
ATOM   5814  N  N     . GLU B  1 309 ? 30.901  -25.684  30.551  1.00 47.05  ? 309 GLU B N     1 
ATOM   5815  C  CA    . GLU B  1 309 ? 32.047  -25.836  29.658  1.00 48.93  ? 309 GLU B CA    1 
ATOM   5816  C  C     . GLU B  1 309 ? 32.455  -27.305  29.471  1.00 49.16  ? 309 GLU B C     1 
ATOM   5817  O  O     . GLU B  1 309 ? 33.073  -27.655  28.471  1.00 50.81  ? 309 GLU B O     1 
ATOM   5818  C  CB    . GLU B  1 309 ? 33.216  -24.992  30.133  1.00 49.25  ? 309 GLU B CB    1 
ATOM   5819  C  CG    . GLU B  1 309 ? 33.135  -23.580  29.635  1.00 50.90  ? 309 GLU B CG    1 
ATOM   5820  C  CD    . GLU B  1 309 ? 33.974  -23.372  28.400  1.00 55.45  ? 309 GLU B CD    1 
ATOM   5821  O  OE1   . GLU B  1 309 ? 35.209  -23.532  28.517  1.00 56.21  ? 309 GLU B OE1   1 
ATOM   5822  O  OE2   . GLU B  1 309 ? 33.416  -23.047  27.316  1.00 58.24  ? 309 GLU B OE2   1 
ATOM   5823  N  N     . ARG B  1 310 ? 32.077  -28.157  30.421  1.00 47.79  ? 310 ARG B N     1 
ATOM   5824  C  CA    . ARG B  1 310 ? 32.429  -29.573  30.383  1.00 47.90  ? 310 ARG B CA    1 
ATOM   5825  C  C     . ARG B  1 310 ? 31.697  -30.384  29.327  1.00 48.80  ? 310 ARG B C     1 
ATOM   5826  O  O     . ARG B  1 310 ? 32.129  -31.494  28.968  1.00 49.88  ? 310 ARG B O     1 
ATOM   5827  C  CB    . ARG B  1 310 ? 32.284  -30.191  31.756  1.00 46.27  ? 310 ARG B CB    1 
ATOM   5828  C  CG    . ARG B  1 310 ? 33.313  -29.632  32.688  1.00 46.03  ? 310 ARG B CG    1 
ATOM   5829  C  CD    . ARG B  1 310 ? 32.923  -29.838  34.093  1.00 45.26  ? 310 ARG B CD    1 
ATOM   5830  N  NE    . ARG B  1 310 ? 33.117  -31.216  34.509  1.00 45.08  ? 310 ARG B NE    1 
ATOM   5831  C  CZ    . ARG B  1 310 ? 32.924  -31.649  35.751  1.00 45.12  ? 310 ARG B CZ    1 
ATOM   5832  N  NH1   . ARG B  1 310 ? 32.520  -30.806  36.698  1.00 41.61  ? 310 ARG B NH1   1 
ATOM   5833  N  NH2   . ARG B  1 310 ? 33.138  -32.933  36.041  1.00 46.42  ? 310 ARG B NH2   1 
ATOM   5834  N  N     . ALA B  1 311 ? 30.605  -29.831  28.809  1.00 48.54  ? 311 ALA B N     1 
ATOM   5835  C  CA    . ALA B  1 311 ? 29.982  -30.423  27.643  1.00 49.49  ? 311 ALA B CA    1 
ATOM   5836  C  C     . ALA B  1 311 ? 30.930  -30.177  26.454  1.00 51.22  ? 311 ALA B C     1 
ATOM   5837  O  O     . ALA B  1 311 ? 31.580  -29.143  26.384  1.00 51.65  ? 311 ALA B O     1 
ATOM   5838  C  CB    . ALA B  1 311 ? 28.640  -29.814  27.409  1.00 48.75  ? 311 ALA B CB    1 
ATOM   5839  N  N     . ALA B  1 312 ? 31.048  -31.145  25.556  1.00 52.29  ? 312 ALA B N     1 
ATOM   5840  C  CA    . ALA B  1 312 ? 31.943  -31.008  24.423  1.00 54.48  ? 312 ALA B CA    1 
ATOM   5841  C  C     . ALA B  1 312 ? 31.766  -32.153  23.444  1.00 56.07  ? 312 ALA B C     1 
ATOM   5842  O  O     . ALA B  1 312 ? 31.119  -33.154  23.771  1.00 55.82  ? 312 ALA B O     1 
ATOM   5843  C  CB    . ALA B  1 312 ? 33.388  -30.941  24.891  1.00 54.86  ? 312 ALA B CB    1 
ATOM   5844  N  N     . LYS B  1 313 ? 32.315  -31.976  22.239  1.00 57.87  ? 313 LYS B N     1 
ATOM   5845  C  CA    . LYS B  1 313 ? 32.540  -33.058  21.291  1.00 59.48  ? 313 LYS B CA    1 
ATOM   5846  C  C     . LYS B  1 313 ? 34.048  -33.174  21.117  1.00 60.84  ? 313 LYS B C     1 
ATOM   5847  O  O     . LYS B  1 313 ? 34.708  -32.182  20.823  1.00 61.51  ? 313 LYS B O     1 
ATOM   5848  C  CB    . LYS B  1 313 ? 31.864  -32.741  19.954  1.00 61.01  ? 313 LYS B CB    1 
ATOM   5849  C  CG    . LYS B  1 313 ? 32.379  -33.546  18.744  1.00 63.72  ? 313 LYS B CG    1 
ATOM   5850  C  CD    . LYS B  1 313 ? 31.859  -34.981  18.732  1.00 64.54  ? 313 LYS B CD    1 
ATOM   5851  C  CE    . LYS B  1 313 ? 32.402  -35.746  17.548  1.00 67.83  ? 313 LYS B CE    1 
ATOM   5852  N  NZ    . LYS B  1 313 ? 32.100  -37.199  17.642  1.00 68.85  ? 313 LYS B NZ    1 
ATOM   5853  N  N     . LEU B  1 314 ? 34.594  -34.377  21.287  1.00 61.57  ? 314 LEU B N     1 
ATOM   5854  C  CA    . LEU B  1 314 ? 36.056  -34.564  21.270  1.00 63.01  ? 314 LEU B CA    1 
ATOM   5855  C  C     . LEU B  1 314 ? 36.639  -34.978  19.912  1.00 66.16  ? 314 LEU B C     1 
ATOM   5856  O  O     . LEU B  1 314 ? 35.959  -35.578  19.077  1.00 67.19  ? 314 LEU B O     1 
ATOM   5857  C  CB    . LEU B  1 314 ? 36.514  -35.522  22.385  1.00 62.03  ? 314 LEU B CB    1 
ATOM   5858  C  CG    . LEU B  1 314 ? 36.138  -35.215  23.852  1.00 58.67  ? 314 LEU B CG    1 
ATOM   5859  C  CD1   . LEU B  1 314 ? 36.666  -36.297  24.807  1.00 56.22  ? 314 LEU B CD1   1 
ATOM   5860  C  CD2   . LEU B  1 314 ? 36.630  -33.838  24.275  1.00 56.48  ? 314 LEU B CD2   1 
ATOM   5861  N  N     . SER B  1 315 ? 37.905  -34.633  19.701  1.00 68.09  ? 315 SER B N     1 
ATOM   5862  C  CA    . SER B  1 315 ? 38.624  -34.983  18.477  1.00 71.34  ? 315 SER B CA    1 
ATOM   5863  C  C     . SER B  1 315 ? 38.849  -36.488  18.319  1.00 72.95  ? 315 SER B C     1 
ATOM   5864  O  O     . SER B  1 315 ? 38.779  -37.248  19.285  1.00 72.04  ? 315 SER B O     1 
ATOM   5865  C  CB    . SER B  1 315 ? 39.979  -34.268  18.441  1.00 72.74  ? 315 SER B CB    1 
ATOM   5866  O  OG    . SER B  1 315 ? 40.833  -34.722  19.481  1.00 71.91  ? 315 SER B OG    1 
ATOM   5867  N  N     . GLU B  1 316 ? 39.128  -36.902  17.086  1.00 76.00  ? 316 GLU B N     1 
ATOM   5868  C  CA    . GLU B  1 316 ? 39.601  -38.248  16.795  1.00 78.09  ? 316 GLU B CA    1 
ATOM   5869  C  C     . GLU B  1 316 ? 40.623  -38.754  17.834  1.00 77.89  ? 316 GLU B C     1 
ATOM   5870  O  O     . GLU B  1 316 ? 40.465  -39.851  18.383  1.00 77.38  ? 316 GLU B O     1 
ATOM   5871  C  CB    . GLU B  1 316 ? 40.232  -38.292  15.398  1.00 81.36  ? 316 GLU B CB    1 
ATOM   5872  C  CG    . GLU B  1 316 ? 39.271  -38.502  14.230  1.00 83.56  ? 316 GLU B CG    1 
ATOM   5873  C  CD    . GLU B  1 316 ? 40.003  -38.926  12.940  1.00 89.60  ? 316 GLU B CD    1 
ATOM   5874  O  OE1   . GLU B  1 316 ? 40.980  -38.243  12.521  1.00 90.14  ? 316 GLU B OE1   1 
ATOM   5875  O  OE2   . GLU B  1 316 ? 39.600  -39.955  12.340  1.00 92.51  ? 316 GLU B OE2   1 
ATOM   5876  N  N     . LYS B  1 317 ? 41.660  -37.953  18.094  1.00 78.40  ? 317 LYS B N     1 
ATOM   5877  C  CA    . LYS B  1 317 ? 42.755  -38.344  18.986  1.00 78.98  ? 317 LYS B CA    1 
ATOM   5878  C  C     . LYS B  1 317 ? 42.265  -38.597  20.410  1.00 76.73  ? 317 LYS B C     1 
ATOM   5879  O  O     . LYS B  1 317 ? 42.768  -39.496  21.096  1.00 77.28  ? 317 LYS B O     1 
ATOM   5880  C  CB    . LYS B  1 317 ? 43.854  -37.279  18.991  1.00 80.04  ? 317 LYS B CB    1 
ATOM   5881  C  CG    . LYS B  1 317 ? 45.147  -37.717  19.695  1.00 82.29  ? 317 LYS B CG    1 
ATOM   5882  C  CD    . LYS B  1 317 ? 46.285  -36.675  19.563  1.00 85.45  ? 317 LYS B CD    1 
ATOM   5883  C  CE    . LYS B  1 317 ? 46.409  -35.785  20.812  1.00 84.40  ? 317 LYS B CE    1 
ATOM   5884  N  NZ    . LYS B  1 317 ? 47.626  -34.918  20.782  1.00 86.13  ? 317 LYS B NZ    1 
ATOM   5885  N  N     . GLU B  1 318 ? 41.285  -37.801  20.841  1.00 74.26  ? 318 GLU B N     1 
ATOM   5886  C  CA    . GLU B  1 318 ? 40.660  -37.953  22.147  1.00 71.92  ? 318 GLU B CA    1 
ATOM   5887  C  C     . GLU B  1 318 ? 39.489  -38.957  22.157  1.00 70.70  ? 318 GLU B C     1 
ATOM   5888  O  O     . GLU B  1 318 ? 38.725  -39.023  23.131  1.00 68.65  ? 318 GLU B O     1 
ATOM   5889  C  CB    . GLU B  1 318 ? 40.192  -36.586  22.663  1.00 70.40  ? 318 GLU B CB    1 
ATOM   5890  C  CG    . GLU B  1 318 ? 41.306  -35.544  22.847  1.00 73.24  ? 318 GLU B CG    1 
ATOM   5891  C  CD    . GLU B  1 318 ? 42.296  -35.891  23.960  1.00 76.11  ? 318 GLU B CD    1 
ATOM   5892  O  OE1   . GLU B  1 318 ? 41.940  -36.680  24.863  1.00 76.93  ? 318 GLU B OE1   1 
ATOM   5893  O  OE2   . GLU B  1 318 ? 43.435  -35.377  23.933  1.00 78.12  ? 318 GLU B OE2   1 
ATOM   5894  N  N     . GLY B  1 319 ? 39.347  -39.725  21.075  1.00 71.97  ? 319 GLY B N     1 
ATOM   5895  C  CA    . GLY B  1 319 ? 38.396  -40.841  21.021  1.00 71.26  ? 319 GLY B CA    1 
ATOM   5896  C  C     . GLY B  1 319 ? 37.002  -40.514  20.514  1.00 70.05  ? 319 GLY B C     1 
ATOM   5897  O  O     . GLY B  1 319 ? 36.141  -41.392  20.451  1.00 69.79  ? 319 GLY B O     1 
ATOM   5898  N  N     . SER B  1 320 ? 36.777  -39.244  20.182  1.00 69.16  ? 320 SER B N     1 
ATOM   5899  C  CA    . SER B  1 320 ? 35.536  -38.788  19.545  1.00 68.50  ? 320 SER B CA    1 
ATOM   5900  C  C     . SER B  1 320 ? 34.277  -38.801  20.403  1.00 66.13  ? 320 SER B C     1 
ATOM   5901  O  O     . SER B  1 320 ? 33.185  -38.589  19.884  1.00 66.19  ? 320 SER B O     1 
ATOM   5902  C  CB    . SER B  1 320 ? 35.289  -39.550  18.252  1.00 70.71  ? 320 SER B CB    1 
ATOM   5903  O  OG    . SER B  1 320 ? 36.465  -39.532  17.461  1.00 73.73  ? 320 SER B OG    1 
ATOM   5904  N  N     . GLY B  1 321 ? 34.420  -39.015  21.709  1.00 64.38  ? 321 GLY B N     1 
ATOM   5905  C  CA    . GLY B  1 321 ? 33.277  -38.960  22.615  1.00 61.95  ? 321 GLY B CA    1 
ATOM   5906  C  C     . GLY B  1 321 ? 32.630  -37.584  22.676  1.00 60.47  ? 321 GLY B C     1 
ATOM   5907  O  O     . GLY B  1 321 ? 33.157  -36.619  22.112  1.00 61.05  ? 321 GLY B O     1 
ATOM   5908  N  N     . SER B  1 322 ? 31.482  -37.497  23.359  1.00 58.49  ? 322 SER B N     1 
ATOM   5909  C  CA    . SER B  1 322 ? 30.773  -36.233  23.543  1.00 56.49  ? 322 SER B CA    1 
ATOM   5910  C  C     . SER B  1 322 ? 29.891  -36.233  24.778  1.00 54.29  ? 322 SER B C     1 
ATOM   5911  O  O     . SER B  1 322 ? 29.261  -37.242  25.105  1.00 54.14  ? 322 SER B O     1 
ATOM   5912  C  CB    . SER B  1 322 ? 29.906  -35.917  22.320  1.00 57.87  ? 322 SER B CB    1 
ATOM   5913  O  OG    . SER B  1 322 ? 28.704  -36.671  22.307  1.00 57.31  ? 322 SER B OG    1 
ATOM   5914  N  N     . LEU B  1 323 ? 29.849  -35.092  25.461  1.00 52.53  ? 323 LEU B N     1 
ATOM   5915  C  CA    . LEU B  1 323 ? 28.850  -34.843  26.485  1.00 50.34  ? 323 LEU B CA    1 
ATOM   5916  C  C     . LEU B  1 323 ? 28.004  -33.674  25.994  1.00 50.13  ? 323 LEU B C     1 
ATOM   5917  O  O     . LEU B  1 323 ? 28.537  -32.630  25.669  1.00 50.65  ? 323 LEU B O     1 
ATOM   5918  C  CB    . LEU B  1 323 ? 29.501  -34.538  27.843  1.00 48.90  ? 323 LEU B CB    1 
ATOM   5919  C  CG    . LEU B  1 323 ? 28.540  -34.187  29.009  1.00 47.60  ? 323 LEU B CG    1 
ATOM   5920  C  CD1   . LEU B  1 323 ? 27.769  -35.409  29.464  1.00 48.50  ? 323 LEU B CD1   1 
ATOM   5921  C  CD2   . LEU B  1 323 ? 29.223  -33.556  30.213  1.00 44.88  ? 323 LEU B CD2   1 
ATOM   5922  N  N     . THR B  1 324 ? 26.696  -33.876  25.904  1.00 50.03  ? 324 THR B N     1 
ATOM   5923  C  CA    . THR B  1 324 ? 25.744  -32.854  25.501  1.00 50.50  ? 324 THR B CA    1 
ATOM   5924  C  C     . THR B  1 324 ? 24.947  -32.396  26.701  1.00 49.41  ? 324 THR B C     1 
ATOM   5925  O  O     . THR B  1 324 ? 24.375  -33.232  27.417  1.00 49.42  ? 324 THR B O     1 
ATOM   5926  C  CB    . THR B  1 324 ? 24.718  -33.431  24.550  1.00 51.77  ? 324 THR B CB    1 
ATOM   5927  O  OG1   . THR B  1 324 ? 25.369  -33.853  23.354  1.00 54.78  ? 324 THR B OG1   1 
ATOM   5928  C  CG2   . THR B  1 324 ? 23.666  -32.394  24.206  1.00 52.20  ? 324 THR B CG2   1 
ATOM   5929  N  N     . ALA B  1 325 ? 24.858  -31.083  26.906  1.00 48.83  ? 325 ALA B N     1 
ATOM   5930  C  CA    . ALA B  1 325 ? 24.136  -30.543  28.058  1.00 47.29  ? 325 ALA B CA    1 
ATOM   5931  C  C     . ALA B  1 325 ? 22.781  -29.939  27.689  1.00 47.64  ? 325 ALA B C     1 
ATOM   5932  O  O     . ALA B  1 325 ? 22.690  -29.139  26.764  1.00 48.96  ? 325 ALA B O     1 
ATOM   5933  C  CB    . ALA B  1 325 ? 24.990  -29.513  28.754  1.00 46.48  ? 325 ALA B CB    1 
ATOM   5934  N  N     . LEU B  1 326 ? 21.728  -30.315  28.408  1.00 46.75  ? 326 LEU B N     1 
ATOM   5935  C  CA    . LEU B  1 326 ? 20.457  -29.592  28.317  1.00 46.77  ? 326 LEU B CA    1 
ATOM   5936  C  C     . LEU B  1 326 ? 20.088  -28.954  29.649  1.00 45.68  ? 326 LEU B C     1 
ATOM   5937  O  O     . LEU B  1 326 ? 19.306  -29.527  30.405  1.00 45.83  ? 326 LEU B O     1 
ATOM   5938  C  CB    . LEU B  1 326 ? 19.336  -30.508  27.836  1.00 47.42  ? 326 LEU B CB    1 
ATOM   5939  C  CG    . LEU B  1 326 ? 19.435  -30.986  26.384  1.00 49.27  ? 326 LEU B CG    1 
ATOM   5940  C  CD1   . LEU B  1 326 ? 18.198  -31.788  26.030  1.00 49.33  ? 326 LEU B CD1   1 
ATOM   5941  C  CD2   . LEU B  1 326 ? 19.630  -29.820  25.407  1.00 48.73  ? 326 LEU B CD2   1 
ATOM   5942  N  N     . PRO B  1 327 ? 20.671  -27.778  29.968  1.00 45.27  ? 327 PRO B N     1 
ATOM   5943  C  CA    . PRO B  1 327 ? 20.325  -27.109  31.225  1.00 44.00  ? 327 PRO B CA    1 
ATOM   5944  C  C     . PRO B  1 327 ? 18.924  -26.535  31.157  1.00 44.81  ? 327 PRO B C     1 
ATOM   5945  O  O     . PRO B  1 327 ? 18.471  -26.128  30.083  1.00 46.55  ? 327 PRO B O     1 
ATOM   5946  C  CB    . PRO B  1 327 ? 21.332  -25.965  31.300  1.00 43.45  ? 327 PRO B CB    1 
ATOM   5947  C  CG    . PRO B  1 327 ? 21.747  -25.740  29.925  1.00 44.74  ? 327 PRO B CG    1 
ATOM   5948  C  CD    . PRO B  1 327 ? 21.757  -27.072  29.271  1.00 45.56  ? 327 PRO B CD    1 
ATOM   5949  N  N     . VAL B  1 328 ? 18.234  -26.502  32.287  1.00 43.91  ? 328 VAL B N     1 
ATOM   5950  C  CA    . VAL B  1 328 ? 16.885  -25.982  32.300  1.00 44.28  ? 328 VAL B CA    1 
ATOM   5951  C  C     . VAL B  1 328 ? 16.922  -24.731  33.136  1.00 43.83  ? 328 VAL B C     1 
ATOM   5952  O  O     . VAL B  1 328 ? 17.479  -24.766  34.214  1.00 43.07  ? 328 VAL B O     1 
ATOM   5953  C  CB    . VAL B  1 328 ? 15.910  -26.987  32.914  1.00 44.12  ? 328 VAL B CB    1 
ATOM   5954  C  CG1   . VAL B  1 328 ? 14.532  -26.388  33.007  1.00 44.48  ? 328 VAL B CG1   1 
ATOM   5955  C  CG2   . VAL B  1 328 ? 15.887  -28.268  32.095  1.00 44.80  ? 328 VAL B CG2   1 
ATOM   5956  N  N     . ILE B  1 329 ? 16.373  -23.625  32.635  1.00 44.65  ? 329 ILE B N     1 
ATOM   5957  C  CA    . ILE B  1 329 ? 16.214  -22.417  33.445  1.00 44.50  ? 329 ILE B CA    1 
ATOM   5958  C  C     . ILE B  1 329 ? 14.749  -22.005  33.547  1.00 45.53  ? 329 ILE B C     1 
ATOM   5959  O  O     . ILE B  1 329 ? 13.977  -22.171  32.607  1.00 46.94  ? 329 ILE B O     1 
ATOM   5960  C  CB    . ILE B  1 329 ? 17.050  -21.233  32.911  1.00 45.12  ? 329 ILE B CB    1 
ATOM   5961  C  CG1   . ILE B  1 329 ? 18.510  -21.312  33.403  1.00 44.67  ? 329 ILE B CG1   1 
ATOM   5962  C  CG2   . ILE B  1 329 ? 16.419  -19.886  33.294  1.00 45.53  ? 329 ILE B CG2   1 
ATOM   5963  C  CD1   . ILE B  1 329 ? 18.730  -20.828  34.821  1.00 42.82  ? 329 ILE B CD1   1 
ATOM   5964  N  N     . GLU B  1 330 ? 14.366  -21.464  34.695  1.00 44.87  ? 330 GLU B N     1 
ATOM   5965  C  CA    . GLU B  1 330 ? 13.006  -21.033  34.877  1.00 45.77  ? 330 GLU B CA    1 
ATOM   5966  C  C     . GLU B  1 330 ? 12.851  -19.517  35.013  1.00 46.71  ? 330 GLU B C     1 
ATOM   5967  O  O     . GLU B  1 330 ? 13.174  -18.914  36.057  1.00 46.02  ? 330 GLU B O     1 
ATOM   5968  C  CB    . GLU B  1 330 ? 12.416  -21.720  36.079  1.00 44.85  ? 330 GLU B CB    1 
ATOM   5969  C  CG    . GLU B  1 330 ? 10.970  -21.378  36.331  1.00 47.06  ? 330 GLU B CG    1 
ATOM   5970  C  CD    . GLU B  1 330 ? 10.619  -21.611  37.769  1.00 49.60  ? 330 GLU B CD    1 
ATOM   5971  O  OE1   . GLU B  1 330 ? 9.893   -22.597  38.051  1.00 50.80  ? 330 GLU B OE1   1 
ATOM   5972  O  OE2   . GLU B  1 330 ? 11.123  -20.837  38.627  1.00 49.99  ? 330 GLU B OE2   1 
ATOM   5973  N  N     . THR B  1 331 ? 12.325  -18.903  33.963  1.00 47.93  ? 331 THR B N     1 
ATOM   5974  C  CA    . THR B  1 331 ? 12.025  -17.490  34.019  1.00 48.89  ? 331 THR B CA    1 
ATOM   5975  C  C     . THR B  1 331 ? 10.815  -17.218  34.918  1.00 49.70  ? 331 THR B C     1 
ATOM   5976  O  O     . THR B  1 331 ? 10.023  -18.119  35.179  1.00 49.76  ? 331 THR B O     1 
ATOM   5977  C  CB    . THR B  1 331 ? 11.777  -16.937  32.639  1.00 50.19  ? 331 THR B CB    1 
ATOM   5978  O  OG1   . THR B  1 331 ? 10.839  -17.774  31.970  1.00 52.26  ? 331 THR B OG1   1 
ATOM   5979  C  CG2   . THR B  1 331 ? 13.051  -16.927  31.856  1.00 49.19  ? 331 THR B CG2   1 
ATOM   5980  N  N     . GLN B  1 332 ? 10.727  -15.980  35.418  1.00 50.65  ? 332 GLN B N     1 
ATOM   5981  C  CA    . GLN B  1 332 ? 9.563   -15.451  36.127  1.00 52.12  ? 332 GLN B CA    1 
ATOM   5982  C  C     . GLN B  1 332 ? 8.854   -14.466  35.230  1.00 54.61  ? 332 GLN B C     1 
ATOM   5983  O  O     . GLN B  1 332 ? 9.477   -13.576  34.655  1.00 55.13  ? 332 GLN B O     1 
ATOM   5984  C  CB    . GLN B  1 332 ? 9.978   -14.715  37.390  1.00 51.22  ? 332 GLN B CB    1 
ATOM   5985  C  CG    . GLN B  1 332 ? 10.559  -15.607  38.473  1.00 51.17  ? 332 GLN B CG    1 
ATOM   5986  C  CD    . GLN B  1 332 ? 9.544   -16.568  39.070  1.00 53.39  ? 332 GLN B CD    1 
ATOM   5987  O  OE1   . GLN B  1 332 ? 8.359   -16.250  39.206  1.00 55.07  ? 332 GLN B OE1   1 
ATOM   5988  N  NE2   . GLN B  1 332 ? 10.012  -17.756  39.442  1.00 54.10  ? 332 GLN B NE2   1 
ATOM   5989  N  N     . GLY B  1 333 ? 7.545   -14.617  35.088  1.00 56.69  ? 333 GLY B N     1 
ATOM   5990  C  CA    . GLY B  1 333 ? 6.787   -13.667  34.273  1.00 59.22  ? 333 GLY B CA    1 
ATOM   5991  C  C     . GLY B  1 333 ? 7.361   -13.541  32.873  1.00 60.05  ? 333 GLY B C     1 
ATOM   5992  O  O     . GLY B  1 333 ? 7.205   -12.512  32.216  1.00 62.17  ? 333 GLY B O     1 
ATOM   5993  N  N     . GLY B  1 334 ? 8.039   -14.594  32.425  1.00 59.05  ? 334 GLY B N     1 
ATOM   5994  C  CA    . GLY B  1 334 ? 8.492   -14.708  31.041  1.00 59.48  ? 334 GLY B CA    1 
ATOM   5995  C  C     . GLY B  1 334 ? 9.649   -13.797  30.700  1.00 59.09  ? 334 GLY B C     1 
ATOM   5996  O  O     . GLY B  1 334 ? 9.922   -13.565  29.530  1.00 60.05  ? 334 GLY B O     1 
ATOM   5997  N  N     . ASP B  1 335 ? 10.341  -13.283  31.712  1.00 57.57  ? 335 ASP B N     1 
ATOM   5998  C  CA    . ASP B  1 335 ? 11.422  -12.334  31.457  1.00 57.84  ? 335 ASP B CA    1 
ATOM   5999  C  C     . ASP B  1 335 ? 12.785  -12.993  31.238  1.00 56.13  ? 335 ASP B C     1 
ATOM   6000  O  O     . ASP B  1 335 ? 13.455  -13.384  32.209  1.00 54.46  ? 335 ASP B O     1 
ATOM   6001  C  CB    . ASP B  1 335 ? 11.510  -11.338  32.601  1.00 57.79  ? 335 ASP B CB    1 
ATOM   6002  C  CG    . ASP B  1 335 ? 12.697  -10.393  32.476  1.00 59.51  ? 335 ASP B CG    1 
ATOM   6003  O  OD1   . ASP B  1 335 ? 13.019  -9.942   31.337  1.00 61.49  ? 335 ASP B OD1   1 
ATOM   6004  O  OD2   . ASP B  1 335 ? 13.285  -10.090  33.545  1.00 59.38  ? 335 ASP B OD2   1 
ATOM   6005  N  N     . VAL B  1 336 ? 13.213  -13.089  29.978  1.00 56.43  ? 336 VAL B N     1 
ATOM   6006  C  CA    . VAL B  1 336 ? 14.504  -13.717  29.700  1.00 54.92  ? 336 VAL B CA    1 
ATOM   6007  C  C     . VAL B  1 336 ? 15.661  -12.785  29.956  1.00 54.32  ? 336 VAL B C     1 
ATOM   6008  O  O     . VAL B  1 336 ? 16.810  -13.178  29.758  1.00 53.63  ? 336 VAL B O     1 
ATOM   6009  C  CB    . VAL B  1 336 ? 14.653  -14.278  28.260  1.00 56.24  ? 336 VAL B CB    1 
ATOM   6010  C  CG1   . VAL B  1 336 ? 13.689  -15.451  28.025  1.00 56.58  ? 336 VAL B CG1   1 
ATOM   6011  C  CG2   . VAL B  1 336 ? 14.526  -13.172  27.207  1.00 57.85  ? 336 VAL B CG2   1 
ATOM   6012  N  N     . SER B  1 337 ? 15.373  -11.562  30.387  1.00 54.34  ? 337 SER B N     1 
ATOM   6013  C  CA    . SER B  1 337 ? 16.448  -10.626  30.671  1.00 54.12  ? 337 SER B CA    1 
ATOM   6014  C  C     . SER B  1 337 ? 16.943  -10.574  32.107  1.00 52.36  ? 337 SER B C     1 
ATOM   6015  O  O     . SER B  1 337 ? 17.873  -9.828   32.408  1.00 52.57  ? 337 SER B O     1 
ATOM   6016  C  CB    . SER B  1 337 ? 16.120  -9.241   30.169  1.00 55.88  ? 337 SER B CB    1 
ATOM   6017  O  OG    . SER B  1 337 ? 16.379  -9.243   28.788  1.00 58.31  ? 337 SER B OG    1 
ATOM   6018  N  N     . ALA B  1 338 ? 16.350  -11.371  32.986  1.00 50.54  ? 338 ALA B N     1 
ATOM   6019  C  CA    . ALA B  1 338 ? 16.810  -11.401  34.351  1.00 48.99  ? 338 ALA B CA    1 
ATOM   6020  C  C     . ALA B  1 338 ? 18.262  -11.850  34.357  1.00 48.28  ? 338 ALA B C     1 
ATOM   6021  O  O     . ALA B  1 338 ? 18.776  -12.346  33.340  1.00 48.75  ? 338 ALA B O     1 
ATOM   6022  C  CB    . ALA B  1 338 ? 15.959  -12.328  35.175  1.00 48.02  ? 338 ALA B CB    1 
ATOM   6023  N  N     . TYR B  1 339 ? 18.918  -11.663  35.500  1.00 47.16  ? 339 TYR B N     1 
ATOM   6024  C  CA    . TYR B  1 339 ? 20.322  -11.995  35.667  1.00 45.83  ? 339 TYR B CA    1 
ATOM   6025  C  C     . TYR B  1 339 ? 20.650  -13.452  35.326  1.00 44.37  ? 339 TYR B C     1 
ATOM   6026  O  O     . TYR B  1 339 ? 21.493  -13.710  34.480  1.00 44.94  ? 339 TYR B O     1 
ATOM   6027  C  CB    . TYR B  1 339 ? 20.737  -11.642  37.094  1.00 45.44  ? 339 TYR B CB    1 
ATOM   6028  C  CG    . TYR B  1 339 ? 22.211  -11.719  37.406  1.00 45.10  ? 339 TYR B CG    1 
ATOM   6029  C  CD1   . TYR B  1 339 ? 23.171  -11.306  36.493  1.00 46.18  ? 339 TYR B CD1   1 
ATOM   6030  C  CD2   . TYR B  1 339 ? 22.638  -12.176  38.642  1.00 45.10  ? 339 TYR B CD2   1 
ATOM   6031  C  CE1   . TYR B  1 339 ? 24.522  -11.378  36.797  1.00 46.89  ? 339 TYR B CE1   1 
ATOM   6032  C  CE2   . TYR B  1 339 ? 23.982  -12.253  38.958  1.00 45.52  ? 339 TYR B CE2   1 
ATOM   6033  C  CZ    . TYR B  1 339 ? 24.915  -11.849  38.034  1.00 46.53  ? 339 TYR B CZ    1 
ATOM   6034  O  OH    . TYR B  1 339 ? 26.239  -11.907  38.370  1.00 47.47  ? 339 TYR B OH    1 
ATOM   6035  N  N     . ILE B  1 340 ? 19.984  -14.406  35.959  1.00 42.96  ? 340 ILE B N     1 
ATOM   6036  C  CA    . ILE B  1 340 ? 20.370  -15.807  35.778  1.00 41.77  ? 340 ILE B CA    1 
ATOM   6037  C  C     . ILE B  1 340 ? 20.084  -16.340  34.354  1.00 42.42  ? 340 ILE B C     1 
ATOM   6038  O  O     . ILE B  1 340 ? 20.945  -17.008  33.760  1.00 41.97  ? 340 ILE B O     1 
ATOM   6039  C  CB    . ILE B  1 340 ? 19.824  -16.727  36.902  1.00 40.54  ? 340 ILE B CB    1 
ATOM   6040  C  CG1   . ILE B  1 340 ? 20.066  -16.089  38.278  1.00 41.16  ? 340 ILE B CG1   1 
ATOM   6041  C  CG2   . ILE B  1 340 ? 20.431  -18.130  36.818  1.00 37.83  ? 340 ILE B CG2   1 
ATOM   6042  C  CD1   . ILE B  1 340 ? 21.545  -15.940  38.696  1.00 42.13  ? 340 ILE B CD1   1 
ATOM   6043  N  N     . PRO B  1 341 ? 18.895  -16.030  33.797  1.00 43.29  ? 341 PRO B N     1 
ATOM   6044  C  CA    . PRO B  1 341 ? 18.641  -16.356  32.407  1.00 44.30  ? 341 PRO B CA    1 
ATOM   6045  C  C     . PRO B  1 341 ? 19.742  -15.869  31.466  1.00 45.22  ? 341 PRO B C     1 
ATOM   6046  O  O     . PRO B  1 341 ? 20.288  -16.652  30.693  1.00 45.11  ? 341 PRO B O     1 
ATOM   6047  C  CB    . PRO B  1 341 ? 17.334  -15.623  32.139  1.00 45.17  ? 341 PRO B CB    1 
ATOM   6048  C  CG    . PRO B  1 341 ? 16.620  -15.763  33.385  1.00 43.86  ? 341 PRO B CG    1 
ATOM   6049  C  CD    . PRO B  1 341 ? 17.665  -15.527  34.437  1.00 43.38  ? 341 PRO B CD    1 
ATOM   6050  N  N     . THR B  1 342 ? 20.083  -14.593  31.545  1.00 46.18  ? 342 THR B N     1 
ATOM   6051  C  CA    . THR B  1 342 ? 21.057  -14.055  30.614  1.00 47.54  ? 342 THR B CA    1 
ATOM   6052  C  C     . THR B  1 342 ? 22.432  -14.629  30.870  1.00 47.01  ? 342 THR B C     1 
ATOM   6053  O  O     . THR B  1 342 ? 23.226  -14.745  29.945  1.00 47.74  ? 342 THR B O     1 
ATOM   6054  C  CB    . THR B  1 342 ? 21.112  -12.533  30.635  1.00 48.52  ? 342 THR B CB    1 
ATOM   6055  O  OG1   . THR B  1 342 ? 21.421  -12.084  31.958  1.00 48.06  ? 342 THR B OG1   1 
ATOM   6056  C  CG2   . THR B  1 342 ? 19.789  -11.977  30.199  1.00 48.92  ? 342 THR B CG2   1 
ATOM   6057  N  N     . ASN B  1 343 ? 22.722  -14.987  32.121  1.00 46.12  ? 343 ASN B N     1 
ATOM   6058  C  CA    . ASN B  1 343 ? 24.005  -15.631  32.405  1.00 45.72  ? 343 ASN B CA    1 
ATOM   6059  C  C     . ASN B  1 343 ? 24.125  -16.919  31.612  1.00 45.95  ? 343 ASN B C     1 
ATOM   6060  O  O     . ASN B  1 343 ? 25.039  -17.043  30.820  1.00 47.73  ? 343 ASN B O     1 
ATOM   6061  C  CB    . ASN B  1 343 ? 24.242  -15.835  33.892  1.00 43.89  ? 343 ASN B CB    1 
ATOM   6062  C  CG    . ASN B  1 343 ? 24.846  -14.623  34.544  1.00 44.72  ? 343 ASN B CG    1 
ATOM   6063  O  OD1   . ASN B  1 343 ? 25.173  -13.634  33.884  1.00 48.47  ? 343 ASN B OD1   1 
ATOM   6064  N  ND2   . ASN B  1 343 ? 25.008  -14.685  35.848  1.00 44.44  ? 343 ASN B ND2   1 
ATOM   6065  N  N     . VAL B  1 344 ? 23.155  -17.819  31.753  1.00 45.26  ? 344 VAL B N     1 
ATOM   6066  C  CA    . VAL B  1 344 ? 23.147  -19.112  31.056  1.00 45.11  ? 344 VAL B CA    1 
ATOM   6067  C  C     . VAL B  1 344 ? 23.082  -19.021  29.502  1.00 47.06  ? 344 VAL B C     1 
ATOM   6068  O  O     . VAL B  1 344 ? 23.889  -19.658  28.800  1.00 47.66  ? 344 VAL B O     1 
ATOM   6069  C  CB    . VAL B  1 344 ? 22.056  -20.020  31.636  1.00 44.22  ? 344 VAL B CB    1 
ATOM   6070  C  CG1   . VAL B  1 344 ? 22.153  -21.404  31.047  1.00 43.84  ? 344 VAL B CG1   1 
ATOM   6071  C  CG2   . VAL B  1 344 ? 22.196  -20.078  33.187  1.00 42.30  ? 344 VAL B CG2   1 
ATOM   6072  N  N     . ILE B  1 345 ? 22.148  -18.232  28.971  1.00 47.69  ? 345 ILE B N     1 
ATOM   6073  C  CA    . ILE B  1 345 ? 22.182  -17.846  27.557  1.00 48.94  ? 345 ILE B CA    1 
ATOM   6074  C  C     . ILE B  1 345 ? 23.576  -17.380  27.095  1.00 49.82  ? 345 ILE B C     1 
ATOM   6075  O  O     . ILE B  1 345 ? 23.934  -17.584  25.937  1.00 51.14  ? 345 ILE B O     1 
ATOM   6076  C  CB    . ILE B  1 345 ? 21.181  -16.721  27.233  1.00 49.95  ? 345 ILE B CB    1 
ATOM   6077  C  CG1   . ILE B  1 345 ? 19.746  -17.188  27.423  1.00 48.78  ? 345 ILE B CG1   1 
ATOM   6078  C  CG2   . ILE B  1 345 ? 21.369  -16.222  25.797  1.00 52.21  ? 345 ILE B CG2   1 
ATOM   6079  C  CD1   . ILE B  1 345 ? 18.794  -16.051  27.557  1.00 48.01  ? 345 ILE B CD1   1 
ATOM   6080  N  N     . SER B  1 346 ? 24.367  -16.758  27.967  1.00 49.10  ? 346 SER B N     1 
ATOM   6081  C  CA    . SER B  1 346 ? 25.700  -16.318  27.517  1.00 50.51  ? 346 SER B CA    1 
ATOM   6082  C  C     . SER B  1 346 ? 26.739  -17.430  27.644  1.00 50.41  ? 346 SER B C     1 
ATOM   6083  O  O     . SER B  1 346 ? 27.920  -17.213  27.394  1.00 51.28  ? 346 SER B O     1 
ATOM   6084  C  CB    . SER B  1 346 ? 26.172  -15.029  28.191  1.00 50.13  ? 346 SER B CB    1 
ATOM   6085  O  OG    . SER B  1 346 ? 26.484  -15.240  29.545  1.00 48.91  ? 346 SER B OG    1 
ATOM   6086  N  N     . ILE B  1 347 ? 26.271  -18.620  28.014  1.00 49.57  ? 347 ILE B N     1 
ATOM   6087  C  CA    . ILE B  1 347 ? 27.109  -19.806  28.107  1.00 49.31  ? 347 ILE B CA    1 
ATOM   6088  C  C     . ILE B  1 347 ? 26.741  -20.858  27.053  1.00 50.28  ? 347 ILE B C     1 
ATOM   6089  O  O     . ILE B  1 347 ? 27.620  -21.375  26.347  1.00 51.33  ? 347 ILE B O     1 
ATOM   6090  C  CB    . ILE B  1 347 ? 26.987  -20.472  29.494  1.00 47.34  ? 347 ILE B CB    1 
ATOM   6091  C  CG1   . ILE B  1 347 ? 27.392  -19.477  30.586  1.00 46.58  ? 347 ILE B CG1   1 
ATOM   6092  C  CG2   . ILE B  1 347 ? 27.806  -21.789  29.519  1.00 46.38  ? 347 ILE B CG2   1 
ATOM   6093  C  CD1   . ILE B  1 347 ? 26.934  -19.820  31.972  1.00 43.55  ? 347 ILE B CD1   1 
ATOM   6094  N  N     . THR B  1 348 ? 25.454  -21.199  26.980  1.00 49.79  ? 348 THR B N     1 
ATOM   6095  C  CA    . THR B  1 348 ? 25.027  -22.286  26.132  1.00 50.42  ? 348 THR B CA    1 
ATOM   6096  C  C     . THR B  1 348 ? 25.090  -21.889  24.661  1.00 52.51  ? 348 THR B C     1 
ATOM   6097  O  O     . THR B  1 348 ? 25.330  -20.730  24.313  1.00 53.17  ? 348 THR B O     1 
ATOM   6098  C  CB    . THR B  1 348 ? 23.624  -22.757  26.493  1.00 49.89  ? 348 THR B CB    1 
ATOM   6099  O  OG1   . THR B  1 348 ? 22.721  -21.659  26.392  1.00 51.50  ? 348 THR B OG1   1 
ATOM   6100  C  CG2   . THR B  1 348 ? 23.586  -23.287  27.911  1.00 48.38  ? 348 THR B CG2   1 
ATOM   6101  N  N     . ASP B  1 349 ? 24.872  -22.879  23.805  1.00 53.45  ? 349 ASP B N     1 
ATOM   6102  C  CA    . ASP B  1 349 ? 25.006  -22.723  22.373  1.00 55.43  ? 349 ASP B CA    1 
ATOM   6103  C  C     . ASP B  1 349 ? 23.657  -22.458  21.727  1.00 56.24  ? 349 ASP B C     1 
ATOM   6104  O  O     . ASP B  1 349 ? 23.454  -22.783  20.573  1.00 57.89  ? 349 ASP B O     1 
ATOM   6105  C  CB    . ASP B  1 349 ? 25.632  -23.994  21.802  1.00 56.09  ? 349 ASP B CB    1 
ATOM   6106  C  CG    . ASP B  1 349 ? 27.013  -24.277  22.380  1.00 55.84  ? 349 ASP B CG    1 
ATOM   6107  O  OD1   . ASP B  1 349 ? 27.788  -23.309  22.590  1.00 55.22  ? 349 ASP B OD1   1 
ATOM   6108  O  OD2   . ASP B  1 349 ? 27.318  -25.467  22.618  1.00 55.56  ? 349 ASP B OD2   1 
ATOM   6109  N  N     . GLY B  1 350 ? 22.745  -21.848  22.476  1.00 55.53  ? 350 GLY B N     1 
ATOM   6110  C  CA    . GLY B  1 350 ? 21.365  -21.679  22.032  1.00 56.33  ? 350 GLY B CA    1 
ATOM   6111  C  C     . GLY B  1 350 ? 20.319  -21.928  23.107  1.00 54.74  ? 350 GLY B C     1 
ATOM   6112  O  O     . GLY B  1 350 ? 20.628  -22.398  24.212  1.00 53.08  ? 350 GLY B O     1 
ATOM   6113  N  N     . GLN B  1 351 ? 19.076  -21.588  22.782  1.00 55.38  ? 351 GLN B N     1 
ATOM   6114  C  CA    . GLN B  1 351 ? 17.969  -21.748  23.709  1.00 54.05  ? 351 GLN B CA    1 
ATOM   6115  C  C     . GLN B  1 351 ? 16.780  -22.318  22.988  1.00 55.46  ? 351 GLN B C     1 
ATOM   6116  O  O     . GLN B  1 351 ? 16.546  -22.029  21.802  1.00 57.36  ? 351 GLN B O     1 
ATOM   6117  C  CB    . GLN B  1 351 ? 17.539  -20.418  24.338  1.00 53.82  ? 351 GLN B CB    1 
ATOM   6118  C  CG    . GLN B  1 351 ? 18.643  -19.411  24.556  1.00 53.11  ? 351 GLN B CG    1 
ATOM   6119  C  CD    . GLN B  1 351 ? 18.879  -18.574  23.341  1.00 54.25  ? 351 GLN B CD    1 
ATOM   6120  O  OE1   . GLN B  1 351 ? 17.959  -18.316  22.579  1.00 56.85  ? 351 GLN B OE1   1 
ATOM   6121  N  NE2   . GLN B  1 351 ? 20.112  -18.139  23.146  1.00 55.58  ? 351 GLN B NE2   1 
ATOM   6122  N  N     . ILE B  1 352 ? 16.038  -23.144  23.714  1.00 54.27  ? 352 ILE B N     1 
ATOM   6123  C  CA    . ILE B  1 352 ? 14.687  -23.475  23.335  1.00 55.27  ? 352 ILE B CA    1 
ATOM   6124  C  C     . ILE B  1 352 ? 13.805  -22.724  24.311  1.00 54.49  ? 352 ILE B C     1 
ATOM   6125  O  O     . ILE B  1 352 ? 13.709  -23.091  25.472  1.00 53.32  ? 352 ILE B O     1 
ATOM   6126  C  CB    . ILE B  1 352 ? 14.448  -24.981  23.377  1.00 54.81  ? 352 ILE B CB    1 
ATOM   6127  C  CG1   . ILE B  1 352 ? 15.124  -25.619  22.174  1.00 55.96  ? 352 ILE B CG1   1 
ATOM   6128  C  CG2   . ILE B  1 352 ? 12.962  -25.297  23.330  1.00 56.19  ? 352 ILE B CG2   1 
ATOM   6129  C  CD1   . ILE B  1 352 ? 15.435  -27.085  22.363  1.00 56.54  ? 352 ILE B CD1   1 
ATOM   6130  N  N     . PHE B  1 353 ? 13.199  -21.644  23.853  1.00 55.56  ? 353 PHE B N     1 
ATOM   6131  C  CA    . PHE B  1 353 ? 12.330  -20.885  24.708  1.00 55.52  ? 353 PHE B CA    1 
ATOM   6132  C  C     . PHE B  1 353 ? 10.897  -21.393  24.618  1.00 57.17  ? 353 PHE B C     1 
ATOM   6133  O  O     . PHE B  1 353 ? 10.358  -21.540  23.531  1.00 59.69  ? 353 PHE B O     1 
ATOM   6134  C  CB    . PHE B  1 353 ? 12.395  -19.405  24.368  1.00 56.21  ? 353 PHE B CB    1 
ATOM   6135  C  CG    . PHE B  1 353 ? 11.484  -18.571  25.200  1.00 57.15  ? 353 PHE B CG    1 
ATOM   6136  C  CD1   . PHE B  1 353 ? 11.714  -18.414  26.560  1.00 55.70  ? 353 PHE B CD1   1 
ATOM   6137  C  CD2   . PHE B  1 353 ? 10.375  -17.956  24.638  1.00 60.34  ? 353 PHE B CD2   1 
ATOM   6138  C  CE1   . PHE B  1 353 ? 10.863  -17.639  27.338  1.00 56.66  ? 353 PHE B CE1   1 
ATOM   6139  C  CE2   . PHE B  1 353 ? 9.517   -17.176  25.416  1.00 60.52  ? 353 PHE B CE2   1 
ATOM   6140  C  CZ    . PHE B  1 353 ? 9.757   -17.023  26.763  1.00 58.14  ? 353 PHE B CZ    1 
ATOM   6141  N  N     . LEU B  1 354 ? 10.280  -21.651  25.763  1.00 56.44  ? 354 LEU B N     1 
ATOM   6142  C  CA    . LEU B  1 354 ? 8.892   -22.082  25.803  1.00 58.14  ? 354 LEU B CA    1 
ATOM   6143  C  C     . LEU B  1 354 ? 7.976   -20.979  26.355  1.00 59.13  ? 354 LEU B C     1 
ATOM   6144  O  O     . LEU B  1 354 ? 8.176   -20.506  27.476  1.00 58.09  ? 354 LEU B O     1 
ATOM   6145  C  CB    . LEU B  1 354 ? 8.772   -23.370  26.627  1.00 56.95  ? 354 LEU B CB    1 
ATOM   6146  C  CG    . LEU B  1 354 ? 9.651   -24.574  26.232  1.00 56.51  ? 354 LEU B CG    1 
ATOM   6147  C  CD1   . LEU B  1 354 ? 9.621   -25.632  27.314  1.00 54.74  ? 354 LEU B CD1   1 
ATOM   6148  C  CD2   . LEU B  1 354 ? 9.233   -25.194  24.910  1.00 58.92  ? 354 LEU B CD2   1 
ATOM   6149  N  N     . GLU B  1 355 ? 6.989   -20.558  25.568  1.00 61.68  ? 355 GLU B N     1 
ATOM   6150  C  CA    . GLU B  1 355 ? 6.082   -19.472  25.973  1.00 63.20  ? 355 GLU B CA    1 
ATOM   6151  C  C     . GLU B  1 355 ? 4.885   -19.990  26.771  1.00 63.74  ? 355 GLU B C     1 
ATOM   6152  O  O     . GLU B  1 355 ? 4.237   -20.946  26.355  1.00 65.28  ? 355 GLU B O     1 
ATOM   6153  C  CB    . GLU B  1 355 ? 5.582   -18.694  24.749  1.00 65.92  ? 355 GLU B CB    1 
ATOM   6154  C  CG    . GLU B  1 355 ? 6.242   -17.337  24.523  1.00 66.95  ? 355 GLU B CG    1 
ATOM   6155  C  CD    . GLU B  1 355 ? 5.268   -16.267  23.984  1.00 72.44  ? 355 GLU B CD    1 
ATOM   6156  O  OE1   . GLU B  1 355 ? 4.219   -16.629  23.389  1.00 74.55  ? 355 GLU B OE1   1 
ATOM   6157  O  OE2   . GLU B  1 355 ? 5.551   -15.052  24.162  1.00 73.25  ? 355 GLU B OE2   1 
ATOM   6158  N  N     . ALA B  1 356 ? 4.573   -19.355  27.900  1.00 63.02  ? 356 ALA B N     1 
ATOM   6159  C  CA    . ALA B  1 356 ? 3.406   -19.752  28.699  1.00 63.95  ? 356 ALA B CA    1 
ATOM   6160  C  C     . ALA B  1 356 ? 2.101   -19.426  27.988  1.00 67.52  ? 356 ALA B C     1 
ATOM   6161  O  O     . ALA B  1 356 ? 1.071   -20.088  28.195  1.00 68.81  ? 356 ALA B O     1 
ATOM   6162  C  CB    . ALA B  1 356 ? 3.435   -19.098  30.050  1.00 62.30  ? 356 ALA B CB    1 
ATOM   6163  N  N     . GLU B  1 357 ? 2.156   -18.394  27.152  1.00 69.54  ? 357 GLU B N     1 
ATOM   6164  C  CA    . GLU B  1 357 ? 1.023   -17.988  26.341  1.00 73.21  ? 357 GLU B CA    1 
ATOM   6165  C  C     . GLU B  1 357 ? 0.614   -19.109  25.370  1.00 74.72  ? 357 GLU B C     1 
ATOM   6166  O  O     . GLU B  1 357 ? -0.557  -19.481  25.313  1.00 76.80  ? 357 GLU B O     1 
ATOM   6167  C  CB    . GLU B  1 357 ? 1.332   -16.662  25.634  1.00 74.44  ? 357 GLU B CB    1 
ATOM   6168  C  CG    . GLU B  1 357 ? 0.207   -16.061  24.752  1.00 80.90  ? 357 GLU B CG    1 
ATOM   6169  C  CD    . GLU B  1 357 ? -1.233  -16.284  25.270  1.00 85.73  ? 357 GLU B CD    1 
ATOM   6170  O  OE1   . GLU B  1 357 ? -1.413  -16.681  26.452  1.00 85.29  ? 357 GLU B OE1   1 
ATOM   6171  O  OE2   . GLU B  1 357 ? -2.188  -16.057  24.476  1.00 89.07  ? 357 GLU B OE2   1 
ATOM   6172  N  N     . LEU B  1 358 ? 1.578   -19.664  24.639  1.00 73.89  ? 358 LEU B N     1 
ATOM   6173  C  CA    . LEU B  1 358 ? 1.309   -20.771  23.721  1.00 75.19  ? 358 LEU B CA    1 
ATOM   6174  C  C     . LEU B  1 358 ? 0.816   -21.975  24.502  1.00 74.69  ? 358 LEU B C     1 
ATOM   6175  O  O     . LEU B  1 358 ? -0.130  -22.653  24.106  1.00 76.70  ? 358 LEU B O     1 
ATOM   6176  C  CB    . LEU B  1 358 ? 2.571   -21.154  22.944  1.00 74.03  ? 358 LEU B CB    1 
ATOM   6177  C  CG    . LEU B  1 358 ? 3.282   -20.056  22.149  1.00 74.47  ? 358 LEU B CG    1 
ATOM   6178  C  CD1   . LEU B  1 358 ? 4.612   -20.547  21.589  1.00 73.03  ? 358 LEU B CD1   1 
ATOM   6179  C  CD2   . LEU B  1 358 ? 2.389   -19.528  21.043  1.00 76.68  ? 358 LEU B CD2   1 
ATOM   6180  N  N     . PHE B  1 359 ? 1.465   -22.225  25.628  1.00 72.28  ? 359 PHE B N     1 
ATOM   6181  C  CA    . PHE B  1 359 ? 1.129   -23.350  26.476  1.00 71.86  ? 359 PHE B CA    1 
ATOM   6182  C  C     . PHE B  1 359 ? -0.327  -23.354  26.933  1.00 73.94  ? 359 PHE B C     1 
ATOM   6183  O  O     . PHE B  1 359 ? -0.959  -24.407  26.978  1.00 75.07  ? 359 PHE B O     1 
ATOM   6184  C  CB    . PHE B  1 359 ? 2.040   -23.375  27.693  1.00 68.91  ? 359 PHE B CB    1 
ATOM   6185  C  CG    . PHE B  1 359 ? 2.034   -24.683  28.405  1.00 68.94  ? 359 PHE B CG    1 
ATOM   6186  C  CD1   . PHE B  1 359 ? 2.978   -25.659  28.087  1.00 68.06  ? 359 PHE B CD1   1 
ATOM   6187  C  CD2   . PHE B  1 359 ? 1.066   -24.958  29.370  1.00 70.35  ? 359 PHE B CD2   1 
ATOM   6188  C  CE1   . PHE B  1 359 ? 2.981   -26.878  28.734  1.00 68.02  ? 359 PHE B CE1   1 
ATOM   6189  C  CE2   . PHE B  1 359 ? 1.051   -26.177  30.021  1.00 70.73  ? 359 PHE B CE2   1 
ATOM   6190  C  CZ    . PHE B  1 359 ? 2.019   -27.141  29.707  1.00 69.66  ? 359 PHE B CZ    1 
ATOM   6191  N  N     . TYR B  1 360 ? -0.851  -22.184  27.284  1.00 74.85  ? 360 TYR B N     1 
ATOM   6192  C  CA    . TYR B  1 360 ? -2.233  -22.079  27.752  1.00 77.15  ? 360 TYR B CA    1 
ATOM   6193  C  C     . TYR B  1 360 ? -3.246  -22.242  26.612  1.00 80.14  ? 360 TYR B C     1 
ATOM   6194  O  O     . TYR B  1 360 ? -4.343  -22.746  26.823  1.00 82.07  ? 360 TYR B O     1 
ATOM   6195  C  CB    . TYR B  1 360 ? -2.439  -20.763  28.520  1.00 77.39  ? 360 TYR B CB    1 
ATOM   6196  C  CG    . TYR B  1 360 ? -3.884  -20.413  28.839  1.00 81.75  ? 360 TYR B CG    1 
ATOM   6197  C  CD1   . TYR B  1 360 ? -4.635  -21.183  29.741  1.00 83.52  ? 360 TYR B CD1   1 
ATOM   6198  C  CD2   . TYR B  1 360 ? -4.498  -19.303  28.245  1.00 85.96  ? 360 TYR B CD2   1 
ATOM   6199  C  CE1   . TYR B  1 360 ? -5.971  -20.862  30.035  1.00 87.43  ? 360 TYR B CE1   1 
ATOM   6200  C  CE2   . TYR B  1 360 ? -5.837  -18.969  28.533  1.00 89.90  ? 360 TYR B CE2   1 
ATOM   6201  C  CZ    . TYR B  1 360 ? -6.561  -19.753  29.428  1.00 90.38  ? 360 TYR B CZ    1 
ATOM   6202  O  OH    . TYR B  1 360 ? -7.869  -19.429  29.712  1.00 93.48  ? 360 TYR B OH    1 
ATOM   6203  N  N     . LYS B  1 361 ? -2.857  -21.827  25.409  1.00 80.84  ? 361 LYS B N     1 
ATOM   6204  C  CA    . LYS B  1 361 ? -3.691  -21.945  24.210  1.00 83.88  ? 361 LYS B CA    1 
ATOM   6205  C  C     . LYS B  1 361 ? -3.840  -23.398  23.736  1.00 84.58  ? 361 LYS B C     1 
ATOM   6206  O  O     . LYS B  1 361 ? -4.752  -23.724  22.971  1.00 87.92  ? 361 LYS B O     1 
ATOM   6207  C  CB    . LYS B  1 361 ? -3.126  -21.077  23.084  1.00 84.46  ? 361 LYS B CB    1 
ATOM   6208  C  CG    . LYS B  1 361 ? -3.284  -19.581  23.313  1.00 85.63  ? 361 LYS B CG    1 
ATOM   6209  C  CD    . LYS B  1 361 ? -2.990  -18.788  22.042  1.00 88.88  ? 361 LYS B CD    1 
ATOM   6210  C  CE    . LYS B  1 361 ? -3.594  -17.378  22.095  1.00 91.71  ? 361 LYS B CE    1 
ATOM   6211  N  NZ    . LYS B  1 361 ? -3.967  -16.847  20.733  1.00 95.25  ? 361 LYS B NZ    1 
ATOM   6212  N  N     . GLY B  1 362 ? -2.953  -24.271  24.204  1.00 81.83  ? 362 GLY B N     1 
ATOM   6213  C  CA    . GLY B  1 362 ? -2.980  -25.678  23.818  1.00 82.02  ? 362 GLY B CA    1 
ATOM   6214  C  C     . GLY B  1 362 ? -1.876  -26.023  22.840  1.00 81.03  ? 362 GLY B C     1 
ATOM   6215  O  O     . GLY B  1 362 ? -1.681  -27.191  22.502  1.00 81.33  ? 362 GLY B O     1 
ATOM   6216  N  N     . ILE B  1 363 ? -1.162  -24.998  22.381  1.00 79.97  ? 363 ILE B N     1 
ATOM   6217  C  CA    . ILE B  1 363 ? 0.017   -25.177  21.550  1.00 78.46  ? 363 ILE B CA    1 
ATOM   6218  C  C     . ILE B  1 363 ? 1.122   -25.717  22.438  1.00 74.85  ? 363 ILE B C     1 
ATOM   6219  O  O     . ILE B  1 363 ? 1.731   -24.972  23.194  1.00 73.06  ? 363 ILE B O     1 
ATOM   6220  C  CB    . ILE B  1 363 ? 0.456   -23.847  20.907  1.00 78.81  ? 363 ILE B CB    1 
ATOM   6221  C  CG1   . ILE B  1 363 ? -0.639  -23.333  19.962  1.00 82.75  ? 363 ILE B CG1   1 
ATOM   6222  C  CG2   . ILE B  1 363 ? 1.794   -24.003  20.174  1.00 77.29  ? 363 ILE B CG2   1 
ATOM   6223  C  CD1   . ILE B  1 363 ? -0.744  -21.818  19.884  1.00 83.21  ? 363 ILE B CD1   1 
ATOM   6224  N  N     . ARG B  1 364 ? 1.336   -27.025  22.369  1.00 74.17  ? 364 ARG B N     1 
ATOM   6225  C  CA    . ARG B  1 364 ? 2.394   -27.692  23.097  1.00 71.07  ? 364 ARG B CA    1 
ATOM   6226  C  C     . ARG B  1 364 ? 3.011   -28.714  22.169  1.00 71.43  ? 364 ARG B C     1 
ATOM   6227  O  O     . ARG B  1 364 ? 2.284   -29.379  21.434  1.00 74.20  ? 364 ARG B O     1 
ATOM   6228  C  CB    . ARG B  1 364 ? 1.841   -28.426  24.306  1.00 70.54  ? 364 ARG B CB    1 
ATOM   6229  C  CG    . ARG B  1 364 ? 0.642   -27.782  24.958  1.00 72.95  ? 364 ARG B CG    1 
ATOM   6230  C  CD    . ARG B  1 364 ? 0.403   -28.368  26.338  1.00 74.41  ? 364 ARG B CD    1 
ATOM   6231  N  NE    . ARG B  1 364 ? -0.545  -27.558  27.101  1.00 77.70  ? 364 ARG B NE    1 
ATOM   6232  C  CZ    . ARG B  1 364 ? -1.215  -27.980  28.171  1.00 78.80  ? 364 ARG B CZ    1 
ATOM   6233  N  NH1   . ARG B  1 364 ? -1.051  -29.222  28.624  1.00 78.51  ? 364 ARG B NH1   1 
ATOM   6234  N  NH2   . ARG B  1 364 ? -2.058  -27.157  28.784  1.00 79.72  ? 364 ARG B NH2   1 
ATOM   6235  N  N     . PRO B  1 365 ? 4.353   -28.828  22.155  1.00 69.18  ? 365 PRO B N     1 
ATOM   6236  C  CA    . PRO B  1 365 ? 5.345   -27.990  22.815  1.00 66.52  ? 365 PRO B CA    1 
ATOM   6237  C  C     . PRO B  1 365 ? 5.145   -26.520  22.480  1.00 67.28  ? 365 PRO B C     1 
ATOM   6238  O  O     . PRO B  1 365 ? 4.912   -26.162  21.325  1.00 69.65  ? 365 PRO B O     1 
ATOM   6239  C  CB    . PRO B  1 365 ? 6.667   -28.483  22.217  1.00 65.29  ? 365 PRO B CB    1 
ATOM   6240  C  CG    . PRO B  1 365 ? 6.420   -29.856  21.897  1.00 66.40  ? 365 PRO B CG    1 
ATOM   6241  C  CD    . PRO B  1 365 ? 5.009   -29.893  21.379  1.00 69.65  ? 365 PRO B CD    1 
ATOM   6242  N  N     . ALA B  1 366 ? 5.229   -25.678  23.496  1.00 65.70  ? 366 ALA B N     1 
ATOM   6243  C  CA    . ALA B  1 366 ? 5.002   -24.255  23.320  1.00 66.51  ? 366 ALA B CA    1 
ATOM   6244  C  C     . ALA B  1 366 ? 6.279   -23.532  22.888  1.00 65.38  ? 366 ALA B C     1 
ATOM   6245  O  O     . ALA B  1 366 ? 6.629   -22.506  23.459  1.00 64.56  ? 366 ALA B O     1 
ATOM   6246  C  CB    . ALA B  1 366 ? 4.446   -23.662  24.620  1.00 65.60  ? 366 ALA B CB    1 
ATOM   6247  N  N     . ILE B  1 367 ? 6.977   -24.059  21.888  1.00 65.77  ? 367 ILE B N     1 
ATOM   6248  C  CA    . ILE B  1 367 ? 8.228   -23.441  21.458  1.00 65.06  ? 367 ILE B CA    1 
ATOM   6249  C  C     . ILE B  1 367 ? 7.984   -22.153  20.670  1.00 67.35  ? 367 ILE B C     1 
ATOM   6250  O  O     . ILE B  1 367 ? 7.469   -22.175  19.562  1.00 70.13  ? 367 ILE B O     1 
ATOM   6251  C  CB    . ILE B  1 367 ? 9.124   -24.409  20.656  1.00 64.98  ? 367 ILE B CB    1 
ATOM   6252  C  CG1   . ILE B  1 367 ? 9.490   -25.614  21.517  1.00 63.00  ? 367 ILE B CG1   1 
ATOM   6253  C  CG2   . ILE B  1 367 ? 10.397  -23.707  20.181  1.00 63.73  ? 367 ILE B CG2   1 
ATOM   6254  C  CD1   . ILE B  1 367 ? 9.677   -26.889  20.742  1.00 63.93  ? 367 ILE B CD1   1 
ATOM   6255  N  N     . ASN B  1 368 ? 8.355   -21.034  21.274  1.00 66.67  ? 368 ASN B N     1 
ATOM   6256  C  CA    . ASN B  1 368 ? 8.386   -19.753  20.605  1.00 68.64  ? 368 ASN B CA    1 
ATOM   6257  C  C     . ASN B  1 368 ? 9.573   -19.748  19.664  1.00 69.13  ? 368 ASN B C     1 
ATOM   6258  O  O     . ASN B  1 368 ? 10.712  -19.634  20.102  1.00 67.34  ? 368 ASN B O     1 
ATOM   6259  C  CB    . ASN B  1 368 ? 8.535   -18.651  21.645  1.00 67.51  ? 368 ASN B CB    1 
ATOM   6260  C  CG    . ASN B  1 368 ? 8.363   -17.270  21.069  1.00 70.03  ? 368 ASN B CG    1 
ATOM   6261  O  OD1   . ASN B  1 368 ? 8.968   -16.920  20.054  1.00 72.78  ? 368 ASN B OD1   1 
ATOM   6262  N  ND2   . ASN B  1 368 ? 7.543   -16.461  21.729  1.00 70.59  ? 368 ASN B ND2   1 
ATOM   6263  N  N     . VAL B  1 369 ? 9.300   -19.893  18.371  1.00 72.31  ? 369 VAL B N     1 
ATOM   6264  C  CA    . VAL B  1 369 ? 10.355  -20.055  17.368  1.00 73.03  ? 369 VAL B CA    1 
ATOM   6265  C  C     . VAL B  1 369 ? 11.127  -18.760  17.202  1.00 73.15  ? 369 VAL B C     1 
ATOM   6266  O  O     . VAL B  1 369 ? 12.345  -18.792  17.047  1.00 72.71  ? 369 VAL B O     1 
ATOM   6267  C  CB    . VAL B  1 369 ? 9.820   -20.522  15.992  1.00 76.10  ? 369 VAL B CB    1 
ATOM   6268  C  CG1   . VAL B  1 369 ? 10.970  -21.052  15.135  1.00 76.16  ? 369 VAL B CG1   1 
ATOM   6269  C  CG2   . VAL B  1 369 ? 8.742   -21.600  16.159  1.00 76.72  ? 369 VAL B CG2   1 
ATOM   6270  N  N     . GLY B  1 370 ? 10.426  -17.629  17.249  1.00 74.11  ? 370 GLY B N     1 
ATOM   6271  C  CA    . GLY B  1 370 ? 11.080  -16.326  17.174  1.00 74.39  ? 370 GLY B CA    1 
ATOM   6272  C  C     . GLY B  1 370 ? 12.264  -16.274  18.119  1.00 71.74  ? 370 GLY B C     1 
ATOM   6273  O  O     . GLY B  1 370 ? 13.370  -15.899  17.736  1.00 72.07  ? 370 GLY B O     1 
ATOM   6274  N  N     . LEU B  1 371 ? 12.032  -16.706  19.353  1.00 69.17  ? 371 LEU B N     1 
ATOM   6275  C  CA    . LEU B  1 371 ? 13.033  -16.629  20.396  1.00 65.96  ? 371 LEU B CA    1 
ATOM   6276  C  C     . LEU B  1 371 ? 13.851  -17.895  20.626  1.00 63.70  ? 371 LEU B C     1 
ATOM   6277  O  O     . LEU B  1 371 ? 14.624  -17.957  21.590  1.00 61.71  ? 371 LEU B O     1 
ATOM   6278  C  CB    . LEU B  1 371 ? 12.378  -16.202  21.702  1.00 64.71  ? 371 LEU B CB    1 
ATOM   6279  C  CG    . LEU B  1 371 ? 12.322  -14.694  21.909  1.00 66.05  ? 371 LEU B CG    1 
ATOM   6280  C  CD1   . LEU B  1 371 ? 10.997  -14.127  21.427  1.00 68.91  ? 371 LEU B CD1   1 
ATOM   6281  C  CD2   . LEU B  1 371 ? 12.527  -14.417  23.387  1.00 65.35  ? 371 LEU B CD2   1 
ATOM   6282  N  N     . SER B  1 372 ? 13.703  -18.897  19.768  1.00 63.75  ? 372 SER B N     1 
ATOM   6283  C  CA    . SER B  1 372 ? 14.509  -20.098  19.919  1.00 61.65  ? 372 SER B CA    1 
ATOM   6284  C  C     . SER B  1 372 ? 15.591  -20.166  18.862  1.00 62.61  ? 372 SER B C     1 
ATOM   6285  O  O     . SER B  1 372 ? 15.408  -19.686  17.749  1.00 65.20  ? 372 SER B O     1 
ATOM   6286  C  CB    . SER B  1 372 ? 13.641  -21.343  19.899  1.00 61.64  ? 372 SER B CB    1 
ATOM   6287  O  OG    . SER B  1 372 ? 12.820  -21.364  21.045  1.00 59.23  ? 372 SER B OG    1 
ATOM   6288  N  N     . VAL B  1 373 ? 16.727  -20.749  19.223  1.00 60.72  ? 373 VAL B N     1 
ATOM   6289  C  CA    . VAL B  1 373 ? 17.861  -20.848  18.318  1.00 61.25  ? 373 VAL B CA    1 
ATOM   6290  C  C     . VAL B  1 373 ? 18.811  -21.951  18.762  1.00 59.67  ? 373 VAL B C     1 
ATOM   6291  O  O     . VAL B  1 373 ? 18.931  -22.232  19.957  1.00 57.42  ? 373 VAL B O     1 
ATOM   6292  C  CB    . VAL B  1 373 ? 18.627  -19.510  18.212  1.00 61.47  ? 373 VAL B CB    1 
ATOM   6293  C  CG1   . VAL B  1 373 ? 19.302  -19.159  19.523  1.00 58.95  ? 373 VAL B CG1   1 
ATOM   6294  C  CG2   . VAL B  1 373 ? 19.649  -19.578  17.111  1.00 63.04  ? 373 VAL B CG2   1 
ATOM   6295  N  N     . SER B  1 374 ? 19.453  -22.576  17.778  1.00 61.00  ? 374 SER B N     1 
ATOM   6296  C  CA    . SER B  1 374 ? 20.559  -23.493  17.983  1.00 60.22  ? 374 SER B CA    1 
ATOM   6297  C  C     . SER B  1 374 ? 21.741  -22.932  17.205  1.00 61.96  ? 374 SER B C     1 
ATOM   6298  O  O     . SER B  1 374 ? 21.664  -22.770  15.991  1.00 64.44  ? 374 SER B O     1 
ATOM   6299  C  CB    . SER B  1 374 ? 20.186  -24.879  17.463  1.00 60.78  ? 374 SER B CB    1 
ATOM   6300  O  OG    . SER B  1 374 ? 21.319  -25.725  17.437  1.00 60.45  ? 374 SER B OG    1 
ATOM   6301  N  N     . ARG B  1 375 ? 22.832  -22.624  17.892  1.00 61.22  ? 375 ARG B N     1 
ATOM   6302  C  CA    . ARG B  1 375 ? 23.962  -21.942  17.247  1.00 63.13  ? 375 ARG B CA    1 
ATOM   6303  C  C     . ARG B  1 375 ? 24.914  -22.848  16.474  1.00 64.79  ? 375 ARG B C     1 
ATOM   6304  O  O     . ARG B  1 375 ? 25.664  -22.359  15.625  1.00 67.06  ? 375 ARG B O     1 
ATOM   6305  C  CB    . ARG B  1 375 ? 24.773  -21.153  18.269  1.00 61.77  ? 375 ARG B CB    1 
ATOM   6306  C  CG    . ARG B  1 375 ? 23.977  -20.119  19.047  1.00 61.11  ? 375 ARG B CG    1 
ATOM   6307  C  CD    . ARG B  1 375 ? 24.840  -19.446  20.100  1.00 59.23  ? 375 ARG B CD    1 
ATOM   6308  N  NE    . ARG B  1 375 ? 24.039  -18.589  20.967  1.00 58.36  ? 375 ARG B NE    1 
ATOM   6309  C  CZ    . ARG B  1 375 ? 24.542  -17.655  21.763  1.00 57.38  ? 375 ARG B CZ    1 
ATOM   6310  N  NH1   . ARG B  1 375 ? 25.855  -17.450  21.800  1.00 57.56  ? 375 ARG B NH1   1 
ATOM   6311  N  NH2   . ARG B  1 375 ? 23.730  -16.923  22.513  1.00 55.90  ? 375 ARG B NH2   1 
ATOM   6312  N  N     . VAL B  1 376 ? 24.899  -24.153  16.770  1.00 64.18  ? 376 VAL B N     1 
ATOM   6313  C  CA    . VAL B  1 376 ? 25.855  -25.104  16.175  1.00 65.10  ? 376 VAL B CA    1 
ATOM   6314  C  C     . VAL B  1 376 ? 25.216  -26.365  15.553  1.00 66.30  ? 376 VAL B C     1 
ATOM   6315  O  O     . VAL B  1 376 ? 25.888  -27.145  14.843  1.00 67.34  ? 376 VAL B O     1 
ATOM   6316  C  CB    . VAL B  1 376 ? 26.905  -25.547  17.213  1.00 63.12  ? 376 VAL B CB    1 
ATOM   6317  C  CG1   . VAL B  1 376 ? 27.630  -24.358  17.781  1.00 62.51  ? 376 VAL B CG1   1 
ATOM   6318  C  CG2   . VAL B  1 376 ? 26.254  -26.326  18.318  1.00 60.64  ? 376 VAL B CG2   1 
ATOM   6319  N  N     . GLY B  1 377 ? 23.930  -26.560  15.842  1.00 65.85  ? 377 GLY B N     1 
ATOM   6320  C  CA    . GLY B  1 377 ? 23.225  -27.791  15.511  1.00 66.44  ? 377 GLY B CA    1 
ATOM   6321  C  C     . GLY B  1 377 ? 22.908  -27.979  14.044  1.00 69.43  ? 377 GLY B C     1 
ATOM   6322  O  O     . GLY B  1 377 ? 22.812  -29.108  13.572  1.00 70.53  ? 377 GLY B O     1 
ATOM   6323  N  N     . SER B  1 378 ? 22.753  -26.877  13.315  1.00 71.18  ? 378 SER B N     1 
ATOM   6324  C  CA    . SER B  1 378 ? 22.393  -26.935  11.900  1.00 74.25  ? 378 SER B CA    1 
ATOM   6325  C  C     . SER B  1 378 ? 23.269  -27.938  11.166  1.00 75.80  ? 378 SER B C     1 
ATOM   6326  O  O     . SER B  1 378 ? 22.764  -28.731  10.366  1.00 77.91  ? 378 SER B O     1 
ATOM   6327  C  CB    . SER B  1 378 ? 22.492  -25.554  11.267  1.00 75.81  ? 378 SER B CB    1 
ATOM   6328  O  OG    . SER B  1 378 ? 21.807  -24.593  12.071  1.00 75.09  ? 378 SER B OG    1 
ATOM   6329  N  N     . ALA B  1 379 ? 24.571  -27.919  11.468  1.00 75.09  ? 379 ALA B N     1 
ATOM   6330  C  CA    . ALA B  1 379 ? 25.541  -28.860  10.898  1.00 76.18  ? 379 ALA B CA    1 
ATOM   6331  C  C     . ALA B  1 379 ? 25.093  -30.283  11.137  1.00 75.85  ? 379 ALA B C     1 
ATOM   6332  O  O     . ALA B  1 379 ? 25.011  -31.088  10.195  1.00 78.19  ? 379 ALA B O     1 
ATOM   6333  C  CB    . ALA B  1 379 ? 26.920  -28.650  11.501  1.00 74.86  ? 379 ALA B CB    1 
ATOM   6334  N  N     . ALA B  1 380 ? 24.771  -30.562  12.398  1.00 73.08  ? 380 ALA B N     1 
ATOM   6335  C  CA    . ALA B  1 380 ? 24.443  -31.902  12.871  1.00 72.41  ? 380 ALA B CA    1 
ATOM   6336  C  C     . ALA B  1 380 ? 23.039  -32.381  12.540  1.00 73.44  ? 380 ALA B C     1 
ATOM   6337  O  O     . ALA B  1 380 ? 22.709  -33.520  12.852  1.00 73.71  ? 380 ALA B O     1 
ATOM   6338  C  CB    . ALA B  1 380 ? 24.671  -32.003  14.375  1.00 69.58  ? 380 ALA B CB    1 
ATOM   6339  N  N     . GLN B  1 381 ? 22.214  -31.535  11.924  1.00 74.48  ? 381 GLN B N     1 
ATOM   6340  C  CA    . GLN B  1 381 ? 20.857  -31.939  11.519  1.00 75.47  ? 381 GLN B CA    1 
ATOM   6341  C  C     . GLN B  1 381 ? 20.859  -33.074  10.476  1.00 77.83  ? 381 GLN B C     1 
ATOM   6342  O  O     . GLN B  1 381 ? 21.745  -33.132  9.622   1.00 79.56  ? 381 GLN B O     1 
ATOM   6343  C  CB    . GLN B  1 381 ? 20.090  -30.729  10.980  1.00 76.52  ? 381 GLN B CB    1 
ATOM   6344  C  CG    . GLN B  1 381 ? 18.581  -30.861  11.079  1.00 76.68  ? 381 GLN B CG    1 
ATOM   6345  C  CD    . GLN B  1 381 ? 17.857  -29.633  10.586  1.00 77.56  ? 381 GLN B CD    1 
ATOM   6346  O  OE1   . GLN B  1 381 ? 18.370  -28.897  9.742   1.00 79.75  ? 381 GLN B OE1   1 
ATOM   6347  N  NE2   . GLN B  1 381 ? 16.650  -29.409  11.097  1.00 76.20  ? 381 GLN B NE2   1 
ATOM   6348  N  N     . VAL B  1 382 ? 19.875  -33.972  10.558  1.00 78.10  ? 382 VAL B N     1 
ATOM   6349  C  CA    . VAL B  1 382 ? 19.683  -35.024  9.537   1.00 80.60  ? 382 VAL B CA    1 
ATOM   6350  C  C     . VAL B  1 382 ? 19.221  -34.356  8.254   1.00 83.30  ? 382 VAL B C     1 
ATOM   6351  O  O     . VAL B  1 382 ? 18.216  -33.643  8.268   1.00 83.69  ? 382 VAL B O     1 
ATOM   6352  C  CB    . VAL B  1 382 ? 18.617  -36.080  9.969   1.00 80.60  ? 382 VAL B CB    1 
ATOM   6353  C  CG1   . VAL B  1 382 ? 18.330  -37.049  8.860   1.00 83.03  ? 382 VAL B CG1   1 
ATOM   6354  C  CG2   . VAL B  1 382 ? 19.051  -36.831  11.241  1.00 78.69  ? 382 VAL B CG2   1 
ATOM   6355  N  N     . LYS B  1 383 ? 19.949  -34.589  7.156   1.00 86.24  ? 383 LYS B N     1 
ATOM   6356  C  CA    . LYS B  1 383 ? 19.692  -33.931  5.863   1.00 87.47  ? 383 LYS B CA    1 
ATOM   6357  C  C     . LYS B  1 383 ? 18.228  -33.896  5.450   1.00 86.99  ? 383 LYS B C     1 
ATOM   6358  O  O     . LYS B  1 383 ? 17.725  -32.851  5.079   1.00 87.43  ? 383 LYS B O     1 
ATOM   6359  C  CB    . LYS B  1 383 ? 20.549  -34.526  4.743   1.00 89.68  ? 383 LYS B CB    1 
ATOM   6360  C  CG    . LYS B  1 383 ? 21.907  -33.864  4.603   1.00 91.05  ? 383 LYS B CG    1 
ATOM   6361  C  CD    . LYS B  1 383 ? 22.501  -34.051  3.207   1.00 93.62  ? 383 LYS B CD    1 
ATOM   6362  C  CE    . LYS B  1 383 ? 23.571  -32.992  2.905   1.00 95.00  ? 383 LYS B CE    1 
ATOM   6363  N  NZ    . LYS B  1 383 ? 24.243  -33.203  1.591   1.00 97.94  ? 383 LYS B NZ    1 
ATOM   6364  N  N     . ALA B  1 384 ? 17.549  -35.036  5.531   1.00 86.40  ? 384 ALA B N     1 
ATOM   6365  C  CA    . ALA B  1 384 ? 16.119  -35.124  5.213   1.00 86.35  ? 384 ALA B CA    1 
ATOM   6366  C  C     . ALA B  1 384 ? 15.331  -33.964  5.823   1.00 85.14  ? 384 ALA B C     1 
ATOM   6367  O  O     . ALA B  1 384 ? 14.631  -33.246  5.114   1.00 86.36  ? 384 ALA B O     1 
ATOM   6368  C  CB    . ALA B  1 384 ? 15.545  -36.467  5.668   1.00 85.40  ? 384 ALA B CB    1 
ATOM   6369  N  N     . LEU B  1 385 ? 15.474  -33.777  7.132   1.00 83.17  ? 385 LEU B N     1 
ATOM   6370  C  CA    . LEU B  1 385 ? 14.842  -32.670  7.839   1.00 81.98  ? 385 LEU B CA    1 
ATOM   6371  C  C     . LEU B  1 385 ? 15.314  -31.327  7.325   1.00 83.22  ? 385 LEU B C     1 
ATOM   6372  O  O     . LEU B  1 385 ? 14.500  -30.450  7.095   1.00 83.67  ? 385 LEU B O     1 
ATOM   6373  C  CB    . LEU B  1 385 ? 15.098  -32.767  9.344   1.00 80.01  ? 385 LEU B CB    1 
ATOM   6374  C  CG    . LEU B  1 385 ? 14.065  -33.539  10.153  1.00 77.66  ? 385 LEU B CG    1 
ATOM   6375  C  CD1   . LEU B  1 385 ? 14.675  -33.948  11.450  1.00 77.16  ? 385 LEU B CD1   1 
ATOM   6376  C  CD2   . LEU B  1 385 ? 12.837  -32.700  10.389  1.00 76.73  ? 385 LEU B CD2   1 
ATOM   6377  N  N     . LYS B  1 386 ? 16.626  -31.186  7.144   1.00 84.25  ? 386 LYS B N     1 
ATOM   6378  C  CA    . LYS B  1 386 ? 17.248  -29.958  6.631   1.00 86.16  ? 386 LYS B CA    1 
ATOM   6379  C  C     . LYS B  1 386 ? 16.646  -29.541  5.292   1.00 88.39  ? 386 LYS B C     1 
ATOM   6380  O  O     . LYS B  1 386 ? 16.440  -28.356  5.041   1.00 89.19  ? 386 LYS B O     1 
ATOM   6381  C  CB    . LYS B  1 386 ? 18.764  -30.162  6.486   1.00 87.01  ? 386 LYS B CB    1 
ATOM   6382  C  CG    . LYS B  1 386 ? 19.617  -28.890  6.443   1.00 88.17  ? 386 LYS B CG    1 
ATOM   6383  C  CD    . LYS B  1 386 ? 21.072  -29.220  6.819   1.00 88.76  ? 386 LYS B CD    1 
ATOM   6384  C  CE    . LYS B  1 386 ? 21.934  -27.974  7.024   1.00 89.59  ? 386 LYS B CE    1 
ATOM   6385  N  NZ    . LYS B  1 386 ? 23.162  -28.264  7.835   1.00 88.51  ? 386 LYS B NZ    1 
ATOM   6386  N  N     . GLN B  1 387 ? 16.349  -30.536  4.457   1.00 89.83  ? 387 GLN B N     1 
ATOM   6387  C  CA    . GLN B  1 387 ? 15.848  -30.333  3.094   1.00 92.53  ? 387 GLN B CA    1 
ATOM   6388  C  C     . GLN B  1 387 ? 14.387  -29.896  3.068   1.00 92.51  ? 387 GLN B C     1 
ATOM   6389  O  O     . GLN B  1 387 ? 14.029  -28.992  2.326   1.00 94.28  ? 387 GLN B O     1 
ATOM   6390  C  CB    . GLN B  1 387 ? 16.067  -31.590  2.253   1.00 93.66  ? 387 GLN B CB    1 
ATOM   6391  C  CG    . GLN B  1 387 ? 17.549  -31.917  2.048   1.00 95.44  ? 387 GLN B CG    1 
ATOM   6392  C  CD    . GLN B  1 387 ? 17.784  -33.134  1.162   1.00 98.37  ? 387 GLN B CD    1 
ATOM   6393  O  OE1   . GLN B  1 387 ? 17.026  -34.105  1.208   1.00 98.31  ? 387 GLN B OE1   1 
ATOM   6394  N  NE2   . GLN B  1 387 ? 18.846  -33.087  0.356   1.00 100.38 ? 387 GLN B NE2   1 
ATOM   6395  N  N     . VAL B  1 388 ? 13.554  -30.528  3.889   1.00 91.09  ? 388 VAL B N     1 
ATOM   6396  C  CA    . VAL B  1 388 ? 12.155  -30.102  4.059   1.00 91.20  ? 388 VAL B CA    1 
ATOM   6397  C  C     . VAL B  1 388 ? 11.985  -28.968  5.089   1.00 90.15  ? 388 VAL B C     1 
ATOM   6398  O  O     . VAL B  1 388 ? 10.860  -28.565  5.393   1.00 89.95  ? 388 VAL B O     1 
ATOM   6399  C  CB    . VAL B  1 388 ? 11.207  -31.290  4.415   1.00 90.17  ? 388 VAL B CB    1 
ATOM   6400  C  CG1   . VAL B  1 388 ? 11.351  -32.416  3.401   1.00 91.75  ? 388 VAL B CG1   1 
ATOM   6401  C  CG2   . VAL B  1 388 ? 11.459  -31.804  5.839   1.00 87.96  ? 388 VAL B CG2   1 
ATOM   6402  N  N     . ALA B  1 389 ? 13.096  -28.465  5.626   1.00 89.79  ? 389 ALA B N     1 
ATOM   6403  C  CA    . ALA B  1 389 ? 13.056  -27.330  6.548   1.00 89.47  ? 389 ALA B CA    1 
ATOM   6404  C  C     . ALA B  1 389 ? 13.489  -26.050  5.838   1.00 91.90  ? 389 ALA B C     1 
ATOM   6405  O  O     . ALA B  1 389 ? 13.721  -25.010  6.473   1.00 91.90  ? 389 ALA B O     1 
ATOM   6406  C  CB    . ALA B  1 389 ? 13.923  -27.587  7.774   1.00 87.60  ? 389 ALA B CB    1 
ATOM   6407  N  N     . GLY B  1 390 ? 13.597  -26.137  4.513   1.00 94.31  ? 390 GLY B N     1 
ATOM   6408  C  CA    . GLY B  1 390 ? 13.876  -24.973  3.685   1.00 96.91  ? 390 GLY B CA    1 
ATOM   6409  C  C     . GLY B  1 390 ? 13.133  -23.775  4.240   1.00 97.03  ? 390 GLY B C     1 
ATOM   6410  O  O     . GLY B  1 390 ? 11.898  -23.724  4.195   1.00 97.05  ? 390 GLY B O     1 
ATOM   6411  N  N     . SER B  1 391 ? 13.892  -22.845  4.818   1.00 97.13  ? 391 SER B N     1 
ATOM   6412  C  CA    . SER B  1 391 ? 13.372  -21.549  5.262   1.00 97.96  ? 391 SER B CA    1 
ATOM   6413  C  C     . SER B  1 391 ? 12.258  -21.620  6.305   1.00 96.22  ? 391 SER B C     1 
ATOM   6414  O  O     . SER B  1 391 ? 11.830  -20.571  6.815   1.00 96.68  ? 391 SER B O     1 
ATOM   6415  C  CB    . SER B  1 391 ? 12.885  -20.710  4.068   1.00 100.85 ? 391 SER B CB    1 
ATOM   6416  O  OG    . SER B  1 391 ? 13.962  -20.088  3.395   1.00 103.58 ? 391 SER B OG    1 
ATOM   6417  N  N     . LEU B  1 392 ? 11.779  -22.830  6.619   1.00 94.25  ? 392 LEU B N     1 
ATOM   6418  C  CA    . LEU B  1 392 ? 10.711  -22.975  7.610   1.00 92.53  ? 392 LEU B CA    1 
ATOM   6419  C  C     . LEU B  1 392 ? 11.027  -22.070  8.797   1.00 92.06  ? 392 LEU B C     1 
ATOM   6420  O  O     . LEU B  1 392 ? 10.137  -21.408  9.324   1.00 91.98  ? 392 LEU B O     1 
ATOM   6421  C  CB    . LEU B  1 392 ? 10.517  -24.436  8.035   1.00 90.35  ? 392 LEU B CB    1 
ATOM   6422  C  CG    . LEU B  1 392 ? 9.300   -24.758  8.916   1.00 88.21  ? 392 LEU B CG    1 
ATOM   6423  C  CD1   . LEU B  1 392 ? 8.033   -24.076  8.439   1.00 88.39  ? 392 LEU B CD1   1 
ATOM   6424  C  CD2   . LEU B  1 392 ? 9.085   -26.250  9.032   1.00 85.85  ? 392 LEU B CD2   1 
ATOM   6425  N  N     . LYS B  1 393 ? 12.315  -22.032  9.154   1.00 92.18  ? 393 LYS B N     1 
ATOM   6426  C  CA    . LYS B  1 393 ? 12.898  -21.115  10.144  1.00 92.84  ? 393 LYS B CA    1 
ATOM   6427  C  C     . LYS B  1 393 ? 12.478  -19.669  9.896   1.00 95.14  ? 393 LYS B C     1 
ATOM   6428  O  O     . LYS B  1 393 ? 11.883  -19.024  10.775  1.00 95.14  ? 393 LYS B O     1 
ATOM   6429  C  CB    . LYS B  1 393 ? 14.439  -21.206  10.100  1.00 93.31  ? 393 LYS B CB    1 
ATOM   6430  C  CG    . LYS B  1 393 ? 15.202  -20.500  11.246  1.00 93.09  ? 393 LYS B CG    1 
ATOM   6431  C  CD    . LYS B  1 393 ? 15.466  -21.440  12.439  1.00 91.11  ? 393 LYS B CD    1 
ATOM   6432  C  CE    . LYS B  1 393 ? 16.571  -20.902  13.378  1.00 92.65  ? 393 LYS B CE    1 
ATOM   6433  N  NZ    . LYS B  1 393 ? 16.259  -19.610  14.101  1.00 92.22  ? 393 LYS B NZ    1 
ATOM   6434  N  N     . LEU B  1 394 ? 12.814  -19.177  8.698   1.00 97.43  ? 394 LEU B N     1 
ATOM   6435  C  CA    . LEU B  1 394 ? 12.482  -17.817  8.260   1.00 99.79  ? 394 LEU B CA    1 
ATOM   6436  C  C     . LEU B  1 394 ? 10.967  -17.625  8.181   1.00 100.06 ? 394 LEU B C     1 
ATOM   6437  O  O     . LEU B  1 394 ? 10.417  -16.774  8.900   1.00 100.09 ? 394 LEU B O     1 
ATOM   6438  C  CB    . LEU B  1 394 ? 13.133  -17.508  6.902   1.00 102.14 ? 394 LEU B CB    1 
ATOM   6439  C  CG    . LEU B  1 394 ? 14.511  -16.838  6.812   1.00 103.87 ? 394 LEU B CG    1 
ATOM   6440  C  CD1   . LEU B  1 394 ? 15.234  -17.288  5.543   1.00 105.46 ? 394 LEU B CD1   1 
ATOM   6441  C  CD2   . LEU B  1 394 ? 14.412  -15.300  6.855   1.00 106.26 ? 394 LEU B CD2   1 
ATOM   6442  N  N     . PHE B  1 395 ? 10.304  -18.431  7.334   1.00 100.07 ? 395 PHE B N     1 
ATOM   6443  C  CA    . PHE B  1 395 ? 8.868   -18.285  7.076   1.00 100.75 ? 395 PHE B CA    1 
ATOM   6444  C  C     . PHE B  1 395 ? 8.031   -18.250  8.353   1.00 99.32  ? 395 PHE B C     1 
ATOM   6445  O  O     . PHE B  1 395 ? 7.373   -17.246  8.631   1.00 100.74 ? 395 PHE B O     1 
ATOM   6446  C  CB    . PHE B  1 395 ? 8.313   -19.373  6.162   1.00 100.56 ? 395 PHE B CB    1 
ATOM   6447  C  CG    . PHE B  1 395 ? 6.804   -19.427  6.163   1.00 102.06 ? 395 PHE B CG    1 
ATOM   6448  C  CD1   . PHE B  1 395 ? 6.062   -18.603  5.318   1.00 106.59 ? 395 PHE B CD1   1 
ATOM   6449  C  CD2   . PHE B  1 395 ? 6.118   -20.266  7.038   1.00 101.19 ? 395 PHE B CD2   1 
ATOM   6450  C  CE1   . PHE B  1 395 ? 4.656   -18.632  5.329   1.00 107.70 ? 395 PHE B CE1   1 
ATOM   6451  C  CE2   . PHE B  1 395 ? 4.717   -20.299  7.065   1.00 102.64 ? 395 PHE B CE2   1 
ATOM   6452  C  CZ    . PHE B  1 395 ? 3.985   -19.486  6.207   1.00 105.69 ? 395 PHE B CZ    1 
ATOM   6453  N  N     . LEU B  1 396 ? 8.052   -19.349  9.113   1.00 96.64  ? 396 LEU B N     1 
ATOM   6454  C  CA    . LEU B  1 396 ? 7.178   -19.487  10.275  1.00 94.85  ? 396 LEU B CA    1 
ATOM   6455  C  C     . LEU B  1 396 ? 7.274   -18.287  11.187  1.00 95.44  ? 396 LEU B C     1 
ATOM   6456  O  O     . LEU B  1 396 ? 6.324   -17.501  11.260  1.00 96.73  ? 396 LEU B O     1 
ATOM   6457  C  CB    . LEU B  1 396 ? 7.457   -20.771  11.057  1.00 92.05  ? 396 LEU B CB    1 
ATOM   6458  C  CG    . LEU B  1 396 ? 6.364   -21.836  11.047  1.00 90.42  ? 396 LEU B CG    1 
ATOM   6459  C  CD1   . LEU B  1 396 ? 6.833   -23.019  11.866  1.00 87.72  ? 396 LEU B CD1   1 
ATOM   6460  C  CD2   . LEU B  1 396 ? 5.044   -21.308  11.588  1.00 89.80  ? 396 LEU B CD2   1 
ATOM   6461  N  N     . ALA B  1 397 ? 8.421   -18.140  11.861  1.00 94.81  ? 397 ALA B N     1 
ATOM   6462  C  CA    . ALA B  1 397 ? 8.667   -17.022  12.798  1.00 95.39  ? 397 ALA B CA    1 
ATOM   6463  C  C     . ALA B  1 397 ? 8.448   -15.640  12.136  1.00 98.26  ? 397 ALA B C     1 
ATOM   6464  O  O     . ALA B  1 397 ? 8.577   -14.601  12.800  1.00 99.57  ? 397 ALA B O     1 
ATOM   6465  C  CB    . ALA B  1 397 ? 10.073  -17.129  13.425  1.00 94.04  ? 397 ALA B CB    1 
ATOM   6466  N  N     . GLN B  1 398 ? 8.113   -15.650  10.835  1.00 99.35  ? 398 GLN B N     1 
ATOM   6467  C  CA    . GLN B  1 398 ? 7.743   -14.447  10.074  1.00 102.03 ? 398 GLN B CA    1 
ATOM   6468  C  C     . GLN B  1 398 ? 6.254   -14.369  9.734   1.00 102.69 ? 398 GLN B C     1 
ATOM   6469  O  O     . GLN B  1 398 ? 5.712   -13.276  9.619   1.00 104.95 ? 398 GLN B O     1 
ATOM   6470  C  CB    . GLN B  1 398 ? 8.551   -14.343  8.781   1.00 103.77 ? 398 GLN B CB    1 
ATOM   6471  C  CG    . GLN B  1 398 ? 9.834   -13.531  8.893   1.00 105.31 ? 398 GLN B CG    1 
ATOM   6472  C  CD    . GLN B  1 398 ? 10.622  -13.503  7.592   1.00 107.07 ? 398 GLN B CD    1 
ATOM   6473  O  OE1   . GLN B  1 398 ? 10.112  -13.881  6.533   1.00 107.73 ? 398 GLN B OE1   1 
ATOM   6474  N  NE2   . GLN B  1 398 ? 11.873  -13.056  7.667   1.00 107.89 ? 398 GLN B NE2   1 
ATOM   6475  N  N     . TYR B  1 399 ? 5.603   -15.517  9.533   1.00 100.93 ? 399 TYR B N     1 
ATOM   6476  C  CA    . TYR B  1 399 ? 4.137   -15.572  9.508   1.00 101.09 ? 399 TYR B CA    1 
ATOM   6477  C  C     . TYR B  1 399 ? 3.656   -14.846  10.759  1.00 101.20 ? 399 TYR B C     1 
ATOM   6478  O  O     . TYR B  1 399 ? 2.565   -14.273  10.789  1.00 102.74 ? 399 TYR B O     1 
ATOM   6479  C  CB    . TYR B  1 399 ? 3.648   -17.030  9.467   1.00 98.99  ? 399 TYR B CB    1 
ATOM   6480  C  CG    . TYR B  1 399 ? 2.467   -17.368  10.362  1.00 97.04  ? 399 TYR B CG    1 
ATOM   6481  C  CD1   . TYR B  1 399 ? 1.190   -16.867  10.105  1.00 98.48  ? 399 TYR B CD1   1 
ATOM   6482  C  CD2   . TYR B  1 399 ? 2.624   -18.213  11.452  1.00 94.00  ? 399 TYR B CD2   1 
ATOM   6483  C  CE1   . TYR B  1 399 ? 0.104   -17.184  10.929  1.00 97.51  ? 399 TYR B CE1   1 
ATOM   6484  C  CE2   . TYR B  1 399 ? 1.544   -18.539  12.277  1.00 93.25  ? 399 TYR B CE2   1 
ATOM   6485  C  CZ    . TYR B  1 399 ? 0.290   -18.021  12.011  1.00 94.72  ? 399 TYR B CZ    1 
ATOM   6486  O  OH    . TYR B  1 399 ? -0.771  -18.343  12.830  1.00 93.95  ? 399 TYR B OH    1 
ATOM   6487  N  N     . ARG B  1 400 ? 4.519   -14.861  11.773  1.00 99.72  ? 400 ARG B N     1 
ATOM   6488  C  CA    . ARG B  1 400 ? 4.331   -14.131  13.012  1.00 99.99  ? 400 ARG B CA    1 
ATOM   6489  C  C     . ARG B  1 400 ? 4.288   -12.613  12.814  1.00 102.95 ? 400 ARG B C     1 
ATOM   6490  O  O     . ARG B  1 400 ? 3.756   -11.896  13.666  1.00 103.94 ? 400 ARG B O     1 
ATOM   6491  C  CB    . ARG B  1 400 ? 5.439   -14.502  13.998  1.00 98.24  ? 400 ARG B CB    1 
ATOM   6492  C  CG    . ARG B  1 400 ? 5.085   -15.621  14.982  1.00 96.05  ? 400 ARG B CG    1 
ATOM   6493  C  CD    . ARG B  1 400 ? 5.389   -15.146  16.412  1.00 96.82  ? 400 ARG B CD    1 
ATOM   6494  N  NE    . ARG B  1 400 ? 4.878   -13.784  16.633  1.00 99.10  ? 400 ARG B NE    1 
ATOM   6495  C  CZ    . ARG B  1 400 ? 5.051   -13.058  17.737  1.00 99.99  ? 400 ARG B CZ    1 
ATOM   6496  N  NH1   . ARG B  1 400 ? 5.734   -13.533  18.777  1.00 98.53  ? 400 ARG B NH1   1 
ATOM   6497  N  NH2   . ARG B  1 400 ? 4.530   -11.839  17.796  1.00 102.11 ? 400 ARG B NH2   1 
ATOM   6498  N  N     . GLU B  1 401 ? 4.849   -12.127  11.702  1.00 104.66 ? 401 GLU B N     1 
ATOM   6499  C  CA    . GLU B  1 401 ? 4.751   -10.706  11.318  1.00 108.00 ? 401 GLU B CA    1 
ATOM   6500  C  C     . GLU B  1 401 ? 3.315   -10.354  10.953  1.00 109.69 ? 401 GLU B C     1 
ATOM   6501  O  O     . GLU B  1 401 ? 2.735   -9.396   11.476  1.00 111.36 ? 401 GLU B O     1 
ATOM   6502  C  CB    . GLU B  1 401 ? 5.662   -10.377  10.124  1.00 109.59 ? 401 GLU B CB    1 
ATOM   6503  C  CG    . GLU B  1 401 ? 7.154   -10.616  10.353  1.00 109.39 ? 401 GLU B CG    1 
ATOM   6504  C  CD    . GLU B  1 401 ? 7.814   -9.513   11.166  1.00 112.13 ? 401 GLU B CD    1 
ATOM   6505  O  OE1   . GLU B  1 401 ? 7.877   -8.361   10.674  1.00 115.36 ? 401 GLU B OE1   1 
ATOM   6506  O  OE2   . GLU B  1 401 ? 8.278   -9.803   12.295  1.00 110.94 ? 401 GLU B OE2   1 
ATOM   6507  N  N     . VAL B  1 402 ? 2.756   -11.146  10.043  1.00 109.45 ? 402 VAL B N     1 
ATOM   6508  C  CA    . VAL B  1 402 ? 1.384   -10.978  9.588   1.00 111.26 ? 402 VAL B CA    1 
ATOM   6509  C  C     . VAL B  1 402 ? 0.414   -11.238  10.743  1.00 110.20 ? 402 VAL B C     1 
ATOM   6510  O  O     . VAL B  1 402 ? -0.438  -10.396  11.039  1.00 112.15 ? 402 VAL B O     1 
ATOM   6511  C  CB    . VAL B  1 402 ? 1.070   -11.913  8.384   1.00 111.29 ? 402 VAL B CB    1 
ATOM   6512  C  CG1   . VAL B  1 402 ? -0.348  -11.685  7.865   1.00 113.67 ? 402 VAL B CG1   1 
ATOM   6513  C  CG2   . VAL B  1 402 ? 2.088   -11.711  7.260   1.00 112.49 ? 402 VAL B CG2   1 
ATOM   6514  N  N     . ALA B  1 403 ? 0.579   -12.391  11.398  1.00 107.24 ? 403 ALA B N     1 
ATOM   6515  C  CA    . ALA B  1 403 ? -0.309  -12.849  12.476  1.00 106.13 ? 403 ALA B CA    1 
ATOM   6516  C  C     . ALA B  1 403 ? -0.564  -11.784  13.543  1.00 107.48 ? 403 ALA B C     1 
ATOM   6517  O  O     . ALA B  1 403 ? -1.716  -11.536  13.910  1.00 108.88 ? 403 ALA B O     1 
ATOM   6518  C  CB    . ALA B  1 403 ? 0.234   -14.128  13.111  1.00 102.67 ? 403 ALA B CB    1 
ATOM   6519  N  N     . ALA B  1 404 ? 0.509   -11.148  14.016  1.00 107.42 ? 404 ALA B N     1 
ATOM   6520  C  CA    . ALA B  1 404 ? 0.420   -10.096  15.030  1.00 108.81 ? 404 ALA B CA    1 
ATOM   6521  C  C     . ALA B  1 404 ? -0.303  -8.857   14.506  1.00 112.49 ? 404 ALA B C     1 
ATOM   6522  O  O     . ALA B  1 404 ? -1.052  -8.210   15.244  1.00 114.18 ? 404 ALA B O     1 
ATOM   6523  C  CB    . ALA B  1 404 ? 1.812   -9.726   15.544  1.00 108.05 ? 404 ALA B CB    1 
ATOM   6524  N  N     . SER B  1 405 ? -0.072  -8.532   13.233  1.00 114.07 ? 405 SER B N     1 
ATOM   6525  C  CA    . SER B  1 405 ? -0.682  -7.358   12.596  1.00 117.66 ? 405 SER B CA    1 
ATOM   6526  C  C     . SER B  1 405 ? -2.161  -7.601   12.272  1.00 118.81 ? 405 SER B C     1 
ATOM   6527  O  O     . SER B  1 405 ? -2.993  -6.700   12.417  1.00 121.33 ? 405 SER B O     1 
ATOM   6528  C  CB    . SER B  1 405 ? 0.074   -6.988   11.310  1.00 119.12 ? 405 SER B CB    1 
ATOM   6529  O  OG    . SER B  1 405 ? 1.451   -6.755   11.554  1.00 118.34 ? 405 SER B OG    1 
ATOM   6530  N  N     . ALA B  1 406 ? -2.463  -8.836   11.859  1.00 116.86 ? 406 ALA B N     1 
ATOM   6531  C  CA    . ALA B  1 406 ? -3.759  -9.238   11.292  1.00 117.99 ? 406 ALA B CA    1 
ATOM   6532  C  C     . ALA B  1 406 ? -5.004  -8.711   12.012  1.00 119.86 ? 406 ALA B C     1 
ATOM   6533  O  O     . ALA B  1 406 ? -5.819  -8.002   11.411  1.00 123.00 ? 406 ALA B O     1 
ATOM   6534  C  CB    . ALA B  1 406 ? -3.824  -10.761  11.165  1.00 115.16 ? 406 ALA B CB    1 
ATOM   6535  N  N     . GLN B  1 407 ? -5.146  -9.060   13.290  1.00 118.11 ? 407 GLN B N     1 
ATOM   6536  C  CA    . GLN B  1 407 ? -6.356  -8.735   14.053  1.00 119.68 ? 407 GLN B CA    1 
ATOM   6537  C  C     . GLN B  1 407 ? -6.434  -7.257   14.449  1.00 122.48 ? 407 GLN B C     1 
ATOM   6538  O  O     . GLN B  1 407 ? -7.249  -6.504   13.910  1.00 125.54 ? 407 GLN B O     1 
ATOM   6539  C  CB    . GLN B  1 407 ? -6.494  -9.642   15.291  1.00 117.06 ? 407 GLN B CB    1 
ATOM   6540  C  CG    . GLN B  1 407 ? -6.734  -11.139  14.996  1.00 114.60 ? 407 GLN B CG    1 
ATOM   6541  C  CD    . GLN B  1 407 ? -7.980  -11.424  14.148  1.00 116.86 ? 407 GLN B CD    1 
ATOM   6542  O  OE1   . GLN B  1 407 ? -8.915  -10.618  14.078  1.00 120.11 ? 407 GLN B OE1   1 
ATOM   6543  N  NE2   . GLN B  1 407 ? -7.992  -12.586  13.502  1.00 115.33 ? 407 GLN B NE2   1 
ATOM   6544  N  N     . SER B  1 410 ? -6.605  -4.967   9.996   1.00 131.22 ? 410 SER B N     1 
ATOM   6545  C  CA    . SER B  1 410 ? -6.710  -3.672   9.323   1.00 135.31 ? 410 SER B CA    1 
ATOM   6546  C  C     . SER B  1 410 ? -7.102  -3.791   7.841   1.00 137.47 ? 410 SER B C     1 
ATOM   6547  O  O     . SER B  1 410 ? -7.592  -2.821   7.246   1.00 141.39 ? 410 SER B O     1 
ATOM   6548  C  CB    . SER B  1 410 ? -5.407  -2.878   9.478   1.00 135.31 ? 410 SER B CB    1 
ATOM   6549  N  N     . ASP B  1 411 ? -6.882  -4.974   7.257   1.00 135.05 ? 411 ASP B N     1 
ATOM   6550  C  CA    . ASP B  1 411 ? -7.272  -5.261   5.868   1.00 137.01 ? 411 ASP B CA    1 
ATOM   6551  C  C     . ASP B  1 411 ? -7.469  -6.757   5.617   1.00 134.37 ? 411 ASP B C     1 
ATOM   6552  O  O     . ASP B  1 411 ? -6.706  -7.589   6.122   1.00 130.81 ? 411 ASP B O     1 
ATOM   6553  C  CB    . ASP B  1 411 ? -6.243  -4.697   4.878   1.00 138.40 ? 411 ASP B CB    1 
ATOM   6554  C  CG    . ASP B  1 411 ? -6.773  -4.635   3.450   1.00 141.70 ? 411 ASP B CG    1 
ATOM   6555  O  OD1   . ASP B  1 411 ? -6.712  -5.658   2.737   1.00 140.29 ? 411 ASP B OD1   1 
ATOM   6556  O  OD2   . ASP B  1 411 ? -7.241  -3.553   3.036   1.00 145.88 ? 411 ASP B OD2   1 
ATOM   6557  N  N     . LEU B  1 412 ? -8.494  -7.087   4.831   1.00 136.47 ? 412 LEU B N     1 
ATOM   6558  C  CA    . LEU B  1 412 ? -8.751  -8.466   4.407   1.00 134.60 ? 412 LEU B CA    1 
ATOM   6559  C  C     . LEU B  1 412 ? -7.999  -8.738   3.101   1.00 135.00 ? 412 LEU B C     1 
ATOM   6560  O  O     . LEU B  1 412 ? -8.593  -8.885   2.026   1.00 137.61 ? 412 LEU B O     1 
ATOM   6561  C  CB    . LEU B  1 412 ? -10.258 -8.719   4.265   1.00 136.95 ? 412 LEU B CB    1 
ATOM   6562  C  CG    . LEU B  1 412 ? -11.102 -8.577   5.540   1.00 136.74 ? 412 LEU B CG    1 
ATOM   6563  C  CD1   . LEU B  1 412 ? -12.555 -8.251   5.199   1.00 140.52 ? 412 LEU B CD1   1 
ATOM   6564  C  CD2   . LEU B  1 412 ? -10.999 -9.821   6.437   1.00 132.61 ? 412 LEU B CD2   1 
ATOM   6565  N  N     . ASP B  1 413 ? -6.676  -8.812   3.233   1.00 132.48 ? 413 ASP B N     1 
ATOM   6566  C  CA    . ASP B  1 413 ? -5.734  -8.801   2.117   1.00 133.05 ? 413 ASP B CA    1 
ATOM   6567  C  C     . ASP B  1 413 ? -5.848  -10.022  1.204   1.00 132.52 ? 413 ASP B C     1 
ATOM   6568  O  O     . ASP B  1 413 ? -6.483  -11.015  1.558   1.00 130.89 ? 413 ASP B O     1 
ATOM   6569  C  CB    . ASP B  1 413 ? -4.312  -8.699   2.678   1.00 130.29 ? 413 ASP B CB    1 
ATOM   6570  C  CG    . ASP B  1 413 ? -3.468  -7.665   1.962   1.00 132.59 ? 413 ASP B CG    1 
ATOM   6571  O  OD1   . ASP B  1 413 ? -3.748  -7.370   0.781   1.00 136.00 ? 413 ASP B OD1   1 
ATOM   6572  O  OD2   . ASP B  1 413 ? -2.520  -7.147   2.589   1.00 130.97 ? 413 ASP B OD2   1 
ATOM   6573  N  N     . ALA B  1 414 ? -5.235  -9.932   0.026   1.00 134.16 ? 414 ALA B N     1 
ATOM   6574  C  CA    . ALA B  1 414 ? -5.172  -11.056  -0.901  1.00 133.89 ? 414 ALA B CA    1 
ATOM   6575  C  C     . ALA B  1 414 ? -3.898  -11.868  -0.670  1.00 130.37 ? 414 ALA B C     1 
ATOM   6576  O  O     . ALA B  1 414 ? -3.962  -13.015  -0.209  1.00 127.57 ? 414 ALA B O     1 
ATOM   6577  C  CB    . ALA B  1 414 ? -5.251  -10.566  -2.337  1.00 138.06 ? 414 ALA B CB    1 
ATOM   6578  N  N     . SER B  1 415 ? -2.749  -11.259  -0.969  1.00 130.76 ? 415 SER B N     1 
ATOM   6579  C  CA    . SER B  1 415 ? -1.440  -11.915  -0.845  1.00 127.89 ? 415 SER B CA    1 
ATOM   6580  C  C     . SER B  1 415 ? -1.204  -12.506  0.543   1.00 123.72 ? 415 SER B C     1 
ATOM   6581  O  O     . SER B  1 415 ? -0.916  -13.694  0.682   1.00 121.15 ? 415 SER B O     1 
ATOM   6582  C  CB    . SER B  1 415 ? -0.308  -10.941  -1.199  1.00 129.27 ? 415 SER B CB    1 
ATOM   6583  O  OG    . SER B  1 415 ? 0.961   -11.511  -0.912  1.00 126.38 ? 415 SER B OG    1 
ATOM   6584  N  N     . THR B  1 416 ? -1.345  -11.666  1.564   1.00 123.46 ? 416 THR B N     1 
ATOM   6585  C  CA    . THR B  1 416 ? -1.069  -12.067  2.941   1.00 119.94 ? 416 THR B CA    1 
ATOM   6586  C  C     . THR B  1 416 ? -2.270  -12.743  3.608   1.00 118.92 ? 416 THR B C     1 
ATOM   6587  O  O     . THR B  1 416 ? -2.403  -12.710  4.831   1.00 117.24 ? 416 THR B O     1 
ATOM   6588  C  CB    . THR B  1 416 ? -0.573  -10.871  3.818   1.00 120.12 ? 416 THR B CB    1 
ATOM   6589  O  OG1   . THR B  1 416 ? -1.630  -9.921   4.005   1.00 122.41 ? 416 THR B OG1   1 
ATOM   6590  C  CG2   . THR B  1 416 ? 0.637   -10.179  3.188   1.00 121.34 ? 416 THR B CG2   1 
ATOM   6591  N  N     . LYS B  1 417 ? -3.147  -13.348  2.814   1.00 120.33 ? 417 LYS B N     1 
ATOM   6592  C  CA    . LYS B  1 417 ? -4.182  -14.195  3.388   1.00 119.30 ? 417 LYS B CA    1 
ATOM   6593  C  C     . LYS B  1 417 ? -3.743  -15.652  3.280   1.00 116.65 ? 417 LYS B C     1 
ATOM   6594  O  O     . LYS B  1 417 ? -4.210  -16.511  4.027   1.00 114.48 ? 417 LYS B O     1 
ATOM   6595  C  CB    . LYS B  1 417 ? -5.541  -13.952  2.727   1.00 122.72 ? 417 LYS B CB    1 
ATOM   6596  C  CG    . LYS B  1 417 ? -6.626  -13.655  3.758   1.00 123.30 ? 417 LYS B CG    1 
ATOM   6597  C  CD    . LYS B  1 417 ? -7.997  -13.417  3.148   1.00 127.39 ? 417 LYS B CD    1 
ATOM   6598  C  CE    . LYS B  1 417 ? -8.950  -12.869  4.207   1.00 128.26 ? 417 LYS B CE    1 
ATOM   6599  N  NZ    . LYS B  1 417 ? -10.354 -12.723  3.705   1.00 132.36 ? 417 LYS B NZ    1 
ATOM   6600  N  N     . GLN B  1 418 ? -2.812  -15.896  2.360   1.00 116.95 ? 418 GLN B N     1 
ATOM   6601  C  CA    . GLN B  1 418 ? -2.257  -17.217  2.099   1.00 115.15 ? 418 GLN B CA    1 
ATOM   6602  C  C     . GLN B  1 418 ? -1.335  -17.638  3.232   1.00 111.50 ? 418 GLN B C     1 
ATOM   6603  O  O     . GLN B  1 418 ? -1.479  -18.737  3.785   1.00 109.35 ? 418 GLN B O     1 
ATOM   6604  C  CB    . GLN B  1 418 ? -1.481  -17.204  0.778   1.00 117.03 ? 418 GLN B CB    1 
ATOM   6605  C  CG    . GLN B  1 418 ? -1.371  -18.555  0.064   1.00 117.42 ? 418 GLN B CG    1 
ATOM   6606  C  CD    . GLN B  1 418 ? -1.292  -18.411  -1.468  1.00 122.46 ? 418 GLN B CD    1 
ATOM   6607  O  OE1   . GLN B  1 418 ? -0.764  -17.423  -1.993  1.00 124.68 ? 418 GLN B OE1   1 
ATOM   6608  N  NE2   . GLN B  1 418 ? -1.821  -19.403  -2.187  1.00 123.88 ? 418 GLN B NE2   1 
ATOM   6609  N  N     . THR B  1 419 ? -0.393  -16.760  3.577   1.00 111.01 ? 419 THR B N     1 
ATOM   6610  C  CA    . THR B  1 419 ? 0.581   -17.045  4.637   1.00 107.71 ? 419 THR B CA    1 
ATOM   6611  C  C     . THR B  1 419 ? -0.080  -17.234  6.004   1.00 105.54 ? 419 THR B C     1 
ATOM   6612  O  O     . THR B  1 419 ? 0.471   -17.916  6.866   1.00 102.62 ? 419 THR B O     1 
ATOM   6613  C  CB    . THR B  1 419 ? 1.692   -15.973  4.709   1.00 108.32 ? 419 THR B CB    1 
ATOM   6614  O  OG1   . THR B  1 419 ? 1.123   -14.676  4.489   1.00 111.33 ? 419 THR B OG1   1 
ATOM   6615  C  CG2   . THR B  1 419 ? 2.755   -16.235  3.645   1.00 109.08 ? 419 THR B CG2   1 
ATOM   6616  N  N     . LEU B  1 420 ? -1.269  -16.651  6.171   1.00 107.06 ? 420 LEU B N     1 
ATOM   6617  C  CA    . LEU B  1 420 ? -2.084  -16.812  7.381   1.00 105.90 ? 420 LEU B CA    1 
ATOM   6618  C  C     . LEU B  1 420 ? -2.731  -18.198  7.462   1.00 104.55 ? 420 LEU B C     1 
ATOM   6619  O  O     . LEU B  1 420 ? -3.096  -18.664  8.546   1.00 102.87 ? 420 LEU B O     1 
ATOM   6620  C  CB    . LEU B  1 420 ? -3.175  -15.732  7.443   1.00 108.70 ? 420 LEU B CB    1 
ATOM   6621  C  CG    . LEU B  1 420 ? -3.722  -15.341  8.826   1.00 108.19 ? 420 LEU B CG    1 
ATOM   6622  C  CD1   . LEU B  1 420 ? -2.782  -14.358  9.517   1.00 107.96 ? 420 LEU B CD1   1 
ATOM   6623  C  CD2   . LEU B  1 420 ? -5.124  -14.751  8.745   1.00 110.64 ? 420 LEU B CD2   1 
ATOM   6624  N  N     . VAL B  1 421 ? -2.876  -18.846  6.309   1.00 105.50 ? 421 VAL B N     1 
ATOM   6625  C  CA    . VAL B  1 421 ? -3.509  -20.162  6.231   1.00 104.61 ? 421 VAL B CA    1 
ATOM   6626  C  C     . VAL B  1 421 ? -2.454  -21.273  6.306   1.00 101.99 ? 421 VAL B C     1 
ATOM   6627  O  O     . VAL B  1 421 ? -2.672  -22.291  6.960   1.00 100.12 ? 421 VAL B O     1 
ATOM   6628  C  CB    . VAL B  1 421 ? -4.411  -20.287  4.971   1.00 107.53 ? 421 VAL B CB    1 
ATOM   6629  C  CG1   . VAL B  1 421 ? -5.081  -21.641  4.917   1.00 107.22 ? 421 VAL B CG1   1 
ATOM   6630  C  CG2   . VAL B  1 421 ? -5.472  -19.203  4.971   1.00 109.95 ? 421 VAL B CG2   1 
ATOM   6631  N  N     . ARG B  1 422 ? -1.316  -21.063  5.640   1.00 101.96 ? 422 ARG B N     1 
ATOM   6632  C  CA    . ARG B  1 422 ? -0.144  -21.935  5.781   1.00 99.70  ? 422 ARG B CA    1 
ATOM   6633  C  C     . ARG B  1 422 ? 0.432   -21.859  7.189   1.00 97.01  ? 422 ARG B C     1 
ATOM   6634  O  O     . ARG B  1 422 ? 0.684   -22.893  7.820   1.00 95.03  ? 422 ARG B O     1 
ATOM   6635  C  CB    . ARG B  1 422 ? 0.949   -21.534  4.797   1.00 100.73 ? 422 ARG B CB    1 
ATOM   6636  C  CG    . ARG B  1 422 ? 0.694   -21.942  3.378   1.00 104.13 ? 422 ARG B CG    1 
ATOM   6637  C  CD    . ARG B  1 422 ? 1.092   -23.389  3.134   1.00 103.56 ? 422 ARG B CD    1 
ATOM   6638  N  NE    . ARG B  1 422 ? 1.524   -23.561  1.753   1.00 105.71 ? 422 ARG B NE    1 
ATOM   6639  C  CZ    . ARG B  1 422 ? 2.759   -23.313  1.327   1.00 106.06 ? 422 ARG B CZ    1 
ATOM   6640  N  NH1   . ARG B  1 422 ? 3.693   -22.891  2.176   1.00 104.25 ? 422 ARG B NH1   1 
ATOM   6641  N  NH2   . ARG B  1 422 ? 3.065   -23.492  0.050   1.00 108.36 ? 422 ARG B NH2   1 
ATOM   6642  N  N     . GLY B  1 423 ? 0.652   -20.629  7.661   1.00 97.01  ? 423 GLY B N     1 
ATOM   6643  C  CA    . GLY B  1 423 ? 1.140   -20.393  9.004   1.00 94.71  ? 423 GLY B CA    1 
ATOM   6644  C  C     . GLY B  1 423 ? 0.338   -21.198  9.999   1.00 93.08  ? 423 GLY B C     1 
ATOM   6645  O  O     . GLY B  1 423 ? 0.892   -22.010  10.732  1.00 90.79  ? 423 GLY B O     1 
ATOM   6646  N  N     . GLU B  1 424 ? -0.978  -21.001  9.997   1.00 94.45  ? 424 GLU B N     1 
ATOM   6647  C  CA    . GLU B  1 424 ? -1.858  -21.717  10.918  1.00 93.41  ? 424 GLU B CA    1 
ATOM   6648  C  C     . GLU B  1 424 ? -1.685  -23.237  10.849  1.00 91.74  ? 424 GLU B C     1 
ATOM   6649  O  O     . GLU B  1 424 ? -1.764  -23.915  11.875  1.00 89.95  ? 424 GLU B O     1 
ATOM   6650  C  CB    . GLU B  1 424 ? -3.324  -21.313  10.714  1.00 95.69  ? 424 GLU B CB    1 
ATOM   6651  C  CG    . GLU B  1 424 ? -3.830  -20.285  11.731  1.00 96.44  ? 424 GLU B CG    1 
ATOM   6652  C  CD    . GLU B  1 424 ? -5.267  -19.826  11.473  1.00 99.46  ? 424 GLU B CD    1 
ATOM   6653  O  OE1   . GLU B  1 424 ? -6.161  -20.681  11.320  1.00 100.21 ? 424 GLU B OE1   1 
ATOM   6654  O  OE2   . GLU B  1 424 ? -5.511  -18.601  11.439  1.00 101.21 ? 424 GLU B OE2   1 
ATOM   6655  N  N     . ARG B  1 425 ? -1.435  -23.758  9.648   1.00 92.48  ? 425 ARG B N     1 
ATOM   6656  C  CA    . ARG B  1 425 ? -1.262  -25.201  9.438   1.00 91.41  ? 425 ARG B CA    1 
ATOM   6657  C  C     . ARG B  1 425 ? 0.025   -25.745  10.070  1.00 88.73  ? 425 ARG B C     1 
ATOM   6658  O  O     . ARG B  1 425 ? -0.020  -26.686  10.869  1.00 87.03  ? 425 ARG B O     1 
ATOM   6659  C  CB    . ARG B  1 425 ? -1.304  -25.564  7.946   1.00 93.15  ? 425 ARG B CB    1 
ATOM   6660  C  CG    . ARG B  1 425 ? -2.662  -25.405  7.245   1.00 96.60  ? 425 ARG B CG    1 
ATOM   6661  C  CD    . ARG B  1 425 ? -3.866  -25.877  8.083   1.00 96.99  ? 425 ARG B CD    1 
ATOM   6662  N  NE    . ARG B  1 425 ? -5.114  -25.892  7.312   1.00 99.32  ? 425 ARG B NE    1 
ATOM   6663  C  CZ    . ARG B  1 425 ? -5.821  -24.814  6.969   1.00 101.20 ? 425 ARG B CZ    1 
ATOM   6664  N  NH1   . ARG B  1 425 ? -5.434  -23.594  7.309   1.00 100.95 ? 425 ARG B NH1   1 
ATOM   6665  N  NH2   . ARG B  1 425 ? -6.930  -24.962  6.270   1.00 104.53 ? 425 ARG B NH2   1 
ATOM   6666  N  N     . LEU B  1 426 ? 1.160   -25.154  9.706   1.00 88.36  ? 426 LEU B N     1 
ATOM   6667  C  CA    . LEU B  1 426 ? 2.448   -25.546  10.264  1.00 86.31  ? 426 LEU B CA    1 
ATOM   6668  C  C     . LEU B  1 426 ? 2.468   -25.437  11.807  1.00 84.76  ? 426 LEU B C     1 
ATOM   6669  O  O     . LEU B  1 426 ? 3.106   -26.247  12.492  1.00 83.01  ? 426 LEU B O     1 
ATOM   6670  C  CB    . LEU B  1 426 ? 3.568   -24.727  9.620   1.00 86.80  ? 426 LEU B CB    1 
ATOM   6671  C  CG    . LEU B  1 426 ? 3.650   -24.837  8.094   1.00 88.68  ? 426 LEU B CG    1 
ATOM   6672  C  CD1   . LEU B  1 426 ? 4.591   -23.807  7.522   1.00 89.61  ? 426 LEU B CD1   1 
ATOM   6673  C  CD2   . LEU B  1 426 ? 4.073   -26.229  7.654   1.00 87.92  ? 426 LEU B CD2   1 
ATOM   6674  N  N     . THR B  1 427 ? 1.742   -24.453  12.337  1.00 85.34  ? 427 THR B N     1 
ATOM   6675  C  CA    . THR B  1 427 ? 1.544   -24.304  13.771  1.00 84.07  ? 427 THR B CA    1 
ATOM   6676  C  C     . THR B  1 427 ? 0.889   -25.542  14.387  1.00 83.19  ? 427 THR B C     1 
ATOM   6677  O  O     . THR B  1 427 ? 1.258   -25.946  15.484  1.00 82.33  ? 427 THR B O     1 
ATOM   6678  C  CB    . THR B  1 427 ? 0.726   -23.027  14.108  1.00 85.56  ? 427 THR B CB    1 
ATOM   6679  O  OG1   . THR B  1 427 ? 1.345   -21.890  13.499  1.00 86.57  ? 427 THR B OG1   1 
ATOM   6680  C  CG2   . THR B  1 427 ? 0.670   -22.787  15.607  1.00 84.44  ? 427 THR B CG2   1 
ATOM   6681  N  N     . GLN B  1 428 ? -0.066  -26.153  13.694  1.00 84.21  ? 428 GLN B N     1 
ATOM   6682  C  CA    . GLN B  1 428 ? -0.692  -27.384  14.191  1.00 83.57  ? 428 GLN B CA    1 
ATOM   6683  C  C     . GLN B  1 428 ? 0.202   -28.605  13.960  1.00 82.20  ? 428 GLN B C     1 
ATOM   6684  O  O     . GLN B  1 428 ? 0.242   -29.529  14.778  1.00 80.92  ? 428 GLN B O     1 
ATOM   6685  C  CB    . GLN B  1 428 ? -2.061  -27.614  13.538  1.00 85.47  ? 428 GLN B CB    1 
ATOM   6686  C  CG    . GLN B  1 428 ? -3.134  -26.608  13.921  1.00 87.48  ? 428 GLN B CG    1 
ATOM   6687  C  CD    . GLN B  1 428 ? -3.583  -26.734  15.365  1.00 87.41  ? 428 GLN B CD    1 
ATOM   6688  O  OE1   . GLN B  1 428 ? -3.499  -25.776  16.141  1.00 87.82  ? 428 GLN B OE1   1 
ATOM   6689  N  NE2   . GLN B  1 428 ? -4.062  -27.916  15.735  1.00 86.59  ? 428 GLN B NE2   1 
ATOM   6690  N  N     . LEU B  1 429 ? 0.903   -28.611  12.831  1.00 82.59  ? 429 LEU B N     1 
ATOM   6691  C  CA    . LEU B  1 429 ? 1.814   -29.690  12.495  1.00 81.70  ? 429 LEU B CA    1 
ATOM   6692  C  C     . LEU B  1 429 ? 2.879   -29.806  13.583  1.00 80.15  ? 429 LEU B C     1 
ATOM   6693  O  O     . LEU B  1 429 ? 3.271   -30.910  13.965  1.00 79.22  ? 429 LEU B O     1 
ATOM   6694  C  CB    . LEU B  1 429 ? 2.456   -29.408  11.143  1.00 82.64  ? 429 LEU B CB    1 
ATOM   6695  C  CG    . LEU B  1 429 ? 3.110   -30.532  10.349  1.00 82.63  ? 429 LEU B CG    1 
ATOM   6696  C  CD1   . LEU B  1 429 ? 2.097   -31.585  9.936   1.00 84.47  ? 429 LEU B CD1   1 
ATOM   6697  C  CD2   . LEU B  1 429 ? 3.778   -29.936  9.129   1.00 83.66  ? 429 LEU B CD2   1 
ATOM   6698  N  N     . LEU B  1 430 ? 3.315   -28.657  14.099  1.00 79.97  ? 430 LEU B N     1 
ATOM   6699  C  CA    . LEU B  1 430 ? 4.329   -28.613  15.145  1.00 78.66  ? 430 LEU B CA    1 
ATOM   6700  C  C     . LEU B  1 430 ? 3.864   -29.093  16.520  1.00 77.60  ? 430 LEU B C     1 
ATOM   6701  O  O     . LEU B  1 430 ? 4.696   -29.487  17.338  1.00 76.46  ? 430 LEU B O     1 
ATOM   6702  C  CB    . LEU B  1 430 ? 4.935   -27.210  15.260  1.00 79.26  ? 430 LEU B CB    1 
ATOM   6703  C  CG    . LEU B  1 430 ? 5.858   -26.708  14.139  1.00 80.39  ? 430 LEU B CG    1 
ATOM   6704  C  CD1   . LEU B  1 430 ? 6.908   -25.760  14.733  1.00 79.21  ? 430 LEU B CD1   1 
ATOM   6705  C  CD2   . LEU B  1 430 ? 6.519   -27.851  13.324  1.00 79.65  ? 430 LEU B CD2   1 
ATOM   6706  N  N     . LYS B  1 431 ? 2.554   -29.053  16.777  1.00 78.33  ? 431 LYS B N     1 
ATOM   6707  C  CA    . LYS B  1 431 ? 1.981   -29.635  18.000  1.00 77.78  ? 431 LYS B CA    1 
ATOM   6708  C  C     . LYS B  1 431 ? 2.388   -31.101  18.104  1.00 76.67  ? 431 LYS B C     1 
ATOM   6709  O  O     . LYS B  1 431 ? 2.704   -31.741  17.100  1.00 77.02  ? 431 LYS B O     1 
ATOM   6710  C  CB    . LYS B  1 431 ? 0.453   -29.567  18.001  1.00 79.13  ? 431 LYS B CB    1 
ATOM   6711  C  CG    . LYS B  1 431 ? -0.171  -28.218  18.284  1.00 80.82  ? 431 LYS B CG    1 
ATOM   6712  C  CD    . LYS B  1 431 ? -1.655  -28.412  18.585  1.00 83.46  ? 431 LYS B CD    1 
ATOM   6713  C  CE    . LYS B  1 431 ? -2.345  -27.110  18.967  1.00 86.23  ? 431 LYS B CE    1 
ATOM   6714  N  NZ    . LYS B  1 431 ? -3.669  -27.359  19.618  1.00 88.15  ? 431 LYS B NZ    1 
ATOM   6715  N  N     . GLN B  1 432 ? 2.379   -31.630  19.317  1.00 75.60  ? 432 GLN B N     1 
ATOM   6716  C  CA    . GLN B  1 432 ? 2.800   -32.994  19.540  1.00 74.54  ? 432 GLN B CA    1 
ATOM   6717  C  C     . GLN B  1 432 ? 2.432   -33.411  20.940  1.00 74.13  ? 432 GLN B C     1 
ATOM   6718  O  O     . GLN B  1 432 ? 2.680   -32.682  21.901  1.00 74.02  ? 432 GLN B O     1 
ATOM   6719  C  CB    . GLN B  1 432 ? 4.310   -33.136  19.332  1.00 73.71  ? 432 GLN B CB    1 
ATOM   6720  C  CG    . GLN B  1 432 ? 4.804   -34.578  19.357  1.00 73.12  ? 432 GLN B CG    1 
ATOM   6721  C  CD    . GLN B  1 432 ? 6.168   -34.745  18.735  1.00 72.61  ? 432 GLN B CD    1 
ATOM   6722  O  OE1   . GLN B  1 432 ? 6.709   -33.820  18.132  1.00 74.07  ? 432 GLN B OE1   1 
ATOM   6723  N  NE2   . GLN B  1 432 ? 6.733   -35.931  18.874  1.00 72.02  ? 432 GLN B NE2   1 
ATOM   6724  N  N     . ASN B  1 433 ? 1.836   -34.591  21.041  1.00 74.23  ? 433 ASN B N     1 
ATOM   6725  C  CA    . ASN B  1 433 ? 1.479   -35.185  22.315  1.00 74.12  ? 433 ASN B CA    1 
ATOM   6726  C  C     . ASN B  1 433 ? 2.710   -35.559  23.130  1.00 72.67  ? 433 ASN B C     1 
ATOM   6727  O  O     . ASN B  1 433 ? 3.784   -35.827  22.579  1.00 71.99  ? 433 ASN B O     1 
ATOM   6728  C  CB    . ASN B  1 433 ? 0.599   -36.424  22.080  1.00 75.26  ? 433 ASN B CB    1 
ATOM   6729  C  CG    . ASN B  1 433 ? -0.843  -36.065  21.789  1.00 77.02  ? 433 ASN B CG    1 
ATOM   6730  O  OD1   . ASN B  1 433 ? -1.344  -35.025  22.248  1.00 78.83  ? 433 ASN B OD1   1 
ATOM   6731  N  ND2   . ASN B  1 433 ? -1.522  -36.918  21.032  1.00 76.28  ? 433 ASN B ND2   1 
ATOM   6732  N  N     . GLN B  1 434 ? 2.554   -35.575  24.445  1.00 72.37  ? 434 GLN B N     1 
ATOM   6733  C  CA    . GLN B  1 434 ? 3.658   -35.983  25.294  1.00 71.61  ? 434 GLN B CA    1 
ATOM   6734  C  C     . GLN B  1 434 ? 3.890   -37.502  25.218  1.00 71.74  ? 434 GLN B C     1 
ATOM   6735  O  O     . GLN B  1 434 ? 2.990   -38.267  24.835  1.00 72.13  ? 434 GLN B O     1 
ATOM   6736  C  CB    . GLN B  1 434 ? 3.484   -35.500  26.734  1.00 71.42  ? 434 GLN B CB    1 
ATOM   6737  C  CG    . GLN B  1 434 ? 4.761   -35.642  27.496  1.00 70.16  ? 434 GLN B CG    1 
ATOM   6738  C  CD    . GLN B  1 434 ? 4.720   -35.068  28.885  1.00 70.55  ? 434 GLN B CD    1 
ATOM   6739  O  OE1   . GLN B  1 434 ? 3.660   -34.704  29.401  1.00 70.65  ? 434 GLN B OE1   1 
ATOM   6740  N  NE2   . GLN B  1 434 ? 5.894   -34.990  29.513  1.00 70.01  ? 434 GLN B NE2   1 
ATOM   6741  N  N     . TYR B  1 435 ? 5.122   -37.902  25.555  1.00 71.16  ? 435 TYR B N     1 
ATOM   6742  C  CA    . TYR B  1 435 ? 5.584   -39.297  25.527  1.00 70.85  ? 435 TYR B CA    1 
ATOM   6743  C  C     . TYR B  1 435 ? 5.526   -39.957  24.161  1.00 71.22  ? 435 TYR B C     1 
ATOM   6744  O  O     . TYR B  1 435 ? 5.509   -41.177  24.071  1.00 72.05  ? 435 TYR B O     1 
ATOM   6745  C  CB    . TYR B  1 435 ? 4.834   -40.149  26.558  1.00 71.08  ? 435 TYR B CB    1 
ATOM   6746  C  CG    . TYR B  1 435 ? 4.760   -39.509  27.916  1.00 69.63  ? 435 TYR B CG    1 
ATOM   6747  C  CD1   . TYR B  1 435 ? 5.915   -39.268  28.664  1.00 67.58  ? 435 TYR B CD1   1 
ATOM   6748  C  CD2   . TYR B  1 435 ? 3.535   -39.140  28.447  1.00 69.06  ? 435 TYR B CD2   1 
ATOM   6749  C  CE1   . TYR B  1 435 ? 5.837   -38.667  29.911  1.00 68.49  ? 435 TYR B CE1   1 
ATOM   6750  C  CE2   . TYR B  1 435 ? 3.440   -38.548  29.686  1.00 69.55  ? 435 TYR B CE2   1 
ATOM   6751  C  CZ    . TYR B  1 435 ? 4.588   -38.310  30.415  1.00 69.12  ? 435 TYR B CZ    1 
ATOM   6752  O  OH    . TYR B  1 435 ? 4.469   -37.716  31.644  1.00 69.23  ? 435 TYR B OH    1 
ATOM   6753  N  N     . SER B  1 436 ? 5.519   -39.161  23.099  1.00 71.24  ? 436 SER B N     1 
ATOM   6754  C  CA    . SER B  1 436 ? 5.353   -39.715  21.769  1.00 71.97  ? 436 SER B CA    1 
ATOM   6755  C  C     . SER B  1 436 ? 6.418   -39.239  20.780  1.00 71.90  ? 436 SER B C     1 
ATOM   6756  O  O     . SER B  1 436 ? 6.083   -38.682  19.731  1.00 72.45  ? 436 SER B O     1 
ATOM   6757  C  CB    . SER B  1 436 ? 3.958   -39.383  21.254  1.00 72.80  ? 436 SER B CB    1 
ATOM   6758  O  OG    . SER B  1 436 ? 2.998   -39.607  22.266  1.00 73.24  ? 436 SER B OG    1 
ATOM   6759  N  N     . PRO B  1 437 ? 7.706   -39.485  21.087  1.00 71.49  ? 437 PRO B N     1 
ATOM   6760  C  CA    . PRO B  1 437 ? 8.733   -38.966  20.196  1.00 71.56  ? 437 PRO B CA    1 
ATOM   6761  C  C     . PRO B  1 437 ? 8.681   -39.723  18.885  1.00 72.41  ? 437 PRO B C     1 
ATOM   6762  O  O     . PRO B  1 437 ? 8.397   -40.922  18.890  1.00 73.34  ? 437 PRO B O     1 
ATOM   6763  C  CB    . PRO B  1 437 ? 10.040  -39.272  20.939  1.00 71.26  ? 437 PRO B CB    1 
ATOM   6764  C  CG    . PRO B  1 437 ? 9.652   -39.940  22.241  1.00 70.82  ? 437 PRO B CG    1 
ATOM   6765  C  CD    . PRO B  1 437 ? 8.267   -40.446  22.049  1.00 71.33  ? 437 PRO B CD    1 
ATOM   6766  N  N     . LEU B  1 438 ? 8.937   -39.037  17.777  1.00 72.67  ? 438 LEU B N     1 
ATOM   6767  C  CA    . LEU B  1 438 ? 8.736   -39.627  16.451  1.00 73.75  ? 438 LEU B CA    1 
ATOM   6768  C  C     . LEU B  1 438 ? 10.014  -39.754  15.620  1.00 74.10  ? 438 LEU B C     1 
ATOM   6769  O  O     . LEU B  1 438 ? 10.869  -38.878  15.641  1.00 73.79  ? 438 LEU B O     1 
ATOM   6770  C  CB    . LEU B  1 438 ? 7.665   -38.843  15.689  1.00 74.51  ? 438 LEU B CB    1 
ATOM   6771  C  CG    . LEU B  1 438 ? 6.240   -38.996  16.248  1.00 75.25  ? 438 LEU B CG    1 
ATOM   6772  C  CD1   . LEU B  1 438 ? 5.407   -37.722  16.055  1.00 75.86  ? 438 LEU B CD1   1 
ATOM   6773  C  CD2   . LEU B  1 438 ? 5.519   -40.216  15.666  1.00 76.07  ? 438 LEU B CD2   1 
ATOM   6774  N  N     . ALA B  1 439 ? 10.139  -40.851  14.887  1.00 75.13  ? 439 ALA B N     1 
ATOM   6775  C  CA    . ALA B  1 439 ? 11.323  -41.080  14.073  1.00 76.04  ? 439 ALA B CA    1 
ATOM   6776  C  C     . ALA B  1 439 ? 11.427  -40.065  12.937  1.00 76.97  ? 439 ALA B C     1 
ATOM   6777  O  O     . ALA B  1 439 ? 10.415  -39.585  12.424  1.00 77.28  ? 439 ALA B O     1 
ATOM   6778  C  CB    . ALA B  1 439 ? 11.316  -42.486  13.530  1.00 77.26  ? 439 ALA B CB    1 
ATOM   6779  N  N     . THR B  1 440 ? 12.661  -39.745  12.560  1.00 77.58  ? 440 THR B N     1 
ATOM   6780  C  CA    . THR B  1 440 ? 12.949  -38.820  11.465  1.00 78.90  ? 440 THR B CA    1 
ATOM   6781  C  C     . THR B  1 440 ? 12.100  -39.107  10.236  1.00 80.49  ? 440 THR B C     1 
ATOM   6782  O  O     . THR B  1 440 ? 11.444  -38.210  9.706   1.00 80.84  ? 440 THR B O     1 
ATOM   6783  C  CB    . THR B  1 440 ? 14.442  -38.878  11.086  1.00 79.69  ? 440 THR B CB    1 
ATOM   6784  O  OG1   . THR B  1 440 ? 15.221  -38.363  12.177  1.00 79.56  ? 440 THR B OG1   1 
ATOM   6785  C  CG2   . THR B  1 440 ? 14.730  -38.064  9.830   1.00 80.64  ? 440 THR B CG2   1 
ATOM   6786  N  N     . GLU B  1 441 ? 12.114  -40.367  9.800   1.00 81.73  ? 441 GLU B N     1 
ATOM   6787  C  CA    . GLU B  1 441 ? 11.373  -40.802  8.616   1.00 83.63  ? 441 GLU B CA    1 
ATOM   6788  C  C     . GLU B  1 441 ? 9.846   -40.730  8.803   1.00 83.80  ? 441 GLU B C     1 
ATOM   6789  O  O     . GLU B  1 441 ? 9.098   -40.724  7.828   1.00 85.32  ? 441 GLU B O     1 
ATOM   6790  C  CB    . GLU B  1 441 ? 11.828  -42.199  8.170   1.00 84.77  ? 441 GLU B CB    1 
ATOM   6791  C  CG    . GLU B  1 441 ? 11.263  -43.364  8.979   1.00 84.36  ? 441 GLU B CG    1 
ATOM   6792  C  CD    . GLU B  1 441 ? 12.072  -43.709  10.222  1.00 82.98  ? 441 GLU B CD    1 
ATOM   6793  O  OE1   . GLU B  1 441 ? 12.999  -42.953  10.591  1.00 82.18  ? 441 GLU B OE1   1 
ATOM   6794  O  OE2   . GLU B  1 441 ? 11.771  -44.754  10.837  1.00 82.81  ? 441 GLU B OE2   1 
ATOM   6795  N  N     . GLU B  1 442 ? 9.395   -40.681  10.055  1.00 82.57  ? 442 GLU B N     1 
ATOM   6796  C  CA    . GLU B  1 442 ? 7.987   -40.409  10.358  1.00 82.67  ? 442 GLU B CA    1 
ATOM   6797  C  C     . GLU B  1 442 ? 7.734   -38.904  10.342  1.00 82.15  ? 442 GLU B C     1 
ATOM   6798  O  O     . GLU B  1 442 ? 6.597   -38.468  10.149  1.00 82.78  ? 442 GLU B O     1 
ATOM   6799  C  CB    . GLU B  1 442 ? 7.587   -40.978  11.727  1.00 81.56  ? 442 GLU B CB    1 
ATOM   6800  C  CG    . GLU B  1 442 ? 7.723   -42.492  11.869  1.00 82.49  ? 442 GLU B CG    1 
ATOM   6801  C  CD    . GLU B  1 442 ? 7.189   -43.016  13.201  1.00 82.37  ? 442 GLU B CD    1 
ATOM   6802  O  OE1   . GLU B  1 442 ? 7.646   -42.558  14.278  1.00 80.06  ? 442 GLU B OE1   1 
ATOM   6803  O  OE2   . GLU B  1 442 ? 6.316   -43.908  13.164  1.00 83.96  ? 442 GLU B OE2   1 
ATOM   6804  N  N     . GLN B  1 443 ? 8.801   -38.123  10.543  1.00 81.28  ? 443 GLN B N     1 
ATOM   6805  C  CA    . GLN B  1 443 ? 8.729   -36.655  10.629  1.00 80.63  ? 443 GLN B CA    1 
ATOM   6806  C  C     . GLN B  1 443 ? 8.725   -35.964  9.266   1.00 82.33  ? 443 GLN B C     1 
ATOM   6807  O  O     . GLN B  1 443 ? 7.859   -35.127  9.000   1.00 82.90  ? 443 GLN B O     1 
ATOM   6808  C  CB    . GLN B  1 443 ? 9.902   -36.103  11.439  1.00 79.24  ? 443 GLN B CB    1 
ATOM   6809  C  CG    . GLN B  1 443 ? 9.755   -36.162  12.937  1.00 77.43  ? 443 GLN B CG    1 
ATOM   6810  C  CD    . GLN B  1 443 ? 10.942  -35.528  13.647  1.00 77.02  ? 443 GLN B CD    1 
ATOM   6811  O  OE1   . GLN B  1 443 ? 11.376  -34.431  13.305  1.00 77.84  ? 443 GLN B OE1   1 
ATOM   6812  N  NE2   . GLN B  1 443 ? 11.467  -36.215  14.647  1.00 76.94  ? 443 GLN B NE2   1 
ATOM   6813  N  N     . VAL B  1 444 ? 9.685   -36.311  8.407   1.00 83.15  ? 444 VAL B N     1 
ATOM   6814  C  CA    . VAL B  1 444 ? 9.872   -35.568  7.161   1.00 84.81  ? 444 VAL B CA    1 
ATOM   6815  C  C     . VAL B  1 444 ? 8.636   -35.544  6.253   1.00 86.69  ? 444 VAL B C     1 
ATOM   6816  O  O     . VAL B  1 444 ? 8.427   -34.560  5.545   1.00 88.06  ? 444 VAL B O     1 
ATOM   6817  C  CB    . VAL B  1 444 ? 11.168  -35.947  6.363   1.00 85.75  ? 444 VAL B CB    1 
ATOM   6818  C  CG1   . VAL B  1 444 ? 12.383  -35.988  7.274   1.00 84.08  ? 444 VAL B CG1   1 
ATOM   6819  C  CG2   . VAL B  1 444 ? 11.007  -37.247  5.615   1.00 87.00  ? 444 VAL B CG2   1 
ATOM   6820  N  N     . PRO B  1 445 ? 7.804   -36.611  6.279   1.00 87.11  ? 445 PRO B N     1 
ATOM   6821  C  CA    . PRO B  1 445 ? 6.636   -36.532  5.410   1.00 89.02  ? 445 PRO B CA    1 
ATOM   6822  C  C     . PRO B  1 445 ? 5.684   -35.455  5.902   1.00 88.54  ? 445 PRO B C     1 
ATOM   6823  O  O     . PRO B  1 445 ? 5.199   -34.664  5.098   1.00 90.41  ? 445 PRO B O     1 
ATOM   6824  C  CB    . PRO B  1 445 ? 5.976   -37.909  5.553   1.00 89.31  ? 445 PRO B CB    1 
ATOM   6825  C  CG    . PRO B  1 445 ? 6.934   -38.754  6.282   1.00 87.98  ? 445 PRO B CG    1 
ATOM   6826  C  CD    . PRO B  1 445 ? 7.785   -37.840  7.089   1.00 86.09  ? 445 PRO B CD    1 
ATOM   6827  N  N     . LEU B  1 446 ? 5.445   -35.411  7.212   1.00 86.34  ? 446 LEU B N     1 
ATOM   6828  C  CA    . LEU B  1 446 ? 4.493   -34.462  7.782   1.00 85.84  ? 446 LEU B CA    1 
ATOM   6829  C  C     . LEU B  1 446 ? 4.883   -33.035  7.441   1.00 85.94  ? 446 LEU B C     1 
ATOM   6830  O  O     . LEU B  1 446 ? 4.026   -32.200  7.182   1.00 87.18  ? 446 LEU B O     1 
ATOM   6831  C  CB    . LEU B  1 446 ? 4.372   -34.632  9.298   1.00 83.75  ? 446 LEU B CB    1 
ATOM   6832  C  CG    . LEU B  1 446 ? 4.056   -36.034  9.838   1.00 83.73  ? 446 LEU B CG    1 
ATOM   6833  C  CD1   . LEU B  1 446 ? 4.217   -36.084  11.357  1.00 82.11  ? 446 LEU B CD1   1 
ATOM   6834  C  CD2   . LEU B  1 446 ? 2.661   -36.515  9.433   1.00 85.50  ? 446 LEU B CD2   1 
ATOM   6835  N  N     . ILE B  1 447 ? 6.183   -32.771  7.415   1.00 84.91  ? 447 ILE B N     1 
ATOM   6836  C  CA    . ILE B  1 447 ? 6.678   -31.430  7.138   1.00 84.73  ? 447 ILE B CA    1 
ATOM   6837  C  C     . ILE B  1 447 ? 6.592   -31.154  5.635   1.00 86.65  ? 447 ILE B C     1 
ATOM   6838  O  O     . ILE B  1 447 ? 6.077   -30.107  5.237   1.00 87.85  ? 447 ILE B O     1 
ATOM   6839  C  CB    . ILE B  1 447 ? 8.093   -31.196  7.745   1.00 83.41  ? 447 ILE B CB    1 
ATOM   6840  C  CG1   . ILE B  1 447 ? 8.079   -31.554  9.231   1.00 81.13  ? 447 ILE B CG1   1 
ATOM   6841  C  CG2   . ILE B  1 447 ? 8.534   -29.756  7.576   1.00 83.65  ? 447 ILE B CG2   1 
ATOM   6842  C  CD1   . ILE B  1 447 ? 9.436   -31.539  9.878   1.00 80.80  ? 447 ILE B CD1   1 
ATOM   6843  N  N     . TYR B  1 448 ? 7.050   -32.104  4.814   1.00 86.97  ? 448 TYR B N     1 
ATOM   6844  C  CA    . TYR B  1 448 ? 6.893   -32.011  3.353   1.00 88.97  ? 448 TYR B CA    1 
ATOM   6845  C  C     . TYR B  1 448 ? 5.445   -31.666  3.006   1.00 90.01  ? 448 TYR B C     1 
ATOM   6846  O  O     . TYR B  1 448 ? 5.187   -30.704  2.280   1.00 91.58  ? 448 TYR B O     1 
ATOM   6847  C  CB    . TYR B  1 448 ? 7.319   -33.311  2.648   1.00 89.79  ? 448 TYR B CB    1 
ATOM   6848  C  CG    . TYR B  1 448 ? 7.202   -33.237  1.135   1.00 92.72  ? 448 TYR B CG    1 
ATOM   6849  C  CD1   . TYR B  1 448 ? 8.255   -32.753  0.359   1.00 93.93  ? 448 TYR B CD1   1 
ATOM   6850  C  CD2   . TYR B  1 448 ? 6.031   -33.633  0.478   1.00 93.93  ? 448 TYR B CD2   1 
ATOM   6851  C  CE1   . TYR B  1 448 ? 8.148   -32.668  -1.028  1.00 96.15  ? 448 TYR B CE1   1 
ATOM   6852  C  CE2   . TYR B  1 448 ? 5.916   -33.543  -0.904  1.00 96.60  ? 448 TYR B CE2   1 
ATOM   6853  C  CZ    . TYR B  1 448 ? 6.979   -33.061  -1.648  1.00 97.67  ? 448 TYR B CZ    1 
ATOM   6854  O  OH    . TYR B  1 448 ? 6.880   -32.965  -3.013  1.00 100.67 ? 448 TYR B OH    1 
ATOM   6855  N  N     . ALA B  1 449 ? 4.517   -32.445  3.563   1.00 89.00  ? 449 ALA B N     1 
ATOM   6856  C  CA    . ALA B  1 449 ? 3.076   -32.253  3.388   1.00 90.27  ? 449 ALA B CA    1 
ATOM   6857  C  C     . ALA B  1 449 ? 2.543   -30.911  3.891   1.00 90.23  ? 449 ALA B C     1 
ATOM   6858  O  O     . ALA B  1 449 ? 1.472   -30.472  3.462   1.00 92.29  ? 449 ALA B O     1 
ATOM   6859  C  CB    . ALA B  1 449 ? 2.309   -33.390  4.037   1.00 89.45  ? 449 ALA B CB    1 
ATOM   6860  N  N     . GLY B  1 450 ? 3.278   -30.270  4.797   1.00 88.25  ? 450 GLY B N     1 
ATOM   6861  C  CA    . GLY B  1 450 ? 2.925   -28.940  5.282   1.00 87.95  ? 450 GLY B CA    1 
ATOM   6862  C  C     . GLY B  1 450 ? 3.515   -27.837  4.428   1.00 89.46  ? 450 GLY B C     1 
ATOM   6863  O  O     . GLY B  1 450 ? 2.788   -26.969  3.938   1.00 91.14  ? 450 GLY B O     1 
ATOM   6864  N  N     . VAL B  1 451 ? 4.835   -27.887  4.248   1.00 88.94  ? 451 VAL B N     1 
ATOM   6865  C  CA    . VAL B  1 451 ? 5.597   -26.882  3.494   1.00 90.74  ? 451 VAL B CA    1 
ATOM   6866  C  C     . VAL B  1 451 ? 5.088   -26.692  2.051   1.00 94.34  ? 451 VAL B C     1 
ATOM   6867  O  O     . VAL B  1 451 ? 5.088   -25.576  1.521   1.00 96.23  ? 451 VAL B O     1 
ATOM   6868  C  CB    . VAL B  1 451 ? 7.118   -27.212  3.499   1.00 89.59  ? 451 VAL B CB    1 
ATOM   6869  C  CG1   . VAL B  1 451 ? 7.931   -26.147  2.769   1.00 90.87  ? 451 VAL B CG1   1 
ATOM   6870  C  CG2   . VAL B  1 451 ? 7.617   -27.339  4.912   1.00 86.81  ? 451 VAL B CG2   1 
ATOM   6871  N  N     . ASN B  1 452 ? 4.647   -27.781  1.426   1.00 95.56  ? 452 ASN B N     1 
ATOM   6872  C  CA    . ASN B  1 452 ? 4.160   -27.724  0.052   1.00 98.86  ? 452 ASN B CA    1 
ATOM   6873  C  C     . ASN B  1 452 ? 2.649   -27.542  -0.046  1.00 100.56 ? 452 ASN B C     1 
ATOM   6874  O  O     . ASN B  1 452 ? 2.062   -27.654  -1.118  1.00 103.30 ? 452 ASN B O     1 
ATOM   6875  C  CB    . ASN B  1 452 ? 4.672   -28.924  -0.729  1.00 99.44  ? 452 ASN B CB    1 
ATOM   6876  C  CG    . ASN B  1 452 ? 6.178   -28.943  -0.794  1.00 98.71  ? 452 ASN B CG    1 
ATOM   6877  O  OD1   . ASN B  1 452 ? 6.786   -28.176  -1.530  1.00 100.28 ? 452 ASN B OD1   1 
ATOM   6878  N  ND2   . ASN B  1 452 ? 6.792   -29.785  0.018   1.00 97.04  ? 452 ASN B ND2   1 
ATOM   6879  N  N     . GLY B  1 453 ? 2.034   -27.254  1.095   1.00 99.33  ? 453 GLY B N     1 
ATOM   6880  C  CA    . GLY B  1 453 ? 0.665   -26.769  1.143   1.00 101.20 ? 453 GLY B CA    1 
ATOM   6881  C  C     . GLY B  1 453 ? -0.429  -27.786  0.920   1.00 102.51 ? 453 GLY B C     1 
ATOM   6882  O  O     . GLY B  1 453 ? -1.551  -27.424  0.560   1.00 104.86 ? 453 GLY B O     1 
ATOM   6883  N  N     . HIS B  1 454 ? -0.121  -29.059  1.139   1.00 101.38 ? 454 HIS B N     1 
ATOM   6884  C  CA    . HIS B  1 454 ? -1.123  -30.104  0.945   1.00 102.64 ? 454 HIS B CA    1 
ATOM   6885  C  C     . HIS B  1 454 ? -2.126  -30.132  2.101   1.00 101.50 ? 454 HIS B C     1 
ATOM   6886  O  O     . HIS B  1 454 ? -3.092  -30.898  2.085   1.00 102.53 ? 454 HIS B O     1 
ATOM   6887  C  CB    . HIS B  1 454 ? -0.455  -31.464  0.744   1.00 101.99 ? 454 HIS B CB    1 
ATOM   6888  C  CG    . HIS B  1 454 ? 0.411   -31.532  -0.475  1.00 103.84 ? 454 HIS B CG    1 
ATOM   6889  N  ND1   . HIS B  1 454 ? -0.106  -31.581  -1.753  1.00 107.43 ? 454 HIS B ND1   1 
ATOM   6890  C  CD2   . HIS B  1 454 ? 1.758   -31.555  -0.611  1.00 102.88 ? 454 HIS B CD2   1 
ATOM   6891  C  CE1   . HIS B  1 454 ? 0.886   -31.632  -2.623  1.00 108.45 ? 454 HIS B CE1   1 
ATOM   6892  N  NE2   . HIS B  1 454 ? 2.027   -31.621  -1.956  1.00 106.05 ? 454 HIS B NE2   1 
ATOM   6893  N  N     . LEU B  1 455 ? -1.899  -29.273  3.090   1.00 99.57  ? 455 LEU B N     1 
ATOM   6894  C  CA    . LEU B  1 455 ? -2.787  -29.184  4.238   1.00 98.55  ? 455 LEU B CA    1 
ATOM   6895  C  C     . LEU B  1 455 ? -3.748  -28.008  4.096   1.00 100.53 ? 455 LEU B C     1 
ATOM   6896  O  O     . LEU B  1 455 ? -4.812  -27.985  4.725   1.00 100.74 ? 455 LEU B O     1 
ATOM   6897  C  CB    . LEU B  1 455 ? -1.972  -29.091  5.535   1.00 95.49  ? 455 LEU B CB    1 
ATOM   6898  C  CG    . LEU B  1 455 ? -1.022  -30.266  5.827   1.00 93.23  ? 455 LEU B CG    1 
ATOM   6899  C  CD1   . LEU B  1 455 ? 0.016   -29.882  6.850   1.00 90.59  ? 455 LEU B CD1   1 
ATOM   6900  C  CD2   . LEU B  1 455 ? -1.775  -31.514  6.267   1.00 92.73  ? 455 LEU B CD2   1 
ATOM   6901  N  N     . ASP B  1 456 ? -3.375  -27.058  3.234   1.00 102.08 ? 456 ASP B N     1 
ATOM   6902  C  CA    . ASP B  1 456 ? -4.123  -25.810  3.026   1.00 104.07 ? 456 ASP B CA    1 
ATOM   6903  C  C     . ASP B  1 456 ? -5.643  -25.994  2.994   1.00 106.07 ? 456 ASP B C     1 
ATOM   6904  O  O     . ASP B  1 456 ? -6.387  -25.171  3.535   1.00 106.63 ? 456 ASP B O     1 
ATOM   6905  C  CB    . ASP B  1 456 ? -3.630  -25.081  1.763   1.00 106.22 ? 456 ASP B CB    1 
ATOM   6906  C  CG    . ASP B  1 456 ? -2.283  -24.387  1.968   1.00 104.47 ? 456 ASP B CG    1 
ATOM   6907  O  OD1   . ASP B  1 456 ? -1.274  -25.079  2.167   1.00 102.35 ? 456 ASP B OD1   1 
ATOM   6908  O  OD2   . ASP B  1 456 ? -2.226  -23.144  1.928   1.00 105.38 ? 456 ASP B OD2   1 
ATOM   6909  N  N     . GLY B  1 457 ? -6.089  -27.086  2.379   1.00 107.30 ? 457 GLY B N     1 
ATOM   6910  C  CA    . GLY B  1 457 ? -7.515  -27.376  2.241   1.00 109.71 ? 457 GLY B CA    1 
ATOM   6911  C  C     . GLY B  1 457 ? -8.150  -28.025  3.458   1.00 108.12 ? 457 GLY B C     1 
ATOM   6912  O  O     . GLY B  1 457 ? -9.345  -27.858  3.704   1.00 109.65 ? 457 GLY B O     1 
ATOM   6913  N  N     . ILE B  1 458 ? -7.354  -28.773  4.213   1.00 105.29 ? 458 ILE B N     1 
ATOM   6914  C  CA    . ILE B  1 458 ? -7.849  -29.482  5.396   1.00 103.94 ? 458 ILE B CA    1 
ATOM   6915  C  C     . ILE B  1 458 ? -8.073  -28.508  6.558   1.00 102.89 ? 458 ILE B C     1 
ATOM   6916  O  O     . ILE B  1 458 ? -7.274  -27.594  6.762   1.00 101.92 ? 458 ILE B O     1 
ATOM   6917  C  CB    . ILE B  1 458 ? -6.888  -30.637  5.812   1.00 101.26 ? 458 ILE B CB    1 
ATOM   6918  C  CG1   . ILE B  1 458 ? -6.840  -31.709  4.712   1.00 102.70 ? 458 ILE B CG1   1 
ATOM   6919  C  CG2   . ILE B  1 458 ? -7.306  -31.251  7.154   1.00 99.53  ? 458 ILE B CG2   1 
ATOM   6920  C  CD1   . ILE B  1 458 ? -5.991  -32.935  5.042   1.00 99.58  ? 458 ILE B CD1   1 
ATOM   6921  N  N     . GLU B  1 459 ? -9.162  -28.712  7.303   1.00 103.47 ? 459 GLU B N     1 
ATOM   6922  C  CA    . GLU B  1 459 ? -9.485  -27.907  8.494   1.00 102.69 ? 459 GLU B CA    1 
ATOM   6923  C  C     . GLU B  1 459 ? -8.474  -28.036  9.644   1.00 99.26  ? 459 GLU B C     1 
ATOM   6924  O  O     . GLU B  1 459 ? -7.697  -28.993  9.716   1.00 97.20  ? 459 GLU B O     1 
ATOM   6925  C  CB    . GLU B  1 459 ? -10.854 -28.293  9.047   1.00 104.15 ? 459 GLU B CB    1 
ATOM   6926  C  CG    . GLU B  1 459 ? -11.992 -28.214  8.091   1.00 107.69 ? 459 GLU B CG    1 
ATOM   6927  C  CD    . GLU B  1 459 ? -12.971 -29.336  8.330   1.00 109.25 ? 459 GLU B CD    1 
ATOM   6928  O  OE1   . GLU B  1 459 ? -13.914 -29.146  9.127   1.00 110.08 ? 459 GLU B OE1   1 
ATOM   6929  O  OE2   . GLU B  1 459 ? -12.779 -30.422  7.741   1.00 109.80 ? 459 GLU B OE2   1 
ATOM   6930  N  N     . LEU B  1 460 ? -8.527  -27.074  10.560  1.00 98.71  ? 460 LEU B N     1 
ATOM   6931  C  CA    . LEU B  1 460 ? -7.688  -27.090  11.744  1.00 96.11  ? 460 LEU B CA    1 
ATOM   6932  C  C     . LEU B  1 460 ? -7.986  -28.281  12.639  1.00 95.26  ? 460 LEU B C     1 
ATOM   6933  O  O     . LEU B  1 460 ? -7.083  -29.051  12.974  1.00 93.04  ? 460 LEU B O     1 
ATOM   6934  C  CB    . LEU B  1 460 ? -7.858  -25.793  12.525  1.00 96.19  ? 460 LEU B CB    1 
ATOM   6935  C  CG    . LEU B  1 460 ? -6.823  -24.689  12.312  1.00 95.33  ? 460 LEU B CG    1 
ATOM   6936  C  CD1   . LEU B  1 460 ? -5.876  -24.940  11.128  1.00 94.38  ? 460 LEU B CD1   1 
ATOM   6937  C  CD2   . LEU B  1 460 ? -7.553  -23.361  12.180  1.00 97.23  ? 460 LEU B CD2   1 
ATOM   6938  N  N     . SER B  1 461 ? -9.255  -28.438  13.002  1.00 97.32  ? 461 SER B N     1 
ATOM   6939  C  CA    . SER B  1 461 ? -9.673  -29.489  13.930  1.00 97.14  ? 461 SER B CA    1 
ATOM   6940  C  C     . SER B  1 461 ? -9.377  -30.908  13.430  1.00 97.05  ? 461 SER B C     1 
ATOM   6941  O  O     . SER B  1 461 ? -9.472  -31.872  14.191  1.00 96.49  ? 461 SER B O     1 
ATOM   6942  C  CB    . SER B  1 461 ? -11.153 -29.329  14.319  1.00 99.43  ? 461 SER B CB    1 
ATOM   6943  O  OG    . SER B  1 461 ? -11.944 -28.890  13.226  1.00 102.32 ? 461 SER B OG    1 
ATOM   6944  N  N     . ARG B  1 462 ? -8.992  -31.044  12.166  1.00 98.08  ? 462 ARG B N     1 
ATOM   6945  C  CA    . ARG B  1 462 ? -8.703  -32.369  11.636  1.00 98.34  ? 462 ARG B CA    1 
ATOM   6946  C  C     . ARG B  1 462 ? -7.219  -32.620  11.357  1.00 96.22  ? 462 ARG B C     1 
ATOM   6947  O  O     . ARG B  1 462 ? -6.836  -33.761  11.106  1.00 95.89  ? 462 ARG B O     1 
ATOM   6948  C  CB    . ARG B  1 462 ? -9.569  -32.687  10.406  1.00 101.63 ? 462 ARG B CB    1 
ATOM   6949  C  CG    . ARG B  1 462 ? -11.082 -32.469  10.611  1.00 105.25 ? 462 ARG B CG    1 
ATOM   6950  C  CD    . ARG B  1 462 ? -11.958 -33.362  9.717   1.00 110.12 ? 462 ARG B CD    1 
ATOM   6951  N  NE    . ARG B  1 462 ? -11.319 -33.706  8.442   1.00 112.56 ? 462 ARG B NE    1 
ATOM   6952  C  CZ    . ARG B  1 462 ? -11.144 -34.948  7.983   1.00 113.52 ? 462 ARG B CZ    1 
ATOM   6953  N  NH1   . ARG B  1 462 ? -11.583 -35.998  8.668   1.00 113.67 ? 462 ARG B NH1   1 
ATOM   6954  N  NH2   . ARG B  1 462 ? -10.538 -35.139  6.819   1.00 114.24 ? 462 ARG B NH2   1 
ATOM   6955  N  N     . ILE B  1 463 ? -6.388  -31.574  11.414  1.00 95.13  ? 463 ILE B N     1 
ATOM   6956  C  CA    . ILE B  1 463 ? -4.928  -31.728  11.238  1.00 93.20  ? 463 ILE B CA    1 
ATOM   6957  C  C     . ILE B  1 463 ? -4.338  -32.723  12.249  1.00 91.19  ? 463 ILE B C     1 
ATOM   6958  O  O     . ILE B  1 463 ? -3.361  -33.418  11.953  1.00 90.16  ? 463 ILE B O     1 
ATOM   6959  C  CB    . ILE B  1 463 ? -4.160  -30.376  11.326  1.00 92.41  ? 463 ILE B CB    1 
ATOM   6960  C  CG1   . ILE B  1 463 ? -4.535  -29.439  10.171  1.00 94.54  ? 463 ILE B CG1   1 
ATOM   6961  C  CG2   . ILE B  1 463 ? -2.640  -30.604  11.339  1.00 90.17  ? 463 ILE B CG2   1 
ATOM   6962  C  CD1   . ILE B  1 463 ? -3.699  -29.618  8.901   1.00 94.92  ? 463 ILE B CD1   1 
ATOM   6963  N  N     . GLY B  1 464 ? -4.940  -32.788  13.434  1.00 90.88  ? 464 GLY B N     1 
ATOM   6964  C  CA    . GLY B  1 464 ? -4.563  -33.785  14.437  1.00 89.80  ? 464 GLY B CA    1 
ATOM   6965  C  C     . GLY B  1 464 ? -4.790  -35.211  13.954  1.00 90.97  ? 464 GLY B C     1 
ATOM   6966  O  O     . GLY B  1 464 ? -3.860  -36.023  13.922  1.00 89.94  ? 464 GLY B O     1 
ATOM   6967  N  N     . GLU B  1 465 ? -6.037  -35.504  13.579  1.00 93.38  ? 465 GLU B N     1 
ATOM   6968  C  CA    . GLU B  1 465 ? -6.434  -36.798  13.007  1.00 94.69  ? 465 GLU B CA    1 
ATOM   6969  C  C     . GLU B  1 465 ? -5.719  -37.115  11.679  1.00 95.30  ? 465 GLU B C     1 
ATOM   6970  O  O     . GLU B  1 465 ? -5.339  -38.271  11.440  1.00 95.43  ? 465 GLU B O     1 
ATOM   6971  C  CB    . GLU B  1 465 ? -7.962  -36.832  12.836  1.00 97.35  ? 465 GLU B CB    1 
ATOM   6972  C  CG    . GLU B  1 465 ? -8.509  -37.832  11.824  1.00 99.21  ? 465 GLU B CG    1 
ATOM   6973  C  CD    . GLU B  1 465 ? -9.710  -37.292  11.060  1.00 102.55 ? 465 GLU B CD    1 
ATOM   6974  O  OE1   . GLU B  1 465 ? -9.953  -36.058  11.105  1.00 102.22 ? 465 GLU B OE1   1 
ATOM   6975  O  OE2   . GLU B  1 465 ? -10.404 -38.105  10.401  1.00 104.66 ? 465 GLU B OE2   1 
ATOM   6976  N  N     . PHE B  1 466 ? -5.538  -36.098  10.827  1.00 95.78  ? 466 PHE B N     1 
ATOM   6977  C  CA    . PHE B  1 466 ? -4.816  -36.269  9.562   1.00 96.31  ? 466 PHE B CA    1 
ATOM   6978  C  C     . PHE B  1 466 ? -3.472  -36.941  9.794   1.00 94.30  ? 466 PHE B C     1 
ATOM   6979  O  O     . PHE B  1 466 ? -3.114  -37.892  9.100   1.00 94.90  ? 466 PHE B O     1 
ATOM   6980  C  CB    . PHE B  1 466 ? -4.581  -34.934  8.840   1.00 96.74  ? 466 PHE B CB    1 
ATOM   6981  C  CG    . PHE B  1 466 ? -3.571  -35.029  7.719   1.00 97.26  ? 466 PHE B CG    1 
ATOM   6982  C  CD1   . PHE B  1 466 ? -2.211  -34.860  7.966   1.00 95.83  ? 466 PHE B CD1   1 
ATOM   6983  C  CD2   . PHE B  1 466 ? -3.973  -35.322  6.425   1.00 100.33 ? 466 PHE B CD2   1 
ATOM   6984  C  CE1   . PHE B  1 466 ? -1.273  -34.971  6.934   1.00 96.46  ? 466 PHE B CE1   1 
ATOM   6985  C  CE2   . PHE B  1 466 ? -3.041  -35.422  5.386   1.00 100.89 ? 466 PHE B CE2   1 
ATOM   6986  C  CZ    . PHE B  1 466 ? -1.691  -35.246  5.643   1.00 98.56  ? 466 PHE B CZ    1 
ATOM   6987  N  N     . GLU B  1 467 ? -2.735  -36.432  10.775  1.00 92.06  ? 467 GLU B N     1 
ATOM   6988  C  CA    . GLU B  1 467 ? -1.365  -36.858  11.007  1.00 90.59  ? 467 GLU B CA    1 
ATOM   6989  C  C     . GLU B  1 467 ? -1.239  -38.320  11.435  1.00 89.94  ? 467 GLU B C     1 
ATOM   6990  O  O     . GLU B  1 467 ? -0.344  -39.028  10.966  1.00 89.94  ? 467 GLU B O     1 
ATOM   6991  C  CB    . GLU B  1 467 ? -0.707  -35.945  12.031  1.00 89.02  ? 467 GLU B CB    1 
ATOM   6992  C  CG    . GLU B  1 467 ? 0.660   -36.403  12.496  1.00 88.83  ? 467 GLU B CG    1 
ATOM   6993  C  CD    . GLU B  1 467 ? 0.989   -35.875  13.870  1.00 89.20  ? 467 GLU B CD    1 
ATOM   6994  O  OE1   . GLU B  1 467 ? 0.232   -35.004  14.357  1.00 89.69  ? 467 GLU B OE1   1 
ATOM   6995  O  OE2   . GLU B  1 467 ? 1.997   -36.331  14.463  1.00 89.18  ? 467 GLU B OE2   1 
ATOM   6996  N  N     . SER B  1 468 ? -2.121  -38.773  12.319  1.00 89.66  ? 468 SER B N     1 
ATOM   6997  C  CA    . SER B  1 468 ? -2.079  -40.167  12.743  1.00 89.45  ? 468 SER B CA    1 
ATOM   6998  C  C     . SER B  1 468 ? -2.483  -41.078  11.594  1.00 91.51  ? 468 SER B C     1 
ATOM   6999  O  O     . SER B  1 468 ? -1.831  -42.093  11.346  1.00 91.67  ? 468 SER B O     1 
ATOM   7000  C  CB    . SER B  1 468 ? -2.922  -40.420  14.002  1.00 89.26  ? 468 SER B CB    1 
ATOM   7001  O  OG    . SER B  1 468 ? -3.888  -39.401  14.206  1.00 90.60  ? 468 SER B OG    1 
ATOM   7002  N  N     . SER B  1 469 ? -3.531  -40.687  10.873  1.00 93.34  ? 469 SER B N     1 
ATOM   7003  C  CA    . SER B  1 469 ? -4.036  -41.469  9.744   1.00 95.70  ? 469 SER B CA    1 
ATOM   7004  C  C     . SER B  1 469 ? -3.078  -41.480  8.560   1.00 95.97  ? 469 SER B C     1 
ATOM   7005  O  O     . SER B  1 469 ? -3.081  -42.421  7.762   1.00 97.66  ? 469 SER B O     1 
ATOM   7006  C  CB    . SER B  1 469 ? -5.396  -40.940  9.289   1.00 97.99  ? 469 SER B CB    1 
ATOM   7007  O  OG    . SER B  1 469 ? -6.357  -41.046  10.321  1.00 98.41  ? 469 SER B OG    1 
ATOM   7008  N  N     . PHE B  1 470 ? -2.266  -40.432  8.444   1.00 94.47  ? 470 PHE B N     1 
ATOM   7009  C  CA    . PHE B  1 470 ? -1.360  -40.311  7.308   1.00 95.13  ? 470 PHE B CA    1 
ATOM   7010  C  C     . PHE B  1 470 ? -0.154  -41.209  7.493   1.00 93.94  ? 470 PHE B C     1 
ATOM   7011  O  O     . PHE B  1 470 ? 0.339   -41.807  6.530   1.00 95.23  ? 470 PHE B O     1 
ATOM   7012  C  CB    . PHE B  1 470 ? -0.926  -38.857  7.093   1.00 94.48  ? 470 PHE B CB    1 
ATOM   7013  C  CG    . PHE B  1 470 ? 0.000   -38.662  5.919   1.00 95.22  ? 470 PHE B CG    1 
ATOM   7014  C  CD1   . PHE B  1 470 ? -0.205  -39.342  4.724   1.00 96.96  ? 470 PHE B CD1   1 
ATOM   7015  C  CD2   . PHE B  1 470 ? 1.067   -37.772  6.005   1.00 94.23  ? 470 PHE B CD2   1 
ATOM   7016  C  CE1   . PHE B  1 470 ? 0.649   -39.152  3.642   1.00 98.28  ? 470 PHE B CE1   1 
ATOM   7017  C  CE2   . PHE B  1 470 ? 1.930   -37.578  4.919   1.00 95.19  ? 470 PHE B CE2   1 
ATOM   7018  C  CZ    . PHE B  1 470 ? 1.718   -38.267  3.740   1.00 96.52  ? 470 PHE B CZ    1 
ATOM   7019  N  N     . LEU B  1 471 ? 0.309   -41.299  8.737   1.00 91.55  ? 471 LEU B N     1 
ATOM   7020  C  CA    . LEU B  1 471 ? 1.444   -42.148  9.066   1.00 90.51  ? 471 LEU B CA    1 
ATOM   7021  C  C     . LEU B  1 471 ? 1.102   -43.638  8.903   1.00 92.05  ? 471 LEU B C     1 
ATOM   7022  O  O     . LEU B  1 471 ? 1.923   -44.408  8.396   1.00 92.67  ? 471 LEU B O     1 
ATOM   7023  C  CB    . LEU B  1 471 ? 1.988   -41.813  10.460  1.00 87.91  ? 471 LEU B CB    1 
ATOM   7024  C  CG    . LEU B  1 471 ? 2.759   -40.479  10.534  1.00 86.76  ? 471 LEU B CG    1 
ATOM   7025  C  CD1   . LEU B  1 471 ? 2.845   -39.925  11.960  1.00 84.36  ? 471 LEU B CD1   1 
ATOM   7026  C  CD2   . LEU B  1 471 ? 4.151   -40.597  9.914   1.00 86.48  ? 471 LEU B CD2   1 
ATOM   7027  N  N     . SER B  1 472 ? -0.116  -44.023  9.297   1.00 92.86  ? 472 SER B N     1 
ATOM   7028  C  CA    . SER B  1 472 ? -0.630  -45.386  9.080   1.00 94.58  ? 472 SER B CA    1 
ATOM   7029  C  C     . SER B  1 472 ? -0.557  -45.737  7.600   1.00 96.80  ? 472 SER B C     1 
ATOM   7030  O  O     . SER B  1 472 ? 0.027   -46.759  7.225   1.00 97.55  ? 472 SER B O     1 
ATOM   7031  C  CB    . SER B  1 472 ? -2.080  -45.519  9.564   1.00 95.69  ? 472 SER B CB    1 
ATOM   7032  O  OG    . SER B  1 472 ? -2.337  -44.683  10.683  1.00 94.15  ? 472 SER B OG    1 
ATOM   7033  N  N     . TYR B  1 473 ? -1.139  -44.862  6.777   1.00 97.90  ? 473 TYR B N     1 
ATOM   7034  C  CA    . TYR B  1 473 ? -1.118  -44.986  5.321   1.00 100.48 ? 473 TYR B CA    1 
ATOM   7035  C  C     . TYR B  1 473 ? 0.300   -45.202  4.789   1.00 99.90  ? 473 TYR B C     1 
ATOM   7036  O  O     . TYR B  1 473 ? 0.542   -46.131  4.009   1.00 102.13 ? 473 TYR B O     1 
ATOM   7037  C  CB    . TYR B  1 473 ? -1.764  -43.756  4.661   1.00 101.48 ? 473 TYR B CB    1 
ATOM   7038  C  CG    . TYR B  1 473 ? -1.686  -43.737  3.142   1.00 104.40 ? 473 TYR B CG    1 
ATOM   7039  C  CD1   . TYR B  1 473 ? -2.446  -44.620  2.378   1.00 108.06 ? 473 TYR B CD1   1 
ATOM   7040  C  CD2   . TYR B  1 473 ? -0.857  -42.828  2.471   1.00 104.06 ? 473 TYR B CD2   1 
ATOM   7041  C  CE1   . TYR B  1 473 ? -2.380  -44.610  0.984   1.00 111.43 ? 473 TYR B CE1   1 
ATOM   7042  C  CE2   . TYR B  1 473 ? -0.780  -42.807  1.077   1.00 107.14 ? 473 TYR B CE2   1 
ATOM   7043  C  CZ    . TYR B  1 473 ? -1.548  -43.704  0.339   1.00 111.27 ? 473 TYR B CZ    1 
ATOM   7044  O  OH    . TYR B  1 473 ? -1.501  -43.714  -1.044  1.00 114.80 ? 473 TYR B OH    1 
ATOM   7045  N  N     . LEU B  1 474 ? 1.227   -44.353  5.223   1.00 97.17  ? 474 LEU B N     1 
ATOM   7046  C  CA    . LEU B  1 474 ? 2.614   -44.442  4.786   1.00 96.58  ? 474 LEU B CA    1 
ATOM   7047  C  C     . LEU B  1 474 ? 3.289   -45.755  5.174   1.00 96.38  ? 474 LEU B C     1 
ATOM   7048  O  O     . LEU B  1 474 ? 4.039   -46.324  4.379   1.00 97.78  ? 474 LEU B O     1 
ATOM   7049  C  CB    . LEU B  1 474 ? 3.421   -43.255  5.309   1.00 94.06  ? 474 LEU B CB    1 
ATOM   7050  C  CG    . LEU B  1 474 ? 3.224   -41.966  4.512   1.00 94.93  ? 474 LEU B CG    1 
ATOM   7051  C  CD1   . LEU B  1 474 ? 3.795   -40.785  5.261   1.00 92.30  ? 474 LEU B CD1   1 
ATOM   7052  C  CD2   . LEU B  1 474 ? 3.840   -42.077  3.115   1.00 97.40  ? 474 LEU B CD2   1 
ATOM   7053  N  N     . LYS B  1 475 ? 3.013   -46.234  6.387   1.00 94.84  ? 475 LYS B N     1 
ATOM   7054  C  CA    . LYS B  1 475 ? 3.626   -47.463  6.890   1.00 94.55  ? 475 LYS B CA    1 
ATOM   7055  C  C     . LYS B  1 475 ? 3.164   -48.676  6.093   1.00 97.60  ? 475 LYS B C     1 
ATOM   7056  O  O     . LYS B  1 475 ? 3.984   -49.429  5.561   1.00 98.77  ? 475 LYS B O     1 
ATOM   7057  C  CB    . LYS B  1 475 ? 3.349   -47.646  8.380   1.00 92.46  ? 475 LYS B CB    1 
ATOM   7058  C  CG    . LYS B  1 475 ? 3.963   -46.547  9.227   1.00 89.66  ? 475 LYS B CG    1 
ATOM   7059  C  CD    . LYS B  1 475 ? 4.264   -46.993  10.637  1.00 87.52  ? 475 LYS B CD    1 
ATOM   7060  C  CE    . LYS B  1 475 ? 4.922   -45.859  11.396  1.00 85.18  ? 475 LYS B CE    1 
ATOM   7061  N  NZ    . LYS B  1 475 ? 5.838   -46.325  12.476  1.00 83.10  ? 475 LYS B NZ    1 
ATOM   7062  N  N     . SER B  1 476 ? 1.849   -48.844  5.990   1.00 99.08  ? 476 SER B N     1 
ATOM   7063  C  CA    . SER B  1 476 ? 1.268   -49.955  5.239   1.00 102.09 ? 476 SER B CA    1 
ATOM   7064  C  C     . SER B  1 476 ? 1.587   -49.935  3.740   1.00 104.36 ? 476 SER B C     1 
ATOM   7065  O  O     . SER B  1 476 ? 1.968   -50.963  3.187   1.00 106.40 ? 476 SER B O     1 
ATOM   7066  C  CB    . SER B  1 476 ? -0.244  -50.025  5.465   1.00 103.36 ? 476 SER B CB    1 
ATOM   7067  O  OG    . SER B  1 476 ? -0.854  -48.759  5.273   1.00 103.08 ? 476 SER B OG    1 
ATOM   7068  N  N     . ASN B  1 477 ? 1.463   -48.771  3.100   1.00 104.23 ? 477 ASN B N     1 
ATOM   7069  C  CA    . ASN B  1 477 ? 1.514   -48.690  1.628   1.00 107.15 ? 477 ASN B CA    1 
ATOM   7070  C  C     . ASN B  1 477 ? 2.807   -48.189  0.969   1.00 106.73 ? 477 ASN B C     1 
ATOM   7071  O  O     . ASN B  1 477 ? 3.127   -48.597  -0.145  1.00 109.05 ? 477 ASN B O     1 
ATOM   7072  C  CB    . ASN B  1 477 ? 0.305   -47.916  1.085   1.00 108.71 ? 477 ASN B CB    1 
ATOM   7073  C  CG    . ASN B  1 477 ? -1.017  -48.595  1.411   1.00 110.37 ? 477 ASN B CG    1 
ATOM   7074  O  OD1   . ASN B  1 477 ? -1.488  -48.545  2.546   1.00 109.33 ? 477 ASN B OD1   1 
ATOM   7075  N  ND2   . ASN B  1 477 ? -1.622  -49.224  0.415   1.00 113.36 ? 477 ASN B ND2   1 
ATOM   7076  N  N     . HIS B  1 478 ? 3.531   -47.297  1.643   1.00 103.89 ? 478 HIS B N     1 
ATOM   7077  C  CA    . HIS B  1 478 ? 4.735   -46.686  1.073   1.00 103.60 ? 478 HIS B CA    1 
ATOM   7078  C  C     . HIS B  1 478 ? 5.922   -46.794  2.025   1.00 101.03 ? 478 HIS B C     1 
ATOM   7079  O  O     . HIS B  1 478 ? 6.711   -45.855  2.177   1.00 99.59  ? 478 HIS B O     1 
ATOM   7080  C  CB    . HIS B  1 478 ? 4.466   -45.225  0.710   1.00 103.28 ? 478 HIS B CB    1 
ATOM   7081  C  CG    . HIS B  1 478 ? 3.316   -45.044  -0.229  1.00 106.19 ? 478 HIS B CG    1 
ATOM   7082  N  ND1   . HIS B  1 478 ? 3.437   -45.210  -1.591  1.00 109.58 ? 478 HIS B ND1   1 
ATOM   7083  C  CD2   . HIS B  1 478 ? 2.020   -44.725  -0.001  1.00 106.54 ? 478 HIS B CD2   1 
ATOM   7084  C  CE1   . HIS B  1 478 ? 2.266   -44.998  -2.163  1.00 112.24 ? 478 HIS B CE1   1 
ATOM   7085  N  NE2   . HIS B  1 478 ? 1.389   -44.700  -1.220  1.00 110.47 ? 478 HIS B NE2   1 
ATOM   7086  N  N     . ASN B  1 479 ? 6.030   -47.959  2.659   1.00 100.88 ? 479 ASN B N     1 
ATOM   7087  C  CA    . ASN B  1 479 ? 7.073   -48.256  3.636   1.00 98.69  ? 479 ASN B CA    1 
ATOM   7088  C  C     . ASN B  1 479 ? 8.470   -48.326  3.030   1.00 99.36  ? 479 ASN B C     1 
ATOM   7089  O  O     . ASN B  1 479 ? 9.458   -48.054  3.709   1.00 97.50  ? 479 ASN B O     1 
ATOM   7090  C  CB    . ASN B  1 479 ? 6.762   -49.576  4.335   1.00 98.90  ? 479 ASN B CB    1 
ATOM   7091  C  CG    . ASN B  1 479 ? 7.518   -49.738  5.630   1.00 96.38  ? 479 ASN B CG    1 
ATOM   7092  O  OD1   . ASN B  1 479 ? 7.388   -48.924  6.545   1.00 93.88  ? 479 ASN B OD1   1 
ATOM   7093  N  ND2   . ASN B  1 479 ? 8.310   -50.799  5.722   1.00 96.98  ? 479 ASN B ND2   1 
ATOM   7094  N  N     . GLU B  1 480 ? 8.539   -48.708  1.758   1.00 102.53 ? 480 GLU B N     1 
ATOM   7095  C  CA    . GLU B  1 480 ? 9.794   -48.743  1.015   1.00 103.92 ? 480 GLU B CA    1 
ATOM   7096  C  C     . GLU B  1 480 ? 10.490  -47.385  1.125   1.00 102.27 ? 480 GLU B C     1 
ATOM   7097  O  O     . GLU B  1 480 ? 11.707  -47.319  1.307   1.00 101.93 ? 480 GLU B O     1 
ATOM   7098  C  CB    . GLU B  1 480 ? 9.553   -49.122  -0.460  1.00 107.50 ? 480 GLU B CB    1 
ATOM   7099  C  CG    . GLU B  1 480 ? 8.941   -50.527  -0.681  1.00 110.22 ? 480 GLU B CG    1 
ATOM   7100  C  CD    . GLU B  1 480 ? 9.273   -51.160  -2.058  1.00 114.87 ? 480 GLU B CD    1 
ATOM   7101  O  OE1   . GLU B  1 480 ? 8.328   -51.510  -2.804  1.00 117.46 ? 480 GLU B OE1   1 
ATOM   7102  O  OE2   . GLU B  1 480 ? 10.472  -51.325  -2.394  1.00 114.96 ? 480 GLU B OE2   1 
ATOM   7103  N  N     . LEU B  1 481 ? 9.696   -46.314  1.067   1.00 101.55 ? 481 LEU B N     1 
ATOM   7104  C  CA    . LEU B  1 481 ? 10.203  -44.937  1.009   1.00 100.35 ? 481 LEU B CA    1 
ATOM   7105  C  C     . LEU B  1 481 ? 10.670  -44.426  2.368   1.00 96.89  ? 481 LEU B C     1 
ATOM   7106  O  O     . LEU B  1 481 ? 11.746  -43.831  2.471   1.00 96.16  ? 481 LEU B O     1 
ATOM   7107  C  CB    . LEU B  1 481 ? 9.150   -43.986  0.415   1.00 101.25 ? 481 LEU B CB    1 
ATOM   7108  C  CG    . LEU B  1 481 ? 8.227   -44.445  -0.739  1.00 105.66 ? 481 LEU B CG    1 
ATOM   7109  C  CD1   . LEU B  1 481 ? 7.376   -43.276  -1.250  1.00 106.96 ? 481 LEU B CD1   1 
ATOM   7110  C  CD2   . LEU B  1 481 ? 8.948   -45.140  -1.927  1.00 109.14 ? 481 LEU B CD2   1 
ATOM   7111  N  N     . LEU B  1 482 ? 9.858   -44.646  3.403   1.00 95.02  ? 482 LEU B N     1 
ATOM   7112  C  CA    . LEU B  1 482 ? 10.254  -44.327  4.775   1.00 91.88  ? 482 LEU B CA    1 
ATOM   7113  C  C     . LEU B  1 482 ? 11.603  -44.975  5.056   1.00 91.60  ? 482 LEU B C     1 
ATOM   7114  O  O     . LEU B  1 482 ? 12.533  -44.310  5.506   1.00 90.39  ? 482 LEU B O     1 
ATOM   7115  C  CB    . LEU B  1 482 ? 9.219   -44.817  5.795   1.00 90.63  ? 482 LEU B CB    1 
ATOM   7116  C  CG    . LEU B  1 482 ? 7.761   -44.359  5.696   1.00 90.93  ? 482 LEU B CG    1 
ATOM   7117  C  CD1   . LEU B  1 482 ? 6.960   -44.856  6.897   1.00 89.17  ? 482 LEU B CD1   1 
ATOM   7118  C  CD2   . LEU B  1 482 ? 7.659   -42.849  5.578   1.00 89.91  ? 482 LEU B CD2   1 
ATOM   7119  N  N     . THR B  1 483 ? 11.705  -46.266  4.747   1.00 93.01  ? 483 THR B N     1 
ATOM   7120  C  CA    . THR B  1 483 ? 12.945  -47.019  4.907   1.00 93.23  ? 483 THR B CA    1 
ATOM   7121  C  C     . THR B  1 483 ? 14.130  -46.319  4.221   1.00 93.89  ? 483 THR B C     1 
ATOM   7122  O  O     . THR B  1 483 ? 15.232  -46.274  4.776   1.00 93.06  ? 483 THR B O     1 
ATOM   7123  C  CB    . THR B  1 483 ? 12.786  -48.476  4.395   1.00 95.58  ? 483 THR B CB    1 
ATOM   7124  O  OG1   . THR B  1 483 ? 11.639  -49.076  5.013   1.00 94.94  ? 483 THR B OG1   1 
ATOM   7125  C  CG2   . THR B  1 483 ? 14.035  -49.315  4.698   1.00 95.56  ? 483 THR B CG2   1 
ATOM   7126  N  N     . GLU B  1 484 ? 13.899  -45.761  3.034   1.00 95.47  ? 484 GLU B N     1 
ATOM   7127  C  CA    . GLU B  1 484 ? 14.963  -45.072  2.302   1.00 96.50  ? 484 GLU B CA    1 
ATOM   7128  C  C     . GLU B  1 484 ? 15.390  -43.772  2.982   1.00 94.23  ? 484 GLU B C     1 
ATOM   7129  O  O     . GLU B  1 484 ? 16.578  -43.432  2.984   1.00 94.17  ? 484 GLU B O     1 
ATOM   7130  C  CB    . GLU B  1 484 ? 14.560  -44.798  0.849   1.00 99.17  ? 484 GLU B CB    1 
ATOM   7131  C  CG    . GLU B  1 484 ? 15.749  -44.796  -0.103  1.00 101.53 ? 484 GLU B CG    1 
ATOM   7132  C  CD    . GLU B  1 484 ? 15.629  -43.753  -1.189  1.00 103.48 ? 484 GLU B CD    1 
ATOM   7133  O  OE1   . GLU B  1 484 ? 16.064  -42.602  -0.970  1.00 102.59 ? 484 GLU B OE1   1 
ATOM   7134  O  OE2   . GLU B  1 484 ? 15.112  -44.086  -2.273  1.00 106.62 ? 484 GLU B OE2   1 
ATOM   7135  N  N     . ILE B  1 485 ? 14.414  -43.054  3.543   1.00 92.59  ? 485 ILE B N     1 
ATOM   7136  C  CA    . ILE B  1 485 ? 14.669  -41.843  4.329   1.00 90.57  ? 485 ILE B CA    1 
ATOM   7137  C  C     . ILE B  1 485 ? 15.518  -42.193  5.550   1.00 88.93  ? 485 ILE B C     1 
ATOM   7138  O  O     . ILE B  1 485 ? 16.526  -41.546  5.810   1.00 88.47  ? 485 ILE B O     1 
ATOM   7139  C  CB    . ILE B  1 485 ? 13.349  -41.148  4.764   1.00 89.27  ? 485 ILE B CB    1 
ATOM   7140  C  CG1   . ILE B  1 485 ? 12.542  -40.700  3.540   1.00 91.31  ? 485 ILE B CG1   1 
ATOM   7141  C  CG2   . ILE B  1 485 ? 13.630  -39.954  5.677   1.00 87.31  ? 485 ILE B CG2   1 
ATOM   7142  C  CD1   . ILE B  1 485 ? 11.102  -40.310  3.845   1.00 90.32  ? 485 ILE B CD1   1 
ATOM   7143  N  N     . ARG B  1 486 ? 15.103  -43.232  6.273   1.00 88.52  ? 486 ARG B N     1 
ATOM   7144  C  CA    . ARG B  1 486 ? 15.816  -43.750  7.442   1.00 87.47  ? 486 ARG B CA    1 
ATOM   7145  C  C     . ARG B  1 486 ? 17.254  -44.191  7.126   1.00 88.93  ? 486 ARG B C     1 
ATOM   7146  O  O     . ARG B  1 486 ? 18.179  -43.852  7.859   1.00 87.92  ? 486 ARG B O     1 
ATOM   7147  C  CB    . ARG B  1 486 ? 15.027  -44.919  8.048   1.00 87.21  ? 486 ARG B CB    1 
ATOM   7148  C  CG    . ARG B  1 486 ? 15.566  -45.464  9.386   1.00 86.44  ? 486 ARG B CG    1 
ATOM   7149  C  CD    . ARG B  1 486 ? 14.999  -46.861  9.742   1.00 87.10  ? 486 ARG B CD    1 
ATOM   7150  N  NE    . ARG B  1 486 ? 13.547  -46.953  9.552   1.00 87.89  ? 486 ARG B NE    1 
ATOM   7151  C  CZ    . ARG B  1 486 ? 12.930  -47.857  8.788   1.00 90.22  ? 486 ARG B CZ    1 
ATOM   7152  N  NH1   . ARG B  1 486 ? 13.624  -48.796  8.145   1.00 91.63  ? 486 ARG B NH1   1 
ATOM   7153  N  NH2   . ARG B  1 486 ? 11.606  -47.837  8.680   1.00 89.98  ? 486 ARG B NH2   1 
ATOM   7154  N  N     . GLU B  1 487 ? 17.439  -44.937  6.037   1.00 91.69  ? 487 GLU B N     1 
ATOM   7155  C  CA    . GLU B  1 487 ? 18.751  -45.545  5.731   1.00 93.66  ? 487 GLU B CA    1 
ATOM   7156  C  C     . GLU B  1 487 ? 19.787  -44.652  5.021   1.00 94.78  ? 487 GLU B C     1 
ATOM   7157  O  O     . GLU B  1 487 ? 20.994  -44.840  5.214   1.00 95.37  ? 487 GLU B O     1 
ATOM   7158  C  CB    . GLU B  1 487 ? 18.595  -46.895  5.015   1.00 95.84  ? 487 GLU B CB    1 
ATOM   7159  C  CG    . GLU B  1 487 ? 18.215  -48.039  5.957   1.00 95.76  ? 487 GLU B CG    1 
ATOM   7160  C  CD    . GLU B  1 487 ? 18.323  -49.422  5.319   1.00 99.49  ? 487 GLU B CD    1 
ATOM   7161  O  OE1   . GLU B  1 487 ? 17.742  -49.652  4.227   1.00 101.36 ? 487 GLU B OE1   1 
ATOM   7162  O  OE2   . GLU B  1 487 ? 18.982  -50.290  5.933   1.00 100.16 ? 487 GLU B OE2   1 
ATOM   7163  N  N     . LYS B  1 488 ? 19.334  -43.691  4.217   1.00 95.30  ? 488 LYS B N     1 
ATOM   7164  C  CA    . LYS B  1 488 ? 20.268  -42.751  3.588   1.00 96.57  ? 488 LYS B CA    1 
ATOM   7165  C  C     . LYS B  1 488 ? 20.216  -41.338  4.163   1.00 94.88  ? 488 LYS B C     1 
ATOM   7166  O  O     . LYS B  1 488 ? 21.196  -40.597  4.072   1.00 95.57  ? 488 LYS B O     1 
ATOM   7167  C  CB    . LYS B  1 488 ? 20.128  -42.748  2.066   1.00 99.25  ? 488 LYS B CB    1 
ATOM   7168  C  CG    . LYS B  1 488 ? 20.681  -44.015  1.434   1.00 101.75 ? 488 LYS B CG    1 
ATOM   7169  C  CD    . LYS B  1 488 ? 21.058  -43.818  -0.025  1.00 105.29 ? 488 LYS B CD    1 
ATOM   7170  C  CE    . LYS B  1 488 ? 21.475  -45.135  -0.667  1.00 107.55 ? 488 LYS B CE    1 
ATOM   7171  N  NZ    . LYS B  1 488 ? 20.332  -46.080  -0.742  1.00 107.55 ? 488 LYS B NZ    1 
ATOM   7172  N  N     . GLY B  1 489 ? 19.082  -40.976  4.759   1.00 93.15  ? 489 GLY B N     1 
ATOM   7173  C  CA    . GLY B  1 489 ? 18.948  -39.703  5.480   1.00 91.45  ? 489 GLY B CA    1 
ATOM   7174  C  C     . GLY B  1 489 ? 18.823  -38.494  4.571   1.00 92.63  ? 489 GLY B C     1 
ATOM   7175  O  O     . GLY B  1 489 ? 18.792  -37.358  5.049   1.00 91.63  ? 489 GLY B O     1 
ATOM   7176  N  N     . GLU B  1 490 ? 18.745  -38.751  3.264   1.00 94.84  ? 490 GLU B N     1 
ATOM   7177  C  CA    . GLU B  1 490 ? 18.661  -37.709  2.237   1.00 96.37  ? 490 GLU B CA    1 
ATOM   7178  C  C     . GLU B  1 490 ? 17.375  -37.838  1.419   1.00 97.22  ? 490 GLU B C     1 
ATOM   7179  O  O     . GLU B  1 490 ? 16.633  -38.812  1.559   1.00 96.89  ? 490 GLU B O     1 
ATOM   7180  C  CB    . GLU B  1 490 ? 19.872  -37.795  1.303   1.00 98.90  ? 490 GLU B CB    1 
ATOM   7181  C  CG    . GLU B  1 490 ? 21.221  -37.597  1.997   1.00 98.86  ? 490 GLU B CG    1 
ATOM   7182  C  CD    . GLU B  1 490 ? 22.405  -37.688  1.042   1.00 101.71 ? 490 GLU B CD    1 
ATOM   7183  O  OE1   . GLU B  1 490 ? 22.194  -37.962  -0.162  1.00 103.90 ? 490 GLU B OE1   1 
ATOM   7184  O  OE2   . GLU B  1 490 ? 23.552  -37.484  1.499   1.00 101.67 ? 490 GLU B OE2   1 
ATOM   7185  N  N     . LEU B  1 491 ? 17.099  -36.843  0.583   1.00 98.55  ? 491 LEU B N     1 
ATOM   7186  C  CA    . LEU B  1 491 ? 16.009  -36.959  -0.379  1.00 100.20 ? 491 LEU B CA    1 
ATOM   7187  C  C     . LEU B  1 491 ? 16.536  -36.800  -1.794  1.00 103.38 ? 491 LEU B C     1 
ATOM   7188  O  O     . LEU B  1 491 ? 16.773  -35.683  -2.264  1.00 104.29 ? 491 LEU B O     1 
ATOM   7189  C  CB    . LEU B  1 491 ? 14.875  -35.965  -0.102  1.00 99.22  ? 491 LEU B CB    1 
ATOM   7190  C  CG    . LEU B  1 491 ? 14.133  -36.013  1.236   1.00 96.40  ? 491 LEU B CG    1 
ATOM   7191  C  CD1   . LEU B  1 491 ? 13.049  -34.953  1.275   1.00 96.17  ? 491 LEU B CD1   1 
ATOM   7192  C  CD2   . LEU B  1 491 ? 13.532  -37.380  1.502   1.00 96.44  ? 491 LEU B CD2   1 
ATOM   7193  N  N     . SER B  1 492 ? 16.741  -37.937  -2.453  1.00 105.24 ? 492 SER B N     1 
ATOM   7194  C  CA    . SER B  1 492 ? 17.077  -37.955  -3.869  1.00 108.83 ? 492 SER B CA    1 
ATOM   7195  C  C     . SER B  1 492 ? 15.885  -37.414  -4.644  1.00 110.16 ? 492 SER B C     1 
ATOM   7196  O  O     . SER B  1 492 ? 14.736  -37.566  -4.214  1.00 108.97 ? 492 SER B O     1 
ATOM   7197  C  CB    . SER B  1 492 ? 17.420  -39.374  -4.327  1.00 110.46 ? 492 SER B CB    1 
ATOM   7198  O  OG    . SER B  1 492 ? 16.437  -40.301  -3.896  1.00 109.73 ? 492 SER B OG    1 
ATOM   7199  N  N     . LYS B  1 493 ? 16.163  -36.767  -5.771  1.00 112.84 ? 493 LYS B N     1 
ATOM   7200  C  CA    . LYS B  1 493 ? 15.117  -36.172  -6.610  1.00 114.63 ? 493 LYS B CA    1 
ATOM   7201  C  C     . LYS B  1 493 ? 13.959  -37.154  -6.816  1.00 114.98 ? 493 LYS B C     1 
ATOM   7202  O  O     . LYS B  1 493 ? 12.784  -36.776  -6.725  1.00 114.33 ? 493 LYS B O     1 
ATOM   7203  C  CB    . LYS B  1 493 ? 15.703  -35.696  -7.948  1.00 118.32 ? 493 LYS B CB    1 
ATOM   7204  C  CG    . LYS B  1 493 ? 17.120  -35.125  -7.818  1.00 118.79 ? 493 LYS B CG    1 
ATOM   7205  C  CD    . LYS B  1 493 ? 17.269  -33.764  -8.486  1.00 121.63 ? 493 LYS B CD    1 
ATOM   7206  C  CE    . LYS B  1 493 ? 18.299  -32.909  -7.741  1.00 120.33 ? 493 LYS B CE    1 
ATOM   7207  N  NZ    . LYS B  1 493 ? 18.293  -31.480  -8.171  1.00 121.51 ? 493 LYS B NZ    1 
ATOM   7208  N  N     . GLU B  1 494 ? 14.315  -38.418  -7.050  1.00 115.93 ? 494 GLU B N     1 
ATOM   7209  C  CA    . GLU B  1 494 ? 13.355  -39.511  -7.201  1.00 116.69 ? 494 GLU B CA    1 
ATOM   7210  C  C     . GLU B  1 494 ? 12.491  -39.753  -5.951  1.00 113.25 ? 494 GLU B C     1 
ATOM   7211  O  O     . GLU B  1 494 ? 11.270  -39.860  -6.057  1.00 113.67 ? 494 GLU B O     1 
ATOM   7212  C  CB    . GLU B  1 494 ? 14.062  -40.795  -7.678  1.00 118.67 ? 494 GLU B CB    1 
ATOM   7213  C  CG    . GLU B  1 494 ? 13.751  -42.047  -6.847  1.00 117.73 ? 494 GLU B CG    1 
ATOM   7214  C  CD    . GLU B  1 494 ? 13.768  -43.343  -7.647  1.00 121.33 ? 494 GLU B CD    1 
ATOM   7215  O  OE1   . GLU B  1 494 ? 13.516  -44.405  -7.029  1.00 120.42 ? 494 GLU B OE1   1 
ATOM   7216  O  OE2   . GLU B  1 494 ? 14.025  -43.311  -8.873  1.00 125.05 ? 494 GLU B OE2   1 
ATOM   7217  N  N     . LEU B  1 495 ? 13.113  -39.831  -4.776  1.00 110.13 ? 495 LEU B N     1 
ATOM   7218  C  CA    . LEU B  1 495 ? 12.357  -40.039  -3.534  1.00 106.93 ? 495 LEU B CA    1 
ATOM   7219  C  C     . LEU B  1 495 ? 11.515  -38.810  -3.205  1.00 105.62 ? 495 LEU B C     1 
ATOM   7220  O  O     . LEU B  1 495 ? 10.409  -38.920  -2.668  1.00 104.42 ? 495 LEU B O     1 
ATOM   7221  C  CB    . LEU B  1 495 ? 13.285  -40.379  -2.365  1.00 104.22 ? 495 LEU B CB    1 
ATOM   7222  C  CG    . LEU B  1 495 ? 12.600  -40.832  -1.071  1.00 101.45 ? 495 LEU B CG    1 
ATOM   7223  C  CD1   . LEU B  1 495 ? 12.108  -42.278  -1.148  1.00 102.11 ? 495 LEU B CD1   1 
ATOM   7224  C  CD2   . LEU B  1 495 ? 13.558  -40.668  0.087   1.00 99.63  ? 495 LEU B CD2   1 
ATOM   7225  N  N     . LEU B  1 496 ? 12.058  -37.643  -3.539  1.00 105.93 ? 496 LEU B N     1 
ATOM   7226  C  CA    . LEU B  1 496 ? 11.355  -36.382  -3.392  1.00 105.24 ? 496 LEU B CA    1 
ATOM   7227  C  C     . LEU B  1 496 ? 10.084  -36.416  -4.254  1.00 107.44 ? 496 LEU B C     1 
ATOM   7228  O  O     . LEU B  1 496 ? 8.984   -36.125  -3.770  1.00 106.27 ? 496 LEU B O     1 
ATOM   7229  C  CB    . LEU B  1 496 ? 12.296  -35.228  -3.777  1.00 105.99 ? 496 LEU B CB    1 
ATOM   7230  C  CG    . LEU B  1 496 ? 11.988  -33.764  -3.438  1.00 105.16 ? 496 LEU B CG    1 
ATOM   7231  C  CD1   . LEU B  1 496 ? 11.546  -33.606  -1.993  1.00 102.20 ? 496 LEU B CD1   1 
ATOM   7232  C  CD2   . LEU B  1 496 ? 13.199  -32.875  -3.740  1.00 105.51 ? 496 LEU B CD2   1 
ATOM   7233  N  N     . ALA B  1 497 ? 10.240  -36.818  -5.515  1.00 110.55 ? 497 ALA B N     1 
ATOM   7234  C  CA    . ALA B  1 497 ? 9.110   -36.916  -6.443  1.00 113.35 ? 497 ALA B CA    1 
ATOM   7235  C  C     . ALA B  1 497 ? 8.116   -38.022  -6.064  1.00 112.96 ? 497 ALA B C     1 
ATOM   7236  O  O     . ALA B  1 497 ? 6.898   -37.850  -6.195  1.00 113.67 ? 497 ALA B O     1 
ATOM   7237  C  CB    . ALA B  1 497 ? 9.605   -37.103  -7.873  1.00 117.11 ? 497 ALA B CB    1 
ATOM   7238  N  N     . SER B  1 498 ? 8.641   -39.152  -5.592  1.00 111.87 ? 498 SER B N     1 
ATOM   7239  C  CA    . SER B  1 498 ? 7.804   -40.268  -5.155  1.00 111.57 ? 498 SER B CA    1 
ATOM   7240  C  C     . SER B  1 498 ? 6.982   -39.889  -3.925  1.00 108.65 ? 498 SER B C     1 
ATOM   7241  O  O     . SER B  1 498 ? 5.836   -40.319  -3.778  1.00 109.17 ? 498 SER B O     1 
ATOM   7242  C  CB    . SER B  1 498 ? 8.660   -41.500  -4.855  1.00 111.16 ? 498 SER B CB    1 
ATOM   7243  O  OG    . SER B  1 498 ? 7.848   -42.620  -4.537  1.00 111.81 ? 498 SER B OG    1 
ATOM   7244  N  N     . LEU B  1 499 ? 7.582   -39.081  -3.050  1.00 105.76 ? 499 LEU B N     1 
ATOM   7245  C  CA    . LEU B  1 499 ? 6.929   -38.589  -1.841  1.00 102.76 ? 499 LEU B CA    1 
ATOM   7246  C  C     . LEU B  1 499 ? 5.783   -37.630  -2.163  1.00 103.94 ? 499 LEU B C     1 
ATOM   7247  O  O     . LEU B  1 499 ? 4.748   -37.640  -1.488  1.00 103.00 ? 499 LEU B O     1 
ATOM   7248  C  CB    . LEU B  1 499 ? 7.955   -37.901  -0.942  1.00 99.96  ? 499 LEU B CB    1 
ATOM   7249  C  CG    . LEU B  1 499 ? 7.561   -37.509  0.480   1.00 95.85  ? 499 LEU B CG    1 
ATOM   7250  C  CD1   . LEU B  1 499 ? 7.199   -38.737  1.305   1.00 93.93  ? 499 LEU B CD1   1 
ATOM   7251  C  CD2   . LEU B  1 499 ? 8.709   -36.754  1.107   1.00 92.87  ? 499 LEU B CD2   1 
ATOM   7252  N  N     . LYS B  1 500 ? 5.983   -36.804  -3.192  1.00 106.07 ? 500 LYS B N     1 
ATOM   7253  C  CA    . LYS B  1 500 ? 4.933   -35.938  -3.720  1.00 107.76 ? 500 LYS B CA    1 
ATOM   7254  C  C     . LYS B  1 500 ? 3.722   -36.771  -4.138  1.00 109.85 ? 500 LYS B C     1 
ATOM   7255  O  O     . LYS B  1 500 ? 2.581   -36.396  -3.846  1.00 109.97 ? 500 LYS B O     1 
ATOM   7256  C  CB    . LYS B  1 500 ? 5.462   -35.127  -4.904  1.00 110.19 ? 500 LYS B CB    1 
ATOM   7257  C  CG    . LYS B  1 500 ? 4.599   -33.928  -5.300  1.00 111.75 ? 500 LYS B CG    1 
ATOM   7258  C  CD    . LYS B  1 500 ? 5.395   -32.957  -6.177  1.00 113.46 ? 500 LYS B CD    1 
ATOM   7259  C  CE    . LYS B  1 500 ? 4.518   -31.874  -6.798  1.00 115.39 ? 500 LYS B CE    1 
ATOM   7260  N  NZ    . LYS B  1 500 ? 3.751   -32.363  -7.978  1.00 117.90 ? 500 LYS B NZ    1 
ATOM   7261  N  N     . SER B  1 501 ? 3.992   -37.904  -4.798  1.00 111.60 ? 501 SER B N     1 
ATOM   7262  C  CA    . SER B  1 501 ? 2.961   -38.837  -5.271  1.00 114.06 ? 501 SER B CA    1 
ATOM   7263  C  C     . SER B  1 501 ? 2.022   -39.312  -4.166  1.00 112.24 ? 501 SER B C     1 
ATOM   7264  O  O     . SER B  1 501 ? 0.805   -39.141  -4.263  1.00 113.58 ? 501 SER B O     1 
ATOM   7265  C  CB    . SER B  1 501 ? 3.605   -40.065  -5.922  1.00 115.82 ? 501 SER B CB    1 
ATOM   7266  O  OG    . SER B  1 501 ? 4.440   -39.701  -7.007  1.00 118.66 ? 501 SER B OG    1 
ATOM   7267  N  N     . ALA B  1 502 ? 2.602   -39.905  -3.122  1.00 109.40 ? 502 ALA B N     1 
ATOM   7268  C  CA    . ALA B  1 502 ? 1.841   -40.571  -2.063  1.00 107.73 ? 502 ALA B CA    1 
ATOM   7269  C  C     . ALA B  1 502 ? 1.069   -39.571  -1.221  1.00 106.04 ? 502 ALA B C     1 
ATOM   7270  O  O     . ALA B  1 502 ? -0.005  -39.890  -0.697  1.00 106.09 ? 502 ALA B O     1 
ATOM   7271  C  CB    . ALA B  1 502 ? 2.765   -41.407  -1.190  1.00 105.26 ? 502 ALA B CB    1 
ATOM   7272  N  N     . THR B  1 503 ? 1.631   -38.364  -1.113  1.00 104.70 ? 503 THR B N     1 
ATOM   7273  C  CA    . THR B  1 503 ? 1.033   -37.252  -0.374  1.00 103.10 ? 503 THR B CA    1 
ATOM   7274  C  C     . THR B  1 503 ? -0.297  -36.821  -1.001  1.00 105.78 ? 503 THR B C     1 
ATOM   7275  O  O     . THR B  1 503 ? -1.335  -36.800  -0.330  1.00 105.30 ? 503 THR B O     1 
ATOM   7276  C  CB    . THR B  1 503 ? 1.997   -36.029  -0.302  1.00 101.81 ? 503 THR B CB    1 
ATOM   7277  O  OG1   . THR B  1 503 ? 3.301   -36.451  0.126   1.00 99.32  ? 503 THR B OG1   1 
ATOM   7278  C  CG2   . THR B  1 503 ? 1.465   -34.971  0.652   1.00 99.58  ? 503 THR B CG2   1 
ATOM   7279  N  N     . GLU B  1 504 ? -0.256  -36.492  -2.290  1.00 108.57 ? 504 GLU B N     1 
ATOM   7280  C  CA    . GLU B  1 504 ? -1.439  -36.037  -3.006  1.00 111.61 ? 504 GLU B CA    1 
ATOM   7281  C  C     . GLU B  1 504 ? -2.598  -37.026  -2.900  1.00 112.93 ? 504 GLU B C     1 
ATOM   7282  O  O     . GLU B  1 504 ? -3.754  -36.619  -2.734  1.00 113.89 ? 504 GLU B O     1 
ATOM   7283  C  CB    . GLU B  1 504 ? -1.093  -35.742  -4.467  1.00 114.81 ? 504 GLU B CB    1 
ATOM   7284  C  CG    . GLU B  1 504 ? -0.797  -34.268  -4.743  1.00 115.77 ? 504 GLU B CG    1 
ATOM   7285  C  CD    . GLU B  1 504 ? 0.536   -34.041  -5.438  1.00 117.05 ? 504 GLU B CD    1 
ATOM   7286  O  OE1   . GLU B  1 504 ? 1.069   -34.991  -6.050  1.00 119.09 ? 504 GLU B OE1   1 
ATOM   7287  O  OE2   . GLU B  1 504 ? 1.056   -32.907  -5.369  1.00 116.33 ? 504 GLU B OE2   1 
ATOM   7288  N  N     . SER B  1 505 ? -2.272  -38.319  -2.970  1.00 113.06 ? 505 SER B N     1 
ATOM   7289  C  CA    . SER B  1 505 ? -3.264  -39.398  -2.952  1.00 114.70 ? 505 SER B CA    1 
ATOM   7290  C  C     . SER B  1 505 ? -4.100  -39.389  -1.679  1.00 112.81 ? 505 SER B C     1 
ATOM   7291  O  O     . SER B  1 505 ? -5.332  -39.331  -1.735  1.00 114.60 ? 505 SER B O     1 
ATOM   7292  C  CB    . SER B  1 505 ? -2.581  -40.763  -3.122  1.00 114.95 ? 505 SER B CB    1 
ATOM   7293  O  OG    . SER B  1 505 ? -3.441  -41.835  -2.749  1.00 115.44 ? 505 SER B OG    1 
ATOM   7294  N  N     . PHE B  1 506 ? -3.415  -39.443  -0.540  1.00 109.21 ? 506 PHE B N     1 
ATOM   7295  C  CA    . PHE B  1 506 ? -4.072  -39.508  0.757   1.00 107.34 ? 506 PHE B CA    1 
ATOM   7296  C  C     . PHE B  1 506 ? -4.955  -38.287  1.009   1.00 107.63 ? 506 PHE B C     1 
ATOM   7297  O  O     . PHE B  1 506 ? -6.115  -38.434  1.405   1.00 108.60 ? 506 PHE B O     1 
ATOM   7298  C  CB    . PHE B  1 506 ? -3.035  -39.672  1.876   1.00 103.74 ? 506 PHE B CB    1 
ATOM   7299  C  CG    . PHE B  1 506 ? -3.634  -39.792  3.249   1.00 101.53 ? 506 PHE B CG    1 
ATOM   7300  C  CD1   . PHE B  1 506 ? -4.178  -40.998  3.683   1.00 101.98 ? 506 PHE B CD1   1 
ATOM   7301  C  CD2   . PHE B  1 506 ? -3.658  -38.698  4.107   1.00 99.31  ? 506 PHE B CD2   1 
ATOM   7302  C  CE1   . PHE B  1 506 ? -4.735  -41.110  4.959   1.00 100.76 ? 506 PHE B CE1   1 
ATOM   7303  C  CE2   . PHE B  1 506 ? -4.215  -38.799  5.385   1.00 97.92  ? 506 PHE B CE2   1 
ATOM   7304  C  CZ    . PHE B  1 506 ? -4.751  -40.006  5.813   1.00 98.24  ? 506 PHE B CZ    1 
ATOM   7305  N  N     . VAL B  1 507 ? -4.402  -37.096  0.766   1.00 106.96 ? 507 VAL B N     1 
ATOM   7306  C  CA    . VAL B  1 507 ? -5.107  -35.825  0.983   1.00 107.28 ? 507 VAL B CA    1 
ATOM   7307  C  C     . VAL B  1 507 ? -6.466  -35.792  0.286   1.00 110.88 ? 507 VAL B C     1 
ATOM   7308  O  O     . VAL B  1 507 ? -7.457  -35.336  0.869   1.00 111.24 ? 507 VAL B O     1 
ATOM   7309  C  CB    . VAL B  1 507 ? -4.255  -34.605  0.526   1.00 106.92 ? 507 VAL B CB    1 
ATOM   7310  C  CG1   . VAL B  1 507 ? -5.064  -33.303  0.582   1.00 107.42 ? 507 VAL B CG1   1 
ATOM   7311  C  CG2   . VAL B  1 507 ? -3.009  -34.484  1.380   1.00 103.62 ? 507 VAL B CG2   1 
ATOM   7312  N  N     . ALA B  1 508 ? -6.501  -36.295  -0.949  1.00 113.69 ? 508 ALA B N     1 
ATOM   7313  C  CA    . ALA B  1 508 ? -7.707  -36.298  -1.772  1.00 117.54 ? 508 ALA B CA    1 
ATOM   7314  C  C     . ALA B  1 508 ? -8.871  -37.068  -1.147  1.00 118.28 ? 508 ALA B C     1 
ATOM   7315  O  O     . ALA B  1 508 ? -10.020 -36.887  -1.545  1.00 121.41 ? 508 ALA B O     1 
ATOM   7316  C  CB    . ALA B  1 508 ? -7.392  -36.843  -3.156  1.00 120.43 ? 508 ALA B CB    1 
ATOM   7317  N  N     . THR B  1 509 ? -8.573  -37.912  -0.164  1.00 115.74 ? 509 THR B N     1 
ATOM   7318  C  CA    . THR B  1 509 ? -9.586  -38.765  0.464   1.00 116.52 ? 509 THR B CA    1 
ATOM   7319  C  C     . THR B  1 509 ? -9.623  -38.712  1.998   1.00 113.38 ? 509 THR B C     1 
ATOM   7320  O  O     . THR B  1 509 ? -8.869  -37.976  2.643   1.00 110.54 ? 509 THR B O     1 
ATOM   7321  C  CB    . THR B  1 509 ? -9.459  -40.241  0.003   1.00 118.03 ? 509 THR B CB    1 
ATOM   7322  O  OG1   . THR B  1 509 ? -9.988  -41.102  1.017   1.00 117.30 ? 509 THR B OG1   1 
ATOM   7323  C  CG2   . THR B  1 509 ? -8.003  -40.626  -0.258  1.00 116.16 ? 509 THR B CG2   1 
ATOM   7324  N  N     . ASN C  1 26  ? 62.937  6.739    66.392  1.00 92.18  ? 26  ASN C N     1 
ATOM   7325  C  CA    . ASN C  1 26  ? 62.231  8.028    66.665  1.00 90.54  ? 26  ASN C CA    1 
ATOM   7326  C  C     . ASN C  1 26  ? 61.046  8.214    65.722  1.00 85.37  ? 26  ASN C C     1 
ATOM   7327  O  O     . ASN C  1 26  ? 61.142  8.903    64.710  1.00 84.09  ? 26  ASN C O     1 
ATOM   7328  C  CB    . ASN C  1 26  ? 63.215  9.202    66.557  1.00 93.33  ? 26  ASN C CB    1 
ATOM   7329  C  CG    . ASN C  1 26  ? 62.584  10.548   66.908  1.00 93.21  ? 26  ASN C CG    1 
ATOM   7330  O  OD1   . ASN C  1 26  ? 61.380  10.633   67.205  1.00 90.60  ? 26  ASN C OD1   1 
ATOM   7331  N  ND2   . ASN C  1 26  ? 63.397  11.612   66.866  1.00 95.20  ? 26  ASN C ND2   1 
ATOM   7332  N  N     . LEU C  1 27  ? 59.922  7.608    66.079  1.00 82.97  ? 27  LEU C N     1 
ATOM   7333  C  CA    . LEU C  1 27  ? 58.762  7.477    65.175  1.00 78.72  ? 27  LEU C CA    1 
ATOM   7334  C  C     . LEU C  1 27  ? 57.903  8.750    64.984  1.00 76.68  ? 27  LEU C C     1 
ATOM   7335  O  O     . LEU C  1 27  ? 56.753  8.660    64.571  1.00 74.03  ? 27  LEU C O     1 
ATOM   7336  C  CB    . LEU C  1 27  ? 57.880  6.316    65.656  1.00 77.52  ? 27  LEU C CB    1 
ATOM   7337  C  CG    . LEU C  1 27  ? 58.586  4.987    65.961  1.00 79.82  ? 27  LEU C CG    1 
ATOM   7338  C  CD1   . LEU C  1 27  ? 58.266  4.438    67.373  1.00 81.31  ? 27  LEU C CD1   1 
ATOM   7339  C  CD2   . LEU C  1 27  ? 58.289  3.972    64.869  1.00 76.57  ? 27  LEU C CD2   1 
ATOM   7340  N  N     . ASN C  1 28  ? 58.456  9.928    65.268  1.00 78.52  ? 28  ASN C N     1 
ATOM   7341  C  CA    . ASN C  1 28  ? 57.686  11.176   65.185  1.00 77.11  ? 28  ASN C CA    1 
ATOM   7342  C  C     . ASN C  1 28  ? 57.615  11.796   63.786  1.00 75.41  ? 28  ASN C C     1 
ATOM   7343  O  O     . ASN C  1 28  ? 56.639  12.475   63.459  1.00 73.69  ? 28  ASN C O     1 
ATOM   7344  C  CB    . ASN C  1 28  ? 58.192  12.214   66.202  1.00 80.15  ? 28  ASN C CB    1 
ATOM   7345  C  CG    . ASN C  1 28  ? 57.932  11.809   67.655  1.00 81.37  ? 28  ASN C CG    1 
ATOM   7346  O  OD1   . ASN C  1 28  ? 57.006  11.064   67.958  1.00 79.53  ? 28  ASN C OD1   1 
ATOM   7347  N  ND2   . ASN C  1 28  ? 58.759  12.314   68.560  1.00 85.22  ? 28  ASN C ND2   1 
ATOM   7348  N  N     . GLU C  1 29  ? 58.640  11.575   62.965  1.00 76.24  ? 29  GLU C N     1 
ATOM   7349  C  CA    . GLU C  1 29  ? 58.662  12.145   61.609  1.00 75.43  ? 29  GLU C CA    1 
ATOM   7350  C  C     . GLU C  1 29  ? 58.645  11.079   60.534  1.00 74.07  ? 29  GLU C C     1 
ATOM   7351  O  O     . GLU C  1 29  ? 58.498  11.372   59.352  1.00 73.34  ? 29  GLU C O     1 
ATOM   7352  C  CB    . GLU C  1 29  ? 59.879  13.042   61.401  1.00 78.20  ? 29  GLU C CB    1 
ATOM   7353  C  CG    . GLU C  1 29  ? 60.172  13.973   62.549  1.00 80.81  ? 29  GLU C CG    1 
ATOM   7354  C  CD    . GLU C  1 29  ? 59.159  15.082   62.668  1.00 79.84  ? 29  GLU C CD    1 
ATOM   7355  O  OE1   . GLU C  1 29  ? 58.907  15.784   61.661  1.00 78.63  ? 29  GLU C OE1   1 
ATOM   7356  O  OE2   . GLU C  1 29  ? 58.610  15.249   63.777  1.00 81.47  ? 29  GLU C OE2   1 
ATOM   7357  N  N     . THR C  1 30  ? 58.796  9.836    60.956  1.00 74.56  ? 30  THR C N     1 
ATOM   7358  C  CA    . THR C  1 30  ? 58.888  8.713    60.043  1.00 73.88  ? 30  THR C CA    1 
ATOM   7359  C  C     . THR C  1 30  ? 57.948  7.639    60.512  1.00 72.17  ? 30  THR C C     1 
ATOM   7360  O  O     . THR C  1 30  ? 57.522  7.644    61.668  1.00 72.71  ? 30  THR C O     1 
ATOM   7361  C  CB    . THR C  1 30  ? 60.273  8.103    60.104  1.00 77.06  ? 30  THR C CB    1 
ATOM   7362  O  OG1   . THR C  1 30  ? 60.666  8.031    61.480  1.00 79.64  ? 30  THR C OG1   1 
ATOM   7363  C  CG2   . THR C  1 30  ? 61.278  8.946    59.318  1.00 78.43  ? 30  THR C CG2   1 
ATOM   7364  N  N     . GLY C  1 31  ? 57.639  6.708    59.622  1.00 70.77  ? 31  GLY C N     1 
ATOM   7365  C  CA    . GLY C  1 31  ? 56.830  5.557    59.988  1.00 69.28  ? 31  GLY C CA    1 
ATOM   7366  C  C     . GLY C  1 31  ? 57.207  4.346    59.173  1.00 69.36  ? 31  GLY C C     1 
ATOM   7367  O  O     . GLY C  1 31  ? 57.924  4.468    58.183  1.00 70.53  ? 31  GLY C O     1 
ATOM   7368  N  N     . ARG C  1 32  ? 56.731  3.178    59.596  1.00 68.84  ? 32  ARG C N     1 
ATOM   7369  C  CA    . ARG C  1 32  ? 56.929  1.940    58.851  1.00 69.26  ? 32  ARG C CA    1 
ATOM   7370  C  C     . ARG C  1 32  ? 55.617  1.336    58.359  1.00 66.56  ? 32  ARG C C     1 
ATOM   7371  O  O     . ARG C  1 32  ? 54.655  1.177    59.127  1.00 65.45  ? 32  ARG C O     1 
ATOM   7372  C  CB    . ARG C  1 32  ? 57.700  0.920    59.685  1.00 72.38  ? 32  ARG C CB    1 
ATOM   7373  C  CG    . ARG C  1 32  ? 59.202  1.156    59.678  1.00 76.90  ? 32  ARG C CG    1 
ATOM   7374  C  CD    . ARG C  1 32  ? 59.920  0.265    60.677  1.00 82.80  ? 32  ARG C CD    1 
ATOM   7375  N  NE    . ARG C  1 32  ? 59.615  0.653    62.054  1.00 85.37  ? 32  ARG C NE    1 
ATOM   7376  C  CZ    . ARG C  1 32  ? 60.209  0.140    63.130  1.00 89.98  ? 32  ARG C CZ    1 
ATOM   7377  N  NH1   . ARG C  1 32  ? 61.151  -0.794   63.005  1.00 92.90  ? 32  ARG C NH1   1 
ATOM   7378  N  NH2   . ARG C  1 32  ? 59.858  0.567    64.339  1.00 90.91  ? 32  ARG C NH2   1 
ATOM   7379  N  N     . VAL C  1 33  ? 55.597  1.001    57.068  1.00 65.58  ? 33  VAL C N     1 
ATOM   7380  C  CA    . VAL C  1 33  ? 54.443  0.372    56.423  1.00 62.76  ? 33  VAL C CA    1 
ATOM   7381  C  C     . VAL C  1 33  ? 54.105  -0.935   57.133  1.00 63.08  ? 33  VAL C C     1 
ATOM   7382  O  O     . VAL C  1 33  ? 54.932  -1.853   57.187  1.00 64.97  ? 33  VAL C O     1 
ATOM   7383  C  CB    . VAL C  1 33  ? 54.709  0.139    54.912  1.00 62.89  ? 33  VAL C CB    1 
ATOM   7384  C  CG1   . VAL C  1 33  ? 53.646  -0.734   54.286  1.00 60.81  ? 33  VAL C CG1   1 
ATOM   7385  C  CG2   . VAL C  1 33  ? 54.775  1.465    54.190  1.00 62.06  ? 33  VAL C CG2   1 
ATOM   7386  N  N     . LEU C  1 34  ? 52.896  -0.986   57.695  1.00 61.18  ? 34  LEU C N     1 
ATOM   7387  C  CA    . LEU C  1 34  ? 52.385  -2.164   58.403  1.00 61.47  ? 34  LEU C CA    1 
ATOM   7388  C  C     . LEU C  1 34  ? 51.745  -3.179   57.459  1.00 60.79  ? 34  LEU C C     1 
ATOM   7389  O  O     . LEU C  1 34  ? 51.819  -4.385   57.691  1.00 62.26  ? 34  LEU C O     1 
ATOM   7390  C  CB    . LEU C  1 34  ? 51.368  -1.754   59.473  1.00 60.49  ? 34  LEU C CB    1 
ATOM   7391  C  CG    . LEU C  1 34  ? 51.821  -1.439   60.894  1.00 62.12  ? 34  LEU C CG    1 
ATOM   7392  C  CD1   . LEU C  1 34  ? 50.626  -1.016   61.739  1.00 62.34  ? 34  LEU C CD1   1 
ATOM   7393  C  CD2   . LEU C  1 34  ? 52.475  -2.654   61.508  1.00 64.92  ? 34  LEU C CD2   1 
ATOM   7394  N  N     . ALA C  1 35  ? 51.109  -2.673   56.407  1.00 58.92  ? 35  ALA C N     1 
ATOM   7395  C  CA    . ALA C  1 35  ? 50.413  -3.487   55.410  1.00 58.50  ? 35  ALA C CA    1 
ATOM   7396  C  C     . ALA C  1 35  ? 50.106  -2.600   54.221  1.00 57.15  ? 35  ALA C C     1 
ATOM   7397  O  O     . ALA C  1 35  ? 49.969  -1.396   54.377  1.00 56.23  ? 35  ALA C O     1 
ATOM   7398  C  CB    . ALA C  1 35  ? 49.147  -4.049   55.984  1.00 57.66  ? 35  ALA C CB    1 
ATOM   7399  N  N     . VAL C  1 36  ? 50.010  -3.175   53.031  1.00 57.90  ? 36  VAL C N     1 
ATOM   7400  C  CA    . VAL C  1 36  ? 49.760  -2.360   51.835  1.00 57.70  ? 36  VAL C CA    1 
ATOM   7401  C  C     . VAL C  1 36  ? 49.078  -3.091   50.656  1.00 58.66  ? 36  VAL C C     1 
ATOM   7402  O  O     . VAL C  1 36  ? 49.371  -4.256   50.363  1.00 59.90  ? 36  VAL C O     1 
ATOM   7403  C  CB    . VAL C  1 36  ? 51.048  -1.663   51.364  1.00 58.04  ? 36  VAL C CB    1 
ATOM   7404  C  CG1   . VAL C  1 36  ? 52.102  -2.695   51.041  1.00 61.65  ? 36  VAL C CG1   1 
ATOM   7405  C  CG2   . VAL C  1 36  ? 50.785  -0.750   50.168  1.00 57.21  ? 36  VAL C CG2   1 
ATOM   7406  N  N     . GLY C  1 37  ? 48.173  -2.378   49.992  1.00 58.22  ? 37  GLY C N     1 
ATOM   7407  C  CA    . GLY C  1 37  ? 47.511  -2.885   48.809  1.00 59.90  ? 37  GLY C CA    1 
ATOM   7408  C  C     . GLY C  1 37  ? 46.371  -1.993   48.377  1.00 59.92  ? 37  GLY C C     1 
ATOM   7409  O  O     . GLY C  1 37  ? 45.811  -1.239   49.191  1.00 59.02  ? 37  GLY C O     1 
ATOM   7410  N  N     . ASP C  1 38  ? 46.029  -2.084   47.091  1.00 61.47  ? 38  ASP C N     1 
ATOM   7411  C  CA    . ASP C  1 38  ? 44.911  -1.336   46.513  1.00 61.85  ? 38  ASP C CA    1 
ATOM   7412  C  C     . ASP C  1 38  ? 45.134  0.181    46.550  1.00 61.16  ? 38  ASP C C     1 
ATOM   7413  O  O     . ASP C  1 38  ? 44.176  0.935    46.653  1.00 61.20  ? 38  ASP C O     1 
ATOM   7414  C  CB    . ASP C  1 38  ? 43.611  -1.687   47.242  1.00 61.45  ? 38  ASP C CB    1 
ATOM   7415  C  CG    . ASP C  1 38  ? 43.339  -3.191   47.287  1.00 64.25  ? 38  ASP C CG    1 
ATOM   7416  O  OD1   . ASP C  1 38  ? 43.539  -3.882   46.257  1.00 66.78  ? 38  ASP C OD1   1 
ATOM   7417  O  OD2   . ASP C  1 38  ? 42.896  -3.680   48.353  1.00 65.81  ? 38  ASP C OD2   1 
ATOM   7418  N  N     . GLY C  1 39  ? 46.390  0.621    46.473  1.00 61.16  ? 39  GLY C N     1 
ATOM   7419  C  CA    . GLY C  1 39  ? 46.735  2.036    46.639  1.00 60.80  ? 39  GLY C CA    1 
ATOM   7420  C  C     . GLY C  1 39  ? 46.545  2.607    48.045  1.00 59.10  ? 39  GLY C C     1 
ATOM   7421  O  O     . GLY C  1 39  ? 46.415  3.824    48.214  1.00 59.01  ? 39  GLY C O     1 
ATOM   7422  N  N     . ILE C  1 40  ? 46.535  1.732    49.051  1.00 57.95  ? 40  ILE C N     1 
ATOM   7423  C  CA    . ILE C  1 40  ? 46.342  2.121    50.456  1.00 56.76  ? 40  ILE C CA    1 
ATOM   7424  C  C     . ILE C  1 40  ? 47.469  1.535    51.321  1.00 56.61  ? 40  ILE C C     1 
ATOM   7425  O  O     . ILE C  1 40  ? 47.816  0.365    51.185  1.00 57.01  ? 40  ILE C O     1 
ATOM   7426  C  CB    . ILE C  1 40  ? 44.956  1.621    50.996  1.00 56.26  ? 40  ILE C CB    1 
ATOM   7427  C  CG1   . ILE C  1 40  ? 43.796  2.250    50.221  1.00 57.24  ? 40  ILE C CG1   1 
ATOM   7428  C  CG2   . ILE C  1 40  ? 44.789  1.856    52.495  1.00 55.09  ? 40  ILE C CG2   1 
ATOM   7429  C  CD1   . ILE C  1 40  ? 43.827  3.753    50.116  1.00 58.57  ? 40  ILE C CD1   1 
ATOM   7430  N  N     . ALA C  1 41  ? 48.034  2.346    52.206  1.00 56.30  ? 41  ALA C N     1 
ATOM   7431  C  CA    . ALA C  1 41  ? 49.062  1.861    53.124  1.00 57.17  ? 41  ALA C CA    1 
ATOM   7432  C  C     . ALA C  1 41  ? 48.730  2.228    54.567  1.00 56.89  ? 41  ALA C C     1 
ATOM   7433  O  O     . ALA C  1 41  ? 48.362  3.370    54.851  1.00 56.74  ? 41  ALA C O     1 
ATOM   7434  C  CB    . ALA C  1 41  ? 50.442  2.402    52.736  1.00 57.79  ? 41  ALA C CB    1 
ATOM   7435  N  N     . ARG C  1 42  ? 48.854  1.253    55.463  1.00 57.32  ? 42  ARG C N     1 
ATOM   7436  C  CA    . ARG C  1 42  ? 48.648  1.466    56.881  1.00 57.75  ? 42  ARG C CA    1 
ATOM   7437  C  C     . ARG C  1 42  ? 50.014  1.600    57.497  1.00 59.40  ? 42  ARG C C     1 
ATOM   7438  O  O     . ARG C  1 42  ? 50.829  0.679    57.406  1.00 61.24  ? 42  ARG C O     1 
ATOM   7439  C  CB    . ARG C  1 42  ? 47.916  0.276    57.494  1.00 58.22  ? 42  ARG C CB    1 
ATOM   7440  C  CG    . ARG C  1 42  ? 46.369  0.378    57.464  1.00 57.45  ? 42  ARG C CG    1 
ATOM   7441  C  CD    . ARG C  1 42  ? 45.747  -0.980   57.709  1.00 57.44  ? 42  ARG C CD    1 
ATOM   7442  N  NE    . ARG C  1 42  ? 46.440  -1.672   58.789  1.00 59.68  ? 42  ARG C NE    1 
ATOM   7443  C  CZ    . ARG C  1 42  ? 46.622  -2.985   58.851  1.00 60.76  ? 42  ARG C CZ    1 
ATOM   7444  N  NH1   . ARG C  1 42  ? 46.152  -3.776   57.889  1.00 60.69  ? 42  ARG C NH1   1 
ATOM   7445  N  NH2   . ARG C  1 42  ? 47.277  -3.502   59.882  1.00 61.73  ? 42  ARG C NH2   1 
ATOM   7446  N  N     . VAL C  1 43  ? 50.295  2.746    58.101  1.00 59.50  ? 43  VAL C N     1 
ATOM   7447  C  CA    . VAL C  1 43  ? 51.652  3.006    58.562  1.00 61.03  ? 43  VAL C CA    1 
ATOM   7448  C  C     . VAL C  1 43  ? 51.764  3.089    60.085  1.00 62.23  ? 43  VAL C C     1 
ATOM   7449  O  O     . VAL C  1 43  ? 50.890  3.651    60.755  1.00 61.95  ? 43  VAL C O     1 
ATOM   7450  C  CB    . VAL C  1 43  ? 52.243  4.277    57.903  1.00 61.18  ? 43  VAL C CB    1 
ATOM   7451  C  CG1   . VAL C  1 43  ? 53.693  4.444    58.287  1.00 63.24  ? 43  VAL C CG1   1 
ATOM   7452  C  CG2   . VAL C  1 43  ? 52.136  4.196    56.396  1.00 60.46  ? 43  VAL C CG2   1 
ATOM   7453  N  N     . PHE C  1 44  ? 52.847  2.529    60.619  1.00 64.01  ? 44  PHE C N     1 
ATOM   7454  C  CA    . PHE C  1 44  ? 53.169  2.659    62.033  1.00 65.68  ? 44  PHE C CA    1 
ATOM   7455  C  C     . PHE C  1 44  ? 53.940  3.953    62.276  1.00 66.48  ? 44  PHE C C     1 
ATOM   7456  O  O     . PHE C  1 44  ? 54.606  4.451    61.372  1.00 66.37  ? 44  PHE C O     1 
ATOM   7457  C  CB    . PHE C  1 44  ? 53.986  1.461    62.515  1.00 68.09  ? 44  PHE C CB    1 
ATOM   7458  C  CG    . PHE C  1 44  ? 54.138  1.404    64.004  1.00 70.63  ? 44  PHE C CG    1 
ATOM   7459  C  CD1   . PHE C  1 44  ? 53.014  1.468    64.831  1.00 70.69  ? 44  PHE C CD1   1 
ATOM   7460  C  CD2   . PHE C  1 44  ? 55.390  1.290    64.583  1.00 73.33  ? 44  PHE C CD2   1 
ATOM   7461  C  CE1   . PHE C  1 44  ? 53.137  1.422    66.213  1.00 72.97  ? 44  PHE C CE1   1 
ATOM   7462  C  CE2   . PHE C  1 44  ? 55.527  1.244    65.961  1.00 76.22  ? 44  PHE C CE2   1 
ATOM   7463  C  CZ    . PHE C  1 44  ? 54.398  1.309    66.777  1.00 76.60  ? 44  PHE C CZ    1 
ATOM   7464  N  N     . GLY C  1 45  ? 53.850  4.497    63.491  1.00 67.50  ? 45  GLY C N     1 
ATOM   7465  C  CA    . GLY C  1 45  ? 54.525  5.758    63.817  1.00 68.45  ? 45  GLY C CA    1 
ATOM   7466  C  C     . GLY C  1 45  ? 53.993  6.951    63.036  1.00 66.65  ? 45  GLY C C     1 
ATOM   7467  O  O     . GLY C  1 45  ? 52.787  7.083    62.849  1.00 64.85  ? 45  GLY C O     1 
ATOM   7468  N  N     . LEU C  1 46  ? 54.890  7.808    62.552  1.00 67.50  ? 46  LEU C N     1 
ATOM   7469  C  CA    . LEU C  1 46  ? 54.495  9.101    61.984  1.00 66.86  ? 46  LEU C CA    1 
ATOM   7470  C  C     . LEU C  1 46  ? 53.671  9.871    63.013  1.00 67.13  ? 46  LEU C C     1 
ATOM   7471  O  O     . LEU C  1 46  ? 52.609  10.419   62.697  1.00 65.52  ? 46  LEU C O     1 
ATOM   7472  C  CB    . LEU C  1 46  ? 53.691  8.928    60.688  1.00 64.73  ? 46  LEU C CB    1 
ATOM   7473  C  CG    . LEU C  1 46  ? 54.427  8.616    59.386  1.00 65.02  ? 46  LEU C CG    1 
ATOM   7474  C  CD1   . LEU C  1 46  ? 53.418  8.295    58.287  1.00 62.37  ? 46  LEU C CD1   1 
ATOM   7475  C  CD2   . LEU C  1 46  ? 55.335  9.769    58.981  1.00 66.80  ? 46  LEU C CD2   1 
ATOM   7476  N  N     . ASN C  1 47  ? 54.190  9.899    64.241  1.00 69.28  ? 47  ASN C N     1 
ATOM   7477  C  CA    . ASN C  1 47  ? 53.473  10.371   65.424  1.00 70.20  ? 47  ASN C CA    1 
ATOM   7478  C  C     . ASN C  1 47  ? 53.004  11.818   65.376  1.00 70.29  ? 47  ASN C C     1 
ATOM   7479  O  O     . ASN C  1 47  ? 52.021  12.173   66.016  1.00 70.94  ? 47  ASN C O     1 
ATOM   7480  C  CB    . ASN C  1 47  ? 54.344  10.168   66.664  1.00 73.24  ? 47  ASN C CB    1 
ATOM   7481  C  CG    . ASN C  1 47  ? 54.138  8.812    67.323  1.00 74.23  ? 47  ASN C CG    1 
ATOM   7482  O  OD1   . ASN C  1 47  ? 53.593  7.887    66.727  1.00 72.29  ? 47  ASN C OD1   1 
ATOM   7483  N  ND2   . ASN C  1 47  ? 54.576  8.696    68.571  1.00 78.82  ? 47  ASN C ND2   1 
ATOM   7484  N  N     . ASN C  1 48  ? 53.717  12.645   64.622  1.00 70.41  ? 48  ASN C N     1 
ATOM   7485  C  CA    . ASN C  1 48  ? 53.481  14.084   64.575  1.00 71.08  ? 48  ASN C CA    1 
ATOM   7486  C  C     . ASN C  1 48  ? 52.800  14.527   63.288  1.00 69.12  ? 48  ASN C C     1 
ATOM   7487  O  O     . ASN C  1 48  ? 52.588  15.716   63.075  1.00 70.15  ? 48  ASN C O     1 
ATOM   7488  C  CB    . ASN C  1 48  ? 54.814  14.839   64.716  1.00 73.85  ? 48  ASN C CB    1 
ATOM   7489  C  CG    . ASN C  1 48  ? 55.265  14.993   66.164  1.00 76.70  ? 48  ASN C CG    1 
ATOM   7490  O  OD1   . ASN C  1 48  ? 54.472  14.854   67.106  1.00 77.06  ? 48  ASN C OD1   1 
ATOM   7491  N  ND2   . ASN C  1 48  ? 56.543  15.304   66.344  1.00 78.06  ? 48  ASN C ND2   1 
ATOM   7492  N  N     . ILE C  1 49  ? 52.476  13.572   62.424  1.00 66.78  ? 49  ILE C N     1 
ATOM   7493  C  CA    . ILE C  1 49  ? 51.877  13.880   61.126  1.00 65.35  ? 49  ILE C CA    1 
ATOM   7494  C  C     . ILE C  1 49  ? 50.527  14.574   61.290  1.00 65.17  ? 49  ILE C C     1 
ATOM   7495  O  O     . ILE C  1 49  ? 49.790  14.311   62.243  1.00 65.44  ? 49  ILE C O     1 
ATOM   7496  C  CB    . ILE C  1 49  ? 51.740  12.613   60.236  1.00 63.22  ? 49  ILE C CB    1 
ATOM   7497  C  CG1   . ILE C  1 49  ? 51.607  12.988   58.767  1.00 62.40  ? 49  ILE C CG1   1 
ATOM   7498  C  CG2   . ILE C  1 49  ? 50.547  11.764   60.656  1.00 62.23  ? 49  ILE C CG2   1 
ATOM   7499  C  CD1   . ILE C  1 49  ? 51.946  11.838   57.855  1.00 62.20  ? 49  ILE C CD1   1 
ATOM   7500  N  N     . GLN C  1 50  ? 50.231  15.467   60.354  1.00 65.31  ? 50  GLN C N     1 
ATOM   7501  C  CA    . GLN C  1 50  ? 48.979  16.188   60.324  1.00 65.59  ? 50  GLN C CA    1 
ATOM   7502  C  C     . GLN C  1 50  ? 47.991  15.464   59.430  1.00 64.33  ? 50  GLN C C     1 
ATOM   7503  O  O     . GLN C  1 50  ? 48.380  14.893   58.408  1.00 63.49  ? 50  GLN C O     1 
ATOM   7504  C  CB    . GLN C  1 50  ? 49.203  17.568   59.748  1.00 67.03  ? 50  GLN C CB    1 
ATOM   7505  C  CG    . GLN C  1 50  ? 49.984  18.490   60.624  1.00 68.81  ? 50  GLN C CG    1 
ATOM   7506  C  CD    . GLN C  1 50  ? 50.380  19.737   59.884  1.00 70.45  ? 50  GLN C CD    1 
ATOM   7507  O  OE1   . GLN C  1 50  ? 50.799  19.676   58.734  1.00 70.20  ? 50  GLN C OE1   1 
ATOM   7508  N  NE2   . GLN C  1 50  ? 50.243  20.883   60.532  1.00 73.53  ? 50  GLN C NE2   1 
ATOM   7509  N  N     . ALA C  1 51  ? 46.715  15.495   59.812  1.00 64.78  ? 51  ALA C N     1 
ATOM   7510  C  CA    . ALA C  1 51  ? 45.631  15.005   58.958  1.00 63.82  ? 51  ALA C CA    1 
ATOM   7511  C  C     . ALA C  1 51  ? 45.692  15.730   57.613  1.00 64.57  ? 51  ALA C C     1 
ATOM   7512  O  O     . ALA C  1 51  ? 45.750  16.965   57.586  1.00 66.74  ? 51  ALA C O     1 
ATOM   7513  C  CB    . ALA C  1 51  ? 44.283  15.234   59.636  1.00 64.41  ? 51  ALA C CB    1 
ATOM   7514  N  N     . GLU C  1 52  ? 45.704  14.960   56.519  1.00 63.27  ? 52  GLU C N     1 
ATOM   7515  C  CA    . GLU C  1 52  ? 45.773  15.469   55.127  1.00 64.29  ? 52  GLU C CA    1 
ATOM   7516  C  C     . GLU C  1 52  ? 47.195  15.875   54.662  1.00 64.79  ? 52  GLU C C     1 
ATOM   7517  O  O     . GLU C  1 52  ? 47.365  16.505   53.618  1.00 66.13  ? 52  GLU C O     1 
ATOM   7518  C  CB    . GLU C  1 52  ? 44.708  16.554   54.845  1.00 66.41  ? 52  GLU C CB    1 
ATOM   7519  C  CG    . GLU C  1 52  ? 43.266  16.148   55.232  1.00 68.32  ? 52  GLU C CG    1 
ATOM   7520  C  CD    . GLU C  1 52  ? 42.178  17.040   54.604  1.00 74.72  ? 52  GLU C CD    1 
ATOM   7521  O  OE1   . GLU C  1 52  ? 42.397  17.535   53.471  1.00 77.66  ? 52  GLU C OE1   1 
ATOM   7522  O  OE2   . GLU C  1 52  ? 41.096  17.240   55.229  1.00 75.84  ? 52  GLU C OE2   1 
ATOM   7523  N  N     . GLU C  1 53  ? 48.211  15.486   55.424  1.00 64.31  ? 53  GLU C N     1 
ATOM   7524  C  CA    . GLU C  1 53  ? 49.603  15.828   55.107  1.00 65.86  ? 53  GLU C CA    1 
ATOM   7525  C  C     . GLU C  1 53  ? 50.204  14.959   53.993  1.00 65.25  ? 53  GLU C C     1 
ATOM   7526  O  O     . GLU C  1 53  ? 49.884  13.769   53.879  1.00 64.05  ? 53  GLU C O     1 
ATOM   7527  C  CB    . GLU C  1 53  ? 50.470  15.726   56.368  1.00 66.13  ? 53  GLU C CB    1 
ATOM   7528  C  CG    . GLU C  1 53  ? 51.887  16.210   56.198  1.00 68.43  ? 53  GLU C CG    1 
ATOM   7529  C  CD    . GLU C  1 53  ? 52.686  16.158   57.485  1.00 71.22  ? 53  GLU C CD    1 
ATOM   7530  O  OE1   . GLU C  1 53  ? 52.163  16.558   58.553  1.00 72.80  ? 53  GLU C OE1   1 
ATOM   7531  O  OE2   . GLU C  1 53  ? 53.856  15.726   57.426  1.00 72.46  ? 53  GLU C OE2   1 
ATOM   7532  N  N     . LEU C  1 54  ? 51.075  15.554   53.182  1.00 66.51  ? 54  LEU C N     1 
ATOM   7533  C  CA    . LEU C  1 54  ? 51.769  14.820   52.134  1.00 66.61  ? 54  LEU C CA    1 
ATOM   7534  C  C     . LEU C  1 54  ? 52.867  13.959   52.751  1.00 66.54  ? 54  LEU C C     1 
ATOM   7535  O  O     . LEU C  1 54  ? 53.600  14.418   53.627  1.00 67.94  ? 54  LEU C O     1 
ATOM   7536  C  CB    . LEU C  1 54  ? 52.373  15.792   51.119  1.00 68.98  ? 54  LEU C CB    1 
ATOM   7537  C  CG    . LEU C  1 54  ? 52.655  15.335   49.686  1.00 69.27  ? 54  LEU C CG    1 
ATOM   7538  C  CD1   . LEU C  1 54  ? 51.372  14.917   48.987  1.00 68.13  ? 54  LEU C CD1   1 
ATOM   7539  C  CD2   . LEU C  1 54  ? 53.326  16.451   48.911  1.00 71.81  ? 54  LEU C CD2   1 
ATOM   7540  N  N     . VAL C  1 55  ? 52.967  12.706   52.312  1.00 65.70  ? 55  VAL C N     1 
ATOM   7541  C  CA    . VAL C  1 55  ? 54.066  11.821   52.724  1.00 65.63  ? 55  VAL C CA    1 
ATOM   7542  C  C     . VAL C  1 55  ? 54.801  11.280   51.522  1.00 66.91  ? 55  VAL C C     1 
ATOM   7543  O  O     . VAL C  1 55  ? 54.240  11.194   50.428  1.00 66.80  ? 55  VAL C O     1 
ATOM   7544  C  CB    . VAL C  1 55  ? 53.602  10.602   53.560  1.00 63.53  ? 55  VAL C CB    1 
ATOM   7545  C  CG1   . VAL C  1 55  ? 52.941  11.049   54.834  1.00 62.58  ? 55  VAL C CG1   1 
ATOM   7546  C  CG2   . VAL C  1 55  ? 52.697  9.694    52.747  1.00 61.73  ? 55  VAL C CG2   1 
ATOM   7547  N  N     . GLU C  1 56  ? 56.054  10.901   51.751  1.00 68.63  ? 56  GLU C N     1 
ATOM   7548  C  CA    . GLU C  1 56  ? 56.883  10.264   50.738  1.00 70.46  ? 56  GLU C CA    1 
ATOM   7549  C  C     . GLU C  1 56  ? 57.269  8.882    51.220  1.00 70.03  ? 56  GLU C C     1 
ATOM   7550  O  O     . GLU C  1 56  ? 57.830  8.740    52.310  1.00 70.85  ? 56  GLU C O     1 
ATOM   7551  C  CB    . GLU C  1 56  ? 58.133  11.094   50.471  1.00 73.33  ? 56  GLU C CB    1 
ATOM   7552  C  CG    . GLU C  1 56  ? 57.843  12.475   49.917  1.00 75.47  ? 56  GLU C CG    1 
ATOM   7553  C  CD    . GLU C  1 56  ? 59.096  13.301   49.705  1.00 81.68  ? 56  GLU C CD    1 
ATOM   7554  O  OE1   . GLU C  1 56  ? 60.206  12.852   50.084  1.00 84.58  ? 56  GLU C OE1   1 
ATOM   7555  O  OE2   . GLU C  1 56  ? 58.978  14.419   49.155  1.00 84.57  ? 56  GLU C OE2   1 
ATOM   7556  N  N     . PHE C  1 57  ? 56.936  7.865    50.430  1.00 69.23  ? 57  PHE C N     1 
ATOM   7557  C  CA    . PHE C  1 57  ? 57.443  6.511    50.671  1.00 69.44  ? 57  PHE C CA    1 
ATOM   7558  C  C     . PHE C  1 57  ? 58.859  6.365    50.103  1.00 72.19  ? 57  PHE C C     1 
ATOM   7559  O  O     . PHE C  1 57  ? 59.146  6.856    49.016  1.00 73.52  ? 57  PHE C O     1 
ATOM   7560  C  CB    . PHE C  1 57  ? 56.511  5.469    50.060  1.00 67.88  ? 57  PHE C CB    1 
ATOM   7561  C  CG    . PHE C  1 57  ? 55.192  5.373    50.750  1.00 66.08  ? 57  PHE C CG    1 
ATOM   7562  C  CD1   . PHE C  1 57  ? 54.185  6.299    50.485  1.00 65.00  ? 57  PHE C CD1   1 
ATOM   7563  C  CD2   . PHE C  1 57  ? 54.946  4.354    51.666  1.00 65.60  ? 57  PHE C CD2   1 
ATOM   7564  C  CE1   . PHE C  1 57  ? 52.965  6.224    51.132  1.00 62.76  ? 57  PHE C CE1   1 
ATOM   7565  C  CE2   . PHE C  1 57  ? 53.721  4.259    52.304  1.00 63.15  ? 57  PHE C CE2   1 
ATOM   7566  C  CZ    . PHE C  1 57  ? 52.727  5.199    52.042  1.00 62.41  ? 57  PHE C CZ    1 
ATOM   7567  N  N     . SER C  1 58  ? 59.730  5.679    50.834  1.00 73.32  ? 58  SER C N     1 
ATOM   7568  C  CA    . SER C  1 58  ? 61.130  5.522    50.420  1.00 76.84  ? 58  SER C CA    1 
ATOM   7569  C  C     . SER C  1 58  ? 61.285  5.046    48.980  1.00 78.02  ? 58  SER C C     1 
ATOM   7570  O  O     . SER C  1 58  ? 62.247  5.407    48.317  1.00 81.25  ? 58  SER C O     1 
ATOM   7571  C  CB    . SER C  1 58  ? 61.878  4.569    51.353  1.00 78.36  ? 58  SER C CB    1 
ATOM   7572  O  OG    . SER C  1 58  ? 61.496  3.226    51.109  1.00 78.77  ? 58  SER C OG    1 
ATOM   7573  N  N     . SER C  1 59  ? 60.338  4.245    48.497  1.00 75.78  ? 59  SER C N     1 
ATOM   7574  C  CA    . SER C  1 59  ? 60.425  3.699    47.149  1.00 77.01  ? 59  SER C CA    1 
ATOM   7575  C  C     . SER C  1 59  ? 60.133  4.739    46.076  1.00 77.26  ? 59  SER C C     1 
ATOM   7576  O  O     . SER C  1 59  ? 60.227  4.439    44.891  1.00 79.20  ? 59  SER C O     1 
ATOM   7577  C  CB    . SER C  1 59  ? 59.504  2.487    46.987  1.00 75.44  ? 59  SER C CB    1 
ATOM   7578  O  OG    . SER C  1 59  ? 58.133  2.844    47.101  1.00 72.18  ? 59  SER C OG    1 
ATOM   7579  N  N     . GLY C  1 60  ? 59.781  5.952    46.492  1.00 75.79  ? 60  GLY C N     1 
ATOM   7580  C  CA    . GLY C  1 60  ? 59.522  7.052    45.562  1.00 76.83  ? 60  GLY C CA    1 
ATOM   7581  C  C     . GLY C  1 60  ? 58.115  7.629    45.607  1.00 74.16  ? 60  GLY C C     1 
ATOM   7582  O  O     . GLY C  1 60  ? 57.937  8.848    45.634  1.00 74.42  ? 60  GLY C O     1 
ATOM   7583  N  N     . VAL C  1 61  ? 57.113  6.757    45.622  1.00 72.17  ? 61  VAL C N     1 
ATOM   7584  C  CA    . VAL C  1 61  ? 55.706  7.175    45.555  1.00 70.21  ? 61  VAL C CA    1 
ATOM   7585  C  C     . VAL C  1 61  ? 55.273  8.117    46.688  1.00 68.49  ? 61  VAL C C     1 
ATOM   7586  O  O     . VAL C  1 61  ? 55.769  8.023    47.820  1.00 67.90  ? 61  VAL C O     1 
ATOM   7587  C  CB    . VAL C  1 61  ? 54.757  5.957    45.449  1.00 68.47  ? 61  VAL C CB    1 
ATOM   7588  C  CG1   . VAL C  1 61  ? 54.299  5.483    46.831  1.00 66.24  ? 61  VAL C CG1   1 
ATOM   7589  C  CG2   . VAL C  1 61  ? 53.579  6.294    44.566  1.00 68.12  ? 61  VAL C CG2   1 
ATOM   7590  N  N     . LYS C  1 62  ? 54.361  9.030    46.360  1.00 68.19  ? 62  LYS C N     1 
ATOM   7591  C  CA    . LYS C  1 62  ? 53.887  10.021   47.314  1.00 67.28  ? 62  LYS C CA    1 
ATOM   7592  C  C     . LYS C  1 62  ? 52.475  9.717    47.770  1.00 65.33  ? 62  LYS C C     1 
ATOM   7593  O  O     . LYS C  1 62  ? 51.719  9.023    47.076  1.00 65.17  ? 62  LYS C O     1 
ATOM   7594  C  CB    . LYS C  1 62  ? 53.993  11.437   46.746  1.00 69.38  ? 62  LYS C CB    1 
ATOM   7595  C  CG    . LYS C  1 62  ? 55.414  11.996   46.832  1.00 71.56  ? 62  LYS C CG    1 
ATOM   7596  C  CD    . LYS C  1 62  ? 55.467  13.489   46.596  1.00 73.30  ? 62  LYS C CD    1 
ATOM   7597  C  CE    . LYS C  1 62  ? 56.916  13.972   46.576  1.00 75.98  ? 62  LYS C CE    1 
ATOM   7598  N  NZ    . LYS C  1 62  ? 57.023  15.457   46.711  1.00 77.26  ? 62  LYS C NZ    1 
ATOM   7599  N  N     . GLY C  1 63  ? 52.123  10.218   48.952  1.00 64.21  ? 63  GLY C N     1 
ATOM   7600  C  CA    . GLY C  1 63  ? 50.833  9.889    49.541  1.00 62.21  ? 63  GLY C CA    1 
ATOM   7601  C  C     . GLY C  1 63  ? 50.252  10.957   50.431  1.00 61.92  ? 63  GLY C C     1 
ATOM   7602  O  O     . GLY C  1 63  ? 50.878  11.978   50.701  1.00 62.84  ? 63  GLY C O     1 
ATOM   7603  N  N     . MET C  1 64  ? 49.037  10.698   50.891  1.00 60.95  ? 64  MET C N     1 
ATOM   7604  C  CA    . MET C  1 64  ? 48.303  11.630   51.724  1.00 61.10  ? 64  MET C CA    1 
ATOM   7605  C  C     . MET C  1 64  ? 47.684  10.862   52.897  1.00 59.64  ? 64  MET C C     1 
ATOM   7606  O  O     . MET C  1 64  ? 46.950  9.881    52.688  1.00 58.65  ? 64  MET C O     1 
ATOM   7607  C  CB    . MET C  1 64  ? 47.229  12.311   50.881  1.00 62.24  ? 64  MET C CB    1 
ATOM   7608  C  CG    . MET C  1 64  ? 46.487  13.446   51.551  1.00 63.53  ? 64  MET C CG    1 
ATOM   7609  S  SD    . MET C  1 64  ? 45.037  13.854   50.570  1.00 65.89  ? 64  MET C SD    1 
ATOM   7610  C  CE    . MET C  1 64  ? 44.693  15.508   51.144  1.00 70.09  ? 64  MET C CE    1 
ATOM   7611  N  N     . ALA C  1 65  ? 48.015  11.298   54.119  1.00 59.44  ? 65  ALA C N     1 
ATOM   7612  C  CA    . ALA C  1 65  ? 47.434  10.746   55.346  1.00 58.20  ? 65  ALA C CA    1 
ATOM   7613  C  C     . ALA C  1 65  ? 46.004  11.205   55.478  1.00 58.68  ? 65  ALA C C     1 
ATOM   7614  O  O     . ALA C  1 65  ? 45.751  12.389   55.663  1.00 60.36  ? 65  ALA C O     1 
ATOM   7615  C  CB    . ALA C  1 65  ? 48.210  11.190   56.535  1.00 58.62  ? 65  ALA C CB    1 
ATOM   7616  N  N     . LEU C  1 66  ? 45.063  10.271   55.382  1.00 57.86  ? 66  LEU C N     1 
ATOM   7617  C  CA    . LEU C  1 66  ? 43.663  10.600   55.564  1.00 57.76  ? 66  LEU C CA    1 
ATOM   7618  C  C     . LEU C  1 66  ? 43.060  9.972    56.808  1.00 57.61  ? 66  LEU C C     1 
ATOM   7619  O  O     . LEU C  1 66  ? 42.044  10.440   57.288  1.00 59.40  ? 66  LEU C O     1 
ATOM   7620  C  CB    . LEU C  1 66  ? 42.866  10.224   54.320  1.00 57.86  ? 66  LEU C CB    1 
ATOM   7621  C  CG    . LEU C  1 66  ? 43.021  11.170   53.128  1.00 58.63  ? 66  LEU C CG    1 
ATOM   7622  C  CD1   . LEU C  1 66  ? 41.915  10.982   52.105  1.00 57.04  ? 66  LEU C CD1   1 
ATOM   7623  C  CD2   . LEU C  1 66  ? 43.048  12.613   53.595  1.00 61.02  ? 66  LEU C CD2   1 
ATOM   7624  N  N     . ASN C  1 67  ? 43.669  8.910    57.327  1.00 56.43  ? 67  ASN C N     1 
ATOM   7625  C  CA    . ASN C  1 67  ? 43.179  8.251    58.546  1.00 56.48  ? 67  ASN C CA    1 
ATOM   7626  C  C     . ASN C  1 67  ? 44.212  8.319    59.646  1.00 56.60  ? 67  ASN C C     1 
ATOM   7627  O  O     . ASN C  1 67  ? 45.284  7.729    59.496  1.00 56.05  ? 67  ASN C O     1 
ATOM   7628  C  CB    . ASN C  1 67  ? 42.856  6.771    58.276  1.00 55.77  ? 67  ASN C CB    1 
ATOM   7629  C  CG    . ASN C  1 67  ? 41.364  6.507    58.092  1.00 55.78  ? 67  ASN C CG    1 
ATOM   7630  O  OD1   . ASN C  1 67  ? 40.680  7.236    57.389  1.00 56.39  ? 67  ASN C OD1   1 
ATOM   7631  N  ND2   . ASN C  1 67  ? 40.864  5.450    58.723  1.00 54.73  ? 67  ASN C ND2   1 
ATOM   7632  N  N     . LEU C  1 68  ? 43.920  9.029    60.739  1.00 57.72  ? 68  LEU C N     1 
ATOM   7633  C  CA    . LEU C  1 68  ? 44.833  9.022    61.899  1.00 58.28  ? 68  LEU C CA    1 
ATOM   7634  C  C     . LEU C  1 68  ? 44.192  8.349    63.085  1.00 59.22  ? 68  LEU C C     1 
ATOM   7635  O  O     . LEU C  1 68  ? 43.383  8.941    63.784  1.00 60.53  ? 68  LEU C O     1 
ATOM   7636  C  CB    . LEU C  1 68  ? 45.310  10.422   62.327  1.00 59.58  ? 68  LEU C CB    1 
ATOM   7637  C  CG    . LEU C  1 68  ? 45.788  11.538   61.403  1.00 59.53  ? 68  LEU C CG    1 
ATOM   7638  C  CD1   . LEU C  1 68  ? 46.407  12.630   62.258  1.00 60.63  ? 68  LEU C CD1   1 
ATOM   7639  C  CD2   . LEU C  1 68  ? 46.772  11.057   60.334  1.00 58.09  ? 68  LEU C CD2   1 
ATOM   7640  N  N     . GLU C  1 69  ? 44.574  7.107    63.313  1.00 59.13  ? 69  GLU C N     1 
ATOM   7641  C  CA    . GLU C  1 69  ? 44.003  6.316    64.376  1.00 61.00  ? 69  GLU C CA    1 
ATOM   7642  C  C     . GLU C  1 69  ? 45.082  6.040    65.439  1.00 62.33  ? 69  GLU C C     1 
ATOM   7643  O  O     . GLU C  1 69  ? 46.280  6.277    65.188  1.00 61.63  ? 69  GLU C O     1 
ATOM   7644  C  CB    . GLU C  1 69  ? 43.436  5.029    63.783  1.00 60.43  ? 69  GLU C CB    1 
ATOM   7645  C  CG    . GLU C  1 69  ? 42.613  5.248    62.514  1.00 62.02  ? 69  GLU C CG    1 
ATOM   7646  C  CD    . GLU C  1 69  ? 42.399  3.974    61.705  1.00 65.58  ? 69  GLU C CD    1 
ATOM   7647  O  OE1   . GLU C  1 69  ? 41.708  3.056    62.200  1.00 68.21  ? 69  GLU C OE1   1 
ATOM   7648  O  OE2   . GLU C  1 69  ? 42.914  3.894    60.564  1.00 66.53  ? 69  GLU C OE2   1 
ATOM   7649  N  N     . PRO C  1 70  ? 44.668  5.562    66.632  1.00 64.14  ? 70  PRO C N     1 
ATOM   7650  C  CA    . PRO C  1 70  ? 45.577  5.290    67.738  1.00 66.22  ? 70  PRO C CA    1 
ATOM   7651  C  C     . PRO C  1 70  ? 46.906  4.653    67.342  1.00 65.95  ? 70  PRO C C     1 
ATOM   7652  O  O     . PRO C  1 70  ? 47.946  5.297    67.437  1.00 67.14  ? 70  PRO C O     1 
ATOM   7653  C  CB    . PRO C  1 70  ? 44.770  4.354    68.615  1.00 67.86  ? 70  PRO C CB    1 
ATOM   7654  C  CG    . PRO C  1 70  ? 43.396  4.861    68.456  1.00 67.89  ? 70  PRO C CG    1 
ATOM   7655  C  CD    . PRO C  1 70  ? 43.271  5.359    67.042  1.00 65.00  ? 70  PRO C CD    1 
ATOM   7656  N  N     . GLY C  1 71  ? 46.905  3.416    66.889  1.00 65.33  ? 71  GLY C N     1 
ATOM   7657  C  CA    . GLY C  1 71  ? 48.191  2.783    66.610  1.00 65.36  ? 71  GLY C CA    1 
ATOM   7658  C  C     . GLY C  1 71  ? 48.729  2.894    65.191  1.00 63.22  ? 71  GLY C C     1 
ATOM   7659  O  O     . GLY C  1 71  ? 49.752  2.291    64.880  1.00 63.42  ? 71  GLY C O     1 
ATOM   7660  N  N     . GLN C  1 72  ? 48.046  3.633    64.316  1.00 61.51  ? 72  GLN C N     1 
ATOM   7661  C  CA    . GLN C  1 72  ? 48.424  3.657    62.892  1.00 59.67  ? 72  GLN C CA    1 
ATOM   7662  C  C     . GLN C  1 72  ? 47.844  4.803    62.061  1.00 58.06  ? 72  GLN C C     1 
ATOM   7663  O  O     . GLN C  1 72  ? 47.005  5.581    62.522  1.00 58.41  ? 72  GLN C O     1 
ATOM   7664  C  CB    . GLN C  1 72  ? 48.102  2.323    62.217  1.00 59.18  ? 72  GLN C CB    1 
ATOM   7665  C  CG    . GLN C  1 72  ? 46.748  1.725    62.613  1.00 60.54  ? 72  GLN C CG    1 
ATOM   7666  C  CD    . GLN C  1 72  ? 46.107  0.977    61.465  1.00 60.41  ? 72  GLN C CD    1 
ATOM   7667  O  OE1   . GLN C  1 72  ? 46.485  -0.153   61.145  1.00 60.65  ? 72  GLN C OE1   1 
ATOM   7668  N  NE2   . GLN C  1 72  ? 45.140  1.618    60.820  1.00 60.91  ? 72  GLN C NE2   1 
ATOM   7669  N  N     . VAL C  1 73  ? 48.313  4.881    60.824  1.00 56.51  ? 73  VAL C N     1 
ATOM   7670  C  CA    . VAL C  1 73  ? 47.977  5.955    59.912  1.00 55.44  ? 73  VAL C CA    1 
ATOM   7671  C  C     . VAL C  1 73  ? 47.604  5.323    58.577  1.00 54.27  ? 73  VAL C C     1 
ATOM   7672  O  O     . VAL C  1 73  ? 48.348  4.520    58.038  1.00 54.48  ? 73  VAL C O     1 
ATOM   7673  C  CB    . VAL C  1 73  ? 49.191  6.916    59.745  1.00 56.01  ? 73  VAL C CB    1 
ATOM   7674  C  CG1   . VAL C  1 73  ? 48.993  7.908    58.592  1.00 55.21  ? 73  VAL C CG1   1 
ATOM   7675  C  CG2   . VAL C  1 73  ? 49.437  7.657    61.016  1.00 57.16  ? 73  VAL C CG2   1 
ATOM   7676  N  N     . GLY C  1 74  ? 46.443  5.671    58.052  1.00 53.93  ? 74  GLY C N     1 
ATOM   7677  C  CA    . GLY C  1 74  ? 46.013  5.131    56.778  1.00 53.49  ? 74  GLY C CA    1 
ATOM   7678  C  C     . GLY C  1 74  ? 46.299  6.158    55.716  1.00 54.07  ? 74  GLY C C     1 
ATOM   7679  O  O     . GLY C  1 74  ? 45.863  7.311    55.823  1.00 54.37  ? 74  GLY C O     1 
ATOM   7680  N  N     . ILE C  1 75  ? 47.035  5.744    54.691  1.00 54.48  ? 75  ILE C N     1 
ATOM   7681  C  CA    . ILE C  1 75  ? 47.511  6.661    53.672  1.00 55.57  ? 75  ILE C CA    1 
ATOM   7682  C  C     . ILE C  1 75  ? 47.104  6.189    52.289  1.00 56.25  ? 75  ILE C C     1 
ATOM   7683  O  O     . ILE C  1 75  ? 47.228  5.001    51.954  1.00 56.51  ? 75  ILE C O     1 
ATOM   7684  C  CB    . ILE C  1 75  ? 49.037  6.823    53.751  1.00 56.37  ? 75  ILE C CB    1 
ATOM   7685  C  CG1   . ILE C  1 75  ? 49.402  7.747    54.916  1.00 56.60  ? 75  ILE C CG1   1 
ATOM   7686  C  CG2   . ILE C  1 75  ? 49.602  7.363    52.437  1.00 57.48  ? 75  ILE C CG2   1 
ATOM   7687  C  CD1   . ILE C  1 75  ? 50.719  7.455    55.517  1.00 57.31  ? 75  ILE C CD1   1 
ATOM   7688  N  N     . VAL C  1 76  ? 46.612  7.135    51.497  1.00 57.03  ? 76  VAL C N     1 
ATOM   7689  C  CA    . VAL C  1 76  ? 46.203  6.880    50.127  1.00 57.46  ? 76  VAL C CA    1 
ATOM   7690  C  C     . VAL C  1 76  ? 47.370  7.269    49.243  1.00 58.41  ? 76  VAL C C     1 
ATOM   7691  O  O     . VAL C  1 76  ? 47.992  8.310    49.455  1.00 59.41  ? 76  VAL C O     1 
ATOM   7692  C  CB    . VAL C  1 76  ? 44.942  7.691    49.765  1.00 58.21  ? 76  VAL C CB    1 
ATOM   7693  C  CG1   . VAL C  1 76  ? 43.826  7.363    50.727  1.00 57.40  ? 76  VAL C CG1   1 
ATOM   7694  C  CG2   . VAL C  1 76  ? 45.233  9.180    49.795  1.00 59.20  ? 76  VAL C CG2   1 
ATOM   7695  N  N     . LEU C  1 77  ? 47.687  6.420    48.273  1.00 58.67  ? 77  LEU C N     1 
ATOM   7696  C  CA    . LEU C  1 77  ? 48.885  6.605    47.471  1.00 59.51  ? 77  LEU C CA    1 
ATOM   7697  C  C     . LEU C  1 77  ? 48.581  7.455    46.258  1.00 61.58  ? 77  LEU C C     1 
ATOM   7698  O  O     . LEU C  1 77  ? 47.526  7.312    45.651  1.00 61.86  ? 77  LEU C O     1 
ATOM   7699  C  CB    . LEU C  1 77  ? 49.444  5.256    47.027  1.00 59.51  ? 77  LEU C CB    1 
ATOM   7700  C  CG    . LEU C  1 77  ? 49.855  4.174    48.032  1.00 57.67  ? 77  LEU C CG    1 
ATOM   7701  C  CD1   . LEU C  1 77  ? 50.899  3.314    47.376  1.00 58.42  ? 77  LEU C CD1   1 
ATOM   7702  C  CD2   . LEU C  1 77  ? 50.398  4.730    49.349  1.00 54.51  ? 77  LEU C CD2   1 
ATOM   7703  N  N     . PHE C  1 78  ? 49.501  8.349    45.897  1.00 63.47  ? 78  PHE C N     1 
ATOM   7704  C  CA    . PHE C  1 78  ? 49.317  9.132    44.675  1.00 65.96  ? 78  PHE C CA    1 
ATOM   7705  C  C     . PHE C  1 78  ? 49.907  8.448    43.447  1.00 68.08  ? 78  PHE C C     1 
ATOM   7706  O  O     . PHE C  1 78  ? 49.998  9.067    42.394  1.00 71.08  ? 78  PHE C O     1 
ATOM   7707  C  CB    . PHE C  1 78  ? 49.854  10.558   44.812  1.00 67.05  ? 78  PHE C CB    1 
ATOM   7708  C  CG    . PHE C  1 78  ? 48.998  11.452   45.656  1.00 66.52  ? 78  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C  1 78  ? 47.714  11.795   45.262  1.00 68.31  ? 78  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C  1 78  ? 49.480  11.968   46.840  1.00 66.15  ? 78  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C  1 78  ? 46.925  12.636   46.050  1.00 68.30  ? 78  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C  1 78  ? 48.691  12.805   47.633  1.00 66.41  ? 78  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C  1 78  ? 47.420  13.139   47.236  1.00 66.27  ? 78  PHE C CZ    1 
ATOM   7714  N  N     . GLY C  1 79  ? 50.298  7.180    43.577  1.00 67.33  ? 79  GLY C N     1 
ATOM   7715  C  CA    . GLY C  1 79  ? 50.720  6.384    42.431  1.00 69.43  ? 79  GLY C CA    1 
ATOM   7716  C  C     . GLY C  1 79  ? 50.502  4.896    42.605  1.00 68.85  ? 79  GLY C C     1 
ATOM   7717  O  O     . GLY C  1 79  ? 49.600  4.464    43.331  1.00 66.74  ? 79  GLY C O     1 
ATOM   7718  N  N     . SER C  1 80  ? 51.325  4.106    41.918  1.00 71.08  ? 80  SER C N     1 
ATOM   7719  C  CA    . SER C  1 80  ? 51.264  2.651    42.021  1.00 71.15  ? 80  SER C CA    1 
ATOM   7720  C  C     . SER C  1 80  ? 51.752  2.235    43.396  1.00 69.45  ? 80  SER C C     1 
ATOM   7721  O  O     . SER C  1 80  ? 52.553  2.929    43.994  1.00 69.97  ? 80  SER C O     1 
ATOM   7722  C  CB    . SER C  1 80  ? 52.131  2.007    40.946  1.00 74.08  ? 80  SER C CB    1 
ATOM   7723  O  OG    . SER C  1 80  ? 51.923  0.609    40.897  1.00 74.42  ? 80  SER C OG    1 
ATOM   7724  N  N     . ASP C  1 81  ? 51.271  1.118    43.912  1.00 68.44  ? 81  ASP C N     1 
ATOM   7725  C  CA    . ASP C  1 81  ? 51.807  0.613    45.161  1.00 67.64  ? 81  ASP C CA    1 
ATOM   7726  C  C     . ASP C  1 81  ? 52.705  -0.587   44.907  1.00 69.64  ? 81  ASP C C     1 
ATOM   7727  O  O     . ASP C  1 81  ? 53.251  -1.170   45.841  1.00 69.76  ? 81  ASP C O     1 
ATOM   7728  C  CB    . ASP C  1 81  ? 50.685  0.227    46.115  1.00 65.78  ? 81  ASP C CB    1 
ATOM   7729  C  CG    . ASP C  1 81  ? 49.782  -0.852   45.550  1.00 67.46  ? 81  ASP C CG    1 
ATOM   7730  O  OD1   . ASP C  1 81  ? 49.698  -0.992   44.305  1.00 71.41  ? 81  ASP C OD1   1 
ATOM   7731  O  OD2   . ASP C  1 81  ? 49.141  -1.554   46.355  1.00 67.76  ? 81  ASP C OD2   1 
ATOM   7732  N  N     . ARG C  1 82  ? 52.868  -0.954   43.642  1.00 71.79  ? 82  ARG C N     1 
ATOM   7733  C  CA    . ARG C  1 82  ? 53.709  -2.093   43.290  1.00 74.22  ? 82  ARG C CA    1 
ATOM   7734  C  C     . ARG C  1 82  ? 55.095  -2.096   43.963  1.00 75.34  ? 82  ARG C C     1 
ATOM   7735  O  O     . ARG C  1 82  ? 55.655  -3.167   44.204  1.00 77.04  ? 82  ARG C O     1 
ATOM   7736  C  CB    . ARG C  1 82  ? 53.839  -2.223   41.769  1.00 77.27  ? 82  ARG C CB    1 
ATOM   7737  C  CG    . ARG C  1 82  ? 54.466  -1.022   41.059  1.00 79.21  ? 82  ARG C CG    1 
ATOM   7738  C  CD    . ARG C  1 82  ? 54.618  -1.308   39.586  1.00 84.02  ? 82  ARG C CD    1 
ATOM   7739  N  NE    . ARG C  1 82  ? 55.316  -2.580   39.377  1.00 88.18  ? 82  ARG C NE    1 
ATOM   7740  C  CZ    . ARG C  1 82  ? 55.278  -3.295   38.254  1.00 91.96  ? 82  ARG C CZ    1 
ATOM   7741  N  NH1   . ARG C  1 82  ? 54.560  -2.872   37.215  1.00 93.06  ? 82  ARG C NH1   1 
ATOM   7742  N  NH2   . ARG C  1 82  ? 55.955  -4.441   38.170  1.00 94.40  ? 82  ARG C NH2   1 
ATOM   7743  N  N     . LEU C  1 83  ? 55.632  -0.912   44.274  1.00 74.76  ? 83  LEU C N     1 
ATOM   7744  C  CA    . LEU C  1 83  ? 57.007  -0.798   44.790  1.00 76.36  ? 83  LEU C CA    1 
ATOM   7745  C  C     . LEU C  1 83  ? 57.096  -0.640   46.309  1.00 74.33  ? 83  LEU C C     1 
ATOM   7746  O  O     . LEU C  1 83  ? 58.169  -0.804   46.887  1.00 76.30  ? 83  LEU C O     1 
ATOM   7747  C  CB    . LEU C  1 83  ? 57.776  0.338    44.094  1.00 78.27  ? 83  LEU C CB    1 
ATOM   7748  C  CG    . LEU C  1 83  ? 58.086  0.247    42.596  1.00 80.93  ? 83  LEU C CG    1 
ATOM   7749  C  CD1   . LEU C  1 83  ? 58.391  1.625    42.049  1.00 81.92  ? 83  LEU C CD1   1 
ATOM   7750  C  CD2   . LEU C  1 83  ? 59.227  -0.706   42.306  1.00 83.35  ? 83  LEU C CD2   1 
ATOM   7751  N  N     . VAL C  1 84  ? 55.974  -0.316   46.941  1.00 71.05  ? 84  VAL C N     1 
ATOM   7752  C  CA    . VAL C  1 84  ? 55.869  -0.255   48.400  1.00 69.22  ? 84  VAL C CA    1 
ATOM   7753  C  C     . VAL C  1 84  ? 55.940  -1.668   48.985  1.00 69.69  ? 84  VAL C C     1 
ATOM   7754  O  O     . VAL C  1 84  ? 55.411  -2.606   48.398  1.00 70.17  ? 84  VAL C O     1 
ATOM   7755  C  CB    . VAL C  1 84  ? 54.540  0.427    48.833  1.00 66.18  ? 84  VAL C CB    1 
ATOM   7756  C  CG1   . VAL C  1 84  ? 54.444  0.533    50.353  1.00 65.10  ? 84  VAL C CG1   1 
ATOM   7757  C  CG2   . VAL C  1 84  ? 54.428  1.819    48.211  1.00 65.75  ? 84  VAL C CG2   1 
ATOM   7758  N  N     . LYS C  1 85  ? 56.617  -1.816   50.124  1.00 70.11  ? 85  LYS C N     1 
ATOM   7759  C  CA    . LYS C  1 85  ? 56.720  -3.107   50.817  1.00 70.66  ? 85  LYS C CA    1 
ATOM   7760  C  C     . LYS C  1 85  ? 56.472  -2.961   52.318  1.00 69.21  ? 85  LYS C C     1 
ATOM   7761  O  O     . LYS C  1 85  ? 56.632  -1.877   52.873  1.00 68.32  ? 85  LYS C O     1 
ATOM   7762  C  CB    . LYS C  1 85  ? 58.096  -3.732   50.584  1.00 74.43  ? 85  LYS C CB    1 
ATOM   7763  C  CG    . LYS C  1 85  ? 58.322  -4.307   49.188  1.00 76.62  ? 85  LYS C CG    1 
ATOM   7764  C  CD    . LYS C  1 85  ? 59.467  -5.310   49.183  1.00 79.72  ? 85  LYS C CD    1 
ATOM   7765  C  CE    . LYS C  1 85  ? 59.684  -5.877   47.798  1.00 82.60  ? 85  LYS C CE    1 
ATOM   7766  N  NZ    . LYS C  1 85  ? 61.120  -6.313   47.583  1.00 88.34  ? 85  LYS C NZ    1 
ATOM   7767  N  N     . GLU C  1 86  ? 56.078  -4.047   52.978  1.00 69.38  ? 86  GLU C N     1 
ATOM   7768  C  CA    . GLU C  1 86  ? 55.938  -4.025   54.429  1.00 69.15  ? 86  GLU C CA    1 
ATOM   7769  C  C     . GLU C  1 86  ? 57.278  -3.696   55.050  1.00 71.94  ? 86  GLU C C     1 
ATOM   7770  O  O     . GLU C  1 86  ? 58.289  -4.322   54.724  1.00 75.26  ? 86  GLU C O     1 
ATOM   7771  C  CB    . GLU C  1 86  ? 55.452  -5.362   54.980  1.00 69.77  ? 86  GLU C CB    1 
ATOM   7772  C  CG    . GLU C  1 86  ? 55.300  -5.331   56.500  1.00 70.19  ? 86  GLU C CG    1 
ATOM   7773  C  CD    . GLU C  1 86  ? 55.452  -6.683   57.171  1.00 73.40  ? 86  GLU C CD    1 
ATOM   7774  O  OE1   . GLU C  1 86  ? 55.355  -7.728   56.494  1.00 75.06  ? 86  GLU C OE1   1 
ATOM   7775  O  OE2   . GLU C  1 86  ? 55.668  -6.693   58.401  1.00 75.25  ? 86  GLU C OE2   1 
ATOM   7776  N  N     . GLY C  1 87  ? 57.295  -2.715   55.942  1.00 71.44  ? 87  GLY C N     1 
ATOM   7777  C  CA    . GLY C  1 87  ? 58.546  -2.322   56.591  1.00 74.11  ? 87  GLY C CA    1 
ATOM   7778  C  C     . GLY C  1 87  ? 59.148  -1.070   55.987  1.00 74.18  ? 87  GLY C C     1 
ATOM   7779  O  O     . GLY C  1 87  ? 59.870  -0.349   56.661  1.00 75.59  ? 87  GLY C O     1 
ATOM   7780  N  N     . GLU C  1 88  ? 58.850  -0.815   54.718  1.00 73.19  ? 88  GLU C N     1 
ATOM   7781  C  CA    . GLU C  1 88  ? 59.258  0.409    54.044  1.00 73.75  ? 88  GLU C CA    1 
ATOM   7782  C  C     . GLU C  1 88  ? 59.001  1.682    54.877  1.00 72.28  ? 88  GLU C C     1 
ATOM   7783  O  O     . GLU C  1 88  ? 58.037  1.772    55.651  1.00 70.14  ? 88  GLU C O     1 
ATOM   7784  C  CB    . GLU C  1 88  ? 58.572  0.503    52.684  1.00 72.64  ? 88  GLU C CB    1 
ATOM   7785  C  CG    . GLU C  1 88  ? 58.879  1.771    51.909  1.00 75.41  ? 88  GLU C CG    1 
ATOM   7786  C  CD    . GLU C  1 88  ? 58.659  1.627    50.408  1.00 79.12  ? 88  GLU C CD    1 
ATOM   7787  O  OE1   . GLU C  1 88  ? 58.682  0.482    49.893  1.00 81.25  ? 88  GLU C OE1   1 
ATOM   7788  O  OE2   . GLU C  1 88  ? 58.474  2.672    49.744  1.00 79.56  ? 88  GLU C OE2   1 
ATOM   7789  N  N     . LEU C  1 89  ? 59.884  2.658    54.688  1.00 73.73  ? 89  LEU C N     1 
ATOM   7790  C  CA    . LEU C  1 89  ? 59.939  3.872    55.484  1.00 73.20  ? 89  LEU C CA    1 
ATOM   7791  C  C     . LEU C  1 89  ? 59.192  5.024    54.803  1.00 70.89  ? 89  LEU C C     1 
ATOM   7792  O  O     . LEU C  1 89  ? 59.425  5.329    53.629  1.00 71.35  ? 89  LEU C O     1 
ATOM   7793  C  CB    . LEU C  1 89  ? 61.409  4.238    55.705  1.00 77.03  ? 89  LEU C CB    1 
ATOM   7794  C  CG    . LEU C  1 89  ? 61.814  5.346    56.676  1.00 78.29  ? 89  LEU C CG    1 
ATOM   7795  C  CD1   . LEU C  1 89  ? 63.189  5.042    57.228  1.00 81.88  ? 89  LEU C CD1   1 
ATOM   7796  C  CD2   . LEU C  1 89  ? 61.786  6.714    56.001  1.00 77.73  ? 89  LEU C CD2   1 
ATOM   7797  N  N     . VAL C  1 90  ? 58.312  5.663    55.568  1.00 68.55  ? 90  VAL C N     1 
ATOM   7798  C  CA    . VAL C  1 90  ? 57.452  6.735    55.090  1.00 66.72  ? 90  VAL C CA    1 
ATOM   7799  C  C     . VAL C  1 90  ? 57.875  8.009    55.808  1.00 67.72  ? 90  VAL C C     1 
ATOM   7800  O  O     . VAL C  1 90  ? 58.116  7.997    57.017  1.00 68.42  ? 90  VAL C O     1 
ATOM   7801  C  CB    . VAL C  1 90  ? 55.962  6.438    55.432  1.00 64.31  ? 90  VAL C CB    1 
ATOM   7802  C  CG1   . VAL C  1 90  ? 55.015  7.373    54.684  1.00 63.12  ? 90  VAL C CG1   1 
ATOM   7803  C  CG2   . VAL C  1 90  ? 55.613  5.002    55.127  1.00 63.69  ? 90  VAL C CG2   1 
ATOM   7804  N  N     . LYS C  1 91  ? 57.948  9.112    55.077  1.00 68.18  ? 91  LYS C N     1 
ATOM   7805  C  CA    . LYS C  1 91  ? 58.499  10.341   55.628  1.00 70.10  ? 91  LYS C CA    1 
ATOM   7806  C  C     . LYS C  1 91  ? 57.446  11.438   55.650  1.00 68.89  ? 91  LYS C C     1 
ATOM   7807  O  O     . LYS C  1 91  ? 56.693  11.590   54.689  1.00 68.05  ? 91  LYS C O     1 
ATOM   7808  C  CB    . LYS C  1 91  ? 59.708  10.774   54.792  1.00 72.95  ? 91  LYS C CB    1 
ATOM   7809  C  CG    . LYS C  1 91  ? 60.468  11.958   55.346  1.00 76.51  ? 91  LYS C CG    1 
ATOM   7810  C  CD    . LYS C  1 91  ? 61.207  12.741   54.263  1.00 80.44  ? 91  LYS C CD    1 
ATOM   7811  C  CE    . LYS C  1 91  ? 61.302  14.226   54.661  1.00 82.69  ? 91  LYS C CE    1 
ATOM   7812  N  NZ    . LYS C  1 91  ? 62.587  14.888   54.252  1.00 86.79  ? 91  LYS C NZ    1 
ATOM   7813  N  N     . ARG C  1 92  ? 57.377  12.187   56.752  1.00 69.56  ? 92  ARG C N     1 
ATOM   7814  C  CA    . ARG C  1 92  ? 56.572  13.415   56.823  1.00 69.25  ? 92  ARG C CA    1 
ATOM   7815  C  C     . ARG C  1 92  ? 57.100  14.427   55.830  1.00 71.13  ? 92  ARG C C     1 
ATOM   7816  O  O     . ARG C  1 92  ? 58.308  14.559   55.664  1.00 74.04  ? 92  ARG C O     1 
ATOM   7817  C  CB    . ARG C  1 92  ? 56.672  14.050   58.204  1.00 70.17  ? 92  ARG C CB    1 
ATOM   7818  C  CG    . ARG C  1 92  ? 55.765  13.463   59.249  1.00 68.99  ? 92  ARG C CG    1 
ATOM   7819  C  CD    . ARG C  1 92  ? 55.474  14.490   60.324  1.00 70.88  ? 92  ARG C CD    1 
ATOM   7820  N  NE    . ARG C  1 92  ? 54.991  15.754   59.756  1.00 71.65  ? 92  ARG C NE    1 
ATOM   7821  C  CZ    . ARG C  1 92  ? 54.902  16.900   60.425  1.00 73.42  ? 92  ARG C CZ    1 
ATOM   7822  N  NH1   . ARG C  1 92  ? 55.260  16.967   61.705  1.00 74.29  ? 92  ARG C NH1   1 
ATOM   7823  N  NH2   . ARG C  1 92  ? 54.455  17.985   59.810  1.00 73.77  ? 92  ARG C NH2   1 
ATOM   7824  N  N     . THR C  1 93  ? 56.212  15.145   55.167  1.00 70.73  ? 93  THR C N     1 
ATOM   7825  C  CA    . THR C  1 93  ? 56.643  16.254   54.329  1.00 73.12  ? 93  THR C CA    1 
ATOM   7826  C  C     . THR C  1 93  ? 56.506  17.536   55.136  1.00 74.39  ? 93  THR C C     1 
ATOM   7827  O  O     . THR C  1 93  ? 57.223  18.503   54.907  1.00 77.14  ? 93  THR C O     1 
ATOM   7828  C  CB    . THR C  1 93  ? 55.852  16.313   52.984  1.00 72.53  ? 93  THR C CB    1 
ATOM   7829  O  OG1   . THR C  1 93  ? 56.243  15.209   52.165  1.00 72.93  ? 93  THR C OG1   1 
ATOM   7830  C  CG2   . THR C  1 93  ? 56.146  17.578   52.199  1.00 75.42  ? 93  THR C CG2   1 
ATOM   7831  N  N     . GLY C  1 94  ? 55.599  17.521   56.104  1.00 73.06  ? 94  GLY C N     1 
ATOM   7832  C  CA    . GLY C  1 94  ? 55.209  18.731   56.807  1.00 74.34  ? 94  GLY C CA    1 
ATOM   7833  C  C     . GLY C  1 94  ? 54.309  19.664   56.007  1.00 74.74  ? 94  GLY C C     1 
ATOM   7834  O  O     . GLY C  1 94  ? 54.068  20.789   56.435  1.00 76.97  ? 94  GLY C O     1 
ATOM   7835  N  N     . ASN C  1 95  ? 53.817  19.220   54.852  1.00 73.27  ? 95  ASN C N     1 
ATOM   7836  C  CA    . ASN C  1 95  ? 52.944  20.059   54.038  1.00 74.25  ? 95  ASN C CA    1 
ATOM   7837  C  C     . ASN C  1 95  ? 51.562  19.435   53.809  1.00 72.57  ? 95  ASN C C     1 
ATOM   7838  O  O     . ASN C  1 95  ? 51.438  18.234   53.504  1.00 70.95  ? 95  ASN C O     1 
ATOM   7839  C  CB    . ASN C  1 95  ? 53.596  20.394   52.691  1.00 75.95  ? 95  ASN C CB    1 
ATOM   7840  C  CG    . ASN C  1 95  ? 54.903  21.181   52.835  1.00 79.04  ? 95  ASN C CG    1 
ATOM   7841  O  OD1   . ASN C  1 95  ? 55.957  20.722   52.408  1.00 79.66  ? 95  ASN C OD1   1 
ATOM   7842  N  ND2   . ASN C  1 95  ? 54.833  22.370   53.424  1.00 80.85  ? 95  ASN C ND2   1 
ATOM   7843  N  N     . ILE C  1 96  ? 50.519  20.244   53.970  1.00 73.04  ? 96  ILE C N     1 
ATOM   7844  C  CA    . ILE C  1 96  ? 49.193  19.836   53.553  1.00 71.30  ? 96  ILE C CA    1 
ATOM   7845  C  C     . ILE C  1 96  ? 49.231  19.903   52.034  1.00 72.29  ? 96  ILE C C     1 
ATOM   7846  O  O     . ILE C  1 96  ? 49.883  20.778   51.467  1.00 74.59  ? 96  ILE C O     1 
ATOM   7847  C  CB    . ILE C  1 96  ? 48.106  20.776   54.140  1.00 72.87  ? 96  ILE C CB    1 
ATOM   7848  C  CG1   . ILE C  1 96  ? 48.197  20.838   55.674  1.00 72.07  ? 96  ILE C CG1   1 
ATOM   7849  C  CG2   . ILE C  1 96  ? 46.695  20.386   53.678  1.00 72.12  ? 96  ILE C CG2   1 
ATOM   7850  C  CD1   . ILE C  1 96  ? 48.346  19.501   56.376  1.00 68.63  ? 96  ILE C CD1   1 
ATOM   7851  N  N     . VAL C  1 97  ? 48.561  18.969   51.371  1.00 70.96  ? 97  VAL C N     1 
ATOM   7852  C  CA    . VAL C  1 97  ? 48.594  18.917   49.912  1.00 72.15  ? 97  VAL C CA    1 
ATOM   7853  C  C     . VAL C  1 97  ? 48.365  20.302   49.305  1.00 75.82  ? 97  VAL C C     1 
ATOM   7854  O  O     . VAL C  1 97  ? 47.346  20.941   49.568  1.00 77.08  ? 97  VAL C O     1 
ATOM   7855  C  CB    . VAL C  1 97  ? 47.577  17.912   49.350  1.00 70.54  ? 97  VAL C CB    1 
ATOM   7856  C  CG1   . VAL C  1 97  ? 47.735  17.793   47.847  1.00 71.40  ? 97  VAL C CG1   1 
ATOM   7857  C  CG2   . VAL C  1 97  ? 47.771  16.570   50.002  1.00 67.66  ? 97  VAL C CG2   1 
ATOM   7858  N  N     . ASP C  1 98  ? 49.327  20.765   48.513  1.00 66.44  ? 98  ASP C N     1 
ATOM   7859  C  CA    . ASP C  1 98  ? 49.224  22.070   47.880  1.00 67.68  ? 98  ASP C CA    1 
ATOM   7860  C  C     . ASP C  1 98  ? 49.463  21.977   46.366  1.00 67.77  ? 98  ASP C C     1 
ATOM   7861  O  O     . ASP C  1 98  ? 49.568  20.880   45.828  1.00 66.97  ? 98  ASP C O     1 
ATOM   7862  C  CB    . ASP C  1 98  ? 50.208  23.031   48.538  1.00 69.84  ? 98  ASP C CB    1 
ATOM   7863  C  CG    . ASP C  1 98  ? 51.646  22.633   48.302  1.00 73.11  ? 98  ASP C CG    1 
ATOM   7864  O  OD1   . ASP C  1 98  ? 51.894  21.427   48.061  1.00 74.63  ? 98  ASP C OD1   1 
ATOM   7865  O  OD2   . ASP C  1 98  ? 52.532  23.519   48.350  1.00 75.88  ? 98  ASP C OD2   1 
ATOM   7866  N  N     . VAL C  1 99  ? 49.521  23.126   45.689  1.00 68.73  ? 99  VAL C N     1 
ATOM   7867  C  CA    . VAL C  1 99  ? 49.860  23.194   44.260  1.00 69.36  ? 99  VAL C CA    1 
ATOM   7868  C  C     . VAL C  1 99  ? 50.478  24.521   43.868  1.00 71.26  ? 99  VAL C C     1 
ATOM   7869  O  O     . VAL C  1 99  ? 50.185  25.545   44.483  1.00 71.53  ? 99  VAL C O     1 
ATOM   7870  C  CB    . VAL C  1 99  ? 48.640  22.999   43.301  1.00 68.01  ? 99  VAL C CB    1 
ATOM   7871  C  CG1   . VAL C  1 99  ? 48.473  21.555   42.937  1.00 66.81  ? 99  VAL C CG1   1 
ATOM   7872  C  CG2   . VAL C  1 99  ? 47.354  23.631   43.857  1.00 66.94  ? 99  VAL C CG2   1 
ATOM   7873  N  N     . PRO C  1 100 ? 51.320  24.507   42.819  1.00 72.62  ? 100 PRO C N     1 
ATOM   7874  C  CA    . PRO C  1 100 ? 51.774  25.728   42.159  1.00 74.65  ? 100 PRO C CA    1 
ATOM   7875  C  C     . PRO C  1 100 ? 50.610  26.465   41.508  1.00 74.13  ? 100 PRO C C     1 
ATOM   7876  O  O     . PRO C  1 100 ? 49.801  25.853   40.809  1.00 73.02  ? 100 PRO C O     1 
ATOM   7877  C  CB    . PRO C  1 100 ? 52.721  25.207   41.075  1.00 75.66  ? 100 PRO C CB    1 
ATOM   7878  C  CG    . PRO C  1 100 ? 52.328  23.781   40.873  1.00 73.82  ? 100 PRO C CG    1 
ATOM   7879  C  CD    . PRO C  1 100 ? 51.951  23.312   42.234  1.00 72.51  ? 100 PRO C CD    1 
ATOM   7880  N  N     . VAL C  1 101 ? 50.522  27.766   41.753  1.00 75.22  ? 101 VAL C N     1 
ATOM   7881  C  CA    . VAL C  1 101 ? 49.526  28.610   41.108  1.00 75.11  ? 101 VAL C CA    1 
ATOM   7882  C  C     . VAL C  1 101 ? 50.229  29.808   40.507  1.00 77.58  ? 101 VAL C C     1 
ATOM   7883  O  O     . VAL C  1 101 ? 51.333  30.158   40.924  1.00 79.29  ? 101 VAL C O     1 
ATOM   7884  C  CB    . VAL C  1 101 ? 48.445  29.095   42.096  1.00 74.03  ? 101 VAL C CB    1 
ATOM   7885  C  CG1   . VAL C  1 101 ? 47.579  27.926   42.579  1.00 72.48  ? 101 VAL C CG1   1 
ATOM   7886  C  CG2   . VAL C  1 101 ? 49.069  29.814   43.287  1.00 75.62  ? 101 VAL C CG2   1 
ATOM   7887  N  N     . GLY C  1 102 ? 49.593  30.437   39.527  1.00 77.92  ? 102 GLY C N     1 
ATOM   7888  C  CA    . GLY C  1 102 ? 50.142  31.651   38.935  1.00 80.17  ? 102 GLY C CA    1 
ATOM   7889  C  C     . GLY C  1 102 ? 49.869  31.763   37.451  1.00 80.62  ? 102 GLY C C     1 
ATOM   7890  O  O     . GLY C  1 102 ? 49.476  30.778   36.820  1.00 79.31  ? 102 GLY C O     1 
ATOM   7891  N  N     . PRO C  1 103 ? 50.092  32.963   36.878  1.00 82.55  ? 103 PRO C N     1 
ATOM   7892  C  CA    . PRO C  1 103 ? 49.811  33.190   35.466  1.00 83.33  ? 103 PRO C CA    1 
ATOM   7893  C  C     . PRO C  1 103 ? 50.723  32.336   34.596  1.00 84.02  ? 103 PRO C C     1 
ATOM   7894  O  O     . PRO C  1 103 ? 50.355  31.977   33.472  1.00 83.68  ? 103 PRO C O     1 
ATOM   7895  C  CB    . PRO C  1 103 ? 50.131  34.675   35.280  1.00 85.79  ? 103 PRO C CB    1 
ATOM   7896  C  CG    . PRO C  1 103 ? 51.158  34.971   36.308  1.00 87.04  ? 103 PRO C CG    1 
ATOM   7897  C  CD    . PRO C  1 103 ? 50.792  34.108   37.490  1.00 84.71  ? 103 PRO C CD    1 
ATOM   7898  N  N     . GLY C  1 104 ? 51.893  31.996   35.137  1.00 84.86  ? 104 GLY C N     1 
ATOM   7899  C  CA    . GLY C  1 104 ? 52.867  31.166   34.447  1.00 86.04  ? 104 GLY C CA    1 
ATOM   7900  C  C     . GLY C  1 104 ? 52.295  29.880   33.887  1.00 84.54  ? 104 GLY C C     1 
ATOM   7901  O  O     . GLY C  1 104 ? 52.850  29.309   32.949  1.00 85.67  ? 104 GLY C O     1 
ATOM   7902  N  N     . LEU C  1 105 ? 51.176  29.436   34.452  1.00 82.27  ? 105 LEU C N     1 
ATOM   7903  C  CA    . LEU C  1 105 ? 50.600  28.151   34.111  1.00 80.56  ? 105 LEU C CA    1 
ATOM   7904  C  C     . LEU C  1 105 ? 49.801  28.128   32.818  1.00 80.46  ? 105 LEU C C     1 
ATOM   7905  O  O     . LEU C  1 105 ? 49.466  27.049   32.331  1.00 79.63  ? 105 LEU C O     1 
ATOM   7906  C  CB    . LEU C  1 105 ? 49.727  27.635   35.257  1.00 78.40  ? 105 LEU C CB    1 
ATOM   7907  C  CG    . LEU C  1 105 ? 50.479  26.893   36.360  1.00 78.34  ? 105 LEU C CG    1 
ATOM   7908  C  CD1   . LEU C  1 105 ? 50.818  27.838   37.519  1.00 79.07  ? 105 LEU C CD1   1 
ATOM   7909  C  CD2   . LEU C  1 105 ? 49.657  25.709   36.837  1.00 75.48  ? 105 LEU C CD2   1 
ATOM   7910  N  N     . LEU C  1 106 ? 49.474  29.292   32.265  1.00 81.58  ? 106 LEU C N     1 
ATOM   7911  C  CA    . LEU C  1 106 ? 48.664  29.330   31.045  1.00 81.60  ? 106 LEU C CA    1 
ATOM   7912  C  C     . LEU C  1 106 ? 49.310  28.514   29.938  1.00 82.44  ? 106 LEU C C     1 
ATOM   7913  O  O     . LEU C  1 106 ? 50.505  28.248   29.975  1.00 83.71  ? 106 LEU C O     1 
ATOM   7914  C  CB    . LEU C  1 106 ? 48.418  30.762   30.584  1.00 83.21  ? 106 LEU C CB    1 
ATOM   7915  C  CG    . LEU C  1 106 ? 47.495  31.588   31.480  1.00 82.64  ? 106 LEU C CG    1 
ATOM   7916  C  CD1   . LEU C  1 106 ? 47.363  32.969   30.897  1.00 84.34  ? 106 LEU C CD1   1 
ATOM   7917  C  CD2   . LEU C  1 106 ? 46.126  30.935   31.638  1.00 79.62  ? 106 LEU C CD2   1 
ATOM   7918  N  N     . GLY C  1 107 ? 48.513  28.084   28.971  1.00 82.06  ? 107 GLY C N     1 
ATOM   7919  C  CA    . GLY C  1 107 ? 49.023  27.278   27.872  1.00 82.88  ? 107 GLY C CA    1 
ATOM   7920  C  C     . GLY C  1 107 ? 49.528  25.897   28.242  1.00 81.81  ? 107 GLY C C     1 
ATOM   7921  O  O     . GLY C  1 107 ? 49.947  25.158   27.359  1.00 82.79  ? 107 GLY C O     1 
ATOM   7922  N  N     . ARG C  1 108 ? 49.483  25.536   29.527  1.00 80.18  ? 108 ARG C N     1 
ATOM   7923  C  CA    . ARG C  1 108 ? 50.054  24.264   29.995  1.00 79.31  ? 108 ARG C CA    1 
ATOM   7924  C  C     . ARG C  1 108 ? 49.034  23.194   30.418  1.00 77.16  ? 108 ARG C C     1 
ATOM   7925  O  O     . ARG C  1 108 ? 47.853  23.481   30.657  1.00 75.89  ? 108 ARG C O     1 
ATOM   7926  C  CB    . ARG C  1 108 ? 51.055  24.486   31.137  1.00 79.64  ? 108 ARG C CB    1 
ATOM   7927  C  CG    . ARG C  1 108 ? 52.142  25.533   30.884  1.00 81.93  ? 108 ARG C CG    1 
ATOM   7928  C  CD    . ARG C  1 108 ? 53.198  25.091   29.867  1.00 84.11  ? 108 ARG C CD    1 
ATOM   7929  N  NE    . ARG C  1 108 ? 53.939  23.909   30.307  1.00 83.88  ? 108 ARG C NE    1 
ATOM   7930  C  CZ    . ARG C  1 108 ? 55.102  23.934   30.949  1.00 84.40  ? 108 ARG C CZ    1 
ATOM   7931  N  NH1   . ARG C  1 108 ? 55.686  25.087   31.245  1.00 85.79  ? 108 ARG C NH1   1 
ATOM   7932  N  NH2   . ARG C  1 108 ? 55.678  22.794   31.303  1.00 83.86  ? 108 ARG C NH2   1 
ATOM   7933  N  N     . VAL C  1 109 ? 49.526  21.953   30.493  1.00 76.86  ? 109 VAL C N     1 
ATOM   7934  C  CA    . VAL C  1 109 ? 48.771  20.792   30.967  1.00 74.52  ? 109 VAL C CA    1 
ATOM   7935  C  C     . VAL C  1 109 ? 49.564  20.114   32.087  1.00 74.25  ? 109 VAL C C     1 
ATOM   7936  O  O     . VAL C  1 109 ? 50.703  19.685   31.880  1.00 75.55  ? 109 VAL C O     1 
ATOM   7937  C  CB    . VAL C  1 109 ? 48.550  19.744   29.852  1.00 74.61  ? 109 VAL C CB    1 
ATOM   7938  C  CG1   . VAL C  1 109 ? 47.611  18.620   30.346  1.00 71.78  ? 109 VAL C CG1   1 
ATOM   7939  C  CG2   . VAL C  1 109 ? 48.028  20.391   28.570  1.00 75.31  ? 109 VAL C CG2   1 
ATOM   7940  N  N     . VAL C  1 110 ? 48.955  20.011   33.266  1.00 72.63  ? 110 VAL C N     1 
ATOM   7941  C  CA    . VAL C  1 110 ? 49.623  19.461   34.444  1.00 71.89  ? 110 VAL C CA    1 
ATOM   7942  C  C     . VAL C  1 110 ? 48.782  18.334   35.035  1.00 70.01  ? 110 VAL C C     1 
ATOM   7943  O  O     . VAL C  1 110 ? 47.606  18.189   34.676  1.00 68.99  ? 110 VAL C O     1 
ATOM   7944  C  CB    . VAL C  1 110 ? 49.867  20.559   35.500  1.00 72.29  ? 110 VAL C CB    1 
ATOM   7945  C  CG1   . VAL C  1 110 ? 50.684  21.702   34.894  1.00 74.67  ? 110 VAL C CG1   1 
ATOM   7946  C  CG2   . VAL C  1 110 ? 48.549  21.079   36.075  1.00 70.32  ? 110 VAL C CG2   1 
ATOM   7947  N  N     . ASP C  1 111 ? 49.365  17.526   35.924  1.00 69.54  ? 111 ASP C N     1 
ATOM   7948  C  CA    . ASP C  1 111 ? 48.552  16.563   36.680  1.00 67.67  ? 111 ASP C CA    1 
ATOM   7949  C  C     . ASP C  1 111 ? 47.928  17.222   37.906  1.00 66.37  ? 111 ASP C C     1 
ATOM   7950  O  O     . ASP C  1 111 ? 47.991  18.440   38.055  1.00 67.15  ? 111 ASP C O     1 
ATOM   7951  C  CB    . ASP C  1 111 ? 49.321  15.278   37.048  1.00 67.93  ? 111 ASP C CB    1 
ATOM   7952  C  CG    . ASP C  1 111 ? 50.454  15.510   38.050  1.00 70.05  ? 111 ASP C CG    1 
ATOM   7953  O  OD1   . ASP C  1 111 ? 50.464  16.549   38.768  1.00 71.02  ? 111 ASP C OD1   1 
ATOM   7954  O  OD2   . ASP C  1 111 ? 51.343  14.622   38.117  1.00 71.25  ? 111 ASP C OD2   1 
ATOM   7955  N  N     . ALA C  1 112 ? 47.338  16.418   38.783  1.00 64.50  ? 112 ALA C N     1 
ATOM   7956  C  CA    . ALA C  1 112 ? 46.581  16.947   39.911  1.00 63.08  ? 112 ALA C CA    1 
ATOM   7957  C  C     . ALA C  1 112 ? 47.447  17.749   40.869  1.00 63.75  ? 112 ALA C C     1 
ATOM   7958  O  O     . ALA C  1 112 ? 46.989  18.734   41.433  1.00 63.52  ? 112 ALA C O     1 
ATOM   7959  C  CB    . ALA C  1 112 ? 45.858  15.819   40.641  1.00 61.59  ? 112 ALA C CB    1 
ATOM   7960  N  N     . LEU C  1 113 ? 48.699  17.327   41.028  1.00 64.70  ? 113 LEU C N     1 
ATOM   7961  C  CA    . LEU C  1 113 ? 49.658  17.977   41.930  1.00 65.88  ? 113 LEU C CA    1 
ATOM   7962  C  C     . LEU C  1 113 ? 50.442  19.131   41.268  1.00 68.14  ? 113 LEU C C     1 
ATOM   7963  O  O     . LEU C  1 113 ? 51.351  19.730   41.878  1.00 69.37  ? 113 LEU C O     1 
ATOM   7964  C  CB    . LEU C  1 113 ? 50.618  16.933   42.510  1.00 66.03  ? 113 LEU C CB    1 
ATOM   7965  C  CG    . LEU C  1 113 ? 49.983  15.895   43.441  1.00 63.00  ? 113 LEU C CG    1 
ATOM   7966  C  CD1   . LEU C  1 113 ? 50.799  14.618   43.448  1.00 61.44  ? 113 LEU C CD1   1 
ATOM   7967  C  CD2   . LEU C  1 113 ? 49.814  16.438   44.846  1.00 61.43  ? 113 LEU C CD2   1 
ATOM   7968  N  N     . GLY C  1 114 ? 50.069  19.443   40.026  1.00 68.49  ? 114 GLY C N     1 
ATOM   7969  C  CA    . GLY C  1 114 ? 50.620  20.575   39.308  1.00 70.34  ? 114 GLY C CA    1 
ATOM   7970  C  C     . GLY C  1 114 ? 51.940  20.273   38.636  1.00 72.39  ? 114 GLY C C     1 
ATOM   7971  O  O     . GLY C  1 114 ? 52.574  21.188   38.111  1.00 74.51  ? 114 GLY C O     1 
ATOM   7972  N  N     . ASN C  1 115 ? 52.359  19.000   38.666  1.00 72.15  ? 115 ASN C N     1 
ATOM   7973  C  CA    . ASN C  1 115 ? 53.497  18.498   37.870  1.00 73.64  ? 115 ASN C CA    1 
ATOM   7974  C  C     . ASN C  1 115 ? 53.174  18.615   36.387  1.00 74.17  ? 115 ASN C C     1 
ATOM   7975  O  O     . ASN C  1 115 ? 52.126  18.127   35.956  1.00 73.20  ? 115 ASN C O     1 
ATOM   7976  C  CB    . ASN C  1 115 ? 53.773  17.017   38.171  1.00 72.68  ? 115 ASN C CB    1 
ATOM   7977  C  CG    . ASN C  1 115 ? 53.985  16.740   39.642  1.00 72.45  ? 115 ASN C CG    1 
ATOM   7978  O  OD1   . ASN C  1 115 ? 54.990  17.127   40.215  1.00 74.41  ? 115 ASN C OD1   1 
ATOM   7979  N  ND2   . ASN C  1 115 ? 53.034  16.059   40.260  1.00 72.54  ? 115 ASN C ND2   1 
ATOM   7980  N  N     . PRO C  1 116 ? 54.067  19.233   35.592  1.00 76.19  ? 116 PRO C N     1 
ATOM   7981  C  CA    . PRO C  1 116 ? 53.752  19.396   34.170  1.00 76.65  ? 116 PRO C CA    1 
ATOM   7982  C  C     . PRO C  1 116 ? 53.787  18.048   33.459  1.00 75.96  ? 116 PRO C C     1 
ATOM   7983  O  O     . PRO C  1 116 ? 54.723  17.279   33.681  1.00 76.50  ? 116 PRO C O     1 
ATOM   7984  C  CB    . PRO C  1 116 ? 54.878  20.306   33.659  1.00 79.31  ? 116 PRO C CB    1 
ATOM   7985  C  CG    . PRO C  1 116 ? 56.041  20.019   34.553  1.00 80.28  ? 116 PRO C CG    1 
ATOM   7986  C  CD    . PRO C  1 116 ? 55.479  19.546   35.889  1.00 78.66  ? 116 PRO C CD    1 
ATOM   7987  N  N     . ILE C  1 117 ? 52.766  17.767   32.642  1.00 74.88  ? 117 ILE C N     1 
ATOM   7988  C  CA    . ILE C  1 117 ? 52.698  16.529   31.833  1.00 74.51  ? 117 ILE C CA    1 
ATOM   7989  C  C     . ILE C  1 117 ? 52.697  16.732   30.297  1.00 76.32  ? 117 ILE C C     1 
ATOM   7990  O  O     . ILE C  1 117 ? 52.436  15.779   29.551  1.00 76.06  ? 117 ILE C O     1 
ATOM   7991  C  CB    . ILE C  1 117 ? 51.521  15.593   32.249  1.00 71.98  ? 117 ILE C CB    1 
ATOM   7992  C  CG1   . ILE C  1 117 ? 50.178  16.348   32.281  1.00 69.94  ? 117 ILE C CG1   1 
ATOM   7993  C  CG2   . ILE C  1 117 ? 51.824  14.920   33.586  1.00 71.02  ? 117 ILE C CG2   1 
ATOM   7994  C  CD1   . ILE C  1 117 ? 48.987  15.529   31.865  1.00 64.99  ? 117 ILE C CD1   1 
ATOM   7995  N  N     . ASP C  1 118 ? 53.007  17.952   29.836  1.00 78.18  ? 118 ASP C N     1 
ATOM   7996  C  CA    . ASP C  1 118 ? 53.104  18.255   28.396  1.00 80.13  ? 118 ASP C CA    1 
ATOM   7997  C  C     . ASP C  1 118 ? 54.533  18.213   27.860  1.00 82.84  ? 118 ASP C C     1 
ATOM   7998  O  O     . ASP C  1 118 ? 54.774  18.568   26.705  1.00 84.89  ? 118 ASP C O     1 
ATOM   7999  C  CB    . ASP C  1 118 ? 52.427  19.598   28.034  1.00 80.68  ? 118 ASP C CB    1 
ATOM   8000  C  CG    . ASP C  1 118 ? 52.843  20.772   28.951  1.00 81.86  ? 118 ASP C CG    1 
ATOM   8001  O  OD1   . ASP C  1 118 ? 53.874  20.677   29.657  1.00 82.74  ? 118 ASP C OD1   1 
ATOM   8002  O  OD2   . ASP C  1 118 ? 52.127  21.808   28.955  1.00 81.46  ? 118 ASP C OD2   1 
ATOM   8003  N  N     . GLY C  1 119 ? 55.477  17.794   28.702  1.00 83.19  ? 119 GLY C N     1 
ATOM   8004  C  CA    . GLY C  1 119 ? 56.897  17.751   28.339  1.00 85.54  ? 119 GLY C CA    1 
ATOM   8005  C  C     . GLY C  1 119 ? 57.511  19.098   27.996  1.00 88.05  ? 119 GLY C C     1 
ATOM   8006  O  O     . GLY C  1 119 ? 58.530  19.163   27.282  1.00 90.78  ? 119 GLY C O     1 
ATOM   8007  N  N     . LYS C  1 120 ? 56.898  20.172   28.498  1.00 87.37  ? 120 LYS C N     1 
ATOM   8008  C  CA    . LYS C  1 120 ? 57.357  21.543   28.234  1.00 89.57  ? 120 LYS C CA    1 
ATOM   8009  C  C     . LYS C  1 120 ? 58.167  22.099   29.405  1.00 90.19  ? 120 LYS C C     1 
ATOM   8010  O  O     . LYS C  1 120 ? 58.424  23.305   29.482  1.00 91.46  ? 120 LYS C O     1 
ATOM   8011  C  CB    . LYS C  1 120 ? 56.182  22.475   27.886  1.00 89.05  ? 120 LYS C CB    1 
ATOM   8012  C  CG    . LYS C  1 120 ? 55.198  21.908   26.856  1.00 88.65  ? 120 LYS C CG    1 
ATOM   8013  C  CD    . LYS C  1 120 ? 54.710  22.954   25.848  1.00 89.79  ? 120 LYS C CD    1 
ATOM   8014  C  CE    . LYS C  1 120 ? 53.919  22.278   24.725  1.00 89.24  ? 120 LYS C CE    1 
ATOM   8015  N  NZ    . LYS C  1 120 ? 54.029  22.977   23.420  1.00 90.97  ? 120 LYS C NZ    1 
ATOM   8016  N  N     . GLY C  1 121 ? 58.558  21.210   30.318  1.00 89.40  ? 121 GLY C N     1 
ATOM   8017  C  CA    . GLY C  1 121 ? 59.504  21.550   31.377  1.00 90.58  ? 121 GLY C CA    1 
ATOM   8018  C  C     . GLY C  1 121 ? 58.868  22.165   32.606  1.00 89.25  ? 121 GLY C C     1 
ATOM   8019  O  O     . GLY C  1 121 ? 57.662  22.027   32.817  1.00 87.12  ? 121 GLY C O     1 
ATOM   8020  N  N     . PRO C  1 122 ? 59.674  22.869   33.422  1.00 90.81  ? 122 PRO C N     1 
ATOM   8021  C  CA    . PRO C  1 122 ? 59.173  23.368   34.709  1.00 89.55  ? 122 PRO C CA    1 
ATOM   8022  C  C     . PRO C  1 122 ? 58.027  24.366   34.530  1.00 88.91  ? 122 PRO C C     1 
ATOM   8023  O  O     . PRO C  1 122 ? 57.965  25.060   33.515  1.00 90.54  ? 122 PRO C O     1 
ATOM   8024  C  CB    . PRO C  1 122 ? 60.393  24.082   35.319  1.00 92.00  ? 122 PRO C CB    1 
ATOM   8025  C  CG    . PRO C  1 122 ? 61.577  23.730   34.432  1.00 94.02  ? 122 PRO C CG    1 
ATOM   8026  C  CD    . PRO C  1 122 ? 61.014  23.397   33.098  1.00 93.60  ? 122 PRO C CD    1 
ATOM   8027  N  N     . ILE C  1 123 ? 57.119  24.418   35.497  1.00 86.84  ? 123 ILE C N     1 
ATOM   8028  C  CA    . ILE C  1 123 ? 56.155  25.499   35.572  1.00 86.46  ? 123 ILE C CA    1 
ATOM   8029  C  C     . ILE C  1 123 ? 56.819  26.607   36.396  1.00 88.19  ? 123 ILE C C     1 
ATOM   8030  O  O     . ILE C  1 123 ? 57.546  26.310   37.348  1.00 88.68  ? 123 ILE C O     1 
ATOM   8031  C  CB    . ILE C  1 123 ? 54.864  25.039   36.292  1.00 83.79  ? 123 ILE C CB    1 
ATOM   8032  C  CG1   . ILE C  1 123 ? 54.170  23.880   35.547  1.00 82.77  ? 123 ILE C CG1   1 
ATOM   8033  C  CG2   . ILE C  1 123 ? 53.921  26.209   36.515  1.00 83.63  ? 123 ILE C CG2   1 
ATOM   8034  C  CD1   . ILE C  1 123 ? 53.691  24.201   34.111  1.00 83.77  ? 123 ILE C CD1   1 
ATOM   8035  N  N     . ASP C  1 124 ? 56.608  27.871   36.034  1.00 89.23  ? 124 ASP C N     1 
ATOM   8036  C  CA    . ASP C  1 124 ? 56.960  28.957   36.957  1.00 90.48  ? 124 ASP C CA    1 
ATOM   8037  C  C     . ASP C  1 124 ? 55.699  29.499   37.657  1.00 88.49  ? 124 ASP C C     1 
ATOM   8038  O  O     . ASP C  1 124 ? 54.736  29.937   37.013  1.00 87.77  ? 124 ASP C O     1 
ATOM   8039  C  CB    . ASP C  1 124 ? 57.825  30.039   36.288  1.00 93.60  ? 124 ASP C CB    1 
ATOM   8040  C  CG    . ASP C  1 124 ? 59.228  29.513   35.897  1.00 96.71  ? 124 ASP C CG    1 
ATOM   8041  O  OD1   . ASP C  1 124 ? 59.635  28.437   36.398  1.00 96.88  ? 124 ASP C OD1   1 
ATOM   8042  O  OD2   . ASP C  1 124 ? 59.927  30.163   35.081  1.00 99.53  ? 124 ASP C OD2   1 
ATOM   8043  N  N     . ALA C  1 125 ? 55.705  29.419   38.983  1.00 87.32  ? 125 ALA C N     1 
ATOM   8044  C  CA    . ALA C  1 125 ? 54.526  29.724   39.775  1.00 85.27  ? 125 ALA C CA    1 
ATOM   8045  C  C     . ALA C  1 125 ? 54.683  30.973   40.656  1.00 86.45  ? 125 ALA C C     1 
ATOM   8046  O  O     . ALA C  1 125 ? 55.730  31.185   41.275  1.00 88.16  ? 125 ALA C O     1 
ATOM   8047  C  CB    . ALA C  1 125 ? 54.168  28.525   40.626  1.00 83.13  ? 125 ALA C CB    1 
ATOM   8048  N  N     . ALA C  1 126 ? 53.630  31.786   40.715  1.00 85.44  ? 126 ALA C N     1 
ATOM   8049  C  CA    . ALA C  1 126 ? 53.581  32.940   41.613  1.00 86.29  ? 126 ALA C CA    1 
ATOM   8050  C  C     . ALA C  1 126 ? 53.647  32.512   43.076  1.00 85.27  ? 126 ALA C C     1 
ATOM   8051  O  O     . ALA C  1 126 ? 54.154  33.231   43.930  1.00 86.72  ? 126 ALA C O     1 
ATOM   8052  C  CB    . ALA C  1 126 ? 52.324  33.751   41.359  1.00 85.62  ? 126 ALA C CB    1 
ATOM   8053  N  N     . GLY C  1 127 ? 53.122  31.332   43.356  1.00 83.00  ? 127 GLY C N     1 
ATOM   8054  C  CA    . GLY C  1 127 ? 53.179  30.768   44.688  1.00 82.20  ? 127 GLY C CA    1 
ATOM   8055  C  C     . GLY C  1 127 ? 52.504  29.415   44.708  1.00 79.87  ? 127 GLY C C     1 
ATOM   8056  O  O     . GLY C  1 127 ? 52.288  28.784   43.666  1.00 78.91  ? 127 GLY C O     1 
ATOM   8057  N  N     . ARG C  1 128 ? 52.171  28.975   45.912  1.00 78.92  ? 128 ARG C N     1 
ATOM   8058  C  CA    . ARG C  1 128 ? 51.502  27.705   46.111  1.00 76.67  ? 128 ARG C CA    1 
ATOM   8059  C  C     . ARG C  1 128 ? 50.301  27.909   47.036  1.00 75.20  ? 128 ARG C C     1 
ATOM   8060  O  O     . ARG C  1 128 ? 50.408  28.574   48.065  1.00 75.64  ? 128 ARG C O     1 
ATOM   8061  C  CB    . ARG C  1 128 ? 52.485  26.678   46.697  1.00 77.05  ? 128 ARG C CB    1 
ATOM   8062  C  CG    . ARG C  1 128 ? 53.810  26.568   45.934  1.00 78.83  ? 128 ARG C CG    1 
ATOM   8063  C  CD    . ARG C  1 128 ? 54.809  25.601   46.574  1.00 80.17  ? 128 ARG C CD    1 
ATOM   8064  N  NE    . ARG C  1 128 ? 54.277  24.240   46.683  1.00 80.21  ? 128 ARG C NE    1 
ATOM   8065  C  CZ    . ARG C  1 128 ? 54.166  23.359   45.683  1.00 79.63  ? 128 ARG C CZ    1 
ATOM   8066  N  NH1   . ARG C  1 128 ? 54.554  23.657   44.447  1.00 80.28  ? 128 ARG C NH1   1 
ATOM   8067  N  NH2   . ARG C  1 128 ? 53.654  22.161   45.927  1.00 77.82  ? 128 ARG C NH2   1 
ATOM   8068  N  N     . SER C  1 129 ? 49.157  27.357   46.646  1.00 73.41  ? 129 SER C N     1 
ATOM   8069  C  CA    . SER C  1 129 ? 47.973  27.354   47.492  1.00 72.24  ? 129 SER C CA    1 
ATOM   8070  C  C     . SER C  1 129 ? 47.634  25.913   47.853  1.00 70.92  ? 129 SER C C     1 
ATOM   8071  O  O     . SER C  1 129 ? 47.824  24.997   47.033  1.00 70.59  ? 129 SER C O     1 
ATOM   8072  C  CB    . SER C  1 129 ? 46.777  27.989   46.774  1.00 71.55  ? 129 SER C CB    1 
ATOM   8073  O  OG    . SER C  1 129 ? 47.128  29.180   46.092  1.00 73.06  ? 129 SER C OG    1 
ATOM   8074  N  N     . ARG C  1 130 ? 47.124  25.710   49.068  1.00 70.29  ? 130 ARG C N     1 
ATOM   8075  C  CA    . ARG C  1 130 ? 46.608  24.403   49.467  1.00 68.72  ? 130 ARG C CA    1 
ATOM   8076  C  C     . ARG C  1 130 ? 45.476  23.986   48.543  1.00 67.06  ? 130 ARG C C     1 
ATOM   8077  O  O     . ARG C  1 130 ? 44.839  24.827   47.905  1.00 67.06  ? 130 ARG C O     1 
ATOM   8078  C  CB    . ARG C  1 130 ? 46.078  24.426   50.898  1.00 68.51  ? 130 ARG C CB    1 
ATOM   8079  C  CG    . ARG C  1 130 ? 47.136  24.435   51.971  1.00 71.21  ? 130 ARG C CG    1 
ATOM   8080  C  CD    . ARG C  1 130 ? 46.484  24.131   53.311  1.00 72.58  ? 130 ARG C CD    1 
ATOM   8081  N  NE    . ARG C  1 130 ? 47.264  24.646   54.438  1.00 75.14  ? 130 ARG C NE    1 
ATOM   8082  C  CZ    . ARG C  1 130 ? 46.799  24.744   55.683  1.00 75.64  ? 130 ARG C CZ    1 
ATOM   8083  N  NH1   . ARG C  1 130 ? 45.564  24.360   55.968  1.00 73.58  ? 130 ARG C NH1   1 
ATOM   8084  N  NH2   . ARG C  1 130 ? 47.570  25.229   56.648  1.00 78.13  ? 130 ARG C NH2   1 
ATOM   8085  N  N     . ALA C  1 131 ? 45.227  22.679   48.491  1.00 65.86  ? 131 ALA C N     1 
ATOM   8086  C  CA    . ALA C  1 131 ? 44.170  22.108   47.672  1.00 63.96  ? 131 ALA C CA    1 
ATOM   8087  C  C     . ALA C  1 131 ? 42.829  22.523   48.214  1.00 62.90  ? 131 ALA C C     1 
ATOM   8088  O  O     . ALA C  1 131 ? 41.949  22.911   47.454  1.00 62.64  ? 131 ALA C O     1 
ATOM   8089  C  CB    . ALA C  1 131 ? 44.276  20.599   47.647  1.00 62.98  ? 131 ALA C CB    1 
ATOM   8090  N  N     . GLN C  1 132 ? 42.682  22.439   49.534  1.00 62.61  ? 132 GLN C N     1 
ATOM   8091  C  CA    . GLN C  1 132 ? 41.406  22.693   50.189  1.00 61.51  ? 132 GLN C CA    1 
ATOM   8092  C  C     . GLN C  1 132 ? 41.424  24.095   50.762  1.00 62.64  ? 132 GLN C C     1 
ATOM   8093  O  O     . GLN C  1 132 ? 42.216  24.398   51.657  1.00 63.84  ? 132 GLN C O     1 
ATOM   8094  C  CB    . GLN C  1 132 ? 41.152  21.663   51.288  1.00 60.76  ? 132 GLN C CB    1 
ATOM   8095  C  CG    . GLN C  1 132 ? 40.956  20.230   50.800  1.00 60.21  ? 132 GLN C CG    1 
ATOM   8096  C  CD    . GLN C  1 132 ? 39.589  19.980   50.186  1.00 62.91  ? 132 GLN C CD    1 
ATOM   8097  O  OE1   . GLN C  1 132 ? 38.689  20.839   50.229  1.00 64.21  ? 132 GLN C OE1   1 
ATOM   8098  N  NE2   . GLN C  1 132 ? 39.414  18.788   49.611  1.00 63.23  ? 132 GLN C NE2   1 
ATOM   8099  N  N     . VAL C  1 133 ? 40.569  24.962   50.230  1.00 62.36  ? 133 VAL C N     1 
ATOM   8100  C  CA    . VAL C  1 133 ? 40.568  26.357   50.650  1.00 63.53  ? 133 VAL C CA    1 
ATOM   8101  C  C     . VAL C  1 133 ? 39.174  26.815   51.069  1.00 62.83  ? 133 VAL C C     1 
ATOM   8102  O  O     . VAL C  1 133 ? 38.212  26.652   50.316  1.00 62.04  ? 133 VAL C O     1 
ATOM   8103  C  CB    . VAL C  1 133 ? 41.137  27.314   49.537  1.00 64.90  ? 133 VAL C CB    1 
ATOM   8104  C  CG1   . VAL C  1 133 ? 41.159  28.762   50.017  1.00 65.41  ? 133 VAL C CG1   1 
ATOM   8105  C  CG2   . VAL C  1 133 ? 42.524  26.890   49.098  1.00 65.02  ? 133 VAL C CG2   1 
ATOM   8106  N  N     . LYS C  1 134 ? 39.076  27.406   52.259  1.00 63.24  ? 134 LYS C N     1 
ATOM   8107  C  CA    . LYS C  1 134 ? 37.831  28.022   52.701  1.00 63.18  ? 134 LYS C CA    1 
ATOM   8108  C  C     . LYS C  1 134 ? 37.284  28.895   51.591  1.00 63.28  ? 134 LYS C C     1 
ATOM   8109  O  O     . LYS C  1 134 ? 38.032  29.601   50.923  1.00 64.38  ? 134 LYS C O     1 
ATOM   8110  C  CB    . LYS C  1 134 ? 38.024  28.830   53.984  1.00 64.36  ? 134 LYS C CB    1 
ATOM   8111  C  CG    . LYS C  1 134 ? 38.205  27.944   55.209  1.00 65.05  ? 134 LYS C CG    1 
ATOM   8112  C  CD    . LYS C  1 134 ? 38.099  28.720   56.518  1.00 68.12  ? 134 LYS C CD    1 
ATOM   8113  C  CE    . LYS C  1 134 ? 38.176  27.761   57.715  1.00 68.87  ? 134 LYS C CE    1 
ATOM   8114  N  NZ    . LYS C  1 134 ? 37.835  28.398   59.027  1.00 70.26  ? 134 LYS C NZ    1 
ATOM   8115  N  N     . ALA C  1 135 ? 35.980  28.809   51.370  1.00 62.26  ? 135 ALA C N     1 
ATOM   8116  C  CA    . ALA C  1 135 ? 35.335  29.621   50.354  1.00 62.39  ? 135 ALA C CA    1 
ATOM   8117  C  C     . ALA C  1 135 ? 35.200  31.054   50.859  1.00 63.66  ? 135 ALA C C     1 
ATOM   8118  O  O     . ALA C  1 135 ? 35.319  31.306   52.063  1.00 63.98  ? 135 ALA C O     1 
ATOM   8119  C  CB    . ALA C  1 135 ? 33.969  29.035   49.985  1.00 60.93  ? 135 ALA C CB    1 
ATOM   8120  N  N     . PRO C  1 136 ? 34.984  32.005   49.940  1.00 64.46  ? 136 PRO C N     1 
ATOM   8121  C  CA    . PRO C  1 136 ? 34.561  33.341   50.345  1.00 65.93  ? 136 PRO C CA    1 
ATOM   8122  C  C     . PRO C  1 136 ? 33.354  33.266   51.286  1.00 65.87  ? 136 PRO C C     1 
ATOM   8123  O  O     . PRO C  1 136 ? 32.385  32.524   51.012  1.00 64.86  ? 136 PRO C O     1 
ATOM   8124  C  CB    . PRO C  1 136 ? 34.147  33.984   49.024  1.00 66.12  ? 136 PRO C CB    1 
ATOM   8125  C  CG    . PRO C  1 136 ? 35.010  33.331   48.021  1.00 66.00  ? 136 PRO C CG    1 
ATOM   8126  C  CD    . PRO C  1 136 ? 35.241  31.919   48.492  1.00 64.40  ? 136 PRO C CD    1 
ATOM   8127  N  N     . GLY C  1 137 ? 33.425  34.004   52.393  1.00 66.90  ? 137 GLY C N     1 
ATOM   8128  C  CA    . GLY C  1 137 ? 32.314  34.089   53.327  1.00 66.50  ? 137 GLY C CA    1 
ATOM   8129  C  C     . GLY C  1 137 ? 31.230  34.967   52.741  1.00 67.39  ? 137 GLY C C     1 
ATOM   8130  O  O     . GLY C  1 137 ? 31.211  35.230   51.534  1.00 67.30  ? 137 GLY C O     1 
ATOM   8131  N  N     . ILE C  1 138 ? 30.332  35.437   53.602  1.00 68.13  ? 138 ILE C N     1 
ATOM   8132  C  CA    . ILE C  1 138 ? 29.158  36.182   53.168  1.00 68.49  ? 138 ILE C CA    1 
ATOM   8133  C  C     . ILE C  1 138 ? 29.530  37.623   52.818  1.00 70.06  ? 138 ILE C C     1 
ATOM   8134  O  O     . ILE C  1 138 ? 29.043  38.182   51.836  1.00 70.66  ? 138 ILE C O     1 
ATOM   8135  C  CB    . ILE C  1 138 ? 28.017  36.071   54.222  1.00 68.43  ? 138 ILE C CB    1 
ATOM   8136  C  CG1   . ILE C  1 138 ? 27.068  34.923   53.878  1.00 67.97  ? 138 ILE C CG1   1 
ATOM   8137  C  CG2   . ILE C  1 138 ? 27.160  37.309   54.259  1.00 70.59  ? 138 ILE C CG2   1 
ATOM   8138  C  CD1   . ILE C  1 138 ? 27.601  33.508   54.129  1.00 67.77  ? 138 ILE C CD1   1 
ATOM   8139  N  N     . LEU C  1 139 ? 30.429  38.209   53.597  1.00 71.04  ? 139 LEU C N     1 
ATOM   8140  C  CA    . LEU C  1 139 ? 30.767  39.622   53.431  1.00 72.53  ? 139 LEU C CA    1 
ATOM   8141  C  C     . LEU C  1 139 ? 31.509  39.935   52.131  1.00 72.84  ? 139 LEU C C     1 
ATOM   8142  O  O     . LEU C  1 139 ? 31.115  40.858   51.425  1.00 73.90  ? 139 LEU C O     1 
ATOM   8143  C  CB    . LEU C  1 139 ? 31.560  40.134   54.633  1.00 73.67  ? 139 LEU C CB    1 
ATOM   8144  C  CG    . LEU C  1 139 ? 31.386  41.604   54.975  1.00 75.65  ? 139 LEU C CG    1 
ATOM   8145  C  CD1   . LEU C  1 139 ? 30.123  41.804   55.808  1.00 76.03  ? 139 LEU C CD1   1 
ATOM   8146  C  CD2   . LEU C  1 139 ? 32.612  42.095   55.725  1.00 77.48  ? 139 LEU C CD2   1 
ATOM   8147  N  N     . PRO C  1 140 ? 32.571  39.166   51.804  1.00 72.05  ? 140 PRO C N     1 
ATOM   8148  C  CA    . PRO C  1 140 ? 33.454  39.553   50.700  1.00 72.95  ? 140 PRO C CA    1 
ATOM   8149  C  C     . PRO C  1 140 ? 32.952  39.292   49.280  1.00 72.31  ? 140 PRO C C     1 
ATOM   8150  O  O     . PRO C  1 140 ? 33.772  39.105   48.380  1.00 72.75  ? 140 PRO C O     1 
ATOM   8151  C  CB    . PRO C  1 140 ? 34.713  38.717   50.962  1.00 72.50  ? 140 PRO C CB    1 
ATOM   8152  C  CG    . PRO C  1 140 ? 34.210  37.506   51.625  1.00 70.69  ? 140 PRO C CG    1 
ATOM   8153  C  CD    . PRO C  1 140 ? 33.087  37.975   52.507  1.00 70.81  ? 140 PRO C CD    1 
ATOM   8154  N  N     . ARG C  1 141 ? 31.639  39.299   49.068  1.00 71.67  ? 141 ARG C N     1 
ATOM   8155  C  CA    . ARG C  1 141 ? 31.078  38.980   47.750  1.00 70.93  ? 141 ARG C CA    1 
ATOM   8156  C  C     . ARG C  1 141 ? 30.219  40.092   47.169  1.00 72.27  ? 141 ARG C C     1 
ATOM   8157  O  O     . ARG C  1 141 ? 29.812  41.008   47.872  1.00 73.30  ? 141 ARG C O     1 
ATOM   8158  C  CB    . ARG C  1 141 ? 30.241  37.714   47.825  1.00 68.95  ? 141 ARG C CB    1 
ATOM   8159  C  CG    . ARG C  1 141 ? 31.020  36.457   48.064  1.00 67.39  ? 141 ARG C CG    1 
ATOM   8160  C  CD    . ARG C  1 141 ? 30.061  35.397   48.508  1.00 65.73  ? 141 ARG C CD    1 
ATOM   8161  N  NE    . ARG C  1 141 ? 30.677  34.091   48.736  1.00 63.30  ? 141 ARG C NE    1 
ATOM   8162  C  CZ    . ARG C  1 141 ? 30.659  33.092   47.862  1.00 60.43  ? 141 ARG C CZ    1 
ATOM   8163  N  NH1   . ARG C  1 141 ? 30.088  33.257   46.677  1.00 59.98  ? 141 ARG C NH1   1 
ATOM   8164  N  NH2   . ARG C  1 141 ? 31.226  31.935   48.173  1.00 58.27  ? 141 ARG C NH2   1 
ATOM   8165  N  N     . ARG C  1 142 ? 29.944  39.996   45.875  1.00 72.47  ? 142 ARG C N     1 
ATOM   8166  C  CA    . ARG C  1 142 ? 29.069  40.944   45.190  1.00 74.21  ? 142 ARG C CA    1 
ATOM   8167  C  C     . ARG C  1 142 ? 28.263  40.174   44.170  1.00 73.15  ? 142 ARG C C     1 
ATOM   8168  O  O     . ARG C  1 142 ? 28.745  39.191   43.614  1.00 72.27  ? 142 ARG C O     1 
ATOM   8169  C  CB    . ARG C  1 142 ? 29.880  42.054   44.493  1.00 76.32  ? 142 ARG C CB    1 
ATOM   8170  C  CG    . ARG C  1 142 ? 29.042  43.069   43.708  1.00 78.54  ? 142 ARG C CG    1 
ATOM   8171  C  CD    . ARG C  1 142 ? 29.838  44.321   43.401  1.00 84.36  ? 142 ARG C CD    1 
ATOM   8172  N  NE    . ARG C  1 142 ? 28.998  45.501   43.144  1.00 87.84  ? 142 ARG C NE    1 
ATOM   8173  C  CZ    . ARG C  1 142 ? 28.653  46.414   44.056  1.00 88.83  ? 142 ARG C CZ    1 
ATOM   8174  N  NH1   . ARG C  1 142 ? 29.064  46.309   45.316  1.00 88.59  ? 142 ARG C NH1   1 
ATOM   8175  N  NH2   . ARG C  1 142 ? 27.889  47.441   43.706  1.00 90.54  ? 142 ARG C NH2   1 
ATOM   8176  N  N     . SER C  1 143 ? 27.046  40.627   43.911  1.00 73.67  ? 143 SER C N     1 
ATOM   8177  C  CA    . SER C  1 143 ? 26.172  39.955   42.958  1.00 73.27  ? 143 SER C CA    1 
ATOM   8178  C  C     . SER C  1 143 ? 26.768  39.822   41.556  1.00 73.44  ? 143 SER C C     1 
ATOM   8179  O  O     . SER C  1 143 ? 27.327  40.773   41.009  1.00 75.38  ? 143 SER C O     1 
ATOM   8180  C  CB    . SER C  1 143 ? 24.822  40.662   42.898  1.00 74.27  ? 143 SER C CB    1 
ATOM   8181  O  OG    . SER C  1 143 ? 24.294  40.789   44.207  1.00 75.09  ? 143 SER C OG    1 
ATOM   8182  N  N     . VAL C  1 144 ? 26.648  38.626   40.991  1.00 71.91  ? 144 VAL C N     1 
ATOM   8183  C  CA    . VAL C  1 144 ? 27.042  38.373   39.608  1.00 71.71  ? 144 VAL C CA    1 
ATOM   8184  C  C     . VAL C  1 144 ? 26.278  39.365   38.748  1.00 73.27  ? 144 VAL C C     1 
ATOM   8185  O  O     . VAL C  1 144 ? 25.095  39.590   38.991  1.00 73.55  ? 144 VAL C O     1 
ATOM   8186  C  CB    . VAL C  1 144 ? 26.739  36.900   39.211  1.00 69.82  ? 144 VAL C CB    1 
ATOM   8187  C  CG1   . VAL C  1 144 ? 26.774  36.706   37.720  1.00 69.63  ? 144 VAL C CG1   1 
ATOM   8188  C  CG2   . VAL C  1 144 ? 27.725  35.969   39.878  1.00 67.57  ? 144 VAL C CG2   1 
ATOM   8189  N  N     . HIS C  1 145 ? 26.963  39.989   37.791  1.00 74.50  ? 145 HIS C N     1 
ATOM   8190  C  CA    . HIS C  1 145 ? 26.350  41.017   36.947  1.00 76.47  ? 145 HIS C CA    1 
ATOM   8191  C  C     . HIS C  1 145 ? 27.043  41.164   35.592  1.00 77.55  ? 145 HIS C C     1 
ATOM   8192  O  O     . HIS C  1 145 ? 26.530  41.828   34.694  1.00 78.79  ? 145 HIS C O     1 
ATOM   8193  C  CB    . HIS C  1 145 ? 26.309  42.364   37.678  1.00 77.96  ? 145 HIS C CB    1 
ATOM   8194  C  CG    . HIS C  1 145 ? 27.599  43.126   37.628  1.00 80.16  ? 145 HIS C CG    1 
ATOM   8195  N  ND1   . HIS C  1 145 ? 28.736  42.714   38.291  1.00 79.26  ? 145 HIS C ND1   1 
ATOM   8196  C  CD2   . HIS C  1 145 ? 27.926  44.285   37.006  1.00 82.78  ? 145 HIS C CD2   1 
ATOM   8197  C  CE1   . HIS C  1 145 ? 29.710  43.579   38.071  1.00 81.08  ? 145 HIS C CE1   1 
ATOM   8198  N  NE2   . HIS C  1 145 ? 29.245  44.541   37.293  1.00 83.62  ? 145 HIS C NE2   1 
ATOM   8199  N  N     . GLU C  1 146 ? 28.218  40.556   35.466  1.00 76.92  ? 146 GLU C N     1 
ATOM   8200  C  CA    . GLU C  1 146 ? 28.957  40.553   34.219  1.00 77.74  ? 146 GLU C CA    1 
ATOM   8201  C  C     . GLU C  1 146 ? 28.727  39.209   33.565  1.00 76.33  ? 146 GLU C C     1 
ATOM   8202  O  O     . GLU C  1 146 ? 28.865  38.180   34.220  1.00 74.35  ? 146 GLU C O     1 
ATOM   8203  C  CB    . GLU C  1 146 ? 30.448  40.724   34.468  1.00 78.22  ? 146 GLU C CB    1 
ATOM   8204  C  CG    . GLU C  1 146 ? 30.833  41.913   35.310  1.00 79.15  ? 146 GLU C CG    1 
ATOM   8205  C  CD    . GLU C  1 146 ? 32.053  41.621   36.144  1.00 78.45  ? 146 GLU C CD    1 
ATOM   8206  O  OE1   . GLU C  1 146 ? 31.981  40.701   36.979  1.00 76.74  ? 146 GLU C OE1   1 
ATOM   8207  O  OE2   . GLU C  1 146 ? 33.086  42.297   35.968  1.00 80.46  ? 146 GLU C OE2   1 
ATOM   8208  N  N     . PRO C  1 147 ? 28.370  39.213   32.271  1.00 77.36  ? 147 PRO C N     1 
ATOM   8209  C  CA    . PRO C  1 147 ? 28.079  37.976   31.551  1.00 76.29  ? 147 PRO C CA    1 
ATOM   8210  C  C     . PRO C  1 147 ? 29.319  37.142   31.305  1.00 75.65  ? 147 PRO C C     1 
ATOM   8211  O  O     . PRO C  1 147 ? 30.402  37.693   31.170  1.00 76.82  ? 147 PRO C O     1 
ATOM   8212  C  CB    . PRO C  1 147 ? 27.539  38.482   30.205  1.00 78.25  ? 147 PRO C CB    1 
ATOM   8213  C  CG    . PRO C  1 147 ? 27.072  39.889   30.479  1.00 79.47  ? 147 PRO C CG    1 
ATOM   8214  C  CD    . PRO C  1 147 ? 28.076  40.401   31.451  1.00 79.49  ? 147 PRO C CD    1 
ATOM   8215  N  N     . VAL C  1 148 ? 29.163  35.821   31.279  1.00 74.15  ? 148 VAL C N     1 
ATOM   8216  C  CA    . VAL C  1 148 ? 30.133  34.953   30.602  1.00 73.92  ? 148 VAL C CA    1 
ATOM   8217  C  C     . VAL C  1 148 ? 29.516  34.637   29.243  1.00 74.64  ? 148 VAL C C     1 
ATOM   8218  O  O     . VAL C  1 148 ? 28.597  33.823   29.147  1.00 73.56  ? 148 VAL C O     1 
ATOM   8219  C  CB    . VAL C  1 148 ? 30.458  33.653   31.396  1.00 71.71  ? 148 VAL C CB    1 
ATOM   8220  C  CG1   . VAL C  1 148 ? 31.170  32.634   30.515  1.00 71.30  ? 148 VAL C CG1   1 
ATOM   8221  C  CG2   . VAL C  1 148 ? 31.315  33.962   32.607  1.00 71.20  ? 148 VAL C CG2   1 
ATOM   8222  N  N     . GLN C  1 149 ? 29.974  35.329   28.205  1.00 76.63  ? 149 GLN C N     1 
ATOM   8223  C  CA    . GLN C  1 149 ? 29.407  35.127   26.884  1.00 77.94  ? 149 GLN C CA    1 
ATOM   8224  C  C     . GLN C  1 149 ? 29.902  33.789   26.370  1.00 77.20  ? 149 GLN C C     1 
ATOM   8225  O  O     . GLN C  1 149 ? 31.100  33.595   26.158  1.00 77.78  ? 149 GLN C O     1 
ATOM   8226  C  CB    . GLN C  1 149 ? 29.774  36.266   25.933  1.00 80.50  ? 149 GLN C CB    1 
ATOM   8227  C  CG    . GLN C  1 149 ? 28.822  37.449   25.974  1.00 82.16  ? 149 GLN C CG    1 
ATOM   8228  C  CD    . GLN C  1 149 ? 29.391  38.692   25.276  1.00 86.54  ? 149 GLN C CD    1 
ATOM   8229  O  OE1   . GLN C  1 149 ? 29.531  38.723   24.048  1.00 89.53  ? 149 GLN C OE1   1 
ATOM   8230  N  NE2   . GLN C  1 149 ? 29.709  39.726   26.060  1.00 86.02  ? 149 GLN C NE2   1 
ATOM   8231  N  N     . THR C  1 150 ? 28.983  32.848   26.208  1.00 76.12  ? 150 THR C N     1 
ATOM   8232  C  CA    . THR C  1 150 ? 29.372  31.506   25.795  1.00 75.24  ? 150 THR C CA    1 
ATOM   8233  C  C     . THR C  1 150 ? 29.455  31.404   24.279  1.00 76.96  ? 150 THR C C     1 
ATOM   8234  O  O     . THR C  1 150 ? 30.167  30.556   23.744  1.00 77.04  ? 150 THR C O     1 
ATOM   8235  C  CB    . THR C  1 150 ? 28.390  30.466   26.287  1.00 73.28  ? 150 THR C CB    1 
ATOM   8236  O  OG1   . THR C  1 150 ? 27.163  30.604   25.559  1.00 74.26  ? 150 THR C OG1   1 
ATOM   8237  C  CG2   . THR C  1 150 ? 28.147  30.636   27.782  1.00 71.80  ? 150 THR C CG2   1 
ATOM   8238  N  N     . GLY C  1 151 ? 28.703  32.262   23.601  1.00 78.43  ? 151 GLY C N     1 
ATOM   8239  C  CA    . GLY C  1 151 ? 28.693  32.308   22.151  1.00 80.19  ? 151 GLY C CA    1 
ATOM   8240  C  C     . GLY C  1 151 ? 27.583  31.484   21.546  1.00 79.86  ? 151 GLY C C     1 
ATOM   8241  O  O     . GLY C  1 151 ? 27.377  31.519   20.329  1.00 81.67  ? 151 GLY C O     1 
ATOM   8242  N  N     . LEU C  1 152 ? 26.877  30.738   22.395  1.00 77.57  ? 152 LEU C N     1 
ATOM   8243  C  CA    . LEU C  1 152 ? 25.805  29.861   21.950  1.00 77.08  ? 152 LEU C CA    1 
ATOM   8244  C  C     . LEU C  1 152 ? 24.442  30.520   22.132  1.00 77.54  ? 152 LEU C C     1 
ATOM   8245  O  O     . LEU C  1 152 ? 24.030  30.818   23.253  1.00 76.29  ? 152 LEU C O     1 
ATOM   8246  C  CB    . LEU C  1 152 ? 25.836  28.540   22.723  1.00 74.98  ? 152 LEU C CB    1 
ATOM   8247  C  CG    . LEU C  1 152 ? 26.941  27.484   22.572  1.00 74.44  ? 152 LEU C CG    1 
ATOM   8248  C  CD1   . LEU C  1 152 ? 26.835  26.463   23.693  1.00 71.40  ? 152 LEU C CD1   1 
ATOM   8249  C  CD2   . LEU C  1 152 ? 26.885  26.778   21.228  1.00 76.30  ? 152 LEU C CD2   1 
ATOM   8250  N  N     . LYS C  1 153 ? 23.743  30.726   21.022  1.00 79.34  ? 153 LYS C N     1 
ATOM   8251  C  CA    . LYS C  1 153 ? 22.393  31.291   21.025  1.00 80.37  ? 153 LYS C CA    1 
ATOM   8252  C  C     . LYS C  1 153 ? 21.495  30.735   22.142  1.00 78.75  ? 153 LYS C C     1 
ATOM   8253  O  O     . LYS C  1 153 ? 21.009  31.489   22.986  1.00 78.78  ? 153 LYS C O     1 
ATOM   8254  C  CB    . LYS C  1 153 ? 21.730  31.072   19.664  1.00 82.12  ? 153 LYS C CB    1 
ATOM   8255  C  CG    . LYS C  1 153 ? 22.532  31.630   18.501  1.00 84.54  ? 153 LYS C CG    1 
ATOM   8256  C  CD    . LYS C  1 153 ? 21.884  31.341   17.164  1.00 85.98  ? 153 LYS C CD    1 
ATOM   8257  C  CE    . LYS C  1 153 ? 22.215  29.950   16.675  1.00 84.45  ? 153 LYS C CE    1 
ATOM   8258  N  NZ    . LYS C  1 153 ? 21.556  29.709   15.376  1.00 86.01  ? 153 LYS C NZ    1 
ATOM   8259  N  N     . ALA C  1 154 ? 21.289  29.421   22.144  1.00 77.66  ? 154 ALA C N     1 
ATOM   8260  C  CA    . ALA C  1 154 ? 20.425  28.771   23.127  1.00 76.13  ? 154 ALA C CA    1 
ATOM   8261  C  C     . ALA C  1 154 ? 20.769  29.147   24.575  1.00 74.61  ? 154 ALA C C     1 
ATOM   8262  O  O     . ALA C  1 154 ? 19.879  29.511   25.349  1.00 74.36  ? 154 ALA C O     1 
ATOM   8263  C  CB    . ALA C  1 154 ? 20.444  27.254   22.937  1.00 74.94  ? 154 ALA C CB    1 
ATOM   8264  N  N     . VAL C  1 155 ? 22.050  29.080   24.938  1.00 73.73  ? 155 VAL C N     1 
ATOM   8265  C  CA    . VAL C  1 155 ? 22.443  29.378   26.318  1.00 72.22  ? 155 VAL C CA    1 
ATOM   8266  C  C     . VAL C  1 155 ? 22.259  30.852   26.608  1.00 73.61  ? 155 VAL C C     1 
ATOM   8267  O  O     . VAL C  1 155 ? 21.480  31.220   27.480  1.00 73.34  ? 155 VAL C O     1 
ATOM   8268  C  CB    . VAL C  1 155 ? 23.894  28.949   26.650  1.00 71.06  ? 155 VAL C CB    1 
ATOM   8269  C  CG1   . VAL C  1 155 ? 24.284  29.418   28.041  1.00 69.09  ? 155 VAL C CG1   1 
ATOM   8270  C  CG2   . VAL C  1 155 ? 24.032  27.446   26.561  1.00 69.92  ? 155 VAL C CG2   1 
ATOM   8271  N  N     . ASP C  1 156 ? 22.955  31.686   25.836  1.00 75.40  ? 156 ASP C N     1 
ATOM   8272  C  CA    . ASP C  1 156 ? 23.043  33.118   26.082  1.00 76.42  ? 156 ASP C CA    1 
ATOM   8273  C  C     . ASP C  1 156 ? 21.688  33.799   26.124  1.00 77.30  ? 156 ASP C C     1 
ATOM   8274  O  O     . ASP C  1 156 ? 21.455  34.663   26.971  1.00 77.45  ? 156 ASP C O     1 
ATOM   8275  C  CB    . ASP C  1 156 ? 23.961  33.767   25.047  1.00 78.39  ? 156 ASP C CB    1 
ATOM   8276  C  CG    . ASP C  1 156 ? 25.423  33.370   25.234  1.00 77.88  ? 156 ASP C CG    1 
ATOM   8277  O  OD1   . ASP C  1 156 ? 25.748  32.700   26.245  1.00 76.53  ? 156 ASP C OD1   1 
ATOM   8278  O  OD2   . ASP C  1 156 ? 26.250  33.728   24.371  1.00 79.01  ? 156 ASP C OD2   1 
ATOM   8279  N  N     . ALA C  1 157 ? 20.794  33.399   25.227  1.00 78.01  ? 157 ALA C N     1 
ATOM   8280  C  CA    . ALA C  1 157 ? 19.423  33.898   25.262  1.00 78.94  ? 157 ALA C CA    1 
ATOM   8281  C  C     . ALA C  1 157 ? 18.626  33.353   26.459  1.00 77.23  ? 157 ALA C C     1 
ATOM   8282  O  O     . ALA C  1 157 ? 18.093  34.132   27.240  1.00 77.39  ? 157 ALA C O     1 
ATOM   8283  C  CB    . ALA C  1 157 ? 18.710  33.607   23.955  1.00 80.37  ? 157 ALA C CB    1 
ATOM   8284  N  N     . LEU C  1 158 ? 18.590  32.028   26.621  1.00 75.78  ? 158 LEU C N     1 
ATOM   8285  C  CA    . LEU C  1 158 ? 17.680  31.363   27.574  1.00 74.44  ? 158 LEU C CA    1 
ATOM   8286  C  C     . LEU C  1 158 ? 18.251  30.997   28.949  1.00 72.53  ? 158 LEU C C     1 
ATOM   8287  O  O     . LEU C  1 158 ? 17.508  30.952   29.932  1.00 71.88  ? 158 LEU C O     1 
ATOM   8288  C  CB    . LEU C  1 158 ? 17.083  30.108   26.943  1.00 74.04  ? 158 LEU C CB    1 
ATOM   8289  C  CG    . LEU C  1 158 ? 16.473  30.282   25.558  1.00 76.30  ? 158 LEU C CG    1 
ATOM   8290  C  CD1   . LEU C  1 158 ? 15.925  28.959   25.107  1.00 76.11  ? 158 LEU C CD1   1 
ATOM   8291  C  CD2   . LEU C  1 158 ? 15.384  31.353   25.561  1.00 77.71  ? 158 LEU C CD2   1 
ATOM   8292  N  N     . VAL C  1 159 ? 19.546  30.703   29.017  1.00 71.72  ? 159 VAL C N     1 
ATOM   8293  C  CA    . VAL C  1 159 ? 20.188  30.388   30.293  1.00 69.88  ? 159 VAL C CA    1 
ATOM   8294  C  C     . VAL C  1 159 ? 21.521  31.139   30.498  1.00 70.13  ? 159 VAL C C     1 
ATOM   8295  O  O     . VAL C  1 159 ? 22.571  30.521   30.692  1.00 69.23  ? 159 VAL C O     1 
ATOM   8296  C  CB    . VAL C  1 159 ? 20.317  28.844   30.518  1.00 68.13  ? 159 VAL C CB    1 
ATOM   8297  C  CG1   . VAL C  1 159 ? 18.957  28.242   30.792  1.00 68.32  ? 159 VAL C CG1   1 
ATOM   8298  C  CG2   . VAL C  1 159 ? 20.931  28.145   29.327  1.00 68.60  ? 159 VAL C CG2   1 
ATOM   8299  N  N     . PRO C  1 160 ? 21.473  32.488   30.494  1.00 71.63  ? 160 PRO C N     1 
ATOM   8300  C  CA    . PRO C  1 160 ? 22.710  33.276   30.503  1.00 72.32  ? 160 PRO C CA    1 
ATOM   8301  C  C     . PRO C  1 160 ? 23.517  33.015   31.761  1.00 71.06  ? 160 PRO C C     1 
ATOM   8302  O  O     . PRO C  1 160 ? 22.948  32.884   32.830  1.00 70.53  ? 160 PRO C O     1 
ATOM   8303  C  CB    . PRO C  1 160 ? 22.224  34.727   30.488  1.00 73.91  ? 160 PRO C CB    1 
ATOM   8304  C  CG    . PRO C  1 160 ? 20.808  34.700   30.887  1.00 73.66  ? 160 PRO C CG    1 
ATOM   8305  C  CD    . PRO C  1 160 ? 20.293  33.297   30.851  1.00 72.56  ? 160 PRO C CD    1 
ATOM   8306  N  N     . ILE C  1 161 ? 24.833  32.936   31.623  1.00 71.13  ? 161 ILE C N     1 
ATOM   8307  C  CA    . ILE C  1 161 ? 25.725  32.568   32.715  1.00 69.72  ? 161 ILE C CA    1 
ATOM   8308  C  C     . ILE C  1 161 ? 26.528  33.794   33.136  1.00 70.79  ? 161 ILE C C     1 
ATOM   8309  O  O     . ILE C  1 161 ? 27.119  34.482   32.293  1.00 72.46  ? 161 ILE C O     1 
ATOM   8310  C  CB    . ILE C  1 161 ? 26.670  31.416   32.272  1.00 69.04  ? 161 ILE C CB    1 
ATOM   8311  C  CG1   . ILE C  1 161 ? 25.861  30.144   32.006  1.00 67.79  ? 161 ILE C CG1   1 
ATOM   8312  C  CG2   . ILE C  1 161 ? 27.789  31.167   33.291  1.00 68.09  ? 161 ILE C CG2   1 
ATOM   8313  C  CD1   . ILE C  1 161 ? 26.611  29.113   31.214  1.00 67.85  ? 161 ILE C CD1   1 
ATOM   8314  N  N     . GLY C  1 162 ? 26.549  34.063   34.437  1.00 70.03  ? 162 GLY C N     1 
ATOM   8315  C  CA    . GLY C  1 162 ? 27.275  35.214   34.974  1.00 70.87  ? 162 GLY C CA    1 
ATOM   8316  C  C     . GLY C  1 162 ? 28.632  34.885   35.567  1.00 70.20  ? 162 GLY C C     1 
ATOM   8317  O  O     . GLY C  1 162 ? 28.896  33.736   35.930  1.00 68.62  ? 162 GLY C O     1 
ATOM   8318  N  N     . ARG C  1 163 ? 29.487  35.903   35.666  1.00 71.46  ? 163 ARG C N     1 
ATOM   8319  C  CA    . ARG C  1 163 ? 30.802  35.777   36.296  1.00 71.31  ? 163 ARG C CA    1 
ATOM   8320  C  C     . ARG C  1 163 ? 30.726  35.569   37.812  1.00 70.24  ? 163 ARG C C     1 
ATOM   8321  O  O     . ARG C  1 163 ? 30.554  36.522   38.571  1.00 71.07  ? 163 ARG C O     1 
ATOM   8322  C  CB    . ARG C  1 163 ? 31.683  36.978   35.951  1.00 73.39  ? 163 ARG C CB    1 
ATOM   8323  C  CG    . ARG C  1 163 ? 32.593  36.738   34.751  1.00 74.59  ? 163 ARG C CG    1 
ATOM   8324  C  CD    . ARG C  1 163 ? 32.772  37.978   33.894  1.00 76.44  ? 163 ARG C CD    1 
ATOM   8325  N  NE    . ARG C  1 163 ? 32.937  37.605   32.490  1.00 77.38  ? 163 ARG C NE    1 
ATOM   8326  C  CZ    . ARG C  1 163 ? 34.039  37.803   31.772  1.00 78.24  ? 163 ARG C CZ    1 
ATOM   8327  N  NH1   . ARG C  1 163 ? 35.095  38.396   32.317  1.00 79.11  ? 163 ARG C NH1   1 
ATOM   8328  N  NH2   . ARG C  1 163 ? 34.078  37.406   30.503  1.00 78.12  ? 163 ARG C NH2   1 
ATOM   8329  N  N     . GLY C  1 164 ? 30.854  34.308   38.232  1.00 68.57  ? 164 GLY C N     1 
ATOM   8330  C  CA    . GLY C  1 164 ? 30.832  33.923   39.650  1.00 67.33  ? 164 GLY C CA    1 
ATOM   8331  C  C     . GLY C  1 164 ? 29.730  32.915   39.949  1.00 65.74  ? 164 GLY C C     1 
ATOM   8332  O  O     . GLY C  1 164 ? 29.567  32.453   41.088  1.00 64.43  ? 164 GLY C O     1 
ATOM   8333  N  N     . GLN C  1 165 ? 28.964  32.598   38.911  1.00 65.64  ? 165 GLN C N     1 
ATOM   8334  C  CA    . GLN C  1 165 ? 27.875  31.643   38.982  1.00 64.47  ? 165 GLN C CA    1 
ATOM   8335  C  C     . GLN C  1 165 ? 28.415  30.206   38.831  1.00 63.10  ? 165 GLN C C     1 
ATOM   8336  O  O     . GLN C  1 165 ? 29.433  29.961   38.162  1.00 63.39  ? 165 GLN C O     1 
ATOM   8337  C  CB    . GLN C  1 165 ? 26.856  31.983   37.887  1.00 65.14  ? 165 GLN C CB    1 
ATOM   8338  C  CG    . GLN C  1 165 ? 25.679  31.028   37.749  1.00 65.83  ? 165 GLN C CG    1 
ATOM   8339  C  CD    . GLN C  1 165 ? 24.570  31.552   36.826  1.00 68.39  ? 165 GLN C CD    1 
ATOM   8340  O  OE1   . GLN C  1 165 ? 24.821  32.338   35.914  1.00 69.62  ? 165 GLN C OE1   1 
ATOM   8341  N  NE2   . GLN C  1 165 ? 23.337  31.102   37.065  1.00 68.21  ? 165 GLN C NE2   1 
ATOM   8342  N  N     . ARG C  1 166 ? 27.750  29.263   39.491  1.00 61.48  ? 166 ARG C N     1 
ATOM   8343  C  CA    . ARG C  1 166 ? 27.945  27.853   39.196  1.00 59.87  ? 166 ARG C CA    1 
ATOM   8344  C  C     . ARG C  1 166 ? 26.774  27.388   38.354  1.00 59.52  ? 166 ARG C C     1 
ATOM   8345  O  O     . ARG C  1 166 ? 25.633  27.380   38.818  1.00 59.32  ? 166 ARG C O     1 
ATOM   8346  C  CB    . ARG C  1 166 ? 28.053  27.041   40.481  1.00 58.43  ? 166 ARG C CB    1 
ATOM   8347  C  CG    . ARG C  1 166 ? 29.367  27.275   41.210  1.00 59.04  ? 166 ARG C CG    1 
ATOM   8348  C  CD    . ARG C  1 166 ? 29.263  28.085   42.526  1.00 59.36  ? 166 ARG C CD    1 
ATOM   8349  N  NE    . ARG C  1 166 ? 27.952  28.654   42.813  1.00 58.60  ? 166 ARG C NE    1 
ATOM   8350  C  CZ    . ARG C  1 166 ? 27.192  28.291   43.843  1.00 57.91  ? 166 ARG C CZ    1 
ATOM   8351  N  NH1   . ARG C  1 166 ? 27.603  27.362   44.713  1.00 55.70  ? 166 ARG C NH1   1 
ATOM   8352  N  NH2   . ARG C  1 166 ? 26.018  28.877   44.010  1.00 58.30  ? 166 ARG C NH2   1 
ATOM   8353  N  N     . GLU C  1 167 ? 27.039  27.047   37.100  1.00 59.61  ? 167 GLU C N     1 
ATOM   8354  C  CA    . GLU C  1 167 ? 25.981  26.531   36.244  1.00 59.80  ? 167 GLU C CA    1 
ATOM   8355  C  C     . GLU C  1 167 ? 26.311  25.092   35.879  1.00 59.14  ? 167 GLU C C     1 
ATOM   8356  O  O     . GLU C  1 167 ? 27.298  24.833   35.183  1.00 59.63  ? 167 GLU C O     1 
ATOM   8357  C  CB    . GLU C  1 167 ? 25.773  27.416   35.011  1.00 61.10  ? 167 GLU C CB    1 
ATOM   8358  C  CG    . GLU C  1 167 ? 24.638  26.993   34.079  1.00 62.20  ? 167 GLU C CG    1 
ATOM   8359  C  CD    . GLU C  1 167 ? 23.230  27.280   34.613  1.00 64.02  ? 167 GLU C CD    1 
ATOM   8360  O  OE1   . GLU C  1 167 ? 23.073  27.739   35.763  1.00 64.82  ? 167 GLU C OE1   1 
ATOM   8361  O  OE2   . GLU C  1 167 ? 22.259  27.044   33.868  1.00 65.29  ? 167 GLU C OE2   1 
ATOM   8362  N  N     . LEU C  1 168 ? 25.498  24.163   36.390  1.00 58.10  ? 168 LEU C N     1 
ATOM   8363  C  CA    . LEU C  1 168 ? 25.677  22.737   36.139  1.00 57.17  ? 168 LEU C CA    1 
ATOM   8364  C  C     . LEU C  1 168 ? 25.386  22.382   34.677  1.00 57.61  ? 168 LEU C C     1 
ATOM   8365  O  O     . LEU C  1 168 ? 24.446  22.897   34.082  1.00 58.40  ? 168 LEU C O     1 
ATOM   8366  C  CB    . LEU C  1 168 ? 24.780  21.919   37.087  1.00 56.18  ? 168 LEU C CB    1 
ATOM   8367  C  CG    . LEU C  1 168 ? 24.620  20.393   36.924  1.00 55.59  ? 168 LEU C CG    1 
ATOM   8368  C  CD1   . LEU C  1 168 ? 25.864  19.590   37.277  1.00 53.71  ? 168 LEU C CD1   1 
ATOM   8369  C  CD2   . LEU C  1 168 ? 23.458  19.911   37.742  1.00 56.01  ? 168 LEU C CD2   1 
ATOM   8370  N  N     . ILE C  1 169 ? 26.214  21.518   34.101  1.00 57.16  ? 169 ILE C N     1 
ATOM   8371  C  CA    . ILE C  1 169 ? 25.888  20.885   32.823  1.00 57.51  ? 169 ILE C CA    1 
ATOM   8372  C  C     . ILE C  1 169 ? 25.588  19.411   33.122  1.00 56.38  ? 169 ILE C C     1 
ATOM   8373  O  O     . ILE C  1 169 ? 26.430  18.698   33.674  1.00 55.86  ? 169 ILE C O     1 
ATOM   8374  C  CB    . ILE C  1 169 ? 27.032  21.030   31.754  1.00 58.42  ? 169 ILE C CB    1 
ATOM   8375  C  CG1   . ILE C  1 169 ? 27.393  22.499   31.524  1.00 59.01  ? 169 ILE C CG1   1 
ATOM   8376  C  CG2   . ILE C  1 169 ? 26.631  20.377   30.424  1.00 58.44  ? 169 ILE C CG2   1 
ATOM   8377  C  CD1   . ILE C  1 169 ? 28.653  22.702   30.712  1.00 59.56  ? 169 ILE C CD1   1 
ATOM   8378  N  N     . ILE C  1 170 ? 24.394  18.959   32.760  1.00 56.05  ? 170 ILE C N     1 
ATOM   8379  C  CA    . ILE C  1 170 ? 23.960  17.625   33.121  1.00 55.18  ? 170 ILE C CA    1 
ATOM   8380  C  C     . ILE C  1 170 ? 23.235  16.877   31.985  1.00 56.02  ? 170 ILE C C     1 
ATOM   8381  O  O     . ILE C  1 170 ? 22.447  17.463   31.250  1.00 57.20  ? 170 ILE C O     1 
ATOM   8382  C  CB    . ILE C  1 170 ? 23.114  17.682   34.406  1.00 54.35  ? 170 ILE C CB    1 
ATOM   8383  C  CG1   . ILE C  1 170 ? 22.729  16.276   34.877  1.00 53.89  ? 170 ILE C CG1   1 
ATOM   8384  C  CG2   . ILE C  1 170 ? 21.897  18.592   34.224  1.00 54.87  ? 170 ILE C CG2   1 
ATOM   8385  C  CD1   . ILE C  1 170 ? 22.139  16.259   36.291  1.00 54.27  ? 170 ILE C CD1   1 
ATOM   8386  N  N     . GLY C  1 171 ? 23.515  15.584   31.852  1.00 55.54  ? 171 GLY C N     1 
ATOM   8387  C  CA    . GLY C  1 171 ? 22.876  14.740   30.843  1.00 56.50  ? 171 GLY C CA    1 
ATOM   8388  C  C     . GLY C  1 171 ? 23.557  13.384   30.695  1.00 56.49  ? 171 GLY C C     1 
ATOM   8389  O  O     . GLY C  1 171 ? 24.665  13.167   31.210  1.00 55.41  ? 171 GLY C O     1 
ATOM   8390  N  N     . ASP C  1 172 ? 22.892  12.469   29.986  1.00 57.33  ? 172 ASP C N     1 
ATOM   8391  C  CA    . ASP C  1 172 ? 23.440  11.134   29.725  1.00 57.35  ? 172 ASP C CA    1 
ATOM   8392  C  C     . ASP C  1 172 ? 24.741  11.213   28.922  1.00 58.31  ? 172 ASP C C     1 
ATOM   8393  O  O     . ASP C  1 172 ? 25.053  12.258   28.329  1.00 59.30  ? 172 ASP C O     1 
ATOM   8394  C  CB    . ASP C  1 172 ? 22.425  10.275   28.982  1.00 57.65  ? 172 ASP C CB    1 
ATOM   8395  C  CG    . ASP C  1 172 ? 21.221  9.882    29.850  1.00 58.35  ? 172 ASP C CG    1 
ATOM   8396  O  OD1   . ASP C  1 172 ? 21.251  10.064   31.099  1.00 56.03  ? 172 ASP C OD1   1 
ATOM   8397  O  OD2   . ASP C  1 172 ? 20.231  9.367    29.262  1.00 59.99  ? 172 ASP C OD2   1 
ATOM   8398  N  N     . ARG C  1 173 ? 25.505  10.116   28.935  1.00 58.24  ? 173 ARG C N     1 
ATOM   8399  C  CA    . ARG C  1 173 ? 26.680  9.938    28.071  1.00 59.02  ? 173 ARG C CA    1 
ATOM   8400  C  C     . ARG C  1 173 ? 26.410  10.410   26.647  1.00 60.56  ? 173 ARG C C     1 
ATOM   8401  O  O     . ARG C  1 173 ? 25.315  10.196   26.114  1.00 60.92  ? 173 ARG C O     1 
ATOM   8402  C  CB    . ARG C  1 173 ? 27.094  8.463    28.026  1.00 59.03  ? 173 ARG C CB    1 
ATOM   8403  C  CG    . ARG C  1 173 ? 26.023  7.543    27.419  1.00 60.31  ? 173 ARG C CG    1 
ATOM   8404  C  CD    . ARG C  1 173 ? 26.458  6.092    27.273  1.00 62.46  ? 173 ARG C CD    1 
ATOM   8405  N  NE    . ARG C  1 173 ? 25.288  5.213    27.333  1.00 64.01  ? 173 ARG C NE    1 
ATOM   8406  C  CZ    . ARG C  1 173 ? 24.614  4.742    26.282  1.00 66.20  ? 173 ARG C CZ    1 
ATOM   8407  N  NH1   . ARG C  1 173 ? 24.984  5.030    25.035  1.00 67.17  ? 173 ARG C NH1   1 
ATOM   8408  N  NH2   . ARG C  1 173 ? 23.553  3.966    26.486  1.00 66.27  ? 173 ARG C NH2   1 
ATOM   8409  N  N     . GLN C  1 174 ? 27.419  11.058   26.056  1.00 61.44  ? 174 GLN C N     1 
ATOM   8410  C  CA    . GLN C  1 174 ? 27.434  11.474   24.641  1.00 63.11  ? 174 GLN C CA    1 
ATOM   8411  C  C     . GLN C  1 174 ? 26.239  12.327   24.221  1.00 64.02  ? 174 GLN C C     1 
ATOM   8412  O  O     . GLN C  1 174 ? 25.576  12.022   23.234  1.00 65.34  ? 174 GLN C O     1 
ATOM   8413  C  CB    . GLN C  1 174 ? 27.573  10.259   23.714  1.00 63.87  ? 174 GLN C CB    1 
ATOM   8414  C  CG    . GLN C  1 174 ? 29.003  9.729    23.530  1.00 64.38  ? 174 GLN C CG    1 
ATOM   8415  C  CD    . GLN C  1 174 ? 29.833  10.510   22.497  1.00 65.82  ? 174 GLN C CD    1 
ATOM   8416  O  OE1   . GLN C  1 174 ? 30.968  10.899   22.773  1.00 64.59  ? 174 GLN C OE1   1 
ATOM   8417  N  NE2   . GLN C  1 174 ? 29.271  10.729   21.305  1.00 67.22  ? 174 GLN C NE2   1 
ATOM   8418  N  N     . THR C  1 175 ? 25.975  13.393   24.970  1.00 63.71  ? 175 THR C N     1 
ATOM   8419  C  CA    . THR C  1 175 ? 24.817  14.256   24.717  1.00 64.55  ? 175 THR C CA    1 
ATOM   8420  C  C     . THR C  1 175 ? 25.192  15.707   24.443  1.00 65.60  ? 175 THR C C     1 
ATOM   8421  O  O     . THR C  1 175 ? 24.317  16.529   24.173  1.00 66.67  ? 175 THR C O     1 
ATOM   8422  C  CB    . THR C  1 175 ? 23.826  14.232   25.891  1.00 63.54  ? 175 THR C CB    1 
ATOM   8423  O  OG1   . THR C  1 175 ? 24.533  14.451   27.120  1.00 62.40  ? 175 THR C OG1   1 
ATOM   8424  C  CG2   . THR C  1 175 ? 23.073  12.892   25.947  1.00 62.88  ? 175 THR C CG2   1 
ATOM   8425  N  N     . GLY C  1 176 ? 26.485  16.026   24.527  1.00 65.65  ? 176 GLY C N     1 
ATOM   8426  C  CA    . GLY C  1 176 ? 26.985  17.341   24.136  1.00 66.66  ? 176 GLY C CA    1 
ATOM   8427  C  C     . GLY C  1 176 ? 27.619  18.118   25.265  1.00 66.03  ? 176 GLY C C     1 
ATOM   8428  O  O     . GLY C  1 176 ? 28.102  19.241   25.056  1.00 66.86  ? 176 GLY C O     1 
ATOM   8429  N  N     . LYS C  1 177 ? 27.623  17.510   26.453  1.00 64.55  ? 177 LYS C N     1 
ATOM   8430  C  CA    . LYS C  1 177 ? 28.090  18.147   27.680  1.00 63.76  ? 177 LYS C CA    1 
ATOM   8431  C  C     . LYS C  1 177 ? 29.416  18.885   27.517  1.00 65.25  ? 177 LYS C C     1 
ATOM   8432  O  O     . LYS C  1 177 ? 29.508  20.068   27.855  1.00 65.84  ? 177 LYS C O     1 
ATOM   8433  C  CB    . LYS C  1 177 ? 28.179  17.136   28.818  1.00 61.69  ? 177 LYS C CB    1 
ATOM   8434  C  CG    . LYS C  1 177 ? 26.849  16.543   29.235  1.00 60.51  ? 177 LYS C CG    1 
ATOM   8435  C  CD    . LYS C  1 177 ? 26.963  15.710   30.506  1.00 58.11  ? 177 LYS C CD    1 
ATOM   8436  C  CE    . LYS C  1 177 ? 27.897  14.508   30.334  1.00 57.92  ? 177 LYS C CE    1 
ATOM   8437  N  NZ    . LYS C  1 177 ? 27.432  13.526   29.296  1.00 59.63  ? 177 LYS C NZ    1 
ATOM   8438  N  N     . THR C  1 178 ? 30.439  18.220   26.987  1.00 66.22  ? 178 THR C N     1 
ATOM   8439  C  CA    . THR C  1 178 ? 31.734  18.881   26.863  1.00 68.20  ? 178 THR C CA    1 
ATOM   8440  C  C     . THR C  1 178 ? 31.691  19.963   25.786  1.00 69.39  ? 178 THR C C     1 
ATOM   8441  O  O     . THR C  1 178 ? 32.297  21.019   25.951  1.00 69.96  ? 178 THR C O     1 
ATOM   8442  C  CB    . THR C  1 178 ? 32.872  17.884   26.647  1.00 68.36  ? 178 THR C CB    1 
ATOM   8443  O  OG1   . THR C  1 178 ? 32.787  16.876   27.654  1.00 73.51  ? 178 THR C OG1   1 
ATOM   8444  C  CG2   . THR C  1 178 ? 34.241  18.571   26.759  1.00 69.29  ? 178 THR C CG2   1 
ATOM   8445  N  N     . ALA C  1 179 ? 30.924  19.705   24.723  1.00 70.13  ? 179 ALA C N     1 
ATOM   8446  C  CA    . ALA C  1 179 ? 30.762  20.635   23.593  1.00 71.70  ? 179 ALA C CA    1 
ATOM   8447  C  C     . ALA C  1 179 ? 30.108  21.958   23.978  1.00 71.75  ? 179 ALA C C     1 
ATOM   8448  O  O     . ALA C  1 179 ? 30.278  22.953   23.267  1.00 73.44  ? 179 ALA C O     1 
ATOM   8449  C  CB    . ALA C  1 179 ? 29.981  19.978   22.458  1.00 72.51  ? 179 ALA C CB    1 
ATOM   8450  N  N     . VAL C  1 180 ? 29.346  21.959   25.075  1.00 69.92  ? 180 VAL C N     1 
ATOM   8451  C  CA    . VAL C  1 180 ? 28.804  23.197   25.634  1.00 69.76  ? 180 VAL C CA    1 
ATOM   8452  C  C     . VAL C  1 180 ? 29.916  23.979   26.318  1.00 69.77  ? 180 VAL C C     1 
ATOM   8453  O  O     . VAL C  1 180 ? 30.072  25.178   26.067  1.00 71.41  ? 180 VAL C O     1 
ATOM   8454  C  CB    . VAL C  1 180 ? 27.641  22.956   26.622  1.00 68.28  ? 180 VAL C CB    1 
ATOM   8455  C  CG1   . VAL C  1 180 ? 27.402  24.188   27.485  1.00 68.00  ? 180 VAL C CG1   1 
ATOM   8456  C  CG2   . VAL C  1 180 ? 26.378  22.592   25.876  1.00 68.57  ? 180 VAL C CG2   1 
ATOM   8457  N  N     . ALA C  1 181 ? 30.694  23.300   27.159  1.00 68.24  ? 181 ALA C N     1 
ATOM   8458  C  CA    . ALA C  1 181 ? 31.815  23.932   27.856  1.00 68.30  ? 181 ALA C CA    1 
ATOM   8459  C  C     . ALA C  1 181 ? 32.912  24.357   26.892  1.00 69.98  ? 181 ALA C C     1 
ATOM   8460  O  O     . ALA C  1 181 ? 33.547  25.394   27.082  1.00 71.00  ? 181 ALA C O     1 
ATOM   8461  C  CB    . ALA C  1 181 ? 32.387  22.995   28.904  1.00 66.82  ? 181 ALA C CB    1 
ATOM   8462  N  N     . LEU C  1 182 ? 33.120  23.553   25.854  1.00 70.63  ? 182 LEU C N     1 
ATOM   8463  C  CA    . LEU C  1 182 ? 34.212  23.773   24.912  1.00 72.37  ? 182 LEU C CA    1 
ATOM   8464  C  C     . LEU C  1 182 ? 33.980  24.986   24.022  1.00 74.23  ? 182 LEU C C     1 
ATOM   8465  O  O     . LEU C  1 182 ? 34.927  25.656   23.610  1.00 75.64  ? 182 LEU C O     1 
ATOM   8466  C  CB    . LEU C  1 182 ? 34.444  22.535   24.048  1.00 72.46  ? 182 LEU C CB    1 
ATOM   8467  C  CG    . LEU C  1 182 ? 35.825  22.543   23.393  1.00 74.73  ? 182 LEU C CG    1 
ATOM   8468  C  CD1   . LEU C  1 182 ? 36.922  22.587   24.463  1.00 74.49  ? 182 LEU C CD1   1 
ATOM   8469  C  CD2   . LEU C  1 182 ? 36.017  21.359   22.431  1.00 75.71  ? 182 LEU C CD2   1 
ATOM   8470  N  N     . ASP C  1 183 ? 32.717  25.252   23.721  1.00 74.34  ? 183 ASP C N     1 
ATOM   8471  C  CA    . ASP C  1 183 ? 32.376  26.374   22.879  1.00 76.57  ? 183 ASP C CA    1 
ATOM   8472  C  C     . ASP C  1 183 ? 32.409  27.677   23.678  1.00 76.71  ? 183 ASP C C     1 
ATOM   8473  O  O     . ASP C  1 183 ? 32.577  28.754   23.107  1.00 78.45  ? 183 ASP C O     1 
ATOM   8474  C  CB    . ASP C  1 183 ? 31.033  26.137   22.187  1.00 77.14  ? 183 ASP C CB    1 
ATOM   8475  C  CG    . ASP C  1 183 ? 31.180  25.385   20.853  1.00 79.80  ? 183 ASP C CG    1 
ATOM   8476  O  OD1   . ASP C  1 183 ? 32.287  24.859   20.556  1.00 81.40  ? 183 ASP C OD1   1 
ATOM   8477  O  OD2   . ASP C  1 183 ? 30.184  25.334   20.087  1.00 81.62  ? 183 ASP C OD2   1 
ATOM   8478  N  N     . THR C  1 184 ? 32.274  27.573   25.000  1.00 74.73  ? 184 THR C N     1 
ATOM   8479  C  CA    . THR C  1 184 ? 32.470  28.729   25.867  1.00 74.47  ? 184 THR C CA    1 
ATOM   8480  C  C     . THR C  1 184 ? 33.948  29.134   25.887  1.00 75.27  ? 184 THR C C     1 
ATOM   8481  O  O     . THR C  1 184 ? 34.277  30.280   25.583  1.00 77.09  ? 184 THR C O     1 
ATOM   8482  C  CB    . THR C  1 184 ? 31.929  28.478   27.282  1.00 72.22  ? 184 THR C CB    1 
ATOM   8483  O  OG1   . THR C  1 184 ? 30.586  28.022   27.177  1.00 71.44  ? 184 THR C OG1   1 
ATOM   8484  C  CG2   . THR C  1 184 ? 31.917  29.763   28.091  1.00 72.75  ? 184 THR C CG2   1 
ATOM   8485  N  N     . ILE C  1 185 ? 34.831  28.193   26.218  1.00 74.23  ? 185 ILE C N     1 
ATOM   8486  C  CA    . ILE C  1 185 ? 36.277  28.452   26.222  1.00 74.91  ? 185 ILE C CA    1 
ATOM   8487  C  C     . ILE C  1 185 ? 36.729  29.057   24.890  1.00 77.42  ? 185 ILE C C     1 
ATOM   8488  O  O     . ILE C  1 185 ? 37.374  30.103   24.868  1.00 78.79  ? 185 ILE C O     1 
ATOM   8489  C  CB    . ILE C  1 185 ? 37.089  27.178   26.569  1.00 73.63  ? 185 ILE C CB    1 
ATOM   8490  C  CG1   . ILE C  1 185 ? 36.811  26.759   28.021  1.00 70.58  ? 185 ILE C CG1   1 
ATOM   8491  C  CG2   . ILE C  1 185 ? 38.586  27.396   26.324  1.00 74.44  ? 185 ILE C CG2   1 
ATOM   8492  C  CD1   . ILE C  1 185 ? 36.894  25.268   28.274  1.00 67.92  ? 185 ILE C CD1   1 
ATOM   8493  N  N     . LEU C  1 186 ? 36.351  28.426   23.783  1.00 78.10  ? 186 LEU C N     1 
ATOM   8494  C  CA    . LEU C  1 186 ? 36.719  28.935   22.460  1.00 80.57  ? 186 LEU C CA    1 
ATOM   8495  C  C     . LEU C  1 186 ? 36.222  30.359   22.200  1.00 82.47  ? 186 LEU C C     1 
ATOM   8496  O  O     . LEU C  1 186 ? 36.909  31.142   21.533  1.00 85.07  ? 186 LEU C O     1 
ATOM   8497  C  CB    . LEU C  1 186 ? 36.232  28.001   21.351  1.00 80.59  ? 186 LEU C CB    1 
ATOM   8498  C  CG    . LEU C  1 186 ? 36.866  26.614   21.227  1.00 79.56  ? 186 LEU C CG    1 
ATOM   8499  C  CD1   . LEU C  1 186 ? 36.514  26.027   19.879  1.00 81.51  ? 186 LEU C CD1   1 
ATOM   8500  C  CD2   . LEU C  1 186 ? 38.373  26.628   21.405  1.00 78.93  ? 186 LEU C CD2   1 
ATOM   8501  N  N     . ASN C  1 187 ? 35.043  30.693   22.727  1.00 81.61  ? 187 ASN C N     1 
ATOM   8502  C  CA    . ASN C  1 187 ? 34.419  31.995   22.487  1.00 83.02  ? 187 ASN C CA    1 
ATOM   8503  C  C     . ASN C  1 187 ? 35.137  33.147   23.169  1.00 83.71  ? 187 ASN C C     1 
ATOM   8504  O  O     . ASN C  1 187 ? 35.025  34.287   22.731  1.00 85.55  ? 187 ASN C O     1 
ATOM   8505  C  CB    . ASN C  1 187 ? 32.951  31.982   22.919  1.00 82.05  ? 187 ASN C CB    1 
ATOM   8506  C  CG    . ASN C  1 187 ? 32.142  33.124   22.311  1.00 84.46  ? 187 ASN C CG    1 
ATOM   8507  O  OD1   . ASN C  1 187 ? 32.096  33.293   21.089  1.00 86.72  ? 187 ASN C OD1   1 
ATOM   8508  N  ND2   . ASN C  1 187 ? 31.484  33.901   23.166  1.00 84.94  ? 187 ASN C ND2   1 
ATOM   8509  N  N     . GLN C  1 188 ? 35.877  32.851   24.232  1.00 82.42  ? 188 GLN C N     1 
ATOM   8510  C  CA    . GLN C  1 188 ? 36.566  33.894   24.997  1.00 83.08  ? 188 GLN C CA    1 
ATOM   8511  C  C     . GLN C  1 188 ? 37.659  34.616   24.211  1.00 85.78  ? 188 GLN C C     1 
ATOM   8512  O  O     . GLN C  1 188 ? 38.294  35.538   24.721  1.00 86.97  ? 188 GLN C O     1 
ATOM   8513  C  CB    . GLN C  1 188 ? 37.137  33.330   26.299  1.00 81.20  ? 188 GLN C CB    1 
ATOM   8514  C  CG    . GLN C  1 188 ? 36.103  32.704   27.233  1.00 78.57  ? 188 GLN C CG    1 
ATOM   8515  C  CD    . GLN C  1 188 ? 34.780  33.452   27.250  1.00 78.50  ? 188 GLN C CD    1 
ATOM   8516  O  OE1   . GLN C  1 188 ? 34.714  34.629   27.621  1.00 79.34  ? 188 GLN C OE1   1 
ATOM   8517  N  NE2   . GLN C  1 188 ? 33.714  32.763   26.855  1.00 77.16  ? 188 GLN C NE2   1 
ATOM   8518  N  N     . LYS C  1 189 ? 37.851  34.212   22.959  1.00 87.16  ? 189 LYS C N     1 
ATOM   8519  C  CA    . LYS C  1 189 ? 38.893  34.764   22.098  1.00 89.69  ? 189 LYS C CA    1 
ATOM   8520  C  C     . LYS C  1 189 ? 38.671  36.235   21.741  1.00 91.98  ? 189 LYS C C     1 
ATOM   8521  O  O     . LYS C  1 189 ? 39.628  36.969   21.475  1.00 94.05  ? 189 LYS C O     1 
ATOM   8522  C  CB    . LYS C  1 189 ? 38.989  33.936   20.821  1.00 90.37  ? 189 LYS C CB    1 
ATOM   8523  C  CG    . LYS C  1 189 ? 40.376  33.880   20.267  1.00 92.45  ? 189 LYS C CG    1 
ATOM   8524  C  CD    . LYS C  1 189 ? 40.427  33.052   19.020  1.00 94.22  ? 189 LYS C CD    1 
ATOM   8525  C  CE    . LYS C  1 189 ? 41.830  33.068   18.469  1.00 97.69  ? 189 LYS C CE    1 
ATOM   8526  N  NZ    . LYS C  1 189 ? 42.040  31.950   17.513  1.00 99.75  ? 189 LYS C NZ    1 
ATOM   8527  N  N     . ARG C  1 190 ? 37.409  36.654   21.744  1.00 91.86  ? 190 ARG C N     1 
ATOM   8528  C  CA    . ARG C  1 190 ? 37.020  38.008   21.338  1.00 94.47  ? 190 ARG C CA    1 
ATOM   8529  C  C     . ARG C  1 190 ? 37.561  39.081   22.284  1.00 94.95  ? 190 ARG C C     1 
ATOM   8530  O  O     . ARG C  1 190 ? 37.641  40.262   21.927  1.00 96.98  ? 190 ARG C O     1 
ATOM   8531  C  CB    . ARG C  1 190 ? 35.494  38.113   21.263  1.00 94.04  ? 190 ARG C CB    1 
ATOM   8532  C  CG    . ARG C  1 190 ? 34.848  37.025   20.426  1.00 94.47  ? 190 ARG C CG    1 
ATOM   8533  C  CD    . ARG C  1 190 ? 33.335  37.174   20.362  1.00 95.34  ? 190 ARG C CD    1 
ATOM   8534  N  NE    . ARG C  1 190 ? 32.703  35.945   19.883  1.00 94.94  ? 190 ARG C NE    1 
ATOM   8535  C  CZ    . ARG C  1 190 ? 32.531  35.616   18.601  1.00 96.83  ? 190 ARG C CZ    1 
ATOM   8536  N  NH1   . ARG C  1 190 ? 32.934  36.420   17.622  1.00 99.08  ? 190 ARG C NH1   1 
ATOM   8537  N  NH2   . ARG C  1 190 ? 31.944  34.466   18.300  1.00 96.24  ? 190 ARG C NH2   1 
ATOM   8538  N  N     . TRP C  1 191 ? 37.929  38.642   23.486  1.00 92.94  ? 191 TRP C N     1 
ATOM   8539  C  CA    . TRP C  1 191 ? 38.335  39.519   24.568  1.00 92.94  ? 191 TRP C CA    1 
ATOM   8540  C  C     . TRP C  1 191 ? 39.720  39.166   25.073  1.00 93.09  ? 191 TRP C C     1 
ATOM   8541  O  O     . TRP C  1 191 ? 40.442  40.030   25.566  1.00 94.55  ? 191 TRP C O     1 
ATOM   8542  C  CB    . TRP C  1 191 ? 37.322  39.429   25.706  1.00 90.43  ? 191 TRP C CB    1 
ATOM   8543  C  CG    . TRP C  1 191 ? 35.952  39.752   25.242  1.00 90.04  ? 191 TRP C CG    1 
ATOM   8544  C  CD1   . TRP C  1 191 ? 35.444  40.991   25.021  1.00 91.71  ? 191 TRP C CD1   1 
ATOM   8545  C  CD2   . TRP C  1 191 ? 34.916  38.827   24.899  1.00 88.47  ? 191 TRP C CD2   1 
ATOM   8546  N  NE1   . TRP C  1 191 ? 34.151  40.905   24.577  1.00 91.39  ? 191 TRP C NE1   1 
ATOM   8547  C  CE2   . TRP C  1 191 ? 33.799  39.585   24.494  1.00 89.41  ? 191 TRP C CE2   1 
ATOM   8548  C  CE3   . TRP C  1 191 ? 34.816  37.432   24.905  1.00 87.27  ? 191 TRP C CE3   1 
ATOM   8549  C  CZ2   . TRP C  1 191 ? 32.595  38.998   24.099  1.00 88.37  ? 191 TRP C CZ2   1 
ATOM   8550  C  CZ3   . TRP C  1 191 ? 33.609  36.845   24.512  1.00 86.72  ? 191 TRP C CZ3   1 
ATOM   8551  C  CH2   . TRP C  1 191 ? 32.520  37.631   24.112  1.00 87.03  ? 191 TRP C CH2   1 
ATOM   8552  N  N     . ASN C  1 192 ? 40.090  37.896   24.946  1.00 92.01  ? 192 ASN C N     1 
ATOM   8553  C  CA    . ASN C  1 192 ? 41.373  37.432   25.456  1.00 92.04  ? 192 ASN C CA    1 
ATOM   8554  C  C     . ASN C  1 192 ? 42.545  37.885   24.596  1.00 95.22  ? 192 ASN C C     1 
ATOM   8555  O  O     . ASN C  1 192 ? 43.675  37.955   25.080  1.00 95.99  ? 192 ASN C O     1 
ATOM   8556  C  CB    . ASN C  1 192 ? 41.375  35.913   25.663  1.00 89.64  ? 192 ASN C CB    1 
ATOM   8557  C  CG    . ASN C  1 192 ? 40.515  35.477   26.856  1.00 86.53  ? 192 ASN C CG    1 
ATOM   8558  O  OD1   . ASN C  1 192 ? 40.097  36.299   27.670  1.00 85.77  ? 192 ASN C OD1   1 
ATOM   8559  N  ND2   . ASN C  1 192 ? 40.251  34.177   26.955  1.00 83.06  ? 192 ASN C ND2   1 
ATOM   8560  N  N     . ASN C  1 193 ? 42.266  38.216   23.334  1.00 97.54  ? 193 ASN C N     1 
ATOM   8561  C  CA    . ASN C  1 193 ? 43.285  38.757   22.432  1.00 100.96 ? 193 ASN C CA    1 
ATOM   8562  C  C     . ASN C  1 193 ? 43.605  40.227   22.684  1.00 103.37 ? 193 ASN C C     1 
ATOM   8563  O  O     . ASN C  1 193 ? 44.580  40.758   22.139  1.00 106.12 ? 193 ASN C O     1 
ATOM   8564  C  CB    . ASN C  1 193 ? 42.886  38.558   20.966  1.00 102.51 ? 193 ASN C CB    1 
ATOM   8565  C  CG    . ASN C  1 193 ? 43.446  37.273   20.367  1.00 102.41 ? 193 ASN C CG    1 
ATOM   8566  O  OD1   . ASN C  1 193 ? 44.454  36.737   20.832  1.00 102.24 ? 193 ASN C OD1   1 
ATOM   8567  N  ND2   . ASN C  1 193 ? 42.793  36.781   19.319  1.00 102.81 ? 193 ASN C ND2   1 
ATOM   8568  N  N     . GLY C  1 194 ? 42.778  40.885   23.492  1.00 102.79 ? 194 GLY C N     1 
ATOM   8569  C  CA    . GLY C  1 194 ? 43.008  42.280   23.861  1.00 105.29 ? 194 GLY C CA    1 
ATOM   8570  C  C     . GLY C  1 194 ? 43.898  42.435   25.084  1.00 105.26 ? 194 GLY C C     1 
ATOM   8571  O  O     . GLY C  1 194 ? 44.339  41.442   25.675  1.00 103.64 ? 194 GLY C O     1 
ATOM   8572  N  N     . SER C  1 195 ? 44.162  43.689   25.453  1.00 107.32 ? 195 SER C N     1 
ATOM   8573  C  CA    . SER C  1 195 ? 44.927  44.031   26.658  1.00 107.44 ? 195 SER C CA    1 
ATOM   8574  C  C     . SER C  1 195 ? 44.011  44.313   27.856  1.00 105.77 ? 195 SER C C     1 
ATOM   8575  O  O     . SER C  1 195 ? 44.349  43.980   28.999  1.00 104.55 ? 195 SER C O     1 
ATOM   8576  C  CB    . SER C  1 195 ? 45.805  45.249   26.392  1.00 110.82 ? 195 SER C CB    1 
ATOM   8577  O  OG    . SER C  1 195 ? 45.004  46.383   26.114  1.00 112.40 ? 195 SER C OG    1 
ATOM   8578  N  N     . ASP C  1 196 ? 42.869  44.951   27.583  1.00 106.02 ? 196 ASP C N     1 
ATOM   8579  C  CA    . ASP C  1 196 ? 41.786  45.116   28.560  1.00 104.03 ? 196 ASP C CA    1 
ATOM   8580  C  C     . ASP C  1 196 ? 41.675  43.852   29.401  1.00 100.66 ? 196 ASP C C     1 
ATOM   8581  O  O     . ASP C  1 196 ? 41.210  42.818   28.928  1.00 99.15  ? 196 ASP C O     1 
ATOM   8582  C  CB    . ASP C  1 196 ? 40.459  45.412   27.840  1.00 104.22 ? 196 ASP C CB    1 
ATOM   8583  C  CG    . ASP C  1 196 ? 39.309  45.746   28.798  1.00 103.68 ? 196 ASP C CG    1 
ATOM   8584  O  OD1   . ASP C  1 196 ? 39.303  45.279   29.963  1.00 102.88 ? 196 ASP C OD1   1 
ATOM   8585  O  OD2   . ASP C  1 196 ? 38.384  46.474   28.368  1.00 105.16 ? 196 ASP C OD2   1 
ATOM   8586  N  N     . GLU C  1 197 ? 42.128  43.957   30.646  1.00 99.85  ? 197 GLU C N     1 
ATOM   8587  C  CA    . GLU C  1 197 ? 42.207  42.829   31.573  1.00 97.03  ? 197 GLU C CA    1 
ATOM   8588  C  C     . GLU C  1 197 ? 40.870  42.534   32.266  1.00 94.47  ? 197 GLU C C     1 
ATOM   8589  O  O     . GLU C  1 197 ? 40.642  41.425   32.748  1.00 92.00  ? 197 GLU C O     1 
ATOM   8590  C  CB    . GLU C  1 197 ? 43.291  43.130   32.618  1.00 97.81  ? 197 GLU C CB    1 
ATOM   8591  C  CG    . GLU C  1 197 ? 43.816  41.926   33.386  1.00 95.93  ? 197 GLU C CG    1 
ATOM   8592  C  CD    . GLU C  1 197 ? 44.524  40.923   32.496  1.00 96.58  ? 197 GLU C CD    1 
ATOM   8593  O  OE1   . GLU C  1 197 ? 44.086  39.754   32.492  1.00 94.01  ? 197 GLU C OE1   1 
ATOM   8594  O  OE2   . GLU C  1 197 ? 45.503  41.299   31.798  1.00 98.81  ? 197 GLU C OE2   1 
ATOM   8595  N  N     . SER C  1 198 ? 39.996  43.536   32.320  1.00 95.09  ? 198 SER C N     1 
ATOM   8596  C  CA    . SER C  1 198 ? 38.736  43.419   33.055  1.00 93.16  ? 198 SER C CA    1 
ATOM   8597  C  C     . SER C  1 198 ? 37.735  42.559   32.299  1.00 91.44  ? 198 SER C C     1 
ATOM   8598  O  O     . SER C  1 198 ? 36.829  41.982   32.901  1.00 89.37  ? 198 SER C O     1 
ATOM   8599  C  CB    . SER C  1 198 ? 38.127  44.805   33.304  1.00 94.85  ? 198 SER C CB    1 
ATOM   8600  O  OG    . SER C  1 198 ? 36.945  44.986   32.535  1.00 94.88  ? 198 SER C OG    1 
ATOM   8601  N  N     . LYS C  1 199 ? 37.901  42.502   30.976  1.00 92.36  ? 199 LYS C N     1 
ATOM   8602  C  CA    . LYS C  1 199 ? 36.975  41.790   30.088  1.00 91.11  ? 199 LYS C CA    1 
ATOM   8603  C  C     . LYS C  1 199 ? 37.417  40.356   29.782  1.00 89.07  ? 199 LYS C C     1 
ATOM   8604  O  O     . LYS C  1 199 ? 36.605  39.538   29.341  1.00 87.42  ? 199 LYS C O     1 
ATOM   8605  C  CB    . LYS C  1 199 ? 36.780  42.567   28.777  1.00 93.56  ? 199 LYS C CB    1 
ATOM   8606  C  CG    . LYS C  1 199 ? 35.820  43.755   28.858  1.00 95.19  ? 199 LYS C CG    1 
ATOM   8607  C  CD    . LYS C  1 199 ? 35.437  44.232   27.454  1.00 98.00  ? 199 LYS C CD    1 
ATOM   8608  C  CE    . LYS C  1 199 ? 35.115  45.736   27.402  1.00 100.55 ? 199 LYS C CE    1 
ATOM   8609  N  NZ    . LYS C  1 199 ? 33.732  46.053   27.856  1.00 99.97  ? 199 LYS C NZ    1 
ATOM   8610  N  N     . LYS C  1 200 ? 38.701  40.073   30.019  1.00 88.99  ? 200 LYS C N     1 
ATOM   8611  C  CA    . LYS C  1 200 ? 39.320  38.775   29.711  1.00 87.59  ? 200 LYS C CA    1 
ATOM   8612  C  C     . LYS C  1 200 ? 38.858  37.656   30.636  1.00 84.56  ? 200 LYS C C     1 
ATOM   8613  O  O     . LYS C  1 200 ? 38.639  37.891   31.826  1.00 83.94  ? 200 LYS C O     1 
ATOM   8614  C  CB    . LYS C  1 200 ? 40.842  38.880   29.786  1.00 88.80  ? 200 LYS C CB    1 
ATOM   8615  C  CG    . LYS C  1 200 ? 41.452  39.696   28.682  1.00 91.78  ? 200 LYS C CG    1 
ATOM   8616  C  CD    . LYS C  1 200 ? 42.950  39.835   28.853  1.00 94.02  ? 200 LYS C CD    1 
ATOM   8617  C  CE    . LYS C  1 200 ? 43.700  38.651   28.263  1.00 93.78  ? 200 LYS C CE    1 
ATOM   8618  N  NZ    . LYS C  1 200 ? 45.168  38.896   28.247  1.00 95.30  ? 200 LYS C NZ    1 
ATOM   8619  N  N     . LEU C  1 201 ? 38.739  36.444   30.089  1.00 82.85  ? 201 LEU C N     1 
ATOM   8620  C  CA    . LEU C  1 201 ? 38.293  35.284   30.859  1.00 80.16  ? 201 LEU C CA    1 
ATOM   8621  C  C     . LEU C  1 201 ? 39.198  34.056   30.701  1.00 79.38  ? 201 LEU C C     1 
ATOM   8622  O  O     . LEU C  1 201 ? 39.023  33.262   29.780  1.00 79.31  ? 201 LEU C O     1 
ATOM   8623  C  CB    . LEU C  1 201 ? 36.835  34.935   30.508  1.00 79.12  ? 201 LEU C CB    1 
ATOM   8624  C  CG    . LEU C  1 201 ? 36.130  33.808   31.273  1.00 75.92  ? 201 LEU C CG    1 
ATOM   8625  C  CD1   . LEU C  1 201 ? 36.198  34.003   32.776  1.00 74.31  ? 201 LEU C CD1   1 
ATOM   8626  C  CD2   . LEU C  1 201 ? 34.700  33.713   30.830  1.00 75.30  ? 201 LEU C CD2   1 
ATOM   8627  N  N     . TYR C  1 202 ? 40.139  33.896   31.627  1.00 79.02  ? 202 TYR C N     1 
ATOM   8628  C  CA    . TYR C  1 202 ? 41.112  32.802   31.602  1.00 78.59  ? 202 TYR C CA    1 
ATOM   8629  C  C     . TYR C  1 202 ? 40.460  31.465   31.969  1.00 76.55  ? 202 TYR C C     1 
ATOM   8630  O  O     . TYR C  1 202 ? 39.773  31.356   32.994  1.00 75.22  ? 202 TYR C O     1 
ATOM   8631  C  CB    . TYR C  1 202 ? 42.271  33.114   32.550  1.00 79.05  ? 202 TYR C CB    1 
ATOM   8632  C  CG    . TYR C  1 202 ? 43.024  34.371   32.177  1.00 81.74  ? 202 TYR C CG    1 
ATOM   8633  C  CD1   . TYR C  1 202 ? 44.292  34.302   31.589  1.00 83.62  ? 202 TYR C CD1   1 
ATOM   8634  C  CD2   . TYR C  1 202 ? 42.463  35.633   32.387  1.00 82.39  ? 202 TYR C CD2   1 
ATOM   8635  C  CE1   . TYR C  1 202 ? 44.981  35.454   31.233  1.00 85.02  ? 202 TYR C CE1   1 
ATOM   8636  C  CE2   . TYR C  1 202 ? 43.140  36.782   32.025  1.00 84.73  ? 202 TYR C CE2   1 
ATOM   8637  C  CZ    . TYR C  1 202 ? 44.397  36.684   31.456  1.00 86.39  ? 202 TYR C CZ    1 
ATOM   8638  O  OH    . TYR C  1 202 ? 45.068  37.824   31.107  1.00 90.16  ? 202 TYR C OH    1 
ATOM   8639  N  N     . CYS C  1 203 ? 40.688  30.454   31.134  1.00 76.17  ? 203 CYS C N     1 
ATOM   8640  C  CA    . CYS C  1 203 ? 39.967  29.197   31.233  1.00 74.32  ? 203 CYS C CA    1 
ATOM   8641  C  C     . CYS C  1 203 ? 40.777  28.073   31.866  1.00 73.26  ? 203 CYS C C     1 
ATOM   8642  O  O     . CYS C  1 203 ? 41.970  27.914   31.583  1.00 74.46  ? 203 CYS C O     1 
ATOM   8643  C  CB    . CYS C  1 203 ? 39.498  28.762   29.849  1.00 74.94  ? 203 CYS C CB    1 
ATOM   8644  S  SG    . CYS C  1 203 ? 38.337  29.908   29.075  1.00 77.20  ? 203 CYS C SG    1 
ATOM   8645  N  N     . VAL C  1 204 ? 40.107  27.287   32.709  1.00 70.97  ? 204 VAL C N     1 
ATOM   8646  C  CA    . VAL C  1 204 ? 40.702  26.117   33.356  1.00 69.54  ? 204 VAL C CA    1 
ATOM   8647  C  C     . VAL C  1 204 ? 39.813  24.882   33.127  1.00 68.28  ? 204 VAL C C     1 
ATOM   8648  O  O     . VAL C  1 204 ? 38.628  24.872   33.505  1.00 67.39  ? 204 VAL C O     1 
ATOM   8649  C  CB    . VAL C  1 204 ? 40.892  26.342   34.884  1.00 68.64  ? 204 VAL C CB    1 
ATOM   8650  C  CG1   . VAL C  1 204 ? 41.447  25.084   35.554  1.00 66.89  ? 204 VAL C CG1   1 
ATOM   8651  C  CG2   . VAL C  1 204 ? 41.774  27.542   35.161  1.00 68.98  ? 204 VAL C CG2   1 
ATOM   8652  N  N     . TYR C  1 205 ? 40.381  23.844   32.517  1.00 68.18  ? 205 TYR C N     1 
ATOM   8653  C  CA    . TYR C  1 205 ? 39.614  22.633   32.219  1.00 67.03  ? 205 TYR C CA    1 
ATOM   8654  C  C     . TYR C  1 205 ? 40.140  21.433   33.002  1.00 65.71  ? 205 TYR C C     1 
ATOM   8655  O  O     . TYR C  1 205 ? 41.331  21.117   32.953  1.00 66.43  ? 205 TYR C O     1 
ATOM   8656  C  CB    . TYR C  1 205 ? 39.614  22.357   30.714  1.00 68.34  ? 205 TYR C CB    1 
ATOM   8657  C  CG    . TYR C  1 205 ? 38.801  21.154   30.303  1.00 67.85  ? 205 TYR C CG    1 
ATOM   8658  C  CD1   . TYR C  1 205 ? 39.410  19.924   30.076  1.00 68.46  ? 205 TYR C CD1   1 
ATOM   8659  C  CD2   . TYR C  1 205 ? 37.421  21.247   30.134  1.00 68.16  ? 205 TYR C CD2   1 
ATOM   8660  C  CE1   . TYR C  1 205 ? 38.661  18.807   29.695  1.00 68.54  ? 205 TYR C CE1   1 
ATOM   8661  C  CE2   . TYR C  1 205 ? 36.655  20.132   29.755  1.00 67.70  ? 205 TYR C CE2   1 
ATOM   8662  C  CZ    . TYR C  1 205 ? 37.285  18.917   29.534  1.00 67.95  ? 205 TYR C CZ    1 
ATOM   8663  O  OH    . TYR C  1 205 ? 36.551  17.812   29.157  1.00 67.72  ? 205 TYR C OH    1 
ATOM   8664  N  N     . VAL C  1 206 ? 39.239  20.770   33.721  1.00 63.98  ? 206 VAL C N     1 
ATOM   8665  C  CA    . VAL C  1 206 ? 39.615  19.695   34.638  1.00 62.60  ? 206 VAL C CA    1 
ATOM   8666  C  C     . VAL C  1 206 ? 39.125  18.339   34.139  1.00 61.66  ? 206 VAL C C     1 
ATOM   8667  O  O     . VAL C  1 206 ? 37.963  17.985   34.330  1.00 60.52  ? 206 VAL C O     1 
ATOM   8668  C  CB    . VAL C  1 206 ? 39.071  19.950   36.054  1.00 61.38  ? 206 VAL C CB    1 
ATOM   8669  C  CG1   . VAL C  1 206 ? 39.741  19.022   37.056  1.00 60.98  ? 206 VAL C CG1   1 
ATOM   8670  C  CG2   . VAL C  1 206 ? 39.287  21.397   36.451  1.00 62.46  ? 206 VAL C CG2   1 
ATOM   8671  N  N     . ALA C  1 207 ? 40.012  17.585   33.491  1.00 62.25  ? 207 ALA C N     1 
ATOM   8672  C  CA    . ALA C  1 207 ? 39.670  16.236   33.033  1.00 61.62  ? 207 ALA C CA    1 
ATOM   8673  C  C     . ALA C  1 207 ? 39.849  15.235   34.170  1.00 60.26  ? 207 ALA C C     1 
ATOM   8674  O  O     . ALA C  1 207 ? 40.956  15.069   34.694  1.00 60.89  ? 207 ALA C O     1 
ATOM   8675  C  CB    . ALA C  1 207 ? 40.502  15.843   31.828  1.00 62.76  ? 207 ALA C CB    1 
ATOM   8676  N  N     . VAL C  1 208 ? 38.758  14.587   34.565  1.00 58.49  ? 208 VAL C N     1 
ATOM   8677  C  CA    . VAL C  1 208 ? 38.814  13.589   35.623  1.00 56.80  ? 208 VAL C CA    1 
ATOM   8678  C  C     . VAL C  1 208 ? 38.275  12.269   35.097  1.00 56.30  ? 208 VAL C C     1 
ATOM   8679  O  O     . VAL C  1 208 ? 37.100  12.176   34.737  1.00 56.07  ? 208 VAL C O     1 
ATOM   8680  C  CB    . VAL C  1 208 ? 37.989  14.007   36.866  1.00 55.81  ? 208 VAL C CB    1 
ATOM   8681  C  CG1   . VAL C  1 208 ? 38.257  13.047   38.020  1.00 54.64  ? 208 VAL C CG1   1 
ATOM   8682  C  CG2   . VAL C  1 208 ? 38.286  15.449   37.276  1.00 55.31  ? 208 VAL C CG2   1 
ATOM   8683  N  N     . GLY C  1 209 ? 39.137  11.257   35.042  1.00 56.23  ? 209 GLY C N     1 
ATOM   8684  C  CA    . GLY C  1 209 ? 38.725  9.904    34.685  1.00 55.57  ? 209 GLY C CA    1 
ATOM   8685  C  C     . GLY C  1 209 ? 38.404  9.710    33.219  1.00 56.67  ? 209 GLY C C     1 
ATOM   8686  O  O     . GLY C  1 209 ? 37.871  8.660    32.816  1.00 56.65  ? 209 GLY C O     1 
ATOM   8687  N  N     . GLN C  1 210 ? 38.722  10.724   32.417  1.00 57.67  ? 210 GLN C N     1 
ATOM   8688  C  CA    . GLN C  1 210 ? 38.706  10.602   30.968  1.00 58.59  ? 210 GLN C CA    1 
ATOM   8689  C  C     . GLN C  1 210 ? 39.909  9.784    30.539  1.00 59.27  ? 210 GLN C C     1 
ATOM   8690  O  O     . GLN C  1 210 ? 40.840  9.584    31.314  1.00 58.91  ? 210 GLN C O     1 
ATOM   8691  C  CB    . GLN C  1 210 ? 38.785  11.981   30.321  1.00 59.56  ? 210 GLN C CB    1 
ATOM   8692  C  CG    . GLN C  1 210 ? 37.588  12.881   30.570  1.00 59.14  ? 210 GLN C CG    1 
ATOM   8693  C  CD    . GLN C  1 210 ? 37.757  14.230   29.902  1.00 60.46  ? 210 GLN C CD    1 
ATOM   8694  O  OE1   . GLN C  1 210 ? 38.324  14.310   28.820  1.00 63.04  ? 210 GLN C OE1   1 
ATOM   8695  N  NE2   . GLN C  1 210 ? 37.269  15.294   30.539  1.00 59.50  ? 210 GLN C NE2   1 
ATOM   8696  N  N     . LYS C  1 211 ? 39.903  9.303    29.306  1.00 60.47  ? 211 LYS C N     1 
ATOM   8697  C  CA    . LYS C  1 211 ? 41.101  8.650    28.795  1.00 61.85  ? 211 LYS C CA    1 
ATOM   8698  C  C     . LYS C  1 211 ? 42.049  9.708    28.206  1.00 63.62  ? 211 LYS C C     1 
ATOM   8699  O  O     . LYS C  1 211 ? 41.597  10.668   27.576  1.00 64.56  ? 211 LYS C O     1 
ATOM   8700  C  CB    . LYS C  1 211 ? 40.748  7.537    27.800  1.00 62.09  ? 211 LYS C CB    1 
ATOM   8701  C  CG    . LYS C  1 211 ? 40.329  8.019    26.438  1.00 63.51  ? 211 LYS C CG    1 
ATOM   8702  C  CD    . LYS C  1 211 ? 39.838  6.897    25.573  1.00 63.31  ? 211 LYS C CD    1 
ATOM   8703  C  CE    . LYS C  1 211 ? 39.247  7.483    24.311  1.00 65.27  ? 211 LYS C CE    1 
ATOM   8704  N  NZ    . LYS C  1 211 ? 38.429  6.492    23.568  1.00 66.69  ? 211 LYS C NZ    1 
ATOM   8705  N  N     . ARG C  1 212 ? 43.354  9.545    28.439  1.00 64.58  ? 212 ARG C N     1 
ATOM   8706  C  CA    . ARG C  1 212 ? 44.378  10.475   27.924  1.00 66.20  ? 212 ARG C CA    1 
ATOM   8707  C  C     . ARG C  1 212 ? 44.161  10.902   26.466  1.00 68.03  ? 212 ARG C C     1 
ATOM   8708  O  O     . ARG C  1 212 ? 44.216  12.094   26.160  1.00 69.04  ? 212 ARG C O     1 
ATOM   8709  C  CB    . ARG C  1 212 ? 45.790  9.920    28.143  1.00 66.71  ? 212 ARG C CB    1 
ATOM   8710  C  CG    . ARG C  1 212 ? 46.260  10.109   29.579  1.00 65.20  ? 212 ARG C CG    1 
ATOM   8711  C  CD    . ARG C  1 212 ? 47.515  9.319    29.923  1.00 64.61  ? 212 ARG C CD    1 
ATOM   8712  N  NE    . ARG C  1 212 ? 47.861  9.490    31.337  1.00 62.24  ? 212 ARG C NE    1 
ATOM   8713  C  CZ    . ARG C  1 212 ? 48.638  8.665    32.039  1.00 61.10  ? 212 ARG C CZ    1 
ATOM   8714  N  NH1   . ARG C  1 212 ? 49.176  7.580    31.478  1.00 60.95  ? 212 ARG C NH1   1 
ATOM   8715  N  NH2   . ARG C  1 212 ? 48.867  8.926    33.319  1.00 58.85  ? 212 ARG C NH2   1 
ATOM   8716  N  N     . SER C  1 213 ? 43.873  9.942    25.586  1.00 68.77  ? 213 SER C N     1 
ATOM   8717  C  CA    . SER C  1 213 ? 43.596  10.258   24.182  1.00 70.48  ? 213 SER C CA    1 
ATOM   8718  C  C     . SER C  1 213 ? 42.501  11.332   24.027  1.00 70.45  ? 213 SER C C     1 
ATOM   8719  O  O     . SER C  1 213 ? 42.660  12.253   23.218  1.00 72.06  ? 213 SER C O     1 
ATOM   8720  C  CB    . SER C  1 213 ? 43.309  8.997    23.339  1.00 70.83  ? 213 SER C CB    1 
ATOM   8721  O  OG    . SER C  1 213 ? 41.978  8.533    23.464  1.00 69.26  ? 213 SER C OG    1 
ATOM   8722  N  N     . THR C  1 214 ? 41.423  11.235   24.815  1.00 68.63  ? 214 THR C N     1 
ATOM   8723  C  CA    . THR C  1 214 ? 40.326  12.220   24.759  1.00 68.33  ? 214 THR C CA    1 
ATOM   8724  C  C     . THR C  1 214 ? 40.829  13.633   25.087  1.00 69.02  ? 214 THR C C     1 
ATOM   8725  O  O     . THR C  1 214 ? 40.423  14.618   24.443  1.00 69.69  ? 214 THR C O     1 
ATOM   8726  C  CB    . THR C  1 214 ? 39.141  11.826   25.685  1.00 66.37  ? 214 THR C CB    1 
ATOM   8727  O  OG1   . THR C  1 214 ? 38.698  10.511   25.340  1.00 66.90  ? 214 THR C OG1   1 
ATOM   8728  C  CG2   . THR C  1 214 ? 37.965  12.786   25.540  1.00 65.51  ? 214 THR C CG2   1 
ATOM   8729  N  N     . VAL C  1 215 ? 41.730  13.712   26.068  1.00 68.59  ? 215 VAL C N     1 
ATOM   8730  C  CA    . VAL C  1 215 ? 42.333  14.982   26.475  1.00 69.20  ? 215 VAL C CA    1 
ATOM   8731  C  C     . VAL C  1 215 ? 43.295  15.536   25.418  1.00 71.49  ? 215 VAL C C     1 
ATOM   8732  O  O     . VAL C  1 215 ? 43.305  16.745   25.154  1.00 72.54  ? 215 VAL C O     1 
ATOM   8733  C  CB    . VAL C  1 215 ? 43.041  14.861   27.835  1.00 68.25  ? 215 VAL C CB    1 
ATOM   8734  C  CG1   . VAL C  1 215 ? 43.299  16.242   28.429  1.00 68.31  ? 215 VAL C CG1   1 
ATOM   8735  C  CG2   . VAL C  1 215 ? 42.189  14.032   28.791  1.00 66.20  ? 215 VAL C CG2   1 
ATOM   8736  N  N     . ALA C  1 216 ? 44.096  14.659   24.813  1.00 72.54  ? 216 ALA C N     1 
ATOM   8737  C  CA    . ALA C  1 216 ? 45.027  15.082   23.764  1.00 75.03  ? 216 ALA C CA    1 
ATOM   8738  C  C     . ALA C  1 216 ? 44.250  15.697   22.603  1.00 76.32  ? 216 ALA C C     1 
ATOM   8739  O  O     . ALA C  1 216 ? 44.666  16.699   22.011  1.00 77.93  ? 216 ALA C O     1 
ATOM   8740  C  CB    . ALA C  1 216 ? 45.867  13.912   23.290  1.00 75.67  ? 216 ALA C CB    1 
ATOM   8741  N  N     . GLN C  1 217 ? 43.105  15.085   22.321  1.00 75.74  ? 217 GLN C N     1 
ATOM   8742  C  CA    . GLN C  1 217 ? 42.191  15.507   21.276  1.00 77.02  ? 217 GLN C CA    1 
ATOM   8743  C  C     . GLN C  1 217 ? 41.580  16.872   21.605  1.00 76.87  ? 217 GLN C C     1 
ATOM   8744  O  O     . GLN C  1 217 ? 41.264  17.650   20.701  1.00 78.63  ? 217 GLN C O     1 
ATOM   8745  C  CB    . GLN C  1 217 ? 41.104  14.435   21.097  1.00 76.16  ? 217 GLN C CB    1 
ATOM   8746  C  CG    . GLN C  1 217 ? 39.962  14.791   20.150  1.00 77.94  ? 217 GLN C CG    1 
ATOM   8747  C  CD    . GLN C  1 217 ? 40.398  14.869   18.695  1.00 81.47  ? 217 GLN C CD    1 
ATOM   8748  O  OE1   . GLN C  1 217 ? 41.040  13.952   18.178  1.00 82.81  ? 217 GLN C OE1   1 
ATOM   8749  N  NE2   . GLN C  1 217 ? 40.042  15.967   18.024  1.00 82.59  ? 217 GLN C NE2   1 
ATOM   8750  N  N     . LEU C  1 218 ? 41.423  17.163   22.895  1.00 75.11  ? 218 LEU C N     1 
ATOM   8751  C  CA    . LEU C  1 218 ? 40.859  18.442   23.324  1.00 74.56  ? 218 LEU C CA    1 
ATOM   8752  C  C     . LEU C  1 218 ? 41.917  19.549   23.316  1.00 75.96  ? 218 LEU C C     1 
ATOM   8753  O  O     . LEU C  1 218 ? 41.650  20.658   22.837  1.00 77.29  ? 218 LEU C O     1 
ATOM   8754  C  CB    . LEU C  1 218 ? 40.172  18.317   24.682  1.00 72.09  ? 218 LEU C CB    1 
ATOM   8755  C  CG    . LEU C  1 218 ? 39.322  19.502   25.137  1.00 72.31  ? 218 LEU C CG    1 
ATOM   8756  C  CD1   . LEU C  1 218 ? 37.909  19.052   25.477  1.00 71.04  ? 218 LEU C CD1   1 
ATOM   8757  C  CD2   . LEU C  1 218 ? 39.959  20.229   26.316  1.00 71.98  ? 218 LEU C CD2   1 
ATOM   8758  N  N     . VAL C  1 219 ? 43.119  19.264   23.813  1.00 75.67  ? 219 VAL C N     1 
ATOM   8759  C  CA    . VAL C  1 219 ? 44.182  20.265   23.707  1.00 77.29  ? 219 VAL C CA    1 
ATOM   8760  C  C     . VAL C  1 219 ? 44.693  20.405   22.264  1.00 79.48  ? 219 VAL C C     1 
ATOM   8761  O  O     . VAL C  1 219 ? 45.367  21.368   21.929  1.00 81.20  ? 219 VAL C O     1 
ATOM   8762  C  CB    . VAL C  1 219 ? 45.352  20.043   24.698  1.00 76.98  ? 219 VAL C CB    1 
ATOM   8763  C  CG1   . VAL C  1 219 ? 44.836  19.601   26.049  1.00 74.34  ? 219 VAL C CG1   1 
ATOM   8764  C  CG2   . VAL C  1 219 ? 46.381  19.057   24.137  1.00 78.86  ? 219 VAL C CG2   1 
ATOM   8765  N  N     . GLN C  1 220 ? 44.360  19.450   21.406  1.00 79.68  ? 220 GLN C N     1 
ATOM   8766  C  CA    . GLN C  1 220 ? 44.663  19.613   19.995  1.00 82.11  ? 220 GLN C CA    1 
ATOM   8767  C  C     . GLN C  1 220 ? 43.718  20.648   19.384  1.00 82.74  ? 220 GLN C C     1 
ATOM   8768  O  O     . GLN C  1 220 ? 44.098  21.405   18.487  1.00 84.86  ? 220 GLN C O     1 
ATOM   8769  C  CB    . GLN C  1 220 ? 44.554  18.287   19.244  1.00 82.17  ? 220 GLN C CB    1 
ATOM   8770  C  CG    . GLN C  1 220 ? 45.446  18.231   18.009  1.00 85.66  ? 220 GLN C CG    1 
ATOM   8771  C  CD    . GLN C  1 220 ? 44.836  17.419   16.886  1.00 87.67  ? 220 GLN C CD    1 
ATOM   8772  O  OE1   . GLN C  1 220 ? 45.099  16.218   16.760  1.00 88.40  ? 220 GLN C OE1   1 
ATOM   8773  N  NE2   . GLN C  1 220 ? 44.003  18.065   16.067  1.00 88.04  ? 220 GLN C NE2   1 
ATOM   8774  N  N     . THR C  1 221 ? 42.486  20.674   19.883  1.00 80.98  ? 221 THR C N     1 
ATOM   8775  C  CA    . THR C  1 221 ? 41.447  21.529   19.318  1.00 81.38  ? 221 THR C CA    1 
ATOM   8776  C  C     . THR C  1 221 ? 41.564  22.959   19.824  1.00 81.91  ? 221 THR C C     1 
ATOM   8777  O  O     . THR C  1 221 ? 41.453  23.907   19.041  1.00 83.71  ? 221 THR C O     1 
ATOM   8778  C  CB    . THR C  1 221 ? 40.050  20.930   19.532  1.00 79.34  ? 221 THR C CB    1 
ATOM   8779  O  OG1   . THR C  1 221 ? 39.980  19.693   18.817  1.00 79.25  ? 221 THR C OG1   1 
ATOM   8780  C  CG2   . THR C  1 221 ? 38.971  21.850   19.000  1.00 80.09  ? 221 THR C CG2   1 
ATOM   8781  N  N     . LEU C  1 222 ? 41.817  23.107   21.120  1.00 80.39  ? 222 LEU C N     1 
ATOM   8782  C  CA    . LEU C  1 222 ? 42.161  24.405   21.685  1.00 81.09  ? 222 LEU C CA    1 
ATOM   8783  C  C     . LEU C  1 222 ? 43.353  25.033   20.946  1.00 83.85  ? 222 LEU C C     1 
ATOM   8784  O  O     . LEU C  1 222 ? 43.344  26.233   20.655  1.00 85.48  ? 222 LEU C O     1 
ATOM   8785  C  CB    . LEU C  1 222 ? 42.459  24.282   23.179  1.00 79.04  ? 222 LEU C CB    1 
ATOM   8786  C  CG    . LEU C  1 222 ? 41.308  23.922   24.110  1.00 76.81  ? 222 LEU C CG    1 
ATOM   8787  C  CD1   . LEU C  1 222 ? 41.769  23.895   25.566  1.00 75.52  ? 222 LEU C CD1   1 
ATOM   8788  C  CD2   . LEU C  1 222 ? 40.150  24.889   23.931  1.00 76.82  ? 222 LEU C CD2   1 
ATOM   8789  N  N     . GLU C  1 223 ? 44.368  24.224   20.640  1.00 84.54  ? 223 GLU C N     1 
ATOM   8790  C  CA    . GLU C  1 223 ? 45.503  24.695   19.853  1.00 87.50  ? 223 GLU C CA    1 
ATOM   8791  C  C     . GLU C  1 223 ? 45.062  25.269   18.512  1.00 89.63  ? 223 GLU C C     1 
ATOM   8792  O  O     . GLU C  1 223 ? 45.415  26.397   18.173  1.00 91.81  ? 223 GLU C O     1 
ATOM   8793  C  CB    . GLU C  1 223 ? 46.522  23.579   19.607  1.00 88.06  ? 223 GLU C CB    1 
ATOM   8794  C  CG    . GLU C  1 223 ? 47.866  23.785   20.286  1.00 89.27  ? 223 GLU C CG    1 
ATOM   8795  C  CD    . GLU C  1 223 ? 48.106  22.801   21.411  1.00 87.49  ? 223 GLU C CD    1 
ATOM   8796  O  OE1   . GLU C  1 223 ? 48.505  21.646   21.123  1.00 87.04  ? 223 GLU C OE1   1 
ATOM   8797  O  OE2   . GLU C  1 223 ? 47.899  23.192   22.582  1.00 86.10  ? 223 GLU C OE2   1 
ATOM   8798  N  N     . GLN C  1 224 ? 44.289  24.490   17.756  1.00 89.40  ? 224 GLN C N     1 
ATOM   8799  C  CA    . GLN C  1 224 ? 43.862  24.884   16.412  1.00 91.41  ? 224 GLN C CA    1 
ATOM   8800  C  C     . GLN C  1 224 ? 43.004  26.127   16.424  1.00 91.63  ? 224 GLN C C     1 
ATOM   8801  O  O     . GLN C  1 224 ? 42.894  26.810   15.409  1.00 93.92  ? 224 GLN C O     1 
ATOM   8802  C  CB    . GLN C  1 224 ? 43.099  23.755   15.728  1.00 91.07  ? 224 GLN C CB    1 
ATOM   8803  C  CG    . GLN C  1 224 ? 43.966  22.874   14.861  1.00 92.75  ? 224 GLN C CG    1 
ATOM   8804  C  CD    . GLN C  1 224 ? 43.367  21.504   14.645  1.00 91.88  ? 224 GLN C CD    1 
ATOM   8805  O  OE1   . GLN C  1 224 ? 42.164  21.304   14.805  1.00 89.94  ? 224 GLN C OE1   1 
ATOM   8806  N  NE2   . GLN C  1 224 ? 44.208  20.548   14.279  1.00 93.74  ? 224 GLN C NE2   1 
ATOM   8807  N  N     . HIS C  1 225 ? 42.392  26.414   17.567  1.00 89.29  ? 225 HIS C N     1 
ATOM   8808  C  CA    . HIS C  1 225 ? 41.586  27.614   17.700  1.00 89.59  ? 225 HIS C CA    1 
ATOM   8809  C  C     . HIS C  1 225 ? 42.338  28.719   18.433  1.00 90.41  ? 225 HIS C C     1 
ATOM   8810  O  O     . HIS C  1 225 ? 41.774  29.784   18.686  1.00 91.00  ? 225 HIS C O     1 
ATOM   8811  C  CB    . HIS C  1 225 ? 40.247  27.303   18.371  1.00 87.01  ? 225 HIS C CB    1 
ATOM   8812  C  CG    . HIS C  1 225 ? 39.310  26.517   17.508  1.00 86.76  ? 225 HIS C CG    1 
ATOM   8813  N  ND1   . HIS C  1 225 ? 38.272  27.098   16.815  1.00 87.28  ? 225 HIS C ND1   1 
ATOM   8814  C  CD2   . HIS C  1 225 ? 39.260  25.194   17.216  1.00 86.53  ? 225 HIS C CD2   1 
ATOM   8815  C  CE1   . HIS C  1 225 ? 37.621  26.170   16.137  1.00 87.54  ? 225 HIS C CE1   1 
ATOM   8816  N  NE2   . HIS C  1 225 ? 38.201  25.005   16.362  1.00 86.87  ? 225 HIS C NE2   1 
ATOM   8817  N  N     . ASP C  1 226 ? 43.615  28.465   18.740  1.00 90.87  ? 226 ASP C N     1 
ATOM   8818  C  CA    . ASP C  1 226 ? 44.493  29.396   19.484  1.00 91.50  ? 226 ASP C CA    1 
ATOM   8819  C  C     . ASP C  1 226 ? 43.841  29.848   20.791  1.00 89.40  ? 226 ASP C C     1 
ATOM   8820  O  O     . ASP C  1 226 ? 43.758  31.052   21.085  1.00 90.22  ? 226 ASP C O     1 
ATOM   8821  C  CB    . ASP C  1 226 ? 44.914  30.595   18.620  1.00 94.49  ? 226 ASP C CB    1 
ATOM   8822  C  CG    . ASP C  1 226 ? 46.111  31.359   19.197  1.00 96.40  ? 226 ASP C CG    1 
ATOM   8823  O  OD1   . ASP C  1 226 ? 47.177  30.742   19.423  1.00 97.28  ? 226 ASP C OD1   1 
ATOM   8824  O  OD2   . ASP C  1 226 ? 45.999  32.592   19.395  1.00 97.95  ? 226 ASP C OD2   1 
ATOM   8825  N  N     . ALA C  1 227 ? 43.359  28.859   21.549  1.00 86.57  ? 227 ALA C N     1 
ATOM   8826  C  CA    . ALA C  1 227 ? 42.735  29.072   22.856  1.00 84.19  ? 227 ALA C CA    1 
ATOM   8827  C  C     . ALA C  1 227 ? 43.589  28.510   24.000  1.00 82.70  ? 227 ALA C C     1 
ATOM   8828  O  O     . ALA C  1 227 ? 43.388  28.857   25.163  1.00 81.53  ? 227 ALA C O     1 
ATOM   8829  C  CB    . ALA C  1 227 ? 41.341  28.468   22.881  1.00 82.19  ? 227 ALA C CB    1 
ATOM   8830  N  N     . MET C  1 228 ? 44.550  27.653   23.660  1.00 82.95  ? 228 MET C N     1 
ATOM   8831  C  CA    . MET C  1 228 ? 45.455  27.054   24.649  1.00 81.73  ? 228 MET C CA    1 
ATOM   8832  C  C     . MET C  1 228 ? 46.277  28.082   25.431  1.00 82.51  ? 228 MET C C     1 
ATOM   8833  O  O     . MET C  1 228 ? 46.629  27.833   26.581  1.00 81.20  ? 228 MET C O     1 
ATOM   8834  C  CB    . MET C  1 228 ? 46.386  26.030   23.989  1.00 82.34  ? 228 MET C CB    1 
ATOM   8835  C  CG    . MET C  1 228 ? 47.250  25.230   24.971  1.00 81.18  ? 228 MET C CG    1 
ATOM   8836  S  SD    . MET C  1 228 ? 46.320  24.093   26.038  1.00 75.69  ? 228 MET C SD    1 
ATOM   8837  C  CE    . MET C  1 228 ? 45.279  23.319   24.826  1.00 76.26  ? 228 MET C CE    1 
ATOM   8838  N  N     . LYS C  1 229 ? 46.560  29.230   24.809  1.00 84.68  ? 229 LYS C N     1 
ATOM   8839  C  CA    . LYS C  1 229 ? 47.406  30.273   25.412  1.00 85.81  ? 229 LYS C CA    1 
ATOM   8840  C  C     . LYS C  1 229 ? 46.772  30.980   26.617  1.00 84.63  ? 229 LYS C C     1 
ATOM   8841  O  O     . LYS C  1 229 ? 47.471  31.660   27.375  1.00 85.57  ? 229 LYS C O     1 
ATOM   8842  C  CB    . LYS C  1 229 ? 47.826  31.306   24.368  1.00 88.49  ? 229 LYS C CB    1 
ATOM   8843  C  CG    . LYS C  1 229 ? 46.663  32.038   23.731  1.00 88.39  ? 229 LYS C CG    1 
ATOM   8844  C  CD    . LYS C  1 229 ? 47.088  33.361   23.132  1.00 90.32  ? 229 LYS C CD    1 
ATOM   8845  C  CE    . LYS C  1 229 ? 45.888  34.079   22.554  1.00 90.44  ? 229 LYS C CE    1 
ATOM   8846  N  NZ    . LYS C  1 229 ? 46.314  35.024   21.489  1.00 93.81  ? 229 LYS C NZ    1 
ATOM   8847  N  N     . TYR C  1 230 ? 45.459  30.833   26.782  1.00 82.68  ? 230 TYR C N     1 
ATOM   8848  C  CA    . TYR C  1 230 ? 44.776  31.380   27.948  1.00 81.29  ? 230 TYR C CA    1 
ATOM   8849  C  C     . TYR C  1 230 ? 44.092  30.312   28.801  1.00 78.98  ? 230 TYR C C     1 
ATOM   8850  O  O     . TYR C  1 230 ? 43.338  30.636   29.724  1.00 77.94  ? 230 TYR C O     1 
ATOM   8851  C  CB    . TYR C  1 230 ? 43.785  32.477   27.544  1.00 81.73  ? 230 TYR C CB    1 
ATOM   8852  C  CG    . TYR C  1 230 ? 42.675  32.050   26.612  1.00 80.33  ? 230 TYR C CG    1 
ATOM   8853  C  CD1   . TYR C  1 230 ? 41.554  31.351   27.089  1.00 77.90  ? 230 TYR C CD1   1 
ATOM   8854  C  CD2   . TYR C  1 230 ? 42.724  32.371   25.262  1.00 80.60  ? 230 TYR C CD2   1 
ATOM   8855  C  CE1   . TYR C  1 230 ? 40.526  30.971   26.233  1.00 76.34  ? 230 TYR C CE1   1 
ATOM   8856  C  CE2   . TYR C  1 230 ? 41.705  32.002   24.402  1.00 80.24  ? 230 TYR C CE2   1 
ATOM   8857  C  CZ    . TYR C  1 230 ? 40.609  31.303   24.889  1.00 78.47  ? 230 TYR C CZ    1 
ATOM   8858  O  OH    . TYR C  1 230 ? 39.605  30.931   24.027  1.00 77.93  ? 230 TYR C OH    1 
ATOM   8859  N  N     . SER C  1 231 ? 44.364  29.045   28.492  1.00 78.40  ? 231 SER C N     1 
ATOM   8860  C  CA    . SER C  1 231 ? 43.803  27.925   29.240  1.00 76.19  ? 231 SER C CA    1 
ATOM   8861  C  C     . SER C  1 231 ? 44.874  27.150   29.999  1.00 75.51  ? 231 SER C C     1 
ATOM   8862  O  O     . SER C  1 231 ? 46.058  27.203   29.659  1.00 76.72  ? 231 SER C O     1 
ATOM   8863  C  CB    . SER C  1 231 ? 43.038  26.974   28.310  1.00 75.78  ? 231 SER C CB    1 
ATOM   8864  O  OG    . SER C  1 231 ? 42.095  27.672   27.507  1.00 77.55  ? 231 SER C OG    1 
ATOM   8865  N  N     . ILE C  1 232 ? 44.433  26.447   31.038  1.00 73.40  ? 232 ILE C N     1 
ATOM   8866  C  CA    . ILE C  1 232 ? 45.263  25.520   31.799  1.00 72.49  ? 232 ILE C CA    1 
ATOM   8867  C  C     . ILE C  1 232 ? 44.482  24.229   31.881  1.00 70.92  ? 232 ILE C C     1 
ATOM   8868  O  O     . ILE C  1 232 ? 43.297  24.232   32.254  1.00 69.77  ? 232 ILE C O     1 
ATOM   8869  C  CB    . ILE C  1 232 ? 45.489  25.984   33.251  1.00 71.73  ? 232 ILE C CB    1 
ATOM   8870  C  CG1   . ILE C  1 232 ? 46.208  27.330   33.304  1.00 73.41  ? 232 ILE C CG1   1 
ATOM   8871  C  CG2   . ILE C  1 232 ? 46.250  24.924   34.045  1.00 70.11  ? 232 ILE C CG2   1 
ATOM   8872  C  CD1   . ILE C  1 232 ? 45.809  28.169   34.515  1.00 72.13  ? 232 ILE C CD1   1 
ATOM   8873  N  N     . ILE C  1 233 ? 45.137  23.123   31.557  1.00 70.92  ? 233 ILE C N     1 
ATOM   8874  C  CA    . ILE C  1 233 ? 44.495  21.820   31.675  1.00 69.19  ? 233 ILE C CA    1 
ATOM   8875  C  C     . ILE C  1 233 ? 44.979  21.113   32.944  1.00 68.12  ? 233 ILE C C     1 
ATOM   8876  O  O     . ILE C  1 233 ? 46.177  21.131   33.265  1.00 69.37  ? 233 ILE C O     1 
ATOM   8877  C  CB    . ILE C  1 233 ? 44.757  20.954   30.420  1.00 69.93  ? 233 ILE C CB    1 
ATOM   8878  C  CG1   . ILE C  1 233 ? 44.690  21.803   29.134  1.00 71.71  ? 233 ILE C CG1   1 
ATOM   8879  C  CG2   . ILE C  1 233 ? 43.807  19.771   30.361  1.00 68.29  ? 233 ILE C CG2   1 
ATOM   8880  C  CD1   . ILE C  1 233 ? 43.363  22.522   28.885  1.00 71.28  ? 233 ILE C CD1   1 
ATOM   8881  N  N     . VAL C  1 234 ? 44.045  20.527   33.685  1.00 65.96  ? 234 VAL C N     1 
ATOM   8882  C  CA    . VAL C  1 234 ? 44.394  19.706   34.833  1.00 64.76  ? 234 VAL C CA    1 
ATOM   8883  C  C     . VAL C  1 234 ? 43.766  18.351   34.613  1.00 63.60  ? 234 VAL C C     1 
ATOM   8884  O  O     . VAL C  1 234 ? 42.539  18.220   34.583  1.00 62.92  ? 234 VAL C O     1 
ATOM   8885  C  CB    . VAL C  1 234 ? 43.914  20.320   36.158  1.00 63.89  ? 234 VAL C CB    1 
ATOM   8886  C  CG1   . VAL C  1 234 ? 44.248  19.400   37.322  1.00 62.53  ? 234 VAL C CG1   1 
ATOM   8887  C  CG2   . VAL C  1 234 ? 44.568  21.662   36.363  1.00 65.32  ? 234 VAL C CG2   1 
ATOM   8888  N  N     . ALA C  1 235 ? 44.607  17.339   34.444  1.00 63.81  ? 235 ALA C N     1 
ATOM   8889  C  CA    . ALA C  1 235 ? 44.127  16.029   34.031  1.00 62.85  ? 235 ALA C CA    1 
ATOM   8890  C  C     . ALA C  1 235 ? 44.425  14.950   35.067  1.00 61.82  ? 235 ALA C C     1 
ATOM   8891  O  O     . ALA C  1 235 ? 45.583  14.648   35.359  1.00 63.28  ? 235 ALA C O     1 
ATOM   8892  C  CB    . ALA C  1 235 ? 44.722  15.656   32.660  1.00 63.81  ? 235 ALA C CB    1 
ATOM   8893  N  N     . ALA C  1 236 ? 43.382  14.376   35.636  1.00 59.92  ? 236 ALA C N     1 
ATOM   8894  C  CA    . ALA C  1 236 ? 43.545  13.156   36.398  1.00 59.12  ? 236 ALA C CA    1 
ATOM   8895  C  C     . ALA C  1 236 ? 42.754  12.113   35.642  1.00 58.51  ? 236 ALA C C     1 
ATOM   8896  O  O     . ALA C  1 236 ? 41.567  11.891   35.920  1.00 58.17  ? 236 ALA C O     1 
ATOM   8897  C  CB    . ALA C  1 236 ? 43.035  13.319   37.815  1.00 57.87  ? 236 ALA C CB    1 
ATOM   8898  N  N     . THR C  1 237 ? 43.419  11.488   34.680  1.00 58.85  ? 237 THR C N     1 
ATOM   8899  C  CA    . THR C  1 237 ? 42.767  10.649   33.693  1.00 58.55  ? 237 THR C CA    1 
ATOM   8900  C  C     . THR C  1 237 ? 42.532  9.228    34.220  1.00 57.31  ? 237 THR C C     1 
ATOM   8901  O  O     . THR C  1 237 ? 42.954  8.889    35.324  1.00 56.74  ? 237 THR C O     1 
ATOM   8902  C  CB    . THR C  1 237 ? 43.559  10.667   32.348  1.00 60.72  ? 237 THR C CB    1 
ATOM   8903  O  OG1   . THR C  1 237 ? 44.922  10.278   32.573  1.00 62.22  ? 237 THR C OG1   1 
ATOM   8904  C  CG2   . THR C  1 237 ? 43.544  12.073   31.722  1.00 60.90  ? 237 THR C CG2   1 
ATOM   8905  N  N     . ALA C  1 238 ? 41.873  8.398    33.424  1.00 57.00  ? 238 ALA C N     1 
ATOM   8906  C  CA    . ALA C  1 238 ? 41.299  7.140    33.907  1.00 56.19  ? 238 ALA C CA    1 
ATOM   8907  C  C     . ALA C  1 238 ? 42.252  6.114    34.537  1.00 56.64  ? 238 ALA C C     1 
ATOM   8908  O  O     . ALA C  1 238 ? 41.830  5.321    35.382  1.00 56.20  ? 238 ALA C O     1 
ATOM   8909  C  CB    . ALA C  1 238 ? 40.479  6.493    32.813  1.00 56.07  ? 238 ALA C CB    1 
ATOM   8910  N  N     . SER C  1 239 ? 43.518  6.098    34.136  1.00 58.00  ? 239 SER C N     1 
ATOM   8911  C  CA    . SER C  1 239 ? 44.432  5.108    34.707  1.00 58.48  ? 239 SER C CA    1 
ATOM   8912  C  C     . SER C  1 239 ? 45.100  5.557    36.013  1.00 58.43  ? 239 SER C C     1 
ATOM   8913  O  O     . SER C  1 239 ? 45.825  4.785    36.635  1.00 58.65  ? 239 SER C O     1 
ATOM   8914  C  CB    . SER C  1 239 ? 45.476  4.630    33.685  1.00 59.82  ? 239 SER C CB    1 
ATOM   8915  O  OG    . SER C  1 239 ? 46.394  5.651    33.354  1.00 60.59  ? 239 SER C OG    1 
ATOM   8916  N  N     . GLU C  1 240 ? 44.834  6.787    36.437  1.00 58.38  ? 240 GLU C N     1 
ATOM   8917  C  CA    . GLU C  1 240 ? 45.518  7.361    37.602  1.00 58.86  ? 240 GLU C CA    1 
ATOM   8918  C  C     . GLU C  1 240 ? 44.837  7.053    38.933  1.00 57.38  ? 240 GLU C C     1 
ATOM   8919  O  O     . GLU C  1 240 ? 43.608  6.971    39.002  1.00 56.21  ? 240 GLU C O     1 
ATOM   8920  C  CB    . GLU C  1 240 ? 45.681  8.864    37.422  1.00 59.56  ? 240 GLU C CB    1 
ATOM   8921  C  CG    . GLU C  1 240 ? 46.249  9.216    36.058  1.00 62.37  ? 240 GLU C CG    1 
ATOM   8922  C  CD    . GLU C  1 240 ? 46.845  10.591   36.016  1.00 65.48  ? 240 GLU C CD    1 
ATOM   8923  O  OE1   . GLU C  1 240 ? 47.906  10.801   36.652  1.00 67.80  ? 240 GLU C OE1   1 
ATOM   8924  O  OE2   . GLU C  1 240 ? 46.255  11.461   35.339  1.00 67.12  ? 240 GLU C OE2   1 
ATOM   8925  N  N     . ALA C  1 241 ? 45.654  6.888    39.976  1.00 57.35  ? 241 ALA C N     1 
ATOM   8926  C  CA    . ALA C  1 241 ? 45.193  6.557    41.336  1.00 56.05  ? 241 ALA C CA    1 
ATOM   8927  C  C     . ALA C  1 241 ? 44.053  7.437    41.806  1.00 54.96  ? 241 ALA C C     1 
ATOM   8928  O  O     . ALA C  1 241 ? 44.116  8.650    41.671  1.00 54.72  ? 241 ALA C O     1 
ATOM   8929  C  CB    . ALA C  1 241 ? 46.349  6.648    42.326  1.00 56.76  ? 241 ALA C CB    1 
ATOM   8930  N  N     . ALA C  1 242 ? 43.023  6.813    42.377  1.00 54.10  ? 242 ALA C N     1 
ATOM   8931  C  CA    . ALA C  1 242 ? 41.835  7.521    42.872  1.00 53.21  ? 242 ALA C CA    1 
ATOM   8932  C  C     . ALA C  1 242 ? 42.146  8.796    43.653  1.00 53.81  ? 242 ALA C C     1 
ATOM   8933  O  O     . ALA C  1 242 ? 41.447  9.793    43.481  1.00 53.61  ? 242 ALA C O     1 
ATOM   8934  C  CB    . ALA C  1 242 ? 40.963  6.604    43.688  1.00 52.41  ? 242 ALA C CB    1 
ATOM   8935  N  N     . PRO C  1 243 ? 43.195  8.782    44.505  1.00 54.67  ? 243 PRO C N     1 
ATOM   8936  C  CA    . PRO C  1 243 ? 43.570  10.035   45.160  1.00 55.46  ? 243 PRO C CA    1 
ATOM   8937  C  C     . PRO C  1 243 ? 43.942  11.168   44.199  1.00 56.55  ? 243 PRO C C     1 
ATOM   8938  O  O     . PRO C  1 243 ? 43.764  12.337   44.535  1.00 56.76  ? 243 PRO C O     1 
ATOM   8939  C  CB    . PRO C  1 243 ? 44.769  9.623    46.003  1.00 56.45  ? 243 PRO C CB    1 
ATOM   8940  C  CG    . PRO C  1 243 ? 44.472  8.206    46.349  1.00 55.41  ? 243 PRO C CG    1 
ATOM   8941  C  CD    . PRO C  1 243 ? 43.920  7.640    45.093  1.00 54.79  ? 243 PRO C CD    1 
ATOM   8942  N  N     . LEU C  1 244 ? 44.436  10.833   43.013  1.00 57.52  ? 244 LEU C N     1 
ATOM   8943  C  CA    . LEU C  1 244 ? 44.732  11.852   42.008  1.00 58.89  ? 244 LEU C CA    1 
ATOM   8944  C  C     . LEU C  1 244 ? 43.493  12.425   41.349  1.00 58.91  ? 244 LEU C C     1 
ATOM   8945  O  O     . LEU C  1 244 ? 43.471  13.609   41.013  1.00 60.25  ? 244 LEU C O     1 
ATOM   8946  C  CB    . LEU C  1 244 ? 45.692  11.336   40.943  1.00 59.88  ? 244 LEU C CB    1 
ATOM   8947  C  CG    . LEU C  1 244 ? 47.164  11.338   41.351  1.00 60.85  ? 244 LEU C CG    1 
ATOM   8948  C  CD1   . LEU C  1 244 ? 48.018  10.858   40.206  1.00 62.15  ? 244 LEU C CD1   1 
ATOM   8949  C  CD2   . LEU C  1 244 ? 47.567  12.741   41.771  1.00 61.64  ? 244 LEU C CD2   1 
ATOM   8950  N  N     . GLN C  1 245 ? 42.468  11.593   41.174  1.00 58.25  ? 245 GLN C N     1 
ATOM   8951  C  CA    . GLN C  1 245 ? 41.217  12.010   40.536  1.00 57.95  ? 245 GLN C CA    1 
ATOM   8952  C  C     . GLN C  1 245 ? 40.347  12.838   41.469  1.00 57.52  ? 245 GLN C C     1 
ATOM   8953  O  O     . GLN C  1 245 ? 39.752  13.837   41.061  1.00 57.97  ? 245 GLN C O     1 
ATOM   8954  C  CB    . GLN C  1 245 ? 40.449  10.798   40.047  1.00 57.20  ? 245 GLN C CB    1 
ATOM   8955  C  CG    . GLN C  1 245 ? 41.213  10.001   39.013  1.00 58.82  ? 245 GLN C CG    1 
ATOM   8956  C  CD    . GLN C  1 245 ? 40.349  8.988    38.338  1.00 59.26  ? 245 GLN C CD    1 
ATOM   8957  O  OE1   . GLN C  1 245 ? 39.145  9.193    38.183  1.00 60.43  ? 245 GLN C OE1   1 
ATOM   8958  N  NE2   . GLN C  1 245 ? 40.942  7.877    37.939  1.00 60.24  ? 245 GLN C NE2   1 
ATOM   8959  N  N     . TYR C  1 246 ? 40.282  12.398   42.720  1.00 56.85  ? 246 TYR C N     1 
ATOM   8960  C  CA    . TYR C  1 246 ? 39.620  13.106   43.806  1.00 56.07  ? 246 TYR C CA    1 
ATOM   8961  C  C     . TYR C  1 246 ? 40.190  14.507   43.985  1.00 56.60  ? 246 TYR C C     1 
ATOM   8962  O  O     . TYR C  1 246 ? 39.460  15.478   44.125  1.00 56.57  ? 246 TYR C O     1 
ATOM   8963  C  CB    . TYR C  1 246 ? 39.832  12.277   45.071  1.00 56.00  ? 246 TYR C CB    1 
ATOM   8964  C  CG    . TYR C  1 246 ? 39.739  13.008   46.385  1.00 56.84  ? 246 TYR C CG    1 
ATOM   8965  C  CD1   . TYR C  1 246 ? 38.502  13.156   47.034  1.00 56.80  ? 246 TYR C CD1   1 
ATOM   8966  C  CD2   . TYR C  1 246 ? 40.877  13.519   47.004  1.00 56.89  ? 246 TYR C CD2   1 
ATOM   8967  C  CE1   . TYR C  1 246 ? 38.407  13.813   48.253  1.00 56.48  ? 246 TYR C CE1   1 
ATOM   8968  C  CE2   . TYR C  1 246 ? 40.790  14.170   48.231  1.00 57.99  ? 246 TYR C CE2   1 
ATOM   8969  C  CZ    . TYR C  1 246 ? 39.554  14.309   48.848  1.00 57.88  ? 246 TYR C CZ    1 
ATOM   8970  O  OH    . TYR C  1 246 ? 39.448  14.959   50.055  1.00 59.16  ? 246 TYR C OH    1 
ATOM   8971  N  N     . LEU C  1 247 ? 41.512  14.602   43.942  1.00 57.37  ? 247 LEU C N     1 
ATOM   8972  C  CA    . LEU C  1 247 ? 42.216  15.835   44.268  1.00 57.58  ? 247 LEU C CA    1 
ATOM   8973  C  C     . LEU C  1 247 ? 42.139  16.864   43.148  1.00 57.85  ? 247 LEU C C     1 
ATOM   8974  O  O     . LEU C  1 247 ? 42.083  18.070   43.405  1.00 58.20  ? 247 LEU C O     1 
ATOM   8975  C  CB    . LEU C  1 247 ? 43.671  15.506   44.599  1.00 58.17  ? 247 LEU C CB    1 
ATOM   8976  C  CG    . LEU C  1 247 ? 44.422  16.401   45.583  1.00 59.10  ? 247 LEU C CG    1 
ATOM   8977  C  CD1   . LEU C  1 247 ? 43.819  16.396   46.972  1.00 56.76  ? 247 LEU C CD1   1 
ATOM   8978  C  CD2   . LEU C  1 247 ? 45.897  15.981   45.630  1.00 60.81  ? 247 LEU C CD2   1 
ATOM   8979  N  N     . ALA C  1 248 ? 42.114  16.375   41.911  1.00 57.50  ? 248 ALA C N     1 
ATOM   8980  C  CA    . ALA C  1 248 ? 42.196  17.232   40.732  1.00 58.09  ? 248 ALA C CA    1 
ATOM   8981  C  C     . ALA C  1 248 ? 41.277  18.464   40.725  1.00 58.01  ? 248 ALA C C     1 
ATOM   8982  O  O     . ALA C  1 248 ? 41.754  19.542   40.432  1.00 59.11  ? 248 ALA C O     1 
ATOM   8983  C  CB    . ALA C  1 248 ? 42.038  16.419   39.459  1.00 58.06  ? 248 ALA C CB    1 
ATOM   8984  N  N     . PRO C  1 249 ? 39.970  18.313   41.049  1.00 57.09  ? 249 PRO C N     1 
ATOM   8985  C  CA    . PRO C  1 249 ? 39.108  19.500   41.109  1.00 57.22  ? 249 PRO C CA    1 
ATOM   8986  C  C     . PRO C  1 249 ? 39.529  20.574   42.122  1.00 58.07  ? 249 PRO C C     1 
ATOM   8987  O  O     . PRO C  1 249 ? 39.520  21.753   41.774  1.00 59.22  ? 249 PRO C O     1 
ATOM   8988  C  CB    . PRO C  1 249 ? 37.737  18.915   41.478  1.00 55.67  ? 249 PRO C CB    1 
ATOM   8989  C  CG    . PRO C  1 249 ? 37.761  17.561   40.902  1.00 55.19  ? 249 PRO C CG    1 
ATOM   8990  C  CD    . PRO C  1 249 ? 39.162  17.081   41.165  1.00 55.98  ? 249 PRO C CD    1 
ATOM   8991  N  N     . PHE C  1 250 ? 39.886  20.181   43.348  1.00 57.87  ? 250 PHE C N     1 
ATOM   8992  C  CA    . PHE C  1 250 ? 40.322  21.130   44.385  1.00 58.51  ? 250 PHE C CA    1 
ATOM   8993  C  C     . PHE C  1 250 ? 41.627  21.861   44.041  1.00 60.39  ? 250 PHE C C     1 
ATOM   8994  O  O     . PHE C  1 250 ? 41.735  23.083   44.212  1.00 61.47  ? 250 PHE C O     1 
ATOM   8995  C  CB    . PHE C  1 250 ? 40.490  20.430   45.728  1.00 57.87  ? 250 PHE C CB    1 
ATOM   8996  C  CG    . PHE C  1 250 ? 39.301  19.645   46.152  1.00 55.90  ? 250 PHE C CG    1 
ATOM   8997  C  CD1   . PHE C  1 250 ? 38.101  20.280   46.446  1.00 55.58  ? 250 PHE C CD1   1 
ATOM   8998  C  CD2   . PHE C  1 250 ? 39.373  18.268   46.264  1.00 55.40  ? 250 PHE C CD2   1 
ATOM   8999  C  CE1   . PHE C  1 250 ? 36.991  19.556   46.849  1.00 53.95  ? 250 PHE C CE1   1 
ATOM   9000  C  CE2   . PHE C  1 250 ? 38.250  17.530   46.662  1.00 54.95  ? 250 PHE C CE2   1 
ATOM   9001  C  CZ    . PHE C  1 250 ? 37.064  18.179   46.954  1.00 53.38  ? 250 PHE C CZ    1 
ATOM   9002  N  N     . THR C  1 251 ? 42.629  21.127   43.571  1.00 60.94  ? 251 THR C N     1 
ATOM   9003  C  CA    . THR C  1 251 ? 43.871  21.784   43.176  1.00 62.67  ? 251 THR C CA    1 
ATOM   9004  C  C     . THR C  1 251 ? 43.617  22.660   41.963  1.00 63.89  ? 251 THR C C     1 
ATOM   9005  O  O     . THR C  1 251 ? 44.272  23.689   41.795  1.00 65.60  ? 251 THR C O     1 
ATOM   9006  C  CB    . THR C  1 251 ? 45.032  20.809   42.891  1.00 62.84  ? 251 THR C CB    1 
ATOM   9007  O  OG1   . THR C  1 251 ? 44.618  19.804   41.963  1.00 61.89  ? 251 THR C OG1   1 
ATOM   9008  C  CG2   . THR C  1 251 ? 45.516  20.150   44.169  1.00 62.27  ? 251 THR C CG2   1 
ATOM   9009  N  N     . ALA C  1 252 ? 42.654  22.263   41.131  1.00 63.27  ? 252 ALA C N     1 
ATOM   9010  C  CA    . ALA C  1 252 ? 42.284  23.068   39.967  1.00 64.37  ? 252 ALA C CA    1 
ATOM   9011  C  C     . ALA C  1 252 ? 41.482  24.315   40.351  1.00 64.80  ? 252 ALA C C     1 
ATOM   9012  O  O     . ALA C  1 252 ? 41.512  25.313   39.622  1.00 66.73  ? 252 ALA C O     1 
ATOM   9013  C  CB    . ALA C  1 252 ? 41.538  22.248   38.946  1.00 63.61  ? 252 ALA C CB    1 
ATOM   9014  N  N     . ALA C  1 253 ? 40.786  24.276   41.483  1.00 63.24  ? 253 ALA C N     1 
ATOM   9015  C  CA    . ALA C  1 253 ? 40.159  25.483   41.995  1.00 63.66  ? 253 ALA C CA    1 
ATOM   9016  C  C     . ALA C  1 253 ? 41.224  26.497   42.383  1.00 65.47  ? 253 ALA C C     1 
ATOM   9017  O  O     . ALA C  1 253 ? 41.103  27.672   42.056  1.00 66.85  ? 253 ALA C O     1 
ATOM   9018  C  CB    . ALA C  1 253 ? 39.266  25.181   43.170  1.00 62.64  ? 253 ALA C CB    1 
ATOM   9019  N  N     . SER C  1 254 ? 42.278  26.038   43.051  1.00 65.77  ? 254 SER C N     1 
ATOM   9020  C  CA    . SER C  1 254 ? 43.374  26.918   43.462  1.00 67.33  ? 254 SER C CA    1 
ATOM   9021  C  C     . SER C  1 254 ? 44.056  27.611   42.276  1.00 68.87  ? 254 SER C C     1 
ATOM   9022  O  O     . SER C  1 254 ? 44.237  28.837   42.286  1.00 70.48  ? 254 SER C O     1 
ATOM   9023  C  CB    . SER C  1 254 ? 44.399  26.147   44.288  1.00 67.36  ? 254 SER C CB    1 
ATOM   9024  O  OG    . SER C  1 254 ? 43.754  25.292   45.212  1.00 66.61  ? 254 SER C OG    1 
ATOM   9025  N  N     . ILE C  1 255 ? 44.435  26.836   41.261  1.00 68.61  ? 255 ILE C N     1 
ATOM   9026  C  CA    . ILE C  1 255 ? 44.968  27.409   40.022  1.00 69.88  ? 255 ILE C CA    1 
ATOM   9027  C  C     . ILE C  1 255 ? 44.045  28.547   39.531  1.00 70.19  ? 255 ILE C C     1 
ATOM   9028  O  O     . ILE C  1 255 ? 44.508  29.666   39.250  1.00 71.50  ? 255 ILE C O     1 
ATOM   9029  C  CB    . ILE C  1 255 ? 45.158  26.328   38.918  1.00 69.48  ? 255 ILE C CB    1 
ATOM   9030  C  CG1   . ILE C  1 255 ? 46.275  25.350   39.294  1.00 69.24  ? 255 ILE C CG1   1 
ATOM   9031  C  CG2   . ILE C  1 255 ? 45.486  26.971   37.578  1.00 71.29  ? 255 ILE C CG2   1 
ATOM   9032  C  CD1   . ILE C  1 255 ? 46.386  24.140   38.356  1.00 67.04  ? 255 ILE C CD1   1 
ATOM   9033  N  N     . GLY C  1 256 ? 42.745  28.251   39.469  1.00 68.47  ? 256 GLY C N     1 
ATOM   9034  C  CA    . GLY C  1 256 ? 41.732  29.220   39.056  1.00 68.47  ? 256 GLY C CA    1 
ATOM   9035  C  C     . GLY C  1 256 ? 41.504  30.377   40.010  1.00 68.93  ? 256 GLY C C     1 
ATOM   9036  O  O     . GLY C  1 256 ? 41.172  31.476   39.570  1.00 69.97  ? 256 GLY C O     1 
ATOM   9037  N  N     . GLU C  1 257 ? 41.687  30.132   41.310  1.00 68.28  ? 257 GLU C N     1 
ATOM   9038  C  CA    . GLU C  1 257 ? 41.449  31.137   42.358  1.00 68.88  ? 257 GLU C CA    1 
ATOM   9039  C  C     . GLU C  1 257 ? 42.406  32.316   42.279  1.00 71.05  ? 257 GLU C C     1 
ATOM   9040  O  O     . GLU C  1 257 ? 42.042  33.449   42.619  1.00 71.92  ? 257 GLU C O     1 
ATOM   9041  C  CB    . GLU C  1 257 ? 41.541  30.512   43.749  1.00 67.91  ? 257 GLU C CB    1 
ATOM   9042  C  CG    . GLU C  1 257 ? 40.238  29.887   44.233  1.00 67.66  ? 257 GLU C CG    1 
ATOM   9043  C  CD    . GLU C  1 257 ? 40.405  29.035   45.496  1.00 68.60  ? 257 GLU C CD    1 
ATOM   9044  O  OE1   . GLU C  1 257 ? 41.562  28.783   45.914  1.00 71.35  ? 257 GLU C OE1   1 
ATOM   9045  O  OE2   . GLU C  1 257 ? 39.376  28.628   46.073  1.00 65.58  ? 257 GLU C OE2   1 
ATOM   9046  N  N     . TRP C  1 258 ? 43.632  32.043   41.843  1.00 71.89  ? 258 TRP C N     1 
ATOM   9047  C  CA    . TRP C  1 258 ? 44.621  33.082   41.676  1.00 73.86  ? 258 TRP C CA    1 
ATOM   9048  C  C     . TRP C  1 258 ? 44.082  34.194   40.775  1.00 75.13  ? 258 TRP C C     1 
ATOM   9049  O  O     . TRP C  1 258 ? 44.157  35.365   41.131  1.00 76.70  ? 258 TRP C O     1 
ATOM   9050  C  CB    . TRP C  1 258 ? 45.923  32.495   41.140  1.00 74.80  ? 258 TRP C CB    1 
ATOM   9051  C  CG    . TRP C  1 258 ? 47.028  33.492   41.068  1.00 77.15  ? 258 TRP C CG    1 
ATOM   9052  C  CD1   . TRP C  1 258 ? 48.023  33.693   41.982  1.00 77.80  ? 258 TRP C CD1   1 
ATOM   9053  C  CD2   . TRP C  1 258 ? 47.240  34.440   40.023  1.00 79.13  ? 258 TRP C CD2   1 
ATOM   9054  N  NE1   . TRP C  1 258 ? 48.844  34.713   41.562  1.00 80.73  ? 258 TRP C NE1   1 
ATOM   9055  C  CE2   . TRP C  1 258 ? 48.378  35.190   40.365  1.00 81.31  ? 258 TRP C CE2   1 
ATOM   9056  C  CE3   . TRP C  1 258 ? 46.569  34.733   38.829  1.00 79.72  ? 258 TRP C CE3   1 
ATOM   9057  C  CZ2   . TRP C  1 258 ? 48.863  36.214   39.553  1.00 83.94  ? 258 TRP C CZ2   1 
ATOM   9058  C  CZ3   . TRP C  1 258 ? 47.051  35.758   38.025  1.00 82.07  ? 258 TRP C CZ3   1 
ATOM   9059  C  CH2   . TRP C  1 258 ? 48.185  36.480   38.388  1.00 83.72  ? 258 TRP C CH2   1 
ATOM   9060  N  N     . PHE C  1 259 ? 43.517  33.834   39.625  1.00 74.81  ? 259 PHE C N     1 
ATOM   9061  C  CA    . PHE C  1 259 ? 42.872  34.820   38.739  1.00 75.94  ? 259 PHE C CA    1 
ATOM   9062  C  C     . PHE C  1 259 ? 41.787  35.611   39.472  1.00 75.86  ? 259 PHE C C     1 
ATOM   9063  O  O     . PHE C  1 259 ? 41.678  36.832   39.317  1.00 77.57  ? 259 PHE C O     1 
ATOM   9064  C  CB    . PHE C  1 259 ? 42.257  34.143   37.505  1.00 75.01  ? 259 PHE C CB    1 
ATOM   9065  C  CG    . PHE C  1 259 ? 43.262  33.504   36.597  1.00 75.47  ? 259 PHE C CG    1 
ATOM   9066  C  CD1   . PHE C  1 259 ? 44.107  34.285   35.815  1.00 77.60  ? 259 PHE C CD1   1 
ATOM   9067  C  CD2   . PHE C  1 259 ? 43.358  32.124   36.516  1.00 73.32  ? 259 PHE C CD2   1 
ATOM   9068  C  CE1   . PHE C  1 259 ? 45.039  33.701   34.977  1.00 78.78  ? 259 PHE C CE1   1 
ATOM   9069  C  CE2   . PHE C  1 259 ? 44.280  31.527   35.679  1.00 74.77  ? 259 PHE C CE2   1 
ATOM   9070  C  CZ    . PHE C  1 259 ? 45.130  32.319   34.907  1.00 78.05  ? 259 PHE C CZ    1 
ATOM   9071  N  N     . ARG C  1 260 ? 40.990  34.898   40.268  1.00 73.92  ? 260 ARG C N     1 
ATOM   9072  C  CA    . ARG C  1 260 ? 39.894  35.490   41.013  1.00 73.47  ? 260 ARG C CA    1 
ATOM   9073  C  C     . ARG C  1 260 ? 40.422  36.423   42.096  1.00 74.61  ? 260 ARG C C     1 
ATOM   9074  O  O     . ARG C  1 260 ? 39.855  37.489   42.334  1.00 75.40  ? 260 ARG C O     1 
ATOM   9075  C  CB    . ARG C  1 260 ? 39.015  34.388   41.631  1.00 71.41  ? 260 ARG C CB    1 
ATOM   9076  C  CG    . ARG C  1 260 ? 37.860  34.895   42.499  1.00 70.66  ? 260 ARG C CG    1 
ATOM   9077  C  CD    . ARG C  1 260 ? 37.504  33.879   43.564  1.00 69.72  ? 260 ARG C CD    1 
ATOM   9078  N  NE    . ARG C  1 260 ? 38.519  33.799   44.615  1.00 70.08  ? 260 ARG C NE    1 
ATOM   9079  C  CZ    . ARG C  1 260 ? 38.577  32.849   45.550  1.00 69.29  ? 260 ARG C CZ    1 
ATOM   9080  N  NH1   . ARG C  1 260 ? 37.683  31.863   45.585  1.00 67.33  ? 260 ARG C NH1   1 
ATOM   9081  N  NH2   . ARG C  1 260 ? 39.548  32.883   46.454  1.00 70.24  ? 260 ARG C NH2   1 
ATOM   9082  N  N     . ASP C  1 261 ? 41.516  36.023   42.738  1.00 74.60  ? 261 ASP C N     1 
ATOM   9083  C  CA    . ASP C  1 261 ? 42.030  36.754   43.879  1.00 75.60  ? 261 ASP C CA    1 
ATOM   9084  C  C     . ASP C  1 261 ? 42.858  37.950   43.473  1.00 77.99  ? 261 ASP C C     1 
ATOM   9085  O  O     . ASP C  1 261 ? 43.352  38.686   44.329  1.00 79.74  ? 261 ASP C O     1 
ATOM   9086  C  CB    . ASP C  1 261 ? 42.829  35.827   44.791  1.00 75.03  ? 261 ASP C CB    1 
ATOM   9087  C  CG    . ASP C  1 261 ? 41.944  34.875   45.558  1.00 73.93  ? 261 ASP C CG    1 
ATOM   9088  O  OD1   . ASP C  1 261 ? 40.726  35.134   45.649  1.00 74.16  ? 261 ASP C OD1   1 
ATOM   9089  O  OD2   . ASP C  1 261 ? 42.455  33.868   46.078  1.00 74.13  ? 261 ASP C OD2   1 
ATOM   9090  N  N     . ASN C  1 262 ? 43.004  38.167   42.174  1.00 78.49  ? 262 ASN C N     1 
ATOM   9091  C  CA    . ASN C  1 262 ? 43.826  39.271   41.706  1.00 80.68  ? 262 ASN C CA    1 
ATOM   9092  C  C     . ASN C  1 262 ? 43.173  40.096   40.606  1.00 81.73  ? 262 ASN C C     1 
ATOM   9093  O  O     . ASN C  1 262 ? 43.806  40.412   39.604  1.00 83.44  ? 262 ASN C O     1 
ATOM   9094  C  CB    . ASN C  1 262 ? 45.202  38.755   41.282  1.00 81.34  ? 262 ASN C CB    1 
ATOM   9095  C  CG    . ASN C  1 262 ? 45.955  38.118   42.429  1.00 80.08  ? 262 ASN C CG    1 
ATOM   9096  O  OD1   . ASN C  1 262 ? 46.661  38.792   43.162  1.00 81.61  ? 262 ASN C OD1   1 
ATOM   9097  N  ND2   . ASN C  1 262 ? 45.805  36.814   42.591  1.00 76.59  ? 262 ASN C ND2   1 
ATOM   9098  N  N     . GLY C  1 263 ? 41.901  40.438   40.806  1.00 81.09  ? 263 GLY C N     1 
ATOM   9099  C  CA    . GLY C  1 263 ? 41.166  41.333   39.908  1.00 82.23  ? 263 GLY C CA    1 
ATOM   9100  C  C     . GLY C  1 263 ? 40.934  40.867   38.477  1.00 82.24  ? 263 GLY C C     1 
ATOM   9101  O  O     . GLY C  1 263 ? 40.554  41.671   37.625  1.00 83.52  ? 263 GLY C O     1 
ATOM   9102  N  N     . LYS C  1 264 ? 41.165  39.579   38.212  1.00 80.82  ? 264 LYS C N     1 
ATOM   9103  C  CA    . LYS C  1 264 ? 40.945  38.990   36.888  1.00 80.72  ? 264 LYS C CA    1 
ATOM   9104  C  C     . LYS C  1 264 ? 39.724  38.074   36.952  1.00 78.62  ? 264 LYS C C     1 
ATOM   9105  O  O     . LYS C  1 264 ? 39.003  38.084   37.948  1.00 77.92  ? 264 LYS C O     1 
ATOM   9106  C  CB    . LYS C  1 264 ? 42.185  38.211   36.440  1.00 80.87  ? 264 LYS C CB    1 
ATOM   9107  C  CG    . LYS C  1 264 ? 43.404  39.079   36.129  1.00 83.66  ? 264 LYS C CG    1 
ATOM   9108  C  CD    . LYS C  1 264 ? 44.709  38.391   36.547  1.00 84.13  ? 264 LYS C CD    1 
ATOM   9109  C  CE    . LYS C  1 264 ? 45.870  38.696   35.600  1.00 86.25  ? 264 LYS C CE    1 
ATOM   9110  N